4XAKE

Crystal structure of potent neutralizing antibody m336 in complex with mers co-v rbd
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
211
structure length
207
Chain Sequence
DIQLTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNSYPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Spike glycoprotein
publication title Junctional and allele-specific residues are critical for MERS-CoV neutralization by an exceptionally potent germline-like antibody.
pubmed doi rcsb
source organism Human coronavirus emc
total genus 40
structure length 207
sequence length 211
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xakE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xakE01
1A1NB 4GBXA 3QZWB 3VI3F 4QTHA 2R1WA 4R97B 3ZYIA 4QOKB 5ID1A 3V5KB 1BOGA 5K9QI 4X5XA 4DZ8A 4U7SA 1OHQA 2FX8L 1I8LC 4ZFOB 4OJFH 3MLXL 3RA7H 2AEIT 4MZ2A 1NDMA 3RTQC 1A1OB 4I0KA 4XC3L 3QIUD 4YUEL 2C7UA 2W65A 5BZDA 3BHBA 3IJYB 1BD2D 2OS7A 5KVDH 1IM3A 3TT1L 3P0GB 1OGAE 1ZWIB 3U0TA 4BZ1L 2E3VA 1J0KA 5IFAL 1KN2H 3E6FA 5GJTH 3QBTB 4GG8B 1RZGA 2VXVL 3ZDXE 1F00I 5J13C 2OL3H 1OB1B 4XAKE 1TVHA 1MCPL 3NZ8B 5I1JH 4R7DB 4TTDD 4O02L 5SX4H 4BFIA 4XAWH 1IGYB 2CDFB 2BVOB 4WO4D 2UZXB 1FNEA 4JRYB 1ND0A 3KXFB 2NMSA 3KJ6H 1I85C 3QUXD 4HC1H 2BNQE 4NRZA 2B4CC 3U30C 1U92A 5EOQH 3MLVH 3MRRB 2EC8A 3L1OL 5JLZA 2ITDA 3MYJA 3P77A 4JAMA 1QA9A 4GKZB 3EIFA 3VFGL 1NAKH 5C0GA 1NQBA 1Q72L 3OWEA 5KSUB 1IVLA 2HJLA 3PDOB 5HDLA 5BO1L 5CMAA 1MI5B 1HI6B 1NCDL 4U1IA 4NQDE 4WO4C 4XHQA 1MNUH 3CLEL 3DIFB 3CFJB 4MJIE 2YN5A 2ZUVA 3HUJE 5KSAD 4NQVA 3O41B 3PWPE 4JFOB 3VRIB 2GK2A 1CK0H 1WWCA 3BKYL 2EDXA 1SEBB 4MJ2A 1YMHB 1LO4L 4QXUL 4Y2DD 3WYRA 1I7TB 5MI0B 4YDLB 4P23B 2D7QA 2UWEF 3L3GA 1T0MB 4NRXB 1EV2E 1G7JA 2D31B 2PXYB 2J8UF 4MHHG 3MA9L 3INUH 5LGJB 5EO1B 5KSAC 4WI9A 5EB9A 3IFOB 1I7UB 4N8VA 3LDBB 3FB5B 6FABH 2P5EB 1OP3H 1R3LB 2BSRA 5GGTL 3KAAA 4PD4K 5JA9A 4PJAB 1BZ7A 5E9DA 1GGUA 2J7LA 4Y2DC 2O5ZL 3ZSTA 2J12B 2HN7B 1NL0H 1PKOA 1DUYB 2ARJQ 3HZMB 1XGUA 2ICWI 3ULVF 2DQJH 4GQPH 4MLIA 4Z7WB 1KELH 2QKIA 1FNGB 2NX5D 5CP7A 3WUWG 1NCWH 1MFNA 2RBLA 3JWOC 4K94C 4BQBA 1N64L 1N8ZA 2Y5TB 1VKXB 4FZ8H 4KV5E 4MWFB 1LILA 4OFDA 4GUPA 4WGVB 3IYLW 3QXVA 1TZHB 4Z0BL 3RIAK 4H1LG 3V5HB 5DTFB 4NC2B 5CZVH 3EYSH 3V0AC 4LK4A 3DGGA 3CIQA 3MUGA 1GPOL 1VFAA 2L0DA 2ZPKL 1PQZB 4YPGA 3TZVB 2FEDD 4XP6H 5JNYA 5DMJB 4JDVA 3O8XA 4ONFL 1S7SB 1TQBB 3OAZK 4LSRL 3IAQA 5D1QD 4R6UA 4S11A 1FSKB 3IU4H 3UJJH 1I3RB 4EN3A 3P4LA 4P3CL 1WC7A 3VMOA 2YPKA 1S9VB 2E9WA 4NDMA 4QRTA 4APQC 4KDVA 2DI7A 4WW2B 1CXKA 4M02A 1V7NH 1U8IA 1T1XA 5FXCH 1YQVH 4QLRA 4AEIH 3I6LD 1QG3A 2DMBA 1KJ2B 2W0PA 5F21B 5HHVL 1CZ8H 3ARGA 2JJUA 4XCNA 4B7LA 2XKNA 5HYIA 2AJSH 2BFVL 5D1QC 4ENED 4OT1L 3P73B 4L8DA 3WIFA 4AM0B 4NHCH 2IFGA 3NCBB 4MAUL 1MCWW 4I5BB 4H88L 4GRMB 3QR2A 1HWGB 3KYNA 4LHUA 3RU8L 3BISA 3G6JE 2A77H 4J4PD 3WXWL 5DYOA 5HPOA 2VLKD 5ESAB 2IH3A 5GGQH 2F54B 5K9OA 2X1XR 3M07A 1YEFL 1ZVSB 1E0OB 2DTSA 1NGXA 3IS1X 4GT7A 5DEGB 2CO7B 4ENEC 2ERJC 3TO2A 1DP0A 3SGJA 4PJCE 4KUZL 2VE6A 3IXAA 4X6CF 4Q6IA 3RGVA 1INQA 5HVGB 1PVHA 3GMNB 2O5XH 3MRDA 4XXDA 1RU9L 1LO3H 5IHZB 5FA4A 2I9LB 2A6KA 1BF2A 2EYSA 4J4PC 2HT4D 3I2CH 4IJ3C 4EI5A 4PJEB 4UI2A 3EGSB 4IIQC 2FHCA 3GHBH 3QNZB 3IDNB 1F8TH 1HHJA 2X4RB 1U8HA 1S7WB 2Y72A 5E2WH 5E99L 1CFTA 5E8PA 2EDKA 4NO2A 1U8MB 4NN5B 1WIPA 5IM7A 3BPNC 5T5NG 1QRNA 4YWGH 4U1HB 1RK0B 2WLYA 2OTWB 4S1QH 4JHZA 4K3DL 1P2CA 1T3FB 3FCTB 1T0NB 2PO6C 4Q0XH 5SX4I 3U83A 3I75B 3QPQD 4UQ2B 3U4BL 3L3HA 3FFCE 2HT4C 5L2KE 3UC0L 3HG1B 1RFDH 3MREB 5BS0E 3OKDA 4DGIL 4HEPG 4ZOCA 4RWYH 3HFMH 4KKLD 4UT7L 4AEEA 3IT8D 5F1IB 2YMXH 1Q9LB 4WFHE 2RR3A 2X4PB 3KYOA 3V8OA 4QTIL 5I1IL 3VXSE 5I1AB 3BI9X 2QEJA 2X4OB 3ROLA 3MLWH 3QEGL 5IFJA 3K81A 3KNBB 1CXFA 1RZFL 1FZKB 5HGHB 3HLAB 3QPQC 2NY5L 3OAZH 1K8IA 4M1CD 1T7YA 5MERB 3O45B 3MJ6A 3DYOA 1I4FA 3O2WH 2CR6A 1AD9A 2Y5EA 4I3SH 2AEQH 2XZCH 3C2AL 3KHOA 4KKLC 4YNYA 4PJ7E 3SKUD 4GG6F 4RGOL 3LS5H 4U2ZA 3TVMB 4PBXA 3MUZ1 3RKDD 3DGCR 1OAYL 4NUGH 4OQTA 4P9HL 1BFOB 1MHPH 4DKDC 3NH7L 1JI2A 3QDJB 3PP3K 1DBBH 4XNYL 3BQUC 4OZIA 3UJTH 1G9MH 3F7VA 4M1CC 4HKXA 2B1HL 3BIKA 3GSVA 3VWKD 2BVEA 5F9OL 5C0FB 4Y16A 2OR9H 2XACC 3PWLA 3MX0A 3AAZB 3T2NH 4XMPL 2DDQH 4OZFB 5DJ0B 1T22B 1YEHL 4JO4L 1M1SA 3FB7B 2A9NH 4DUXA 4QWWD 4WTZA 3NVQA 2ARJB 4LMQE 4Y19A 4U0RB 4CNIA 4XP9L 5AUMB 5FGSA 2C1OB 3LVEA 1DDHB 3ARFD 1RZKH 3CDYA 5F9DC 2IANB 1F4YL 1UKQA 1NH6A 1TFHA 2YC1B 3CFDA 1A47A 1BBDL 3QYCA 2AJVH 2B2XL 3CSGA 3F6IA 4Z7UE 3MV9E 3WNMA 5C09A 4QWWC 2NY7L 4YDKL 3UPRA 5J11C 4M6OL 5I1HL 1KCRL 4AH2A 4OKVA 1JI1A 1CGYA 3S98A 5DVMA 1T2QL 1L9NA 2KQMA 1OAZH 5L9DH 4GQ9H 1A4JB 1XF5B 5KS9A 3HZKB 5ILTL 1X7QB 3WXVH 1KPRB 2VDOL 2OZ4H 2DLFL 2KBGA 4LP4A 3TA3D 4HBCH 2H1PH 4LKXB 2W0KA 5JPMB 3CX5J 3QNXA 4XCEB 2X4QA 1N59A 4G7VL 4GKSA 4HKZB 4HX1B 2VLRB 2MCPL 4XVJH 5J0BA 4JFEB 1H3PL 5DJYA 4ZO6A 2R2CA 4PREA 2ZOLA 3QXAA 5MEOB 2GYSA 4GLRI 4FTVD 3NIGE 1OAKH 1WWBX 4F7EB 2OK0H 1REIA 4LKCA 4RMSA 1M7IB 5HDOA 2O5YH 4UDTB 2HRPH 3TA3C 2XICA 4HAFA 1CGSH 5EOCJ 3QA3A 4GAGL 5JMOC 5C07D 4R0LA 1NFIA 4WRLA 3VJ6A 2VLJE 5TE7H 1FGVH 1G6RA 