2DTSA

Crystal structure of the defucosylated fc fragment from human immunoglobulin g1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
211
structure length
211
Chain Sequence
LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Structural comparison of fucosylated and nonfucosylated fc fragments of human immunoglobulin g1
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dtsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dtsA01
5F7NC 3BVNA 4OGXL 5C7XL 4OAWA 3RWJA 3CK0L 1AP2A 3BXNA 3TVMD 5HHXH 1FL3B 4AIXA 3K1KC 1YUHA 3HE7C 2ZUTA 2GSIB 2NNAB 4C4KO 3MA9L 5D1ZC 1MELA 1PLGL 5JOFB 1DUZA 3VI4F 3EIFA 4JY5H 4HV8A 4X7TA 5T3ZL 2LAAA 2AABL 2IG2L 1I7TB 4P2OD 3QIUD 3BZEB 2JELL 1XF5A 3WHE0 1OQXA 5D2NE 4LLDB 5HYFA 2J4WH 2HTLC 1MCNA 5BQ7A 5LGJB 5D7IA 2C26A 5L7XL 2IPTH 4IRSC 3FRUB 5DQDH 4HHAA 5E56A 2VH5L 5JPNB 4MHHG 2CMRH 2ADGA 3CDGA 1JZ2A 2DM2A 3S5LG 3MUGB 2AXGB 2Y23A 4P5TD 1DLHB 3ZE2E 1UVQA 3C87A 4FXLA 4U1MB 5KSUA 4P2QA 1SJHB 4RX4D 5JXED 5E95B 4ZDHB 2FEDC 2JJWA 4KZDL 2G75A 1HQRB 4Z0BL 2ZNWA 4YHNA 3MLTA 1WFTA 2Y1VA 5E9DB 1GVIA 4KTDH 4JREB 4YFDB 5DJXA 2KQNA 1MWAH 4GXUM 4N0CD 2H2PC 2PXYB 3MRGB 3QQ9D 4M7KH 3QDGA 1VADB 3G6JB 3GMOB 5INCB 4U6XA 1NCTA 3KXFE 4CGTA 4I18B 3VXRA 5C70A 4UOJA 3WLBB 5DDHA 4GRLD 3IDYC 1A5FH 1RZKH 2DBLH 1U42A 1UZ8B 4D9QE 1N6QL 3HMWL 1E28B 2J7LA 1I9JH 4OFIA 1NANI 1LD9A 5L2JA 4JO3H 5HGDA 5F7HA 4XT1C 1S7WA 2NY2D 2VQUA 1U3HD 3LRHA 4FQ1L 4KJPD 4D9QD 1B3JA 4ZXBC 5HDLA 2ADFL 4NT6A 2Y6SC 1GC1C 5C0BA 1IC4L 4EZMA 4JVWA 4AY0A 4XBGA 3MRLA 2O5XH 1CFNA 2ZZUT 3BP7B 3ARXA 5IEHA 2UVFA 1VHPA 5DJYA 4QRRA 1AD9B 2ED8A 4PGDB 1EAPA 5SWSB 2VWEE 4S0SD 5T1LA 2Z92A 4FXGA 3U0PB 3QNYA 3JBG7 2ZPKH 4PJHE 5EZJA 4M7ZB 2FYYA 3RGHA 4H20H 4BJLA 2X4PA 1M7XA 2JJSA 5KVDL 4ZPTA 1BD2E 3UC0L 4FQLL 3B2VL 3MLSH 3A6OA 2GTZA 3O3EB 1LO3L 3MV11 5LBSL 1RMFL 1KYOK 1HH9A 4Z7VE 2Q8AL 2VDPH 5DT1H 2JJVA 1TCRB 4XWOC 4RIRA 1II4E 3QXWA 1PKQA 2JKXA 3S37X 3FZUD 1AI1L 1B4JL 4U6TA 5JLZB 1BD2D 3DO3A 2XNAA 5I8KH 1XCTA 3GIVA 5D72L 4JREC 3MJ7B 5EDXA 3D85D 4JQIH 4MS8D 5J4MA 1FN4B 1TQCB 2PXYC 4OV5A 4Z7NE 4HH9B 3VXUE 4OZIF 4AQOA 3RKDC 3WHE1 4OCNC 5MHSE 4ZS7H 1NC2A 2J6EL 1EXUA 3KPMB 2GITA 2Y36H 1MWAB 4FA8A 1QSZA 4KDTC 4V1DB 3VRJB 3EYSL 1NGPH 5JPMB 5D7LD 5DMYA 4OZ4B 4WUKH 3TJEL 5HXMA 2XQYK 1RUAH 5MERB 3VXUD 3X11B 2OR9L 4G6FB 4R96A 3H3PL 1YJDL 1U95A 4FQHA 4MXWH 5SX5K 3RBGA 5L9DL 4P3CH 4U6VL 4YUEH 4PREA 5EN2A 2Z4QB 1OAYH 5F7DA 5B8CB 5I1JH 4ISVB 3MNVA 1L7TL 4Y1AB 2E7MA 1MCJA 1NL0L 3O4LB 4QOKD 3ZKQD 3FT4A 4WUUE 4P3WA 2ADJA 3QI9A 1F90L 5D4QA 2ZKHH 1IEBA 5JW4M 3KJ6L 4EEEA 5I1KH 1S3KH 4YBQC 5SWZA 4YDVA 4DKDC 5K93A 1FG9C 4I5BB 2AJUH 4WUUD 3L3DA 4DUXA 3GK8L 3BQUA 4M7ZC 3WO4B 4XP1L 1RZIA 3F58H 5FOJA 4NOFA 5HY9A 3ZTJH 3KAAA 3LKQB 2D7TL 1RJLA 5ESVB 4F9LA 4N90E 7FABL 4ZSOB 1K85A 5D5MA 3UBXA 2R2EB 2B2XH 1T0NA 5D6CA 4RMUA 3NAAL 2BHUA 3BZFA 4OLYH 3RVVC 1TXKA 3HZVA 4WHCA 3VFSB 1XGUB 1K5NA 4M5YL 1EK3A 4UZGA 1Q0YH 3P4OA 4LHQB 3IU3A 2ZUSA 1HNGA 4HCRA 2HKHH 4NYLB 1YY9C 1PZ5A 2R4RL 1U93B 4Z7WA 4N90D 2EIEA 4ODVL 3OR6A 4BFBD 4U3CA 2CRIA 5T1KA 4S1DC 5KANI 3RIFF 4GKSB 5DD6B 3QFJB 5DRXB 5LJYH 3TNNB 5I17B 3H7LA 4CVXA 4ORGA 3KGRA 5IIEA 3OKMA 4FTVB 5C09D 5DK2A 1OY3B 4OLUH 3FQWA 1OB1A 3AS1A 3ZTNL 4D9LH 4MA3A 4P3DA 3IJSA 3WJLC 3DYPA 5I1HL 1RZJC 4DGYL 1LE5B 1VFBA 3BO8A 1TIUA 3U9PH 1N4XL 3UXFA 5KS9B 5IEKB 4XXCA 1RZKC 3TBSA 2Z35B 3MX0A 4I0PC 5CJOH 4PG2A 5KTEH 4DAGL 2IWGA 2IBBA 1RFDH 3BVNB 4OAWB 3RWJB 5CD3A 5D7JD 4JHZA 3CCHA 1AP2B 3BXNB 1CD1A 1VCAA 4YX2H 3VA2C 2VXVL 1PEWA 1YUHB 3I6LE 5KN5B 2NTFB 4I77L 5FGSA 4PYHA 1JGDA 1JWMA 4OZFH 1IQWH 3WO4C 4K94H 1CD0A 4HV8B 2YXMA 4X7TB 3MMEA 3QUZA 2IH1A 5FUOH 3C2SA 5IMKA 3SE8L 1RHHA 3I6KA 2XZQL 5B4MC 4Z8FH 5T5FL 3D6GA 1AO7E 4IRZH 1NC4D 4XC1H 4WY7L 3ARED 4S10A 2PYFA 5BQ7B 5D7IB 3KYMA 1I8IA 3NIFE 1MVUA 1X44A 2DI7A 3GO1H 5E5MA 3BDYL 1VA9A 4MB4A 1SJVA 4HHAB 4OGXH 4YAQA 2ADGB 3CDGB 1FO0B 1EBAA 3MOBH 1AO7D 3KLSA 2BJML 4I13B 2L0DA 4E42B 4Y1AE 1UVQB 5EC2B 5KSUB 1D9KA 2AEPL 4P2QB 3E0GA 1UYWH 1KTLB 2EE2A 2EXYD 4XAKE 4KUZH 2G75B 3HLAA 3MLTB 4POYA 1JRHL 5T3ZH 3T0WA 5IFAH 3HS0A 2A2QT 1KELL 2AABH 4P4KD 2NXZC 4JO4L 4NRYA 2JELH 5JORA 4DN3H 5DJXB 5I75C 1MQKH 1ZAGA 4F7MA 4MX7B 5EU5A 3WV0A 3HNSH 5FEBA 1NQBA 3MODL 4XVTL 4U6XB 2W60A 4XAKD 3P40A 1JPGA 3S37L 1NGQL 1NBQA 4GKZB 3OAUH 3VXRB 1NLBL 2YD1A 1P9MC 4JZOA 3PHOA 5DDHB 4NDMA 4OM0L 3ME0A 5E8EA 4Y89A 4ZSOE 3MBED 1LD9B 5L2JB 4U05A 5HGDB 2ZUVA 5GS0C 4NQXA 1Z9OA 4Z0BH 2EDOA 1RI8A 4Z7WF 5GS1B 1S7WB 1SY6L 3TPKA 2VAJA 1FORH 3LRGA 4G6JH 4KRPB 2NZIA 4I2XA 4PJDE 1DANU 4AT6B 4NT6B 4JJ5A 5B3JF 5HGAA 2VRAA 4V2BA 4M8VA 5E2UH 5CGYC 3MRLB 1CFNB 4UB0H 1DVFC 1FQ9C 1BM3L 4EI5A 4JRWA 5IEHB 4JKLA 2NXYD 5DJYB 4QRRB 4YO0B 3EOAA 1EAPB 3O2DH 4AEFA 2P48B 5CAYB 5TPWL 5T1LB 2Z92B 4FXGB 3QNYB 5GISL 3HMWH 2FYYB 3IS0X 4ZPTB 5CJQL 3O81A 5C92A 5CJ8A 3OKEA 2GTZB 1F3DJ 5KS9E 1HH9B 4M7LT 5F1NA 4HCRH 4RIRB 2PYEA 4FQ1H 1PKQB 5EZIH 4MYWB 3PG2A 3FN3A 2GCYA 3MV01 5CEXB 2XNAB 12E8H 4C59B 3GIVB 2Z31D 3DI3B 4QXTA 2EEAA 3IF1A 2F8OA 4YBLC 4OV5B 1BIIA 1A6UL 3OQ3B 1HSAB 3M8OL 1NC2B 1EXUB 