2DTSA

Crystal structure of the defucosylated fc fragment from human immunoglobulin g1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
211
structure length
211
Chain Sequence
b'LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structural comparison of fucosylated and nonfucosylated fc fragments of human immunoglobulin g1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dtsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dtsA01
2VH5H 3RZWA 2COQA 5C9KA 3MRNB 1MJUL 3GMMB 5K59F 3LZFH 1RK1A 4PGBB 1TCRA 5JW5A 2BZDA 5KSBB 3UAJD 4XNZC 1VPOL 4D9RE 2P24A 5IW1A 1I1FA 2Z91B 5FO9B 5DJ8B 3I6KA 4GMSL 3X12B 5FYLH 4E41B 1IEHA 1T0NB 2FEDC 2HLFC 2P1YA 4OB5H 3VH8B 1A6TB 4X99A 1F58H 1OTSD 2EIBA 2N7AA 1JZ8A 4Y7MA 1N3NB 3LV3B 4KHXH 4YBHA 5D93B 3RGHA 3L3KA 2XTJE 4GXUM 2DIAA 5MENA 2AJZB 2VSCA 3KYMB 1EHLH 4HXAL 1HXMB 1DP0A 3L95B 1MWAH 3O8XC 2O61A 1P4BL 4Y8DC 3OGCA 5HDLA 4PV9A 4PRNA 4ORGA 1G7MB 1CF8L 3QWOA 3ZTJH 1QLEH 1W8OA 3WSQH 3CSYA 3GKZA 2OR7A 2J8UF 3FN0L 2EDBA 2ZZUT 2QR0B 4XWOD 2A38A 4TNVK 5J8OA 3F6LA 5DMGD 3KNBA 5LJYH 2BHZA 3GHEH 4MYWB 3CFEB 3ZDXE 3WN5A 5CJBA 2APBA 5B39G 4YGAB 4KUZL 1WV7T 2E7CA 2BNQD 3FCTA 4JFXA 3HG1A 1MHHB 1G9MC 5C0NC 4PJHA 2NY5L 3MXVH 5DUML 3BYYA 5FECB 2X4RA 4ZS7H 3D3VA 1M1SA 3U4BH 4NN5B 3C5ZD 5D1QB 3ESVF 1I8MA 2YA0A 3NABL 1GAFL 2VLKA 4PRIE 4M3KB 3AREB 1MIEL 1INDL 4Z76B 5IB5A 4EI6B 1F11B 3MRPA 4XRCB 1SM3H 3OKLA 2A73A 3QIBC 4PRPE 4XBEL 5EOCL 4WDIA 5HYQB 2NW2A 5I8KL 5D8JH 1ERNA 3QNYA 1E6OL 1XR8A 3RUGF 2VKXA 3C8KB 4PGCB 4NIKB 5CD3A 5EU6E 1MOEA 2Z9TA 3U36A 2M1KA 1P4LA 4MNQD 1MJJA 4MHHI 5CEZL 4OD2A 5CSZB 4WI9A 1DEEB 1QSED 2R0WL 1KYOK 4M4RA 3IFLL 2XFXA 4NC1E 5JTWA 4G6ML 3KPSA 3KPQB 4UT6L 1A6VL 1IM9D 3HNTL 5FA4A 1F5WA 1D5XB 1G7HA 1T7ZA 2D7NA 4PLJD 4GKZA 1ZTXL 5J13C 1JGEA 5M95B 3GSXA 1KTLA 1T04A 2ADJB 1YYMH 3FQTB 2W60A 4EN3D 2FR4B 1RFDL 1DUYB 1ZSDA 1V3LA 4YHKL 4W6XB 3Q48A 3MGAA 5EUOB 1B4RA 3F7RA 4U05A 3L7FA 2GTWB 3TNNA 2VZTA 2X4QA 4NQDA 2D9CA 2N7BA 3IJSA 1PZ5A 2Q3AA 2XNAB 2FRGP 3HFMH 4LLQA 4MQXD 2Y6SD 4M48H 4G6AC 5KOMC 5GIRB 1SJEA 1MFDL 1BFOA 1F90L 3ZT7A 2I24N 1U8PA 4IRJA 4LKCA 2RGSA 2QHRH 4NBXB 4UUJA 1TPXB 3Q6GH 5DURB 3BH8B 1KB9K 2R23B 2E8YA 2MWCA 3AGVA 2YPKB 4WWKA 3TH3T 4H8WH 1A4JB 3UTZB 3IVKB 3TT3L 3U2SB 4E9LA 1CGUA 1EZVX 4L8DA 5F44A 4Z7UE 3HRZB 1F02I 3HUJB 4G7YL 4L4VB 2D7TL 2HVKA 2NYYC 3I50H 3RY4A 4OLUH 3KLHC 4DGVH 3H9HB 2A9NL 1NJ9B 3HNSL 4Z18A 4WI3A 4KJYB 3OXSB 4JG0H 1RJZA 3CFBA 1PY4A 2A1WL 3GSOB 5ITFA 1KXQE 3DHJA 5C09E 4J12A 3E6HA 3MGOA 1DBKL 1A1OB 1PFCA 4XAWH 2NPLX 1G1CA 4PJAE 2VO5A 1RU9H 4PB9H 5JW4Q 1NBZB 2MKWA 2E7MA 3TN0A 4P23B 4KKLD 3MFFA 1ZGLM 5IW3A 2E27L 2W92A 1G7LB 3PJSB 4LVNC 3BGMB 5GS1B 4OZIE 1OAYH 1G6RA 2BXYA 4NZUL 3ZDYF 4KRPD 4W6YB 5F1IB 1J8HA 3H9SE 3ZE1F 5C9JA 4XZUB 3EHBC 4X9IA 5EIIB 1EUUA 2DMCA 3K4ZA 4BQCA 4ONGH 4V1DA 4JFDD 1CL7L 3GJEB 1C8PA 4NSKA 3T4AB 2DLFL 4QTHB 1JGDB 1VGEL 4HH9B 4PREA 1TVBA 3D2UD 2FJFA 2DM2A 3WS6C 5J89A 1A7PH 1KCRL 4WIQA 3OG4B 3TH2T 1FYTA 1OGTA 2WIIA 3H3BC 3NTCL 1GZQB 3S36H 3KDMB 3U30C 4PG9A 3ZKMC 3GMLB 4PY7A 1G6RL 4YHZH 1FZMA 1LEIB 3QIUC 2YOCA 4WUUE 4NUJB 4ZFGL 5SWSB 3EO9L 4QKXB 3ULUF 4Z7WA 1KOAA 5LGHH 1M05A 4LSTL 4YEEA 3RDTB 5E5MA 3CFKA 1FH5H 5K59E 2MNUA 5F88B 4PRDB 3PHOA 4X7CC 1T1ZA 3QDMA 5LG1A 1BVLA 1RURL 3S5LG 4S10A 5CEYA 2ZSWA 5CLTA 4KMTH 5SWZA 4KAQL 2ICCA 3ULVH 4LHUD 3UO1H 2GJZB 4FQCL 2BOBB 4ZUSB 2X1OA 5GZOC 1H8SA 3FT4A 4ZAKB 3EYOA 3CVHA 1FP5A 1I7RA 3D48R 4EBQL 3S37X 4ZOAA 2WZPD 4AG4H 5C0EB 3Q5YA 3ULUD 3MNVB 4PRHA 1PX4A 3SE3A 4LCIH 3UXFA 3Q6FB 2CIIA 3KLAA 4NZTH 4MDJB 4BQBA 1N5YL 1JRHI 2R15A 4TUKH 2GAZB 5K9KB 1WFNA 3U9UB 3IDUA 4NRYA 1GJIA 4H8WC 5FA3B 3W9EA 1AD9B 2P48B 1G7PA 4OLYL 5DD1H 5CILL 5IMMB 3O3EA 5EUKA 4MQ7B 2MCG1 2PYFB 2J8UE 2AQ2A 1UWXH 2ATPA 3HNVH 2WWKO 3F58H 4ODTL 1P7QB 1OLLA 4XNYH 1CLOH 2F9BT 4S2SA 5ALCH 3CVHL 5E9DD 5I18H 5F6HI 2CH8A 1JPGA 3CPLB 4RAUA 1S5HB 4KV5F 1ZA6A 2EO9A 4CL7A 1X4ZA 1CLZL 4OI9A 4Y5VA 2OMNA 3C5SA 1HH6A 4QYOA 1GC1L 4YDIH 1NCDL 2Y1VA 1C5DB 3H42L 5C0JA 2VXSH 4CDGC 5DRWA 1Y0LA 1FLRL 4JPVL 2QSQA 1CFVH 3NFSL 5TFSL 4MNQE 3L5HA 2IAMA 3CXHJ 3ARDC 4LLWA 1PX3A 2WAHA 4FFVC 5TGBA 3O6MH 4LLVA 4XCFH 1DQML 3PP4H 1HILB 5EU3B 1WWBX 3JVGC 3T0EA 4GAJH 1I7TA 3NPSB 5DHXB 1GGIH 4Y1AB 4RNRB 3VXTB 1A22B 1AGFB 4JZNB 4OFPA 1LO0H 4GRLD 5J1AB 3RUGE 4PJCF 3SDAD 5KSBF 3KR3L 3Q3GB 5DFVD 4LCCA 5DD6A 2XN9B 2IBGA 3MPCA 4O2EA 2B4CH 3AS1A 2X42A 4JQVC 4WV1C 5H37G 2ESVD 3VW3L 1J12A 1TVDA 4N1HB 1HHKA 4ZO6A 3HR6A 4Q2ZB 4Z7OE 5HGHA 2E6JA 1MRFL 3KYNA 1IGIL 3BPNC 5FGBA 1MCDA 1EUTA 4M62L 5LGKA 4ELMF 2H8PB 4Y4FB 5F9JA 1UZ8A 1P69B 3ZO0A 4KJQD 1B0GA 4NM4H 3QCVH 5IWLC 4I0PD 3E6FB 5HD8C 3VJ6A 2E9WA 2R9HC 3BW9A 2F19H 3B83A 5HDOA 3IDNA 1KLGA 4OFKA 1A7OL 3VWKC 1T66C 3G08A 1V05A 4FQIL 4JREB 3P77B 3O6FA 2F53D 4K94L 5MERA 2Z8RA 4U4BA 4ZOEA 1I8IA 3FO0H 4GG6E 1FC2D 4GMSH 3WKML 2CD0A 2D9QB 1JNJA 4DFHA 1LWRA 2BVOA 4JM4L 2DWEB 2X4PB 5CJ5A 3GSNA 2R29L 3U7WL 4WI7A 4Q74A 4HS3A 4MA7H 3MJ6A 4HC1H 3HZKB 3ULVC 5DUBA 1CFTB 5D7IA 2R4RL 5HGDA 1NL0L 4NRXB 3GMQA 5BZWA 2FWOA 4J8RB 4U1LB 2P46B 3WLWD 4U6HA 1ITBB 