3GSNA 2P45B 4JFZH 4LPYA 1MCRA 3S7GA 5BJTB 3TJHC 1ACYH 3C60D 4QHLA 3U0WH 2GAZB 5DT1H 2DIAA 1FDLL 4RIRA 2Z8WC 4PGCB 2P5WB 2BSSA 1P4BL 3OKEA 4HUWA 4N5ED 1KIRA 1R24A 2VDRH 4RCAA 4EVNA 2ZG3A 3PP3H 4J8RB 4IS6B 1K4CB 1MCCA 3WDHA 5GGRB 5I8OH 2FBJL 2VL5A 35C8H 4YAQB 5EO9A 1JUFB 5EZLA 1H8NA 3QDGA 4QHUA 4XMKL 2FDBP 1M6OB 5DD1L 1LP9E 3SCMD 3W9EB 1JRHL 4ZO9A 2PNDA 3C60C 4NC1C 3EBAA 5EU7E 4DN3H 5DGRA 2VDNH 2B5IC 3NFPB 5DUPL 5L6YL 3VXMD 3WV0A 1M71A 3H9SA 4UILH 4H8WC 3PQYD 1Q9OB 1D9KD 3UJIH 2G5RA 3T0EC 2BNRB 3V5DB 3OKNA 3FJTA 4YLQT 1EGJA 4AL8H 2A74B 1V7ML 2Z8VC 4JEGB 3O2VL 4HK0A 3CDCA 3VXOA 3T77A 3ARWA 2A1WL 5E6ZA 1EO8H 1CLOL 5A40E 3DBXB 2YA2A 4OGAD 5D2LE 4JN2A 4OLVL 1JF6A 1D9KC 2DMCA 2UWEB 2EH8H 3MTRA 4BFGA 2V2XA 4HDIB 4NBYB 5F7DB 4HG4K 4C54A 5HYJD 4OV6F 2J8UB 2JJTC 3MRNB 4JFDE 2Z8RA 2LU7A 4DFHA 4FFYH 2J5LC 3S3SA 1YC7A 1MFAH 3TYGL 1FJ1A 5ECJE 1P5UA 3IXTB 4TTGA 1HHHB 2NW2B 1N3NB 3VFPA 4OGAC 4L9LB 5D7IF 2DOCA 2XA3A 1I7ZB 3PWJB 2EXWD 1A6UH 4JQVA 2QHRH 1YYMH 2FJHB 4K9EL 1ZHNA 3HE7A 5DDHA 1NCBH 1JL8A 1DQJA 4WI6A 2IAMC 3OKYA 5D7LE 3VWJD 5TE4H 1A1NA 3QZWA 2AV1B 4PGDB 5I76B 4POYA 5EN2B 4QOKA 3V5KA 1LEKB 3NCEB 1K4DA 4KK5D 4KROD 4D0CB 1B6DA 1BAFH 2J88L 4OLZL 5LG1A 3HI5H 4ZFOA 1INDL 3TT3H 1KB5H 3ZT5A 2DQIH 4A2LA 2JIXB 3QDMB 4G6KL 4Z8FL 5FV2A 3IJYA 3MYZA 2DQUH 2DL2A 4LPXA 1ZWIA 4S1DD 5SV3A 3TCLB 4U2YA 4CN1A 2IG2H 5JOFA 2Y25A 3OBAA 3OF6D 5E7FA 5DMYA 2BXYA 4GG8A 3ARED 3W0WB 4KROC 3BPLC 2BJML 3C6SB 1OB1A 4KAQH 4HGWB 1GHFL 4Y5YC 4Z7QE 1SQ2N 4N8VG 4CVUA 3V95A 5B21A 4L4TE 1IGYA 2CDFA 2BVOA 5EBGA 4JRYA 4BQ8A 3KXFA 2DYPD 1UCBL 2B7DT 2P48B 4HFUL 4S1DC 4AQOA 1CFVL 1AGBB 4XPFH 4EBQL 4E0RB 2JJSC 2XN9E 1IFHL 2VN4A 3AREC 4GO6B 4GKZA 4PJBF 5GS0D 3CU7A 3L3JB 5HBBA 1IAMA 2V7HB 1CDHA 3C8HA 3PDOA 1VCAA 4MSWB 3DV4A 5C7XH 1MI5A 1HI6A 4OCYH 3B9KC 2WWKO 3DIFA 3CFJA 5T1KD 3RHWF 1I1YB 3D3VD 2VXSL 4JPVH 4JFOA 4YBHA 3VRIA 4OD1H 1F3DH 4OAWA 4X6CB 1ZLWK 3RY6C 5FYJH 3L6FB 4WWKD 1KEGL 1SEBA 1YMHA 3MLYL 4M1GH 3UYPA 3S4SB 4DEPB 5L2JB 5GS0C 4P23A 5EORL 3ZDYF 4NRXA 1T0MA 2EC9T 2D31A 1MIML 5LGJA 5I8KL 1T20A 4X6DF 3DMMB 5EO1A 5I17A 5ICYB 1NLDL 1IEAA 1EXUB 3IFOA 1I7UA 2GTWB 4E42A 4XPTH 3S37X 3W81A 4WWKC 5CBAB 1IEBA 4JZJB 1IGCH 4JFFB 1J87A 1AR1D 2HN7A 1TQCB 1DUYA 3HZMA 2VR5A 4QRSB 5GSRB 1UKTA 4D0DB 4JG0H 5LXGL 5CD5C 1BFVL 1FNGA 2CKNA 1RUML 4LHUG 1I9JL 4R9HA 2DF3A 3ZZ1A 3EHBD 3BDBA 3O4LB 3OJMB 1YN6A 3I85A 5IQ7H 1VKXA 1YDPA 2Y5TA 4HJGB 1F42A 4JVUA 2R0KL 5GRWA 4Q9QL 2DD8L 1J18A 5F7EL 4X99B 4PLOB 2XQYG 1TZHA 2EDOA 4F8QA 3V5HA 4RGNE 5DTFA 2EICA 5B3JE 3DUSB 3RDTC 5I19H 3RL1B 5D6CA 4XNMB 1A6VL 3TZVA 1EMTL 1S9XB 3MLRL 2ESVE 2H2SD 5KVFH 1KULA 4MQXD 5E1HB 4NJAL 3TNMA 4GG6B 3K8MA 3FONB 4YBLB 2AABL 3EHBC 1EVTC 2ITCB 1EEQA 3VXPB 4ZNEA 1R5WB 1RUKH 3K0WA 1S9VA 1IM9D 4X7DC 4WW2A 1U8JB 4XP1L 2X9YA 2VH5H 3MRMB 1KJ2A 1G7HB 4JB9L 4A6YH 5LVEA 2X2YA 3C08H 2H2SC 4KKAC 1HK6A 4FMFA 4YXKL 4MQXC 2H26B 2VYRE 4U7KA 4XI5D 4KRPB 4N0FA 3P73A 4AM0A 1A6PA 3ELAT 3FQTA 4CU7A 4I5BA 1QR1B 3S3PA 4GRMA 2W9DH 4AZ8A 4O9HH 4K8RL 2OMBA 4KY1H 1MEXL 4PJDF 4LVNB 4TSCH 5HDQH 1N7MH 1H15B 1HSAB 5F97E 2D0GA 2P46B 5C70A 5ESAA 2F54A 1X5JA 4M6MH 4E5XB 4XI5C 5DEGA 2Y7QB 4EDWL 4WHTB 1FNAA 4X9HA 5B3NA 3HI6H 5FYKD 1AE6L 2A9ML 4ZG1A 3GMNA 5D1XA 4FABL 1F4HA 4TUKL 5IHZA 2JCCE 2I9LA 1TLKA 4OF0A 3I50H 4MA7L 2DM3A 1OTUD 4F57H 3L3OB 2IPTH 1NCNA 4PJEA 1I8KB 1UEMA 3CDGB 1CLYL 4UIKH 3B8YA 3EGSA 3ECBB 3QNZA 4P9MH 4I2XE 4NN6B 3MLPA 4DCQB 1U8MA 2P8PA 3B83A 2NZ9D 7CGTA 2DJUA 2EDJA 5HPMA 3QUZD 3ARSA 4FP8H 1RK0A 2ICEB 4PYHA 4U1HA 1MRFH 1YECH 3FCTA 1T0NA 4TSAL 1ITBB 4PJXE 1OTUC 2DAVA 3I75A 4UQ2A 3HG1A 3GM0A 1DBJH 4H26B 3MREA 4G6MH 4O4YL 1F6LL 5IVXE 1BGXH 4WTZG 3BP6B 2W60B 3T4AB 5F1IA 2NY6C 2W38A 1Q9LA 2X4PA 4DAGL 1QLFA 4O58L 4ELME 4ZQKB 1QKZL 4LVHC 4OM0L 5IUSA 3FQNB 1FVCA 4DKEL 4C4KO 2NZ9C 2VLKE 5I1AA 2FX8H 2X4OA 5I18L 1FZKA 4K23L 3VFVB 5KJRH 1AXTL 4X7EC 1HINH 2YPVH 4NKDB 4U3HA 3U7YH 5FOBB 5MERA 4UOW0 1ONQB 3O45A 3RJDA 2YR3A 4ZUWB 3HKFA 5IFAH 5HGAB 2QV2A 2PR4H 3O0RL 5EIIB 4ZUVB 4G6FB 3TVMA 1X44A 3WS6C 1BFOA 5JQ6L 2WMPA 4A2MA 3TBTB 3QSKB 2DM7A 3QDJA 1TETL 2C3WA 3UO1L 3U7WL 1MCOH 1TDQA 3FKUS 2HH0H 3VXUB 3T0DA 3Q48A 5E00B 4F7TB 1PEWA 3HR5B 1OAXL 3SE9L 3KLAA 2WANA 1D6EB 5C0FA 4JQXA 2VXQL 1FH5L 3AAZA 3L1OH 4O51B 4OZFA 5DJ0A 3FQXB 1T22A 4HV8B 1PG7W 4OCSL 1UA6H 4LLYB 4JKPH 3QUYB 1VESA 2ARJA 5GGTA 4YHZL 5JW4N 5AUMA 3H2WA 4Y4FD 2C1OA 1DDHA 2CK0H 1NMAH 3O8XD 1AJ7H 4BQ6A 3RUGF 4RMWA 3RNKB 1W2KT 1IL1B 4MA1C 4Q9RH 5CIPH 2IANA 5GRUH 5IB5B 2QR0B 4ONGH 2D3VA 4WI3A 2YC1A 1Z0MA 3D9AH 3HZVB 3BD4A 3UCRA 4XBGA 2C1PB 2P43B 5GSVB 3B9VA 2I07B 4TPRL 1IC1A 3B9EA 4IRJB 4TNWK 4Y4FC 1G9NH 3ARGD 5DRNB 3O8XC 4K71B 1A4JA 1XF5A 1T7XA 3HZKA 3QULB 5CP3H 2J4WL 3M45A 4AG4L 4BK4A 1X7QA 1WGOA 1KPRA 4KTEL 1Z6JT 4JJ5B 5D1ZB 3PP4H 4J3TA 4N0UE 2LABA 4NNXB 5D7IB 4LKXA 2QSTA 2O5ZH 4G42B 4ISVB 3GBNL 5JPMA 4LHUD 4PJFF 3I6GB 4GXUM 4POZD 4XCEA 4NQCE 4PJ5D 3IFPB 4HKZA 4HX1A 3LQAL 2VLRA 3PUCA 4JFEA 3EYVB 2VZUA 2ED8A 3DRQB 3EZ8A 3ARGC 5MEOA 2HKHH 4K7PH 4CDHA 1RJZB 4F7EA 3VA6A 3MV11 1N64H 3LCYA 3QO1B 5DSCB 5E8DL 3RX7A 2VLMD 1M7IA 4WCYL 