5IF0A

Crystal structure of vrc01c-hugl2 fab from an hiv-1 naive donor in complex with with a germline-targeting gp120 engineered outer domain eod-gt8 at 2.44 a
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAKISGSYSFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords VRC01cHuGL2 Fab heavy chain
publication title HIV-1 broadly neutralizing antibody precursor B cells revealed by germline-targeting immunogen.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 219
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5if0A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5if0A01
4LCYA 3VD4A 1LO5B 2IGFL 3DUHA 2OL3L 3W2DH 5DQ9B 4MWFB 3RBGA 4AIZA 1Y18B 3S5LA 1BD2D 1N26A 5CZVH 3UZQA 2DLHA 4XH2B 2EDXA 4ZFZA 1H3VA 1YY8A 3ULUE 5DLML 4DGIH 3SKMA 1MFBH 3FCTB 1JRHL 3BDYL 3OKDA 4HXAL 4N0FA 4XCCH 4C83B 3Q6FB 5FF6B 2VR9A 3QA3B 5IMOB 2R2CA 1JV5B 5DSCA 1AKJA 2EDBA 5IESH 5K9OB 4JM4L 2QSVA 3BKCH 3PP4H 2XY1A 1UM4L 3ZKXB 2CKBA 3FRUA 5EUOF 4N0UB 1C5DA 4Z76B 4NRXA 4M1GL 3TWCH 3BO8A 1MFAL 3HE7D 4I9WD 4DFHA 4MHHI 3QFJA 5DVMA 5DEGA 1WZLA 5MERA 3SE8L 3EO9H 5DFWH 3L3GB 1PW3A 1KEGH 1DQDL 3DURB 4MJ5A 3OAUL 4DQOL 1A6ZB 2OX5A 4F7PA 3TCXA 1WBXA 1IKNA 5BV7C 1CLZL 1HHHA 4ODXB 4OUUA 5T1LA 3QBTB 4OLUL 3DVNA 2XA8L 4G8GE 3T8XB 5D4QA 4I2XA 3U9PL 5ICYA 2BNUA 5GRJL 1GOGA 4LEXL 5DS8A 5I8EB 5BVPL 5HGBA 5ITBL 1RZ8B 1EFXD 5DMJB 4HS6A 1KB5A 4FFYL 5EZOH 1JPTL 4GRMB 3VXQB 1DTUA 3RGVA 4YNYB 3D3VD 4QNPE 1T0MA 4JFHE 3DVFA 4L8BA 3C5ZC 2IH3B 3UXFA 2ZUWA 3H9SE 3VXNA 1C7TA 5CZXC 2A0LC 1GGBH 5I15H 4ZYKB 1FCCA 3QG7L 4FA8A 3LN9A 1P4IH 3HZVB 2J6EH 2AJVL 3N50A 5ADPL 5HYQB 1BMGA 2OTPA 2QADC 2VKWA 4HUVA 3HAEG 4WI5A 3HR5B 1DBAL 5ECJE 3L1OL 3QI9A 2EXYC 2DRUA 4CDGC 4N8CL 4XXDA 4PGEA 2P49B 4I77L 5HTSA 4UOW0 4FQQB 3W9DB 2FEEI 5C0EA 2FBJH 3SKNA 4JFFA 3KXFE 4JHWL 3S36H 2CRZA 1Q0YL 3F7VA 3HE6C 4M4PA 1N5AA 5JHDB 4YBHA 4WW2A 2A9ML 2G2RA 3AB0B 1G0XA 3OXSA 3B3IB 4JREC 2AEPH 3N1GC 3AMKA 5D5MF 1VEPA 4WI6A 2VISA 1P4LA 4MNHA 4U2ZA 2X2YA 5F7WC 3VDAA 1AIFB 3QSKB 4S2SA 2X4NB 3UPCA 3CH1A 1I1FA 3LRSA 4ZFOA 5HGDB 2N1KA 4JPVL 3T0EB 3GMRB 5D1XB 1BD2E 4QO1A 3BPNC 4LSRL 4WO4C 4Q6IC 3LV3B 4JFOB 3JV0A 3KWWB 1XIWD 3BYYA 5KVFL 5C08B 4JO4H 2DMBA 2N7BA 4M9OA 2CKBL 1JPFB 3GSQA 3MOBL 3UTQA 2P45B 1T7YA 5C07B 1FV1A 4OGXH 3GNMH 5E6IB 2IQAB 2B1HL 1J0IA 4KK8D 3TVMC 1I9JH 4MCYA 4PP1C 3FB7B 4XCYB 4GW5A 3QIBC 1HHKA 3A67L 3BW9B 2WBJC 4OB5H 1U3HB 2F58H 3VFWA 1T21A 4PTTA 3QNXB 1KOAA 2VSCA 1S8DA 3T04D 3TZVC 4Y2DA 4RMVA 3GIVB 1CGSL 2CLZB 4GAGL 3V6OC 4XAKE 3MLRH 2I9LA 2HFGH 3STBA 4CGTA 4AEIH 4WUUD 4GG6A 3I6KB 5DJ6A 4O02H 4Z7NF 2CGRH 4LPWA 3MRLA 4JRYD 4BQ6A 1MAJA 1FG2A 3H3BC 2OXGA 3PQYA 5HVGB 3HUJF 4P5KB 1N3NA 3GJEA 4JHAL 3B2VH 5D6DC 1CICB 4ETQB 4YHKH 3CX5J 3S5LG 3P77B 4NZUL 4J8RA 1KJ3H 5DMYA 5JORB 2QSCH 2D2OA 1YDPB 1U8OA 1PKOA 4N1EA 3FQWB 1IAOB 1KJ2L 1X44A 4HPYH 2IBZX 2IALB 2ICCA 2XWBA 2V17H 5GJTL 4RQQB 1DFBH 1EUUA 3ARXA 2H8PA 1WCQA 4YXHH 3A6CL 1NBYA 4AT6A 3NAAL 4HT1L 2P5WB 1UT9A 5C8JA 4HV8A 3EYVA 4ALAL 1GC1L 1T1XA 2BSTB 5EOQH 5BZDB 3RIFK 3EAKA 1FLTX 5EU5B 4ZS6D 2LVCA 3QEGH 5HI4C 1Z5LA 3ALPA 5KS9B 1AE6H 1WFNA 3NIFE 3FFDA 4L3EB 1S5HB 5I1JH 3EOTL 3V5HB 1S7UA 1CLYL 3GDBA 1HOCA 2DTMH 5IVOA 1K6QH 1T22B 2X7LA 4OZGE 1FC1A 1JGDB 3TBSA 4YBLB 1EHLH 3VDBA 5H2BA 3FMGH 5F3BB 3TGXA 5FK9B 3ZDYF 1H15A 3M17A 1U2CA 4PLOB 1OT2A 1IGML 2NZ9D 3P0VL 4ZFOL 1NCDL 5B8CA 5I1EH 4CL7A 3SDXF 4PJBB 4GXVH 3NCMA 3MRQB 3C6SA 2EH8L 4XMLH 4D8PB 1CN4A 1G1YA 5EU3A 2MOVA 3BYTA 1F8TH 1MCCA 3VRLE 3W39A 2XNAB 2PO6B 3NCBB 1K8DB 4X0KA 5FYJU 5TE4L 3SDCD 1ZGLM 4PBXA 4R8WH 3BKML 3RWFA 4OBSA 4QRPE 1BIHA 5ETUB 4WUKH 1X5JA 4HG4J 5BOPA 3CSYB 3VG9B 1O7VA 5FCSH 1OSPH 3HG1B 2BJML 4QXGL 3HI5H 2H2SD 2YD3A 4M3KB 5FA3B 5MENA 3GFUA 3U83A 3ZYOA 1IRAY 4GFTB 1B9ZA 3LKQB 4G6MH 1MY7A 2DMKA 2EZ0D 5KANI 2YUZA 2VLJD 5IG7B 3D69A 2J6EA 5C0AB 3PGFL 3ARGA 3MSPA 4U6YB 4X9BA 4DVRH 4P2QB 3F58L 2ZUVA 1KTDB 3M45A 5CSZA 3MUZ1 1JNHA 1TVHB 5F9OH 4YBQC 4NYLB 5GGRA 4HK0B 4KMTL 1MCWW 5DRXB 4GT7A 2EIBA 5DZNA 3WD5H 2HRLA 4LSQH 4NOBA 3CUPA 1HINH 1QEWA 2VWEE 1A7QH 3HMWH 3K8LA 5GPRA 3TNNA 1QA9B 3OR7B 1PDKA 4APQB 2R0ZH 4MQ7B 1XR9B 2V2WA 4NQEB 4EXKA 2AK4A 4P23B 1I7ZA 1UQSA 1HSBB 1JVKA 1XGRA 3V5KB 3IDIA 4U1JA 1MI5B 3AREA 1IM9A 1FVDB 1KCLA 5IM7B 1CFTB 5ESAB 2FL5A 1UWGL 1GZPB 3MLWL 4WHTA 3GMNB 4NN6C 5E1AA 3V7AE 4ZAKD 3OTTA 3UTSA 4N8VA 1MLBA 5DR5H 3RPIB 3LIZH 2NXZC 4JN2A 4WWID 2CK2A 4Y4KD 4KTEL 1FN4A 1JMZA 3I75B 3LQAC 3TA3C 1TTUA 3QXAA 4LLDA 4ZO8A 3LSOA 1QSFD 1QRKA 4D9RE 4D0BA 3KVQA 4KKAC 4JQVC 1NGWA 3D0LA 1ORSA 1EH9A 3D87B 5CP3A 3A6BH 3I6LE 3O41A 2P4AB 2L7JA 5IB4B 5LGKA 4CNIA 4I18A 3DRTA 1YYLL 4CN1A 1HILA 5KZCD 1WGOA 5FO7A 1WT5A 5IHBA 3LRHA 3D18B 3G6JF 3HKFA 1J8KA 3KPSA 1IL1A 1WV7T 5KSAB 3AGVA 2G75A 2P5ED 2R29H 4FQIH 4YHML 4RGOH 5I16B 3QO0A 5AYQA 1G7IB 3BDXA 5ITFB 4YHOL 2V7NB 5GZNC 4JKLA 1JZ4A 4M00A 3JTSA 2NY4B 3GM0A 1K2DA 2XY2A 2AGJH 3BN9D 4M5ZH 1IJ9A 1QQDB 5FOJA 3QUZA 4BFIB 1BLNB 2LE9A 1G9NH 2M1KA 4OD2B 1K8IA 1XGQB 3BAEL 1TCRA 2I60H 4HIHB 4K9EC 2OJZH 1VPOL 4XPTL 4I5BA 3L3HA 1SJXA 3G5ZB 4NBYB 2YPVH 3U79A 4KK6C 