5IF0A

Crystal structure of vrc01c-hugl2 fab from an hiv-1 naive donor in complex with with a germline-targeting gp120 engineered outer domain eod-gt8 at 2.44 a
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAKISGSYSFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 broadly neutralizing antibody precursor B cells revealed by germline-targeting immunogen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
molecule keywords VRC01cHuGL2 Fab heavy chain
total genus 42
structure length 219
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5if0A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5if0A01
4PP2A 4F8TA 2UV3A 4PJDB 3LRGA 3WIFB 4LNRB 3ARFA 4Z7WE 1S8DB 2JJSC 4PRBA 3LEVL 3U30B 4H1LG 4ZUVB 5GS0L 5DRWB 1FC1A 1MFAH 3KPLA 4ZOBA 5D6CA 3SGKA 4FZ8H 5AG9A 2H32B 3T0EA 3MV8D 1OTUC 1RZIB 3UTSD 3IDJB 2GK0B 5FUCC 1E0OB 3CXHJ 5AUMA 3WJLC 5I1JL 1JZ5A 1WT5C 4QTIH 5CIPA 1FH5H 4WFGE 1C1EH 1FVCA 3FZUD 5I1AA 1N6VA 3K4ZA 4IHOA 3ZKND 3GSRA 5B39G 4WFGD 1D9KC 3P9MA 4JZOA 2IBBA 1CXHA 3HR5B 4FP8L 2UWEE 1KB9J 5JOFA 2B4CC 4GW4A 1BFSA 1G9MC 2DQGL 4K3DL 4WY7L 5IIEA 2ESVB 3C5SB 3FO2A 5IV2A 5CSZA 3BD5A 1YEDA 5F1NA 3ZTJH 5H37H 4R7NA 3SDDD 4LDEB 1FN4A 5AZEH 2ZNWA 4FRWA 43C9A 1NFKA 6FABH 1XF5A 2ADGA 1MLBB 4OZHB 2FJFA 1ONQB 3AXLA 1N0LA 4HKBA 1QSED 1ZS8B 2V9RA 1A6UH 4ZUTB 3D39A 1LO2H 4S2SA 3F58L 3HNVL 4WHCA 3WUWG 4GAGH 4M62H 2IALA 3DX8B 3V5HA 3E8UH 1DQLH 3AY4C 4UDTA 2VDKL 3WEXA 4LPWA 4MNQD 1C5CH 1MJUL 1MVUA 3RP1A 5F7KC 5T5NF 2BSTA 4OF7A 1HINH 4HUNB 2Z35A 5DHXB 3V4PH 1HDMB 1JZ2A 3G5VA 3ZYOA 3W2DH 3T4AB 1NGWA 3FT4B 3UEZA 4Y2DB 2ZUWA 1JI2A 2EH8L 5D1ZD 2ICWJ 2NXZB 3CFCL 3CZJA 3IETA 3L7FA 5BW7C 1CFVH 3HZVA 1OAZL 4WUKL 3RDTC 3WMSA 1MI5A 5F9JB 3WCYA 4MHHG 2Y5TA 1UH3A 2R1YB 1FLTX 4RGOH 1W0WB 3GSVA 3B83A 4N1HB 2R4SL 4GXVL 4XWOD 5D72H 1CFNB 4LEXL 3CIQA 1BGXL 1YEKL 4Z95H 1RUKH 4ZAKA 5M7QA 2LAAA 5ETUA 5DA4A 4JKWA 1T1XB 4JRYA 1KELL 4QO1A 3HUJA 1I1YA 1G7LB 4Z18A 4JKPL 3UZQA 3VXUE 1JPTL 3QDJE 4ODBD 1SY6H 5DFVC 3DURB 1WFNA 3V5KA 4UQ2B 1BLNB 3KPSA 1PG7X 5BVJA 2NTFA 1X5ZA 3FOMB 4GBXA 2P47B 4YGAB 2P5WD 5GZOD 3VJ6A 4NKMA 2DKSA 5C07E 1LP9B 5SWSE 4DUVA 2GITA 3ME0A 2KZWA 4LSQH 1B0GB 3RZCB 4TNVK 2HFTA 3OPZH 1N7MH 1OGTA 3S36L 1K2DA 3OXSB 4KKLD 2J8UB 3BSZH 3W5NA 4P2OB 3ZTNL 2JIXB 3WFEL 4K8RD 5GZOC 1JRHH 3DJ9A 4OD1L 5JDJA 5IQ9A 5JQ6H 2DRUA 5HI4D 4LGRB 1Z6JT 2VE6B 2VR5A 4PB9L 2AJZB 1IQDB 4PGEA 2R0LH 4G6KH 4YHPA 4BFBD 1I3RA 4G3YH 3PWJA 4JDZA 3UTQB 2BVOB 2IQAB 1MOEA 3GJFA 3NGBC 3MV7A 4UB0H 3E1F1 4HZAA 3B8SA 2V2WB 2J8HA 4NUGH 3IJSA 3GKWH 1OCWH 4EZMA 2R0KH 1ZHBA 1ZANL 3CLFL 4PJ8D 5C0EA 2YMXL 3HNSL 3MRNA 4BH8A 4JFHE 4JG0H 3WNKA 2DI7A 2CUHA 4JFZL 4ONFL 4F7PA 1WCBB 1R5WB 4X7CC 1DBJL 3UTTA 1ZLVH 4JM2F 1PG7W 1R3JB 4F7PB 5E08L 1NUFA 5L6YL 3QXTA 4LCYA 5D1XD 3MRBA 3HC0B 3SOBH 5CHNA 3BPNC 2HVKA 1YPZF 2KPNA 3VXPB 3VXTB 4Z95L 4QOKA 4RFEA 4WW2C 1PBYA 3D0LB 5CKGA 3U9UA 3O2DA 3RAJL 4KDVA 4XXDB 2AXGA 3ES6B 2G9HB 1MFDH 2HJLA 1Z5LA 3PG2A 4R90H 1FNEB 3RWIB 4Z77B 3QDMA 2Y06H 5DURB 4U6YA 4E42A 1EUUA 4NQEE 4JFED 1JPFB 5I8EB 5BCAA 5BZWB 4OLYL 3L3OA 4W4OC 5KW9H 3P0VH 3W2DL 4P2QA 2NXZC 1FNLA 3NTCL 1NUDA 2ZG1A 3L1OL 1C16B 4OD3L 4FABL 3OKDB 5D1XB 2YEZA 2FO4B 3T65B 3CPLB 4K7FB 3TBVB 3RUGA 2YD4A 1G7JB 2FGWL 4IRJB 4GBXC 4ZPTB 5CEZH 4K94H 5A3IC 3MV01 1UKQA 2AKRB 2XYCA 4GFTB 3TCLB 3HMXH 1U8OB 1HOCB 5GSRA 1E6JH 4ONOA 3MCLL 4U7MA 3GBMH 1KC5L 2SEBB 2EKSA 3RNKB 1M71B 1OGAB 4YXLL 1OM3L 5I1HL 2DBJA 2WIIA 4Z76A 4J23A 5IFHH 4FFYH 1H3UA 3LH2H 2E7MA 1O7VA 1JI1A 5C8JB 4HWEH 4NQCD 4CVXB 3VFVB 2VXSL 3WXVH 4PRPA 3TO4A 4M9PA 3OQ3B 4M93B 3GMPA 2DJUA 2JIXD 3G08B 2IGFL 1FYTB 3D5OF 1LK3H 4LCIL 4KK5D 3SBWA 4O9HH 2PXYA 5FYKU 1ADQL 1FYTA 3I84A 4CJ0A 5IEKB 1N6QL 3RZCD 4LLDA 1BHGA 5B21A 1MJJB 4HS8L 3KR3H 3HZVB 3WD5L 4WVRA 1G9ML 3FL7A 5HHXL 3ILQC 1AGCA 1P1ZB 5DVOA 2A6KB 3MLXL 2GJ6A 3ARBD 2X1WL 4D9QD 4TVPL 1XGUB 3MJ7B 4PRAA 4WWKB 4H1LB 4O2CA 3PNWA 4A6YL 4AEIH 4OCYL 4G8FB 4K3JL 1MELA 4PLKD 4NQVA 3T0AA 1XFPA 5HGBB 1KEGL 5EWIL 4JFOA 1QZ1A 2YPVL 3T0EC 5TQ2L 2BSRB 4N5ED 1IQWL 3I6LD 4K8RH 2OTPA 1I8LC 1QFWH 4RNRA 3FQWB 3HUJF 1EPFA 3MMEB 2EYRA 1G7HB 3CU7A 5F6HJ 2XY1A 3V7AE 3WO4C 4UUJA 3GJEB 3PP3H 4PUBL 3V5DA 1NC4B 3NA9H 2WINB 5CBAA 2QQKH 2YA1A 5ICYB 1OF2B 1BQHG 3HE6D 3LEYL 1GOFA 2W9EL 3LQAC 1MLCB 3VFOB 3V9FA 4NWTH 1T7WA 5TDPA 1LVEA 5IKCB 2JJUA 2GCYA 4Y5VB 5FKPB 1QSVA 3IAPA 3MLTB 4P4KC 4DZ8A 2X4SA 3HPJB 2DKUA 4HQQH 1NGQL 4Q0XL 5EN2B 4IHOB 2Y4SA 2DQFA 3FQTB 1CDUA 4N5UA 3QIWC 5E56A 4L4TE 2D2OA 2DQFB 1LEKB 5C07A 1BF8A 1VEMA 1N5AA 3EOTL 3RGVD 5SWZE 4WCYH 2EXYC 4U6VH 1MRDH 3RIAK 3ZTJG 4LCWB 2M8XA 3QO0B 5EZOL 3NPSB 3I6GA 4Z7QE 4OD2A 2WK2A 2R9HD 1HN1A 1IGJB 1NC4D 3BZEA 1DLHB 5DD0L 3QZWB 2ZPKH 2QADB 4WFEE 3VMPA 4ODTH 4ZXBC 5A16B 3CSGA 3RNQA 3TVMB 4HSQA 4WW2A 3SJVE 1U2CA 5A16A 1CQKA 3U1SL 3NTCH 3WHXB 2CDFB 4XX1E 2CK0H 1MQKH 2IJ0C 3S3SA 4Z8FH 3NCEB 3O4LE 2C9AA 2CDFA 3QJFB 4FTVE 2KZ1B 2ED8A 2G5BA 5ESQA 4OZFB 3WHE0 1CN4A 5C7XH 4N0FA 4OLVL 4MA7H 1UVQA 4YK4C 2CH8A 2YD3A 5BXFA 4DEPB 4YE4H 3IFPA 1Q1JH 3QEGH 3W9DB 2UUDH 2PCPA 4S11A 4FQXD 5DDHA 3BPCB 1CD9B 2ZG2A 