4Z0BH 3I6KB 4UDTA 3LS4L 1AQKL 2EE6A 3C87A 4C56E 3HC4L 1F4AA 2ZPKH 3KPPB 4UV4L 1ZEAL 5DFVD 4HKJA 1H3XA 5GJSL 1B4JL 5BJTA 4UBDD 2GAZA 1MFCH 4PGCA 1MJ8H 2P5WA 4P3CH 3NN8B 4YE4H 3W11D 4J8RA 4IS6A 1K4CA 5GGRA 3SHSA 3VD7A 1HDMB 3WHE1 4YAQA 1WAAF 1JUFA 4XC1H 3G6DL 1U8NB 4WI8A 5DFVC 1N4XL 1XF1A 4EI5C 1M6OA 3SJVE 1BPVA 4PJHE 5DD5H 2RB8A 5BRZA 3W9EA 2EEAA 4UBDC 4OT1H 2IC2A 3QFJD 4YHPB 4Z7VF 4JHBA 2OLDA 5JW4R 1FYTD 1H9VA 2YUZA 3FOLB 3T04D 3BH8B 4MAYD 1OARL 4PJBB 3Q1SL 5JA8B 3W11C 1Q9OA 3RU8H 3SDYL 4FQXB 1HOCB 3QZWG 4MVBC 5IB2B 1J1XL 2D7TH 2BNRA 3V5DA 3AVEA 4FTVE 4UIMB 3IF1B 2G9HB 1A64A 1EBPA 3STBA 3GSUB 4Z77B 4OZHF 4NYLB 4OCXH 1CFNB 3HNTH 2P42B 3DBXA 5TF1L 1JNHB 3JTSB 3MRJB 4JVWA 4MAYC 4NQEB 5JDSB 2UWEA 1MQKL 4HDIA 3GFUA 5F7DA 3OKLB 3UX9B 4PRPB 5C08B 4WJ5B 2J8UA 3BSZH 3H3PL 3MRNA 3U7AA 4NC1E 3GMOB 4D3CL 4X6DB 3N1GC 3RY4A 1BX2B 2XOTA 3CJJA 4V1DB 1FORH 3T0EE 1A4KB 5TJWK 1J0IA 1HHHA 1MJUL 1H5BB 2NW2A 1N3NA 1YN7B 4L9LA 4Y7MA 4YX2L 1OAUH 3BZEB 4R26L 3ROOB 1I7ZA 3PWJA 4P2RD 3QEQE 1S7RB 4AMKL 2AKRB 4K3GA 3UC0H 1SBSL 3P4NB 4R8WH 1YA5A 2DIBA 3PDGA 4O2FA 4HWBL 4P4KB 5I76A 2AV1A 4L3AA 4PGDA 1YMMA 4JPIB 4PRAA 5IP4A 1HN1A 4CVWA 1UCTA 2AV7B 1LEKA 1VEOA 1F58L 4D0CA 3RX5A 2F8XC 5H35B 4LGPB 2WIMA 4PLJD 3TO4B 1PGRB 5C09D 1RZFH 2J3SA 1YNLH 1OM3H 2JIXA 3B3IB 4EIGB 1T66C 2C9AA 3DROB 3GJFK 5IV2B 3C2AH 1QFHA 5IROC 4RGOH 3TCLA 2WNGA 3C5ZD 1Z9SA 1CWVA 1DSFL 3QCVH 5T1DL 3W0WA 1T6VN 2K9UA 3C6SA 5TGBB 3GO1L 3NH7H 4HGWA 4WUUE 1D6VL 3R1GL 4D9RE 2BHZA 5I9QB 3THMH 5H37H 2O26U 3WNNA 4XP5L 4HLZG 2FATL 2ED7A 1JGLL 2CLRB 3B5TA 4WIQA 5F9OH 4UNVA 1HZHL 4BFEA 4BH7A 3GSWB 3C5ZC 1FE8H 3HI1B 1AGBA 4QT5B 4XMPH 1TPXC 1A7OH 5I8CB 1CXHA 5FEBA 4P4RB 4LDOB 4PJDB 1WZLA 5AYUH 5DD0L 3L3JA 1A7NL 5DD3H 2MTPA 2V7HA 1CFBA 4MSWA 4S0SD 2F53B 2IPKB 2NTSP 5AZ2H 3HPLB 2WSKA 1I1YA 5IHBA 1KPUB 4ZUUA 2CLVB 4Q6YA 3NZHL 3BGMB 1F4YH 3AS1A 1F6FB 5IHUL 5T3ZH 4YHYB 4X6CA 3DXAD 3X3FL 2B2XH 3L6FA 2NPLX 1FNHA 1U8PA 1CGVA 2AGJL 3JV5A 5CJQH 5IBTL 1CGUA 3S4SA 5L2JA 4P46B 4ALAH 4YGVB 4R0LC 4JN1H 4ZFFA 3TM6A 4OCRL 1D5IH 3QI9B 1T2QH 2QSVA 1AI1H 5C0AE 1CD0A 1MVFA 3DMMA 1IE5A 1IARB 2VISA 5ICYA 1EXUA 5CEYA 4NWUH 3C6LB 4U6HB 4X7TB 5IJKA 1RZ7L 4M7JL 5EC1B 5I66B 1H3UA 1NMCB 5CBAA 1QR4A 4MB3A 3CFKB 4JZJA 3VD3A 4C55A 4WV1B 1NBZB 5F6IB 3UAJC 5DURB 1CLCA 4QRSA 5GSRA 1H3PH 1Q1JH 4HIEB 4D0DA 1RULH 3GI9H 5C0EB 5DQDL 4JPKL 4YK4C 3AFLA 2C3HA 2UVFA 4GS7B 1KACB 3O4LA 5EDXA 4HJGA 4IEFB 1J0JA 5L8LB 1UWGH 3KPNB 4GAGH 3T09A 2ARWA 4RISL 1K2DB 3DUSA 4JQIL 1QFWH 1P6FA 3GJFH 4NKMB 3F5WB 4XNMA 5DF0A 1S9XA 4U1SB 4FQHB 4XNZC 2BOCB 3S8WA 3FONA 1UWXK 1J88A 3F62A 3HMXA 3VXPA 3HTLX 2XRAL 1CD8A 5D7JD 1JP5A 3DX9B 2A83B 4JR9H 3U4EB 5CJ8A 3TIEB 2FBJH 3IB4A 1CGXA 5DUMH 2QJDA 1RZJL 1U8JA 3U0PB 1S7XB 3MBED 3MRMA 4URTB 4ODWA 4XMKH 1G7HA 3QDAA 1J8HE 5J56B 4JY6B 1XGQB 4MDIB 1I1CA 2H26A 4OB5L 2JKXA 3SDCB 3P9MA 5L6YH 3WDIA 2QLVB 3BP7A 2LU3A 4PR5B 1QR1A 1LO5B 1EFQA 3BZ4B 4YO0B 5IKCB 2FD6L 3QIWA 3SKMB 3QO0B 1H15A 5CJOL 1HSAA 4ERSH 2BRQA 2H8PB 4XZUB 4JQVC 3O2VH 4JFHD 3HE7C 3RUGB 2QSCL 3LKOB 4MD4B 4LPWA 4M6AA 2GJZB 4E5XA 3VGFA 2A1WH 2FO4A 2Y7QA 1CLOH 4WHTA 5GRZA 1P7HL 2VJXA 5KW9L 1QLEL 4HPOH 5C3LD 4K7FA 4BQCA 3WEXB 3AROA 4MCZB 1UWEH 4ZUSB 4NM8L 5JUEL 1A8JH 4FRWA 4G3YH 4DKFL 3U46B 5FYJD 2X05A 5IMLB 3L3OA 1I8KA 4NO0B 3CDGA 4DUVA 3CVHH 1JF5A 3VD9A 1UKSA 5MHSD 3ECBA 3OR6A 3WFCH 1KJ3H 2W1NA 1BIHA 3HC3L 5L0QB 1F5WA 5C0JB 3LKPB 3CMOH 4MX7B 4MB5A 4PJFB 4DVRL 5DK0B 1R5VA 2ICEA 5JHDB 1ZOXA 1RUQL 1CTNA 1I3GH 3SO3B 4OZFG 1MI5D 4H26A 3QQ9D 1G0XA 1MF2L 2W60A 3L3IB 3T4AA 1CT8B 4M7LT 4XCYB 5KVGL 2IEPA 4LASH 3DECA 4PGJA 5IB4A 2J88H 4OLZH 3FQNA 5FF6B 1NBVL 1INDH 2IMNA 1JFQL 4YXHL 1DLHB 1C8PA 4P23D 1VFMA 1IKFL 5BCAA 1UWXH 1YEGH 4NKDA 2PXYD 5FOBA 5FYKE 4L4VB 2YRZA 1ONQA 3QQ9C 4M4PA 5C0BB 4ZUWA 2FLBT 4P3DA 5HGAA 4WFGE 5GRVL 5EIIA 5EUOA 4ZUVA 1Q0XH 1QBAA 3MV8B 2P5ED 1WZKA 4QKXB 5MEQA 2Y1VA 3LPFA 1GHFH 4JG1L 2BVQB 2YD5A 2P24B 3TBTA 5HJ3B 3GK8L 5MI0C 2VR9A 4YDLC 3RZCD 2PYEB 4P23C 4XPBH 2YD7A 2PXYC 3VXUA 3UPAA 5E00A 4F7TA 4QY8B 3KLDA 4Z7VB 3HR5A 1D6EA 1A3LL 2B0SH 3LDBC 1UJ3B 4HQQH 1DUZB 1IFHH 1P4LA 4O51A 4QRUB 4LARH 3FQXA 1EAPB 1XCTB 4HV8A 1QFUL 1UT9A 4LLYA 3QUYA 5DVOA 1FCCA 2QADD 4UT9L 3RZCC 4CJ1A 1PAMA 3FTGB 2Q8AL 4MXVF 1RVFL 2VXSH 4KI5F 1YEEH 5EBMA 1LK3H 4OZHB 3ARDD 1IL1A 5IB5A 1FZOB 1OP9A 2QR0A 2CMRL 3QIUB 1KEGH 1KENL 3P0YL 4XMLH 2GITB 3HZVA 5F1NB 5EORH 1QFWI 1NGPL 1LWRA 2C1PA 4NJ9L 5GSVA 5SX5K 2I07A 4LCYB 2R2BB 4IRJA 2CDEB 3TZVC 3X3GH 5DRNA 1B6UA 5E9DE 3ARDC 1TQBC 3LHPL 3QULA 5DJDB 4OM1H 4JJ5A 2GFBB 5D1ZA 1FSKC 2VIRA 5FUOL 5D7IA 5TDPB 2XXCB 1HCVA 4G42A 4ISVA 2DLGA 3QUXB 3I6GA 4XWOD 4WW2C 2WQ8A 2VDML 3IFPA 4Z95H 4MMXC 3BKMH 3EYVA 5LXGH 3DRQA 4JPWL 2F54D 1NGYA 1OTTD 1I9JH 8FABB 1RJZA 1CXEA 2Q3ZA 3DETD 4LSQH 3VFUB 3IDJA 2QSQA 2DD8H 2X4SB 5F7EH 4FMKA 2XY2A 5C1MB 4CJ0A 1DQML 1KV3A 3FO9B 4HLJA 1MIEL 1WF5A 3KPPA 3Q0HA 4XWOC 5FA3A 1A6VH 2WLZA 4AK1A 3MLRH 4NZTH 4NJAH 1RIHH 2R0LH 1KLUB 3JUZA 4MCYB 3DSFL 1RJYB 3DETC 1FZMA 3JTTB 5IB1B 3IVKB 1KPVB 3FOMB 4Z7NF 1PY9A 4U1MA 5IFHL 1S78D 5DJZA 3NN8A 4M1DL 1HXMB 