2VSCA

Structure of the immunoglobulin-superfamily ectodomain of human cd47
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
115
structure length
115
Chain Sequence
ELLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUKOCYTE SURFACE ANTIGEN CD47
publication title Paired Receptor Specificity Explained by Structures of Signal Regulatory Proteins Alone and Complexed with Cd47.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 19
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vscA01
1VFMA 3KG5A 5E99H 2ADJB 4GW1B 3MUZ1 4ZAKB 1RULL 5AYUH 3WS3A 2Z8RA 2BRRL 4LQFH 4LLVA 5JZ7C 1L7TL 4M61B 5ACZB 4DFHA 5IR1A 1EDQA 4IRJA 3QUMB 3E3QE 3MRJA 3SDXF 3P9MA 5HGBA 5IEHB 4HC1H 1GL4B 1HHHA 4HWBL 3CXHK 2HTKD 1I7TA 1IARB 4P2RB 4NM8L 4KAQH 3T1WA 4OZHF 2X7LB 3B9DA 3MLUH 5MI0B 5E8OA 3MYZA 2R2BB 2UVEA 4HS8L 4EUPG 4M6OL 5HDOA 5LCVL 4JZJB 3W11D 2JIXB 5JIKA 4AT6A 3GSUB 1HKFA 3VMNA 4K7FB 1WZLA 3ARVA 1MNUH 1T7YA 3ZE1F 1DTUA 1WV7T 3F8UB 3TP4A 3GJEA 5L2KB 1Y6NR 2CUIA 1QYGH 2VAAA 2VXVH 1SYSA 2HH0L 2GAZB 4N8CL 3VDCA 2V7HB 2OSLB 5IVXE 1UENA 5KSUA 5DJCB 1AC6A 2ATPA 1V7NH 4M7KL 5B3NA 4L3EB 1OT1A 5CEXB 4GSDH 1UWXK 2PO6D 1A4JA 3IAQA 3HI6L 5C0DB 5DGRA 4HULB 1U2CA 5FO8B 3H3PL 1PZ5B 1SQ2N 4X9IA 1EJOL 1IEBB 5IFAH 3KPMB 4ODBD 4D0CB 4MJIE 3TBTA 4U1IA 3MV8A 1N0XL 1HHIA 2YD2A 2LU7A 4P46C 1U8HB 1RUKL 3B8SA 5AZ2L 4GXVH 1UM6H 4UT9L 3RNQA 3TBWB 3C5JB 3LRGA 2Q6WA 4G7VH 2A77L 2BK8A 3VXSB 5CIPA 5IK3A 1GSMA 1V5JA 5JXAL 4ZS6D 1QFUH 3UTOA 2BY1A 1GVIA 4EDWL 4WI3A 4MXWL 5F1SA 4OLVL 4WFFE 1JI1A 2PW2B 5EU4B 5IBTL 5CZVL 3CUPA 2W9EL 1G9EA 1EZVY 1F11A 3WLBB 5DQ9A 1MHHB 4XVTH 2BSSB 1RIUL 3FRUB 3WCYA 3S96A 1R0AL 3MLZH 3HNSL 4XP9H 4G7YL 3WMSA 5JR1H 2ICEB 1AO7D 4PJBB 4YGVB 3V6OC 3MXWH 4DZBA 4GBXA 4U6XB 4RFNC 4Y4FA 1YMMB 1QLEL 4YPGB 1D5MB 1WSST 4KZDH 1GPOL 2FX9H 1TJIH 1OOAA 5C2UB 4L9LC 4Q9BA 1G7MA 2XWTA 3DRQB 2VITA 3FO1B 3VWKD 1CXEA 1A7RL 4OLXH 4PREA 5D96C 1F4XL 4MNGE 2Q20A 2WLYA 2XG4A 4FABH 2GSIB 3VXOA 5KVFL 4LCUB 2HLAB 4M7LT 4JKKA 3QSKB 3RPIB 1QVOA 3SDCC 3LKQA 4WTZA 2W65A 1VGEL 3GRWA 5E6IA 4DJMA 5BMFL 4I0PC 5JW4R 5INCB 1J8HA 3MRGA 1E27A 