5IQ9B 4X7TA 5GXBB 4OF7A 1BVZA 5EC1A 4Z8FL 4HS8H 4WJ5B 2Z92B 1J1OL 4LIQE 3RVWD 4G9FD 1CF8H 1OL0A 3QHTC 3LS4H 3DRTA 4JPWH 2AXGB 2VDPL 3EOAA 3KPMB 5J3HD 2NY0D 4OF8A 2BMKB 3UTOA 1FGNL 3STLB 3BPCA 4RQQB 2XTLA 2A9ML 3J7HA 1QVOA 4X98B 4CRPA 1ZS8A 2RJMA 1G0YR 3RWIB 4M02A 3NZHL 3GSNL 2OSLB 1SVZA 4HS6B 3B8YA 1AC0A 2AEWA 3TCXA 5DRXA 1YNLL 3UJTL 1KJVB 2VL4A 2WINB 2J5LC 5CMAA 1VA9A 2LQRA 2VLJD 3FQRA 3HE6C 3MJ7A 3C08L 3BKJL 3WXWH 4XP1H 3VXUB 5GGVL 4RAVB 2NW3A 4DGYH 4RA3A 5F1NB 3P4OB 4PJ9C 3PF2A 4RSVA 1K4CA 5F72S 4QO1A 1GZPB 5JUEL 5E2TH 3SDDA 3TJHD 5BQ7A 3ZDYE 2J8OA 4UTBH 3MZGB 3VXMB 3ZE1E 3N85H 3T0VA 2BSSA 3LB6C 4ALAH 4KQ3H 2DDQL 1DQDH 3ZMRA 4NKMB 1E4XI 1OAKL 4RWYL 4YQXH 3G9VA 3GNML 4HX1B 5B22A 4YFEA 4CBPA 3KYAA 2CLVB 4FNLL 3BISA 4KTYA 1CICA 1OT1A 2H6PB 4PJDB 3T1WA 2XWTB 1ORSB 2BVPB 2VISA 5D4QA 1H3PL 3NH7L 6FABH 1WEJL 3FFDB 4LLUA 2XZCL 4U6VH 4RZCB 3MNZB 5E08H 3NCBB 4PUBL 1HN1A 4FQQA 2GSIB 4IMKA 2B4CC 5EH1A 2FL5B 5GGSB 5KS9A 2CR6A 1R5WA 3WLBB 4NKQB 3VG0L 3V6OA 3QA3A 2VERN 3X13A 4JHAL 2P8LB 5C0DB 3LRHA 3M07A 1L4IA 5C8JB 1T5XB 2D03L 2VR5A 5CUSL 5AZEL 1YEHH 1KCUH 2IFGA 3LN4A 3K2MC 3KG5A 3ILPB 3V5HB 2MQCA 4A6YH 2DQUH 3GDBA 3ROLA 1WIOA 1BAFH 4YPGA 2AK4A 5GRUL 3ULUE 2FEDD 2HLFD 3OAYK 3PNWA 1U91A 2VDRL 4EOWL 4HEPG 4DCQB 1EFXD 4OF3A 1LEKB 4F9LA 2PETA 4NGHL 1K4DA 1XR9A 1XGTB 3DX8B 1U9KA 3O8XD 4ZPVB 5ID1A 3RTQA 5JPNB 4MSWA 3UTSD 1EJOH 3BRGC 1F90H 2XQBL 5DVNA 4U1KB 3T0XA 3WIIL 1PY9A 1WWWX 2MHAA 1NGWB 4K7FA 3STZB 4L9LB 3QRFM 1N4XH 5MEPA 2Z31C 1P1ZB 5E9DE 2FGWL 1A2YA 4LAQH 1DQJA 1I1AB 1X5XA 5I71C 3C6LB 1U92B 1IM3A 4DN3H 3TNMA 2IWGA 4F80A 3MRMB 2PNDA 4PJXB 3CXHK 4Z7VA 1P6FA 5C0ND 4XC3L 4P5KA 4XPBL 3OKOA 3KYKL 4FTVB 3BUTA 1QR1B 1JP5A 1YZZA 1NFDE 2BVQB 4FXGA 2X2YA 3KXFD 5EORL 2G5BA 3ZHKA 4UOJA 5HHQA 1OW0A 4EUPB 5EWIL 2OP4H 3SOBH 4ZMAT 1ZGLP 4NC2B 1IC7L 3QXWA 1T5WA 3CDFA 3QIBD 3IAQA 4I2XE 4KV5E 4XAKD 5EBMB 1D5BB 2YPLB 4HGMA 4X8JB 4IDJL 5JW4N 3CH1A 5D7LB 2H2PC 2CLZB 3P0YL 3UYRH 1G84A 2A83A 1Q9OB 1RZJL 4LVHC 5ADOH 2NNAA 4NN7C 4NT6A 2EIDA 2GJ6D 3LD8C 4UIMB 2ESVE 1MCBA 4PB0H 3WMSA 5DMKA 4IOFC 3U9PL 3GSWA 1NAMB 2YD9A 4QNPF 1TENA 1YEKH 1OM3L 3T8XB 3C5JB 2F74A 1VGEH 2AJVL 2ZOLA 1IAOB 3HRPA 5FUCE 3WCYA 4EVNA 1AKJB 2PXYB 4XNXL 5ICXB 4ZSOE 1JWSA 2I5YH 4IS6B 5DGRA 4PJCE 5KSBE 1U3HB 3QUZA 4UDUB 3RRQA 3VXNA 1ZHNA 1HI6B 4Y5XB 1FZKA 4XBGB 3MO1B 1S9XA 4X6EB 1MI5A 4JZJA 1HHIA 3JTTA 3BMWA 5A2IH 2V9QA 2P5EB 4K7PY 5INCB 3K81A 4OM1H 1FIEA 2JJSC 4P2OC 5FF6A 5HYJA 2F53E 3HC0B 4HWBA 1LE9A 3EKCA 4PY8J 3QPQC 4ONOA 1T1YA 4ELME 3RU8L 1LP9A 2FECI 4DAGL 4FG6C 3TF7C 4XBPB 1GGBL 4P4KB 1MFAH 2EH8L 4BUGA 4JFFD 5TE4H 4I13B 4G6AD 4YWGL 4LSTH 1RZ7H 2FB4L 2ZNWA 1UKQA 5FYLD 1I7ZA 1ZVSB 1NANH 1I4FA 3O3AB 5DVLA 2YPVH 4HIXL 3JV0A 1MUJB 2B7DT 4RFNB 1ZLVH 1LVEA 5JHDA 2EDKA 5CHNB 2JCCB 5JMOC 3BP5B 3OWEA 3IDJB 4FQCH 4P59H 4S1SL 3N1PC 2Q6WA 4C54A 5T1DL 5MHSD 1AHWA 1QFWM 1X5GA 1YMMA 3NOIA 3VFSB 2VXUL 4AL8L 4LP5A 5DS8A 5CD5C 4HWBL 5C08B 2NYYD 1N7ML 5I1GL 3LN5A 2LU4A 1CZ8L 3KLHD 3QIWC 3N1QC 2VDNL 1ADQH 5DHYA 2VC2H 3MBXL 3VWJB 4AY0A 5IB4B 4BQ8A 2R56H 1NUFA 1YY9C 2M8XA 3MLRL 3EUUA 4HJJH 2R8SH 4M7LT 4L1HA 4PJEF 4R4FH 1RK1B 2VABA 3BD4A 5D96B 3NCEB 5CILH 3GHBL 1ZLUK 4C56A 4GJTB 5EC2A 3IXTA 2AJXH 2P24B 5IW1B 1I1FB 2J8HA 3FFCD 3DV4A 1S5IH 5BXFA 5EZIL 3I6KB 5ISZD 3DMMA 2A6IA 1QKZH 2BDNH 1T1WA 3H7BA 3D69A 1NMAH 1RV6X 3EHBD 4F7MA 3PQYB 4X99B 3QNZA 3HS0A 3ZKSD 1TCMA 3QEQA 1JWUA 3L3KB 3DXAA 5GGTA 4JVUA 3MRJA 4FQXA 2XWBA 1CXIA 3HPLA 2O61B 2HLAB 3QB7C 3OGCB 1NEUA 4PV9B 1R6VA 1CIDA 1EIBA 4PRNB 4KQ4L 3QWOB 2AS5M 4MA8H 3SE4C 5B38G 3WDHA 1BQHA 3CSYB 5DJXA 2HRLA 2EKJA 2Z35A 3ZKMD 3GFUA 4OZGB 3BZ4B 1QSFD 3KNBB 3FRPA 1OSPH 5D71H 1DBJL 1HSAB 4NFDA 3WN5B 1PDKA 1AGDA 3CX5K 4QGTA 3QIUD 4YGVA 4LU5L 3T2QA 4G80A 2YEZA 5EO0A 1JV5A 1FNHA 4JE4B 3FCTB 4JFXB 3HG1B 4HLJA 3UTTA 4Q9QL 1NGZA 1TZHA 2DLIA 2X4RB 3CLFL 5GGTL 3D3VB 5C07A 3BO8A 4IIQC 4BQ9A 4B5EA 1BEYH 2Y23A 3ELAT 3P0VH 3W11C 1CIUA 1I8MB 2Q8AH 4PG2C 1P9MA 2VLKB 3OSKA 4NP4H 3V5KA 1G9EA 1Q0YL 3IAPA 2VXQL 3MRPB 3HB3C 1A6AB 4OT1H 3OKLB 2A73B 2IMMA 4P2CG 3LPWA 4WDIB 3UTSE 5I8OL 2NW2B 2QBWA 4V2CB 1MIMH 1TIUA 2KBGA 3NIGF 3LEYL 4P2QB 4CMMA 4KMLB 5GZOD 3QNYB 5IB1B 3QDAA 1XR8B 4EI5A 3GJFH 1HOCA 2VKWA 5J1SC 1HQ4A 1MFEH 4S1QL 5BV7L 3PGFH 5J7CC 2OI9B 3BX7C 4FS0A 3DNKA 4P4RB 4L4VE 5CD3B 1MLCA 2QSVA 1I85A 4K94H 5TDPA 5EDXA 1KPVA 2AKRA 3U36B 4FQ1L 1MJJB 4D94A 3PL6B 1JMXA 4X7EC 4JM4H 4OD2B 4YX2H 3E8UH 1FAIH 3BHBB 5C0AD 5TDOA 4YO0A 5E7FA 1I3GH 2XFXB 4AQ1B 4K3JH 1N6QL 1RZKC 3KPSB 3OAZK 4J4PC 1YEJL 1NGYA 1NSNL 3UCRA 5C3LD 5M7QA 4DJMA 1UACL 5FA4B 3TWCL 1NKRA 4Y4KB 2MQ0A 1G7HB 5F1OB 1HWGB 1KXVC 5CLWA 4L3EA 2IJ0C 5E1HB 5DJYA 1R0AL 4GKZB 4YAQA 5JOEA 1JGEB 3C60C 4Z8FH 1KTLB 1T04B 5K33A 2W60B 2VQTA 4NO5A 4F3FA 1ZSDB 1F2XK 4PJGF 5IVXF 2IAND 2VDQL 1B0RA 4HDIA 4YC2B 2YC1A 3I84A 3L7FB 4NQDB 3WO4B 4DQOL 3IJSB 3GIVA 1PZ5B 1Z3GL 4JY4A 4LLQB 1RZFH 1A3LH 3BDYH 5IJVA 2C5DC 4N8VG 1SJEB 3ME0A 3TM6A 1BFOB 3VD3A 3N0PB 3WDJA 2EXYC 1UB5A 1FDLL 1U8PB 4IRJB 4LKCB 3LHPL 4P46A 3ARDD 4UDTA 4UUJB 5C2BL 2PO6B 4FFVD 4CVXA 