5AZEL 3BZ4A 4I1NB 2GITB 5J1TC 1H15A 4JM4H 1PG7H 4GMTL 4ELKB 4K3EL 5GZND 4PJCF 3IB4A 1MI5D 4OLVL 4JFEA 3VRLE 1CXEA 1BAFH 2A74B 2BFVL 3ZL4L 4N0RA 5HYQB 4R7NA 3QZWG 4R96B 5TE7L 4EKXA 5CD5D 2H2SD 3X14A 4FQHB 4PREB 5EN2B 1U8JA 1J8HD 2CUMA 3ABZA 5F7DB 5D72H 3O6LL 3MNVB 4KRPC 4K9EL 3FT4B 1S7TB 4HUWA 2ADJB 3BIKA 3QI9B 2GTWA 4OZGE 3TCLA 1TVDA 4WFEE 1UXWB 3KJ4B 3VFMA 4GG8A 4RAHA 5SWZB 4YDVB 3EYSH 2CLVA 3GJFK 2VLKA 5HD8D 5TJWK 1UKTA 3L3DB 4K94C 2XTJD 3BQUB 3AFLA 3ZSSA 4PUBH 1RZIB 1JCKA 2XOTA 4E41D 3BKYH 1L0QA 2MFNA 3H3PH 1YJDH 4WFED 4PV9B 2Y7QA 2FJFA 1RJLB 1HH6A 4MJIA 3LPWA 1MHPH 5J06A 1L7TH 2E6QA 5FB8A 2DWEA 2DL2A 5D5MB 3UBXB 4ELME 5BVJA 1T0NB 3GZKA 1REIA 3NA9L 5D6CB 3T0BA 3BZFB 3P30H 3HZVB 5ACLA 1K5NB 2DTSA 1F90H 2Q8BH 4YHIB 3ARQA 2NTSP 1CBVL 3P4OB 3QEQA 3RA7L 3IU3B 4EDWL 3KJ6H 4RDQG 2WLYA 4L8BA 3RZCD 3BKCH 3F7VA 2OR8A 1GH7A 2IAMC 4Z7WB 1B4RA 2CRYA 1WIUA 3OR6B 1NEUA 3BEVA 4Z95H 5T1KB 3QUXA 4YDJA 3JV6B 5E4EB 4LQ1A 4MDJA 4CVXB 4R4ND 4GBXB 3CFDA 4U1GB 5F7LB 5IIEB 3OKMB 3NTCH 3TO2B 3KVQA 4TSBH 2FR4B 1K6QL 5C0EB 4HEME 5DK2B 1NCWL 4YLQT 5EIVA 1OB1B 2E7BA 7FABH 4MA3B 4P3DB 4WI8A 3BAEL 2EXWD 4LMQE 4KMLB 1S78C 5CMAA 2B1AL 3MLVL 1VFBB 1QYGL 3BO8B 3NAAH 3PGFL 2I25N 2DOCA 1KT2A 4YIQA 3W9DA 4NNPL 3SE9L 4M5YH 3GRWA 1PKOA 1QTYT 3PQYA 3JV0A 3KPRB 5JZ7C 1DBKH 1U91A 3TBSB 3BT2L 1RK1A 4MHHI 1KB5A 1UADC 4MZ3A 1BECA 3AB0B 2R4RH 4LLQB 4YE4L 2DIJA 2Y9RT 3OR7A 4ODVH 1YN6A 1GGYA 3QI9C 3WNKA 4XP4L 2VZ3A 5CD3B 3D0LA 5DC0A 2X10A 3VI3E 1EVUA 1IILE 1CD1B 1O7VA 1RU9L 4WEMB 4OZHA 4GG6A 3MC0A 5K9OA 3QJHA 1Y6KR 3MV8A 2W9EL 3VJ6B 3ZDZF 1JWMB 5HI5C 4PTTA 1QSVA 2FD6H 3K4ZA 2IGFL 2NLJB 5ISZA 1EZVX 3QUZB 4DGYH 2IH1B 5IMKB 4QTIL 4TNVK 1T2XA 4JRYA 1X6NA 1RHHB 1IL1A 3UTOA 2CIKA 5JHDA 3U9UA 1K8IA 3FFCE 4M4RA 4F9LC 1T7XA 2PYFB 3LCYA 4LHUA 4HFWB 2JCCA 3QRGL 5ADOL 1I8IB 1T66C 2DI8A 1MVUB 5DYOA 3RQ3A 1E27B 2YKLH 3U7WL 4NC0B 4G43A 2ICEA 3K8KA 1J0JA 2BNQB 4YAQB 4XBEL 4UIMA 5DVKA 1QR1A 3U83A 3V5DA 4PD4K 3S4SG 5IESL 2Q6WA 2JB5H 3FFCD 1RUQH 1H3UA 3H9SD 5C0NC 4I77H 3T4YB 1D9KB 1QPXA 4GAGL 3HN3A 1U8MA 5TDOB 3HLAB 4F7EA 5F7EL 4JKPL 25C8L 1JZ4A 3HS0B 1BVZA 4H1LA 4HWNA 4U1GC 2CR3A 4NRYB 5CWSA 3WFDL 4ESKA 5JORB 2XZQH 5FFLA 4F7MB 2D2OA 5E2TL 5IW6A 2CK0H 2GQHA 3FQNA 3C6SA 2OZ4L 4YC2B 3BDYH 3T2NL 5HYJB 1BZQK 1JPGB 5CIPH 4DZ8A 2PO6C 4JZOB 4Y8AA 3PHOB 4NDMB 4XXCC 2NY3B 1OM3L 3KYKH 3VD3A 3OKKA 2BJMH 4PG2C 1G0XA 5E8EB 5J57B 3AB0C 5D1QD 1PEZA 5DK0A 3RNQA 1RIHL 4HDIA 2CKBL 4NQXB 3BN9C 1F3DH 1JRHH 4YHOL 2R8SL 2ARWA 3AY4A 4I2XB 1NGZA 5E2VL 4JJ5B 3SPVA 4YXKL 5MEPB 3SCMD 4BZ2L 3OWEA 5HGAB 5CEYA 3MODH 4PP1C 1CI5A 5D1XA 3WHXA 1FFPA 3O3DA 1FYTE 3FOMB 4QTHA 4PJFB 3QUZC 3SDCA 2DKUA 4JJHA 1ZWIA 3PGCA 3S37H 2HTKD 1CYGA 1NGQH 4EI5B 5J56B 1NLBH 5A40E 5DMIL 3PE9A 1F2XK 1JRHI 1NFDE 4LSVH 1UWXH 1T5XA 4TVPE 2QSTA 3GMPA 5KOMC 1SJXA 4OB5L 3KPLB 1HKLH 1E4JA 1GPOH 1YJDC 2J5LB 4WNQA 1FYTD 4X80L 1JBJA 1PFCA 4X9FA 3OKEB 5D7KD 1A9EA 1PBYA 3KPRE 1SY6H 5I8OL 2PTUA 5F1NB 2IFFH 2PYEB 2A6DA 3NPSC 4NFBA 3T2QA 2WP3O 3W0WD 3E1F1 4ZNCD 4GG6F 2MSPA 3B9KC 3LD8C 1LO0L 2VDRH 1FP5A 3P9MA 3S3JA 2GCYB 3VXME 2FZ3A 2GYSA 3QDJD 5DZLA 1CIDA 1UWGL 1Z3GL 1FNLA 5CZKA 2WINA 1IAIH 4WWKD 3OXRB 4QXTB 3RDTC 1YEKL 4NBXB 3IF1B 3EYOA 5TPWH 2RJMA 1A1OA 1BIIB 4ZAKD 1IFHL 2APVA 2R0ZH 4FNLH 4C54A 1NJ9A 4HUNB 4X99A 4JO2H 3VXMD 3WNLA 4P2RA 5CJQH 2JCCF 5I19L 1H15B 4W4OA 1QLRA 4TUKL 1PVHA 3UTTA 1QSED 1IAII 3FFDB 3HG1D 4R7NB 3AAZA 4YDIH 1X4XA 3G6AA 3X14B 1IGCH 2BNQE 3NCYS 2RFXA 3RWIA 5HDOA 1KJMA 5I1GH 2D03L 2VQTA 4OCLC 5F1SA 2BNRA 2HT2D 1MHHA 3BIKB 4Y2DD 5B38A 1A6UH 2AJYL 2GTWB 2NX5E 1AXTH 3TCLB 1IAKB 3VFMB 4PJEE 2X9XA 3THML 1BEYH 1ZA6A 6FABH 3IFPA 2CLVB 2VLKB 3CFJA 4OFYD 4U7MA 5GGUA 3HE6B 2BFVH 3FQUA 4Y19A 1CD9B 3ZL4H 5EBWA 3PL6A 4XNYL 1M7IA 5HHNB 2NX5D 5HYJE 2J5LC 5TE7H 2EYTA 3UJJL 2Y7QB 2FJFB 2ZSWA 1Q72L 5FHAH 1HH6B 3RIFK 3VXNA 5F1IA 4MJIB 3BRGC 2LVEA 4FMKA 2P46B 5D96B 3QXUA 3O6LH 1FNGA 1ZOXA 1N2RA 4K9EH 1A7BA 2OJEA 2VL4A 5DZOA 3S9DB 1HWHB 5I1CH 1QZ1A 3GSNL 3NZ8B 4D9RE 3QEQB 1MRDL 1KUMA 4L8BB 3F7VB 4LHJB 3TIEA 3SGDH 1MF2L 3B9EA 4BUGA 2QR0B 3BEVB 2FH8A 4HIIA 4FQIL 3QUXB 3S35X 4ZNEE 1J1XL 5FCSH 4FQCL 1BQUA 2YA2A 4P9HH 4XNMB 2YPLA 4MDJB 1EAJA 4PJFE 2J8HA 1P53A 3CFDB 5EUKA 4D9RD 3CPLA 4MCYA 4Z7UF 1CFTA 2OXHA 4J6RL 1ZLWH 2W0FA 5IBUG 5JXAH 3AM8A 2EDTA 1HE7A 4X6CF 1JWUB 1SJEB 5FYJD 2LU7A 5CMAB 3SGDI 2XKSA 3CFCL 3C09B 4HGKC 4WEBL 3U7YL 4LCIL 3UO1H 3VGDA 1KT2B 4YIQB 3W9DB 4BYHA 4JANA 4OT1L 2YD3A 4OF8A 4D3CH 3PQYB 4LGRB 1U91B 4BQCA 1RK1B 1KB5B 3O6FC 4W70A 4JPWL 1TQBC 4LDOB 2BSSB 2R2HA 2YMXL 3OR7B 1YEIL 1YN6B 4OF7A 2Z9TA 5EZLA 2ICWJ 3D0LB 4MQXD 1TJGH 3GNML 2ZCHH 4C56A 3I75A 4GG6B 3OTTA 4OZHB 3OSKA 5K9OB 1ED3A 1ZVSA 3QJHB 4PTTB 1UH2A 1MH5A 3LMJH 5ISZB 2C5DC 3PXJA 3SE3C 3MLVH 1NBVL 1QYGH 2VLRB 5I0ZA 1F6LL 3PGFH 5KVFH 4JRYB 3SE9H 1IL1B 2CIKB 3OL2A 5JHDB 3U9UB 1G9NH 1K8IB 1GAFH 2ZG3A 3BT2H 5D96C 4LBEA 5KBNC 5DYOB 3L6FA 3ULVD 3O3UN 5GRXG 4OLXL 4G43B 2ICEB 5C0CA 1T83A 1LNUA 1XF3B 1NLDL 4UIMB 4HULB 1QR1B 1D6EA 3FOLA 3MRJA 1E6OL 2Q6WB 4YHML 3WIFA 1F4XH 1RU9H 4GAFB 2F53E 