5ID0A 1Z3GH 1W8NA 5DUMH 4DGYL 3QXUA 5LXGH 3DVGA 4I0CC 5HHME 2F15A 4PJIA 4L4VB 5JTWA 1R5WA 3UTTB 1VDGA 3WFBL 3WIIH 4N68A 4ZUUA 4M6NL 3EYSL 4R97C 3SO3B 4D0CB 3CSYA 3VXQB 4X5XB 2N7BA 1IM3A 3B9KC 3WN5A 5E2WH 4YQXH 1NSNL 3LN5B 1DSFH 1NMBL 1Y18B 3NA4A 4P23C 1CXIA 3R1GL 3VFSA 3I2CH 1U3YA 1PD6A 2FIKB 2Z8RA 3BZFA 1D5BB 2XT1B 3VFSB 2EO9A 1BEYH 1JTOA 4GRLD 3K7UA 3VDCA 4HIEA 1AD0A 1CGSL 4R96B 4Q6IC 1KPVA 4PJEB 4X6BB 5LGKA 4UB0L 1IARB 2I24N 4P23D 3BGMA 4XCEB 2W65A 3TVMC 4WV1B 1CCZA 5GS0D 3P9MB 4Z7QF 4MAYB 3FO1A 5HPMB 1DLFH 3RWHA 2V2TB 1GAFL 4IMKA 5K9KB 1M7DB 3IXAA 4GMTH 4XCYA 1I9JL 4GRLC 1UJ3C 1NLBL 1H3VA 3MOAH 5FYKH 1BJ1J 2GQHA 3TVMD 1YNKL 5SWZB 2XACC 1JHTA 3P40A 3DETD 5I71C 3CPLA 4K7FA 5FGRA 4W70A 3T0EE 5KJRH 3I3EA 2FECI 1S7UA 4ZPTA 3DX9A 2H8PB 3B2UC 4Y4HD 4KKAD 4LCWD 1BBDH 1QPXA 1U8OA 3G5XA 3B9DA 2GTZA 1CLYH 4PJBE 5DEGA 3PWUA 1FLRH 3O6FC 4EDWL 2CRIA 1MREL 2E6PA 4LMQI 4Q74A 1T1ZA 4MZ2A 1JYXA 5FO9B 5J0BA 3NH7L 1FL5B 5DD1H 3T08A 3LEXA 4AY0A 1N5YL 2IH1B 1DQML 4CVXA 3BKJL 1OAQL 1YQVL 2Z8WC 3TN0C 4OAWA 4EBQL 3IFNL 1A3RL 5HYJA 3CVHL 2C4FU 3G08A 2IAMC 2JJVA 3U0WL 5J11B 1WWWX 1TDQA 2HN7A 3L7FB 2Y25A 5L9DH 2NLJB 2R15A 4M5YH 1ZT7B 2AQ2A 4KVCL 3QP3A 1F5WA 4ETQB 3MV9E 4CW1A 2X1XR 2NTSP 4K2UH 1XGPA 4YXKL 3MOBL 4J7RA 3VD7A 5AD0A 4E41B 3L3KA 5T1LB 1EEQA 5C08B 3RGHA 4J12A 5AYUH 3PV7A 4DGVH 4CDHA 2IFGA 5ERWB 1S7XB 4HFWA 3B5GA 5E99L 2VLRA 3BKMH 4S1DD 1G0XA 2GSIA 5F97E 5C0EB 5C0AA 3LS4H 1CE1L 4DJMA 4IEFB 1ZA6A 4P9ML 1OD7A 3HC3H 4QHMB 3IDYC 5MEQA 4XNZB 5DWUH 1NL0L 1IGCL 4I48A 5LJYH 3OB0H 1KCRL 2P48B 1GIGH 2J4WL 2AV7A 4UT9H 2EYRB 3V6OA 2QL1A 1EO7A 1XGRA 4BSWA 1JZ7A 3C9NA 4PIRF 1DVFA 3KS0J 4MGXA 3U7YH 2OLDA 4I9WD 3QUXA 4CMHC 1MRCH 5D2NC 2WSKA 3GBNH 2CRZA 3UPRA 1FC2D 2GK0A 1NBYA 3MR9B 2I25N 1A4KA 2VE6A 2KH2B 2BY0A 4X7SH 2OTWB 1JMXA 2VUOA 4WW1A 1WWAX 3BIKB 4FTVB 4KTDH 1MIEH 2YRZA 3EOAA 4PJ7B 5IR1B 1IGFH 3BRDA 1C7SA 3GI8H 2Z4QB 3KPMA 4OUOA 4H0HB 5DJYB 2Q86B 5K93A 2M2DA 3T0XA 3KPOA 2PCPB 1CICC 1II4E 1WZMA 4XCFH 4YHMH 4OBSA 3LKPA 4UBDC 2RCSL 4HLZG 1E4WH 5DQDL 1L7IL 3L3HA 4PJAE 5F1KC 5HGHB 5D9SB 1IKFH 2Q7YB 3DXAE 3BP7B 5FYLE 3RJQB 2EDBA 3U82B 2EEAA 1EHLH 3VFTB 1CICD 3OKMB 1QPPA 4P23A 4ZOCA 5H94B 1BWMA 3RI5K 2IADB 2BJMH 3QEHB 3LKNB 1BPVA 4HS6B 1E4XI 4NNPL 2EYSA 4RZCB 4XC1L 1PEZA 2WIMA 5F1SA 1EHLL 4WNQB 2GJ6E 3OR7A 4E41D 2ZKHL 3PWNA 4KROC 1TQCC 1AHWC 2EZ0C 5DHVB 5IF0A 4YBQD 1PAMA 3WFDL 3LZFL 2R39A 2YBRA 3T4AA 3F5WA 5ENWB 4LGPB 1T2XA 3LS5L 1E28B 3G6JF 3V6ZA 4J4PA 3E2HC 4G9DA 4I3SL 5C0JB 2OSLA 4MJ2A 3SE3A 3JV0A 2P8PA 2FBJH 5E1HB 2R29H 3ROOB 3VA2C 3ARGA 1U8KB 2R69H 1J5OH 4HG4J 2J6EH 5DRZA 5DUBA 4NCC2 4J3WA 4WHTB 5A3ID 4NBYB 1KNOB 1T89C 2Y23A 2EC8A 5I66B 5JPMA 2ADIA 5L2KE 1DTUA 1FFRA 1GOHA 1NBVL 3A67H 4X0KA 1T1XA 2FSEA 5EB9A 3TPUB 4GQ9H 3O6FA 3PWLB 4QHLA 3FOLB 1NFDA 4D9QE 2DQEH 2NZIA 5DK3A 1DVFC 3TPUA 1TJIH 4P57A 3Q0HA 2HT2C 3K1KC 4JN1L 3I75B 3S5LA 5JW5B 4ZYKB 1I1FA 4DK3A 1GIGL 1TZHA 1MJ8L 4KQ3H 4HIJA 3ZKMC 5ACZB 3H6JA 2DWEA 1UWGH 2EDYA 3FMGL 1CICB 1OLLA 3LIZL 3BPNB 4M7LT 1W2KT 1F6AA 2VIRA 2XG5A 2YRLA 5B39A 5IB3B 4GKSB 1YMMD 4KDTC 2GY5A 4PY8J 2V5TA 4XBGB 1IC7H 5FKPA 5HGGS 5ACLA 3L95A 3SJVB 4HPOL 2QSVA 4Q9QL 3PJSB 5GGQH 1AI1L 4XB8A 1QHOA 4YGVA 5C09E 3BN9D 3QH3B 3MODH 5IFJA 4XMLH 3GJFB 1V7MH 1FORH 4JHZA 1BD2A 1MJ7L 1HIML 3O9WA 2VDRL 1W0VB 1I9RH 4OCRH 4BH7B 3DO7B 1XGYL 1BFOA 3QPXL 3H7BA 5EBLA 3IKCB 4KJQD 1A2YB 3IJYA 4O2FA 1I3UA 3B3IB 2FLRT 3U0PB 3UDWC 1U8QA 1NUNB 5GZNC 1YQVH 5IP4A 3KHOA 4BFIA 3T1WA 2PW1A 4LPUA 2BDNL 1MI5D 2VDPL 4LRNL 3F7VB 4L4VD 2OCFD 4AEEA 3U4BH 1H8NA 1T2JA 1W8OA 1E27B 1UXWA 1OQOA 5EC1B 1RIUH 1RU9L 4M7JH 4LKCB 3NABL 1QRNE 1S7SB 5BZDB 1UJ3A 4LKCA 3H9SD 4GKNB 4P5TD 1EK3A 2XN9D 4Y2DD 5DRWA 5HYSG 3SDYH 3VXRA 4QYOA 3L3KB 3SE9L 1RVFL 3VD3A 1TQCB 5IMMB 1U0QA 1JFQH 1KCSL 4KQ4L 5JLZB 1J8HE 5BZWA 4F15B 1T5WA 2IWGA 4CAGA 1EUTA 1NLBH 2IFFL 2AS5M 1WLHA 4RBPK 1JPST 3G5YA 1WZLA 4KK8D 4C4KT 5CEZE 4P99A 1UENA 4M1GH 2ZSVA 4WU7B 2J8UF 3N1QC 3GMMA 2N56A 3H9SE 3WO4B 3QDGA 1KC5H 1VPOL 2F74A 1PZ5B 3AVEA 4NNPH 5CSZB 1E6JL 3EDKA 3GB7A 4ONGH 4UZGA 4BQCA 3UMTA 3L3JA 5EFIB 2O61A 1FP5A 4G5ZH 4DQOH 3IDXH 4Y2OA 1XR8A 1T7VA 4OF8A 1KENL 2W1NA 1T2QH 3H9HA 5C0AE 2ZCKH 4UV4H 4WU5A 1ZGLA 1U9KA 2B2XH 1S9WA 1CFBA 1E6OH 1P2CA 5DTFB 4YHZH 3UTSA 3IRZA 3T0DA 1AJ7H 4Q2ZA 4MNQA 4X9BA 5FCUL 3P4NB 3QG6A 4U2ZA 2B5IB 1MVUB 4QRTB 2CIKA 1U8IA 1B2WH 3HI1B 4WDIB 5DI8A 5F89B 1JWSA 3HE6B 4K07A 5I1LB 1N64H 4X83A 5JXAL 5GGSY 1A9EB 4ZFZA 1JV5A 2AK4B 2CRYA 3HAEB 4PRDB 4XP6L 5I1EH 1CLCA 1LEIA 3SO5A 4APQA 5CLWA 2AK4A 3HAEA 4PRDA 4KI5D 3RWCA 3EUUA 5KSAC 3SDDA 5IHUL 4U33A 1MRCL 5I2IA 4F2MA 3JUYA 1GGTA 3OF6D 4G6JH 15C8L 3O6ML 3ZHKA 1R5IA 3IFOB 2ARWA 4JRXB 2XRAL 4AZ8A 3B43A 2MCG1 4P23B 4WWKD 5E8PA 5C0RL 1G0YR 1Y18A 2VLRE 2DLEA 1OAKH 1JGEA 3T4YA 4ONFH 1U93B 1C5DA 4NQXB 4KJYA 2YUZA 3MUJA 5E99H 3SKUD 4QHNA 2A0LD 5GRWA 4XCNA 1CVRA 1I1CA 3WIFA 2R2BA 4H25B 3R06B 4PJ9A 1D7FA 4GKSA 1FVEA 2X4TB 3CC5A 1NCWL 3BGFC 2ZCHL 4N90E 4XHQA 1M7IB 1XCQB 4OCXH 4AG4H 3UJTH 2ZG3A 5I19H 3E6FB 1ZHNB 4N9GB 4NN6C 3WSQH 5T3ZL 2YKLL 1ND0B 1DE4B 3GSRB 3MA7B 