5TQ2H 3SGDH 5FFLA 5IEKB 1CVSC 4HT1H 1HDMA 1OVZA 4NKIH 1NKRA 5F7WC 2K7QA 3WS3B 1U8NA 2ZCHL 4HH9A 3QXDB 3P0VL 2RAMA 1U41A 4RA3A 2VXTH 2YD4A 4TUJB 4YHPA 3AS3A 3BP5B 1CGWA 1S5HB 1S78C 3FOLA 3VA2C 3BH8A 3DWTA 4PJBA 3TESA 5ACLA 4K8RH 4NN5C 5JW4M 2NX5B 5JR1L 3S88H 4FQXA 1HOCA 4TOYH 3BN3B 4N0CD 5IB2A 4DUWA 4LCUB 5C2BL 1JWMB 3S34L 2B1AH 1AGEB 4LIQH 4Y4HB 2DWDB 3IF1A 2YD3A 2G9HA 4MA8L 5FGRA 2EDYA 1LDPH 2KPNA 1OP5K 3D25B 5HYEA 1JZ7A 3S37L 4Z77A 5JW3L 4NYLA 2E9JA 1CFNA 1AE6H 1JNHA 5SX5H 4FABH 5M7QA 5IT2L 4Y5XB 5MENB 4V2CB 3MNZB 1OF2B 3QDJD 3V52L 4PRPA 5C08A 4WJ5A 1CLYH 4X6DA 4NZRL 3K2UL 4KHXH 4LU5H 3SE8L 4UDUB 2DWEA 1BX2A 4JO2H 5J7CC 4RQQB 4ZTOL 3VFRB 4V1DA 1QRNE 1A4KA 1YEDB 1QD0A 2EH7H 3DO3A 1Z9OA 5FO9A 5HY9B 1X6LA 3TVMC 1IGTB 1H5BA 4KV5F 4EOWL 1YN7A 3BZEA 5CAYB 3ROOA 4MNQD 3MRPB 4TVPL 2OR8A 1S7RA 2AKRA 4G8FA 4OCMC 2QQQA 3P4NA 1FV1B 2UVEA 1NSNL 4O4YH 3TNNA 4P4KA 3EYFB 3BKCL 3KHQA 3LMJL 4JPIA 4NKQB 4K3HA 4WTXA 4JQXC 4F9PA 4UTBL 3ZTJG 5JXEA 1F97A 4DOHB 1TVDA 2L4OA 3PDDA 4DKEH 2X70B 3P30L 5H35A 3TO4A 3OL2A 1DQDH 4KVCL 4ELKB 1QPXA 1NC2B 3B3IA 1SMOA 5IESL 4K23H 1AXTH 5B8CA 1V05A 4G9FD 3DROA 4FFWD 2EYRB 3S4SG 1S5IL 1C16B 1E28B 1FNSH 1NCUA 4EKXA 5C0IB 5DJ6B 3ZHKA 1JNLL 3BYYA 3JVGC 5JQ6H 1BQHB 3VFMB 4OZIE 5TGBA 1INEL 1D7FA 4DTGH 3RVXD 3KPSE 2GHWB 2E8ZA 4JJHA 1FRGL 2CR3A 3G6JF 2BRRH 2ADFL 2CLRA 3ZKND 2YZ1A 1K9TA 2B20A 4YHLL 5B4MD 3GSWA 1FH5H 3HI1A 5F71A 4QT5A 1FPTL 4Y19E 3NIFE 3R8BB 5I8CA 3HAEH 3TBYA 4PJCF 5AAWA 3RVXC 1S3KL 3GBMH 3OV6A 1OP5H 3H8NA 1L6ZA 2YKLH 5IK3B 5E2TL 4RX4D 2IPKA 3MA7B 1RY7B 3GRWH 3HPLA 3GMQB 4Z0XB 3H6JA 1W0YT 5BMFH 1KPUA 4QXGL 2CLVA 3ZKNC 4I0CC 3FO0L 5FK9B 3BGMA 4EUPH 5C09E 3GIZH 4P2YA 2BMKB 4XP4L 4ZFGH 3MZTA 4POUB 4KK8D 3RVVC 3T3ME 1VGKB 1IMHC 4YGVA 4AIZB 3QI9A 1FO0L 1XR8B 5I6XB 1YJDL 5I15H 3WIHH 2IPUG 3U6RB 1ZVYA 3C6LA 4U6HA 1NBYB 4LRIA 4X7TA 2FNBA 5I66A 4X7SH 1GGCL 1ZGLM 3SGDI 4IDJL 4KK8C 3VWKB 3GBNH 1U95B 4WV1A 1NBZA 4OTXL 5KOMC 3FN9A 2A2QT 1U91B 4HIEA 2HJFB 1TVBB 3LH2H 2G75B 4PRHD 5C0EA 2HT2D 4FQQB 4OLWL 3WJLC 2BY1A 4XCCH 4ZOBA 5E8DH 2O61B 4WCYH 3LS4H 3QIBD 1AQKH 3ARFB 3LPWA 1DQQB 2LE9A 2FO1A 4IRSD 3KPNA 1J7VR 4WEUD 1K2DA 5D96B 3FB8A 1CQKA 4LSTH 4UV4H 3WFDH 4NKMA 1ZEAH 3DURB 2Q20A 4N90D 4TYUA 3F5WA 2HLFC 5DRXB 4PJIF 3DNKA 1KN4L 2Y06L 4U1SA 4M9PA 4FQHA 4WENB 3V6OA 2BOCA 2W9EL 2YBRB 1D5BB 2WV3A 2QBWA 4XNXH 1PEZA 1NFDE 4L3ED 3QDGE 3DX9A 2A83A 3U4EA 5C0CB 2EDEA 4IRZL 3TIEA 4XCFL 1DJSA 2R4RL 3CH8A 5C0ND 1VPOL 1G84A 1YNKH 3G6DH 3U0PA 1S7XA 3JWDL 5HVHB 1QSZA 1N4XH 4J3XA 4UNUA 2A6IA 1H3VA 1SYSB 1XGQA 3O3DB 3H9SE 4JRXD 4M6NL 3X14B 1V3MA 1T2JA 3SDCA 4N9GB 4ACPA 2E9BA 5FIEA 2NY5C 1A7RH 2NY1B 5HGDB 4PR5A 2WBKA 3CXHK 3Q1SH 5F6HI 3D85B 1LO5A 2J6EH 1BHGA 3BZ4A 4XNQB 2XZAH 4YO0A 2QQLL 2YS4A 4L9LC 4Z7UF 5IKCA 4WW1B 5C0NC 2FWOB 2D4FA 1OQOA 3QHFL 3SKMA 3UTPE 1N2RA 3QDMD 2EZ0D 1IGIL 15C8H 2H8PA 1RZIB 4XZUA 4P9HC 5T33L 1X5AA 1D5ZB 1AIFB 5LGHL 2K3TA 4U6XB 3O81A 3RUGA 1UM6L 5C07B 2UY7A 1IJ9A 2YUWA 3O6KL 3SKNB 2F19H 4HUNB 4HCRH 4LLDB 1E6OL 4G6JL 2ZUUA 3VRJB 3WEXA 2FX7H 2G5BB 1GIGH 5TPWH 4MCZA 2CKBH 2VSDA 2QQKL 3WD5L 4ZUSA 3C60B 1MQKH 4U6YB 5JHLH 4LSUH 4NRYB 3W39A 1F2XK 1EZVY 2IF7A 3E3QE 3U46A 5A2FA 1BQSA 4LNRB 4DZBB 2Y23A 4HK3J 4X7CC 1NLBL 4YHML 3KYKH 1JZ6A 3UP1A 3LKPA 4LCWD 4MX7A 2OP4L 2VZSA 3UTTD 4PJFA 5BW7A 4NWTH 3SCMB 5DK0A 1BJMA 2Q8BL 4LDLB 4R26H 5JHDA 4NUJB 4AMKH 2GUOA 2KZWA 1SBSH 1P9MA 2V9TA 1DTUA 2EDTA 3VXMB 4QOKE 3PHSA 3PQYB 4HWBH 2A73B 2G2RB 2ZCKL 2NXYD 4Z7OF 4KWUA 4I18B 5J8OA 3ILPB 3L3IA 4OJFL 1MCSA 1CT8A 3K3QA 3V79C 3IFNL 5IHLB 1BFSA 1LD9B 5KVDL 5FF6A 4JFHE 4NZJA 5CFHA 1DLHA 1M4KA 1SY6A 3CCHB 3EO0B 1KN2L 5GJTL 2FCBA 2K7PA 4K7PX 1F2QA 4L4VA 1JCKA 2OL3L 1ZLUK 1T03H 4ODUB 3DMMD 1XGTB 5GPRA 5I1JL 5C0BA 3VFSB 3EO9L 5HYJB 2BNQB 4P5TB 3MV8A 3KYMB 4XAWL 2XA8L 3QRFM 1J9CT 4H0GA 2MPAL 3ARBB 3MQIA 1D6VH 2BVQA 2P24A 1WAAA 3O6FB 4JFFD 2CRZA 4JRYE 3EOAB 1K3ZA 1Q94B 4DEPC 3KXFE 3LKNB 5K9KB 4NQTA 5JTWA 1PBYA 2PYEA 4XP5H 2FATH 2HLAB 1JGLH 5EOQL 3MLVL 3TBSB 3RBSA 1IC5H 4QY8A 1HZHH 1R5IB 1I8LA 4Z7VA 3DMMC 1QSVA 1C5DA 4I13B 1UJ3A 3O4LD 2GTZB 5IJKC 1DUZA 4OLYH 4QRUA 1XIWD 5JIKA 1EJOH 5LBSH 1XCTA 3VWJB 4X4XB 1W0WA 4OBRA 1CR9L 1SVZA 5D2LF 4FQIH 4LF3B 1RUPH 1TQCC 5KANG 5E6IB 1CK0L 3FTGA 5FUZH 1NMBH 4KROB 3BPLB 2H3NB 5KZCB 1AGDA 4Y5YB 4OZHA 2ATPB 1A6TB 1FZOA 4CUCA 4P5KB 1LDSA 3QIUA 3RIAF 4CVZB 1CBVH 4IMKA 1RV6X 2GITA 5IBTH 3INUL 3O6LL 2X9WA 2UY6A 3H7BB 3PIQB 3C9NB 4LCYA 5EU5B 2R2BA 1TJHH 5T3XH 3TH3T 2CDEA 3CLFH 4M62L 1HYSD 3QXUA 5DJDA 3F58H 4PY8I 4M7JH 1NL0L 2GFBA 3I3BA 1OLZA 2JJVA 1FAIH 3K2MC 2WAHA 5DXWA 3VXRD 2DQJL 1KELL 5FYLE 3EAKA 4HS6A 3QUXA 1W72H 5CKGA 2EDRA 2X10A 2GSIA 2ICWB 3PF2A 2XZQH 5DQDH 3GIVB 3OB0K 5F89B 1R3IL 1ITCA 4J6RL 1HYSC 8FABA 3D69B 3GJEB 2FIRT 4OCWH 3VFUA 5CZVL 4MXQD 2X4SA 1QQDB 1D5MB 4OZ4B 1CD1B 5T1KB 1TZGL 1EHLH 4U6VH 5L8KB 4RISH 4ZAKB 2AK4E 2OMNA 3FO9A 4JQIH 3WO3B 1JK8B 3UEZA 4LEOB 2EIDA 3TBVB 1ZLUH 5E2VL 1YNTB 3IU4L 3GNMH 3UJJL 4ZNEE 4WUKH 5J3HC 4MCYA 1KLUA 1RJYA 3TC9A 5F1SA 5IB1A 3JTTA 2A0LD 1KPVA 2XRAH 1FIGH 1V7NL 4MXQC 4K9EC 1HXMA 1YQVL 2VWEE 