5E8PA 4KWUA 3UEZA 1HYRC 3V5HA 2D7PA 2W9EH 1U8MB 3HTLX 1E6JL 4X4YB 3QUXC 1QACA 4OCYL 5M7QA 4S11A 1X5IA 3KR3L 3OAZK 1K8DA 4WJ5A 4H1LB 5CWSB 2MQ0A 1CDIA 1HEZA 5T3XE 1UGNA 1WIOA 3LRSA 5IW6B 2F53D 2VIRA 2F5BL 2PETA 3FQNB 3QWOB 2FATL 2HJLA 3C6SB 3C09C 5J1AA 4DZ8B 3F12A 1FIEA 4L4VE 4XBEH 4KK6C 1MJUH 1D5BB 3W5NA 2O93L 5IESH 3T0EA 3V0VB 1V8HA 5T3XD 3OJ2C 3OKKB 4CAGA 4PJ7F 2ATPA 3PHQA 5DK0B 3FQXA 3RNQB 4HDIB 4QWWD 1QVOB 4G6AC 5IBLC 1S7QA 3J7HA 4OGYH 4X7SL 1YYMH 2EC8A 4OBRA 1YEHH 2MCPL 4APQA 1NGZB 3I2CH 2UV3A 5E7FA 3UPRA 4X5LA 3DJ9A 4IRJA 1NGXA 5E2TH 3SPVB 3H6JA 5CEYB 5D1XB 1FFPB 3O3DB 4QTHB 5JQ6H 3SDCB 2VLLB 1KCSL 1ZWIB 3PGCB 4G9FA 5K9JL 3VD7A 1I1AD 1XF4A 1PQZA 4POUB 1EHLL 5T5NG 3LQAH 5GSVB 3GMPB 3VW3H 2OXGA 1ZXQA 2F15A 4ALAL 5IB3A 4A6YA 4DW2L 1P4BL 3VFVA 4WNQB 4QRPA 4XPHL 1OT1A 1URLA 3ARZA 4UBDC 4PJGE 5HYSG 4PJ8A 4NN6B 1AJ7L 4MZ2A 3CFKA 2A6DB 3VU2A 2FX9H 2X4TA 3OHXA 4JR9L 3TZVA 3R8QA 2NYYC 3QP3A 5MENA 5E2VH 5D8JH 1KF9B 4YXKH 4XH2A 3AMKA 3P9MB 2ESVE 2FZ3B 5IB2A 4JGMA 3PWPA 4PJXF 2YRLA 3AS2A 3MXVL 2DQGL 1NEZG 3NA4A 2WINB 5C2UB 3EYOB 1GYAA 2B20A 2GJ6E 4OGAC 1H8OA 4OB5H 3VH8G 2GKIA 4P9HC 4KMQA 1DBAH 3FB7A 1NJ9B 4X99B 2VLRE 4P2RB 2ESVD 4LLUA 1QLRB 3DECA 2XN9A 3F7QA 2PTVA 3UTTB 5GJSH 4O5LL 3TC9A 1JTOA 4ONGL 4MGXA 2GJ6D 4CMHB 4NC1C 3AAZB 5BRZD 1PZUB 1XH3A 1AFVH 3G6AB 1PX4A 3NIDF 3MZTA 3JUYA 1I9IH 1LO0H 3S35L 3O11A 3RWIB 2EDQA 1Z3GH 1KJMB 3AY4C 4AIOA 4J8RB 1YEKH 2BNRB 2G9HA 4LKCB 4NQSA 5B38B 1IFHH 5D1XC 1J9CT 3REVA 4KZEH 5DC4B 1BGXL 3SDCC 3K74B 3GHEH 1DEEB 2CLRA 5BJTB 3MV9A 5KJRL 3IFPB 4PRBB 5GRJL 2YK1L 5J1SC 2HTLD 4R2GC 5B3NA 3I9GH 5GGUB 4AZ8A 2QTEA 2YN3A 4Y19B 3PL6B 2BMKA 3CNKA 2BVUA 2BVPB 3QHZL 1ERNA 2EYTB 3LN9A 1F5WA 4LCWA 1G9NC 2ZSWB 2WBJA 4M00A 5EO9B 3VXNB 3H3KA 4XWGH 5F1IB 2HLFD 1XR9A 4NN6C 4RGNB 1FNGB 2D03H 2QQQA 3L5IA 1N2RB 5DD0L 1LVEA 2OJEB 2OL3B 4NJAL 3RIAF 5K9QI 4HS3A 4POZC 3OKOB 1VB9A 2V5RA 2Q3AA 3GSOA 3BI9X 5BO1H 3IDMA 2X05A 1U92B 4G7YL 5EZOH 1DP0A 1WWBX 2IBZY 4PB0L 4ACPA 4ZFOL 4HIIB 3OXSA 2R0WH 2VDNL 3ARBA 4X9BA 2D3VA 4XNYH 1YNLH 5EUKB 3C6LA 4HS8L 5HVHB 3VXQA 3CPLB 3FL7A 4W4OC 4JE4B 4MCYB 2ZJSL 4PGCA 1CFTB 2ZCKH 1H3TA 1H0DA 3VFOB 2P45B 3UTSA 2BVQA 4NKIL 4CMHC 5IVXA 4U4BA 3KLAA 3M17A 2VDQL 1DQMH 2Q7YB 4FQXB 5HGHA 2EC9T 2ICWI 2R1WA 3GMQA 5B21A 1AKJD 1MRDH 4DWHA 4LLVA 1XGQA 3DRQA 1KJ2A 2ERJC 2ZUXA 4UT9L 2EYSA 4X6EA 1MF2H 4ZXBD 2C4FU 1JGUH 8CGTA 3RGVA 1J1XH 2X09A 3CZJA 5EIIA 4S1SL 4FQCH 4P57B 3NH7L 1BREA 1I9RL 2CDEB 4C56B 3I75B 5CEZL 3CXHJ 2EEBA 4F9PA 3VMPA 3ZYOA 4G8FA 1X5XA 1ED3B 1ZVSB 4F15B 3SDAA 4MXVE 1RUML 4XCNA 2V6HA 4O00A 1MH5B 1JYWA 4KVCL 3TA3A 1QG3A 3CFCH 3PL6C 4A6YH 4WEBH 3JTTA 4LCIH 4HAGA 3C8HA 5F71A 1EO7A 1NMAL 15C8L 3LQAC 2FRGP 3ZZ1A 4HMCA 3FO2A 4LBEB 2WWMC 1OOAA 2GIYA 3U79A 3EBAA 4KXZH 1CU4L 1YEIH 5C0CB 2K1MA 3RZWA 1LNUB 1PD6A 4IIQA 2YC1A 3CGTA 1D6EB 2FEEI 2YUWA 3FOLB 4HGWB 4JVUA 3MRJB 1XF1A 3WIFB 4JZJA 2AJXH 4Z7OF 1I3RA 5E8PB 5L6YL 1T1WA 2BNRE 3V5HB 1GCFA 2VXQL 4PGEA 5GIRA 2M2DA 4D0CA 2IEPA 5TE6H 2EDFA 1OARL 3RKDD 5B22A 4KXZI 1NBVH 3T4AA 3UYPA 5C0RL 3WIIH 1K8DB 4WJ5B 4RISL 5CUSL 2AJZA 2D0GA 3LPGA 3V6FB 2HKFL 1HCFX 3P4LA 3AM8C 2VIRB 1ZHLA 1J18A 4PJIF 4Y19E 5CZVH 5J1AB 5MEOB 1NLDH 2LV4A 3QCTH 1QLEL 2DQHL 3QDMD 4YZFF 4YHYC 1E6OH 5I71B 4YHMH 1BLNA 4RGNE 3RNKA 3V5KA 2ATPB 2QBWA 3PHQB 4JN1L 3FQXB 1E6JH 5FXCH 1CR9L 4A2LA 4C55A 4OCYH 1CFVL 4BH7A 4J1UA 3KR3H 4X6FA 5DD5L 1GL4B 3BPOB 4APQB 4HPOH 4IRJB 1NGXB 4F15C 4LLWA 5ICZA 2F5BH 5DUBA 5C9JA 2LE9A 1DJSA 1Y6MR 1DUYA 1EA9C 1XF4B 3LKRA 1LE9A 1RZFL 3S96A 1PQZB 2BVYA 5I6XB 3NIGF 2JJTA 2R2BA 8FABA 3PDOB 1N3NB 4QHKI 4TRPH 3RVXD 3I50L 3SO5A 3QG6B 4ZO7A 2UWEA 2ZCLL 5CS7A 3VFVB 3C9NA 4I3SH 2LVCA 1LP9A 4QRPB 2J6EA 3RVVD 1T83C 1DSFL 3MTRA 1G1CA 5E1AA 3RU8L 1RZ7H 2AI0H 1I3GH 4P23C 1DDHB 4X7SH 3RRQA 4PJ8B 3RHWF 4QCIA 5EOCL 3TEUA 1A3LH 3CFKB 3VI4E 2DD8L 4GMSL 4L29A 2XA3A 3TZVB 5LQBL 4Y4FA 1JHLH 1YY9D 1S5IH 4WI2A 4K71B 5MENB 2RHEA 4XH2B 1IGJA 3D2UD 4MD0A 5IB2B 3PWPB 1UA6H 1T0MA 2XPGA 4C56E 4ODXA 5D2LA 1Q9LB 3SKJL 2E6PA 1EHLH 4FFYL 4V1DD 4E0RA 1A6TA 4Y0GA 1J0ZA 1B6UA 4PG9B 3FB7B 1FL5A 4J3VA 3KLHD 3EO0A 4LLUB 1OGTA 4XPHH 5CBAB 5JO5B 1U2HA 1ZS8A 1SBSL 4Q6YA 2XN9B 1C5DA 3T0EC 5I71C 5FHBL 4Z0XA 4I0PD 1Z5LB 2YD2A 1S9KC 2GFBB 4E9LA 4NKOA 1KJ2H 4N1EA 3B4NA 3VWJC 2C3GA 5E8DL 1HHHA 1RJYA 4PJ9D 3ALWA 3GSRA 1T5WA 5EBMA 3S5LA 5DO2C 2A6KA 3ARFA 3O11B 5DURD 3MXVH 5DQJA 2DQGH 4NUJB 2YRPA 4P2CG 2G9HB 4IRJC 4KMTH 1I8MA 5CILL 4NQSB 1I7UB 4UT7L 5JW5A 1PDKA 4WTWA 4KROB 2CLRB 3MV9B 3QJFA 3G5VA 3MUJA 4NHCH 5I6XC 1FFOA 2FCBA 1OCWL 3AC0A 5EOCJ 4L3EB 5SWQA 5BMFL 2N7BA 4DGIL 1S7VA 3SDXA 5E8NA 2X5PA 2MQ3A 3LKSA 3Q1SL 4LCWB 3S35H 3WNMA 1FNEA 4AH2A 1UJ3C 1IEAA 5KZCD 1ZSDA 2JF1A 3TZVC 1IBGL 2WIIB 4K71C 4X7CC 3QIWA 3CVHA 4HS3B 3MGTA 1H3PL 1BX2A 2Y72A 3GSOB 2CK2A 2XQBL 4HAFA 3ISWA 2NXZD 2C3WA 5IWLA 1QFWH 1NAMB 4JHWH 4QGTA 3K8MA 5HDQL 2UZIH 4RFOL 2HWZH 1G6RA 3ARBB 5FO8A 3TO4A 1QPPA 3VXQB 1HCVA 1R3LA 4PGCB 4S1RH 5ID0A 1NCCH 1KXTB 1H0DB 4M62H 3ILPB 3IAPA 4X4XA 1CWVA 4NJAH 3EJYD 2HFTA 2AJSH 4QHNA 5IVXB 4WFGE 2GSGA 4BFIA 