3VXUA 4WCYH 5IMLA 5FHBH 2VR5A 4IBLT 4AIXA 3BVNA 3HC0B 4DKEL 2BX5A 4TTDC 4ZOAA 1RUQH 3VGAB 2VLJE 4CVZA 4MAYB 4RAVA 1FL3A 1A2YB 1FYTA 4HH9B 43C9A 3MRRA 1ND0A 1F58H 1UXWA 4LSDA 2WW8A 3T2PA 4CU8A 3C5JA 4P4RA 3VWKD 5CLTA 3KYOB 3NCCB 2YD5A 4NQTA 2UY6A 1NCBL 1QFHA 4NNYB 2YA0A 2EIZB 1QD0A 5FO8B 3X3FL 4G8IB 1JNJA 3LVEA 2APBA 2DWDA 1IBGH 2R2EA 4Z7VA 4MVBD 4K3EH 1XF2A 1CG9B 1J1PH 1Q38A 1RZIA 1LNUB 1NFDB 5FFLA 2ENYA 1BAFH 3P9MB 3U4BL 3MA9H 4I4WB 4HUXA 3IDGB 1IGYA 1MIEH 2Z31A 2PW2B 5FHAL 1ZANH 4ZTOH 3P40A 4U6XB 4LFHD 4O58H 4PRPA 5E2TH 1EEZA 3I2CH 1VFAA 2XICA 3QQ3B 5DI8A 4YJZL 1FBIL 3C8KA 2VC2H 2X4PB 1MCDA 2YXMA 4KFZC 3KPQB 3OXRB 1LDPL 4PJDA 3PUCA 4B50A 5DJDB 3P9LB 3TESA 1N5YH 5LGHH 5F3HA 3GSNH 2GTZA 5FECA 3UX9B 4Y5VA 1VKXA 5GGUB 4X7FC 1IQWH 4OM0L 4WU7B 4KKNA 1MVUB 5IWLA 3LKOA 1QSFE 2ZSVA 3D2UD 5GRZA 2VH5L 4Y1AA 4LL9A 4HDIA 4WI4A 1QRND 4M6MH 3O6KL 1SJHA 1X5GA 5HGHB 4ONGL 3AS3A 1JCKA 3SGDI 2L0DA 4GAJH 1CIDA 1U41A 5BZWB 4M62H 3V6BR 1M7IA 2GAZA 4NN7C 4PS4H 3NFSL 3RY6C 5SWSE 3SQBA 4OZIB 3O2DL 4HIJA 5B4MD 3ELAT 5CGYC 2OM5A 3VXRE 5SWQB 5JNYA 1FO0B 5IBLC 3LN5A 5IK3B 5CJ5A 2PNDA 1B0RB 2NY0B 2AEQH 5CINL 3JWDC 5LWYH 4PJXA 1RVFL 3LN4A 2DKSA 1Q9LB 5C0IA 1A7OL 1IFHL 4H26A 1EBPA 5GGVL 5I6XB 1DVFA 1T66C 4QF1A 1CD9B 5AWNH 2DQCH 2A83B 1A6WH 4AY0A 3PIQA 1ZHBB 1T1YA 3UBXI 1YUHB 4XNZC 5LAXA 4N1HB 4N8VG 5EFIB 2YWZA 4K2UL 5E4EB 3UPAA 1FZMB 3HNVH 4P9ML 5I76A 2EE2A 3CFDB 4M7LH 3MRJA 3VFSA 2ORBH 2B2XL 3P30L 1R5VB 3QJHA 1BQHA 1TNMA 4HLJA 4RMWA 4ZUUA 1QKZH 1XCTA 2Y6SC 5E8OB 1YPZA 1X6LA 3MV11 4G6JL 2E8YA 4PJEF 3RVXC 1SJVA 2NW3A 4GH7B 2HRPH 5CEXA 1MHCB 5TFSH 3BGMA 3KPNB 2NY1B 3JTTA 3CX2A 4HWUA 2ZOLA 5I9QC 1BVLA 2P1YA 3PL6A 3HI6L 4NZRH 4OLWL 1FH5L 5A2IH 1I1AB 3GHEL 4F7EB 1U58B 4EI6B 4I48B 1C7SA 5J1SC 1S3KL 1OAXL 1ADQL 3MV9A 4QHUB 4GKZA 3T0WA 1KEML 4QHLA 3H8NA 2R9HC 1I1YB 2LQRA 3O6MH 2HYMA 1JZ8A 3MRNA 2FECI 5D72L 5DD6B 3D48R 3SDAC 3FN0H 1DN2A 4HBCH 1TJIH 2HLFD 1A3RL 3ILPA 4OCSL 4P57B 4PRDA 5EIVA 4I3RH 2BRRH 1J05B 1W72L 3GO1H 4ERSL 4Z7WF 2ZCHL 4XVSH 4LHUA 5GRYA 2X40A 1HHGA 4G8EB 4FQPA 4OM1H 3ROLA 4JKPL 5E8PA 1FJ1B 2BNRA 3V52L 3HNSL 2IGFH 1U95B 3JWNC 5AZEH 4EQ2A 3RFZC 4N0CC 1MAML 3DMMC 2ZG2A 1OTSD 2YRPA 1UKQA 2FYYA 3SOBL 2V5SA 3FTGA 3UAJC 3LY6A 2UWEE 4Q9RL 5KVEL 1UWXH 3GMQA 5D96B 1R5IB 1W0WA 3SHSA 3QXWA 4ZO7A 2KH2B 2VXVL 4X5XB 5KVDL 2MCPL 4OCYH 4ZUWB 1WEJL 5DC0A 2HFFB 3FO0L 1JHTB 5EN2B 5GGVY 1UVQB 1RJCA 1ERNA 2Q6WA 1SVCP 1RJYA 5BOZG 4OGAC 4RGMB 1BHGA 1EA9C 1BZQK 4PUBL 3M07A 4JM4H 4YR6B 3QCVL 4J7RA 2NY5L 1C08A 1G7MB 3R1GH 3FFCB 4NWUH 4HXBH 3GMMA 4X7EC 2HJLB 4NHCL 2JB5L 3FRPA 1MFAH 1HXYA 3DXAA 4HD9A 3ARFB 4TPRL 4LLYA 4ODUA 5HD8C 1FRGL 4NNPH 4LQ1A 1UZ6E 3DHJA 3OAUH 1WCBA 3PDGA 5LXGL 2DQIL 1CLZH 2E7MA 2OL3B 3P11H 7FABH 5MP6H 1CXKA 4FZ8L 4LASH 4PLJC 3U9PH 1KPUB 1LD9A 5AD0B 5HHOA 2AS5M 5JHDD 1NLDH 5CJ8A 3I84A 1YEDB 4IRSA 4H1LH 5IB3A 3MFGB 4PJFA 2BVQA 2AW2A 3JV4B 2F19H 1MCKA 5JQ6L 1FFQA 2Y9RT 4LCUB 5CSBA 2AXHA 4DN3L 1FNEB 4CVXA 3N06B 3O4OB 4X6CA 3HC3H 1IVLA 4FRWA 4GW4B 2H9GA 1HH9B 1CFBA 3GMLB 1JYWA 4MXVF 2VAAB 3T0ED 4EN3C 5D1XD 5ADPH 4DKAA 2D31B 2OLDA 1VGKA 3HCVA 4JCLA 4IRJC 4R4BB 1IT9L 1J1OH 4O2EA 1RMFL 3WHE1 3L1OH 1C12B 5C08D 5E2JA 3GSNA 3GIZH 3ZT6A 3TO4B 4TNVF 1NGQH 2P24B 4UNTA 4L3CA 2DAVA 1LP9F 2P8PB 2VZ1A 5DUBA 2WWKO 3MXVH 5I0DA 3NACH 1TZIA 4POUB 1Q9KA 4MD0B 3VFMB 2DM4A 4EDXB 1WLHA 1P84J 2V5RA 1U3HD 4LSTH 1SY6H 2JJUA 3INUL 1DEEB 4L8CB 3DX6B 5J11B 2XV6B 1TQBC 2GSGB 1OGTB 1TZHA 5I1CL 2XTJE 5C6WH 1X4XA 4XMPH 4JG1H 3OR6A 4XWGH 4FQ1H 1UKSA 2B5IC 4P2OC 4XNMB 2VABB 1GHFH 1BQHG 4PGDA 3HZKA 5HYJB 4KAQL 2I07A 1CICD 1H3PL 4LMQE 3IFLL 3LQZB 3GI8L 4E42B 2W65B 5L88H 3W5NA 5F6IC 4LK4A 3VXMA 1U8NB 2W9DL 2Q87A 4AJ0A 4PTUB 5IR1A 1PY4A 1UADC 1HKLL 3K8KA 4XBGA 2R15A 1K5NB 4RSVA 3RDTC 3C09C 2D9CA 5E0QA 1AXTL 1MFDL 4S1RL 3ZDXF 1RZJC 4PJAF 2ZSWA 4QOKA 1I1RA 5J8OA 1E6JL 1KXTB 1LEGA 1WZ1L 5BJTA 5D7JC 1BFOB 4HJ0C 3Q1SL 4JO3H 5DYOA 4FTVA 4LCYB 3DETD 5GHWH 2EKJA 3MNVB 3L3DA 3L9RA 3C5ZA 5EBLA 3VRJB 1SBSL 5D2LB 3S5LB 3D0VA 5FIEA 1JFQH 4FQXD 5HSFA 4KMLB 4L3ED 3NA9H 4JGUA 5KN5B 4ONHA 4TULH 4X5LA 4LHUG 1DBML 3SKMB 1FVCA 4JLRB 3OKDB 2NX5A 4PB9L 4JHAH 5INCB 5DSCB 1AKJB 4B53A 2AXFB 3MRPB 1V7NH 3BKYH 5EZIL 4OQTH 3FN9A 2CKBB 4I0PC 4KUZL 3V4PH 3FRUB 1QTYT 4NRYA 1C5DB 5DD1H 4WFFD 4D9QE 1MFCL 4NRXB 4RISH 3O3DA 5FUCE 3BO8B 3QFJB 2R4RH 4OD1H 3TJHC 1QO3B 2PO6D 4C58B 3HE6A 5MERB 3MACH 4NQCE 1QBLH 2X4RA 1OD7A 3FQUA 4C4KO 2HFTA 3HZYA 3O2VL 1WICA 3T0EE 5BW7A 3T3MF 3IXTB 4P48A 3E3QC 4WEUD 4IMKC 3JZ7A 1HHHB 2ESVB 2Y5EA 4ZPTA 1FIEA 1UGNA 3FO2B 3HG1D 3N1QC 4C54A 1S5IH 3DGGA 3FRPG 3ZHDA 5IB2A 3SDDA 5ICYB 3RA7H 1QSEE 2Q7YB 4NZTL 5HGBB 3EOTH 2NY7L 3GHBH 4OKVB 2XXMB 3MLZL 4L1DA 5C07E 4RMQA 1UJ3C 5C3TA 4WO4A 4BH8A 4IM8A 5GISL 1CLCA 1FCGA 5DJ2A 1EMTH 3LQAH 5IW6A 5C0AD 1LO2L 3VXNB 1A0QL 4P2QD 1NCCH 2B0SL 5J13C 1CL7H 3WNNA 5I1GL 5E2VL 4OV6F 5EUOB 4HEME 1JGUL 2O5YL 1KJ2B 4WFED 2X1XR 3KHOA 4ZFFB 1XEDA 5L6YL 2WUCH 3QIBA 2NY2B 1A5FL 5F9JA 5TE4H 1KB9K 5D93C 3OZ9H 5EOCJ 4V2CB 1X5YA 2WBJA 3BEWA 5JTWA 4APQD 4XMKH 2JJWA 1WWBX 3EFFA 4R2GC 4U1SB 3W9EB 