1LO3H 2HA1A 1X7QA 4JRXD 5TE7H 2PYEA 3HI6H 4WWKB 4AEEA 4I18C 4L29A 4X0KA 4QLRA 1SMAA 4MA3A 4RCAA 1KJ3L 5CWSA 1BQSA 4IBLT 1DBAH 3FB6A 5DRZA 1D6VH 4OBRA 2HVKB 4RWYH 2EC9U 4POYA 4QNPE 1DEDA 1PAMA 1RJZB 5DMYA 3CFBB 1K8DA 1NGPL 4YNYB 5ITFB 4YHML 3E6HB 3MGOB 1AD0A 4AIXA 1AQDA 1KF9B 3EJZC 1JNNL 5KANI 3EAKA 4JFFE 5FHAL 5GGRB 2GIYA 5HD8D 3TN0B 3ULVF 3BN3B 4QCIA 3CLEH 1LNUA 2R9HD 5FYLE 3CXDL 3PWVA 4HAFA 1FFPA 4Y89A 4QTIH 2Y4SA 5I1EL 3MLUH 5T3XL 3VWKD 4RGNC 3VD9A 1J8HB 1T66D 1UM6H 4LPUA 2XKNA 4JCLA 3QULB 1Z2KA 2D03H 3WFCL 1CYGA 3O6KH 1NDGA 4KRLB 5MHSE 4V1DB 2BC4B 4NSKB 1DBMH 4NNPL 2NY1C 2R2EA 4LQFH 1TVBB 4PREB 4PV8A 2FJFB 4PJXF 1JFQL 3ULVD 4IRSB 1XCTA 4GOSA 1BQUA 4MB5A 2MTPA 4R3SA 3MBEA 1C1EH 1FYTB 1OGTB 2WIIB 3VXSA 2YZ1A 5KSAA 3O4LA 3TYGL 3QUYA 3X17A 4ODBD 4PG9B 3GSQA 4MAYC 3V4PH 1RJLA 1QQDA 2OL3H 3VRIA 4PY7B 4DVRH 1FZMB 3K1KC 3QDJA 4LVOB 4ZS6C 3FFCE 3RKDC 3GZKA 5ISZE 2CO7B 3BIAX 3VXRD 1MCWM 5IFJA 4I3GA 3S34H 4L5FL 5FYKU 1P4IL 4XP4L 4YXKL 3O81A 4Z7WB 1M05B 3LH2L 4JPKL 4PJIA 1M7XA 1NGQL 3I3BA 3DSNA 4OBSA 1QFHA 5E5MB 5E4IA 3ULSA 3CFKB 4BUHA 2FBJL 3IRPX 1JHKH 4PJEE 5IIEA 5TPWL 3PHOB 4Z5RA 1MHEB 1T1ZB 3QDMB 4QRSA 1BVLB 3HMXH 1WT5A 5CEYB 2ZSWB 3HE6D 2HT4C 3DWTA 4KROB 4Y1AE 4PJ9D 3FT4B 3EYOB 3CVHB 1I7RB 2X9WA 2E7LC 5FYKH 3SN6N 2XN9E 4OZ4A 3LB6D 4PRHB 4E0RA 3B9VA 4LLDA 3O41A 5L6YL 2YKLH 3KPNA 4ZOBA 1XGUB 4RRPG 1D3CA 2GTZA 1UEYA 3TO4A 5JHLH 4CU7A 3KLAB 2ADFH 3HI1A 4CU6A 2VTFA 4YDJA 1JJUA 4KY1L 4NRYB 1NCCL 5J6HB 2CRMA 3W9EB 4M00A 1G7PB 1Z9SA 2R0KH 4L4TA 3O3EB 5EUKB 4LEXH 2ATPB 2ZKHL 1XCQA 3NCCB 3JWOH 5IR1A 2UY6A 1MQ8A 5E0QA 3I3EA 1ORQA 2B0SL 4B50A 4NCC1 4S2SB 1A6WH 1CGSL 2WM0A 3S9DB 3U7YH 1JPGB 4RAUB 4M8QA 1ZA6B 3BUYA 2JCCF 5F9AC 4Y5VB 3SE9L 3C5SB 1DR9A 4HV8A 1HH6B 1V3KA 5HHOB 2RCSL 5FKAA 4HGWA 4QYOB 2BNUB 4NJAH 5HPMA 4WEBH 2QQNL 4H0HB 1WISA 3LKRA 3Q1SL 1T0PB 2ARWA 3CX2A 3L5JA 5C0JB 1U36A 2AEPL 4YHYB 4LQ1A 5DRWB 2VLRA 2X05A 5JXAH 2W9LA 5HYIA 2IAMB 4LLWB 5HHMB 5TGBB 2P4AB 5DJ2A 2AVGA 4MWFA 4AZ8A 4LLVB 5IROA 5IHUL 1A3QA 1SJHB 4YWGH 3RPIA 2HKFL 3O3DB 3T0EB 4P3WA 3HAEH 1I7TB 3NIGE 2OR9L 3AMLA 1Q72L 3FB8A 2XYCA 3LKPA 2V5YA 2YUXA 2AGJL 1GHFL 2ZPKL 4AEIL 4XGZA 4R7DA 3LEXB 3MV7D 4XT1C 5ANMB 5DD6B 4XVSL 2Z31D 3C6SB 1MJ8H 1R3IH 1QFOA 1MY7A 4JO3L 3LRSA 3S35H 4F33A 1HHKB 1CQYA 5HGHB 2IANE 3KYNB 5JR1L 2Z8VC 2R0LH 3ZDZF 3PG2A 5FIEA 4LDLB 3ES6A 5LWYL 3TVMA 5GRXG 5MEOA 1UENA 3CUPA 5F9JB 1N64L 1UZ8B 2DQDL 2WV3A 3HCVA 4YUEH 1N59A 2DBLL 1CZ8H 4U7SA 4I3RL 3OXRB 4WW2C 5KAQF 4WFGD 1KSRA 3I6LD 3QQNA 1TZGL 3L3DA 3VJ6B 4WO4C 2F5AL 2AJ3A 5GZNC 1BZQK 3BQUC 3IDNB 3IJHA 3QISA 4KPHH 5A2KH 1FL6B 4OZFH 2EEBA 4JRXE 1NPUA 3VXME 2XZAL 1K2DB 1PKQE 5FEBA 4PJGE 5IVXE 1YY8A 4DKAA 5MERB 4Y4HA 2GK0A 1W72A 1ZKAA 2H2PD 4OZGF 2C7UA 1S7QA 4PTTA 5GHWL 2BVOB 3GSNB 4HS3B 2D7MA 1XAUA 3BESR 5DUBB 1UVQA 3RGVA 5D7IB 5ICZA 4IOFD 3FT3A 1AR1C 5HGDB 2B5IB 3GMQB 3NCJH 5BZWB 4UV7H 3OB0H 4WENB 3Q2CA 4WGWB 4R6UA 4U6HB 4B0MM 4IHOA 4X7TB 3GGWA 1D5ZA 3AY4C 5EC1B 4FFWC 1HZHL 4JFYA 2DQTH 4NOBA 5KVFL 3SY0A 3EOAB 4HT1L 4PRIA 2VE6A 2DQJL 2IH3A 3QI9A 3K2UH 5D7SH 1QLRA 4TSBL 4U0RB 1ES0A 1W72L 3BPCB 1EO5A 2VQUA 1QVOB 4KRNA 3QFJB 1ZS8B 4PRPA 5TQ0L 5JIIA 2ZJSL 1Y6MR 3NIDF 4P2OD 5BOZG 5GJSH 1Q9KA 4OI7A 3WV0A 3QPQD 5CGMA 3JWOC 5IT2H 5DRXB 4FG6D 3U1SH 4UINH 3ARVA 3U0WL 2VLLA 3EOTH 4Q9QH 5CMAB 4ZFOA 4OTXH 2JIXA 1D5IH 1QOKA 3SGJC 3FQRB 3ULVE 1A7RL 2PKDA 3OV6A 3D6GA 2NW3B 1G7IB 4UILL 3K4DA 3M45A 1K4CB 3SDDB 5BQ7B 2I9TA 2FLRT 1EHXA 4KDTA 1Q0YH 1CLCA 1RQ5A 3MLYH 3WKNA 1IAIH 3L5XH 2BSSB 2JELL 3DUHA 5IB2A 2JE8A 1IC1A 3O2VL 2JTDA 3LEYH 4OCXH 4XXCC 4PP1C 3AC0A 3O4OC 2CDEA 3TIDA 2WBJC 3NA9H 2F58H 4R4NC 1CICB 1IEAA 4NHUA 4HPOH 4LCUA 2H26A 3L5IA 4PJXE 5CD5D 2VISB 3VXRE 1KTDA 4LLUB 1YECL 3QIWD 4ZFOL 1R5VA 4YHOL 3LQMA 4FQQB 1YY9D 4FABL 5KS9B 3FQNA 4KKCC 1ZAGA 4OCYL 2G9HA 4UU9A 2YD6A 4RWHA 1R5WB 3DECA 5TDNA 3KPRD 3QA3B 1ZLSH 2R39A 2VXVH 5J12B 2WUCL 1A1MA 5HBBA 3MV9D 3TT1H 1Z9OA 3HE7C 3T0BA 5I6XC 3LN4B 4ZO9A 32C2A 3NA4A 4OV5A 1KC5H 3ROLB 2AK4B 5F7EH 2M2DA 4DKDC 4KJWC 1U91B 1U6AH 3KPLA 1RUPL 1X4XA 2A2QT 3HTLX 2FX8L 4GRWH 4N0CC 4KTEL 1HYRC 5DA0B 1E27A 2EDHA 5GGRY 1QBMH 4Z7UA 4CMHB 2NTSP 4KHTL 2BXZA 4DQOH 1K4DB 3B6SA 1XR9B 3CFCH 4M5ZL 1Z3GH 3CC5A 1OGAD 5D2LB 3MA9H 5ID1B 3RTQB 4MSWB 1WZ1L 2LVCA 4M6OH 2FO4A 3MLTA 1VEPA 1NC2A 2D0FA 4JFHD 2MHAB 5C09A 1VFUA 3MRGB 4K7FB 4PLNC 5MEPB 4I8DA 4PJAA 5DD5L 2IFFH 2P5EE 3QQ4A 1UWXK 4P2RD 2W9EH 1A2YB 1DQJB 5F21B 3WFDL 3CAFA 1IM3B 2V7NA 2ZCKH 3TNMB 1Q0XH 4OZIA 4U1JA 3O6LH 3FO2A 4WHCA 4M7LL 5I1LA 3TH4T 4FQ2H 4P5KB 3H9SA 3OKOB 1JRHL 3L3JB 4NFCA 1B0WA 4FXGB 3MR9A 1T83C 5B4MC 2V2TA 3W11D 2G5BB 4XNUL 4UV4H 4L8SC 3E2HC 1DFBL 5HHQB 3MLZH 3ARBA 4WEMB 5C3TA 2EDXA 4QRPD 4WFHE 3ARGA 3VGBA 4O58H 3HB3D 1QFUL 2Y07L 5FHAH 1NUGA 1T5WB 4LPWA 3GI9L 5HHVL 3EIFA 3CH1B 5GRJL 4M4PA 5AEAA 5CFHA 2A83B 2NNAB 4NT6B 5MI0B 1IVLA 4HIIA 2GSGA 5C08E 1FFRA 5DMKB 1A9BA 3KJ6L 1FL3A 2BX5A 3GSWB 4NM8H 5I0ZA 2Z4QA 4EXKA 3PDGA 3VFUA 4FFZH 5ADPH 1BP3B 1ZA3A 4ZUTA 5DSCA 2F74B 1A02N 1N8ZB 3S3JA 1S8DA 1UC6A 2ZOLB 2J4WH 3MOBL 1I9RH 5ALBL 