2VKWA 2JE8A 3CXDL 5DEGB 3S35X 1PDKA 2GY7B 4ZFFB 1C5BH 4PJHE 3BDYH 4JPVL 3H7BB 4Z7VF 3SGEH 3NPSC 1WSST 2D7QA 1DUYA 5GRZA 2Q8AH 4H88H 1OLZA 4JKPH 3AY4A 4HLZH 4C56D 4HUMB 1LWRA 2E7HA 3DGCR 1A1MA 1T03H 3BDYL 4JPVH 4HCRA 3SY0B 3MLWL 3UJJH 4NJAL 3VI3F 4JCMA 3RPIA 3O4OC 2QHRH 4KJPD 4KMTH 5DMIL 2IG2L 3WSQL 4AT6A 1A4KB 4LMQE 4XAWL 5FYJH 4KRMB 2IQ9L 32C2B 4P9HH 1HIMH 4QXTA 4YK4B 4V2CB 3VFWB 1QLFA 1AP2A 4MNHB 5DXWA 3MV8E 1OPGH 1NCAL 3BPOC 3IFPB 4JZJB 3WDIA 5MP6H 2B1HH 2FEEL 2OZ4L 1RIVH 2X4RA 4MD0A 4MNQE 3HZKB 3ZDYF 5GJTH 1I9IL 4LCIH 3PL6D 1BFOB 3AAZB 4JZNB 1CGXA 1W72A 4OGAC 4LHUD 4PV8B 3BPOB 5GGTL 3SE8H 3LQZA 2XV6B 3GM0A 1TNMA 3ROOA 5B3JE 1RIHL 3BHBA 3VH8B 1RK0A 1KACB 5MEQB 3PWVA 3WFZA 1NJ9A 1B4JL 2A6DA 5EULV 3N85H 3VXQA 2CIIA 1K8IA 3HCVB 4RAHA 4JANB 3FFCA 4KKAC 2R2HB 4I0PC 1PY4A 5E5RB 3KPRD 2AEQL 4I0KA 3MODL 4OI7A 2NX5B 1KIRB 1FBIL 1TJIL 4PRBB 3VXRE 2C1PB 5GGQL 2AEWA 4HJJL 4KZDH 1P7KA 3O6LH 5LGJB 1EX0A 4XMKL 5DHVA 5KSVA 4DUXA 3K0WA 2DMCA 4WY7H 4KGLA 4ZYKA 1G9NC 1CFSB 2W65B 1NEZA 3QULB 4JN2A 4FTVA 4ALAH 4FABH 5IVXA 1R3KB 2DWEB 5DJDA 3SDXE 4OIIL 2VRAA 1XCTA 5I1DB 2J6EL 3SN6N 4MJ6A 1BZ7A 1C1EL 1GH7A 4OUUA 4NZDA 4ACPA 4IM8A 1ES0B 2XI9A 3G6AB 1U8KA 3KYAA 5IW6A 1R0AH 1J1XL 2P5WB 5CSGA 5DJ6B 4TN9A 4TUKL 2ZCLH 5I66A 5JPMB 4FZ8L 4AIXA 1DBML 4X4ZA 4QKXB 5CGYC 4M1CD 3BUYB 2Q7YA 5BV7H 1MFDL 1BREA 1K4CA 3N9GL 3QDGE 5D1ZA 3LZFH 5IFJB 3QR2A 4P5MA 2B8OT 3BE1H 3BT2L 3RL1B 2P42B 2DQTL 1CG9B 2EZ0D 4G5ZL 1T1YB 3GGWB 5E8PB 1XAUA 4JJ5A 4XVSL 1D5IL 3H42L 4YHOL 1MRDL 1DUZB 1KCUH 3GMLB 3QSKB 1MUJB 5T1KA 5D8JH 5C08D 1XR9B 4U7SA 4HJ0D 4FOMA 1P53A 4P4KB 3MRDA 1GGIL 1EEYB 4POZC 2ZJSH 3PWPD 4XPBL 3VG0H 1ZT4B 4ZQKB 3QHZH 2XXMB 4NDMB 3BO8A 2DQTH 3OAZH 5F9DC 2D9CA 2FL5A 1VFOA 1SJVA 3VRJA 1KLFA 5T5FH 1MCPH 5F7EL 1V3JA 3FQRA 4I5BA 3D3VA 4NQDB 4LVNC 2COQA 3OXRA 2DTMH 4UU9A 4QYOB 2ESVD 3UO1L 2JCCA 1WC7A 4KTDL 2VLRD 4OV5B 1WBZB 1AR2A 4G8EB 3PDOB 4W68A 3NABH 1LE5B 4HBCL 5HVHC 3BE1L 3MUGB 3H3PL 2XNAB 3DTXA 3OR6B 5IG7A 4O2CB 3S36H 5J8OA 1W72L 5GGTA 3D18A 5LG1A 3QWRD 2HJFB 1JPGA 1JBJA 4PGBB 3HG1E 3WXWH 5FYLD 3MGTA 1BD2E 1D9KD 3X12A 5K9JL 4UILL 3QUXD 2NTFB 4N0UA 4EXPX 2HMIC 2AP2A 5C09A 1EVUA 3WE6B 4XXCA 1CL7I 3MRQA 1SVZA 5CD5D 1FBIH 3NFNB 3I9GL 5GGRB 1CF8H 4Y88A 3OG6B 1OW0A 4PY8I 3HC4H 3IDMA 4IIQB 2BVYA 1UZ6E 2BVQA 4M8QB 2W07A 4HS8H 3BH8A 5IKCA 1FFPB 2W0PA 3A6BH 3MLZL 4GXVH 2R4SH 5BQ7B 5ID1B 1NAML 3QWRA 5C0AD 1QACA 2V6HA 1FFPA 3O3BB 4L8SC 3VXMA 5IB5B 4I18A 5DVMA 1DN0B 2DDQL 3DSFL 4PREA 4RMSA 4YR6B 4XTRD 1RFDL 4LGSB 5HDQH 3TO4B 4UT9L 4PJGF 3OBAA 4Q9RH 3ARSA 5DT1H 3OJDA 4LP5A 3LH2L 5D7LB 3U2SA 4P59L 5FUOL 4KMLB 1MCOH 4JDTH 4E9LA 4KDWA 1OAYH 4P2OD 4S1RH 1U8HB 4L5FL 1HINL 1DQMH 1KTKE 4MJIE 2IQ9H 4O58L 2DQJL 4P9HL 1S7VB 3DXAD 2BNQA 4BZ1H 4PG9B 3OZ9L 5EUOB 2I07B 4GBXD 5I1IL 2WBJC 2JCCE 3DX8A 2EYSB 4PJAF 4Y16B 5ELIA 4EDWH 4C58B 4MD4A 1IJ9A 3OR7B 4RWYL 1U8NA 1JNNL 1EAJA 2YXMA 1BBDL 4O51B 2Z93A 4DKEH 5B3NA 5DK2B 4ZAKD 4MDIB 2R1WB 4KAQL 1I4FA 3D87B 4O5LL 1N26A 5FUCE 3RL2A 4GSDH 1A3RH 5I1LA 4YHLH 1SHMA 1CVSC 4F7MB 2DL2A 4DW2H 2HFFB 4MD5B 3IJHB 3DUUA 3ZE0F 3MLWH 3MRMA 1QSZA 4UT6H 2V2XB 1G7IA 2A9MH 3F62A 1HNGA 3V4VH 2R2BB 4H25A 3IKKA 2BSSA 3E2HB 3G6DL 5IB4B 1JPSH 3MBXL 1ITCA 3H2WA 1ZT1B 2CJUH 3D9AH 5GIRA 4B5EA 5SWSA 2A6KA 4IRJC 5EU6B 3CSYB 1ZT1A 5EOQL 2R23A 1LO3L 3RGVB 4OF0A 4X9FA 3MJ7A 1JPSL 3MBXH 4KTEH 2BNRD 2HWZL 3G6DH 4G7VL 2NX5A 3OKLA 2XZAL 2Y36L 4FXKA 3S5LB 4ZFGH 4ZFFA 4UQ2A 5ECJE 4PG2A 5CJOH 3QUZD 5EU7C 5JHLL 4A6YA 5ISZA 1FGVL 4FMKA 5EO0A 1N8ZA 5E4EB 4NUGL 3NAAL 4LASH 3GSNB 3QFJE 4OLZL 2Y07H 4UDUA 4ZNEA 4IOSD 3KPRA 4FQJL 4OBRA 4JO4H 1J11A 5HD8C 1AIFA 3MYZA 1MLCA 1EEUA 1WIOA 1I9EA 4JAMA 1J87A 1KF9B 3S4SG 2VKXA 4S1QH 5CEXB 3OG4B 4KK6D 1RJCA 5DD6A 4M4PA 5F3HB 5EZIL 3OZ9H 2DM2A 1FPTH 2JJSA 1HSAA 2DQJH 3W81A 4N0FB 4PJBB 1KT2B 4KUZL 3SGKC 4NZRH 3TBWB 3FQNB 5J6HA 3QCVL 4URTB 1MCOL 4JDTL 5FUOH 3QDHA 5L2KB 1NGZB 1YA5A 4RDQG 1KN4H 1UACH 2VWEC 5D2NB 3QHFH 1JPTH 5D1QC 2X4NB 3KDMB 2XA8H 5I75B 1L4IA 1RJLB 1IAIL 2O5XL 4G8GE 1CGWA 3IGAA 5JNYB 4ZNCD 4FQLL 3GJEA 2A83A 2DLFL 5ICYA 3IGAB 5JNYA 5HGDA 4ZFOB 4Y8AA 3MV9B 2Q6WB 1YNTB 2E9BA 4X4YB 2FB4L 3JTSB 4RGOL 4YHIA 2NR6D 1JHKL 4KZEH 4Z7WA 2F54B 3Q5OA 5D4QA 2VDNH 4JY6A 3PE9A 2B5IC 3SGEI 2H2PD 2BP3A 2ED7A 5JLZA 3LDBC 3MR9A 3O4LD 1F6FB 4ETYA 3BWUC 5HI3D 2IPUK 4DQOL 1SY6A 3U0WH 2NR6C 4Q97A 2PW2A 5H35B 3CVIL 1FO0B 2NY7H 3OR6A 5IG7B 5HPMA 3DV6B 1RZFL 3U30C 2BNRA 4EBQH 1UWEH 1OARH 2NMSA 3DVGB 3QUYC 1VPOH 4PJFB 4CNIA 3HR6A 4RISL 1MJUH 2HTKD 3OAYH 4W4NA 4J6RH 3BOVA 3U2SB 4YDJA 4ZXBA 2YPLD 5IVOA 5C9JB 4KJPC 4OZIB 5CZXC 4U0RB 1TZIB 5FF6B 1BF2A 1HHGA 3X11A 3LN5A 4HKJB 1ZVSB 3ZSSA 1ZHLA 5I9QC 1KCSH 4K3JH 5EIVA 3ILPA 4HT1H 2EDWA 5D6DC 1CBVH 1D5BA 4L1DA 1GRWA 12E8H 1AO7B 1EO8H 5CZXD 2ZUUA 2FJGB 4JGMA 1EHNA 3DVNA 1QLFB 4I9WE 2D03H 1ZLUH 2P5EE 4L5FH 4KUCF 4ZO9A 5CKAA 2HFGH 3GMNA 2P7TA 1DDHA 3FN0H 4AMKL 3P3YA 3FO0L 4U6TA 3TBTA 1A0QH 5GS0C 4UIMA 4MNGE 2LVCA 2UY7A 4ZFZB 3GK8L 5ENWA 2FHBA 5HBBA 1FH5L 2C5DC 1ZSDA 3H42H 1IQWH 4UIMB 4X6CF 3FT3A 1T7ZA 5SWZA 4G6ML 3DV4A 2AQ3A 1R3IL 5HPOA 