4FNLH 5BV7L 3TZVA 5GS0L 1NGXA 5C0EB 4NQED 2AXJA 3GRWL 5KOMC 3V6OA 4QXGH 4H1LA 4OAWA 4P23D 1T04B 3GSVA 3F7VB 3GJFK 1ZV5A 2OI9C 5F93C 2AJYL 1J8HE 1MI5D 4WW2B 3R06B 3FOLA 1JNLL 4FFWD 3FQTA 2VDNH 5GRUH 3T0VA 2RR3A 4U0RC 1ETZA 4LRNH 5T5FH 5HHXL 1LO4H 3C2AH 3NMEA 4A6YL 5D6DA 4AG4H 1DQMH 4MNHB 5IP4A 1IM3A 3MXWH 3O3AB 4HEPG 2VMFA 4Z77B 2P5WE 3ARPA 4S2SB 1INDL 1I1FB 2YC1B 1R0AL 5E2UH 3LRSB 4ZFOB 4HJJH 4KJYB 2NYYC 1PX4A 4HULB 4I3SL 4AENA 4E0RB 1AO7E 3U0WL 1M6OB 3IFOA 3TJEH 2W38A 1I3VA 2VDPH 3WFCH 5JR1L 4GMTL 3QEHA 5EO1B 2K1MA 4XX1G 8FABA 4XNUL 4M4RA 3GSRA 4KI5F 4KPHH 2WAHA 4NC1E 2VDRL 3O9WB 5EPMB 1KV3A 2V2XB 5FKPB 5KSAD 2GEEA 4Q58C 1SY6A 1IEAA 1ZOXA 3TC9A 4AM0B 5E99L 3FAXA 2QV2A 2XTLA 3V6ZA 2YSSB 4JFDA 4FXLA 3VXUE 3CFKA 1CZ8H 3SO5A 2NY4D 5BRZB 2XQYG 3ULVF 5GGQH 4KKBD 5L2KA 4HIXH 3RWDB 1NGYB 1IGJA 3UCRA 4J2XA 2EDTA 4XP9L 2I9LB 3AAZA 3F62A 4FFVD 4ODSL 5FYJE 1RJZA 4KTEH 1RIHL 4BH7A 3KPOA 32C2A 5DZOA 1KJVB 3HG1E 1YJDC 4NQVA 1YNKL 4CN6A 2DQGH 4QCIB 4K8RD 2BRQA 1CDBA 3RVWC 3PQYB 3GJEB 3IJYA 3HS0B 2QQNH 3S35L 5T1MB 1D5MB 4TSAL 3MRGB 5DO2D 2VXUH 4KQ4L 2ED9A 1JN6A 1NL0H 3CLFH 3W0WB 4K7PX 4L4VB 4MAYD 5MHSD 3AUVA 1IAII 1U8OB 3P4MB 2UUDK 2LU4A 1KTLA 4IEFB 3IJHB 2C1PB 1DBKH 4PRPE 3X12A 4G6FB 3ARUA 4AT6B 4ZO9A 3Q6GL 4LCIL 1CDUA 3DV6A 3HB3C 1SEBA 1F4AA 3CZJA 4JAMA 4XVUD 3MJ9A 3ZKQD 2J8UA 3EYVB 3B83A 2AJZA 5ACLA 2IG2L 4EBQL 2E6QA 3K8MA 1UM6H 3VD5A 2X9YA 3ESUF 1DUYB 2X41A 3UTPD 1OLLA 2B7DT 5J9PA 4GRWF 3FN3A 4OZHF 4GW1B 4JANB 5ACZB 5JPNA 3TYFA 3RKPA 2X7LB 2J4WH 1VCAA 3TBSB 2IBBA 4JZOA 4IOFD 1N7MH 1B2WH 5DJCA 5H2BB 1MI5E 2YK1L 3HUJB 1OD9A 3PJSB 4X9GA 1U3JA 5HHQB 1CE6B 4L9LB 1NSNL 2W9EL 3NZ8A 1BOYA 2EYRB 3QIWB 3THML 1EO5A 3C6SB 2FRGP 3QDGA 4QXWA 4OV5A 1MCQA 2IANA 4GS7B 3NOIA 5F96L 4X0KB 3R8BB 4FP8L 2VUOA 4HKBB 5AAWA 4CRPA 2MPAL 1DL7L 3RWFB 2CD0A 3QQ4B 2LABA 4M6AA 1HQ4A 5IOPA 1DANT 4O9HH 4R26H 5DK0A 5E5UB 1V5JA 3ZKMD 3PWPB 4H8WL 5D70L 5C0ND 3DLQR 2XPGA 1MCPH 5LQBH 3AM8C 4N9OB 3MV7A 4WWKC 2YOCA 1YEIL 3TA3A 5MENB 1FGNL 4FZEH 1PLGL 5KVGH 4QXUL 3F6LA 4JQVA 5IIEA 2Y7QA 2Y1VA 3UYPA 1EV2E 1HQRB 3ZTJG 4ENEC 2NY0D 3D69B 4H1LG 3IDNA 5F8QC 1JL8A 3ARGB 3X14B 3IDMA 1FVEB 5J6GB 5I74C 2IPKB 2E27H 1JNHB 2E6PA 5DD5H 4R7DB 4I3GA 3O0RL 1PZ5A 2ED8A 2UVFA 4YFLI 3SDXB 1ZT1A 4C56A 3HPJB 2FX7L 3FJTA 3MTRA 4N0YL 4D0CB 3RWGB 3S37H 3MRHA 1VEOA 3H7LA 2D9QB 3MV9E 4K23H 1F4XL 3V0VA 4QY8A 2AERT 1QFUH 5DVKA 1MJ7L 5CZKA 4OGZA 1MCFA 4NO0B 2AK4B 2BSRB 4FQ2H 3RJQB 4L8DA 1YN6B 2YR3A 1TNNA 4F7MA 3RX8A 1WAAF 1YMMB 4F58H 2IBZY 1S7SA 3IDIB 4PJ8C 1IM9B 2DBLH 1XH3A 3QEUB 3RGHA 1V8HA 3LD8B 3ARBD 2NY1D 5KSBF 3MJ9L 4X5WA 1FNSH 1NBZB 2CJUH 1HZHH 3C9NB 4XP6L 3ULVL 2BNRE 1I1AD 2Q7NA 5LJYH 1BJMA 1T0NB 1S7XA 4KTDH 5DJAB 2B1AL 3ZSSA 3CVIL 1IFHH 4PV8B 4IJ3C 1JZ2A 4NP4L 4QXTA 4LLDB 4ZMAT 3MV8A 5AG9A 1UM5H 5L7XL 5DWUL 1NFDE 3CK0L 2BP3A 1RFDL 3TIEA 4P59L 1J87A 4CNIB 5I19H 4NC0B 4I18B 2DM2A 3DRTB 1PZUB 4HCRH 1TTGA 4YHPA 5EZLA 5FGRA 3T08A 5AG8A 1JYNA 1RURH 3NA4A 3QXDB 1A4KA 1IL1B 5JDJA 1RJLA 4YDIH 4X6BA 1JWMA 4PP2A 3T09A 5T3ZL 3MBXH 2BVUA 4H25B 5DQDH 2UZYB 3QWOB 2RAMA 1EGJH 2AXGA 4KQ3H 5C0BA 5HYSA 3ULUC 1EJOH 5CJBA 3V5DA 1U8HB 4OLWH 3NPSC 3U30C 5EZJA 4KJQC 2XKNA 4X4XA 1ADQH 1A6TA 3QH3A 4YHYC 1J10A 1TCRB 3H42L 4PG9B 3FFCD 3SQOL 3QDHA 1H3TA 1RUAH 2AJSL 4I5BB 1WSST 2RJMA 4UT9H 3SGEI 4JM2C 1S7VB 4X7TB 1EBAA 4KZEH 1A1OB 3ARFD 3ILQC 4PRAB 9CGTA 3BQUB 5F70A 3X3GL 3QISA 5DFTA 1ZE3C 4OLYL 1AC6A 3BVNB 2HT3C 3IDYB 3OPZL 2L7UA 5E4IA 1B0GB 2E7CA 2DLFL 1OCWH 4PYGA 1FL3B 2RFXA 4NUGH 3G6JB 2V5TA 3MRRB 1ZS8A 4QRUA 1ND0B 1I8KA 2KQMA 5TDNB 4Z78A 1UXWB 3RY6A 4MJ6A 2FJHA 1OL0A 2GTWA 3BEVA 4OCXH 4P4RB 1J0ZA 1Q9OB 5K59E 5D71H 1FSKC 5SWZE 3IU4L 3FO0H 4R4NC 5ANMB 5F7DA 1I4FB 2IC2A 4R0LB 5I71C 4FXGA 4P2RA 5TDOA 2R2EB 3BP4B 1KN2L 4ZD3H 2GY7B 3UJTH 1OM3L 4NFCA 3K2UH 4LRIC 4LLQB 5IBTH 2WUBH 3EDFA 4K9EL 4HUXB 5KW9L 1GXEA 2JIXA 1NC2A 1IGYB 2HP4A 1ZAGA 1KIPA 2PYED 4YE4L 2YPLB 2Z35B 3UTTA 2DL2A 4PJ5A 1KIQB 1W72B 3HRZB 2Y36L 3U9UA 2X4UB 4B5EA 1ZWIA 4P4KC 3QUMH 5HHMD 4BUGA 2IEPA 4X9FA 1QLRB 3WO3B 4Y5XC 3TO4D 3K80A 3EYUL 1RHFA 5IFHH 4QWWC 3MRCA 4YGVA 3BP5B 3LEXA 4JR9L 4FQJH 1AD9B 3VFVB 4DUXA 3OKOA 5F3HB 5F88A 5FECB 4Y5VB 3VXSA 1A21A 2GSIB 4HK3J 4HWZA 3B9AA 1V7MH 4IS6B 3P3YA 3FT4A 3REWA 4KJWD 2JE8A 3LKOB 1VHPA 2ZSVB 5DJ0A 4DKFH 4PY7B 5B38A 3BT2L 1DQJA 3T4YA 1P1ZA 5ALBH 1M7IB 2GAZB 3PWNA 4N0RA 4PGBA 1IC5L 3FQXB 4MA8H 1ZK9A 4F3FB 2PXYC 1XGPA 3ABZA 4JG0H 2WQ8A 2HMIC 5F21B 3OGCA 3SDAA 3QEQA 4QRSB 3KS0J 4EI5C 4H88H 4YUEH 1I7TB 1MCSA 3D39B 4DAGL 4DGVH 5HYJD 1IT9H 2FZ3A 5K9JH 1SEQL 4MJ2A 1B4JH 4H0IA 3RUGA 4W81A 3ROOA 4PJXB 1MJ8H 2IF7A 3LN4B 5D1QB 5DZLA 3VD9A 2A1WL 1PKQA 3DMMA 1ROWA 3KG5A 1OGAA 3PWUB 1TENA 2DYPA 4QF1B 4ONOA 3BP6A 4YHLL 2OR9L 1PYWB 5TGBA 1BGXL 5CHNA 1MOEA 2VRAA 3MFFA 2BSSA 4MLIA 3WLWD 3LEYL 3EJZD 5DFVC 4Y19E 5KAQG 3Q0HA 4K3DH 1F5WA 1Z0MA 2HFEB 5I76B 2F8OA 5ESVA 1AFVL 2Q3ZA 4C59B 1MCLA 3MJ6A 1XCTB 3HE7C 1ODAA 4YEFA 4ZXBB 1MELA 3IFNL 2Y23A 4LLMA 3EDDA 1WBZB 1LMKA 5ALCH 4NZJA 3MLYL 4OCLC 4NQXA 3VFTA 3U2SA 1A4JA 4U31A 2COQA 1QZ1A 1UENA 5IB5A 1BVLB 