3DYMA 3KLAB 3M17B 2YA0A 5HGHB 2R1WB 3DV4A 3WO3B 1M6OA 1KGCE 4LP5A 4LLVB 1XGQB 3DRQB 1N59A 4K2UL 3EKCA 3ZKND 3FN0L 4R97C 5C08A 4PB0H 4X6EB 2D9CA 2APWA 3CDYA 4UQ3A 3RGVB 3DIFA 5EIIB 4R26H 5DJ0A 1I75A 4PRPB 5CGYD 4GLRH 1CK0H 2A0LD 3VFWA 2XA8L 4KROC 1DVFD 5DWUH 4UILL 3IDIA 3DX9A 2VAAA 4RQQA 3GJEA 3N50A 3IETB 3DETC 4OLEA 2ZJSH 3T8XA 4EUPG 4G8FB 4ZUSA 1YMMA 3MLXL 5ESQA 5JDSB 3SDAB 1A7PL 1K3ZA 4XCNB 3WXWL 1JUFB 2P43B 3TA3B 1O7SA 5JNYA 4NKIH 4I0CC 2Q1EA 3CMGA 2VDQH 1T7YA 2IADA 1MCEA 1RIUL 4LVNC 2WBJC 2EIDA 2PTTA 3QCUH 3WXVL 1KENL 3FO2B 5TF1H 5J9PA 4OJFL 3C08L 4N0FB 4UT9H 1V7MH 3KPQA 4KUCF 1TETL 3BJLA 4G3YH 5LAXA 4S1SH 1WCBA 2YBRA 1I9RH 4JB9L 4BELD 4JZJB 5CEZH 5DEFA 1T1WB 1BBDL 3HC4L 5CKGA 4B7IA 1WQVT 4PGEB 1NFKA 5GIRB 1JHKL 3L9RA 4YHLH 3UAJD 4D0CB 5H37H 3QDGD 3R0NA 4XPGL 5C9KA 3BP5B 3EYFB 3T4AB 4I3RL 3V0AC 5TGBA 1LQSR 2GEEA 1ZHKA 3C6LC 3K81A 3K2UH 3QAZB 4PRHE 2P7TA 3V4PL 3LDBC 5F72S 4HZAA 1TVHA 2BRRL 4L3EE 4U1LA 2C4XA 1INQA 1CU4H 3B2UD 4O02H 5DUMH 4GAYA 2Y5EA 4Q97A 4KFZC 3QQ3A 2YN5A 4OF6A 4PRHD 1IQDA 1JZ5A 5IFHH 1GZPA 1MJ7L 1BLNB 2AK4A 3V5KB 5L6YH 1HOCA 2VXQH 5F9OL 4CADA 1JPTL 4PYGA 5KSBA 1MIEH 2VR9A 3JWOL 5C0BD 3RGVC 3SKOA 1OARH 4AEHL 4J1UB 2DJSA 1KCUH 3RWDA 2VUOA 4RISH 2DQDH 4ONOA 5CUSH 7CGTA 4XP5H 4F9PC 4JPIB 4QRRD 2HKFH 3IS1X 4LQFH 4LLWB 3SDAC 3LS4L 3V7AG 5CLTA 4M5ZH 3W11C 3IFOA 5DUBB 4UNTA 3L3GA 3TA3C 3TH3T 5C9JB 4YK4B 3WYRA 1DUYB 5IV2A 4YHPA 1LE9B 2EZ0C 1VPOL 2VDML 5I1DA 1FNFA 1NCAL 2R2BB 2DQUL 1W0WA 3C5ZA 4TSCL 1L0XA 1FNSL 5D7SH 2IBZX 5ANMA 1BF2A 2UWEB 4RZCA 5E94A 3S3SA 5T3ZE 1LP9B 4DUWA 1EEQA 4WI3A 1CR9H 5BZDA 5E1AB 5EIQA 1CFVH 4IIQC 3MV7A 3HCVA 3L1OL 4RWYL 4L29B 4JQVA 4Y4FB 5EFIA 1MAMH 2IAMD 1ZT7A 4EN3A 1UM6L 1P5UA 2W0PA 4CVWA 5T3ZD 5CGMA 4MD0B 1G6RH 2Z93A 3KPPA 1QQDA 4PRPE 4LU5H 1VEOA 3B9DA 3QXTA 1ROWA 1T0MB 2XPGB 4ODXB 3QAZC 5D2LB 4BSVA 2IANE 1VGEL 3HUJF 4LVOC 3VGAB 1JNLL 3GKZA 4BUHA 1F3JA 1A6TB 3I50H 1HINL 5DVNA 2FIRT 2ZCLH 1S78D 4C83A 3X3FL 1GGIH 5D93B 1OGAE 3EJZD 2A73A 4XPBL 1OGTB 3RU8H 2OK0H 4YQXL 4K7PX 4K7FA 4J4PA 4U33A 1C5DB 2IAND 4Z0XB 2CQVA 3MFFA 4NN7B 3SO3B 4OQTL 5LQBH 1TZHA 4FQQA 1FVEB 1MY7A 4NKOB 1WBXA 2MKWA 3HB3D 1KOAA 1HHHB 1RJYB 4UIKL 5DK3A 3QPQC 3GSRB 3S5LB 5EBMB 2Z8SA 2A6KB 3ARFB 2IMMA 4BK5A 1FAIH 5LXGL 5DQJB 5CSGA 1KCLA 3DX8A 4FFYH 1I8MB 3V2AR 4OBSA 3S36X 2I24N 3N06B 5JW5B 3MREA 2FX7L 4YR6B 2YUXA 3RIAK 4WU7A 4YK4C 4DFIA 1NFIA 4WWID 1WWCA 3G5VB 1N0XL 3QBTB 2XQYG 1FFOB 2JJTC 1GGUA 4NO2A 5FHBH 4HS6A 4RBPH 5ACMA 3SDYL 4KK8D 4LSRL 5SWQB 1S7VB 3SDXB 1T03H 1P4IH 1QSFE 1X7QA 3LKSB 5T1DL 2D4DA 5EO0A 5E8DH 3RKPA 3G6DL 4K3JH 1FNEB 4AH2B 1FCCA 1UT9A 1IEAB 3GMLB 4MA1B 2GJZB 1HHJA 1ZSDB 4Y4FC 5C0ND 1H3WM 5BS0B 3QIWB 3CVHB 1BFVH 4UT7H 3OAYH 4G5ZL 3SBWA 5KVEH 1WVZA 3MGTB 4FP8H 1QSFD 1BX2B 1ZMYA 3O45A 1MFCL 1AD0A 4EXKA 1UACH 3E3QC 4Y16A 4UAOC 4QEGA 4OF5A 3VGAC 3BPNB 3TGXA 3VWKD 5KOVC 4XVJH 1CDBA 4NO0A 4KJWC 1H3VA 1MCRA 3MRKA 4JEGB 2C3HA 1FLTX 1WFNA 3ALPA 5FO8B 5D93C 1JF1A 4Y8DC 3Q1SH 3RTQA 3TO4B 4KRNA 4DVRH 5HVFB 2PO6D 3FMGH 1NBYA 1NUDA 1TJHL 2FJHA 1CFSA 1YQ2A 1UM5H 1PX3A 4N0YL 4NN7C 3SO3C 1MCIA 4LSTL 4XCFH 2X4UA 1LO4L 3ULUF 3EAKA 2YPKA 2GSGB 1CICD 3NMEA 4NM8H 4OFKA 2DQEL 4BFIB 5ENWA 4FZEL 4G7VL 1LP9E 1H3PH 2E8YA 2EE6A 1CIUA 3BN9D 5J89A 3ARFC 1X5LA 1M6OB 2XQBH 2YPVH 2H26B 3DX6A 2Y06H 5C86A 5BCAA 5DQ9A 3N85H 1N59B 5IQ7L 3QUMA 5C08B 3IT8D 4YXHL 5J0BA 3IFNL 4QXGH 5HDQH 4ZFFA 4UQ3B 3DIFB 4B0MM 4PP1D 4Z76A 3RI5F 5DJ0B 4PJCE 2HAZA 1OAZH 3NCEB 3VFWB 1EO5A 3LN4A 3U0WL 3DX9B 2VAAB 4RQQB 3GJEB 3T8XB 3KPSA 4Q6IA 1CXFA 1YMMB 1ITCA 5ESQB 5C3LD 3HC3L 5EB9A 3CH8A 1QKZL 3WN5A 5F6HJ 3IDGA 1OLLA 2OQJA 4HC1L 4JGUA 5FYJL 2I07A 1ODAA 4Y4KA 2DQCL 2IADB 1I7RA 1JYXA 2PTTB 4GRWB 1INEL 1FFNA 4MA1C 1FSKB 3VFGH 3ULUH 2VXUL 1N0LA 1IEHA 3DSFL 3QZWA 2K3TA 4N8VG 5EPMA 3EYUH 5FAAA 1EV2E 5E24E 4PJ5E 1FNHA 3QIWC 4YNYA 2OJZL 3KPQB 5C0IA 4D0DB 2VZ1A 1YNKH 5LAXB 3QO0A 1ADQL 4F58L 3B9KD 1DQQA 2DAVA 3MRCA 5JMOC 1WCBB 2YBRB 1DQLL 4IEFB 4J12A 5ETUA 4LRNH 3TLRA 4MNQA 4UILH 4EIZC 5DEFB 3LEYL 1FV1A 5IWLC 3RDTD 2AK1L 2NY1C 4HWUA 3NABL 1DFBL 4S0TD 3T2OA 2HFGL 1A7PH 4OIIL 4G9DA 2GY7B 3WXWH 3L9RB 1IRAY 4PJ5D 2CKBA 4HXBL 4EI6A 2I9TA 5TGBB 5DUPH 1R3IL 1ZHKB 1A6AA 2AQ1A 1OWRM 4WI6A 2XY1A 4GT7A 4WFFE 1HHIA 1N6VA 1TVHB 2WUBL 4OJFH 5JW3L 3SDXE 4JRXA 4JFZL 4RMSA 1MVFA 1JIBA 3ULVL 4FHBD 3O6KL 4GAYB 1LK3L 1R24A 4LSSL 4XNZB 5GGTL 3SDDA 1IQDB 4JB9H 1VEPA 2IFGA 1JGVL 2C7UB 2MCG1 1GZPB 4ODUA 4WFFD 1I9EA 2AK4B 3HC4H 1HOCB 5BS0E 5HDBE 4HF5H 4HJJL 5C71A 4CADB 5KSBB 1JHKH 3BGFB 3SKOB 4QXUH 3IVKA 4OCXH 4XPGH 3LV3A 3RUGA 1ETZA 4N8CH 4KJQC 3RWDB 4I3RH 4RMQA 5J12B 3LSOA 2OTUA 4M1DL 3V4PH 1R5WA 4NRXA 4K7PL 2XFXB 5EULV 3RHWK 5AYUH 3IFOB 3L3GB 4R3SA 2EIZA 5DF0A 5IV2B 4ENED 5DFWH 3EDFA 5EU6B 3M1BA 3MLYL 3B43A 3V4UL 5L2KE 1Q8MA 3C5ZB 4RMTA 3E2HB 5FECA 1MJ7H 1HILB 4ZS6C 3SHSA 5J6HA 4RZCB 5E94B 1XGYL 3ROOA 3UTQA 2DN7A 5F9WB 3S36L 5KW9L 5F9OH 1JPTH 5BZDB 3JWOH 3MV7B 3HZMA 3N1QC 3HCVB 5L2KD 3VXSB 1AIFA 5EFIB 4AEIH 1ZT7B 3CSBA 4EN3B 4CNIA 3CFIC 2VQ1A 1RY7B 2FSEA 2GK2A 2P42B 3BRDA 2Z93B 4F57L 