4S2SB 4AEIL 1CZ8L 4XNUH 5IEKA 3L95B 4LPTA 3KWWB 5MP6H 4PLNC 3OX8B 3WS3A 1PSKH 3G6JB 3QXDA 2C5DC 2F15A 4NHCL 1MCKA 3WHE0 5D9SB 2EKSB 5TH2B 1HH9B 4TUJA 4L8SB 3BP5A 3L5JA 1ZA6B 4NN6C 3CSYB 1P5VA 2A77L 1MPAH 4LLMB 3X11B 5D2NB 2NX5A 2FD6H 5HHNB 3EW3B 4LCUA 5CSGA 1JWMA 1AGEA 1PDKA 4GW1B 2PN5A 3GSOB 1GSMA 4AIXA 1ZA3A 3D25A 1M05B 1LO3L 4F7PB 3KVQA 5A2LH 5DMIL 4N9OB 2X5PA 3DLQR 2N7AA 3I2CL 2AEWA 4WDIB 3AXLB 1QUNA 3KS0H 4PJEE 4G9DB 4D8PB 1ZS8B 5JUEH 1FVEB 4Y5XA 1U36A 1OF2A 3MNZA 2F58H 3GHBL 3TBWB 5I2IB 1F8TL 4L29B 5E2WL 5KN5B 1ZLSL 4Y5VB 3FFCB 4UDUA 4P2QB 3T1WA 1IM9B 4EI6B 4RQQA 2XWBB 4YWGL 3UZVB 3VFRA 2I60H 5F96L 1RK1A 4S1QL 3VW3H 2APTA 1A9BB 1YEDA 4Q0XL 3RPIB 5HY9A 4XBPB 1U6AL 5GQBA 1KOAA 1IGTA 3VRLE 2OL3B 4DVRH 3OPZL 5D7KE 3TEUA 3HG1E 3VFTB 2HG5B 2VZ1A 3MRPA 3OB0H 5HHXH 1ADQH 5I1GL 2YMXL 1FV1A 1FP5A 4MNHB 1ACZA 3MXVH 5FCUH 5CEZE 4HXBH 4XXCA 1U93B 3EYFA 1YYLH 4MJ6A 4HW6A 3U1SH 2OI9B 3RWIB 3NOIA 4DWHA 4J4PA 5KVGH 2LQRA 1YEJH 3WL9B 1K6QL 4U1JB 2EIBA 1NBVH 2FLRT 4XVUD 4HS8H 1QFWM 2QL1A 3O2WL 4BUHA 3RWJB 4NFBA 1JFQH 1NC2A 4I3SL 1WCQA 2AEQL 1CDGA 5DUBB 3QUYC 1J0HA 4PJIB 4RAUB 4BM7A 2WWKT 3LS5L 5ACZB 1NDGB 2GK0B 2F5AL 4NUGL 4PTTB 1MHPL 2NYYD 2EYRA 5F1KC 1C16A 5CWSB 1E28A 5C0IA 3MOQA 3MGTA 3NFSH 4OIIH 5DJ6A 2DQHH 5IIEB 4EQ2A 4U1KA 5DJ2B 1BQHA 4JG1H 3UJTL 1G9ML 3VFMA 3AMLA 1L9MA 4DFIA 4XVUC 4NO5B 2E7MA 3BEWA 5SWSD 4ZXBB 4B0MM 5C8JA 5CHNB 3PE9A 4OI9A 3QJHB 4ZS6D 4PGEB 3T2NL 2CXKA 3OAYK 4IRJC 1ETZB 5INCB 4N5UA 3QUZB 1G7MB 4K71C 1A3LH 1MCDA 3AB0B 5DJXB 2A9NL 5D1ZC 3ZL4H 3FT3B 3MNVB 3QG6B 5GHWH 1QFUH 4Z7UB 5EU6D 2XFXB 3MV9B 2MWCA 3OKMB 1JNNL 4B5EA 2V5TA 1RZKL 3D18B 3GBLA 2H2PD 5FYKU 4EQ3A 4F58L 2Q8AH 1T2XA 2NNAB 2JCCF 2IANE 5IK3A 3MA7A 4Z0XA 4ZS6C 3GMQA 3WNPA 2AJVL 2BSED 4K8RD 1MLCB 2NW3A 5FK9A 3DX8B 3PGDB 4RMUA 5KSVB 1SYVA 1ZHLB 4L8BB 2BMKA 1ULVA 3P0YH 4S1RH 4HIXL 3FHQA 3GMRB 3QPXL 2W0LA 5BVJB 1VGKA 4NJ9H 2H2PC 1NAMH 3WXVL 1WTGT 4MA3B 4P0DA 1AP2B 2OZ4L 1YY8B 1XR8A 2Z0BA 4PJXF 2H1PL 1P1ZB 3LHPH 2IQ9L 3F7PC 3B43A 5A2IH 1JJUA 5IEHB 1B0RB 1IQWH 4B7IA 2D03H 4J2XA 4XVJL 2IADB 1VEPA 2VLRE 4JFEE 3VWKA 3ZKMC 1U95A 2BOBB 4P99A 3X12B 5JPNA 3VI3E 1OAKL 2OK0L 4JM2F 1WBYB 1U91A 2HJFA 4JPWH 1TVBA 3JSSA 1P53A 2HRPL 4FQQA 3LB6D 4HUVB 4LQ1A 1C1EH 1CGSL 1IQDB 2ZUXA 2VABB 4YGAB 5JO5B 2O61A 1GZPB 4KTDH 5BZWB 1PYWB 1DQMH 1FHGA 3ARFA 1FGVL 1DQQA 4HWZB 3QFDB 4JFZL 4FQXC 4NQED 1ACYL 5EFIB 5DRWA 3U0WL 5DT1L 2ZKHH 3RRQA 5C08D 4CVXB 3ZE1E 2P5WE 2VDRL 5J1AB 3GUTA 1S7VB 5D6DA 5I8OL 2YBRA 1D5BA 4V1DD 1U42A 35C8L 3KGRA 4ZOAA 4M1DH 4NPYB 2FGZA 1JPTH 3WJJA 3MOBL 2ZG1A 2VQUA 1B4RA 4KZDH 2VZ3A 5EZOL 1UM5L 3FQUB 3SDAB 3OAYH 5BRZE 1CE6B 5F44A 1DL7H 1UH3A 4RDQG 2VOTA 2DM2A 4MS8D 3FB6B 1SYSA 2D4DA 4I3RH 3O3DA 4KRNA 4XBEH 3MFFB 3X14A 4P4KD 4S1SH 5F7MC 3UJIL 2OSLB 4TUOB 4N9GA 1J05B 4PJ5B 1FFNB 1J86A 2BNRE 4AENB 5HGDA 4AL8L 3LD8B 1OGTB 3OXRB 5J6HB 3D85A 2ZP0T 5JORB 1H5BC 4XNQA 4BKLB 5EU4A 5D2LB 4R4FH 3TO4D 5C2BH 4WW1A 3SE4C 2FWOA 1JF1B 3EYQC 1EO8L 2XQBL 4JFDB 1D5ZA 1AIFA 3WLBB 4MS8C 4U6XA 2VDPH 3VGGA 5C07A 4P4KC 3A6CL 3QWQB 4DGVH 3SKNA 4FQ2L 2EH8L 4ORZC 5IQ9B 1WQVT 4B41A 2UWEE 4LLDA 2OX5A 4F9PC 5JXEC 4C4KT 3VRJA 1CXLA 4FFYL 3TO4C 3C60A 2H6PB 3G04B 4U6YA 1MFAL 4NRYA 4D9QD 1KCVL 5CKAA 4LNRA 4DZBA 5E8NB 3AS0A 4ZTOH 1EJ6A 2QTEA 3I9GL 4OKDA 1NBQA 5DO2C 3UPCA 4HSQA 1A6UL 1S7TB 3TCXA 3ULVE 3DV6B 2QHRL 3EYOA 1PFCA 5F9WB 5DHYB 1YYML 1WT5A 1NCBL 3SCMA 1DVFB 4NUJA 5TE4L 3SBWA 3MRKA 2BHYA 1FYTB 1YMME 3VI4F 2ZSVB 5I9QC 3VXMA 2F53D 4JO1H 3ZE0F 3PQYA 1D9KA 2A73A 2G2RA 3BKCH 3HI5L 3LMJH 4Q58C 4I18A 3P3YA 3LSOA 3ILPA 3TT3L 3MLZH 4UTBH 2JJTA 5E7BA 4LLAA 2AI0L 3P30H 4LGSB 5CLTA 1LD9A 3DI2B 4KVCH 3LRGA 2DQUL 1NGWB 4UNTA 4P46D 2BP3A 4X6EB 2CDGB 5J6GB 2NY0B 3CCHA 3EO0A 2IG2L 5DS8A 5FHAH 3ULUH 2E6PA 1S5IH 2YN3A 4LVEA 4KAQL 3W0WE 4ODUA 1XGTA 3V4VH 4CU6A 3GHEH 4CBPA 3VFSA 4K7PY 4PJHF 3ZYOA 5F3BB 1MWAH 5HYJA 3C6LD 2BNQA 2ID5A 1DEDA 2ICWJ 3KYMA 3LQAC 1GGIH 1INEH 3ARBA 1Q94A 5K9KA 3LKNA 4P46C 2KDGA 3TPKA 1OQXA 3JUYA 3MNWA 3HE6B 2HLAA 1SVCP 3K4DA 3ARTA 3UXFA 1T4KB 2P1YA 3MRGB 2BZDA 1R5IA 4YHLH 5HI4D 1VEMA 3N50A 4P2RB 4P49A 3OZ9H 3C6LC 4GOSA 5EBWB 4LRIC 1K5NB 1NMCC 4OCYL 5EPMB 3HB3D 3AMKA 4U1LB 4X4XA 3VWJA 1S3KH 3KLSA 4JPVL 3BPCB 5JW4Q 1GOFA 2DBLH 1BF8A 4WV1C 5F6IC 1AO7D 1X5FA 5KSBF 5E2TH 5E6IA 5CZXD 5FYJL 2XTJB 5A2JH 4Y5YA 3LRSB 3RWGB 1P84K 1HH6B 4M1GL 2ATPA 1A6TA 1A0QL 4GS7C 3U36B 3X13B 4CVZA 1FFOB 5GGUB 5TDOB 1I75A 3HB3C 3T65B 1YQ2A 4O00A 3H7BA 4ORGB 3C9NA 3E2HC 3ZHLA 1FO0H 5EU5A 2JJSA 4PRID 1OY3B 4GRWH 5CZXC 3IRZA 1H8OA 5GISH 3V6OC 1IGCL 5IVOA 2ZCLL 3SDCD 1DLFL 2WM0A 1GGCH 4JKMA 4IDJH 1RIVH 4JG0L 1JHLH 3P4OB 1IAKB 3P40A 4OTXH 3VE0A 2E7LA 2ICWA 2Y07H 3O4LE 1KIPB 3GIVA 1YEKL 3CNKA 3D69A 2DJSA 2GJ6D 4I9WE 4RZCB 3SDCC 4HUUB 2W59A 1QQDA 1D5MA 4R2GB 4OZ4A 1CD1A 4OFIA 5T1KA 1IAIH 4R90H 5KVFL 1JK8A 2DBJA 4FQ1L 2V2WB 4LEOA 3DXAB 3TBVA 1YNTA 4WWKA 1KN4H 5DA4A 1VFBB 2Y06H 1MRCL 4NO0D 2W9EH 4KQ4L 5BVPL 2DQDH 3QISA 1HQ4B 5DRZB 3H7LA 2VH5L 1VGEH 4S2SA 4HMEA 3C08L 3KWWA 3UTQB 5JHDD 4MJ5B 3OX8A 1JYXA 3JWDH 3G6JA 5EZJB 1BJ8A 5E2JA 4M6NH 5D9SA 5CBEB 