4Y5YA 3LB6D 2ED9A 2CIIB 4B7LA 3QXDA 4PJXF 1J0HA 2FCBA 2R4RH 2VL5B 3AREC 2NY6B 1I7RB 3MLRL 4OCRL 4OFYD 1PYWA 1ZGLP 3P0YL 3QCTH 1YNLH 3QNXA 1BFVL 2P5WE 5E2WL 2C3VA 2O5ZL 3WD5H 4ZD3L 3C8DA 4YDKL 4XPTH 4FQ1L 5D2LA 1FCCA 1UB5A 1AFVL 2PYEB 5EPMA 1EEYA 1C08A 3ZLQC 2O5ZH 3CFJB 1LDSA 3MMEA 4KC3B 4KXZI 1GVIA 2F8VA 4GW1B 5IESL 3CDFA 1AQDA 5DRXB 3IXAB 3O6LL 4HFUH 2F58L 3EYQD 1DFBH 3GO1H 1S8DA 2VXVL 4YNYA 3OXSA 1V8HA 3RVUC 2OXHA 5IB4A 2E3VA 2X4SB 4RAUA 5TPWL 5I8CA 3GBML 4A2LA 4U1NB 5GRXG 5JMOC 1X6LA 3RWEA 2OTUA 3KLHD 2OJEB 5EN2A 1G7QB 4S0SD 3VCLA 1YEIL 5BS0D 2R4RL 1T7XA 2P43B 2GEEA 4OFVA 4OGAD 4R7DB 4UQ3B 3SDCC 2YD9A 3WFHB 1MF2H 5TFSH 4GRWE 3O2WH 2WWMD 4GW5A 5CINH 5DMGD 5EC2B 4MX7A 4ZUSA 4L4TA 1MHPH 4KKNA 2OP4H 1XIWD 3O8XA 4XPHH 5I6XC 5IIEB 4A6YB 1J5OL 1RIVL 4LLYB 1ZVHA 2YN5A 1JHLL 1ITBB 3IB4A 4YBHA 5D8JL 4Y4FA 4I3SH 4PRPE 5DLML 1TJHH 4MHHI 1CT8A 3ULVE 4MJ5A 1J05A 1TJGL 3T09A 4BUGA 2APFA 1U8JA 1EO8L 4HF5L 32C2A 4NQED 3R0MA 4PBXA 3ULUE 3RVTD 2VQ1A 1MEXL 1T3FA 3BH9A 4L8BA 5CJ8A 1ADQA 5F3HA 1RZKC 3UJJL 1V3LA 3D2UB 2A74B 4BQ6A 3RA7H 1MNUH 4OV5A 5T3XE 1FGNL 3RX7A 4OF6A 2IANB 5DD3H 4B7IA 1V05A 5DR5H 4MAUL 3QUMA 4H88L 3TNNB 3QG7L 1PLGH 3LQZB 5T33L 4KKBC 4CRPA 3S37L 3NGBB 5C0FB 1DBJH 4Y4KD 5E00A 1RUQH 4HJGB 5T1MA 4LL9A 1QBBA 1J8KA 2AJSH 2OR9L 3MRHB 1YN7A 2PUQT 4FFWD 4YDIL 4K8RL 4X6CE 1NGXA 2R0KL 1OCWL 5IHBA 2YD7A 5D71L 1NDMB 1YN7B 5BRZB 2PO6D 3MRLA 4BSVA 1X5AA 2VQUA 3C6SB 4GMSH 1E4KC 2AVGA 1FG9C 4LLUA 2ZUXA 2JB6B 4XP5H 4WTZA 2MCPL 1S5HA 3ET9F 4XMKH 3RUGE 4ZNEE 3WS6A 1IAIH 2O5XH 4QXGL 4YBLB 2ZUVA 4MQTB 4JM4H 2Q3ZA 1A7BA 2AKRA 4GAYA 4RFEB 1P4BH 5ISZD 4NM4H 5I18H 5E03A 1KN4L 4JREC 1WBYB 1UA6H 3P0GB 5D72L 3S35L 4YDVB 4P3CH 4NC1E 3UTSB 2Q76A 2ERJC 3O6FD 4OZIF 1QQDB 4HV8B 4KTYA 3EFFB 4NZRL 4ELKB 3MRMB 1U3ZA 2CLVB 1DDHB 3T3ME 3V8CA 1AIFB 1KCVH 2EYTA 4QOKD 3DXAA 1IVLA 4AIZA 1UKSA 1OP3H 1OQXA 1G1CA 5GRUL 5C0CE 5HHNB 3BISA 4K3GA 2KKQA 4XC3L 3ARDB 4Y19A 2VZVA 1LEIB 1RHHB 2OI9C 3QDGB 3GIVB 5E6ID 2F74B 2BCKB 5D1QA 3LQAL 4M5YL 5I2IB 5MEPA 2V9TA 2BOBA 1YMHB 3K81A 4Y4KA 4OCLC 3ZE1E 3V52H 1HOCA 5GSRB 3PL6A 4Z6AT 2O5YL 1T1ZB 1UH2A 1Q0XL 5E2VH 5E9DB 1S9YB 4DN4H 1LK2A 1F4XH 3BQUB 4H5SA 1EXUB 1T03L 4I2XA 3T4YB 4WWID 5FECA 2XZAH 2FEDD 1RJYB 2ATKB 2X4UB 3BKYL 1XF2A 1C5DB 4OFYA 5KAQG 4YH6A 4FZEH 5HHQA 1OL0A 2VISB 2W0LA 3HFML 1JGLL 2NYYC 2G2RA 4S10A 3L3DB 3ARUA 3V6OE 3K46A 5E2TL 4GW1A 2DQGH 3G04A 4QTHB 1RMFH 3IDIB 5I1KL 3W9EB 1VEPA 4UINL 5EZJA 1A21A 4FP8H 4LLMB 4PRHA 3QO1B 2Y36H 4FQQB 5FXCH 1MFEL 3LHPH 4UU9B 5CILH 2OL3A 2AJ3A 3RWCB 3SKJH 2OZ4A 3VFPA 2EE3A 2Y5TB 5C0DA 4OZHF 4G7VH 4P46A 2P44B 1CDGA 1P7QD 1UKTA 4UINH 5JIKA 4Q6IB 2QBWA 4KU1A 3WNLA 4KHTH 2UWEB 4UTAH 4JO1L 4LCCB 3KPSE 4O2FB 3Q6GH 4OM0H 3Q1SL 5F96L 1GGUA 2WBJB 5SX5H 4XNQA 4JM2A 2VSDA 5C0BD 4GW4B 1J0ZA 4CUCA 4UTAL 2DYPB 1NMCB 4WRLA 3PXHA 1NQBA 1LD9B 1U93A 1UM4L 1YECL 3QISA 4P2YA 5C07B 5AG8A 4Y5XA 1FNGB 1N2RA 4J1UA 5D5MB 5TF1H 5L0QC 4EI5C 3IVKB 4MQXD 1MFEH 3LHPL 4FFVD 3OJVC 4GLRH 4QHNB 1G7JA 5D5MA 3W0WD 1HQRB 3B5HA 3QDAA 1AQDB 3ARFB 5IB3A 5TPWH 4EI5B 4QRRE 4QNPF 1J0YA 4N0UE 5D6CB 2CR3A 1JNNH 3C5JA 4HUWA 3EBAA 3UPRB 4NP4L 1QFUH 3EGSB 3TH3T 4NZTL 3O9WC 4G6JL 4UOW0 3HMWH 1MCWW 2Q7NA 4IS6B 5JQ6L 3IDNA 4IIQC 1ZHNA 2XN9E 4N9GA 1SYVA 4MCZA 1C12A 1WFTA 3H0TA 5DK0B 4ODXA 2XOTA 4JQVC 3TNMA 1H3PH 4PJHB 2JLLA 1X5XA 4B50A 5D1QD 2YC1A 2WUBH 4U1HB 4L4TB 1IC1A 3GMOB 3TT3L 4OGYL 4XPTL 1A6ZA 3VRLE 1GZQA 3QPXH 3C6LB 1DBBH 3MZGB 3REVA 1RZ7L 2FDBP 5D9SA 1HI6A 3LQAH 1E4KA 4EN3B 1QSEE 3BP5A 5FCUH 2B39A 1TZIA 4Z8FL 4RGNE 3W11C 4CN1A 1NLDL 3DHJA 5KVMC 4NT6A 4OD2B 5BOPA 3SY0A 4N0YL 2DL9A 4OCSH 2QQLL 3U1SH 1HKLH 4XP9L 1AO7E 5CEYA 2GJ6B 3TJEL 1VHPA 2H41A 2N7AA 4ZPVB 4M61B 5C0BB 3LSOA 5D7JD 5BZDA 5DO2D 3QDMD 1A7OH 2QSQA 1RD6A 3BI9X 4P49A 2QV2A 1MFCH 1JWUB 1KB5L 3T2OA 4GKNA 3HUJB 3PDGA 2E27L 5DUPH 4U7KA 1WTLA 1HH9B 5E8NB 5GSVA 4C59B 4QXUL 1MQKL 5FO7B 3ZDXF 1SJHB 2RAMA 5INCB 2H2SC 3MLVL 3CFJA 3D6GA 3RTQB 3QUYD 4P46C 3MPCA 1G6RH 1X5GA 4MLSA 1S7QA 5C92A 3HPLB 2R1XA 4YEFA 4X7TB 3N50A 5I1DA 1LNUB 1QG3A 3HI6L 4OZGA 3ULUD 2XXCB 2R1XB 5T1MB 4V1DB 3KXFE 3QYCA 4JFPB 2XWJA 4QCIB 1VKXB 3IU3B 4EVNA 4PTTA 4UAOC 3TN0A 3WNMA 3RZWA 3P77B 4IDJH 5C0BE 2ITCA 3RWJA 2VDKH 2VZ1A 3AS3A 1J1OH 4P2RD 4P2QD 4X5XA 3GJFK 4MA1C 2C3GA 1S7TB 3C60B 3TIDA 1U3JA 4XP1L 5CP3H 5J12C 5KOVC 2QQKL 4JRYB 5LAXA 1ZGLM 1KJMA 7FABH 2AK1H 2NY3C 4L3EB 1ZGLB 3U36B 5KS9B 1FIGH 4BJLA 1OARL 4MNGB 1KYOK 3ZZ1A 1CDHA 1LK2B 2FGZA 4GG6F 5CJXA 1U8LB 3RA7L 1V7NH 2VSCA 2R2EB 1MHEA 4AEIL 2VDLH 4M7KH 3ARDD 5SWSD 1MHEB 1KULA 1FVEB 2X4TA 4N8CH 4WUUD 2NY0C 4L29A 4FNLH 3UZEA 1YMME 3QJHA 4KXZH 1NFIB 3GSXA 2PTVA 3ISWA 1V7ML 3TH2T 1VGEL 1R0AL 4ONHA 3VWKC 4QXTB 2FX8L 2OX5A 2A74A 4GRWB 4TQEL 2EEDA 3V79C 3U0TB 1IM9D 2DQDH 4XVTH 3PHOA 5HHOD 4N0YH 3KJ6L 4I0PA 3ZSTA 1HHKA 4NM8L 4JM2C 3BWAB 5E95B 3OKKB 1JGEB 4JFQA 4S1DC 5C2BL 5ITFA 1TCMA 1AGDB 2ITDA 1U36A 2UVFA 4H5SB 1LEGB 3DRQA 2X7LA 3MUHL 4FFYL 2QR0B 3NCJL 4JM2B 1ZTXL 1JPGB 2OS7A 1NJ9B 1HXYA 1UXWB 2WUBL 4UNUA 3ARVA 1HH6A 4UIKH 2Q3AA 3OJ2C 4MWFA 3MRGB 4KK8C 1P5UA 1RZKH 5IW1A 