3KPPB 2QQLL 1S7UA 5C0FA 1SYVA 1T1ZA 3CLEH 3FB8A 2VO5A 3W82A 2FECI 3P0YL 1TNNA 4BSVB 1WZ1L 1D6VH 2G60H 1VPOH 2NY6D 1NCAH 2DQUH 4TSCH 1FNSH 4JFED 4IHOA 3MNZA 1F3JB 4HUXA 4PRIE 2OMNA 5EO1B 4Q0XL 3MLRL 4C83B 5J8OA 4J3XA 5I74B 1Z0NA 2NY7H 2A73B 2R1YA 5C0JB 32C2A 4IDLA 3RX8A 2DYPA 3CX5J 1GXEA 3QEUA 1N7MH 1QRNA 4I48A 4M1CC 1X6LA 3MFFB 3O6FD 3WIHA 4GSDL 1CDHA 3GGWA 1TZHB 4FQQB 3A67H 1KBGH 3QUMH 5ELIA 4NM4L 5EUOF 4QF1A 1R3KA 1WBXB 4PRID 3CXHK 3JWDH 3LH2L 3BGFC 4P9ML 3SOBL 4ZFZA 5C07A 1OT2A 2VR5A 2OX5A 1VGEH 1PJ9A 1EFXA 2JIXD 5I9QC 4EBQH 5J11B 3MREB 1ZHNA 1BJMA 3LHPL 3SQOH 2HJKA 3O8XA 5CCKH 1NFIB 4ZD3H 1EJOH 4XPBH 5L8JB 5E08L 1YDPA 1TCMA 1IAIM 1JZ8A 3GMRA 1V05A 3TWCH 4HS6B 4JFOA 2W59A 4K3DL 4OQTH 5HI4C 4MAYD 4UNVA 5F9WC 1X7QB 1G7QA 5EO0B 1CVSC 1BFOA 5BV7L 4FOMA 1ZGLA 1N8ZA 1DANT 1UKSA 1MNUH 3ULUC 4O2CA 1F6AB 1HHJB 4MXQC 3VD9A 3V6OA 1D5IH 4JQVC 4L4TA 3RUGF 1L9MA 3D1MC 3O9WD 4EN3C 1OP3K 1A7OH 4MDIA 5IB5B 2FX7H 1S9WA 1EJ6A 3WNNA 5DA4A 3O45B 2QHRL 1EMTH 4AIZA 1AD0B 3C5SA 4KVNL 2DS4A 4Y16B 4ZUUA 3G9AB 1N0XH 2VSDA 1JPFA 4NQVA 4HXAL 5A2FA 1FPTL 3K4DA 3CZFA 3RWFA 4NO0B 3BUYB 3MRKB 3F7PC 5I74C 1JF1B 3IGAA 3RTQB 2VSCA 1MRFL 2GK0A 4LAQH 4M43H 3PQYD 4KK6D 5EU6E 4J4PC 2FJHB 1CFSB 3IDJA 1PSKL 4QRQA 1BMGA 4NQEA 1GIGH 1QBLL 3MLZH 4DKFH 2EH7L 2P8PA 4G5ZH 3OG6B 5ENWB 4UINL 5IBLD 2F5AL 4Z5RA 1SEBA 1W8OA 1EEYA 5FF6A 1G6VK 1MFCH 2MTPA 3D3VA 3DX6B 5JA9A 3EO1A 5DQ9B 1EVTC 3QUMB 3VXSE 3X13A 1A21A 1Q9OA 3D9AL 3QEGH 4HZLB 3MV8D 4ZFFB 1JF5A 2E8ZA 3CVIL 5F6HI 4Z76B 5KSAD 4KAQL 3LN4B 1MJJA 4PR5A 1ZLVH 1ACYL 2AJ3A 4Q6IB 3TVMA 1VGKB 4L3AA 1CF8L 1C5CL 1TJHH 5IGXH 4XMLL 4N5EC 3HC0B 3BGMA 4JHBA 2BOBB 4LHUD 2PCPA 1IZKA 3IDGB 2X7LA 2OQJB 5C2BL 2O5YL 3O2WH 2I07B 4Y4KB 1YNTA 4J3TA 1YMHB 1KIQA 1I7RB 5D9SA 3MFGB 1NGWA 3QZWB 5E2WH 5EPMB 5IMLB 4GH7B 4YXHH 1BQHA 1T21A 3IFNH 4YNYB 5C0IB 3SBWC 3TV3L 2FB4H 3DPBA 1DQQB 3MRCB 2AJVH 1GC1L 5ETUB 1AR1D 2HRLA 4HW6A 1X5FA 4Y16C 4DEPB 4XC3L 1YZZA 4CBPA 1FV1B 4X4ME 4Q9RH 5D2NA 4P5TA 4PIRF 5F9AC 3HC3H 4PJBB 4G9DB 1GRWA 1QKZH 1LO2H 4RX4A 1MHEA 2CKBB 4N9GA 4HC1H 1QBAA 4F7CB 5TFSH 1KEMH 5GRVL 3RTQC 2DQCH 1A6AB 3U4BL 2CUIA 1C1EH 2WQ8A 5IKCA 1W0VA 1HHIB 1RZGA 1FAKT 5T1MB 2PW1A 3KHOA 1NCDH 4IOSD 3WIHH 5GGVL 3C8DA 4JRXB 3MQIA 1RURL 2OJZH 2J1KA 4JFQA 3BGAA 4KHXL 5ITBL 5F93C 5I15H 4F58H 1HSBA 4HEPG 3BH8B 1QOKA 3SDDB 2F8XC 3T04D 3NCBB 1C7SA 4ODUB 2W65A 4GRLA 2AK1H 4XMPH 2HFGH 5IOPB 3JWDC 4Z6AT 2DQIL 5AUMA 5E2JA 5D1XD 3LV3B 3MLWL 5GGRY 5TQ2L 3CUPA 1ETZB 3RUGB 1RQ5A 2OTWA 4UV7L 3KXFA 2OTUB 1R3IH 4X6CE 2DQTL 5ERWA 1R5WB 4Q6IC 5KVGH 3HPJA 3OJVC 4NRXB 3TYGL 3TESA 1U3HA 1T89A 2WUBH 3WN5C 4R2GD 5EC1A 2DLFH 1B6DA 1JP5A 3OZ9L 5H8DA 5C6TH 4LARL 4R3SB 2UVEA 4M3KB 5FOBA 2EIZB 1EEZA 4CDHA 4QO1A 1T6VN 4QHMA 35C8L 4Y4KC 5H35B 2R39A 4CW1A 4Y5VC 4YDLB 3M1BB 4AJ0A 4LSSH 1BBJA 4HWEL 2DKSA 1VFMA 3LOWA 4I0KA 4X5XA 4NNYA 5J6HB 3ROOB 3UTQB 2H1PH 3ARVA 2W91A 4QNPF 1VESA 4POZD 3HZMB 4MD4A 3QWRD 1IM9B 4WCYH 4NO5B 4DEPC 1WC7A 2DRUA 2G5BA 3O6ML 4M1DH 1C8PA 5HHXL 2FO4A 3IKCB 1K2DA 1AIFB 4K7PH 2WP3T 4CNIB 1BZ9A 4M48L 2VQ1B 5IBTH 4U1NA 2FSEB 4PJHA 1LEIA 4PJAB 1S7UB 2V7HA 1SYVB 1T1ZB 3FB8B 4JY5L 1YYLH 5CZXD 3V4VH 5C0FB 1BD2A 3IDNA 3MLYH 4QHLA 3V4UH 3HNVL 3A6CH 3MOQA 3D85A 2AVGA 3MRDA 2XY2A 2NY0D 1W72A 2V9QA 4IHOB 3MNZB 1TZIA 2J4WL 3UJTH 4Z7VA 4HUXB 1JGLH 2M8XA 2Z0BA 3KYAA 5ALCH 5KW9H 2HMID 1XGYH 1MUJA 3S36H 3R1GH 3U2SA 4NWTH 2R1YB 32C2B 4WW1A 2DYPB 5DQDL 3SDDC 2DL9A 1F4WL 4OFPA 3ZTJG 5A3IC 2VDOH 2CR6A 1NDMA 3GGWB 5BOPA 2KUTA 4QF1B 1I1YA 3MJ9A 3GM0A 1A14H 1D5MB 5KANG 4ZFZB 4U0RB 3VXUA 5C07B 4HK3J 2FO1A 3A0OA 3S4SB 3K7UA 4R4BA 3MRBA 4P46B 4UTBL 1I7TA 4AENB 1RJZA 4FS0A 4OLWH 1EFXB 4XHJD 1MWAL 4LLDA 4NO3A 4PJBE 5FK9A 5LGJA 4M7KL 2HJKB 5BZWA 1FBIL 3O8XB 3MLRH 3ZLQC 1ORQA 4G8GE 3PL6D 5FYLH 1RZJL 1TMCB 5FM5O 4PJ7E 2IBGA 3PWUA 3ZE2F 5FKAA 5CHNA 4YDLC 4HWZA 5JPNA 4JFFE 3GMRB 3ZMRA 4PLJD 2AXGA 4ZFOA 1RZKL 2DBLL 3I02A 4D0BA 1DLHA 2ID5A 4NM4H 4WUUA 4U1MA 1G7QB 1I9JL 3X3GH 4UQ2A 4JO3L 3LH2H 1BFOB 4XAWL 3SOBH 3FO9A 4G8GD 2VLMD 1N8ZB 1ZGLB 4JPKL 3BP4A 4ZTPL 4O2CB 4PRNB 3WBDA 4N0UE 5GZOC 3V79C 1J88A 3BD4A 4JFFD 4L4TB 2NY5C 3G5XA 5F44A 4NZJA 3T3ME 3L5WA 5INCA 4AIZB 2YPLD 4ZUUB 4X6DE 2VJXA 2O5XL 1QEWA 5E08H 1T7VA 1I3VA 1S7SA 4I18A 3WSQL 5K9KA 3WNPA 4NQVB 2X1WL 4HPYL 3RWFB 5DJAA 2VNCA 2ZPKL 2AV7A 2WWKO 3E6HA 4EQ3A 4RGMB 4OD2B 4OZFG 3IGAB 4ZTOH 2GK0B 3RI5K 3MLSL 3ECBA 1YEFH 3IDJB 4EXPX 4QRQB 2XV6B 4U7SA 1J0KA 5F89B 1CDGA 2VDPL 4NQEB 5DT1L 4TSAL 4PJXE 1OQOA 3PP3H 5E5RB 2P8PB 1TZGH 1WJ3A 5HYSA 4Z5RB 1SEBB 1EEYB 2QHRH 5FF6B 3D3VB 2H32A 4LK4A 2F58L 3EO1B 4LPYA 4PJHF 2CDGA 3X13B 1Q9OB 5GQBA 4JQIL 4GAJH 5GRUL 1FVDA 2D31A 3O8XC 3HI1A 2VKXA 4PJAE 4W4NA 3DOSA 2HH0L 4BH8A 1MJJB 4PR5B 5D7JA 3ARWA 4BSJA 2AJ3B 1MRFH 2JB6B 3TVMB 3NIDE 1NGPL 2R0LL 3VH8A 3BGMB 4JM2F 2J88H 1XGRA 2PCPB 2H3NA 1T4KB 4CN4A 4CU8A 2D9QB 1YNTB 1TVBB 1KIQB 4MXWL 4X9GA 3SGKA 5JLZA 4P23D 4I9WE 4P2OB 5GS0L 1KG0A 4Q9QL 2XWJA 2W0LA 2WLZA 1NGWB 5I1JL 3V6OC 3MJ7A 5F1OB 1BQHB 1T21B 3N0PB 1QFUH 3CVIH 1J5OL 4CN1A 3FT2B 4LFHD 4KAQH 2BC4A 2E9BA 