2EKSA 5TH2A 1MHEB 3EDJA 4HPYL 1JYWA 3RVTD 4OGYH 2H32H 4L8SA 2DKUA 4TSCL 4H0IA 5HDQL 1FGNH 1ZA6A 1N7ML 5L0QC 4G43B 2EEBA 4LLMA 3X11A 5D2NA 2QQLH 1MAMH 1FL5B 5BW7C 5HHNA 4M6ML 2P8LB 2JCCB 3L5XH 4NP4H 4GW1A 4FHBD 3SO3C 3GSOA 1P9MC 2Q7YB 1S7UA 3CFIC 1NCCH 1E4KC 1M05A 3Q2CA 3E0GA 2KZ1B 1XGRB 1P6AB 4DKAA 3RVTC 2NY3B 4F7PA 1NEUA 5IR1B 1DQLH 4WFFD 3I50L 4I2XB 3MV8D 3WKNA 4F57L 2IPTL 4UIKL 4WDIA 2QQKH 3AXLA 4D8PA 1FVEA 2R4SH 4AEHL 5BV7H 1KB5B 4YDIL 5F9JA 3TBWA 5I2IA 2H41A 4L29A 5I0DA 3EFDH 5HTSA 4PJXB 5KN5A 2VXUL 3KPRB 5TQ0H 5D7JB 1BQHG 4Y5VA 3FFCA 1NLBH 4P2QA 3MRCA 1IM9A 3S35L 1T5XB 4EI6A 2XWBA 4M03A 5JIHA 1A9BA 1YECL 1I9EA 4UV7H 3RPIA 3MBEB 5I30L 4XBPA 2AJ3A 5T3XD 5J89A 2OP4H 2OL3A 4L8CB 2EE9A 4UOJA 5J1SC 4G6ML 1TIUA 3DX7A 2R0ZH 2I26N 2HG5A 1Q9KB 4PUBL 4JM2B 1BGXL 2DMKA 1G7IB 2VDKL 4FFZH 3ULUE 3SPVA 4QRRD 4MNHA 3IETB 1CYGA 4OI8A 3IS0X 4KMTL 5DI8B 5CLWA 2ZCKH 1A3QA 1U93A 1WICA 1BMGA 1ZTXH 4HC1A 4ZDHB 3RWIA 1UJ3C 3P11L 3WL9A 3IFNH 3TJEH 1QBBA 2MHAB 4R7NB 5KJRL 1HINL 3I3EA 2YPVL 3U7YL 3EDKA 4Q9CA 3PHQA 3RWJA 2WUBH 3WNKA 4J3WA 5DUBA 4PJIA 4RAUA 4F9LA 1BVKB 2PR4L 4WHDA 1NDGA 5FECB 5EUOE 4B50A 4PTTA 4NNYB 1KTDB 5CWSA 3EO9H 2WWMD 5IMMB 2XA8H 3S9DB 4Q2ZB 5IIEA 3QIUC 3PWVB 1MCOL 4BZYA 2MPAH 5DJ2A 4ZFZB 4O2CB 4IMKC 3IDYC 3HNSL 2FYYB 2HH0L 3MCKB 4JM4L 4M7KH 4NO5A 3VXUE 1KEML 5EG6C 4P5MB 2DQTH 4CAGA 3QCTH 4TNWF 5CHNA 1RSFA 3QJHA 3UDWA 4F33B 5ISZD 1ETZA 5INCA 3QUZA 1G7MA 4C59B 1UA6L 5DJXA 4TTDC 2WWMC 5H8DA 4JKPL 3IDIB 3RI5K 3FT3A 3MNVA 3QG6A 3V6ZB 2CGRH 1YPZF 4ODSL 1CR9H 2CK0L 4R4ND 4U05A 1NMAL 5F7YC 4ETQB 5T1MB 1AJ7L 4TULH 2MKWA 3D18A 5J57B 3QUXC 3MRQB 4Z78B 4Q9RL 1E6JL 5GRUL 4ONGL 4GRWE 2NNAA 3WS6A 4QNPE 2IALB 5E5UB 4UMGA 1I1AB 2DQEH 1MLCA 5ICZB 2FGWH 3L5IA 3D9AL 1UB5B 3DX8A 3OB8A 4Y8AA 3PGDA 3ALPA 1RZJC 4XT1C 2W07A 5FYJU 1ZHLA 5KSVA 1TNNA 1FIEA 4KXZH 4LQFL 1WISA 2Y6SD 1NCAH 4LL9A 4MB4A 3GMRA 3MGOA 5IW3A 5C0RL 1IAII 1G9NL 1GC1L 3O6LH 4R4NC 5BVJA 4PD4J 1P4IH 5IMOA 4MA3A 2BY3A 1AP2A 4NQCB 1YY8A 3PP4L 4M62H 1ZT4B 4WHYG 3A67H 1T1WA 1P1ZA 1XGYH 4IBLT 5FKAB 2NCMA 1CD9B 3MJ9H 4FZEL 3S3JA 5IGXL 3RZCB 1YY9D 2Y6SC 1NFKA 4RFEB 3D6GA 1P7QB 3VFOB 2UYLB 3VGBA 3X12A 5SWZD 2HKHL 4K7PL 4Y4HD 1WBYA 3ORJA 4A6YB 1A3RL 1JN6B 1R3IH 4J6RH 4OLEA 2OJEB 3ES6A 1EHXA 4HUVA 2FJFB 2DN7A 3N06B 1IQDA 2Q1EA 1T7ZA 2QADB 2VABA 5F7HA 4IMLA 4WFEE 1KJMB 1GZPA 1TZGH 4Y4FA 5BZWA 1PYWA 4GH7B 1Z5LB 3AY4A 1A14H 5C0DB 2CXGA 1NJ9B 3QFDA 5FM8A 3I84A 3ARDB 3OJ2C 1J11A 5MEND 3MUHL 5E2VH 3ZMRA 1MFCL 4Y4HC 1MJ8L 4YHNB 4CVXA 4OZGA 4WWID 4YE4L 3STZB 4XWGH 4PJ8B 1UG9A 4PJHB 2GY5A 4ODHH 4W6XB 3B9DA 4X5WB 5LAXB 4ZPTB 2VMFA 4NPYA 4XC1L 1U58B 2ZNXA 1A2YB 5IG7B 2FEDC 4ZO7A 4BUGA 4WEBL 4GLRH 3FQUA 5DD5L 5BOPA 5C6TH 4Y5XC 2NTFB 2E7BA 2RQ8A 1CE6A 5DFWH 2V7NB 4YH6A 2V2TB 2DM4A 4DVBB 2VSCA 3FB6A 3MFFA 1KF9B 4PJBE 5IBLD 4DK3A 2FJGB 2OSLA 5GZND 4TUOA 2D7TL 1J05A 4PJ5A 1FFNA 4KJQD 4C83B 4AENA 4M5YH 4OF5A 2YXFA 4OLXH 3OXRA 3SDXF 2XKSA 3D0VB 5JORA 1ZGLB 4BKLA 5F7UA 2NQCA 5M95B 3QUKB 2EXYD 5KSBB 4NQXB 4NCC1 1NC2D 3EUUA 3GKWL 1JF1A 1I8IA 3QWRD 7FABH 4OCXL 3HNTL 4JFDA 5HI3D 5K9QG 3WLBA 1L0XA 3MMEB 3BH9B 4XXCC 2FIKB 4OV5B 5IQ9A 5DMIH 4XB7A 4KJQC 3CZJA 1KC5L 3VFNB 5L88H 3BSZL 4PRPE 3BGFB 1TJIH 3LKRB 5C08E 1EO5A 4BH8B 2Z31B 4X6DE 3BWAB 2EXYC 3RJQB 3PWNB 1RIUH 2H6PA 3G04A 2BVTA 3B2VH 1FORL 4V1DE 1ZLSH 5CZKA 4KRLB 5D71H 5HVWA 1F3JB 5HI3C 2EEDA 5FGCE 5E8NA 5EC2B 1CE1L 5F96H 3H9ZA 5C9JB 1OAUL 3GZKA 3DVIA 5CGYD 1U6AH 1S7TA 4JKWA 5LKNA 3DV6A 3OPZH 5DHYA 3QAZB 1FBIL 4R8WL 1T21B 2R1YB 4P57B 1DVFA 2XPGB 1P7KB 2CRIA 3QFJA 4V2BA 5I1GH 2FZ3A 1L7TH 1FYTA 2ZSVA 1C5BH 1SJHB 4MAYA 3ALWA 3QXTA 3LAFA 4JREB 4L9DA 4PBWD 3ZKSD 4KVNH 4OFVA 4DN4H 1II4E 1YNLL 1OM3L 4HGMA 1K6QH 1KGCE 2IBZX 5CGYC 4X7FC 5DJAB 2AW2A 4BQ9A 5H94B 4PG2A 1GH7A 5B39B 1NGWA 4WUUB 4AIOA 1N26A 4NBZB 3IJHB 3MV7D 1J1PH 4X6EA 4Y2OA 4CN4A 2CDGA 5J6GA 3DVFA 1JPSH 2F5AH 2FHFA 6CGTA 3LEYH 4Z18A 3UYOD 1HSBB 2OBGA 3QCVL 1GXEA 2ZZUT 4H5SB 1KTLB 5CIPB 1X9QA 3MR9B 2BHUA 4YHKL 1KIQB 1XT5A 5HSFA 4KXZI 5KVEL 4LMQI 1Q38A 3THML 4I3GA 4L4JA 1HIML 4HFWB 5I1DA 5HHPB 3OJDB 3BVNB 2R1XB 3HZYB 1G7LB 3UTSD 4BFBD 4JY4B 1PZUB 4LDEB 5EWIH 4YZFF 1FE8L 3RKDC 3L5HA 1A7OL 2HTKD 5I6XC 1T4KA 3MRGA 4MNQB 5AYUL 5FGBA 4P2RA 3T3PF 5CCKL 2OZ4A 1ORQB 5DD3L 2HTLD 4GKNB 1HXYB 12E8H 1R3JB 2N4IA 1K5NA 3WFEH 5EPMA 2VC2H 5AZ2L 4F7MA 4U1LA 1JNNH 1EEYA 3OGCB 5IROA 3BPCA 1AXSA 5FDYA 3VWKC 3TH2T 5I1CH 4F58H 3H42L 2NY4B 2R23B 5CGMA 5T3ZL 1OPGH 3HC0B 3VGEA 1OTSD 1A5FL 4G8GD 2HTKC 3IAPA 3WNLA 5C0AB 3LRSA 3RWGA 5CJQL 1BM3H 1HH6A 4NZUH 2J2ZA 1DANT 4ALAL 1CIDA 3NABL 4HIXH 3U36A 2HTLC 4JN1L 1MY5A 3MSPA 2ADGB 4RMTA 4QO1A 3LN9A 3PJSB 3QPXH 4QRPB 3V8CA 1D5IL 3X13A 1LK2B 3WHXB 4G9FB 1FFOA 4UU9B 5E8OB 5GGUA 3ARFC 2HT3D 5TDOA 3T65A 5C0CD 1AI1L 1FNFA 1O7VA 3QQ4A 2ZSWB 3BD5A 5DZOA 5D96C 1QVOB 3C5ZA 4ORGA 2F74A 1X5XA 5FUCC 4NWUL 1N6QH 1ZANL 3PXHA 5CINH 1AQDB 1A1MB 2VITB 5IB3A 1HE7A 2EE2A 2Z93A 2AQ2A 2IQ9H 1T89A 2VDLH 3EOBA 4X4ZA 5D6DC 4D94A 2LU4A 2NY1D 4UZGA 2B4CH 1Q1JL 1TITA 2LVCA 3WJJC 3D85D 1RULL 3GI9L 1IRAY 1RUAL 1IAKA 2XKUA 3B6SB 2AXFB 3Q6FB 