5T3ZE 5BVPH 4UAOB 1JIBA 6CGTA 2BK8A 3GHBH 5DRXA 5D70H 4OZGE 3VD9A 2A1WL 3RRQA 2EXYD 1JTTA 1AKJD 1XGRB 4BSWB 2C1OB 1DVFB 3CDCA 4C56A 3FN9A 4F7CB 3S3PA 3BD3A 1WFUA 4IIQA 1EFXA 2DQIL 3QB7C 4JQVA 3F7YB 4QLRA 3EYFB 4WHDA 5J6GB 2I5YL 3SDCB 3CFDB 5C8JA 5KW9L 3HNTH 5C0IA 1I7UA 4OZGF 1SM3L 1KJVB 4PJ7A 4P2RB 4CMMB 1WZKA 3WIHL 3BKML 1RY7B 1L6ZA 2CSPA 1DANU 4FXGA 1DR9A 4RX4A 4X9IA 5E4IA 5HVGB 4U2YA 1GZQB 4W6XB 2IPUG 1JVKA 3BP5B 4TQEH 4G8GB 1AGCB 3WL9A 4MLIA 3LRSB 4OZHA 5IWLC 1HILA 2XTJE 5D1XC 2ADFL 4PGZA 1MSPA 4ISVA 5GRJL 1T89A 1AO7A 4GLRI 4R2GD 5L9DL 1I3VA 4OZFH 5FYJE 4NQUA 5HHVL 4CL7A 3LKNA 5DMIH 3S34H 3LMJH 2KBGA 4JFXA 5ESQB 1CQYA 4U49A 1ZANH 4LSRH 2X10A 4W4OA 2BMKA 5F8QC 1BZ7B 4P48A 2YZ1A 3RVVC 3P4MB 3FAXA 3FONA 3IAQA 3JV6B 4JFYA 1FFNB 1FLRL 3GI8L 2BX5A 1SVCP 1F3DJ 4QGTA 2YK1L 4D0BA 4A2MA 3B5TA 3ULUF 2ZOLB 2P46B 4JG0L 4W6YB 2CLZB 5DJXB 3WJJC 4AK1A 2VMFA 4UMGA 2O5YH 2DM7A 4HIHA 2D31B 4HXAL 3NMEA 2BERA 5HXMA 4ODVH 2OJZH 1HQ4A 2GJJA 2DLFH 4PJXB 5F8RC 5BS0E 5F88B 1NKOA 4Z5RA 3FQTA 3UX9B 3B9EA 3BW9B 4HUUA 3BEVB 1UB5B 3TC9A 5KSUA 5D5MF 3SKNB 5ANMB 4MB3A 4GKZB 3HHRB 3DX7B 4GS7B 5K9OB 4JFFD 3T8XA 2HJKA 3S88H 4TUJA 2GJZB 4PJEA 2D0HA 1MCJA 2E8YA 2WQRA 3M07A 4I48B 3BSZL 3KPPA 4Y4HA 3RTQA 2GJZA 3HTLX 5L88L 2DDQH 5KZCD 3EDDA 4L9LC 1IGJA 3BZEB 3D85B 4YDLB 2YUXA 1WQVT 3HZMA 1NC2D 3M45A 1YEKH 2HT4D 3QQ3A 4U1JA 3BAEL 1U8PB 3RNQB 1GJIA 3TJHD 3RUGF 3NVQA 3T04D 1J10A 1NSNH 1OAKL 1P4BL 1KIQB 3HE7A 5E8OA 1T22B 5I0ZA 2XA8L 1HKLL 4OI8A 5LKNA 4OFPA 4M7ZB 5JZ7C 4X5LA 1KELH 4CGTA 4QY8A 3MV7D 3WIIL 3VFRA 3DX9B 1ZLWH 5HVHB 4QY8B 4JREB 3MRFB 1PG7L 1EA9C 4EQ2A 4NQCE 3TBWA 5DUML 3W9DA 4OGYH 4PGBA 5ABDE 1EEZA 3GMOA 1IGTB 5D7LA 5D96B 5EBLB 4KUZH 3RPKA 4XNXH 1AHWB 2EDLA 4OIBA 5HTSA 3MRJB 3S6CA 1I8IB 2APTA 3DPBA 4XAKD 1P84K 2IH1A 4GAFB 4Y19E 5JHDB 1IKNA 3I6KB 3MRJA 4PRHD 1NDGA 1INEH 4NZTH 3I6KA 3F58H 2DQHH 3O2DL 1AC6A 1UZ8B 3BZ4B 4NHCL 1MNUL 1FQ9C 2DQIH 2P5ED 3NFPB 1R5VB 2BNQE 3BMVA 5CZKA 3T2QA 1TZGL 2DQCL 5TE4H 1YDPA 3MLPA 2E7LA 3KLDA 5HSFA 3C8KB 1SEQH 1T1WA 2X41A 3HUJE 4NQDE 1MRFH 1A6AB 3ULVL 1FGVH 2DJ4A 5FM5O 4GAGL 4M62L 3CFEB 3KPNA 4K3DH 4GRMB 1KT2A 3IDJA 2A6IB 2F54D 3MUGA 1JUFB 2YD6A 2D0GA 4L9DA 1M7DA 4XCYB 4XNQB 3Q6GL 4OM0L 1UGNA 4XXCC 2A6DB 2OP4L 2UZIL 1FAIH 5I8OL 5E6IA 4PJEE 4OZHE 2R2HA 1JK8B 2IAMB 2ILLA 5J11C 1XT5A 4NPYB 3MQIA 3RTQD 1H0DA 1RVFH 1YEIH 2ZSWA 4MMXC 1NC2B 3RDTA 2DQDL 2A9ML 4EN3D 1IAIM 4QRPA 5J7CC 5INDA 4JLRB 5CGYD 3SGDI 4WENB 4L8SA 4J2XA 3PWUB 4QRPB 4I18C 3CSBA 3OGCB 1CR9L 1IZJA 2BHZA 4JFHD 4X99B 1OP9A 2NY2D 2Y6SC 4XRCA 4M48L 4PJ7E 2D7OA 2FZ3A 1UADC 1XF3A 4NBXB 2CK2A 2EDTA 35C8H 1QBMH 4Z7VA 4ZO8A 4DGYH 4ODHH 2Z35B 2W0FA 4F7TB 1RFDH 1YEHH 5FM8A 3DSFH 4K7PH 5HVWA 2R0ZH 2X6MA 5J13B 2W0FB 4P2RA 5F7MC 1IRAY 3D69A 3FONB 4OTXH 5KZCB 4JY4B 5BRZD 4XVJH 4WI7A 2ORBH 1M6OA 4O02L 1ERNA 4QF1A 2I60L 3MJ9L 2W9DH 2FX9L 1UJTA 4P5MB 5IBLD 4M6MH 3U46B 3V0WH 4PGCA 1GL4B 5B22A 3C09C 5DZNA 5F21B 3MROA 3WYRA 1W0VA 4ZS6D 4BH7A 5IB1B 1KLGA 3K4AA 5FM5M 1ACYH 1KIUA 3ROLA 4K9EC 3G6JE 3ALXA 2EDHA 4H20L 4I13B 2X4OA 2ARJA 4UOW1 3UPCA 1IEHA 5EZOH 4MXWH 3TEUA 3HI6H 4GQ9L 1W72H 2B1HL 5I16A 3BMWA 4DOHE 1FO0H 5HYFA 2BSRA 1ZOXA 5IFHL 1QYGL 2W0KA 5IW1B 3NZHL 3B9KB 1NBVH 5K33A 1BFTA 1KJ3H 2HFGL 4KQ3L 4Z7NF 3FT3B 1ZT7A 3TZVB 4NO3A 4JM4L 1J88A 5KG9A 2EH7H 3QQ3B 4U1JB 3OKNB 5IVZB 4TSBH 1OT2A 3QI9A 1KTLA 3RVXD 5DJXA 1MFCL 4FFZH 4LIQE 1EZVX 1P6AB 1YJDC 2MJWA 5GIRB 3VMNA 4XP5L 1JZ4A 1MCNA 2ZOKA 4O2EA 1LE5A 4K3EL 1TQBC 3I6LE 3TO4C 4NWTL 3WBDA 3IF1A 2H32H 2BVPB 3DTXB 4NCC1 4U6YB 4E42B 2WBJA 5I9QB 4MAYC 4N8PA 4XPBH 5MERA 5DJ2B 5B8CB 2WUCL 4WI2A 3BQUD 4S1SL 2EE6A 3TA3B 2FBJL 3QG7H 1O0VA 5CD3B 2NY4C 5GS1A 4YHOH 2LU3A 1EGJA 3MUY1 3PHQA 5IMKA 4EUPG 3MRQB 2PO6A 5M95B 3O0RH 1I8IA 3QEQB 3PP4H 1BVKB 5FGCE 5K9QI 3BT2H 4JGJA 1NAMB 4MSWA 1WEJH 5B38A 4KK9D 3L5IA 3GIZL 3R06A 1NEZG 1T0NB 5CMAB 3HI5H 3RIFF 3VGBA 1ZA3A 5CEXA 1DBMH 4M48H 1XZ0A 2CUIA 2ZCLL 1CK0L 4QOKB 3Q3GB 3DMMD 1YPZA 1YJDH 1IEBB 4JM2D 2DBLL 3QEUA 1T66C 1LO0H 4FQ2L 2AQ1A 2G5BB 3P11L 3QIUA 3EO0B 3AU1A 2IQAA 3ULUC 5HYSB 3AREA 1BVLA 4P5TC 1UVQB 1FFNA 1M4KA 5CINL 3O2WL 4YDJB 2HTKC 1TTGA 2XTJC 4G7YL 4JO2H 2K3TA 2PW1B 4TPRL 4XMPH 5EA0H 43C9B 1UZ6F 5GGVY 3DX6A 3FHQA 1BOYA 3GSOB 4LSSL 4G8GA 3U7YL 1L7TL 5DHYB 2VLJB 4ZUWB 3BP6B 1P6FA 3QIWA 1EMTL 2NY3D 3O11B 3RPIB 1BX2A 5F88A 1IM3B 3VXTA 3WFEH 1KCKA 1DFBL 3GO1L 2XKSA 3TCLA 4PJ5A 3PNWB 3OAUL 3DRTA 5E8EB 4OIIH 5KTEH 2C1PA 4PJ5B 1JGDB 3CMOH 1MPAL 4G43A 2BNUB 5IJVB 3AC0A 3WIHA 5LQBH 5BO1L 5GGTH 4ERSH 1FV1B 1YYMH 2AERT 1L9NA 1AD0B 1XF3B 1N4XL 1AFVH 1INEL 3RY5A 1Z9OA 2EDQA 2IH3A 3LKSA 4CMMA 3BEWA 2YPKA 1A6TA 3OWEA 4N1EA 1FSKB 4CMHB 4M6OH 2RR3A 1CZ8H 3JWNC 3GMMB 1RUKL 4JR9L 5HD8D 5TDPB 2WAHA 4MMZC 3MRLB 4BSVB 3W0WE 3PWPB 3QFJA 5DJ6A 3SGJA 4P5KA 3A6CL 4XVUC 4NIKB 1IQDA 2A77H 3E6FA 3INUL 4JFFA 1QO3B 3AS2A 1M1SA 1R3IH 3U9PL 4FXKB 5IROA 3D2UD 3SE8L 2XZZA 5DD1L 5KSAD 5HGAA 3NCMA 2GAZA 5HHPB 3HLAA 5TDNA 5GJTL 2F8OA 5H2BA 4X4ME 4NZUH 2VLKA 1BLNA 3KPSB 2BRQA 1U8LA 3C5ZC 3GGWA 1KTDA 4WEBL 3MRNB 4BH8B 2XZCH 3VJ6B 4IRSA 3QI9D 2XN9A 