1OWWA 2DWEA 5GS2D 3NCEB 3TIDB 1AKJD 3A0OA 3JWDL 4X99B 2O26U 1L4IA 4J6RH 4GKZB 1WWWX 4ZPVA 3CU1A 2X1QA 3WXWL 3KYKL 3NH7L 2E7BA 2M8XA 3T65B 3WS3A 2VN7A 4HCRA 5HYSG 3QFJD 3IRPX 4XNQB 2UV3A 4M7KL 1W0YT 2ADIB 5GJSH 1JWUA 1BZ9B 3IXAB 3TH2T 1EZVX 2FEEL 1U8KB 4LHUB 3VGGA 3MODL 3ARDB 3Q2CA 4JO1L 3LMJL 4U4BA 1YMHB 4U1GC 3G5XA 1EGJA 2ESVD 4LEOA 3F65A 1CDCA 3VA2C 4Y4FC 4GKOA 3FTGB 4QHKI 4HLZH 1RUPL 5K93A 2VSDA 4Q0XL 5IEKA 4ZQKA 5E00B 4PJEB 3DJ9A 1G7HA 5IVXA 5F72S 5DHXB 4EN3A 3PGDA 1H9VA 1J1XL 4AL8L 1MFNA 3RGVD 3NFPB 4G8FB 2OMBA 3SE9H 3N1MC 1QFWI 5EOCL 4GBXC 4GQPH 2CO7B 1I3RB 2MQ3A 4PJIA 3H9YA 2DOCA 1WUNT 1GPOH 5FOBA 1VDGA 1PGRB 2BOCA 4L4TE 4HPOL 2DF3A 5LBSL 3CH8A 1CF8H 4OZFG 3LS4L 5EBGA 3DGCR 2VZOA 2ARJB 3BD4A 1BEYH 4BUHA 4LLYB 4OZ4B 4MZ3A 4NNXA 4ODUB 3OL2A 3CDGB 3BZ4A 1XGUA 4UB0L 4PREA 3PDOA 5LG1A 3QR2A 1D5IH 3CXDL 4KROC 2G5BA 2YD6A 4PJHE 4PV9A 4ODVL 4KK5D 3FB8B 4U1KA 1YYMH 3KNBA 1QSVA 1LD9B 1O7SA 2AI0H 2DBJA 5DA4A 3B9KB 2WIMA 1IARB 2DD8L 2LU3A 4LDLB 5FUZH 3ZE1E 3ARRA 3MCLL 4P2OA 4UOW1 1HH6B 5I8OL 1Z0NA 2DQTL 5IHZA 4HKJA 3WFBH 1ACYH 3DX7B 4M8QA 4O2CB 3WDIA 5IB3B 3C08L 5T1DH 4LKXA 1F11A 3PE9A 5IVZB 1URLA 4MNQA 2J88L 5GS1B 4X6CB 3G6DL 5TF1H 5C3LD 1P5VA 4UAOC 2HVKA 2VXSH 2DQUL 4HW6A 3QUMA 3RDTA 5JXEC 1NCTA 3V4UL 1G9ML 4CJ0A 5B38G 4P99A 4RA3A 2Q86B 2HVJA 5ELIA 5IFAH 5L6YH 4G43A 4GUPA 1OAUL 1FZJB 1OTUC 5D7JA 1CE1L 5F9WC 2P8LA 2VWEC 1P53A 1LE9B 5AZ2H 4AH2A 5GS0H 4OSUL 3O9WD 4PJ7A 2CO6B 4S0SD 2FWOA 1BQLL 4RMRA 5LVEA 2X42A 5FAAA 4PB0H 3FT2A 1YY9D 3JV5A 1FAIH 2KZ1B 1OF2B 1VB9A 1EXUA 3RL1B 4XZUA 3LKPB 4GG8B 1N59B 1JGEA 1KNOA 3DX8B 1P4BL 2EDKA 3RWJA 3SO3C 1A9EA 3LEVL 2QEJA 5BRZD 5E24E 1I8LA 3IJSA 3KHQA 3VCLA 1T83C 5GZOD 3KPRA 4JY5L 4UU9A 2C4FT 4I0PA 4N9GA 2BVEA 2FIKA 3QCTH 4OLEA 5CILL 1IGIL 2ZJSH 2ESVE 5GXBB 4D9LL 5JIHA 2BSED 3TN0C 2ZG1A 1XGYL 4IDJH 2J8UE 4MXWH 4UINL 3WFHB 3PQYD 4DEPB 4U49A 4UILL 5JZ7D 3VMOA 1F4YL 1FIGH 3ZO0A 4XNUH 4POYA 5BV7B 4IMKA 2AK1L 4DK6A 5CEZH 3DNKA 3W0WD 1CVRA 4L4VD 4QRTA 3BMWA 3CC5A 4JDVB 1S9VA 3IDUA 3QDJA 3QJFB 4DW2H 4WI3A 4OLVH 2DQDH 4NM4L 4DUVA 1U8QA 2ZSWB 1DZBA 5FYLL 3W82A 4QOKB 4G6FD 5IMKA 4XXCC 4MQTB 5EUOE 3FL7A 1LEGB 2NZ9C 5BJTB 1GIGH 1UJ3A 1PG7L 2FGWL 3MNWB 5DYOB 3IF1B 2WLYA 4NKQB 1DSFL 4A6YB 4YXKH 3RL2B 3C5ZB 1ITCA 3I9GH 5ID0B 4F2MA 5L8JB 3SDCC 5IT2L 2BXYA 1RK0B 4IHOA 4NDMA 4UOJA 3RI5F 3VFNB 1BJ1H 1X6NA 4W6WB 5FCUL 5GSVA 1FVCB 3HMXL 5DK3A 1YNKH 3EOBA 3LKNB 3IDXL 3WSQL 2EYTA 4PJGA 3FB5A 4PLKD 5F6HI 1Z9OA 3N9GH 4L1HA 1MEXL 3QO1A 2YWYA 4MGXA 1KIRB 1HI6B 2H2SC 4LBEA 4UIMA 1N2RA 3HA0A 3MV7E 3G9VA 3O6LL 5TJWK 3EDJA 3EO0B 4JRXA 4NRZA 3TYGL 3V79C 4WGVB 2EZ0C 3ZDZF 5DK2A 1JWSA 2HN7B 2RHEA 3RVTC 2X4RB 2HTKD 1TETL 1Q72H 3NIDE 4JREB 1I85A 2ERJC 3D85A 3EDKA 3S96A 3MRDB 4MDIB 2NW2B 4JKMA 3DROB 3PWPD 2D7PA 4NN5B 2D03L 2IMNA 5ICZB 1RZ7L 1WIUA 4DVBB 4C56E 4U1NB 5HBBA 5EC2A 3JUYA 1P7QB 5MEND 1S7WB 2GI7A 5DHVB 4V1DA 2OTWB 3BPNB 1MPAL 4M3JA 4WO4B 1RAMA 4Q6IB 5DVOA 4MA3B 5IW6B 3ARGD 3PHOA 5BO1L 3WNPA 5K33A 2X5PA 5BRZE 2KKQA 3CVHL 3QRGL 4RRPA 5I1LA 1A7RH 1B3JA 2W9EH 3RX5A 1SHMA 2BC4A 3PABB 4LVOB 5GGTH 1F90H 3W11C 1YEJH 5D5ME 1IGCL 5D7IA 3MYJA 2CIIA 3TVMB 1EEYB 3SJVA 5F9JB 4AEHH 4Y4KC 2LFGA 4LU5H 1MHEB 4XBEH 5EA0H 2MPAH 2KDGA 1M05A 3BEWB 2I9TB 4AIOA 1ZGLA 4P3CH 4A2MA 1MHPH 1CK0H 1E4WL 3IDJB 2NTFA 1PY9A 2CDGA 2FX9L 4HWEL 4ODWA 2VL4A 1R5WB 4NO0D 2AK4D 5CWSB 1YMMD 5IKCB 5EU6E 5FEBA 2DIAA 2HJKA 4KHTH 1CVSC 3W0WE 1IM9D 1YEIH 3MZTA 3NFNB 4RX4A 1GH7A 4PJ9A 4R9HA 1MFEL 1L9NA 3H9HA 4X8JB 1ETZB 3M1BA 5DURB 3LKRA 4YPGB 4R7NB 1QYGH 3STLA 1L7IH 3UTSD 4EUPB 2DICA 2Y25A 1H8SA 3NCJH 4YQXL 4Y88A 2IPUK 3SY0A 4UTBH 4ZS7L 4P5TB 1CFSB 1FQ9C 1OARH 5FM8A 2ID5A 2R2BA 2ITDA 4NKMA 4MCZA 4DOHE 4LDOB 3CFEB 1OTTC 4TUKL 4CMMA 2ATPA 4LIQL 6FABH 3NZHH 5ABDE 2EIDA 3REVA 4B41A 5D2NB 3UJIH 1N0XH 5CLWA 1MWAL 2YD8A 1DQQB 3QEHB 2HG5B 8FABB 3TBWB 5ESQA 3GSRB 4Z7NE 4MS8C 3BWAA 4O5LL 3WBDA 4Z6AT 3QDMA 1WIPA 2BOBA 5JIIA 3KPSD 1WITA 3HUJE 1J11A 3OHXB 1IEAB 4YHNA 4M6OL 3G08A 1EJ6A 1A7BA 2XI9A 4OLZL 3RHWF 3ARQA 4TVSa 1NAKH 3ZL4H 4OTXL 1T4KB 5JW5A 4PBVC 2AAVA 4I13B 3I02B 2FLBT 1XFPA 4JPIA 3PHQA 5L2KB 2P8MB 1F6AB 4G6KL 2D7QA 2EEAA 1CGYA 5EWIL 5H37H 2E9WA 5MEQA 1ZT7B 1RJZB 1E27B 2JELH 4NQDB 4Z8FH 3U4AA 5EO0A 1JNNH 1E6OH 3O4LA 3DI2B 1R3HA 1I3GH 3AROA 3BQUD 5DMIL 3T1FB 5C0CE 1I8MB 4JFEB 2GHWB 2GCYB 1BVZA 2DDQH 3V7MA 3MOAL 4ELMA 1DUZA 1JN6B 2Y06H 2O5XL 1FFOB 1AY1L 2CIKA 3GMPB 1RULL 2YMXL 2APTA 3B5TA 1BQUA 3AM8A 3RZCC 1FORH 4JDZB 3ZDYE 3MRBA 1HDMA 2HT4D 3BKJL 3X12B 3PWJB 3L3KA 4XVJL 1CBVL 1S7TA 4JAMB 1DLHB 1IMHC 2BNQA 3MMEB 2XQYK 2AJZB 1OW0C 5IROC 1OSZB 1XF3B 5E5MA 5TDPA 4F7CB 3SCMA 2YKLL 5JOFA 3BZEA 1UH3A 3FONA 1P2CB 4M1DL 2CRIA 4RFOL 5IEHA 1TITA 1YJDL 4ZG1A 4HS8L 3BISA 2JJTC 1KCVH 3MUGB 2M26A 4ZSOB 5D7LE 2YPLD 4TQEH 1KG0A 2EE9A 1IKFL 5EOTA 5C2BL 4G6AD 5E08H 5HY9A 2AV1A 3BP7A 2XFXB 4GLRH 3LDBC 2JF1A 4HKZA 1U9KA 5B4MC 4BYHA 3L6FA 4KVCL 3H2WA 2HA1A 5TE6H 2PTTB 4PRIB 3BFOA 1B90A 1ZA6A 3S88H 4PJBF 5HHVL 2UY7A 3AY4C 4XCEB 1MUJB 3TBTA 4TVPL 5E8NA 5JO5B 4PJ8A 4Z95L 5IB1A 4RRPG 2B8OT 3BGFC 2UZIH 