1JWUA 4P9HH 1F6AB 1S5IL 2AK1H 3QIWB 2LE9A 4IRZL 5K9OB 4QRPD 3VW3L 3S4SB 1DN2A 3V8CA 5B38A 5JW4Q 2BNQB 4LARH 3IJSA 3FO0H 1KCRL 1KGCD 4HT1L 4RISH 1EEZA 6CGTA 5LQBH 4ISVA 1INQB 3D85A 2R2HB 5I1IL 2A9NL 4X9FA 5C0BB 3K8MA 4YXLH 3MJ7A 3MREA 3DURB 5DR5H 2X4NA 2VH5L 1T1ZB 1A9EA 1N26A 4QRUA 1OSZA 1YY9C 2ARJA 1DBKH 1OAXH 4ZTPL 1BM3L 3FQUB 4LCCB 4YK4C 1V8HA 1A6TA 1CWVA 3U9UA 2VZVA 2IQ9H 2IH1A 1J8KA 5HTSA 1DQDH 3MCLH 4MNQD 2FH6A 4F7TA 1I7ZA 5GRWA 3TZVA 2YA1A 4PJDB 3TN0A 2CDGA 1RJZB 2NY0D 3HG1A 1ZLVK 4XPBH 3MLVH 3UROR 5FYJL 5E94B 3PNWB 4UV7L 2OL3H 4XPTL 2NW3B 4C56D 2IG2H 4OQTA 2F9BT 5E7BA 2DQEH 1YEKL 4NZUH 2Z92A 4ENEC 1UXSB 1CDUA 2C1OA 4ERSL 3CFJA 1MFAH 4M7ZC 1DZBA 3QHFL 4OV6F 4X7SL 5H35A 3B3IA 4LLYA 4JHWL 4M6NH 4WFED 3V6FA 4FNLL 5DYOA 2CPCA 2R39A 1NSNH 2H2SC 5E8EB 4HZLA 43CAA 4YHYB 1PYWA 4MQXD 4P5MA 3QUKB 1MRDH 4Q58C 2CSPA 2MHAB 2NY3D 3S35X 5DUBB 1RUQH 2OR8A 3IJYB 3KJ4C 1U8QA 1MFEL 4P3CL 2WV3A 3CDGB 2LU4A 4Z7WF 1JHTA 5EN2A 4YFEA 1FH5L 3RZWA 4U0QB 3SKUD 4FQ1H 4G6KL 4XNXL 4WNQB 3TO4A 2B1AL 1JNHB 2PO6B 4JO2H 2D31A 1QTYT 2H9GA 4N0UA 4S2SB 1CT8A 5JHDA 1ND0B 3NFNB 3LHPH 2D7TH 1AIFA 2EDBA 1TZIA 2HLFD 5D7JA 4OGXL 1A7PH 1QEWB 1KXQE 2Z0BA 2OTPA 4KRPC 1DFBH 5D70L 5JOFA 4RWYH 3OB8A 1HQ4B 4WWID 4PJXB 5DQJA 4QY8B 4UQ3A 4A6YH 5D1ZA 1LGVA 2J8UA 3KVQA 3GRWL 3T8XA 3B4NA 4L8DA 3HMWH 4Q6YA 4P2YA 5DD1L 5ALBL 2AXFA 1P5VA 3KPSD 1KTRL 1S5HA 3A67L 1IM9A 1ZK9A 1SEBA 2LQRA 4ZODA 1NKOA 1CD1B 1AO7B 4X7TA 1LP9F 4W6XB 5J12C 5CGMA 2FJGB 1F42A 4M9OA 1G1CA 1FVEA 5GGRY 1KELH 4QWWD 2A6JB 3L5XL 2A38A 1VFBB 1OARH 1FSKB 4Z8FH 2J7LA 4OZGF 4DGIH 4KKCC 4U7MA 1TENA 2DBLH 2X4PB 3ZYOA 3BPCA 1XZ0A 4QRTB 5GSVB 1P4IH 3RAJH 1ZMYA 3G5XB 5T1MB 4DW2H 2WUBL 1Z9LA 2XKSA 4HH8A 5F72S 1YJDC 2COQA 4MNQE 1C5CL 4E0RB 1NFDE 4UAOC 4AEEA 5I74B 3L9RB 3RIAF 3AGVA 4Z7VF 4XCYA 2G60L 2YZ1A 2WIMA 4KV5E 4P4KC 1CLZH 1NC2D 2Z9TA 4LSUL 4QRPB 1KLUA 3P4NB 4KI5F 5FK9A 5I2IA 4C56E 3MNVA 2IANA 1B4JL 3S98A 5CEZL 2E9WA 1I3GH 5F7DA 1IT9H 5CJOL 2V9RA 3MOAL 3MRLA 5HHMD 4RAVA 2FZ3B 4N8VG 3BQUA 2CDFB 4MD4A 4OQTL 4OCRL 2H26A 1TCMA 1LEGA 1MY5A 3OJDB 3ARGD 1N3NA 3F7QA 5SV4A 1OAZH 