4F57L 3GMLA 1A7PH 4HC1L 5F6IB 4I2XB 3P30L 5GGSA 3I50H 3H9SA 4YWGH 3O3EA 3SE9H 4RFOH 3LAFA 4NQSB 3MRBB 1L9MA 5IMOB 1JN6A 2NXYC 4FHBD 1L0YA 3MACL 5CJQL 1OVZA 4GT7A 1F8TH 3WUWB 4MYWB 4QHKI 1NCCH 2D7TL 3DUHA 1RZJL 3QQ9D 2DLTA 3QXWA 1RIUL 1I3RB 2GTWB 3P4OB 3EDFA 2J88H 3DSNA 6FABL 5J57B 1TCRB 4S0TD 5KJRL 2CPCA 2QSTA 3SDCD 4MX7B 1GGBH 2VDPH 2QJDA 1CGUA 4OQTH 4XBPA 4HZLB 5ANMA 5MERB 1K6QL 1CD8A 5T3ZH 4RAVB 2X1QA 1DVFD 2LABA 1JP5A 1MY5A 4GH7B 4KJYB 2ATKA 2X4UA 2AGJL 3S37H 1XF2B 3MFFA 4LBEA 3RIAF 4LOUD 2DOCA 3B9AA 3MFFB 1JHKH 3FAWA 3HZMB 1ZLSL 3TT1L 1FL3B 3TGXA 1UJ3B 4X80L 4XB7A 5GJSH 1MWAH 3FO9A 3VFGH 3VG9C 4XNMB 4L8BB 1O5DT 1YEFL 4WU5B 3SGDH 3OGCA 3OHXA 3O2VH 2H26A 3KPQB 4LU5L 1CFTB 4Y5VA 4TOYL 4WIQA 3PV6B 2FHCA 3AB0B 4G9FD 3K2MC 4HAFA 3L5XH 4OSUH 4DKAA 5DLMH 1M05A 4PJCF 1K5NA 4MCYA 4ODXB 4HJGA 5CIPB 5FV2A 3TNMB 4PP1C 4DCQA 1F58H 3UTPD 4Y4KC 1X5IA 2A73B 1SEBB 3THMH 1NGXB 4HKZA 5J1AA 5CZVH 2PKDA 1A8JH 3EFDL 4KJQC 2CK0L 5HY9A 2PXYD 2NXYB 4Y1AB 2XWTA 2WWKO 4GQPH 4XPAL 2C7UB 5D7IA 4PJIB 3ESVF 4PJFE 3A67L 4R0LA 5DVNA 5DZOA 3UTPE 1T2QL 2DYPD 5TE7H 5J13C 3L3HB 3STBA 2MNUA 1F90H 2Y72A 3H9HB 3LB6C 1G9NH 4G9FE 4H8WH 4HKBB 4I1NB 1NFDE 1CL7H 2OK0L 1JZ6A 1T0NA 5CMAA 3JSSA 4RMWA 5I15L 5DQ9B 4M61A 3IDUA 5LBSL 5C1MB 5I73B 3GUTB 1T3FB 3BH9B 5ACMA 3VXME 3DUSB 4LHUG 3V4UL 5FOBA 4FQHB 2APBA 3FB7A 4MCZB 5I8KL 5I16B 3C08H 1MCQA 1V3KA 5INCA 5HDBF 1HKFA 3GI9L 4G80B 4IRZH 1Y0LA 4XCEA 2UZYB 2DMKA 5I30H 5IFAL 4JZNA 1RZKL 4ZFGL 3KAAA 5E00B 3S7GA 1AKJA 3IDXL 5E2UL 2W91A 4WHYH 3LCYA 5I74B 3CK0H 3BEWB 1NCUA 4FQQA 3MV9D 3IDYB 1G6VK 5E5MB 5F9WB 4IMLA 1BQHA 5D96C 1DL7H 4TOYH 2A9NL 4PV9A 1KNOA 1RU9H 4TTGA 1WVZA 1YZZA 4MZ3A 1S7XA 4HFWB 2CMRH 4TNWF 3C60A 4RA3A 3TIDB 2G60L 5I17A 2GT9B 5J56B 1B3JA 3M1BB 1RZGB 3FB8A 1TITA 3AM8A 1ORSB 4PBVC 5LVEA 3F6IA 5FECB 2GT9A 1U8MB 2VUYA 2IEPA 4G43B 1P7HL 3RWFA 1Q0YL 1AE6L 5KOMC 3VFNB 4OLUL 4Z7UF 4CVZA 5J3HC 4DKDC 5ACZA 5FO8A 1FL6A 3FN0L 4RFNB 5F7DA 4X7TA 2GUOB 5JOEA 1CXLA 4WUUA 4Y8DC 4LLMA 3GBNL 3REWB 4OB5H 5IB2A 3C5JB 1QVOA 3C2AL 4K8RC 4XNZC 4M7LH 5C0DB 4LHUA 3V6OC 1RV6X 2FO1A 1D5ZA 1FSKC 5IB2B 3OX8B 4YX2H 2WBWB 3G9VA 5IMLB 3ARPA 3MYJA 3VDAA 5D1QB 1FNSL 2CKBL 25C8H 4CU6A 5FHBL 3RL1A 5DJ2A 1UYWH 3QH3A 5B8CA 2C4FT 4PLJC 4BYHA 5DWUL 3GSQA 2NZ9D 5MI0B 3QPQC 1F4WH 5J6HB 3GSQB 3O6KH 4PJ8C 3O3UN 5K9QG 1N2RB 5JXED 3T0VA 4XPFL 1A1MB 2V7NB 1FZJA 1XGTA 1UWEL 4EI5D 1AI1H 5GS3A 5ALCL 1BQLH 4NT6B 2NZ9C 4GAJL 1XF5B 2ADGB 3SDAD 5CCKH 2VLJA 4NC2B 1P84J 5AYUL 5I8KH 2X9YA 2A38A 4DTGH 1SEQL 3ZDZF 1Y6NR 1R3LA 3K2UL 4O00A 1B88A 2FD6H 5IBUG 5JXEA 1HXMB 3UTTE 4M5ZH 5E6ZA 2NY2C 3HKFA 5ESAB 2BXZA 4HUKB 2GTWA 3P4OA 3IRPX 1R3HA 5LWYL 5KVFH 4ZMAT 3T77A 1CFTA 4M43L 1NEZB 3QULA 3MOQA 4NC1C 2WM0A 1KPVB 3O3AA 4UILH 5C6TH 3BRGC 1N5YH 1A6VL 2GHWB 4R26H 4GG6E 1X6NA 2AJVL 1CYGA 5IMMA 5D2LE 4AM0A 4QWWC 4R2GB 5F72S 2D7PA 3ZDZE 1P7QB 5I1CH 4R6UA 3C08L 3SDXA 8FABA 5H35A 4PJ9D 4BZ2H 1MREH 5HYJE 2EECA 1A5FL 3U48A 1LO5B 2EIBA 4WW2F 5D7KD 4Y5XB 4WHTA 2DN7A 3P77A 2LV4A 3QRFM 4X7FC 4XC1H 4U1IB 2MPAH 3SE3C 1D5MB 1UM6H 1L0XA 2QHLA 2DTML 4XI5D 3HRZA 5L6YH 3GB7B 4FXLA 4ZAKB 1RUAL 2Q6WA 1JGUH 1QSFB 3CH1B 1QLRA 4YJZL 5D7LD 1MCIA 2H26B 2ZUYA 4RZCA 2BY1A 4H26B 1IC5L 4XCFL 4YHML 3UYRL 1DLFL 2YOCA 1I1FB 3QDJB 1QRND 4DOHB 1EAPB 3EJZD 4JKMA 1F4AA 1EBPA 4P46D 4AEHL 5DQJB 4JO4L 5C0CB 4JO2L 4N1CA 4UDUB 3DXAB 1GZPB 2AGJH 3QUML 1IGFL 2O26U 1C7TA 2CIKB 3L5XL 1IC5H 1S3KH 3SE4C 3CLFH 2NY6D 4FXGB 3CFBB 4HXBL 2A0LC 4XCCH 3LKPB 4H0IA 1VACB 2EEBA 4BSJA 4YFLF 3DV4B 1U3HD 3TO4D 4O4YH 4Y5XC 3KHQA 4YFDB 4YEEA 4PPTA 4JFFE 5C08A 1T80A 1HSAB 3NBNA 3PL6B 1NAKH 1D9KA 4PJBA 4DKFH 5CGTA 5HHPA 3BQUC 4I0PD 1TNNA 2F53D 5IK3A 1HSBB 1DBAH 2CJUL 1DCLA 2HLFC 3D9AL 4TVPE 5LXGL 1KTDB 2BNRE 1MHHB 3DRTB 2C3VB 3U0PA 1X44A 1TVHA 2X40A 5HYQA 1TVHB 3K8KA 1BQUA 3I75A 5JW5A 5AWNH 3AB0C 4MA7L 1OP5H 1YEGH 4OLVH 1JN6B 3QIBC 5FYJU 1IGYB 3DYPA 4NN6B 1VADA 5DYOB 4MDJB 1EHAA 3LKSB 3NFNA 1CDCA 1B0GA 3RZCA 3FO9B 1KTLB 4PRNB 1OF2A 3D48R 3P9LA 2DLGA 4Y5YB 3VH8G 3HRPA 3O4OB 3BD4A 3L3GA 4AL8L 4RWYH 3W82A 1T66D 3ZYZA 1WICA 4M6AA 5DEFB 4DGIL 4YHYC 5ERWA 1OTTD 4HD9A 1S7TA 3KJ4C 4X6FB 4GXUM 1JF6A 3UC0H 2VLRB 4EI6B 5GGVL 2WLZA 3FRPA 1YC7A 4Q9CA 1OHQA 2XTJD 3P30H 1MCWM 5F70A 1A7PL 1J9CT 2K7QA 3MXWH 3ARQA 4YIQA 3SDDC 4DN3H 1L6XA 2AV1A 1VESA 4G6FB 4LCWE 4DTGL 3N1FC 4Z7OF 5DT1L 4MXWL 3LRHA 2QQQA 4BKLA 5HDLA 4I8DA 3SO3C 1FNSH 4OFIA 4BKLB 1WF5A 1QEWB 2W38A 4LVEA 5IGXL 1NDGB 1YPZE 1K3ZA 2JK5B 2M1KA 3ZDXE 5SWQA 3EGSA 3Q3GA 1DEEA 3K8LA 1XIWB 2ICES 3BESR 3LOWA 5DD5L 3JUZA 1ZVYA 4U1NA 3VXOA 3U79A 3D0LA 1OTUD 5IW3A 4NNYB 5JORA 2QQNH 3IXTB 4FTVD 1QR1A 3VXRB 2YWZA 2A6JB 3VRIA 2FH8A 3GDBA 1QFWL 4G6AD 5C71A 3CDGA 1UQSB 4WI4A 3KJ4B 5DFWH 5DMKB 4JRXD 3B6SA 2APWA 1CLYL 3FKUS 4G9DB 3C2AH 1X4ZA 4IBLT 5BO1H 1A6WH 3QXAB 4LOUC 4PGJA 5DDHB 1U42A 1CD0A 4LPYA 3QA3B 1G9EA 4JGUA 4MS8C 1NCDL 3G5YB 4LLDB 5E94B 2CLZA 1ZHKA 2DWDA 1I1RA 2AK4D 1RUQL 4KGJA 3VFTA 4PRIE 3ZT5A 4LNVA 1CFQA 1LO0L 3C6SA 1MQ8A 2DAVA 3T1FA 2OL3H 1CFNA 2VXTL 5I74C 1G84A 1X4YA 4CVWA 4L4TD 4HGWB 1I9JH 1EH9A 4U6HB 