2WBKA 4NN6B 2H2PC 1HQ4B 4CADA 4QRRA 3QPXL 5IW1B 3PV6A 4LARL 4ODHL 4BKLA 1KB9J 2O61A 3SGKC 4DUWA 3S9DB 5BS0A 5DRNA 2BHZA 4PRHA 3V0AC 4PR5B 3WUWA 4GRWB 4OZHB 1A9BB 5DRZB 3IKCA 5IIEB 1UWXK 3JV6A 1FE8L 4BZYA 3D39D 4O4YH 4RWYL 1A6AA 5TH2B 5GGTA 3TV3L 1UYWH 3J7HA 4X6DA 3ETBF 2GUOA 3LHPL 3MA7A 5DEZA 5BVJA 2F53A 5I75B 2E6JA 1FDLH 4OI9A 4Y2DC 4S1QH 5D1QD 1KPRA 1Y6KR 4N5EC 2X4QB 3UJJH 3VI3F 4M61B 4OIIH 3KLHD 4RIRA 2V7HA 5DMKA 4U1MB 1R3JB 3CIQA 3DPBA 3O11A 4K3JH 2KQNA 5AYUH 1M7DB 3F12B 1DCLA 3MRHB 4X4ZA 4JFQB 3K3QA 4ORGA 2XZQH 4QY8B 1YEKH 4K7PY 1INQB 2DQJH 1MF2H 4NUJA 4ZXBD 3DUSA 5CEYB 4YX2L 3MC0A 4XP1L 1S7SB 4TRPH 4OLXH 5DHYA 2V6HA 3JBG7 1U8LA 5I1KL 5DD0L 4YHIB 5IMMB 3QUXC 3G6JE 2W0KA 4JM2A 3FQRA 2KBGA 2OJEB 3GSXB 5FO9A 1BREA 1NLBL 4KZDH 2QHLA 4MX7B 4M93C 1G6RH 5GRWA 3NTCH 5HHPB 4LLWB 3FHQA 4EOWL 1ZVSA 3EYQD 1KCSH 4QHMB 3RIAK 4JFYA 5JW3H 1VFMA 1Y6MR 4LNVA 1OAQL 5H94B 2ZUUA 1J0HA 3VXPB 2X70A 1KCUH 3TIEB 3K1KC 1AGDB 1F2QA 4LHUD 4PJIE 3ARDD 1QLEH 5EZLB 2YPLE 3ARZA 3RU8L 4NPYB 4XTRD 1AH1A 5CP7A 2MSPA 1QBMH 1TLKA 4O51B 2VXQL 4LRIA 4OJFL 4LAJH 3BD5A 3H9SA 5KTEH 4UTAL 2C3XA 4O2FA 5LCVL 3ZT5A 5HYIA 1RUMH 5C0BB 4G9DB 5A3ID 3UPRB 5CUSL 1SYSA 5KSBB 4R90H 4OQ1A 3WNLA 4OT1H 2EECA 2RIKA 2X6MA 3FOMB 1CT8A 4P4KA 3MR9A 2XKNB 4MJ4A 3AFLA 1X5KA 4DZBA 1DDHA 4Y5XA 3SKJH 3AC0A 3AB0C 2X4TB 3L3JB 2VLKE 4BQCA 1XF4A 3KJ6L 2Q8AH 3KXFA 1UFUA 5FUCC 5KSVB 4K3HA 2VDOH 4J3TA 4U6VH 4U2YA 3V0WH 5HDQH 1FFPA 5DC9B 3H6JA 2OP4L 3QXTA 1QBBA 3D39E 4X98A 5E94A 1PEWA 4J4PC 4U1LB 1L7TH 3T0EC 2QTEA 1ZVYA 2A6IB 5D1XC 1M7XA 2X4OA 2RFXB 4ESKA 4POZD 5JPMA 2PYFA 4QRQB 4QRUB 3B9KD 3F8UB 4WRLA 3GBNL 2OZ4A 2MJWA 2PXYA 4MJ6B 5HHOD 2FJHB 2GTWB 1GZQA 4PJCF 1N4XH 2VNCA 3MJGX 1A7NL 3P9WB 4EI5A 1D7FA 3WIHL 1J1XH 2A77L 2NTSP 4OZFB 1MCBA 3VFUA 4M48L 2QHRL 1BD2A 3U36A 4PJ7E 4FXGB 5E6IC 5TDOB 4XPBH 2A73B 3FO1A 2R69H 15C8L 1OAKL 2D7TH 1LO3H 3F7PC 5T3XL 1NC2B 3MGOB 4BFBD 4LOUC 3RBSA 4K94L 2VQUA 1FL5A 1RUKL 3AREC 3U7WL 5J06A 1MY5A 4XBPA 5EORH 2JJVA 4KRMB 3TO2A 3U9UB 1UJTA 4D3CH 2AKRA 3QQ9D 2A6KA 1YQVL 2W0LA 2GJZB 4F33A 3EOAA 3IETA 3U0TA 3WUWG 3HE7A 2EKSA 3CPLA 3EIFA 4YDVB 2O93L 5J6HB 1D9KC 1IAKB 1IC7H 4OGYL 1CICC 1E4XH 3DSNA 3GJFH 2QQLL 1IGTA 5F89A 3CLEL 4LVNC 4GSDH 2DQTH 5C09B 3REWB 5I1AA 2SEBA 3C5SA 2CSPA 5GSRA 1I1CA 5I9QB 3DUUA 1HIML 1J9CT 2HKHL 3MQIA 3T4YB 1P1ZB 2C1OB 4YEEA 4WEBL 1EFXA 2J5LB 4MDJA 1U8PB 3MJ7A 4OUOA 4CAGA 2BCKA 1AQKH 3N85L 4P46B 3MGAA 3P4OB 1MQKH 2VDMH 3OGCB 3QEQB 1G9MH 5I1HL 1T6WA 4H20H 2F54E 1HWHB 1MRDH 3VRLF 3L95B 4PJEE 5GIRA 1UCBH 4E5XA 3ULSA 3CDFA 1Q1JL 4Z0BH 1BBDH 1YEGH 3DOSA 1CDJA 2FJFB 1R24B 2V9RA 4NGHL 3EO1A 4X7DC 3WNMA 4ZUSB 3QUZC 1Y0LA 4Y4FA 4ACPA 4NC1C 1Q0XH 2YRZA 3HFML 1UEMA 4ISVB 5TGBB 4TSCL 5H35A 4O00A 4PJGE 3O3UN 4QOKD 1T1ZA 1MJJA 2YEZA 2BZDA 1ZHKA 5ESVB 1I7UA 3B2UC 3QIUC 1T0PB 3Q3GA 1U8MA 2PR4H 4GBXA 4OZGA 3C5ZD 1TTFA 2JCCF 2FO4B 1JHKL 2OYPA 3U82B 4JY5H 3MRFA 2A0LD 5CZXD 2DIBA 3CFBA 4Z7WE 1HYRC 3QYCA 2OZ4L 3HPLA 4NQXB 1BWWA 1CU4L 3FB6B 5JUEH 5A16B 1I9RH 3ME0A 3OGOE 3GGWB 5D9SB 4XC1L 2XRAH 5GGSY 3GBML 3GSWA 4D94A 5DJXB 4KUCF 4NM8H 1U8JA 2K7PA 4KJPC 3L7EA 2EXYD 1GCFA 4QHKJ 2H6PB 3KJ4C 5A2LH 4JQIL 3DTXB 1F4YH 5CBEA 1JZ5A 1RHHA 4KDWA 4ZPVB 1JK8B 4QRPA 4XWOC 5F7KC 1FP5A 1AI1H 5TQ2L 4XNXH 2CR6A 1KELL 1NEZA 4R4FH 1T20A 2EEBA 3STZA 1AR2A 4HUNB 2ATKA 2JK5A 4RFEA 3PNWA 5D1ZC 1YECH 2NY3B 1RZKC 1DSFH 4GKNA 2AJXL 2I5YL 5B21A 1CQKA 2P7TA 4J3OC 4PGCB 1MNUH 5D7IE 2BFVH 4MA7H 2F5BL 4W4NA 1G7HB 1P7QD 5IVXB 2H1PH 5JXEA 1K4CB 5F1IA 4EN3B 4BZ1L 2X05A 1ZKAA 2QQQA 2BVPB 1E28A 3HMXH 5EUKA 4WO4D 4IRJB 2X09A 3KLAB 3PWLB 1U6AL 1NAMH 1N64H 4M43H 3B43A 4LQFH 2B4CC 3BIBX 4YFLF 5DQJB 4Z7UF 4XPGL 2ZKHH 1YNLH 3ES6A 1MCIA 5I73B 5EU7E 3WXVH 5FOBB 1A14L 1ZTXL 3H9ZA 4GMSL 2BOCB 2EO9A 4OFKA 4XAWL 1AC0A 3JXAA 1JPST 3LPWA 5KSUA 3QZWB 3LH2H 3TYGH 3BSZH 3QCUL 1FNGA 1KC5L 4NKIL 3TVMD 1JTOA 1TMCB 4PP1D 2JB6A 4XC3H 4Q6YA 4NNXB 5I66A 3MLTA 4LLVB 4X6FB 1C5BL 5HVHB 5IBUB 4PREB 3PDOB 3RWHA 1CDYA 2NR6C 4MXVE 1HEZB 1T83A 3EYFA 3U4EA 5HI5C 4U1KB 3OKNA 1IAMA 5CJXA 5DD3L 1CR9H 1U3ZA 3D9AL 2B5IB 1YEFH 4LPXA 4MD4A 4KXZH 4MAUL 2ICEB 1NGPL 3DRQA 5EIQA 1O0VA 2G9HA 1MCEA 3TN0A 1R3KA 1S7QB 1YEHL 3MLUL 3MGTA 1LP9E 3QHTC 4U0QB 1F11B 2XG5A 5KSAC 2IH1B 4BFEA 4ZOBA 5F6IB 4DGYL 1MHHA 1HXMA 4NIKB 4P5TD 3MO1B 2YUXA 4TUJA 2XWJA 2Z91B 2EDNA 1KTRL 1GGTA 4FQCH 4LVHC 2R23A 1AGFA 1GAFH 5T33H 3VG0H 3L5HA 1BWMA 5DJZA 2DKUA 1X4YA 4Y4HB 2P43B 2QR0A 2FIRT 5I8KL 5IV2A 3RQ3A 5IF0B 4XXCA 5CBAA 5FUOL 4KKLC 35C8L 1D6EA 1UACL 4K7FA 1IAIL 3GJFA 5L8LB 2P8LB 4EXPX 1E4WH 4W68A 1KCRH 4XB8A 5C0GA 3SDYH 4AH2B 2VLRB 3MLXH 4PFEA 1L0XA 2A9NH 4FQLH 5HI4D 3OBAA 1H3WM 1A6VL 1ED3A 3N1PC 5EG6C 3SDCA 2FJGB 8CGTA 2R56L 1D5BA 2DL9A 4FOMA 3PWVB 4HMDA 4U6HA 5J1AA 5HPMA 5IJVB 1SM3L 2K9UA 3P73A 4JFDD 4F8QA 1QFOA 1EZVY 2WZPD 4BSWB 4ELME 3VWKB 3MLVH 5L2KD 4YDJA 4HK3N 3DYMA 3VCLB 1IGFH 4HFWB 1FNAA 4PJAE 1HE7A 2P42B 4DKDC 2WSKA 4NJAH 3CVHB 1LO0L 4OCRL 2AJ3B 4UDUA 4I0PB 5CD5C 4HQQH 4P3DB 1NCAL 2FIKB 5IGXL 2HLAA 4KH2A 4BJLA 5I2IA 5I17A 3WNKA 4XVUC 1MJUL 2VLJA 4TUKH 4LIQH 4Z7QF 