2YK1H 1IC4L 5HHMD 1ZHKA 2HKFH 3Q6GH 1QTYT 2F8VA 5HVHC 5JOPE 4KI5D 1KIPA 3OQ3B 1UWGL 4CMHB 1JWUB 5AD0B 1IT9L 4ONHB 4TVPD 4RZCA 1QFWL 2L7UA 4HUUA 4QXTA 4JANB 2NY1C 2N56A 3MJ7A 4ZPVB 5D93B 2HMID 4GAYB 4KPHL 5AAMA 4EXPX 3I02B 3V6OE 2RGSA 3DXAA 5E0QA 3RWFB 1VFBA 3L3KB 4KI5C 3BMVA 3VGDA 5I8EB 3IDXH 5EIQA 4JR9L 4XX1G 1DE4B 2ADJB 5EO0B 5DUML 1UEYA 4PRBB 1HQ4A 5DRZA 3MOBH 4LBEB 5FO8B 4F2MB 5EZOH 3VGHA 4GMSH 3Q5TA 1UM5H 2HMIC 5AYQA 1Y18B 4MJ5A 4LRNH 4FOMA 2PTTB 3VFWA 1HILB 5EZJA 1P69B 4N5EC 1FCGA 4FXLA 5CBEA 2YUVA 1X4XA 1MHEA 1F11A 1B0GB 2GT9B 2DKSA 1YPZB 3JWOH 4G43A 4ERSL 4NQSB 4K94H 2EIEA 2CQVA 4PRHB 3ARXA 3T0XA 1UADC 2AK1L 1WT5C 4XH2B 3SCMC 1AD0B 3B8SA 4XAKD 3RUGE 1JGDB 2P8LA 1CFQB 4HF5L 4MQSB 2JCCA 3T3MF 1GGBH 3NCJH 3SBWC 2XQBH 4PJGA 4XHJD 3TIDB 4HPOL 3IKCB 3QIBB 2Q7YA 2V5YA 3FO1B 2I25N 4F3FB 4HG4J 1H0DB 1JPST 4IRSB 4OSUH 3A6CH 1XGRA 4PPTA 1UWEL 4FQ2H 4I18C 4GFTB 4MJ4A 1QSEB 1AXIB 2MKLC 5IR1A 4G3YL 1MCQA 2BNQD 4P5TD 2IFFL 1KYOK 4XVTH 4TSBH 5K93A 2MMXA 1MELA 3ARBD 3CVHL 5FHBH 1I9IH 3O6FD 3MO1B 3SGEH 1PKQE 1KB5A 1KCVH 4W68A 4PJ9B 4YQXH 3WFCL 1JBJA 1KJ3L 1KUMA 4GBXB 3KPRA 4L3EB 5D7JA 4WTWA 3CMOL 2ORBH 3NIDE 5ID1B 4MJID 1T5XA 3LQMA 2AJZB 3I9GH 4PJFE 4BZ2L 3KDMB 3PWPD 5JHDE 2WW8A 4KJWD 2N1KA 3T08A 3MBEA 4P5TC 1I3GL 3G5YB 2I5YL 5EOTB 1OD9A 3VCLB 4L8CA 4JRXB 4QHKI 2HAZA 3ARBC 2YWYA 3BHBB 3O6FC 4NM4H 5LQBH 5IW1B 3A0OA 3BD3A 4FQCL 1G7IA 1AFVH 1MOEA 5E6ID 4UAOC 1G7PB 4M43H 2GCYB 4LASL 3IETA 3JBG7 1GRWA 5DI8A 3MXWH 5KZCD 3BIAX 3WO4B 4AJ0A 4GXVL 1RZGB 4ZDHA 4WU7B 1BJ1J 4KJWC 1A1OA 2EXWC 2GY7B 2AI0H 4R7NA 1WV7T 1YJDC 3DVGB 1YEGL 3FRPA 3L3DB 4OLUL 2DTMH 1NFDF 3O2DH 3VWJC 4L4VE 2LAGB 1ND0B 1W0VB 5C0BE 1BVKA 3F7RA 3HMWL 5E6IC 5FECA 1Q0XL 2GSGB 4KK5C 3MV8E 2CSPA 4NNYA 1KTDA 4D0BB 3NZ8A 4OQ1A 3P77B 4R7DA 4JAMB 5IMMA 4Q2ZA 4XPBL 3PWVA 2PW2B 2PYEE 2R69H 4ZFZA 4O2CA 1RZ8B 2FYYA 3MCKA 5CMAB 2CIIB 1OW0A 4G5ZH 4K3EH 5FM5M 4Z7VE 1KB9K 2B0SL 5I16B 1VFUA 3FT4B 1JYVA 4OD3H 3MRRA 4LCWB 3LN5B 4HQQL 4F33A 2D7PA 1Y6KR 4HGKC 3CZFB 4LARL 3UTTB 5CSZB 3WNOA 5ITFB 5KSUA 4L1DA 3SDXB 4QHMB 3V6ZA 4HXAH 4GAJH 5CD3B 3L3GB 3HS0B 4ZAKD 4ETQA 4NC0B 2NXYB 3O41A 2HFFB 1YEEL 3H3KA 1LK3L 1KT2B 5T1MA 3RWEB 5BOZG 3WE6B 3MRQA 4OZHE 5LCVH 4Z78A 2E7LC 1E4JA 1IC7L 2IALA 5CILL 2ZUTA 4XMLL 1QO3B 3KPOB 4LGRB 3EO1B 4PLKD 1BD2E 1I7TA 1N5AB 1A0QH 5D8JH 3JWDC 5AWNL 4PB0H 4W6WB 3LPGA 2PXYA 4XRCB 4HK3N 4X98B 1JIBA 5E4EB 3X3GL 3MBXL 1NEZB 4ZAKC 2QKIB 3GJFB 4X83A 3FB5A 1UZ8B 1T1ZB 2P5EA 4NQCA 4OM1L 1R3LA 2IJ0C 3E1F1 4PJAA 4OIAA 1ZT4A 3TP4A 4PLKC 2ZCLH 4NIKB 5FKAA 4U33A 1MRDL 1ORSB 2IBBA 2EYTB 3BKJL 3RZCA 1DLFH 1WZ1L 2KUTA 2VAAB 4XPGH 4FXGB 4Z95L 2C3VB 3BKML 1EERB 4X9GA 1O5DT 4RFEA 1P7QA 4Z7WA 3VFOA 2UYLA 2LTQC 5D72L 4LSQL 4MWFA 1XIWB 4A6YA 1X5KA 1JN6A 1YEKH 2OJEA 2FJFA 2YPKB 1WZMA 2OXGA 1AR1C 4L8SC 1KJMA 1PQZA 2UUDK 1Z5LA 1T1XB 5C0DA 4NZTL 1NJ9A 4KFZC 5D2NC 3ARDA 1RIHL 1S7SA 1KIUA 2BY0A 1DEEB 2R0LL 4FQ1H 2Q87A 2IGFH 5ESQB 1I3RA 4YHNA 1MRCH 3WFBL 4L8DB 3FFCD 1WWWX 5L2KD 5TQ2L 1ZMYA 4KQ4H 4PJ8A 4P2QD 5BS0D 4UB0H 3P2TA 3PG2A 5BVPH 4HT1L 4TRPH 5DHVH 1G6RL 4NKIL 4X5WA 3GSNL 5LAXA 3KYNB 4ZPTA 3EYUH 1U58A 1A2YA 4WFHD 5IG7A 2D7NA 3VDAA 2VNCA 3V6BR 3MLTB 5HDBF 2VXTL 3VXSD 3SGEI 5K9OB 3NCFB 2YD2A 2VUYA 4U1GC 4Q7DA 5FDWB 5DVNA 3G9VA 5GRJL 2V2TA 4DVBA 1FC2D 3CVHB 3VXRB 4Y5VC 2PTVA 3TO2B 2MJWA 5DC4B 4HPYH 1N5YH 2X42A 1AC0A 3S88L 3RGVB 2NX5E 4TOYL 5DK3A 2EDQA 2HJKB 5I73B 2B1AL 4LIQL 4C83A 3ZYJA 1S9KC 3UYRH 1WITA 1N0LA 4UT6L 3KPLB 3WMSA 1LDPL 1ZGLA 1ZVSA 5KSBA 2D2OA 4JHWL 4NQXA 1LE5B 1XF4B 1MCEA 2PKDA 2G60H 4GJTB 2ZG2A 2DLHA 3MMEA 3BH9A 3UBXI 5IM7B 5GS3A 2FIKA 4OV5A 2F8OA 2X41A 2OI9C 2FSEB 4H1LH 2VQ1B 3VFNA 3VDCA 1P2CB 3RL2B 4BH8A 5CGTA 2Z31A 3VG0L 1GOGA 4KHXL 4LU5L 4AEHH 3BWAA 3PWNA 4JO2L 4YDIH 4ZXBD 1QZ1A 3IDNA 2X4RA 1S7WA 2VXUH 2EH7L 3U9PH 4F9LC 4JGUA 3I6LE 3S35H 1UENA 3CMGA 2CO6B 1MSPA 5EC2A 2I24N 5C9JA 2OTWA 5DQ9B 3S36H 1T3FA 5I30H 5EOCL 4OFPA 3S5LB 1T21A 3BE1L 2R1YA 1JWSB 3MV9D 4J3VA 4P57A 2XPGA 4PUBH 3NAAL 4H8WH 4ZXBC 2VDKH 1AD9B 2APBA 5CJXA 2VN7A 1UH2A 1SJHA 1F90H 3UDWC 4KMTH 1WK0A 4DOHE 1EK3A 2APVA 1UYWH 3QUZC 2UUDH 3KNBA 1DQDL 3AB0C 3OKOB 3P11H 5HGHA 3HLAA 3DYMA 5DK2B 4ODTH 1IAIM 2IWGA 1R0AH 5H94A 2IBZY 4U3XA 5B39A 2XYCA 5ALBL 1X4YA 3IJHA 1RMFH 2ADIB 3QEUB 1FNSL 3KPSB 1HSBA 4KH2A 4Y16B 4J3OC 5INDB 2R8SL 1KTLA 4DTGL 5CIPA 3D2UD 3MR9A 1KIQA 4PYGA 1ZSDB 4HFWA 3HNSH 5HHPA 3OJDA 4JM4H 1WIOA 2BRRL 3BVNA 1KEMH 2R1XA 3HHRB 3HZYA 1G7LA 1B0WA 1Z2KA 4JY4A 1KNOB 1OOAA 1KJVB 4GW5B 3REWB 3SE3A 1HNGA 2VLJD 2DQCL 2DICA 3B9AA 3DVNB 1IKNC 5CP3A 3FB7A 4MNQA 3QHZL 3GBML 1ORQA 1RURL 2VO5A 4GKNA 1HXYA 3T2OA 2YKLL 1R3JA 5DJ8B 4CKVX 3UPRB 4LP5A 1DZBA 3GRWL 4ODSH 5BMFL 1SBBA 3OGCA 2YSSB 1E6JH 3BAEL 3GIZL 2R23A 3JVGA 3HC0A 1CN4A 1XF2B 5IVZB 4ZFGL 2HP4A 5ADOH 3PL6B 3EDEA 2X4NB 4LQFH 4PB9L 3ZO0A 2DQFB 2EDFA 5C0RH 4QRPA 3QNXB 2EDLA 1LK2A 4PIRF 3WHXA 4G9FA 4UU9A 1X5HA 1GC1H 3AY4C 5I15L 4N8CH 2ZSWA 5F7NC 3WIHL 1QVOA 3SDAD 2ZOLB 3VG9B 4YDVB 4X7SL 1AQDA 1A1MA 3RWDB 2E27L 2VB5A 3DARA 5DGQA 2BERA 2IQAB 2OTUB 5SWSB 2JK5B 4FZEH 5E03A 1QHOA 4YXLH 5IGXH 