2QR0B 2MSPA 35C8H 1RJYB 3FQTB 1XFPA 3R4DA 5SWSA 5T5FL 2JELL 3SE8L 5LWYL 4U4BA 1I1AC 3D39E 5IB5B 3RIFK 2NQCA 5E2TH 1KLGA 3PG2A 1U8KB 4PBVC 4R7NB 1FCGA 3BMVA 4Z77B 2KZWA 2EIZB 1J9CT 2L4OA 4MNQB 3U4EA 4JKLA 1CFSA 3LQZB 2VLME 1DQQB 5EU6D 4J12A 2Y7QA 4RWHA 1CK0L 4RMQA 4O5LL 3VXNA 5E1AB 2NY0B 4EXPX 1HXYA 3HAEB 2EICA 5AAMA 5SV3A 3TBSA 3DECA 5CKAA 1JP5A 4DN3H 5TQ0H 4C56B 5F1NB 2D9CA 2Z8SA 1N8ZB 4H1LH 1P4BH 4HQQH 3RGHA 3PDOB 4XZUA 5ID1A 5TE4H 3MZTA 1KF9B 3L6FA 5GJSH 3TC9A 1I9JH 4QXTB 1U92A 1K4CB 2AEWA 4JM2D 5GGTL 1YEGL 1LEIA 2OR9L 2HFEA 2LV4A 1NAKH 1FYTE 3GI9L 5E56A 1TTGA 5AUMA 1H5BB 4LSTL 5FDYA 4X4ZA 5HHVH 2NY3B 2GFBB 3BH9A 4F7CB 2EXWC 3BRDA 3K2UH 4HDIB 4XGZA 1AE6H 3FKUS 5JZ7D 3IFNH 4ZUUA 1RI8A 4P57A 1YNKL 5I73B 1RUPL 1J1XH 1L0QA 5F1IA 3QHZL 2ADIB 3S34H 3LKSA 4HEME 2NY6C 3SGDH 3GJFA 3O4LE 3DMMC 4D0BB 5D1XC 2Z31D 1DP0A 2A6DB 5DMJB 1L9MA 3Q48A 4NN7C 2XT1B 1EO8L 4WEBH 5TPWL 4UUJB 2A1WL 4XAWL 3WHXA 5FO7A 1UJ3C 5DJXA 3TO2A 1ORQB 1I8LC 1VPOH 3CXHJ 2W60A 4X4YA 4R0LC 5KS9A 4HEPG 5ISZE 4F9PC 1URLA 2B8OT 5F3BB 1IAKA 1SMOA 4Y5YB 3HZKB 2O93L 5E8NB 5I1GL 1JZ2A 5EOTB 1IAIM 1PG7X 2VKXA 2VDMH 2VDQL 5KSAC 1NQBA 3CFKB 4MJ6B 4PJ8C 3BRFA 5DHYB 1YEEH 3O45B 3FQXA 4JPIA 4YO0A 3VGFA 2DLIA 5IEKB 5LGJB 3KPSB 3RL2A 2AAVA 5GGQH 5DUPH 3BJ91 3LQAH 3LRSA 3HFMH 4K23L 4XHQA 3PWUB 4Z7QF 4D3CH 5DEFA 3UTTD 2W0KA 4R7DA 4H25B 4NC0B 5KAQF 2R0LL 1GRWA 3BX7C 4GQ9L 2RIKA 4Y5XA 3I84A 2UWEB 3C09C 2VLJA 4JPKL 5FGCE 3HC0B 5I1DB 5C0GA 3BZEA 4L3AA 1XF5A 1KB5L 4JDZB 5E4EB 2MQ0A 5F9WC 1JFQL 2AJ3A 3IETB 1K85A 1WBYA 1LO5A 1DSFH 3GIZH 1F3DJ 4YHNB 3DV6A 1P53A 1OGTA 4OCXH 4CKVX 4IEFB 2R8SH 5EZLB 1IGMH 2SEBB 5EU6E 4PV9B 4JFFD 1OPGH 2F5AL 4YR6B 1E4XL 3FRPA 2Q1EA 4OLUH 2ZUQB 3QUMH 4XNZB 3QZWG 4KTDH 4W68A 2MCPL 4OLYH 1NC2B 2BXYA 3WNOA 3ARWA 4YDKL 4KK8C 4CMMB 4FG6C 4K8RL 2W9DL 5HHMB 3OKYA 2GI7A 4JY5H 1A2YB 1A47A 4S1SL 5I8OH 5JXEC 2NPLX 2GSGB 4JANB 4GMTL 1PBYA 3RFZC 3ARGB 4TNWK 2EYTA 3ZLQC 3WNLA 3VI3F 1S7WB 4CDHA 5AZEL 2YK1H 4PJHB 5DXWA 5ESAB 3SDCD 3VH8B 3U7YL 4K3DH 1QG3A 2D3VA 4K3EH 4RGOL 1G7QB 3SCMD 4I0PD 3VFSB 2WBKA 1RAMA 5DTFB 1R5VB 1IILE 3CFEB 3WN5B 