3MRMB 1G9NC 4F57L 5FGCB 4HUKB 5KVMC 2Q8BH 4WFHD 4WY7L 4YXLH 4YAQA 1XZ0B 3E8UL 3G5VA 4JHZA 5GRVK 1CL7I 4MMZC 2E9IA 1J0KA 1FNLA 4XGZA 5MEPA 1TJGH 3QDJB 4RNRB 4JO2L 5DT1L 5F6HJ 2K3TA 1BFTA 1U8QB 1QHOA 2GK0A 2ICWJ 1BM3L 1M71A 4P5MA 3O81A 2IJ0C 4UV7L 4Z0XB 1BQSA 2VL5B 4EDWL 3ULVD 3GMOB 1G84A 2C4XA 1U93A 5B39A 4G3YL 2ZUSA 1H3XA 3WKMH 2HKFL 1DP0A 1NEZG 2XZCL 3T3ME 3MBEB 3P4NA 5SX4I 4JJHA 3U1SH 2G60L 5I8CA 2EDLA 3TLRA 1G7LA 2E7HA 5JDSB 2D4FA 4LCCC 5L2JA 2VDKL 3H0TA 2F9BT 5C0NC 1BBJA 3TNMA 3FB5B 1NJ9A 1A7PL 4QRRE 1MWAB 3NPZB 4Y4KA 1J5OH 1FLRH 1ZEAL 2R0WH 5D93B 5HXMA 1DR9A 3CJJA 4R2GB 1OPGL 2XIDA 4OCWL 1QSFA 4NWTH 4ODTL 4PRHE 2CK0L 4PRID 1HSAB 1UB6B 2IFGA 4JRXB 4NRZB 3BOVA 1X5AA 1YEEH 5T3ZD 5C86A 5DK2B 3VMNA 2IAND 1JWSB 1ZA3B 2OI9B 4MNGB 3GI9L 4W4OC 4G7VH 2OK0H 4JZNA 5HJ3A 4X6DE 1GGIH 1ZT4A 5M95B 3SGDH 2F53E 1CBVH 4G80B 1LQSR 4PRBB 5I6XC 5D2NE 3VXRA 1KLFA 1YN7B 4N1CA 1AQDB 3H7BB 1NMAL 1CLOH 2NXZD 2R1WB 5EC1B 3VD3A 2VO5A 2H3NA 2CPCA 4IMLB 4YDLB 4WEMB 2WNGA 3KPPB 1NUGA 1NAMA 1V3KA 3KYMB 3TA3D 3H3PH 3RRQA 5C0DA 3MROB 1NH6A 4K7PH 1BFVH 1NANI 2BY0A 1S9WA 2DM7A 4KHXH 3WKNA 5I1DA 4Q9CA 2BVOA 3BUYB 2VTFA 3P0YL 3V7AG 3LS5H 5J1TC 2BXZA 1LK3L 4TSBH 1NMBH 5JIPA 4P9HC 4MJIB 5BXFB 2BC4B 3RAJL 3SKUD 3MYJB 3TF7C 3OX8A 1HHIA 2QQKL 4IOIB 5FKAA 3SJVB 5IW3A 1MCJA 4JJ5A 3U7YH 2ZCLH 4NQDE 4E41E 5A2KH 2OTUB 4WFGE 1OAYH 4XCNA 4J1UB 2GJ6E 2CH8A 4JFEE 2Y5TB 4F37F 5FB8A 3VFGL 4S1SL 4PG2C 4LLAA 4DTGH 4KI5E 5B3JE 1RZGB 2EH7L 4HFUH 4WW2F 3EYOA 3WL9B 4JPKH 3VE0B 4KRLB 3LKRB 5I0ZA 3STLB 2R8SL 1K3ZA 5TE7H 1EDQA 2DLGA 4KK6D 3BIKA 3RWEB 3LHPH 5D96C 4XCFL 1Z3GL 5I1IL 1UZ6F 3L5WB 3IGAA 4FFZL 3UO1H 2R2BB 3O2WH 4GJTB 5JIKA 3UBXB 3ULVE 3L3OB 1SJEB 4HAFA 4M5YL 5KJRH 1ZLSL 1XGTB 2ATPB 2H32A 4J3WA 3RZCA 1VADA 4LSSL 1A3LL 2MQCA 1F4WL 4XP5H 1LK2A 2UWEA 1MCOL 2VQ1A 1E4KC 5ID1B 1C16A 3HC4L 4GRLC 4HKXB 4MA1C 4RA0C 1OVZA 4JB9H 5ESQB 5FA4A 4UDTA 4G9FB 4ZSOE 3BWAB 1OW0A 2FHBA 4KVNL 1I7RA 5IROA 4UT7H 4PYHA 4OIBA 3GSOB 1S7RB 4NO3A 4YHNB 4M7JL 3G08B 2QJDA 3ECBB 3D2UA 1F3DH 1QNZL 2VLMD 3O3BA 1KGCD 4MLSA 2FX8H 1WBYB 4PRIE 4G7YL 4DFIA 5JW5B 3NVQA 2CLRB 1UB5A 1MREL 5C0BD 2JJTA 2A74A 5JLZA 4N90D 4L8SB 2X1PA 4L5FH 1TJHH 1DBJH 3KPMA 4LCWB 1N6UA 4CVWA 1WK0A 4N8PA 5BW7C 2QKIA 2ZPKH 1HN1A 2CMRH 4WU5A 3DWTA 5IFJA 1AXIB 4KRPC 1NC4A 2Z4QA 3UC0L 4YHZL 1L6XA 5MEQB 3WV0A 1A1MA 3SDDC 5JXAL 4GG6F 3TT3L 3MRKB 2IBGA 5D7KD 3AY4A 4TUOA 5TPWL 3ARVA 3T2NL 1ZSDB 2E9BA 1T3FB 1ZHNB 5C0RH 5B39G 4AMKH 4XRCB 3O4OC 3AU1B 4GRWE 1JYVA 3HZMA 4WI2A 4OZHE 3OMZA 4QTIH 3VFRA 3QHFH 5ISZB 3DECA 1T03H 3SGKA 5MI0C 3SE4A 5E6YA 5EBWB 1P7KB 4WWKB 3I50L 1HDMB 5F7UA 3MREA 5LCVH 4FG6C 4YO0B 5D8JL 3IU3A 2YD9A 1LO5A 1M1SA 2XZAH 3DYOA 3S35X 5INDB 3I3EA 2F5AL 5ADOL 5DQ9A 4MWFA 1JGVL 1Y18A 1OAZL 3GKWL 4LSUH 4I9WE 4P2RD 2AQ3A 4QT5B 4PRNB 5FYKL 4QGTA 3HNTL 1LEIB 3FCTA 4MD5A 4XVTH 4C83A 4PGJA 1NC2D 5IEHB 1T66D 1T1WB 3Q6FA 1RIUL 5FF6A 3QA3A 1CGWA 2APFA 5K9OA 3UTTD 4HJGB 1KB5L 1UXSB 5E9DB 5EH1A 3T3PF 5HY9B 2AV1B 4IRZH 5EU4B 1GGYA 2EDOA 4Z76A 1F3JB 5I30H 1S9XB 1JZ7A 4M1CC 5HGGS 3BE1L 2Y6SD 1KLUB 4JKWA 1A1NA 4NQUA 4LSPH 3D3VE 4HS3B 2IAMC 3L3GA 4JDTL 1G7PB 5CJQH 3TBTB 4J3UA 3DURA 2GKIA 5IB1B 1A6ZA 5C09D 3QUXA 3WIIL 2DQEL 1A7NH 1CYGA 3LB6D 4ODXA 4XPAH 2FB4L 3T8XA 2D4DA 2VZSA 1AXSB 1INEL 1XT5A 2HWZL 5I8EA 4B7LA 5FDYA 4DK3A 4X7SH 5EIIB 4OF6A 5FYJH 5I18H 1UZ8B 4IJ3B 3OF6D 2ADFL 3VXQA 4P46D 4FQXB 4YNYA 3SDAD 3QEQD 4HZAA 1A6AB 1RUKH 2W0FA 5C9KA 2IH3A 4HX1B 1WAAE 3VH8A 1C1EH 1W0VA 2CRMA 2EXWD 4ZYKA 3EOYG 2R39A 2XQBH 1CD1A 5D7SH 5F7NC 5KSBE 1R3LB 5HYQA 4N0CD 3DMMD 5EO9B 1OGAD 5K9KA 2V7HB 2ADGB 1BF8A 1JPGA 3T0AA 4QYOA 5CIPH 5C9JA 3O11B 1H0DB 1RZKH 3MUY1 3OG6B 4EVNA 2AQ1A 2R0LL 3PV7A 1NCWL 4FQQA 3W9DA 2H26B 3QFDB 4OGAD 3U30B 5D6CB 3K4AA 4UIKL 4IOSD 4NUJB 2HAZA 4UUJA 5JHDA 2C4FU 4YK4B 1DEDA 1IC4H 4YHYB 3S34H 5DHYB 2ZCKH 4KK9C 2R0KH 1DLFL 4MSWA 1QFWL 2B4CH 5B3NA 4JFPB 1CXLA 4NCC2 3RVUC 3FQRB 2A2QT 1JGLH 2WBWB 1AIFA 3MNZB 2X4NA 4U7SA 5DA0B 4NQCA 1H5BC 4I8DA 1F97A 4RBPK 5HGDA 5F7EL 4J4PA 4LF3A 5GGSB 25C8L 3T0EA 2PW1B 3GMRA 5D1XA 1ORQB 3WMSA 5EBMB 4OFYA 4XPHL 1KN4L 3VD7A 1CGUA 3LV3A 4JFOA 2J12B 5CIPB 3KWWA 4G8GB 1KT2A 4X4MA 3DVGB 4YDKH 2IWGA 3NIGF 3IVKA 2WK2A 1JPSL 5MEOA 1REIA 4JFZL 1C5CL 1QSEA 4WDIB 3TT1L 3QXUA 1EO8H 2J2ZA 1JPFA 2B39A 4WUUE 3VFOA 4OD3L 1K4DB 2NY3D 1KBGL 5I71B 5C07A 4QEGA 5E6IA 4BSJA 2RB8A 4JRYE 5CP7B 1T2QH 1UWEH 4L3AA 1RZFL 1ITBB 3FB7A 5J0BA 2GJJA 4MXQC 1HCVA 2NY2C 4DN4L 3BW9A 4F7TB 5C71A 4TNVK 3OAZH 2FD6L 3HN3A 1UC6A 2IQ9H 3QNXA 4LNRA 4EN3D 3Q5YA 3W2DL 3GIVA 2CLZA 3K46A 2ICWA 3G6AB 1T7VA 4HIIB 4IRJD 5DVLA 4WNQB 2O5ZH 3RVVC 5CZVL 1NBVH 2ZOKA 5C09E 4P4KB 3I6KA 4OKDA 4TNWF 4Y5XB 4DGIL 2QSQA 4EZMA 1MFBL 4ONFH 4XCCL 4YWGH 1AGEA 3CSPA 1D9KA 4P5KA 1QR4A 1NUFA 5IESL 4ETQA 1CICA 4NJ9H 3BKCL 2YHGA 3PP4L 3KXFB 3P77A 5FYLD 3IB4A 2XG4A 1IZKA 2Z93B 4Q2ZA 4K8RH 3TFKC 1R3IH 1J8HA 5JORA 43CAA 4HWBH 4MB4A 5E94B 4X98B 3TWCL 4XB7A 2CRYA 1IAOA 5CAYB 4HUWB 2X4OB 2A6JB 2CR3A 2Z8SA 3EO9L 5JPMB 2PYFB 3ZTNH 4RQQA 2PTUA 2CUHA 1KEGL 2BHYA 4WHDA 4XP4H 1B88A 2FSEB 5ERWB 2AV7B 