2ZKHL 3MYZA 2OS7A 1M1SA 2P5EE 4TVSa 1FZOA 5D2NB 1AO7A 4P5TB 5E00A 5JPMA 3Q6GH 2AJUL 1MHEB 5L8KB 4N9GB 3Q3GA 2DMKA 5FA4A 1M7DB 4RGMC 3KYOA 3RPKA 2D0HA 4TOYL 3F58L 3HFML 5JHLH 4JFDD 3GBLA 3GBNH 4P4KA 2O26U 1FC2D 1W0VB 2P5ED 1ZANL 1RZGB 3TBTA 3GUTA 2A6JA 2XRAL 2Z4QA 3T0ED 5ADPH 2PW1B 2YZ8A 3MO1A 1MLCA 2R2CA 4DVBA 4JFQB 3F65A 5FUCC 3MJ9H 3VWJD 4TNWK 2JE8A 1HKFA 3TV3H 4MJ4A 2X4RB 3HPLA 3P0GB 1XR8B 5KAQF 1GC1H 4KKBC 1PG7X 3BE1H 4XC3H 1Q0YL 4TTDD 2W65B 4GRLB 4WO4D 3SJVE 5AUMB 1FVCA 3MBEA 1K9TA 4I5BA 1GOGA 3CUPB 3RWEA 2OTWB 4G9FD 1JNHA 1K4CA 2ZUYA 3U4BH 4XNUL 5ERWB 1I1FA 3TVMC 3HPJB 3WFBL 5GS3A 2NY2B 4PS4L 1U3HB 1QUNA 1FFQA 4IBLT 4OLUL 5EC1B 1N5AA 2APXA 4D9LL 4ZSOA 3SJVD 1MOEA 4ZFGL 1EEZB 1RURH 4KHXH 4JY6B 4QHMB 2VERN 4CW1B 5IBUB 1XGUA 3U9PL 2Y07H 1BBJB 3U6RB 5CGTA 3LEXA 5CJOL 3UTZB 3TZVD 2VXSH 2X2YA 4PJDA 1S8DA 5EU3A 2QADD 3C2AH 3JV5A 2DQIH 4S2SB 1RFDL 4Y4HD 1OW0A 4MD4B 3MLWH 5TQ2H 2QSCH 5DD6A 1CGXA 5DRXA 5A2JH 4OF3A 1Y6NR 1CQYA 2FO4B 1CGUA 1QBBA 5D2NC 4P5TC 4GW4B 1BZ9B 3STLA 4M6MH 1OF2A 3OZ9H 4U1NB 4LARH 1LEIB 3EGSA 1IQWL 2V7HB 4K94L 4F3FA 2I60L 5E99L 35C8H 5FUOL 4C57C 1BD2B 4QHLB 1A6ZA 5KS9A 5IEKA 4IRZL 1DBBL 3D85B 4XC1L 2Z31A 3MRDB 4Z7VB 1W72B 3BWUC 2YR3A 4N0CC 1WCQA 4U6YA 1MUJB 1MRCH 3GO1L 1BF8A 1MFEH 2ZOLA 3VFRA 4WW1B 1KC5L 5DLMH 1J8KA 1FL6A 3O6MH 4AYFA 3LY6A 1NDMB 3MOBL 5DMGD 2JK5B 4HFUH 4WDIB 4B53A 2X42A 3ZE1E 5KN5A 2NTFA 1I1YB 4NKMA 3DWTA 4M48H 5FGBA 1IC7L 1UYWL 5BVPH 3VXUB 2WBWB 1AGCA 4KUZL 5IB1A 4R4BB 5IFAL 3MRBB 4IMLB 4YPJA 1DN0A 1NBZA 4KROD 4JCMA 4PJIE 3MSPA 1B0WA 1RJZB 1J8HA 4DN3L 4GXUN 4N1HB 3HNVH 4YWGH 4BZ1L 1MQKL 1U3HC 4QOKB 4NO3B 1T89C 4Y5XA 5FK9B 4MNGE 1J0YA 4PV8A 3HNSL 5BZWB 3U30C 1ORQB 4PRDA 3BN3B 4H8WH 1KJ3H 3PWUB 5FKAB 5CHNB 4K3GA 3OAUL 2WBJD 4HWZB 1OD9A 1F4WH 4AL8L 1FO0A 5C0GA 1AY1H 4ZFOB 2HYMA 2CLZB 5IHUL 3I02B 1KLUA 4D0BB 4E42A 5EC2A 4WUUB 4UQ2B 3HAEA 1A7QH 3CX2A 3FO9B 1KTLA 1HZHH 2APBA 3WD5L 4OFDA 3BP4B 4OZGA 4AG4L 4NBYB 3V0WH 1LDSA 4UTBH 1FORL 2WUCH 4G6JL 3G5XB 3UJIH 3BPCA 3EHBC 2VWEC 1CVRA 4MX7A 1JZ7A 4YBHA 2F19L 1FBIH 3L5WB 2D4FA 1JV5B 4G6KH 5E2UL 1RZJH 3DI2B 1MCDA 1P2CA 1QEWB 4UB0L 3C6LD 3ZYJA 1S7SB 4GKZA 5K9KB 1E4XL 3VD4A 3O0RH 1HQ4A 1WTGT 4DKEH 4EOWH 2BERA 3BMWA 3O2DL 4MS8C 5DJAB 4XXDA 2AV7B 1SQ2N 1S7RA 3INUH 4W6WB 3E6FB 3EW3B 5FUZH 3TP4A 3UTSD 3E6HB 4ELMA 2AQ3A 2DKMA 4JM2C 4XAWH 5DMJB 4Z78A 2E7HA 1EIBA 4PJDF 3EZ8A 4JPKH 2VDLH 3K46A 2V2WA 3ECBB 1RK0B 3DRTA 5GS1A 5MEQA 1GOFA 4ZTPH 2P5WE 5C09B 4JY4A 1XGTA 2AERT 4XGZA 4HCRL 2H45A 4AT6A 5EZIL 1Q1JH 5HYSB 4JG0H 3MRQA 3ZHLA 4L1DA 1NUFA 1DQTA 2H32B 3HRPA 12E8L 2A9NH 3GSWA 2CDGB 3WSQH 2GAZA 2P5WD 4B41A 4RMVA 3CH1B 2W1NA 3QQ4A 4YO0A 4HPYH 1FVDB 5INDA 2D31B 2NY4D 2A9ML 4OCMC 5KS9F 3HI1B 1NEZB 4ZOCA 2L7JA 1UEYA 1Y18B 3MLUH 1BFSA 4BH8B 4MB5A 5D7JB 1S9XB 4ONHA 1QFWM 4JM4L 1PG7L 4QRTA 2AGJH 5EU7E 3VH8B 2VR4A 1NDGA 1XGRB 2H3NB 4TSAH 1BAFL 1S9YA 5FYKU 4OI8A 5F70A 3WS6A 3BUTA 2V5TA 1KG0B 5CEXA 2XWJB 2F58H 3SN6N 3SY0A 3AREB 4XNQA 3VXPA 5D7LE 1A64A 3GSQA 5GRUH 5TH2A 4X9IA 1CE1H 4NJ9H 1CDJA 4XB7A 5D71L 5AD0A 3HI5L 1HSAA 2HH0H 2BC4B 4LOUC 5FO7A 5JW4N 4ONFL 3VRLF 5D7IF 1FZOB 4I18C 5JTWA 2VZSA 1AO7B 2HA1A 3FFCA 3FT3A 3QEHA 5E00B 4ELKA 1WV7T 5IW1A 2R0LH 2G2RA 4QOKE 4JFYB 2ENYA 3GHBH 3C5JB 2L7UA 3Q3GB 5FA4B 2PR4H 2A74A 3KYOB 4OD3H 4PUBL 5FIEA 5HYQA 3BKYL 2VLJE 4AMKL 4P4KB 1V3MA 1KULA 5GS0H 2IALB 3PWVA 3TBTB 3GUTB 2A6JB 4Q9QH 3IXAA 3MO1B 4WGWB 1MLCB 4DVBB 1MHPL 2QEJA 3KPNA 1S7TA 2VUYA 2AXHA 1G1YA 1A1NA 1J5OH 3EFFA 3P30L 1L4IA 3HPLB 2VLJD 2Q8BL 1D5XA 1UXWA 3OGOE 3T1WA 1KFAH 1EGJA 3BKCL 4LVEA 5D1QA 1FVCB 2B39A 4NZUH 3MBEB 4MQ7A 4YEFA 4Z95L 3MRHA 4MVBD 4M8QA 3RWEB 1J1PL 4TOYH 3HFMH 5D7JC 1JNHB 1K4CB 2F54E 1I1FB 4ELMF 3ARGD 4PV9A 3NTCL 3GIZH 4TSBL 1ZANH 4XX1G 2XRAH 2EDNA 1FO0H 1N5AB 3SCMA 3GBML 4H8WC 4HD9A 4HQQL 5SX4H 3HAEH 3MCLH 4IS6A 5CEZE 3SGKC 3S8WA 2F54D 1CGSL 1DBKL 2NXYB 4YHIA 3LEXB 3WFEH 1P6FA 5C09E 4PJDB 4Y4FD 5EU3B 1S8DB 2MPAH 3FB5B 1TQCC 3BYTA 1FYTA 3JV6A 3FCTA 1X5KA 5SX4I 5CEZD 4GBXA 4XNUH 5LWYH 2X1PA 3TO2A 3WFBH 5I73B 2FR4A 1NFDA 3QPXH 4PS4H 5C0EA 3STLB 1KCRL 2VOTA 1OF2B 3MRNA 2FD6L 3EGSB 4ZFGH 2EXYC 3UYOD 4F3FB 4EUPA 4OUOA 4P4KC 1A6ZB 3VFPA 2BNUB 1I8LC 3KPRA 2Z31B 4WWKA 5B8CC 3QDAA 1BFTA 4U6YB 4ZAKA 4Z7QF 2CGRH 4LLQA 5I8CA 4P0DA 2YKLL 4LHUG 1TLKA 2ZOLB 3SE4C 3VFRB 2OLDA 3VXMA 1FL6B 1J7VR 1G7PA 3EOYG 4KUCD 2JB5L 3T65B 1RUQL 1MI5B 1A1MA 1WEJH 5HHOE 4NKMB 2RGSA 3UZEA 1CGVA 3MBEC 3VJ6A 2RIKA 3FO0H 4I4WA 2AS5M 1AGCB 5IB1B 2NLJA 2I60H 5E99H 1DN0B 1NBZB 1GGTA 3BWAA 1A9BA 2BXZA 1J8HB 3NCFB 3P11L 3PP3K 1DBBH 3H7BA 4NQDE 4Y5XB 4PV8B 1MCWM 5HHOD 4HFWA 4Y2DA 4M02A 2CK0L 4PRDB 1E27A 2YWZA 3WKNA 4K55A 4LAJH 2BNQA 5FYKL 2BOCA 2IPUK 1KC5H 3PWNA 3QDHA 4LMQI 3MROB 1CGTA 1YPZB 1FGVH 5LVEA 5J3HC 1V5JA 5C0GB 3KYKL 1KLUB 4OFYA 4NQDD 2E3VA 1CT8A 4Y2OA 2X1XR 3T4YA 4MCZA 1MQ8A 1A0QL 3HAEB 1IC7H 3LAFA 3HR6A 4E41B 1OW0C 2NX5A 5TDOA 1VFAB 4OZGB 1ZE3C 3NCJL 1HI6B 3HMXA 1MCKA 4M7LH 3NCMA 4PJEA 3T3PF 2A6IA 3QXVA 5I73C 4BZ1H 1IC5L 1VEMA 2NY1D 1NKRA 3BPCB 4L3CB 4LSQL 1P1ZB 3BKML 4YHKH 3QT2A 2DMBA 