5J4MA 2HFFA 4J4PD 5GSVA 3WHXA 5C70A 4NCDA 2ED8A 1JWSB 1UWEH 4WFGE 3QUZB 3VXNB 4HGKC 1ZHNB 1FZKB 2PTTA 1S9XB 1MI5B 3MLWH 4JZJB 1HHIB 2CXGA 1RK0B 3JTTB 3TYGH 2AAVA 2XQYG 1I9JL 3C60D 3PWUA 3SO3C 4LSPL 2JK5A 1AE6H 1MVFA 5FF6B 4YK4B 5HYJB 3ZDZE 4UB0H 3PQYE 5GGUA 1ZHLA 1T1YB 1LP9B 3FONA 2W07A 2OXHA 5CS7A 3VGAC 1AY1H 4PS4H 1P4IH 3D85D 3BZEA 3GM0A 5AG9A 1MNUL 2EIZB 4FZ8L 4M61A 5GS2D 2EXYD 4YBLC 4JANA 4X6BA 1QYGL 4IJ3B 5TPWH 1I4FB 5BVJA 3VRJA 3F7VA 3VFVA 3SBWA 5JHDB 3IF1A 5ITBH 1MCJA 2ITCA 1IGML 1KNOA 3C5ZA 1KBGL 3GK8L 2JB5L 2Q6WB 4OZGE 5E99L 1O5DT 1AHWB 5FGCB 2J8UA 3CIQA 2R4SL 1YMMB 3BKYH 1JPSL 1MREL 4GG8A 5DS8B 1D9KC 5F1KC 5GSRA 3W0WD 1A7BA 2L7UA 4H20L 5DEGA 5LXGL 3NGBB 3LN5B 3FOMA 1SVCP 3P9MA 2HRPH 5DHYB 4LEOA 2AJUH 3QHFH 4LPXA 2IPTL 4PRAA 2DQGH 3MUZ1 4O4YH 1CR9L 1WBXA 3V6ZA 1DVFC 3MYJA 1BD2D 1KELL 2VLKE 4DN4L 2IQ9H 3EJZD 3MJGX 5EZLA 2VABB 5LAXA 4G6FB 4L9DA 4EQ3A 3PP3H 3DYMA 3TESA 5FAAA 5T3ZH 4C56B 5EC2B 4MNQA 4DKFL 4P2QE 4F9PC 5L7XH 4FZEL 1T7XA 4UT9L 3DV4B 5BXFB 5GS0H 4NO0D 3V7MA 4GUPA 2JJWA 3DMMB 2A6IB 3TA3C 1MCIA 1T1WB 4RGND 5HXMA 4D3CL 1EAPA 3D69B 3NIDE 4F7MB 5F6IC 3T65A 3QNZB 5DD3L 1IM9A 3HS0B 5C86A 3RUGA 3QEQB 4FN0A 3B5GA 5E5UB 1OP9A 5IFAL 4PRBA 2Z0BA 4XPFL 3WJJA 4JLRA 2ERJB 2NY1D 3OQ3B 3MRJB 4FQXB 2XWBB 4XPTL 3HPLB 3MMEA 1MLBA 4KI5F 1EHAA 3KPSE 1IFHH 1IKFH 3TBTA 2B1HL 2VR9A 3I9GL 4JB9L 4Y16C 4MD0A 4QXTB 1BQHB 5IF0A 4R26H 5DJXB 1Q1JL 1T7WA 1VERA 4X83A 4J3OC 3KPRE 4MAYD 3RWFB 5KN5B 35C8H 1XF2B 3GBMH 2ZPKH 3P11L 4P57A 3FN9A 4XPAH 4RGOH 2A6JA 3AB0B 5BV7B 4NWTL 6CGTA 4ZS6D 1E4XL 4HG4K 4YGVB 1AC6A 3RKDD 4G80B 2YEZB 5EO0B 1JV5B 1MCPL 4MA1C 3UTTB 1A7QL 4FFYH 3MRLA 1NGZB 4DTGH 4HK3N 1TZHB 2VDLL 5C07B 4M6NL 3BO8B 5DQDH 1A14H 3SDXF 4LSRL 3RWHA 4X8XA 5JR1H 3TCLA 4C58B 3BOVA 3VFWA 4GG6A 3V4VH 5D7IF 3VFOA 5F8QC 5LWYH 1CD8A 2CDGA 1FBIL 3V5KB 2HFEA 2VLMD 3LMJL 4KZEH 2P49B 2HT4D 4EUPG 3UBXG 3RY6A 3DBXA 4QXGL 4N0UB 2CXKA 4EI5B 4FXLA 1HOCB 2EDJA 4K23H 1UWGH 1ZLWH 4HF5L 1EGJA 1HQ4B 2R2HB 2APXA 1QTYT 5JW3H 4GRWB 1IAKA 3W9DA 5K9JH 1ZHKA 1MHCA 4P2RE 5TDPB 4KZDL 5L2JA 1KPVB 2AKRB 4OUOA 3WS3A 3KHQA 5GHWH 3DUSA 3H3PH 1Q8MA 1ZT7A 1CFSA 2A6KA 4RISH 5TDOB 5BZDA 4P9HL 1EDQA 2FSEA 1JNHA 4UQ3A 5IVNA 1MCOH 2WP3T 3IDGA 3QXTA 4Q6YA 1NGYB 2GFBA 2XA8H 1P84J 5FV1L 1LO4L 4XPHH 3RA7L 1JMZA 5GPRA 3BIBX 3D2UA 1LGVA 3M1BA 1J8HE 4PJ5D 1HZHH 1NLBL 4JVWA 4NO5B 4F3FB 1H15A 2AI0H 4XC1L 1JCKA 1B0RB 4HDIB 4LIQL 2YC1B 2DQIL 2E9JA 3WE6A 5CP3H 3B8SA 1O7VA 5F3BA 3GIVB 1MAJA 2QQKL 4UQ2B 3OAUL 3LQAL 3TZVB 2V9TA 1H8OA 2HJFA 2HFGH 4CVZA 4YDKL 1LILA 1UB5B 5GS0C 1FPTL 4P46B 4UDTB 2OJZL 2IADB 4R8WH 1W0VA 1X7QB 1XF4A 2PYEB 5KS9F 1JWMA 3QFDA 4L29B 2FDBP 4GW4A 3RL2A 4X0KB 4WW2F 4MA3B 4X6DE 5CWSB 1EEZA 7FABL 1YPZF 1I7UA 4AT6A 3FB6B 3BJLA 3L6FA 5DRZB 5KJRH 2JELH 1J05A 1DSFL 2IQAA 5CJXA 2O5YH 4D0DA 4KGLA 4N8CH 4LHUA 5I8CA 5D70L 4XP5L 2H32H 2AV1B 1GRWA 2YZ8A 5H94A 3WNPA 5E03A 1K8DB 3BI9X 2IPUG 4LP4A 5D9SB 4NWUH 3UYOD 2ZUVA 1NCUA 2YA2A 1AQDB 2CLRB 1J0HA 3HPJA 4O5LL 1XGPA 4CNIA 3SGEH 4JG1L 1DLFH 5D2LF 4HLZH 5FGRA 2ZUWA 1S3KH 4QCIB 3ARTA 1LNUB 1OAUL 2ATKA 1R3KA 4WO4D 3PWVB 1F8TL 1U42A 1FFPB 5KSVB 5GZND 1WJ3A 3BQUD 3PV6A 5FGSA 5HJ3A 2UV3A 1Q9WA 5F7DB 3ZT6A 3WJLC 3PIQB 3QQ3A 3ARFC 3OZ9H 1NDGB 1ZLVK 2C3VA 1YEGH 1HKLH 3OB8A 1H0DB 2P47B 1DTUA 2R2EB 2FECL 4PV8B 2Y9RT 5E9DA 2DTML 3VA6A 1XCTB 4GRMA 4FMKA 3CU1A 1AR1D 3ULUL 1MVUA 1OCWL 3KYOA 2CIKB 1UH3A 3MBEB 5FYKD 4M5ZH 3SPVA 3VXSB 4ZFFA 1BD2E 5KSAB 4Q6IC 5TQ2L 3O4LB 3QUYB 3GSQB 2J88L 1NFDA 4FFWD 1EPFA 3VRIB 3N9GL 4OLXL 2AABL 2VWEE 3QDJB 3IGAA 2DYPD 1CXFA 3MC0A 1U3ZA 4XVJL 5HHOE 5IFJB 4I2XA 4QHMA 4YHNA 3MOAL 1J5OH 4GRLA 4LDEB 3B5HA 4MB3A 2I60L 3SDAA 3ULSB 4TPRH 3MJ9H 4WUKH 5IIEB 4NQED 1KN4H 3EJJX 3SDYL 3SKMB 4Z5RB 1MCFA 1AH1A 3GI8L 2ESVA 4EDWL 4BK5A 5HGBA 4S0SD 1M4KA 3QEGL 3Q5OA 1NANI 3NN8A 3SJVD 5ANME 3TPUA 3RWGA 4KVCH 4OZ4B 4Q0XH 4E0RB 4LLDB 3O41B 4AJ0A 3KPNB 3GI9H 4I0PA 4ZSOA 1MF2L 2GTZB 1KFAL 4PJCA 3TO4B 1AP2A 4PP1D 5KSBA 2G5RA 2WBJD 1RVFH 3HI1B 2G60H 4R4ND 4ZD3L 1JF1A 4BH8B 4YDJB 5A1AA 1I8LC 1QBLH 3AM8C 1FL5A 1IKNC 1AXTH 4KI5E 3KJ6H 1L7TL 4NUGL 1CFBA 1NCBH 3O9WC 2NXYC 1QRND 2F53A 3T77A 3VH8A 5CIPH 4L4TB 4NJ9L 1JYXA 4ELMA 2I26N 3JUYA 1AGBA 3PWPD 1XCQB 1ZWIB 2CMRL 4KKCD 3KYMA 2DQCH 5IR1B 3BWUC 1ORQB 3UPCA 5FUZL 4GQPH 1KEGL 1YEFH 3TC9A 4UZGA 3BUYB 3HE7D 4R0LA 4X80H 1KACB 4K2UL 2DD8L 3THMH 4HV8B 4MCZB 5FKAB 2VZ3A 4HGWB 4N1EA 1JZ7A 4OCRL 5HPMB 5LQBL 3U82B 3QXAA 4BH7B 1NUNB 2QR0A 3SDXE 3BYTA 4KJWD 3GJFK 3PWLA 4G9FA 2VLRB 4CAGA 3ARQA 4N0CD 4PP2A 1P84K 2VDML 1NMBL 1QLFB 3LKQA 3BVNA 4MWFB 2YUVA 5KZCB 2FD6L 5D6DC 3FB8B 1RHFA 3INUH 3LKPB 3DURB 2KUTA 4N5UA 4XGZB 5D1QA 4R7DB 3QDHA 4IRZL 4NQVB 3QRGH 1F4XH 1SBSL 2BVYA 2VQ1A 1SEQH 4PJ5E 5DHVA 3LRSB 4M43H 5DJCA 3QFJE 2J6EH 2D7OA 4JY6A 4F33B 3U4AA 1JBJA 4U2ZA 4K9EL 4JO1L 4H88H 4IEFB 5E6ZA 4M5YH 5GGQH 5CJQL 3ES6B 2HT2C 3QQ9C 3TVMB 1N0XL 3JWDH 3R1GH 4XX1G 5MEOB 3CUPB 3HCVB 3STBA 1CK0L 1N59B 5A40E 2IEPA 5TE6H 3IKKA 4HPYL 5TF1L 4YDLC 1CU4L 1DANT 5EZOL 4R2GB 2R69H 5B4MD 5IMOB 3CNKA 4QXUL 3L3DB 2XTJB 3MRQB 2AJ3B 