2P5WA 4F8TA 5SX5H 2VIRB 1GZQB 3BH8B 5BZDA 1TVDA 4EI5B 4YZFF 3VFUB 5EU5A 1DE4B 4LAQH 2WLZA 1AO7A 4XPFH 1YY9C 4M03A 4MNQD 5JHLH 5KS9A 2WINB 1S5HA 3ZKNC 1HCFX 1PSKL 4Z7VF 1BZ7B 1I9IH 1FZOA 2X4SA 1JGDA 3RDTD 3QAZC 4Y4HD 5GZOC 5BMFH 5FK9A 3E6FA 2MCG1 3GUTA 4XBPB 1GGBL 3TO2B 5I15L 1JF1B 2R1YA 4EIZC 5CMAB 2A6KB 3TBYB 4HJ0D 4N5UA 1P4IL 3QIUA 2J6EL 3MRQA 4QKXB 4D8PA 4F33B 3IETB 3B8SA 2VLRD 1T5WB 2XNAA 3DO3A 2BMKB 1WQVT 1K8DA 1RIVH 3PP3H 2Z9TA 5DUMH 4PJDF 4HZLB 1MRCH 4MYWB 3VH8G 1PX3A 1F4HA 4HF5H 1JI1A 3LAFA 5F7YC 4MAUH 5ETUA 3CSYA 3C5SB 3OKMA 5IQ9B 3NABH 4PJCB 4X83A 2FBJL 2Z92B 3HG1A 2K7QA 1F02I 1XF5A 5DRWB 3S36L 4CMHC 2XZZA 2WIIB 3KPRD 2VZVA 4DGYH 5FA3A 1O5DT 4I0PD 2YD4A 3BRFA 2AEPL 4Y5YC 2ZWLT 3VW3H 1G7QB 2A6DB 4YFEA 4HC1H 5B22A 1DN0A 3L3IB 5IG7A 3T4AB 2R4SL 4UNVA 5GIRB 4P2QA 3BXNA 3ZE2E 1FO0H 1TVHA 5DMGD 2EE6A 1QPPA 1EAPB 2D0FA 5A40E 3IS1X 4NYLA 1D5ZB 5D1ZA 1A6UH 4FS0A 4PJXF 3MLSH 4U1GB 2YN3A 4HK0A 2ARWA 4Q97A 1U8IB 5DGRA 4Y4FB 4LLUA 4RWHA 4U1HB 3QDJD 1P6AB 4OFVA 4JO4L 1QA9A 3O45B 3OR7A 3GK8H 1T1ZB 3MV01 4MQ7A 3U0PB 5DJYB 4L9LC 1MJJB 3S97C 1DQLL 1FFNB 1I7UB 2EC8A 4KMQA 3MOQA 3QIWC 3VXOB 3Q3GB 5ENWB 5HGAB 3QHZH 4OGXL 2Y07H 2Z8RA 3GNML 4OZGB 4WGWB 1WZKA 2GITA 4ZUTA 1I9JL 4GS7C 3V5KA 1YPZF 3MRFB 1MI5A 1EERB 1FVDA 4Y2OA 4Q9QL 5IM7A 1CFTA 1GZPA 1SMAA 4OB5L 3MBED 4RZCA 3C6LC 3GMNA 5C70A 4U1IB 4RFNC 4CUCA 5C2UB 3BI9X 3GSWB 4P9HH 3RPIA 3MLRL 2APVA 2HFGL 2P5EE 4AEIL 4JE4B 5CBEB 3I75A 4R2GD 5GGRY 2CGRL 4KROB 3L5XL 2FR4B 3PXJA 1JHLH 1FYHB 4PD4K 3HI1A 3QNZB 3TCLB 5C6TH 1PAMA 4JRXD 4JY4B 3B2VL 5IB4A 2VDQL 2DLTA 3D25B 3F5WB 1P5UA 1T20B 1OP5H 1BFSA 1J0YA 1A3QA 3NGBC 1KJ3L 1RU9H 3STZB 4CW1B 2QSCL 2ATKB 4RAUB 2FGZA 2JK5B 4NZDA 2YZ8A 3PNWB 2WMPA 5KSAA 1N6QH 4ZNCD 4HPYL 3U6RB 5I16A 3D6GA 2BDNH 2V17L 1G7IA 3BZFB 5F71A 1DFBL 5ITFA 5T5NG 2V7NA 2JCCB 1VGEH 4YXHL 2NYYD 1MRFH 2BVTA 1S9YB 4C55A 3B8YA 4RMTA 2VLRE 5EOQL 5CS7A 1AJ7L 4IIQC 4BZ2H 4V1DD 3RP1A 1GGCL 5ACMA 5E56A 3UTZB 1K85A 1F3RB 1QQDA 3QEGL 3O6FB 4ZDHB 4BFIA 1BLNA 3ARBB 1YQ2A 1FGVH 5BQ7B 1AE6L 4OD2A 2VYRE 3QWRD 4G5ZH 4HIHA 2DTML 1K6QL 4MJID 2HH0L 3M8OH 5J3HD 3LD8C 2IPTH 5KSUB 1EHLL 4ZUVB 4HWBA 3FMGL 1ZHLA 4W6YB 1FNGB 4F9PC 1OP3H 2W59A 2JB6B 3SJVD 1NDMB 4J3VA 4KY1H 2MNUA 3MLTB 1FZKB 4KV5F 4ZTPH 5I66B 1G7JB 5I1EL 3RWHB 4GXVL 1UA6H 4XMLL 1A2YA 1WTLA 4HH9A 3EYFB 1F8TL 1EIBA 3K2MC 3WE6B 3CMGA 4PBWD 2RQ8A 4CU6A 2OL3H 3I6GB 1F6FB 3KYOA 1EVUA 4NNYA 3WHXA 4RX4D 1FFRA 1OB1A 5FO8A 2DQFB 1OSPL 1R3KB 2EDQA 3GBLA 5JMOC 3V2AR 3FT3A 3RVWD 5DLMH 4PJFF 1JRHH 1CG9A 1U92B 3BDYH 3DX9B 4HXAH 1LNUA 1NFDA 3S3PA 3P9MA 1HXMB 1LK3H 1L6ZA 4Z7UB 1BIIB 2PW2A 4X6CF 5HI3C 3GSUB 1AGFB 3VDCA 3DO7B 1UM4H 3OKKB 3UROR 4G6ML 4U6XA 1QRNE 4WJ5B 2OQJB 1Z9SA 2OS7A 4TVPD 4RDQG 3QQ3A 4DVRL 4M1GH 3EJYD 2EDRA 2IADA 3TPUB 2X4PA 1ZVHA 1ZXQA 3HB3D 3KPQA 4LIQE 3OXRA 5F9OL 3SE8H 3EZ8A 4G9FD 1DQDH 5DJDA 4KDTA 3P9LA 3WLBB 1JE6A 4DQOH 1YNTB 1Z9MA 3WD5L 4LSQL 5GGUA 1HINL 1A7QL 3BQUC 3HMWL 4YIQB 4WU7A 4WTWA 2N4IA 4OLUH 2XA8H 1MVUA 3TM6A 4H5SB 4TTGA 1BX2A 1D5BB 5HPMB 2UYLB 1AR1C 2R0ZL 3P73B 3X13B 5GRJH 4LEXH 4RAHA 5HGHA 4LCCA 5BVPH 5ITBH 4EEEA 5BZWA 3G5YA 4FFYH 4LCWD 1JPTH 1CXIA 4MNGE 2IMMA 1EUTA 3EGSB 4HC1A 1A47A 3RZWA 4WW1B 3HAEB 4OZIA 5I1IH 3P4LA 4LKCA 2HLAB 1B6UA 5I2IB 5I17B 3DIFB 1FO0A 4AZ8A 2F8XC 5DDHB 3OWEA 3OB8A 1TFHA 3QNYB 5IK3A 4R0LC 1B0RA 2VB5A 3QG7H 3QULB 3O4LD 5DR5L 3LIZL 5CEZD 3DBXB 5IHLB 4FQHB 1LEKB 2AJVH 4W4OA 1Q9LA 2PYEB 3G04A 5A1AA 4GAFB 1DBAH 2ERJB 1P84K 3UYRL 3NN8B 3S98A 5HVFB 2XN9B 3G5VB 4KVNH 3JWOL 5ISZD 4N8CH 5SWZA 2A83A 5HHMB 5SV3A 3ET9F 1ZHBA 3C60B 4I77H 2XWTB 3A6BL 5EFIA 4WWKD 1FZMA 5CCKL 4MJIE 3FO9A 3OQ3B 4JHWH 3PHSA 1Q0YH 4AQOA 1TDQA 4N0UE 3WJJC 5E8OA 2BNQD 2A9MH 3ZDZE 2R29L 4FQIL 4RGOL 1T80A 3KDMB 1AHWB 5B39B 1Q9WB 2AABL 4WV1C 5J12C 5L0QC 3P4NB 5I8CB 4M6NL 2AGJL 4B0MM 4M5ZL 1PG7X 1U58A 4EI6A 2CLVB 1BBJB 3BPLB 4I48A 4JPVH 3TNMB 2NY5C 1G9NL 5E9DD 2Q76B 4LSRH 2I60L 1SYVA 4M7ZC 1WC7B 2HJFB 5GS2H 5LGJB 5KVFH 5DD6A 3RNKA 1FL6A 4P57A 3GB7A 2CKBH 5DF0A 2YPVL 3TEUA 5FHBL 3MOBH 2MQ0A 4PG2A 4PJ8D 5ICXB 1NFIB 4BQ8A 4MQXD 5A43C 1JUFA 2B1HH 1RUQL 5D1QC 5SWSB 1FJ1A 3BPOB 1FNHA 3KLHC 3A67H 3VXRB 4S1DC 1OAZH 1NGZA 1F58L 4Y16C 1R5IA 3CAFA 3IKKA 4X5XA 3O8XC 5C0JA 1PBYA 5BS0D 1CGSH 4G9FE 4AIZB 4GAGH 1V3MA 2HFFA 2VITA 1JHTA 1UVQA 5CGMA 3UDWC 4ZFZB 1IBGL 1S9WB 1YY8B 3C8DA 4K3EL 4YR6A 4ZXBC 2Q1EA 1J1PL 4N0FB 1E4KA 4GRLA 1I8LC 1BAFL 1G7MA 3MA9L 4Y19A 5E1HB 5JHDE 1MIEL 1ZANL 2HJLA 4ZTOL 4QTHA 3WNOA 4O58L 4NZUH 5E2TL 1FG9C 2VAJA 3I2CL 1QR1A 3OX8B 5L8KB 2VC2L 1KJ2H 1TCMA 5DEGB 3EHBD 3WIIH 2JJSC 5GJTH 3ULUD 5FYKU 2V2TA 4ORZC 4UBDC 3A6CH 1NMCC 4XCNB 1N5YL 3NAAH 4HT1H 4MJ5B 5LGHL 3GSNL 4KJQD 3VJ6A 4F7PB 4ALAH 1GC1H 1WBXB 1IQWL 1WVZA 4OUUB 5T1LB 5F7LB 3DVNB 4I2XB 1YEDA 4X4ME 5C08E 5T3XD 2BNUB 5ISZE 5M94B 4M6ML 1U3YA 5DS8B 3JV4A 3CMOL 4GAJL 4JM2D 4HS6B 4M62L 1CLYH 1KB5B 4LCUA 1FNEA 3S3SA 4Z5RA 4PS4L 3BIKB 3RGVB 1T0MB 2V5YA 2HT3D 4L8BB 3W81A 1HH9A 2IPUG 2VAAA 2D31A 5SV4A 3I3DA 3WJLC 1IGMH 4R4BA 3K0WA 3P0VH 1NCDH 4G8GD 3TPKA 1LK2B 5LWYL 2EH8H 3HLAA 2UWEB 5JW4N 4HUVB 