5HYJA 1IM3A 3DXAE 4LSPH 1P2CB 2ZNXA 3R0MA 5D5MF 2B0SL 4FFWC 1HQ4B 3PDGA 3RZCB 4LSVL 1XGPA 1AC0A 2Z31C 4AL8H 1RJCA 4FG6C 3DGGA 1QD0A 5IHUH 4XXDB 1NMCB 3PNWA 4CUCA 1S7RB 4ELMB 1V7NL 1HKLL 1GPOL 2BY2A 1FG2A 4ZOBA 4Z78B 3WD5H 1R3HA 3DXAD 2V2WB 3EO9L 4AG4H 3DRTB 3P4MA 5MEQB 3VA6A 1JF6A 3NACH 4JY4B 5GZNC 1XGTB 4XGZB 2IFFL 5EOQH 1EGJH 4LRIA 5FGBC 4X0KA 3HUJE 4RRPG 4IJ3B 5MEPA 3MRQB 2F19H 4ZNEA 5CD5C 2J8UB 2VDRL 3FOMA 4PJFA 3G5YB 4KTYA 4OSUL 3GSWB 1E4XH 2GAZB 1IAIL 2F8VA 3QQ4B 2B8OT 5I1LA 1WUNT 2BSED 4Y5XC 5LGHH 5INDB 1OPGL 3N1PC 1ZEAH 2R0ZL 4FNLL 3KPLA 5HHME 4JO2L 5IK3A 4NHUA 4ONHB 3GKWH 3GRWL 4QRTB 1NDGB 2RCSL 1T6WA 1E4XI 5GRVK 3WCYA 1S9YB 4YDIL 1JE6A 5HHMD 1IGCL 1E0OB 1R5VB 2FLBT 3UBXI 4YDKH 3SY0B 2HLAA 3VXPB 4XNQB 5I1GL 4L5FH 3GSQB 1MI5E 3OXRA 3IAGC 2UY6A 5TH2B 3JZ7A 4TVPH 1JYVA 3U48A 3FB6A 1CXKA 2A9MH 1B0RB 4L9LB 2VZOA 1AXTL 5AD0B 5FO7B 5GGRA 2O61A 3RJDA 1HHKA 5AG8A 1J8HE 1WGOA 1UENA 3FFCB 3QEHB 1BEYL 1OAXH 3FT3B 3H9SB 5IW1B 6FABL 2G2RB 4XTRC 1I1RA 5F9JA 4YFLF 3AU1B 3ILQC 3FFDA 4WTZA 1RULH 5I66B 1XEDA 5FGCB 2XWBA 4JFHD 5DJ2A 3NOIA 3PWVB 5FHAL 5IHZA 5GS1C 1YPZE 4M1CD 4XB8A 3IXAB 5ITFB 4LGSB 3KPNB 4LCYA 2F53A 4O2EA 2EXWC 2DI9A 2XTJE 3BKJH 1A1NB 3EFFB 5I1CL 4E41E 2FLRT 3BHBA 3WNOA 5D71H 3HI5H 4LF3B 1D5XB 1IAKA 4ONFH 3BSZH 2MWCA 1UFUA 1RVFL 2XWTA 5C8JA 1IARB 3TT1H 2P44B 2YEZA 3W9EA 5D1QB 4MQ7B 3ULSA 4XVUD 5B39G 3MRHB 3HE6A 5FV1L 4M8QB 4JG1L 4P9HL 5HHNA 1T1YA 2BDNL 2JJSC 1T7WA 2EDHA 4AMKH 1DCLA 4L4VA 1LILA 4KK5C 5CSBA 3FRPG 1JTTA 5JXAL 1RUKL 3MRMA 5BXFB 5IVNA 4UOW0 5HI4D 3SCMB 1YEDA 3B6SA 1SBBA 3UO1L 3WS6C 4IS6B 1KB9K 1ZA3A 4ZYKA 2QQNH 4D3CL 1I1AA 3NZ8A 3HMXH 4QRSA 4MXQD 4KGLA 4LEXL 4PJFF 4YFLI 4DQOL 1ZT1A 2QR0A 3RBSA 1CE6B 1FYTB 2J8UE 3FCTB 4XNMA 1J1PH 1TJGL 1MCBA 2ZCHL 4K8RH 1IGIL 4KK9D 1QNZH 3U1SH 5DJ8A 1NFDB 2FX8H 3MRNB 4JLRA 3W0WB 4PB9L 5HBBA 1JWUA 1SJEA 3GBMH 3I3BA 3LMJL 4HQQH 2NZ9D 2N4IA 2DWDA 4O9HH 4EUPB 5KVFL 2RB8A 3L5XH 3VFPB 1T1XA 3CU1A 1EHXA 4J4PD 1CGSH 1G9NL 4PJGA 4WWKB 1GAFL 4PBXA 3KS0J 3JSSA 1FLRL 5CLWA 5HSFA 2BSSA 5K9QG 4ZAKB 4PGJA 2V5YA 5I8CB 3GSVA 4GXVH 3VXMB 1DBJL 4MLIA 3SGEH 4XP9H 1E4WL 2ESVA 2C3XA 4N8VA 1G7PB 3KJ4C 1F4XL 1A1MB 1QSEB 3K80A 1D3CA 1KCRH 5D1QC 3S34L 2GJ6A 4I4WB 5BRZA 3RVTD 1U8OB 3BQUC 5ID1A 2VLRA 3BWAB 1A9BB 3DHJA 3TIDB 4IOFC 1OAUL 4LFHG 3H7BB 3H9SE 1OSPL 3QNZA 3F6IA 3RVWD 4BQ6A 2FGWH 3UMTA 4Y2DB 3SCMC 3VG0L 4EJ1C 4WV1A 5FGCE 2BOCB 3LS5L 3TT3H 1XF3A 3PWNB 4KPHL 1QO3B 4OIAA 1MJUL 3VXOA 4LSUL 1OHQA 3MXWL 1CT8B 1TJIH 4MCZB 4KDWA 1KEGL 4BQBA 2NX5B 3OMZA 4XZUA 3LKNA 4X4YA 1YEEH 4EIGB 5DR5H 5E4EC 2NQCA 3OB0H 4OGYL 5IJKA 1YYML 4Y5YA 4GBXC 5GRYA 4PJEB 2DIAA 2A6IB 3P11H 1YEHL 3I2CL 2PKDA 4M1GL 2OTPA 2DICA 2P1YA 2X1QA 5CP3A 1OP5H 4KY1H 5FKPA 3CC5B 3QWOA 3RAJH 5JQ6L 1IM3B 5A2KH 5HI3D 2XKUA 3B5GA 5FYKH 3ZKMC 4XI5C 1A7NH 1IVLA 4R7DA 2DQJH 4UOW1 1D5BA 1XGPB 4WWKC 1KXVC 4LPVA 3LQAL 3DGGB 3V0VA 3VW3L 5EU4A 3CU7A 2X70A 5FA3A 5JIPA 5SX5H 3PNWB 3CSGA 2MMXA 5GPRA 2DBJA 3ZYZA 1BWMA 1A0QH 4XCCL 1KXQE 1T04A 1FG2B 1QVOA 1G9EA 3W81A 1R3HB 2APTA 3PXHA 3P4MB 3NCJH 3R8BB 3EYVA 1M05A 2V9RA 3D69A 4GQ9H 2FX9L 1IC5H 4M4PA 2C3VB 1CFQA 3MUZ1 4LSQH 4X0KB 5D8JL 3BKMH 3BD5A 1VFOA 4J3WA 2VLLA 5D7KE 1FIGL 1DQDL 3S7GA 1OTSD 3EFDH 5DVMA 3KPSD 2B0SH 3OKYA 1MFAH 2MJWA 1GZQA 5I1LB 1G9MH 5GSVA 1TNMA 3W0WE 4Y2DC 1V7NH 1DBAL 3QFDB 5DRZB 3MJ6A 5IK3B 4NHUB 3WUWG 4MSWA 3QDJE 1G84A 5EUOE 1IE5A 3EO9H 2Z8VC 4URTB 5GJSL 3WFCL 3RWHA 1D9KC 1AFVL 4OZHF 3ZYIA 4NQCE 4WGVB 1FGNH 2X4QA 1I9IL 1MFDL 4MNQD 4JN2A 2HLAB 4OSUH 4J2XA 4BM7A 3H9YA 2R29L 1QSEE 1T20B 3QUKA 1OPGH 3HG1E 3FB6B 1YEJL 3TN0D 4NZDA 1SM3H 5E6IA 5C1MB 4KZEL 1GHFH 4NQCD 4YC2C 5GGRB 2HT3D 4K8RC 3SEPA 3GHEL 4HKJA 4LLYB 5F7FA 3V8OA 2O61B 1HHKB 1KNOA 2EE9A 1E4KA 3GRWH 4HIJA 2NY3C 4GRMA 2RCSH 5F9JB 1KB5H 3I9GL 4HLZH 1JMZA 4HWBA 3PABA 2X41A 4OFVA 4ETQA 2IQAA 2XWBB 4W6YB 5DJ2B 5IHZB 1SEQH 4XWGL 1UQSB 3VD5A 5F7UA 4RAUA 4KDTA 3HZKA 1WZMA 3L95A 3MJGX 3K4AA 1I8KA 4LCYB 2F53B 4J8RA 4O2EB 1WFOA 2MOVA 1G7LA 4LRIC 4LKCA 3OJDA 1A6WH 2ICCA 2YD6A 3T0DA 4G6MH 3WLWD 1A3QA 3TNMA 3BHBB 4HUMB 3QDMA 4KC3B 4E5XA 5BO1L 4EI5C 1DEEA 2XWTB 3H9HA 5BJTA 5C8JB 1OD7A 1H5BA 2YEZB 1X9QA 5EZOL 1RAMA 3PWJA 3ZSTA 2Y4SA 3NFSH 4PRBA 3W9EB 3ULSB 3MRPB 4K23L 2BHZA 3GJFA 2R0WL 4H88H 1T1YB 1YNLL 4PPTA 5IG7A 4MQXC 2BVPA 4U1KA 4L4VB 2KDGA 4O4YL 3V7AE 5EO9A 3HNTH 2ZCKL 3MRMB 3T08A 1ZHBA 3RL1A 1YEDB 3B6SB 2OL3A 2YS4A 2KPNA 2V9TA 5F21B 1DQML 1ZA3B 4ZYKB 3F7YA 3OKOA 4NC2B 3I6GA 1I1AB 1JYNA 3KS0H 4QRSB 1RVFH 1LHZA 2YWYA 4GO6B 1U92A 1IGFH 4H1LH 3BMVA 1AC6A 5FYJE 2R0KH 1ZT1B 1JGUL 3FTGA 4P59H 5CP3H 1A6VH 2IPKA 4JG1H 1ZTXL 1IKNA 1XMWA 1GGCL 2VZUA 2BDNH 1JGEA 3DVFA 5C3TA 4XHQA 5DJ8B 2CJUH 4EVNB 1QLFA 1RUKH 4JLRB 2Y5TA 3VFOA 3NZHL 4N5UA 2M1KA 4XMKL 2J2ZA 1LEGA 3D2UA 2FEEL 4JQXA 4A6YL 2DWDB 4JDTL 4CL7A 2Q7YA 4JKMA 1T1XB 4FQXA 3BFOA 3DX7A 4PJGB 3ARSA 1QRND 5TQ0H 2X89A 4LEXH 3RY6A 1UXSA 4PLKD 3L7FA 3WJLA 3GSVB 5D70H 3E8UH 4DQOH 4GS7B 4H0HB 2ESVB 5IF0A 4P57A 2R56H 2AEIT 4N8VB 3FQRA 2CDEA 3ARTA 1IGIH 2XIDA 2AJXL 2W9DH 1JWSA 5DHXB 3SKNA 1NCUA 3H0TB 