5ALCL 4JFXB 3QA3B 5EU7C 5C6PB 3LH2L 3B6SA 2AXFA 3Q6FA 3BESR 3OSKA 4MHHI 3SDAC 4GSDH 4XCCL 1XCQB 3IFLL 1A3RH 4ODXB 4WGWB 5E1AB 4JFDD 5EU6B 1KBGH 1JWUA 5AD0A 1FG2B 3DYPA 3VMPA 5F88B 5I1EH 4JGMA 5FYLL 1AY1H 4LSTL 4POZC 5EH1A 1XF3B 3WFDL 4RX4A 4JANA 5FUCE 1A6ZB 5K59F 1W8OA 3LD8C 1NFDB 3K1KC 3RVWD 4GAYA 5GGSY 3MOAL 3I02A 3MUJA 3EJZD 1U2HA 4XNXL 5GS0H 2D9QB 1H3TA 3RWFA 3L3KA 3U79A 2X40A 5I8EA 1KFAH 1DE4A 3QUMH 4TNVK 5JIPA 5D7LD 5EO0A 2XWJB 4M48H 4PRBA 1YNKL 4OGXH 3V7AG 2HFGH 4LBEA 5T1LD 5FO8A 4WEBH 2ZWLT 3RVWC 1DVFD 3WJLA 1Y18A 1JYNA 4RFOH 3EJZC 1K3IA 5GGVY 1GYAA 1BFTA 2PTTA 5K33A 3NFPA 1HILA 3T77B 1A7RL 5EUKB 3TN0D 2J6EL 4NN7B 3N1MC 1CXIA 2XZAL 4YEFA 3VMNA 4BSWB 2UV3A 2GT9A 1BZ9B 1YPZA 2A74A 4JO3H 4NQSA 2V2XB 15C8L 4PRHA 3V6FB 3M17B 5F9WC 2VL4A 4XH2A 1DVFC 1JGDA 3GKWH 1CFQA 3SQOL 5C07E 1KXTB 1V3JA 1S7QB 2NY0D 2F19L 3TIDA 3IKCA 3QIBA 2WUCH 3FO1A 4HCRL 4L4TD 1G9MC 4BYHA 4EEEA 3FRPG 2OM5A 4F3FA 5CJ5A 1H0DA 4IRSA 2FX7L 1GIGL 4HS3B 5TPWL 3BRGC 2CKBL 1QSEA 4R3SB 1KC5H 5JHLL 4LSUL 3AGVA 2RIKA 3RTQD 3O4OB 2XN9D 3DPBA 4E41B 2Q86B 3MO1A 4PG2C 4PJ9A 2UZIL 1G0DA 3NPSB 3KYKL 2NY0C 3HE6D 3IXTA 3TGXA 4L3EA 4RNRB 1CE1H 1YEIH 1K4DB 2M8XA 2AJZA 4NWTL 1RZKC 3KDMA 1PX4A 1KSRA 3QH3B 1MJJB 4W4OA 2YD6A 4GMTL 2FJHA 1FBIH 1HHKB 3G5YA 5EOTA 3VCLA 1OT2A 3VXME 4JRXA 1F13A 2OJZH 3PQYE 4LPCA 3LKQB 2FH6A 3SGKA 5IW1A 3ESUF 1GGYA 1WIUA 5EN2A 1LO0H 1G7PA 5CUSH 3HE6C 3NTCH 4Y1AB 2GCYA 5JOFB 2XTJD 3ZE1F 3NCYS 2CK2A 4KGLA 1RJCA 1ROWA 2HRLA 3QDMA 4WU7A 5FGBC 1U3HB 3DO7B 4MGXA 1BEYH 1VA9A 3DVGA 3HAEB 4L5FL 3L3DA 1MCJA 1J12A 2VKXA 4ZTPH 1T03L 5CEZL 2C3XA 1W0VA 4Z7NE 1VHPA 4U31A 2NR6D 4RSVA 1T83A 5GS1B 2GSGA 3PXJA 5HYJE 4ZD3H 2XTJC 4I77H 4D0BA 1C5CH 4PLJC 4EUPB 1KCLA 4HD9A 4YHKH 1RHHB 4NT6B 5HHOB 5KVEH 2JB6B 3V9FA 1W8NA 4JDTH 3V4UH 1HIMH 2JE8A 2PW2A 1U3JA 1NPUA 1RZ8A 3DV4B 5FYKH 1IC5L 1MJ7H 2CIIA 2X09A 4RGND 1DFBH 3ZDZF 2NR6C 5I16A 3FT4A 4E0RA 4LCWA 3LN5A 4FQLH 4OLYL 5IVNA 1QP1A 4OAWB 3UTTA 2A6DB 3CZFA 4J3SA 1EJOL 5CSZA 2ESVD 5LBSL 5ITFA 1T89C 4KKNA 5CCKH 1HKLH 1J1OH 4FQIL 3SDXA 4QHMA 1RUPL 1TJGL 4R2GD 1CICB 5FUZL 5CD3A 1NMBL 3ARZA 1OSPH 1ZAGA 3D48R 1B88A 1DBAL 3HS0A 1L7IH 3RWEA 2HFFA 3H42H 4M7LH 1KT2A 4RGNC 3WE6A 1T20B 1DBMH 5I17B 5I75B 1IEAB 1A5FH 4E42B 1QO3A 1CBVL 3KPOA 4OF6A 3SEPA 3EO1A 1JGVL 5C92A 1IEBB 1N5AA 3NABH 3HCVB 4R2GC 3U4AA 1TJHL 4XRCA 5T3XL 4X98A 2XQYK 1R3HB 3CLFL 1JZ8A 1K8DB 1NEZA 2NXZD 3F6LA 5E08H 1X5GA 2WIIB 5FOJA 2GTWA 3QNYB 4X4MA 3GJFA 3F58L 1UZ8A 1T1ZA 1ZANH 1FAIL 1YN6B 1YDPB 3H9HB 4XGZB 4JFFA 5ITBL 4I4WB 2Q3AA 1ORSA 1CGTA 2EYTA 5ENWB 1W72L 4APQD 1CG9B 1NC4D 1AH1A 2VAAA 2FH8A 1UGNA 2CH8A 4FXGA 2C3VA 4FQJH 1KTRL 1RUAH 2XZQL 4Y88A 4N0YH 5D6CB 1TCRB 4W81A 2AK4B 1IC4H 1MREL 2NXZC 1EHNA 3FFDB 3ZLQC 2L7JA 3WIIL 4OCWL 1CLZH 3TNMB 3L5WB 2YD9A 1XIWA 1EEUA 4X99A 3WKMH 4YFLI 1EHLL 1FL6B 4ODVL 4U6VL 1IT9H 3D3VE 2Z35B 2VKWA 1CQYA 1AO7B 2NY3D 3E2HB 4J7RA 1I3UA 3RL1A 3BN9D 5SV4A 3GNML 3LEVL 2OQJB 2OCFD 2QQNH 4WUKL 4KPHH 2B39A 1A21A 4GG6A 1DEEA 5HXMA 1OD7A 2ITCA 5ESQA 4Y0GA 1TENA 1R5WA 1FIGL 3IDGB 5D70H 3KPRD 5GZOD 5K9JH 4N0FB 2I9TB 3FQTB 4LCCB 4NOBA 2WBJB 4XNUL 1EO7A 1ERNA 4LHQB 2KH2B 3BDXA 1MLBB 5MP6L 2NY3C 3FT2B 4YHIB 2NY2B 3BJLA 4PRIB 1PSKL 2HVJB 3BN9C 3PHOB 2AQ3A 3GM8A 4KUCF 2AJXH 3MLTA 5E56A 2CKBB 5DD6B 4M3KB 1PX3A 1DANU 5FDWA 4JM2D 1PG7H 1Q9WB 5GZOC 5D7SH 3P4MB 3CVHA 5D7JC 3VXRA 1U8KB 1MPAL 4JGJA 4WEMB 4MLSA 5D2NE 3D5OF 2C26A 2HJKA 4FNLL 1SJEB 5D1XB 2DIJA 1CL7H 1IAOB 1F4WH 2PO6D 3MBEC 1CU4L 3NMEA 4F80A 3KPLA 2AK1H 2FBOJ 1WFNA 1N6UA 1MVUB 2GJ6B 4HF5H 1ZVHA 1LE5A 1XF4A 4JM2C 1BP3B 3QT2A 1WFUA 3PGFH 3LY6A 3FN0H 1MUJB 1EZVX 5B39G 2P8PB 2Z91B 4XX1E 5HPMB 4JY5L 2FSEA 2F58L 2IFFH 2VQ1A 4OCLC 3HRPA 2Y9RT 3RL2A 2FR4B 1A7PH 5DHXB 2GKIA 5H2BB 5KOVC 5JIIA 3V0VB 4P2QE 2HVKB 2I60L 4GXUN 3VW3L 2AP2A 1QFOA 4Z5RB 4DCQA 1EHAA 1HHGB 1QLFB 1JZ2A 3GSQB 2D0HA 5DQ9A 4BZ2H 1EH9A 4U4BA 1FVCB 5HHXL 1MHCB 1ADQL 2I5YH 1OAQH 3RGHA 3S5LA 3JV4B 3W9DB 4I48B 3WFZA 1UXSB 3BQUD 3MXVL 1JWSA 2LAAA 5FCUL 5HGGS 4HXBL 3J7HA 4OUUB 1OW0C 1YYLL 2XY1A 5DWUH 3BP6A 1OWRM 4FQCH 3U1SL 1MH5B 2BC4B 4ZQKA 1MFDH 1YEJL 2YUXA 1KXQE 1I1AD 4DJMA 3ULVL 2V9QA 4GXVH 4HS8L 5GGVL 3OKOA 4P2CG 3F12B 5DK2A 3VFVA 3M1BB 4PJIE 4OLUH 1C7SA 5IWLA 1BQUA 2Z92B 4M93B 2BVPB 2ADIA 2E7CA 3QEUA 1RHFA 3G5ZB 3HMWH 3KPSA 1E4WL 3NFSL 4OIIL 3KLAB 4NQCD 1SJXA 2DQHL 1BQLH 2ENYA 1KCUL 1I1AC 5INDA 4MNGB 5A43C 1I9RH 3B5HA 4LAJH 4QRQB 3SY0B 3KR3H 3U9UB 1ZSDA 2AERT 4M61B 1P7QD 3CFBB 3MUY1 4XB8A 4OQTH 3T0WA 3TPUB 2OYPA 1KNOA 3PNWB 4C56D 4X8XA 1KJVA 2F5BL 4GW5A 3REWA 1FLTX 3D39B 3QCUH 3ZL4L 3CXDL 5GHWL 3DVNA 3LV3B 4G7YL 2EE3A 4RAVB 4XBGB 4XPHL 1K85A 5DJ8A 4QRRB 3RNKA 2KQNA 1W72B 2W91A 2YSSA 3VH8B 5JXAH 5GRXG 1IC7H 4JKLA 5CILH 5J12B 4S1RL 1XF2A 5IVZA 3IDYB 3N1FC 2ENSA 2HFEB 5FO7B 4PJ8D 3PL6A 4KGJA 3SJVD 5D5MF 2R2HB 5AWNH 2X4NA 2DQFA 2QADC 1NAML 5HYQB 5ANMB 5ICXB 3O11B 3SN6N 3MBXH 1T1YB 2X4TB 3WSQH 3CX5K 3ZHDA 5TFSH 4NCC2 4W70A 1QPPA 3TJHD 1KXVC 4YDVA 1IQWL 5F6HJ 3RWDA 2D03L 4NNXA 3ULUF 4JKKA 4EJ1C 2IQAA 2OTUA 1MRDH 2JK5A 4PJ8C 2R29L 5SWSA 2YRLA 3BKJH 1BLNB 4JFXA 1WZ1H