4JQXC 1CGTA 3LRGA 3ALXA 3QI9B 4GLRI 2P8PA 5AWNL 1DJSA 2DQCL 4XXDB 3BKMH 4PGEB 1A6WL 2WANA 4NO3B 4JFHD 4BK5A 3HNVL 4MD0A 3SKNB 4JFFB 2BJMH 1B0WA 4M7LL 2ORBL 3O3BB 4L8CA 4L4TA 3DX6A 1QKZL 1N5AB 2GSGA 2AQ2A 2G2RB 3KPMB 4UT6L 3OXSB 4UQ3A 4RMUA 3B9KC 3VFPA 1I85C 4P4KD 3IS0X 3WEXA 3LDBB 2OXHA 2VISB 5IFJB 1P4LB 1NC4B 5TFSL 3PGFH 4AK1A 4XNMA 2VABA 1A1MB 4QWWD 2EE3A 3F58H 3CH1B 4NZRL 2IAMA 4P2CG 1G1CA 4PJHA 3LQZA 4E42A 3KXFD 2CXKA 3F7RA 1U8NA 4KMTH 3RWIA 3GEWB 5KS9E 2C7UA 3BGFB 4PTUA 4L3EE 3O6ML 1CFNA 1K5NA 3VFRB 3FN0L 2J8HA 4HBCL 1TJIL 2MKWA 4H0HB 4I3RL 5FV2A 2BRRL 3GSQB 3WYRA 3GO1L 3UTQB 5E8EA 4XVSL 3QQ9C 5IVNA 1FV1B 1BFOA 2HMID 3IU3B 4OM1L 3WDHA 4MCYB 4EI5D 3MNVA 5AZEL 4GW5B 3SGJC 4WFFE 1PQZA 4PJBE 1HHKB 3VRJA 1LWRA 2J8UF 1UWGH 5D2LA 3G9AB 3MLWH 3VFWB 1T21B 4PTTB 5FM4A 1LE5A 1S8DB 5KN5A 1JZ6A 4Y2DB 3RY5A 4OCYL 2QLVB 4JLRA 4MD5B 3JVGC 5EU7C 2WV3A 3L5JA 3V8CA 4RMSA 4GG6B 5DJ6B 5INCA 2AXFA 3RWCA 2RCSL 3MRPA 2OSLA 2ZZUT 4PJ9C 3MRIA 3MRLB 5DFVD 5T3XE 2Z0BA 5FDWA 1FG2B 2GY5A 3R1GL 3RTQC 4EQ3A 1N3NB 4NWUL 2FEDD 4HXBL 3AVEA 4KI1A 4LPVA 2VE6A 2FATL 1A1NB 1QO3A 4J8RB 3ZT7A 1YYLH 4UMGA 1TQCB 1CFVL 4DEPC 4NNPL 2XTJB 1A8JH 1MSPA 5C0AE 4XAKD 4P2QE 4YHMH 2FO1A 4Q74A 1E0OB 3IXTA 3QUXB 5GS0C 2XWBB 2NNAA 3VI3E 3P11L 1HYSC 7FABL 1RK1A 3QDAA 5MP6L 2ICES 2ESVA 4YHOH 2H8PB 4LASL 3FO2A 1NBYB 2Y72A 5C8JB 5DGQA 3D1MC 4HV8B 4WFEE 2Q7YA 1T1XB 1H5BA 5F1SA 1Q8MA 3ZHLA 1NLDL 4M93B 1PSKH 1CI5A 5FXCH 4OKVA 1Z5LB 3C87A 2F19L 4M9PA 1CDIA 3FFDB 3BAEH 1S7UB 1HOCB 2W0FB 4NQEE 5CGTA 1VPOH 4OQTA 3VH8B 4XPTH 1W0VB 3HC3L 4LPTA 3NIDF 2DM3A 3VWJC 1CD0A 1CD1B 5EUOA 1PFCA 1KJ2A 1H15B 3M17B 3BPCA 4DKEH 5K9KB 5ILTL 4Y4FD 1J1OL 5B8CB 4ZFFA 1JPGB 4QYOB 4LGRB 3QG6A 5C9JB 3GIZL 5EU3B 3W39B 3W9EA 2KPNA 1NGQL 4U1SA 4EVNB 2YZ1A 3R8QA 1PEZA 5DXWA 4KKCC 4GBXD 4X9IA 1CWVA 1T04A 1NCBH 2VERN 3MXVL 4WI8A 3NACL 4UUJB 4XHJC 3X3FH 3R06A 4LSTL 1SY6L 4MSWB 1CXHA 3U4BH 2R4SH 4GO6B 3LPFA 3O3AA 4NN5C 5FHAH 3T1WA 4XMPL 4Z77A 4CVUA 4JG1L 4XWGL 2YC1A 3BUTA 4FQ1L 4KJYA 4NQCB 5KAQF 3KAAA 4L29A 4KROD 4LF3B 4QRPD 4E0RA 1GHFL 4HWNA 3SCMC 1M6OA 3FZUC 4JN1L 1FBIH 5CSZB 3HHRB 1WWCA 1LDPH 5L88L 1KT2B 5EO1A 4CBPA 3MZGB 3IVKB 5GGRB 5MEOB 1QSEB 3VFOB 3O9WA 3CUPB 5EPMA 5FKPA 2V2XA 1DQLH 5CP3H 4LVOC 2NXYB 1QEWB 4OM0H 3SEPA 3TNNB 1C8PA 4U33A 1UG9A 4RGNB 1A22B 3IAPA 3BHBA 2VH5H 4AM0A 2V2WB 3O6KH 3QT2A 2YSSA 4ONGH 4Q9QH 1E4XI 1S78C 5BRZA 4JO3L 1I7ZB 4LNRB 5GHWL 5JXED 1UQSB 3VI4F 3NFSH 1KSRA 1XGRB 3WFZA 4U1JB 3AREB 3O2DH 4KWUA 4R6UA 2ICWB 1NGYA 5D5MA 3RWDA 2FL5B 5MHSE 3O6FD 1JFQL 1J86A 4KUCD 4WHTB 2ZOKB 1OTUD 5E1AB 3NA9L 3CFIC 4TULL 4PJCE 3UTSB 5FM5M 5EDXA 1TXKA 1KJVA 4N8VB 5CINH 1MLBB 4JN2B 3L5XH 1AGEB 4QCIA 1RVFH 4PGZA 1A7OH 1D9KB 1FN4B 3HTLX 3HS0A 5GGVH 1ZLWH 3ZKSD 2VDQH 1V7NL 3QXAB 3LSOB 3BKYL 5T1MA 5C1MB 4OQTL 4D0BB 1W8NA 1D5MA 4LVNB 3UTPE 3MRGA 4P5TC 5EU6A 1NGWB 3D0LB 4Q2ZB 3V4PL 1ORSB 3B9VA 1J8HB 5DD1L 3W0WA 43CAB 3O41B 4L4VA 5AUMA 4WTZA 4RISL 4K2UH 4BQ9A 4P9MH 2VOTA 3P4MA 5EULV 2KL6A 2R4RL 4OD1L 3VGEA 4QHNA 3IJHA 2C1PA 3MACL 1HILB 2B2XH 3P30H 1QBLL 1CDGA 3R0NA 4PPTA 5D2NC 5FO7B 5HDOA 2EICA 1EHAA 1T89C 3KPSB 4MZ2A 2G75B 4G6JH 4Y5YA 2HTLC 3QO0B 1AJ7H 4YC2B 4U3CA 4CKVX 3TN0D 1GGCH 1MAKA 4H8WC 1S5IL 2V9TA 4D9RD 1DUYA 3JTSB 1AO7B 3RA7L 1VENA 1K2DB 3SBWC 4LHJB 3I6LD 3OG4B 1I9EA 3HI6H 1FZOB 2X4SB 1G6VK 3MPCA 1FH5H 3GHBL 4GW1A 4JANA 3GHEH 5ACZA 2HH0H 3QUZB 3WN5C 1S3KH 1OAXH 3RNQA 1KEMH 1K8IB 3QP3A 1NKOA 1EMTL 2BY2A 3LQAL 3HUJA 3E6FB 3PJSA 3GUTB 5D72H 2NLJA 1NEUA 5HHQA 1NCCL 3RI5K 1CE6A 3L3HB 4L9LA 5TF0A 2R1YB 1AGBA 2X9XA 1CL7L 1A3RH 2ILLA 4OCSH 4OZIE 2EYRA 3QIWA 3VXUB 1W72H 3QIUB 5IMLB 4ERSH 2ZCHH 4MB5A 2WWMC 4JKPH 1VFUA 1T7WA 1XCQA 2WUCL 3V52H 3HNSH 4CVZB 4HKBA 2NY6B 3E1F1 4RAVB 1MAMH 3OZ9L 1FYTB 43C9B 4XMKL 3C6LA 3SOBH 3QQ4A 3NCYS 4FNLL 4Q9RH 5KVEH 3OKMB 5T1KA 1X7QA 1EVTC 3C5JB 3PWPA 4KI5C 1HNFA 2VXVH 3PGCA 5KVDH 2MCPH 1WEJH 3CCHA 1XF5B 3KJ4B 4KU1A 5C0CA 2DWDB 4Z7VB 4PUBH 4JPWL 1XF2B 2VDNL 5GRUL 3QCVH 3IT8D 3LOWA 1RZIB 2NY5H 4LRNL 5T5FL 1LO4L 3C2AL 1HQRA 4K55A 1DN0B 3T77A 4AG4L 3ULVC 1DQML 2JCCE 3MXWL 2EDFA 2Z31B 3RVTD 1EEUA 3X14A 5L9DL 3BXNB 1FVEA 5J6GA 4NHCH 2JB5H 5E2UL 4W70A 2IPKA 4HJJL 3E0GA 4PRPB 5CKAA 4LDEB 4R7DA 4TPRH 1EEZB 3RUGF 1VFAB 5D1ZB 1FRGH 2XN9D 3SDXA 5DI8B 1VSCA 5J57B 3TJEL 3C8KB 1OQXA 2EDHA 3C60D 4HGKC 4LLUB 2VDPL 3HPJA 3WFCL 5LXGH 2DQIH 4UZGA 4D0CA 3RWGA 3UMTA 4PJDB 4FZ8H 3QUYC 4IIQA 2GTZB 4KPHL 1VKXB 4RCAA 4NO0A 2BSRA 1YN6A 3ZE0F 1WF5A 4Y1AB 1YMMA 5D7LA 2GITB 4HDIB 4ZUTB 3KGRA 1SJHB 4Y8DC 5JQ6H 1CZ8L 3QEUA 4DN3H 3Q5TA 5JW4Q 3CDCA 3W11D 2X89A 4RZCB 4KXZI 5GGQL 1NBZA 4HIXL 4F15B 3C9NA 4F9PA 1W8OA 4HIJB 1T0NA 5DJAA 2EDEA 4JCMA 5JNYB 3QPQD 4PV8A 3LN5B 1JJUA 1RMFH 3QXVA 4HGWA 4KDVA 3UYRH 3JWOH 2DQGL 3HI1B 5C0IB 5CJOL 4H26B 4ODBD 4Z7UE 2LTQB 3VGBA 1DVFB 2QQNL 5CCKH 2LV4A 5I75C 2PCPA 2VXUL 5F8RC 3PIQB 1T1YB 1NL0L 3CLFL 5LAXB 5SWSD 3QXDA 2RGSA 3FFCE 3VXRD 3MRJB 3VFSB 4JGMA 3ARSA 1K3IA 1DBKL 3QJHB 3INUH 1BQHB 2AABH 4H25A 4ZUUB 3O2DA 3QWOA 1OQOA 1I8IA 4LVHB 1YPZB 5I1CH 5J89A 5IVXF 1OTTD 2NW3B 4M6NH 4LPYA 4WTZG