1S7VA 3IJHB 5HDQL 1PYWB 5CSZA 5IBUB 4TVPH 1VENA 4F7PA 3EO0A 1BZ9A 1YY8B 3QPXL 2EDQA 1FG2A 2J12B 4Y4HB 1MH5A 1EO8L 2GK0B 3MODH 1IGYA 5EO9A 2C7UB 1S7QB 1D5XA 3DO3A 5K9OA 5FOBA 3S7GA 2IALA 2P44B 3D18A 3IXAA 1L0QA 1UVQB 3RGVB 1A7NL 2ADJA 5T1MA 2FR4A 3RWJA 4M1CC 1H5BC 1FCGA 4MAUH 5EA0L 2DMKA 1B4JH 2FX9H 2NZ9C 4IHOB 2GTWA 4M7JH 5KS9E 2NY4B 3GGWB 1CGXA 4FRWA 4B41A 1DQLL 4QOKD 1P53A 5I30L 2B1HH 4JFYB 2IGFH 1OARH 4QRUA 3L7EA 4OV6F 2O5XL 4PRIB 1YPZE 2IH3B 3QI9B 3KLDA 1QLRB 1ES0B 5I1KH 2R23A 1A0QL 1V3MA 3MZTA 3GBLA 4PRPB 4QWWC 4LMQE 3UTSA 2FJGA 5DT1H 4G8GD 2WK2A 3P11H 3OKMA 4OJFH 1Q9KB 4NQCD 1A4JA 4GS7C 4GRWF 4G6KL 1T0MA 1BBDH 1K9TA 4HZLB 2Q7YA 1AQKH 2VLLB 4ZFOB 1IC5H 2JIXB 4ODXA 4OSUL 4P5MA 4YLQT 3VDAA 4M6NH 5D2LE 3SCMC 4F15C 1NMCB 2QHLA 1KLUB 5K9QG 3R0MA 2ARJA 2I9TB 5FYKE 1F13A 1I3RB 1HEZA 2JJTC 1F4YH 4LCCC 1FVCA 5IB2B 5J11C 4GKNB 1EEUA 2DB8A 1NBZA 1IGTB 4K71B 2CDEB 4HUKB 3TIDB 1YEEH 3A0OA 3QUKA 4Y5YC 1IEAB 5FGBC 3X3FH 1IQWH 4OD1H 3BGMA 4LCUB 2H26B 1D9KD 2O5ZH 3D0LA 1KTDB 3QIBA 3IAGC 1ND0B 4XZUA 1ZVHA 3SHSA 4O9HH 1AGCA 1R5VB 3FO1A 3UMTA 4J3WA 1MAML 4WHYG 1DVFD 4ACPA 3FQNB 4NQEE 3DPBA 4R90H 5FUOH 2G9HB 4UU9B 2GJ6A 4I3SL 3TIEA 3T4AA 4Q58C 3IFNH 1MCWW 3V4UL 3VGFA 4XPGL 2KQMA 2IMNA 1A1MB 1G9ML 3T4YB 1K8IA 3RA7H 3O6FC 3JWDC 1INEH 1JHLL 1UZ6F 32C2B 4UNTA 3SJVE 4OV5B 4OCLC 5IHLB 1GPOH 3TA3D 3LN9A 3QXUA 2LTQB 3BKML 4RA0C 2YSSA 3KPLB 5HYSA 1TQCB 1E27B 2EDEA 2DQIH 4Z7UB 3MLXL 4NKDA 1FHGA 1J0JA 3B6SB 3QZWA 4AEHH 4Y0GA 1HINL 4BZ2L 3RVTC 4TSAH 1QRNE 4YDKH 2FO4B 1KPUB 1NC2B 4Y16D 2XKUA 2QSTA 1TJGL 1WZMA 4U2YA 3WFBH 4CKVX 5C09B 3PWPE 4HWUA 2SEBA 1UA6L 1A3RL 1T89C 4WFFE 1XH3A 4PJAB 4XP6H 3IFPA 4LARH 1MRDL 4JFFA 1F00I 2HT3C 2ID5A 5DC0A 3QQ4B 4G8IA 3WIHL 3VFPB 1SYSA 2IBZY 1SY6A 1TTFA 2V7NB 4ZUSA 3D39D 3QSKB 3SEPA 4U1JB 4CU8A 4OZIB 1FE8H 3FO2B 3GRWH 3PWJA 4RFEA 5I1LB 4Y2OA 5JXEC 5GS3A 3H9SB 1EHNA 2YD1A 1CTNA 1EVUA 3PHSA 2WANA 1CE6A 3MR9B 4XP5H 1H3UA 5D70H 3TBSA 2V2TB 1SQ2N 2BK8A 2I07A 3KJ4C 1MWAA 2C1OA 4O5LH 3ARGB 2VH5L 4XVTH 3OKKA 2YN3A 3H9YA 2QQQA 5JHDE 3LZFL 5FA3A 5E94A 4HAGA 4JZOA 1OAUH 4S1RL 5FHBL 4MQ7A 1YMME 4NNYA 5D5MF 4X4ZA 1P7QA 1SY6L 4HIIB 2GSGB 2NX5D 5FYLL 2R1WA 1I8KA 2HFTA 1A9BB 1IEBA 1FL3B 3O11A 5C1MB 3CPLA 5IGXH 3EJYC 1S5HA 4OB5L 4G7VH 3FFCA 1ZA3B 5ISZA 5DSCB 4KHXL 1EEYA 5ENWB 1S8DB 5C92A 4DZBA 1EHLL 4WHTA 2VZSA 2VNCA 2HFFB 2BHYA 5GSVB 3WHXB 1MWAL 4K7PL 4D0BA 3VFRA 4B7IA 1RULH 4K07A 1D6EA 1PBYA 4C56E 1LQSR 3GIZH 2PTTB 1NBYA 4PJEA 5TQ2H 1QLEL 2ED7A 4LLMA 1UM4H 5IBTH 3WSQL 3WS6A 3PWUB 3MRKA 2JK5B 2NTFA 2ITDA 3LDBB 4LHQB 3VA2C 2OXGA 4Y1AA 5GGUB 3VXTA 3GHEL 1ZHLB 1ED3A 2P43B 4CJ1A 4MGXA 1AGFA 1FG9C 3FONB 1A6ZB 2DAVA 4XVJH 1F97A 2FHCA 3NAAH 3ZL4H 4Z6AT 2XN9A 4YFLI 2EEAA 5MEND 5B3NA 3BZEB 2WQRA 1U8NA 1JNLL 3MXVL 5T3ZD 2W65A 2QQLH 4ZS7L 3ZHDA 2CRYA 5GS0D 3U4BL 3QIUA 1L6ZA 4JANB 2BNQB 4URTB 5BVJB 3VRJB 3F7VB 3VFVB 1GXEA 5ACZA 1C7SA 3IF1B 3G6AA 2AK1H 3RAJH 2ITCB 3RY5A 1KNOB 4QOKE 4QRRD 1SM3L 3N1FC 3C5ZB 3RL1A 4C4KO 3AS3A 4Z0BH 3TBYA 2N1KA 2J8UB 1RZJC 1F3DJ 5D8JL 4OFIA 4BELD 4GG8B 4MZ3A 1KIUA 4RX4D 4EXPX 3FOMB 1U93A 4O51A 4GBXC 3P9MB 12E8H 4LEOB 1UCBH 4MDIA 5DUPH 4PRAB 1LD9A 1R24A 2DIBA 1WBXB 2CKBH 3V6ZB 1KJ2H 1S7TB 3MYJB 4PJFF 4U3XA 5IHBA 3V0WH 4M1DH 3CH8A 3VI3F 2DWEA 1BWMA 1ROWA 3JBG7 5LAXB 4H26A 1WWCA 2X1WL 3ARXA 3HZKA 1FORH 5IJKC 4NJ9H 3HC3H 1MPAH 5KVDH 4ORZC 4MNQB 1KIPA 3SE8L 4TNVF 4N0UE 4GUPB 4KUCF 4UTAH 5C0AA 1QSEB 1EAPB 4MXWH 1F4WH 4Z77B 4GRWE 4KWUA 3T65B 3R0NA 1IM9B 1N0LA 3MLVH 1YYML 2DD8H 2EDOA 1MCQA 3ARFD 4TVSa 3TYFA 3RUGB 2MPAH 4PRBB 4JLRB 2MQ3A 4KK9C 1C08A 2AJSL 2G75A 3I6GA 5I1JH 3WFEH 5CKAA 3MMEB 1MLBB 4EN3B 3HFML 3TBTB 4M48L 2IANA 1XGYH 2KH2B 5ERWA 5EOCJ 5IF0B 2QHRL 4U1HA 3Q6GL 1KJVA 5FDYA 3EDJA 3BPLB 4PGZA 3OKDA 4ODVH 3C9NB 4P57B 3BD5A 4H8WL 2WLYA 3ARDA 4P9MH 4QF1B 5IBLC 1CDUA 4JRXA 3MV01 3MRLB 3VXMA 5I74C 3JVGA 1PKQA 4PJGA 5IVXA 3RWHB 3I50L 4OLUL 4DGVL 4KFZC 3EOYG 4K3DH 5E2UH 5HVHC 1KCSH 4GG6B 3VFOB 4JG0L 2CDGB 2ICEB 3ZDXF 3PHQA 4WI2A 2HFEB 4JQVA 4EZMA 4LLYB 1CK0H 5HYFA 1UEMA 3K3QA 3IFOA 3WIFA 4XAWL 3B9KC 5DQJA 2F8OA 5EZOH 1RU9L 4PB9L 2P42B 1UZ6E 3DBXB 2YWZA 4I9WE 1F3JA 4OQTH 2ZCHH 1IAII 4KXZH 2FL5A 1OAYL 3WLBA 3W9DB 1ZHKB 1MHCB 2LFGA 3CCHA 1JI1A 3WS3B 1DBBH 1U2HA 1WF5A 3DUSB 3D39E 3O2DH 4KMQA 4ONGL 4BZ1L 2OM5A 1ZT7B 3U0TA 3ILPA 1CFSB 2A6KB 4KRPB 3VWKA 3V5HA 4EDXA 4L8CA 4WI4A 4UQ3B 3IDGB 2DKMA 2GFBB 3M17A 3O9WD 2NXYD 4YXLL 3OF6D 1CQKA 4JFDB 1A7PL 3LQZA 4KTDH 3C2AH 4ZNEE 1YJDH 1ZANH 3D2UB 1XGTA 3M1BB 3S36L 1WIPA 3QWRD 2W9DH 2KKQA 4U6XA 5JPNA 1PLGH 1AI1H 1H15B 4U1KA 4JQXC 2XV6B 3VG9B 3CFDB 3WE6B 4WU7A 5F3BB 4UNUA 4L9LA 3STZA 3VFNA 1MJ7H 1QFWH 2EKSA 2NX5E 3QG6A 5C2UB 4JFZH 4W6WB 2DQEH 2HJFB 1KPRA 3V52H 4X5WA 1JUFA 4CVZB 5LGHL 1I1AA 5IQ7H 2X10A 1OY3B 3OX8A 3UTPE 2RR3A 4F7TA 2P7TA 1W0VB 3VXRA 1FH5L 5ECJE 3BGFB 4OD3H 1XF4B 4ZXBC 5D7KD 3QG7H 3QFDB 1LO5A 3RL2B 4J2XA 1CXKA 4KMTL 1VSCA 3FTGA 3ULVL 3UO1L 5D5ME 1EEZB 5FKPA 1BF8A 4IOIA 1G9NH 1I7UB 4AT6B 1CCZA 3QAZB 4MMXC 3L6FB 3FZUC 1J05B 4RDQF 1V3JA 3HE6A 3HZMA 1NCTA 4AG4L 3MRHA 3UBXI 