1YNTA 3WN5B 5F9OH 1AH1A 2ENSA 1YN6A 1DQTA 2Z93B 4HPOH 4PTUB 2XZQL 2Q20A 2HKHH 5EOCJ 3M17A 2AJUL 2G9HA 1U8MA 4TPRH 4DFHA 2VC2L 4QRQA 2ICCA 3V6ZB 1PSKH 4Q2ZB 3QHZL 2RFXB 2VLJE 4HS3B 3ARFC 4YXLH 1T4KB 3F6LA 1NGPL 1TPXB 4J8RA 5EBMA 5DVKA 5ICXB 3ARGD 3LN4B 5IQ7H 4KFZC 5AYQA 4JN1H 3RX8A 1NMAH 4IRZL 5I30L 4K71B 2XRAH 5KBNC 4XP1H 3UYPA 3QUZB 4KRPC 4YDLC 3FQUB 2NY0D 4DVBB 2JB6A 4MJIA 1TLKA 1INDL 4HKJA 4PGDA 3U46A 2VWEE 4R7DA 3BVNA 1NGYA 1OSZA 2WBJD 4WI9A 4JLRA 4LSPL 1OAUL 3SKMA 2MHAB 1Q1JL 2AJXH 4TSBL 4HGKC 2V2WA 2VLKD 3UXFA 5JXAH 4KI5F 1QA9B 3THML 3ZDYE 3SCMD 3F65A 4Y4HB 3RBSA 3GSNA 3H9SB 1NGPH 4RQQB 5IJKC 3MJ6A 1KBGH 1KPRB 4U31A 5HYQB 3EFFA 3RY6A 4UT7L 4JPKL 2EC9T 1R24B 2HRPL 5BJTB 3QFJD 3VG9B 1Q9OB 2JJTC 4M5ZL 2HT4C 4N0CD 3VGAB 2E7CA 4C55A 3CCHB 3VXPA 4LK4A 5L8KB 1DJSA 5SX4H 1DBKH 3GSWA 2QSCL 5DSCB 5T5NG 3X13B 2HN7B 1KGCE 4NO3B 4Z7WB 2BVTA 2NLJA 3P9LB 4KROB 4JY6B 1ZLSH 4YPJA 1Q72L 1X3DA 4NRYA 3CMGA 4RRPG 3LEYH 3VXMD 3ZE0E 4PLKC 1UWXH 4NKDB 5EU7E 2WW8A 5KSBF 2X4QA 3ZE2E 1RULL 4JFZH 3H9ZA 1KLGB 5EO1B 3T0ED 1EO5A 3AAZA 1ZHBB 1JGVL 1OGAE 2MTPA 2PXYC 1Q9WB 4GAJH 3L3OB 3DX7A 1G6RA 5CCKL 1MCLA 3L7EA 3EO9L 4OM1L 1ZWIA 1BZ9B 5C0AB 4L8CA 5TGBA 2HLAA 3QZWG 3Q2CA 4C54A 4DZBB 3L3IA 4NRXA 3BXNA 3WLWD 3QDGD 4AENA 4P2QE 3HS0A 3V0VA 4OZIA 3LPGA 5FEBA 2AABL 1FL3A 2BRRH 5C09B 1HHJA 3H8NA 1I8KB 1LO4L 1VEOA 4HH9A 4N8VB 1DLHA 1QSFA 4RMUA 3DI2B 4LARH 4X5WA 2PN5A 5D7LE 3QUXB 2BRRL 4HK0B 3CFEA 4BK5A 2DLHA 3LKRB 1F4YL 2CQVA 3MO1A 1I7UB 3QJFA 4BELD 5KVEL 4RDQF 3QCUH 3I50L 1A6WL 3LKOA 3BGMB 1IC4L 3T2NH 3K4DA 4F57H 1VFBB 1FVDA 2C3XA 4I18B 4A6YH 2G60H 4YR6A 3B9VA 1IGCH 3GMPB 3S96A 3RWHB 2V2TA 1UCBL 5EUKB 3Q1SH 5I1HH 3QWQB 1OM3H 5JMRA 5IBTH 3LS4L 3ZHDA 5HYJD 1DL7L 4XMLL 4LP4A 3QWOB 3TWCH 3NIGE 5SX4I 3S98A 2ZSWB 1Q72H 3ARZA 3RDTB 2DWDB 3RTQC 1YY8B 1S7UB 1CGYA 4DGVL 5DFTA 3HN3A 5EUOA 4AG4L 2V17L 2V7HA 4NZUL 2WANA 3OKOA 1URLA 2YWYA 4ELMF 2LE9A 1TZGH 4LEOA 2WIIB 3CLEL 2WWKT 2EH8H 5LGJA 1A6AA 4OT1L 4Z7VB 4UT7H 5ILTH 3M17B 4NQXA 3FMGH 3MA9L 43CAB 5J3HD 1RJYA 3CK0L 5IF0B 2A6IA 4KI5C 4PLOB 4XNYH 3SQOH 2EDDA 3LDBB 4JFYB 4JR9H 1J1PH 3U7AA 4HDIB 2Y06L 3CMOL 5EU6D 4LDOB 4PV8A 4ELME 8FABB 1A02N 4DN4L 2EXWC 4MAYA 4H8WL 4IDLA 4IJ3C 1GHFH 2RGSA 3VH8A 1QBAA 4M93C 5C9KA 4I5BB 4APQD 3V4UH 4PGCB 4KPHL 4LVHB 2JCCB 3CFKB 3O45A 4NYLA 5IBLC 4XBEL 4YUEL 5LBSH 1UC6A 2R1YA 4LAQL 3QUZA 5IK3B 4HWBH 4LSTL 3BW9A 4KVNL 4H1LA 3ARBC 3O81A 3SKNA 1MHHA 4X9HA 1G9NL 4CU8A 3VDBA 4NZJA 1KJ2A 5HI5D 1KCVL 3E0GA 4L3EA 5I73C 1FZOB 2QKIA 1CU4H 3AM8C 3EZ8A 3MGTB 3X12B 5A40E 2X44D 2VLKE 4WWKC 4MNGA 1LP9A 1S3KL 3MV8A 1JCKA 4N5EC 1S9VB 1NKRA 3BN3B 2RFXA 3FFCD 4F7TA 4GBXB 2DLIA 4RA0C 3ARWA 1U3HA 2XKNA 5C2BH 3S88L 4PRNA 3KPRB 2XZQH 3BDXA 1HHHA 1S7WB 4ENEC 2Q1EA 2J7LA 4NN7B 4YHZL 5MENE 4JRWA 1FHGA 5EU5B 3MLUH 2DS4A 5C6WH 5E08H 5DJ0B 5CJOL 4NQCB 4HXBH 1OWWA 4FQ2H 3UTQA 1PKOA 1ND0A 1B0RB 2FJHB 2MFNA 4F9LA 1L7IH 4HUXB 1SYVB 2H3NA 2YMXH 3HNSH 2AJZA 2MMXA 2H8PA 3JV4B 4JZJA 3MROB 4YHPB 1H9VA 1NGYB 1AXTL 4FQPA 2EIEA 4UV7L 4CDGC 1T5XB 5HYSA 4PJHA 3VWJD 5B8CC 2MKLC 3FQNA 5C3TA 5MHSE 2X05A 2I9LA 3RU8H 3SEPA 1HCFX 1EFXD 5TE6H 2NCMA 1PLGL 1AGDA 2ITDB 5EH1A 3TLRA 5EO9B 5DJZA 1U8HA 2FHFA 5MEOB 2IFFH 3TBSB 5HHQB 4JANA 2BNQB 4ZOAA 4BQ8A 2NNAA 1QFHA 4R26L 1MAKA 5F6IC 4LSRL 3LV3B 1R3JA 2I9TB 4PJIE 3U4AA 4LEXH 1A7RH 1KOAA 3DO3A 5KVFL 2AK4E 1N7ML 1XIWA 3O8XD 3VRJB 5CJBA 4PTUA 3QFDA 3L5JA 4LQFL 5GISH 2W59A 3D3VB 2FIKA 4ESKA 3MLYL 5AEAA 4C56B 5DK2A 4HC1H 3VFUA 3BH8B 4TUOA 3MLSH 2UWEA 3PHOB 4LCCC 3O8XC 4D94A 4QHUA 1AO7D 5D2NE 4K7PX 1XCTB 4DN3L 4JY5L 3GMRB 4NO5A 2ZUTA 5E24E 2K1MA 4X7EC 5JW4N 3V4PL 3RX5A 4Z78B 3EHBC 1V3MA 3QA3A 4NQDD 2JJWA 4KHXH 5ITBH 2YPLA 2JKXA 5DEZA 2XZCL 3BDBA 1KG0A 2V9QA 4Y19B 5KN5B 5FGBA 4EIGB 1D5MA 4ZO6A 1FO0L 4YHNA 1YQ2A 2BNQD 1IAKA 1UCTA 4L3CB 5KS9F 5E9DE 1CLOH 1NAMA 2HLFD 4JPWL 4MSWB 2CKBH 2W9DL 4PJDA 4PJ8B 4KVCH 1OB1B 2VXVH 2LQRA 5FOJA 3R4DA 4Q9QH 1AC0A 3U4EA 2VL4A 1UH4A 3WHE1 5BQ7A 5KSBA 4R3SB 3QIUD 2KQMA 4UDTB 5DQJA 1YEGL 1J8HA 3LEXB 4M6OL 1LE9B 3RWGA 1A7QL 5C0IB 5KTEL 3VGGA 1MCDA 3UTSE 1ES0A 3OAUH 4F9LC 2BMKB 2IMMA 2G75A 2YC1B 3HNTL 4U1SA 4PJAB 4F33B 5TQ2H 4M3JA 1PFCA 3LQMA 4RBPH 5C0ND 1NPUA 1IAMA 1PX4A 3Q5TA 4ERSL 4X6EA 2VN7A 3IETB 3P0YH 2NX5E 2X70B 4KY1L 1ZHKB 3C2SA 2GSGA 1MFAL 5GS0H 1IEAB 4JKKA 4PRPD 5T1DH 1RUPL 2D31A 2A1WH 2F8XC 2ZZUT 1HSBA 5H8DA 4XGZA 5JOPD 4NJ9L 5C0BA 3KLAA 3QUYA 3OKOB 5JDSB 5EUOE 1NANH 5C3LD 2BC4A 4RCAA 3HA0A 2BC4B 5CBEB 1QFOA 1LK3L 2R29L 5GGSB 4DZBA 3V5KB 1GGCL 2IMNA 4M9OA 4Z0XB 4UUJB 5T1LD 2E8ZA 2BY3A 2UYLA 4ZSOB 1QFPA 1KTRL 1Y0LB 2VITA 4EDXA 4HBQA 4PP2B 2EDNA 1UT9A 5SV3A 2VITB 1RAMA 2AJ3B 1JGUL 2WINA 4EIZC 5CBAB 4QCIA 1VKXA 1DQQB 4NOFA 2AK1L 3L5WA 3VXUD 2DBLH 4NNXB 5I75C 5EBWB 4Q6IA 2JIXA 3U6RB 4KKCD 4LHUB 1T83C 1UM6L 1RZIA 5EU5A 3JVGA 1F90L 3HI5L 2OTUB 4X0KB 1UM5H 1CGVA 2GSIB 1VFBA 2AEPH 4C83A 1BOGB 2B4CL 3VFRB 1A5FH 1Z3GL 1UB6B 5E2TH 2X89A 1S9KC 3TCXA 5CD5C 2EIZA 1LHZA 3HFMH 3IJSB 4Y1AA 3IVKA 4LRIA 1Q9LB 3ZHLA 2IF7A 2XN9B 2XQYG 5EBGA 5DJCA 5DFVD 1SYSA 2NW3B 4QRRA 3MRPB 5EU6E 4XP4L 1CLOL 