2GJ6B 4KKLD 3ULVE 5BRZB 4OF0A 5BV7B 3HE6C 4PB9H 4XPTL 5TE6L 4PJ9A 5ID1B 4I8DA 3SGJA 2NPLX 3WIIL 1L7IH 1A7RH 4RGOH 2Y25A 1RZ8A 4TQEH 1G9MC 3QNZB 4H25A 1FLRH 5EWIL 3K0WA 2EDLA 1FZKA 1ONQB 2FBJL 4G8EB 4WV1B 2KZ1B 2EDRA 3U4AA 5CZVL 2R15A 2QL1A 3LIZL 3CXDL 5KVMC 2HFEA 5DMKA 3B3IA 1DBJH 3SKUD 1YC8A 1E4WH 5DI8A 3QCTL 4HGWA 1U6AL 3VXOB 1UZ6E 4KI5E 5DZNA 3G08B 5CINH 4KRMB 5IB4A 4ODSH 3S34H 4WHDA 5F96H 4XZUB 2VB5A 3LKNB 4D8PA 3O2VH 1P5VA 4Y5YB 2YD7A 4NUGH 1OAUH 4KI5D 3UYRH 5ECJE 3DUUA 3V6FA 1OSPH 4HPOL 4LP4A 3L5JA 1RIVH 2ITCA 3DMMD 5GGSY 5FKPB 3VG0H 3DROA 3MBXH 4FFVD 1Q9KA 3LS5H 1G0DA 5MEOA 4KPHH 4R7DB 4QNPE 3IXTB 3MGOA 2VDKL 3P0VL 2EO1A 2CPCA 4LSUH 5EU4B 5FA3B 2COQA 2X70B 1AQKH 2J8OA 1N26A 3VGGA 3MXWH 3KPOA 4TRPL 3VGHA 1T04B 2UY7A 5EBLA 4I3SL 1FJ1A 1TTGA 3O3BA 1KEGH 3B5HA 4NBZB 5IMOA 3T0AA 4KKBD 3D39E 1RZ7L 2AI0L 1I3GL 5ICYB 3EYVB 3DYOA 1M05B 1A3LL 1C5BH 3D69B 1OTTD 1JHLL 4M1GH 5IR1A 1S5IL 1CFQB 2I5YL 1JNJA 1CG9A 2X9YA 3CFEA 1LGVA 3RFZC 4OM1L 3AS0A 1UA6L 1AKJB 3D39D 3QA3A 4F2MA 4NP4H 1BJ1J 2HN7A 5AZ2L 1GZQB 3PDOA 1N3NA 3NFPA 4JHAH 2XYCA 4ZXBB 2HVJA 3QG6A 5FYLD 4WV1C 4XCCH 2OL3H 4YXLH 5GJTL 5H37G 4MSWB 1DVFA 4M03A 4MA8L 4LIQL 1DDHA 4YEEA 4OZIA 3QRFM 1F2QA 3BDXA 3RWHB 3OKNA 4MA7L 1B2WL 1N64H 1KJ2L 2APFA 2X4QB 3IDXL 5K59E 3JV4A 1ORSB 2YHGA 3LB6D 3IU4H 4MD5B 4JN2B 4RFNB 5IJKC 3GM8A 4Y5YC 1FIGH 1DQDH 4X83A 2HLFC 1Q9LA 3Q0HA 4KQ4L 3KPTA 3QUKB 4KMTL 5DGQA 1N5YL 3VFTA 5F7WC 3F8UB 5BRZE 4TNVF 1J05A 3HHRB 4PG9A 5E6IB 1XIWD 1P7KA 2QSQA 2C1PA 4HKJB 3LN5A 5F3BA 2FH6A 1KNOB 5CBAA 4DZBA 5JO5A 4HIJB 4NHCL 1U58A 2VE6A 3BP6A 4MQSB 4GRMB 2NR6D 1NANH 4F7PA 1Z5LA 4GQPH 3WFCH 5FM4A 3UDWA 3PABB 2GFBA 4OD1H 4LNVA 4ETQB 2IQAB 3A6BH 3OF6D 1KV3A 5FDYA 2B4CH 1MFDH 3G04A 4RAUB 3HZKB 3L95B 1NCNA 4NUJA 1I8KB 5C0AE 2R29H 1G7LB 4GKNB 3OJDB 3HE7D 1I7UA 1GOHA 4PLOB 5D1ZD 3TNMB 1YEJH 4NFCA 1MLBA 3TJHC 3TBYB 3KXFD 3QDMB 4E5XB 4PRHA 3H9HB 4Z77A 2ORBL 1H5BB 3AGVA 3PWJB 1QFWL 5C0AD 4JHWL 5HVGB 3QCVL 4L3EA 2UZIL 3GJFB 2HWZL 5IT2L 4F8TA 3ESVF 4FQ2L 5IG7B 2ZUQB 4IRSD 1WAAE 2X9WA 4U1KB 4TN9A 1QHOA 1ZVHA 1IKFL 4S1RL 1NCCL 1L9NA 4M62L 1ZHBB 4OZFA 3RL1B 2WIIA 2AJSL 5I76A 4PLNC 1PY4A 1NGYB 1OP9A 3B9AA 3F7YB 2FEDD 1UKQA 4ODHH 3I6GB 3STZA 4DJMA 4RFNC 3ZKSD 3L3KA 2VABA 4PGZA 5FM8A 3D48R 3L3OA 1NAMA 3EHBD 5ABDE 4FQJL 2H2PD 2DJ4A 4K23H 3FTGB 2IPKB 1A3RL 5E6IC 1EZVY 4R26L 1P84J 1KN4L 1CK0L 1JGEB 5DWUL 4O4YH 1RHFA 4MB3A 2QKIA 1E4KC 3R4DA 4HUKB 5C0DA 1P7QD 2IAMA 1QLFB 2Y5TB 3ILPA 3OB0K 1LEGB 5IMMB 4KKNA 3D2UB 1H3XA 3D87B 1FE8H 4JM2D 1YY8A 3DX7B 1JFQL 2R69H 3QCUL 1OP5K 4HK3N 5TF1L 3T77A 1UXSB 1N6UA 3L7FB 1G7MA 1V7ML 1DN2A 4WTXA 2Y6SD 4G3YL 4YJZL 4LASL 1ZTXH 5IF0B 4PRPA 2WZPD 1GGCH 5MHSD 3U4EA 5EA0L 3FQRB 1WK0A 2IANA 1H5BC 3DBXA 2AP2A 3CMOH 3IETA 1JWSB 4I0PB 4YFEA 3SKNB 4YHZL 5JDSA 2MKLC 3NZHH 1O5DT 3PP4H 1JUFA 4XMKH 4YHLL 5GGQL 1XFPA 4PJ9B 4JDTH 3PV6A 2ZUQC 1OGAA 5DURB 5E9DE 4YGVA 3K2UL 1X5YA 1RZ8B 1KCVH 4CRPA 4H25B 1J0HA 4LDEB 4RGNC 1FYHB 4MNHA 2CUHA 2VXTH 5DTFA 2LU4A 2VZTA 3OGCA 4XWOD 1AH1A 1FZKB 1A4JA 3I3EA 4N0FA 3G6JE 3TFKC 2HFEB 5DMKB 1EDQA 3B3IB 3ALXA 4O02L 1CLYL 1UWXK 5DI8B 5DUML 4OCRL 3G9VA 4O2FA 5E9DD 4UI2A 2IF7A 5IFHL 4WI7A 3O2DA 2A77L 2OR7A 3C8KA 1KN2L 1R6VA 1G7JA 3RVXC 5IB4B 3PDDA 1NAKH 2PXYD 1MIEL 2X1OA 2OBGA 4XPTH 2A1WL 4D8PB 1YEGL 1IKNC 1PW3A 3BP5A 3EYFA 3Q6FA 1KCUL 4LOUD 3QDME 1ZK9A 2DQDL 5HVHC 3GSUA 4D2NA 3H8NA 4XP5L 4Z9KB 1UM4H 5KZCB 1UB5A 3C60A 3DUUB 2L4OA 1FZJA 3B8SA 4LQFL 5JR1H 3MACL 4U2ZA 1C12A 4M5ZL 5EWIH 1MCWW 2ITCB 3DROB 4RSVA 2FBJH 4P5KA 4ZUWB 3BEWA 1QSFA 4JQXC 3RJQB 1GJIA 5JMRA 1J11A 3LIZH 4R9HA 2EE3A 3CXDH 1Q9KB 1BJ1H 4FQXC 1WF5A 3MGOB 2NXZB 3PIQB 4M7JL 1U6AH 5I75B 1RUPH 3D0VA 4GW1A 4KV5F 5F3HA 5D7SL 5SWSE 1UCBL 3VWKA 3KPOB 3RY6C 1SMOA 2A38A 1MCCA 2WWKT 5EBLB 1FJ1B 2B4CC 3O3BB 3TPUB 3CVHL 4GKOA 5IMOB 5C6WH 3KLHC 3IAQA 2PO6A 3LQZA 1QHPA 4JPIA 1HIML 4R4FH 1MAML 4YBQD 5IR1B 2YRZA 5SWSD 1CG9B 2A83A 1CICA 3CFEB 4PJ9C 4TPRH 5T33L 1CN4A 1G6RL 3SGJC 3TBWA 4LU5L 1H9VA 1MREL 3QA3B 4F2MB 4HG4J 2HN7B 1J12A 5F6IB 5IVXF 2VDKH 3P0VH 3MRIA 3NFPB 2HVJB 3W2DL 1EO8L 1DUZB 2ZUWA 1TPXB 5F97E 5DD3H 1GGIL 4QHUA 4FZ8H 1LEKA 1DVFB 2OK0L 2IMNA 5DJZA 1XF5B 5CJXA 4OZIB 3IRPX 1X3DA 4V1DE 4XVSL 3I6LD 3OKNB 2FBOJ 1JZ6A 1NAMH 2I5YH 4W6XB 4EQ2A 3FQTA 4S1DD 4PJCA 3GI9H 3JV4B 4ETYA 1WSST 2ITDA 4OM1H 5C7XH 1FAIL 4HH8A 4IM8A 3P3YA 3CK0H 5AZ2H 3RWCA 3O4LE 3VFTB 2WAHA 3WDIA 3DURA 3MA9H 1J05B 1PLGH 1P7KB 3QUYA 2DJUA 3OPZL 3B9KA 1G7IA 2C1PB 5GJTH 4YHNB 3LN5B 1JI1A 4G6FD 5F3BB 4MA8H 4DZBB 2IG2H 5HTSA 1U58B 2VE6B 1CXIA 3BP6B 4LIQH 3RDTA 4LCUA 4F7PB 4YBLB 4Y1AD 3O4LD 4MA7H 1FVEA 5L7XH 4PJ5A 1B2WH 1T03L 3P9WB 3QDGB 1P4IL 2KH2B 3IDXH 4K3JL 2WM0A 1ZLWK 3G04B 2VH5H 4APQC 3BPOC 4PRAA 4KQ4H 5FM5M 3EJYC 1BFVL 1N5YH 5F7YC 5KVEL 4FP8L 4YR6A 2G5RA 3Q48A 1MLBB 1U41A 4LPTA 4KZDH 5A16A 3DV6A 1UACL 4PRHB 4Z77B 2QHLA 5F6IC 5B4MD 3ZKNC 4DN4L 4UV4L 2UZXB 4R0LA 1A4KA 3QIBA 1Y0LA 4XVJL 1T80A 5C0BB 1U3ZA 4L4JA 4CMMA 1TPXC 4WHYG 2WMPA 4XBGB 3QFJE 4DVRL 2A0LC 4NCDA 3FMGL 5I0DA 3GMLA 4PJ8C 1UM5L 5J3HD 4RFEA 4FTVE 4ZG1A