3F7QA 4D0DB 4LHUB 3NFNA 5I8CB 2R2BA 4OM0H 2G2RA 4LCIL 1O0VA 5H94B 4TUJA 1K5NA 2HT2D 3QQ9D 4NZTL 1P9MC 1RMFH 3L3HA 3HPJB 4ISVA 4Z7UF 4TUKL 2QKIA 1XGPB 4CNIB 5T3ZE 2WBKA 1WFOA 4Z0XA 1MAMH 2Y06H 4WW1A 5SWZD 2ATKB 4RGMC 1R3KB 5DD1L 2ARJQ 2ED9A 2BSTB 2V17H 3L3OA 3PV6B 5HJ3B 5IMLB 3HNVL 2AERT 1Q9WB 3CDYA 3F58L 2N4IA 4F7EA 3LKNB 1G9MH 2FIKA 1CLOL 3QQ3B 3I02A 4HKBA 4QRRE 4XNYL 5ALCL 5A43C 1WZKA 1CD1B 3R06A 4JKWA 4OIIH 3GB7A 4HUXB 2D7QA 4IS6A 2C3VB 3AVEA 43C9A 2YD3A 1G7QA 5E9DB 3BKMH 5FM8A 5I1IH 4GRMB 1A21A 3DARA 1AFVH 1MVUB 2X40A 3KYOB 3P4MA 2VXSL 3MCKA 4M1CD 2B1AH 5DZLA 5DDHA 4JKLA 4N90E 3SPVB 4ZFFB 1MCHA 1OP5K 2NZ9D 3FKUS 3RNKA 3X14A 2Y5TA 2XXCB 3O6ML 4PGDA 4WHDA 1BQHG 1QSVA 4BZ2H 3MLSH 4XCFL 5FV2A 3QH3A 1NFDB 3PP4L 1X5KA 2VAJA 2DKUA 4LPVA 4GAJL 1CS6A 3IGAB 1CGYA 3FRPG 1LO0L 4DEPB 5D2NB 3PP3K 1ZVSA 4K3EL 4MMZC 1EH9A 4GAYA 4QHMB 2B4CL 4QWWD 4YHNB 1J86A 3WIHH 5BS0D 4GRLB 5L0QC 2NY2C 3SDAB 3MV7A 1K6QL 4PJFE 5LCVH 1YJDC 4TOYH 5JMRA 1K3IA 3GMNA 3VI3E 1O7SA 2Z31A 3VFSA 4HC1A 4GW1A 5DI8A 2ESVB 3CSGA 3S4SA 3L1OL 2FEEL 2F54D 3SCMD 2ILLA 5DMIH 4MQTB 4NM4L 3QCVL 4Y2DC 4AIZA 3VWJA 3UC0H 5IVZB 4CW1A 5DK2B 3NN8B 3V0AC 5I8EA 2F19L 2JB6A 3TPUB 3RWGB 4OLZH 2NY7H 4U1GC 1BLNA 3OKEA 4I0PB 1NEZB 1E4WL 4ZSOB 1OQOA 4PJCB 1AP2B 4S1RH 2NLJA 2MJWA 3NBNA 5FHBH 1KN2H 1JF1B 3T0AA 3FO0L 1SY6H 4KK8C 1X5HA 1YEIH 1FL5B 4MCYA 1DL7H 5CINH 2CGRH 1MCKA 3WNKA 4MA7L 2F53B 3CVIH 4HC1L 1FO0H 3T77B 1EXUA 4XTRC 2LE9A 3PQYA 1N2RA 5E70A 4ELMB 3V8CA 1G9NC 3JV5A 1GOHA 1AGBB 2NY3C 4YZFF 2VJXA 3ALPA 2ZP0T 4K7PH 2HLAA 4N0YH 1EMTH 4JDTH 4DZ8A 4HS8L 4R0LB 3KHOA 3O6FD 1XT5A 3LS4L 4JPWL 2HKHH 3ZKXC 3PGCB 3QXAB 5J9PA 5I19H 2D7PA 4OLWH 3PWLB 3QWQB 4G9FB 4OZGA 3BZ4A 1ZLWK 3S37H 1TMCB 4PP2B 1HSAA 4ZTOH 4NQTA 4PYGA 5JQHC 3LKQB 3BVNB 1BMGA 5E1AB 2NY0B 4JDVA 4TVPD 3UP1A 1JNLH 3RVTD 4P2OA 5E6YA 5TJWK 4UIKH 3WXWL 4XP1L 1GIGH 1M7DB 1T2XA 4WI6A 2HVJA 4DGYL 1V5JA 1U8QA 3ETBF 1CD9B 2PUQT 5JDSA 4NN6B 5E2TL 1C12A 1L9MA 4JN1L 2VLJB 1RJYA 2VQ1B 5INDA 1HSBA 4UTBL 3IU4H 1A6AA 2HT3D 5F9WB 5DHVB 2QADC 3N85L 1ACZA 2XPGB 3NCYP 5DJCB 4ALAL 4OGZA 4JY6B 4KQ3L 1NGXA 1JZ3A 1DQDL 2XICA 2OYPA 4P2QA 2ICWJ 4YQXL 4A6YA 2F5BH 4NCC2 5IB1A 3GSUA 4XCEA 1XIWC 4J6RL 5JXED 4HULB 4LK4A 4P4RA 6FABL 3NCYS 5EU7C 4U6VL 4NO2A 4HUNB 5E08L 4Z7OF 4Q9RH 3PL6A 1S7VB 2JJVA 1OHQA 2A74B 3DI2B 3BHBA 4F7PB 5D7KE 3EO0B 3QIWA 1BZ9B 1FG2B 1MH5B 3SE8H 1IGYB 5EO9B 1RIHH 2VUOA 4Y4KA 5K9OB 5FOBB 5I1HH 1YEHL 1KCUL 5FYJH 4TNWK 2IALB 3KPRA 4X4MA 2RIKA 3D18B 2DQUL 4A6YL 3IXAB 1BAFL 5CAYB 4B53A 1OAZH 3MV9A 2Q20A 4XNZB 5T1MB 2EXWC 2X4OA 3EJYD 2ADIA 2MOVA 3B2VH 3RWJB 4JM2C 4LCYA 3S96A 4HCRH 3T3PF 3TGXA 5H8DA 3VGHA 2AJSH 4GG6F 1S9VA 1QP1A 2VXTH 5F9OH 5H37H 5FB8A 5EBLB 5GRZA 1QRKA 4NQXA 2DICA 2Q86A 1I75A 2YMXL 4QRUB 3L7EB 5BVPH 1UM5H 1EJOL 1EFXB 3X3GH 4LSDA 1DN0A 3WHE0 2PO6A 3MXWH 1OGAA 3O8XB 3GBNH 1N4XL 3EFFB 2X44D 1RPQA 3UTSB 2FJGB 4WCYH 3OKMB 4N1CA 1TVHA 1VACA 4XMKH 3J8F7 5E56A 2CRIA 4LAQL 3SKOB 1BJMA 1BIHA 2CJUH 2UUDH 1T0MB 2MSPA 3BSZL 2Q7YB 4DN3L 3O3BA 3PABA 3VFGH 4ODXB 1KB5H 1AIFA 1TNNA 4P5MB 2OK0H 1KIQA 4P2RA 1HXYA 2VDKH 5FXCH 1JF6A 5L8JB 2ARJB 4YNYA 1HEZB 1LEGA 2IBBA 2ZUQC 2C3WA 1C5CH 1IBGH 1FVCB 2OP4L 4IIQA 3SOBL 4BSWA 5GGRA 4V2BA 3KXFB 4PG2A 1EFQA 3QUKB 1ZT1A 4QRPA 5KSUA 3UYRL 1RJCA 3D0LB 5ADOL 2RB8A 5D1ZC 3QIBB 3RX8A 4GBXD 3QULA 4TRPH 5BRZD 1AGCB 3FO1B 2IH1A 5BS0E 4PB0L 5BO1H 2W0FA 2D31A 4LRIA 4PBWD 3SKNA 2X7LA 4BZ1H 3D25A 2EE9A 4GQ9H 1GOGA 2BC4A 1YEKL 2FX7H 3TIEB 2GJ6B 3WNOA 1T22A 4R4BA 4YXLH 3SGEI 4IRSA 1MEXH 1K8IB 43CAB 2I5YL 1L7IH 1YNTA 2UVEA 4GT7A 1XGRB 4J4PA 4LSVH 2YSSB 4ZUVB 5BW7C 3CMGA 5HYSB 4OM1L 3VD4A 2N56A 4X6DA 4NKDB 5T1LD 2B20A 4KK9D 3QZWB 5J13B 3EBAA 4MHHG 5IEHA 3C60A 4A2LA 1ADQA 1MFAL 3DHMA 4PLKC 3F65A 2DIJA 2Q76B 5TE4L 1RZ7L 5EPMA 4M7KH 2SEBB 1XH3B 1U8MB 3IFPB 2ZUXA 2EDWA 2BFVH 3D85A 2YPVL 2ZCLH 4JFFB 1MHEA 5F89A 2DKSA 3ARSA 1HNGA 1TFHA 1U8LA 4G8IB 4CUCA 1QFPA 3G6DH 25C8H 3IS0X 1SYSB 1RZGA 4P59L 3PDDA 3NZ8A 1NLDH 3MUY1 4XCCH 4ZODA 2PW1A 5IBLD 4F58H 3PWJB 4RFEB 1FIGH 1QUNA 5DJ6A 4I18A 3TBSB 1CE6B 1FNEA 3P30H 1XGUA 2BVEA 3SGKC 1ADQL 4HD9A 2VC2L 4YZFE 2I07B 1MWAB 2R56L 2C1OB 4TVPE 2BNQE 3CZJA 1VFBA 3GSRA 3OKKB 4JFED 4HJJL 2R8SL 1QHPA 3IKCA 4R4FL 3B9KD 5J6HA 5ESAA 5E94B 5IBUG 4JZOB 2YA1A 1NFDF 3ARYA 1CDIA 4BFEA 2X9XA 1BD2A 1NFKA 1UT9A 2AJXL 4NNYB 1S5IL 3H9ZA 3VXOA 3DJ9A 3GKWH 2HYMA 2R1WB 1QKZL 2BDNL 1I8KB 1IEBB 4S0TD 1NMAL 3O11B 1T80A 1MCEA 3D87B 1WBZA 3FFCB 4R97C 4WWID 4LVNB 4NO0A 1EVTC 2EE3A 5ISZB 1EEYB 3OR7A 5HHOA 4HKZA 4DZBB 1LO2L 2BNUA 2ZNXA 4WHTB 2X4TA 4R9HA 4D0BB 3VFRB 1VEMA 2JF1A 1DANU 5HY9B 1D6EB 3K46A 4PJEB 4HK3J 1NBYB 1RY7B 4LLMB 4MA8L 1P5VA 1WLHA 3FN3A 3TPKA 3P9LA 1QSEE 3MRKB 1SJHA 1WSST 2NTFB 3O3DA 2ITDB 3GMOA 3GJFA 1OSPL 1ED3B 5D71L 1U8IA 5I73C 2W0LA 3G9AB 4BFGA 3LEXA 5KTEH 4G6JH 3I2CH 4JGUA 5ANMA 3FQXA 4K3EH 1PEWA 3DXAD 3U30B 3UTQA 4MAYA 1T03H 4TTDC 1U8NB 3C6SA 2Z93A 4OLVH 3RVUC 1QSFB 4GSDH 2W65B 4HHAA 4M93C 1K6QH 3QIUB 1BEYL 1OLZA 3ZSTA 1FSKC 3P0VL 2Q8AL 1HDMA 3MV8D 4NP4L 5L88H 4OLEA 3L1OH 5T33H 5ACZB 2ICWI 