4JPWH 1FYTE 4J3VA 4XNUH 4FS0A 3TBSA 1AGBA 3CXHK 2KDGA 4XNXL 3KGRA 5EORL 5FYKE 2AJXL 2YSSB 5E2VL 4NSKA 4BQBA 3QEHA 4X98B 4YZFF 1GYAA 5DUPL 5FA4B 4D0DB 2DD8L 5A43C 1HXMA 3NIFF 3OL2A 4D0DA 4ORZC 4GUPA 4FFZL 4P5TB 1DQJA 1TCRA 2R2CA 1QRKA 4D9LL 5EOTA 3P4NA 3QG6B 2H3NB 3QUKA 1RZJC 4X4XB 1BD2B 2FRGP 4TUOB 4P2OC 3O9WB 3SHSA 3HI1A 2HYMA 2RB8A 4WDIA 5F89A 1YEEL 3KYOB 4H20H 2FYYA 2Y7QA 4I77L 3VA6A 4PJ7F 5BOZG 4Y2DA 5DMYA 3ARBA 3MRIB 1NL0H 4JHAL 2LU7A 1J0JA 4D3CL 4NO0A 3DRQB 1ZE3C 4QXUH 4PRHE 3GKWL 4PJGA 4XAKE 2DJSA 1FRGL 5CP7A 3SJVD 2FX7L 2NNAB 3OKDA 1K4DA 1MCEA 1QLEL 2Y5EA 4PV9B 2ORBL 1K8IB 3HCVA 5EZIH 1IAKB 2OZ4H 1YN6B 5FYLL 3HMWL 5LCVH 5ETUB 1U92A 4XWOC 1G7MA 4K2UL 4ZTOH 1A14H 4FN0A 4FQIH 3JTTA 2AXGB 3QNYB 1WBXB 2FX9H 3MV7E 4R96A 2PYEA 5FDWA 2Y6SD 5EPMB 4OLZH 5KSVB 3O9WD 3LN9A 5KSBB 1NCDH 4LSQL 3I3BA 1FAKT 4MB5A 4EJ1C 4QHUB 4X6CB 4JN2B 1K5NB 4MCYB 1KEGH 2HTLD 1YMMB 3EOBB 4OQTL 3RWGB 5F7DB 1TXKA 4IRJD 4P3DB 3HR5A 5D93C 5FB8B 3GMQA 1UM4H 2CLVA 4YAQB 1K2DB 5IBUB 4HWNA 3PGDA 4L4VE 3PGFL 5T33H 3NH7H 1LO5A 5DRZB 5DUBB 3MLUL 1QBML 3FTGB 1U41A 4YNYB 3FHAA 4NFBA 2X2YA 3NCCB 3FFDA 1QFUL 4R4FL 3B8YA 3VGHA 4JQXC 2GSGB 3B2VH 5DGRA 2VNCA 3QQ9C 4ZUTA 3TP4A 5CJQH 4MVBC 1KJ2B 4F37K 1A4JB 1DE4A 5B3JF 4H0GA 5H2BB 4NKQB 4P57B 3VU2A 1A9BB 2VLKB 4RMQA 4JFDB 4OCXL 5KANG 3L6FA 1A2YA 3IJYB 1F3JA 4TULL 3J7HA 3WLWC 2X4OB 5FYKL 2R2EA 5D2LB 4Z0BL 4LLYA 1J0IA 2UZIH 3EYVA 1HEZB 4OAWB 2EXWD 1FL6B 1D6EA 3BJLA 1X5KA 4KAQH 3EO1B 3WS6C 1T0MB 4JVUA 2ICEB 4P2OA 5J1SC 2N1KA 4POUB 4Y0GA 2YS4A 3MCLH 4EDXB 1NEUA 4Y2DC 1M6OB 4FQCL 4HKXA 3I2CL 4KJWD 1RJZB 3QXDB 4P4KD 4J4PD 5ANME 3ZKXB 4RAUB 2DI9A 1BP3B 1IT9L 1EMTH 1TMCB 2HH0L 8CGTA 1J1PL 4L1HA 2PW2B 3IU4L 1WZ1H 2YHGA 1P4IL 4TVPD 2XNAA 4XMPL 1FDLH 3CLEH 2HRLA 3VD4A 4LVNB 1F3DH 5IESH 3MRHA 4LPTA 5GZND 5HDQL 1C08B 2R0WH 1F4XL 3T3PF 1NDMA 3WV0A 3VXUA 4HK3J 2XWBB 4U1GC 4AIOA 1N64L 2UYLB 4ZSOA 5HGDB 3V52L 2IBZX 4EUPH 3MLZH 3MV9A 2FNBA 3LRSA 1B2WL 1AXSA 1NCTA 1PG7H 1HHHB 1S7WA 5CFHA 3W5MA 4OFKA 5ICZA 1UEYA 2W92A 5INDB 1OB1A 2GW5A 5I18L 3CDYA 5GGRA 3EAKA 3HE6C 2B0SH 3DBXA 5CP3A 4LSSH 3DWTA 4NWUH 2H9GA 5AUMB 4O4YL 1DEDA 3ABZA 5GHWL 2BVEA 2VQTA 3DVIA 3D2UA 3CVHB 2MCPH 1S78C 1F00I 4X6DE 2P7TB 3VXSA 3DECA 3CAFA 5MI0C 2FLBT 2X1OA 5IVNA 2VLME 2V5SA 3EO0A 3QIUB 4X4XA 3KPOB 4KI1A 4PR5B 1XEDA 5FYJD 4PJ9C 4KWUA 1KG0B 4L3AA 5FUZL 5F9WC 3ESUF 1INQB 2WV3A 5KN5A 1FYTD 3VW3L 5ID0B 2C7UA 1T0PB 3TBVA 3O3DA 1TETH 2VDLL 1MLBA 1Z9LA 1CIDA 2GK2A 3BKCL 1CK0H 3ULUH 2Z8VC 5EFIA 1V7NL 3FB6A 1HHGB 4WEMB 3X11B 4XWGL 2VZTA 4XI5C 4X8JB 5H94A 1FGNH 2BOBB 1E4XL 3GZKA 4U1GB 2HKFL 3ALPA 4I3GA 2CDGA 2D7TH 5T3XH 3D39E 4HLJA 3RI5F 3NFPA 3ZTNH 5IB1A 2GI7A 2XTJB 2E6QA 4GMSL 2IADA 4TYUA 1RUMH 4GXUN 4MD4B 4GKOA 4MNQB 3X17A 4QHKJ 3C87A 3OB0K 4TVSa 4D3CH 3PL6C 2OR9H 4YDIH 5JUEH 1T83A 1JTPA 4JHAH 4P4KA 3PQYB 1TETL 3MRRA 1A6PA 3ULVF 2IANA 2YK1H 2YBRB 2OSLB 5KSBE 2P8LB 4ENED 1SY6L 4MB4A 1QQDA 4HV8A 4TNVF 2VABA 4Y19D 4TSAH 4Z7UA 2PR4L 4OZ4A 4MXVF 1D5XB 3TZVA 3CVIH 2P4AB 2Z91B 2VABB 5EWIH 1I85C 1G0DA 4QRUB 4HUVA 4YAQA 1A7OL 2BDNH 4NO2B 1SJEB 3STZA 4OGXL 3L5WB 4PJHF 1XF4B 2FO4A 1ACYL 5DVLA 3IU3A 4EVNB 4JJHA 3LMJL 5T3ZD 1OTSC 3MLTA 5DURD 5GRVK 1RHHA 4ZUWA 2VTFA 3GNML 1IGML 5I6XB 1NLDH 1NFDB 3O11A 1BJ8A 4TUKH 3PQYD 5MEPB 1TJHL 4DWHA 4ODWA 3CH1A 4M1DH 4E0RB 1GPOL 1K9TA 1DBBL 1SM3H 1GCFA 2HJKB 1WITA 3FOLA 4JFDA 1X4XA 3O8XB 5D7SL 3RKDC 4O9HL 3MJGX 5F7FA 4LKXA 1N4XH 2I5YH 1TQBB 3VFNA 1IZKA 2EIDA 4Z0XA 1OAUH 2YXFA 2ATPA 2Q76B 1FV1A 1G7HA 2WZPD 1P4LA 3MRPA 1RHFA 3WLBB 1U3HB 2XKNB 3TN0D 1MF2L 5TFSL 5B39B 1A1NA 4NFDA 2P5EA 2ZUQC 1HQRA 2VB5A 4HWEL 4CN6A 1T4KA 1P4IH 4TSCL 4LPCA 2XICA 1X7QA 5FA3A 3RVVD 2VIRB 2XY2A 1CS6A 3FTGA 1KPUA 5L2JA 4JPIB 4JHWL 1T22A 2BVUA 2BOCB 5FHBH 2VQ1B 4KI5E 1BMGA 4ELMB 3ARXA 1KCLA 1MH5B 2X9WA 3D1MC 5C0CD 5J9PA 5JA8B 2OMBA 4OZFA 4WJ5A 2Z9TA 4M7LL 3EW3B 3SCMA 3UTZA 2KL6A 1PSKL 1TVBA 4Y5VC 1IAII 3VWJA 3SKMB 4YZFE 4GOSA 2J3SA 4XT1C 5C0FA 4ODHL 4Z9KB 4WFFD 1W72B 5BVPL 3KLHC 1IAOA 1UEMA 4M02A 2V5MA 1JNHA 4JVWA 3P11H 3BIBX 4JO1H 3TO2B 2FX8H 1Q0YH 5TGBB 1JK8A 1G7PA 1ZLUK 3O3EB 2VDOL 4PG9A 2DM3A 4HMEA 1MCCA 4WI3A 4LBEB 4FQXB 3MRGA 4CADA 4OGZA 3MLRH 4ZFOL 1MRFL 3KJ6H 3L9RA 3MGOB 2XFXA 5JW4R 5E7FA 12E8L 5F96H 3X13A 4KY1H 3TV3L 1S7SA 3IXTA 4NJAH 3PP4L 3NN8A 1CXFA 1JGDA 4GG8A 2NW2B 4JKLA 3ETBF 4I3RH 1A22B 1F3RB 4HK0A 3CDGB 4MA1B 4X6FA 3P73B 1JUFA 2OTWA 4NO5B 1MVFA 1MIMH 4LCCA 3CFDA 4GRWF 2R8SH 2QQNL 2VDQL 4F7EB 1IKFL 1DZBA 4WU7A 2WUCH 1RMFL 1A6TB 5AZ2H 1Q0XH 1BZ9A 4JFPA 4POYA 4J3OC 3CH8A 4NRXB 3VXUB 3C5SA 1H0DB 5FGBC 3WE6A 1CDIA 3QIBA 7FABL 4G3YL 4KRLB 4YC2C 1FFOB 5D5ME 1NCWH 1MIEL 1RK1B 2VAJA 5L8LB 2EDKA 2D7NA 1M71A 2FB4H 1JRHL 4OD1H 4PS4L 3VXSE 1CFSA 3B2UD 2AXHA 2RHEA 1EXUA 1KEMH 5L7XL 4LEOB 5JORB 3C60C 3VW3H 5JIIA 1KIPB 1QSEB 1YYLH 4JB9L 4S1RL 4PREB 5GGVH 2E7BA 3EYUH 1GSMA 3RDTD 5MEND 3DMMA 5DZLA 3EFDH 5I76B 1KB5H 5K9KA 5ICXA 5E6IC 4RWHA 5HYJB 3ARBB 3MRIA 2A73A 4XZUB 3ARGC 1WAAF 4C57C 4UNVA 4AL8H 1ETZA 4WV1C 5SWZD 3JV6A 3S4SA 4KK5C 3GIVA 1LP9E 1BECA 4DVBA 1LDPH 3MJ8B 1H3GA 1NCBL 3OXRB