3G6AB 4ZXBD 2EYTA 4OGXH 4OT1L 3RL1B 4UNVA 3TBYB 3OXRA 4TULL 3VCLB 5CEXA 2ZWLT 1MIML 3VGDA 4ODWB 3BFOA 1NBVH 1KENH 3FZUD 1AJ7H 3DX7A 1U8KA 1FL6A 4OF6A 1E4WH 1MFEL 1U93B 4O51B 3PGFL 1K2DA 4MDIB 5IUSA 4HFUL 3UJIH 1I9EA 1LD9B 3T3PE 1R24B 3MUHL 2VDOH 1VFAB 3ARBC 4YX2L 3SDXA 3E8UL 3N06B 1FAIL 5I17A 4H26B 3VXQA 1I3GL 4K3JL 4NKIH 1I1RA 5B21A 1KCLA 1KIPB 4YIQA 4ZUWA 2DS4A 4M9PA 4YE4L 5C0AB 1CDYA 4HZAA 3QUXC 2V5SA 1S9WA 1BOGA 1QNZH 3D0VB 4RDQG 1E4KC 5DK0A 5HI5C 1OPGH 4HQQH 1QR4A 4G3YH 2ZUYA 3TYFB 2NXZC 1KB5B 3B5TA 1FNGA 4ZG1A 3GUTA 1C08B 1KIRA 1J88A 2W59A 2G75B 1X6LA 3I6GB 4P5TC 4PJ5A 1BGXH 3QFJA 5HPOA 4XB7A 2W0PA 5BRZE 1RZFL 1A3LL 3BDYL 2IANB 5DA4A 5GJTH 3T08A 3S98A 5ERWB 3ZKNC 4JO2H 4F37F 1AO7D 1EK3A 3BPOC 5DMJB 4JFDE 1KUMA 3QCUH 4U1HB 4M7ZC 3G5YA 4L3ED 1LO3L 3QHZH 5FK9A 3OKDB 4D2NA 1LK2A 5TE7L 4ZPTB 2VMFA 3MRFA 3HI6L 3T0DA 2M26A 1G7IA 1I9IH 3ARDB 1YNKH 3RZCC 3MQIA 4YHIA 3VFTA 1SEBA 4JN1H 5IG7A 3EYSH 4JRXB 1JGVL 1DBAL 2PR4H 1D6VL 1PKQB 4PJGB 5IVXB 3V95A 4ZO7A 2NY2D 4CGTA 3SQBA 5D7JC 2LV4A 4BSVA 4J6RH 1R3HA 3PHQB 4WV1B 4NDMA 2CRZA 4QRTA 5F96H 3IFOB 1EA9C 4WVRA 3WIFB 5DQJB 4ENEC 4APQC 4Y2DD 3BPNB 4LLAA 4LSSH 1J0ZA 3OPZH 5CZXC 2IG2H 2YD7A 1MRCH 1F3JB 3CLEL 4WFED 4X7SL 4LCWD 4QTIL 2OL3A 3LCYA 5D6CA 1MFBH 3MLUL 4FXKA 1UM6L 3CK0H 4WW2A 5L9DH 3CCHB 3OJDA 4WO4A 1YPZA 2DI8A 3O6KL 4LPCA 3BQUA 3U0TB 3VWKB 4KK8D 1DBML 4EDXB 4L8CB 3MRBA 3EW3B 1KCKA 1TQBC 4LQFL 1LHZA 1UJ3C 3M17B 5IMKA 3OL2A 4N0FA 1BQLH 4XTRD 4D9LH 2KZ1B 3LQZB 2NY3D 3BP4A 3HMXA 1C1EL 3KAAA 5HHPA 4M6AA 4JFEE 4OFVA 1EZVY 5A2FA 1BREA 5D2LA 3G5ZA 1B2WH 2YMXH 4U6XB 1X5FA 4ZFZA 3V4PL 2X41A 2ZUTA 2L7JA 5B8CC 2OTWA 3SDCC 5I9QC 2OL3L 4LASH 4MXQC 4DVRL 4RFOH 2APTA 4XNMA 1T20B 5E6IC 4WU7B 2H2SC 3MRGA 3VFNB 3ARWA 3D1MC 2EKSB 3QG6B 3AY4A 5EFIB 5JNYA 3S34L 1KPRB 4DGIH 1BX2A 2OMBA 3FMGH 1JUFB 2J2ZA 3L5WA 4X5WB 1IGJA 2DYPA 3BSZH 1UYWH 3OX8B 3FAWA 4F7TB 2P7TB 3VXRB 1REIA 1JHKL 3PUCA 4IOSD 1NCAH 5LBSH 3L3JA 1LK3H 3HMXL 1LO5B 2F8XC 3CMOL 3V7AE 3NVQA 3FTGB 4JHBA 5AAWA 5FKPB 4NQEA 4IOIB 2Y25A 2ENSA 2J5LB 4PJ8C 2R1XA 2FH8A 5D2NE 4DW2H 4UI2A 1T2QH 3SGJA 5FYKL 3HE6B 3HZMB 4X5LA 2QADD 3MRHB 2WWKT 4JKMA 3NFNB 2YKLL 2R2BB 4PJ9B 2G2RB 2PF6A 2APFA 1FJ1A 4JO4H 4TUJB 1K5NB 4X4XA 3SJVA 5JHLL 1XIWD 2MCPH 3FHQA 3O2WL 2ADFL 3L3HB 4ISVB 3E3QC 2QKIB 1BZ7A 3C09C 1CDJA 2B8OT 3OKYA 4MS8C 3UJJH 4OCSH 3U83A 4Z0XB 3D9AH 4JN2A 4LAJH 4WW1B 2WBJA 3U6RA 2R0KL 4PJ7B 3W39A 1P2CA 4P3DB 4LEXL 2DWDA 3L3OB 3MV8E 1NH6A 1N8ZA 3HAEA 4N5EC 2DBJA 3JWOL 3CFJB 5E2WH 4F7EB 1QRNA 2FIKB 4HKBB 3I02B 1CBVH 1A6WL 3R06B 3GB7B 3U7YL 5IB3A 1WC7A 3IDYC 3PWPA 1FCCA 43C9B 5I75C 2DF3A 5C0BD 1BJ1J 3IRZA 4S11A 4U1NA 1G7QB 1RK0A 4NJAL 4WEBL 1ACYH 4WY7H 2Q3ZA 3DRQA 2EXWD 3P4MB 3MCKB 1YC8A 4JM2D 5DDHB 5JXAL 5DYOA 4ODSH 5CKGA 3RWDA 2DRUA 1ZT4B 3RNKB 3K1DA 3X14B 1UCTA 2Y5TB 4PGDB 4ETYA 1CFNA 3QH3B 2K7QA 3W81A 3H0TB 2EIZA 4OZFA 4OZHF 4CADA 4JFOB 2P8MA 4GAYB 1NC4D 3FQUA 1MJ8L 3VMNA 1C5BH 1R3IL 1RZKH 3S35L 3DOSA 4G9FE 3MV7B 3GMNB 2R0LL 1DDHB 2Z31B 2P5WD 4GW1B 5DI8B 5DLMH 3S4SB 4YUEL 4ONFH 5I71B 1S9KC 4AIZB 4UAOC 1AO7E 2OTUA 4CW1B 1PEZA 3G6JB 4JCMA 5I8EB 5AUMB 2JB6B 1MHPH 4HBQA 3FHAA 4KPHL 3LEVH 1BLNB 3OKEB 2VLJE 1JZ2A 3K4AA 1T83A 4HWZB 4JRWA 4L8SA 5E8DH 2NLJB 1R3JB 5GS2H 4D9RD 1IGFL 4M1GH 4MCYB 1F4HA 5D1ZD 4MD5A 1OD9A 1C16A 2OS7A 1EXUB 3ZYZA 4TUOA 4ODUA 1N2RB 3AAZA 2X4SA 5MP6H 3NCJL 4UV7L 4LVHB 1IT9H 4NN7B 2NY6C 1LO2H 1UQSA 5KVEH 1Y18B 3LD8B 2FH6A 3F12B 1U0QA 4LRNH 1XZ0A 3TJEH 4DZ8B 1OF2A 3B9DA 5D1XC 1QA9A 5A2LH 1E0OB 2DQTL 4QXTA 3WD5H 2DL2A 4LCWE 2I27N 3K2UL 4XP9H 5D7SL 5E4EC 5AAMA 5J9PB 3RHWK 2X89D 4QOKA 3EYFA 3RWFA 5KN5A 2ICES 5ID0A 5T1KD 1XF2A 3C8HA 4CDHA 5GJSL 1DQQA 1KT2B 1IMHC 4JDVB 2BY0A 4U1SA 5IT2L 3U1SL 4UINL 3EOTL 4KK6C 4YXHH 4OTXL 2Y5EA 4PLKD 4DKEH 4G8GA 4P2OB 5L8LB 1D5IL 1PKOA 3VD5A 3AMKA 1WVZA 2WNGA 4JHWL 4ZQKA 1CT8A 2HVJB 5FYJD 1U8QB 4QRQA 5JDSB 1C12B 1OAQH 3MLYL 1RJYB 5INDB 1HSBB 4F37K 1IAIL 3L5XL 4GMTL 3GMPA 1NGXB 4TULH 4OCXL 4JEGB 4A6YB 4N0UA 4K8RC 3QDGD 3GSUB 4LHUG 4XCEB 4JGJA 3NA9L 2F58L 4HW6A 5D72H 3WUWA 1FZJA 4HPOL 2R2HA 3MSPA 3PV7A 1T7VA 5DVMA 1T6VN 4HFUH 5EU6D 4EJ1C 4R7NA 5EN2A 4NO2B 5I2IA 3MRRB 1FNSH 2L0DA 4JQIH 1D9KA 3V0VA 3I85A 1J1XH 3AU1A 3QIWB 1ZLSL 1DLHA 2VXVL 1Z0NA 4OFYD 3TV3H 3KXFE 1JGLH 3F8UB 3TT1L 3WXVH 1DVFA 3AS0A 4KXZI 4YE4H 4OAWA 3KPRB 2LABA 2ZSVA 1KYOJ 1KC5L 4M3JA 4BZYA 3IU3B 5F7EL 5E8NA 2FHBA 3MV9B 4XAKE 4MLSA 2X4OB 3IDXH 2ADIB 4P49A 2CK2A 3LVEA 1U6AL 1CVSC 4F9PA 4LCYB 4Z95H 3S96B 2YRPA 5DGQA 1QBML 3TA3A 4HK0A 5D93C 1S9VB 3CFCL 3HHRB 4UQ2A 2GJ6E 2ZG3A 3TZVA 5T5FH 3VI4E 4X9GA 4WI5A 5FB8B 3MA9L 5I66A 1ONQA 4NQXB 2Q86B 2Q1EA 2BJMH 1EO7A 3A6BH 5EU7E 2DJSA 4M6OL 2XA3A 3NACH 1DN0B 2HAZA 5HHXH 2IADA 3A67H 4MZ2A 4HKJA 5C0RL 1OGAB 4A2MA 1PG7W 4I0KA 4ZTPH 3R8BB 4LGRB 2YD8A 2HP4A 1TVHB 1VACB 2IFFL 4Y16A 1UXWA 2CDFA 5I18L 2W9EL 4ETQA 3WL9A 2ZCKL 5JOFA 4ONHA 1JGVH 1KB9J 1Q0XL 3O3BB 3PABB 5C0BE 1QFWI 3O6LL 1AIFB 1KJMA 4TTDD 5F8RC 1KIQB 3RVUD 3Q0HA 1HXYB 4FQ2L 4P2RB 4BKLA 4HBCH 3BXNB 1EBAA 4KVNH 4AK1A 3D39A 2DM3A 2AV1A 2YRZA 4UV4L 4NN5C 5D9SA 1Z9MA 5D1QC 1LEGB 3MLZL 4BJLA 1UKTA 1CG9A 1KEMH 2R2CA 3OKNB 2CLRA 2GHWB 5AYQA 1IC4H 5A16A 4IIQB 4O58L 4BSWB 5C0CD 3RI5K 3AREC 1U8OA 2CO6B 4H1LH 1JN6A 1ZT1B 4X7SH 4ZNEA 5J0BA 4QRPB 5KSUB 3HMWH 3FQWA 4ZYKA 5KSVA 1T3FA 4O2FA 3VMPA 4NHCH 3HLAA 3QJHA 4HUMB 5F7DA 3PIQA 1Q94A 2IH1B 2W0FB 2D31B 5JPMA 1EJ6A 4FQJH 4NM8L 3SKNB 2X7LB 4JY5H 3D25B 1RHHB 3VH8G 4PFEA 2P5WE 2E6QA 1H0DA 4FFZL 5ADPL 3ARBD 3BRFA 1OT2A 3AXLA 2NX5A 5ESQA 2D4DA 2MKLC 1T22B 2NCMA 4R4BB 2J4WL 1JPTH 3IETA 1I9RL 1VCAA 2AEQH 1UWEL 1IAMA 2CIKA 3ARRA 1TDQA 4OZHE 1YNTB 3QUXD 4LGPB 3MLWL 3IDIB 4XWGH 4MNGB 3VFMA 4PY8I 3W82A 5HI5D 4W70A 1AE6L 4HIHA 5BJTB 2NXZD 4X6DB 5D5MA 3U48A 3ZTNH 3BZDA 4G9DA 4UB0L 2VSDA 4WUUD 4PGJA 5IEHB 1YN6A 3C60B 4P5TD 5AWNL 3QNXA 1AY1L 4PS4L 5AZ2H 3RNQA 2YD5A 5A3IC 5B3JF 4PLOB 3B43A 4FQHA 3ZKND 3E1F1 2XY1A 5DO2C 5EPMB 4RAHA 4U6TA 2PW2B 5F6HJ 1BIIA 3SKMA 4PJ7F 2FZ3B 3D85B 5DD0L 1TPXC 3HZYA 5F89B 1U8LB 1DE4A 1B88A 3HZVA 3A6CH 5ITBL 3CMOH 4RMWA 1RZGB 3NZ8B 3G5VA 4P3CH 4UT7H 1X5AA 3RZCD 2PW1B 2Q8BH 3BKYL 3RQ3A 5MEQA 4U7KA 3EDEA 3RIFK 4MVBC 5DJ6B 3MRCA 4QRRA 15C8H 4I18B 3ARPA 1FNEB 1EBPA 1QSFE 3BAEH 2HRPL 2FLBT 5D7JD 2K9UA 2AJUL 4XMPL 3QHFL 3O2WH 2DQGL 4O4YL 5DR5H 4BH8A 3W0WB 1VFBB 3GSRB 4RX4A 3LIZL 1BFVH 3IKCB 5GRVK 2IQ9L 5DJ0B 5ESAB 4ENED 5CBAA 4APQD 1AXSA 3JSSA 2E3VA 2PCPB 5CZXD 5T3ZL 5M94B 5FYJE 1BD2B 1FVEA 3N1MC 4P23C 4F7CA 5L7XL 1ZWIA 5GS0L 1BFTA 3FL7A 3VXOB 5JQ6H 5CCKH 5KW9H 5GS1C 4JAMB 5GQBA 4N9GA 1B90A 4BQ6A 3WNNA 1WBZB 2V9RA 1WTGT 5EIQA 1GOFA 4NO0B 5EBGA 3QDGE 3OR7B 4X6CB 3VRLF 2ENYA 4HKZB 4MCZA 4RGNB 4JFQA 4POZC 5HGAA 2X4TB 3K80A 3MREB 4BH7A 3WJLA 2R0ZH 1RUMH 5KANG 3ARFA 4DK6A 3R8QA 1ZE3C 1WCBB 4PJFA 1IFHL 1IKFL 4J3XA 3LOWA 2NR6C 3Q5TA 2DLHA 3QUMH 1QLFA 2NY1B 4R26L 4FP8H 3G6JF 3P9LB 5C0AE 4Y19D 4AEFA 3JTSA 1WFUA 1QO3A 3GMOB 4TQEH 3SDCD 3GJFB 4W4OC 35C8L 3DURA 4MXQD 1U8IB 3GBML 4XPAL 4RGOL 4I77H 2BNRD 4Q6IA 5E6ID 1T1XA 3FQXB 4GAGH 2H2SD 4NQVA 1E28A 3UTQB 3UPRA 4MAYB 3CU7A 2Z93B 4MB4A 1H3TA 4FFYL 1H9VA 4DTGL 1QZ1A 4HHAB 5DQDL 1A14L 1PG7L 3C87A 1YMHA 5IV2A 4D0CA 3S88H 5ILTL 3DUUA 3V4VL 1HDMB 1HCVA 2D3VA 3EFDH 3RDTC 2Y36H 1BM3H 4HIJA 5CZVH 2GYSA 2EYTB 4X9BA 5DJAA 2X70B 2GQHA 5I15H 4KZEL 2OTPA 5IMOA 5CEXB 3BP7A 3DSFH 3BT2L 1XMWA 3QO1A 3MRQA 1OAXH 4PJ8D 3TFKC 1CGVA 2XZZA 4ZAKC 4K23L 1UWGL 3DX7B 4OIBA 1U8KB 5GRWA 1PYWA 4W68A 1PGRB 1RI8A 5DRNB 1XEDA 1J18A 5JW3L 5K9JL 2CR3A 2XG5A 4RMUA 1A6UH 1T7YA 3TP4A 5CP3A 1E6JL 1IGFH 3H3PL 1J87A 1YYLH 3SDXB 5I17B 4RISL 4TSCH 3VXQB 2UUDK 2UZIH 4MS8D 1V7NH 4PBVC 1MCOL 4AIOA 2XA8L 2YR3A 4QY8A 4YIQB 1PSKH 4LSQH 4ZUWB 1OP3H 4XPHL 1I8LA 1EX0A 1ZEAH 4N5ED 4KKBC 3AM8A 1IKNA 1S9WB 1BOGB 3DGGA 1J1PH 4OGYH 1ODAA 5C0CE 3O9WA 4H25A 5DK0B 3OF6A 1G0XA 1HIMH 4MJID 2AI0L 1FNGB 2XI9A 1T4KA 4WTZA 5HYSG 5IM7A 1UGNA 3GUTB 2DJ4A 1KIRB 4XMLH 1JHTA 4BK4A 4PJ5B 3QWRA 5EG6C 2H32A 3QZWG 1FFNA 1YUHA 3P73A 4HWEH 3UPAA 3ROOA 4JRYD 1F45A 3GO1H 2HFGL 4HXBL 1R5IA 3HC4H 4D8PB 1IGCH 1C7TA 4HZLA 3UZEA 3FJTA 4R8WL 5BMFL 3G5YB 3MX0A 4H1LB 2BY3A 4Q9CA 5FK9B 2ZUUA 1LK2B 2DJUA 3EDKA 5F93C 3RVVC 3MRFB 5HVGB 4JHWH 1HWHB 2UY7A 1KLUA 3NPSC 4YHIB 4PJBE 3VFTB 1SEBB 3KPOA 4GXVH 5IG7B 1I3RA 1IARB 5KJRL 4G8FA 4GMTH 5D6DA 5C7XH 5CJOH 4MNHA 4GKNA 4BM7A 2O5YL 5FCUH 4N8CL 1IGTA 3ZZ1A 1B6UA 4NNXA 4BSVB 1SYVA 4LNRB 1R3HB 4U3CA 3ZYJA 2OLDA 4NDMB 4NWUL 3T2NH 1U58A 4QRTB 5E00A 4RIRB 1LDPH 4Y4FC 3MOQA 1ND0A 4FOMA 4MJ2A 2GUOA 2YXMA 1DLFL 1S3KL 3ZTJG 2WWMC 3S3SA 1YQVH 2WBWB 1NDMA 1T6WA 4K7PX 3U46B 3CD4A 1RUKL 2OL3B 5D6CB 2ZOKA 4FXKB 3T2PA 4F57H 3BMVA 4WW2B 4TN9A 2BRQA 3OJDB 4WO4B 4OF0A 3T4YA 1YPZB 2FATH 2BRRH 4JREC 2W91A 3OZ9L 3BQUB 3W2DH 1YEGL 1HKLL 3QCTH 1S9YA 4DVBB 4QHKJ 5C6TH 1QBBA 1FQ9C 3MRBB 1Z6JT 5B3JE 5IMKB 4HJGA 1IQDA 4N0FB 3MJ9A 2XRAH 1YN7B 2UWEA 3DROA 2HG5A 3BP4B 5TH2B 2X1XR 2NY6D 4PJ7E 3TBVA 5HHPB 3IYLW 1KCVH 1YDPA 4UBDC 1WUNT 5IESH 1KGCD 3G5ZB 1EERB 2WLZA 4DWHA 1HH9A 4ZFZB 2OTWB 1INQB 5LGJA 1H5BA 5D1XD 1KPUA 4POUB 5DXWA 4XNMB 5C0RH 5DF0A 3QO0A 3VE0A 2CK0H 2B2XH 3SO5A 5JNYB 3BP6B 3F7YA 1MAKA 1BX2B 3L5WB 4EUPH 3OHXB 1J8KA 1J5OL 3MTRA 3VFPA 1IGJB 2DYPB 4XH2A 2V2XA 4OCWH 4TPRL 3MJ9L 2C3GA 4WUKL 1FZOA 2B39A 1KN4L 2ZG2A 4KK6D 1FVDB 4NBYB 5CIPA 5BS0A 2FYYA 1D5MA 2HTKC 4N8PA 2H1PL 4NQEB 3V6FA 2X6MA 3QXDA 1MFNA 2R1XB 5HVWA 1NAMH 2ORBH 1OSZA 2OZ4H 2F54A 4Y19E 4MD4A 4KVCL 2BP3A 3SCMA 4Q0XL 1TJHH 3EO1A 4UOW0 5L2KD 2FJHA 2V7HB 1FJ1B 5HI3C 2GT9A 1RUAH 4K8RD 4X4XB 3SJVB 3VRLE 2BNRE 3MV7E 1JL8A 2V5RA 1RVFL 2C4FU 2G60L 2JJTA 4X6DF 1NAKH 1BZ7B 1QBLL 5CP7A 1JTTA 1CE1H 2X9YA 1AXTL 3B9AA 1WITA 3QUMB 5EU4A 3O4OB 4X7FC 1NCBL 4JN2B 5IFHL 2DLGA 2RBLA 2WBJB 3U6RB 3W39B 3MCLH 1P2CB 4Y5YA 4YJZL 2DWDB 3G6JE 2ICWA 5IP4A 3HAEB 5ENWA 3QJFA 2DQCL 1OTUC 2VOTA 1QRNB 2BSED 3T2OA 5IB3B 1WC7B 1U41A 1YEFL 3BZFA 4AENA 3I6LE 1CLYH 3PWPB 1ZGLA 4X80L 5HI4C 3THML 4U1NB 3N1GC 1N5AA 2DTSA 1MJUH 2YRLA 2J6EA 4WGVB 4E41D 2RHEA 3DRQB 3RX7A 3HE7B 1IRAY 5I6XB 3PDOA 1MCNA 1VPOH 5DYOB 3RWDB 4YHLL 2QEJA 1A6ZA 5EOTA 5AWNH 3E3QE 1CFNB 2CUHA 2LVEA 1F3DH 2X1PA 1W8NA 3INUL 4LDOB 5DJDA 1NUDA 2VN4A 1OB1A 4OZFB