3BE1H 3MV11 5GRJL 3C5ZD 5L9DH 5IFHH 3K81A 3L1OL 1I3RB 3WYRA 3NZHH 4GLRI 3BPOB 8CGTA 5EU6B 4C57C 5IOPB 4KI5C 1KTKE 2EKSB 1VGKB 4MCYB 3FT3A 1QSEA 2VZTA 1INEL 1RFDL 5IB1A 1XR8A 1GGUA 1CN4A 5C08A 4PB9L 4PP1C 4EXKA 3BKJH 4H8WL 4YH6A 4QHKI 4EVNB 2KQNA 4CVUA 1IGYB 5CP3A 5GS1B 3GK8L 3N85H 4LHUB 4NGHH 1I3VA 4JM2B 3ULUF 4R4NC 1UXWB 1YY9D 1WBXB 4JFYA 2GTWA 3NPSB 4ELMA 3OKEA 4RMSA 2OS7A 1ETZB 3WS6A 4HLZH 4GKZB 4UOW1 2R1WB 4Z95L 5HHOD 3ZKSD 2QQLL 4ORGA 3WFDL 5FM4A 2AKRB 4OSUH 1HINH 2E6JA 3L5JA 4GW4B 3VXRE 3UTPD 4ZFFA 3B2UC 3QJHB 4I4WB 2HVKA 3GEWB 3U0PB 1OGAE 5HI5C 5ETUB 4PRPE 1M71A 3EJZD 4WWKC 1T89C 4U1NA 1H3WM 2XYCA 1JNLL 4P59H 5F7UA 4BSVA 1I9IL 3ROLA 1UWEH 2Z31B 2D0HA 3A6CH 3X3GL 3HE6D 5KTEL 1G7HB 1LE9A 2EO1A 2FYYA 4ENED 1VFOA 2V9TA 2OP4L 1R3IH 3LN4A 3P3YA 5DRWA 1I7RB 3MACL 4HUNB 4XP6L 4IRJC 4HIJB 2H2SD 1AFVL 4I0KA 5IMLA 1YY8B 3U83A 4DTGH 1ACYH 4YC2C 5CGTA 1MVFA 1P7KB 2ZUYA 3RHWF 1E6OL 1KTDB 3P2TA 4PGBA 1M6OB 1JI2A 3OKDB 3ARDA 3VXUD 1V7MH 5BXFA 5EA0H 2EDXA 2PETA 4V2BA 1BJ1H 5DFVC 1F4HA 1S3KL 4J3VA 2RBLA 5ESVB 2VUOA 2YD9A 4KKBD 3V6OE 5T3XL 3BN9C 3D3VD 1XGQA 1WJ3A 3WNPA 3A6OA 1BFSA 3D6GA 4S1DC 3K4AA 4JFPA 3WUWB 4ZMAT 4YQXH 2ADGB 4JFXB 2J8UF 3QFJA 3FOLA 5DJ8A 4DZ8B 3UTTB 4XB8A 4PJGB 1I8KB 4OGAC 4PRNA 1FP5A 4Z7OF 2ERJC 3VMPA 1AXIB 3CLFH 3PXHA 4XWGH 5IROA 2CIIA 2F54A 4NN5B 4KRPD 3FB6A 2X9WA 4N0CD 5HDLA 4MGXA 1H15A 3V52L 4CVXB 1JHKH 5FV2A 4MDIB 4TRPH 5D2NE 4L1HA 3MRQB 1I1FA 3QDGE 4N90E 4UIKH 5GSRA 4PY7B 1DQTA 4I3SH 5BVPL 3WXVL 4G6FD 5J11B 1GZPA 4JFFB 5C09D 3EYUL 5EOQH 3IDNB 4Y2DA 5J89A 5IHBA 2XWJB 3QCVL 2ED8A 4LIQH 4LEOA 3BEWA 1HZHL 4XVJH 1S7TB 2BHZA 4NQDA 4RFNB 5T1DH 3IFLL 5BV7B 1AI1H 1BJ8A 4G3YH 1U6AL 4KKCD 1C16B 4N5UA 4AM0A 5HHXL 1Q9LB 4L9LB 4OCYL 3GMQA 4K7PY 3SDYL 2XPGB 3M1BA 4IMKA 4WUKL 4F57L 1NLBL 3FOMB 5D96B 3CZFB 4R3SA 1KTLA 3ARYA 3DUUA 3PWLB 5D7KD 5DFWH 5FOBA 4APQA 1ERNA 2DTML 2W0FB 2CK0L 1FVDA 4GBXC 5ABDE 5J13C 4HPOL 5KSBB 3B2VL 3SDCB 5EIIB 2Y5TB 1AGCB 1XGYL 1UZ6E 4P9ML 3SCMB 3ROOA 4I0PB 1KEMH 3LN9A 3DVGB 1L0XA 4R4BB 2I5YL 4JREC 2FEEL 3QDJA 4P4KD 3C5ZB 4H5SA 3PWPE 1KPUB 4Z76A 4LASL 4B50A 1TQCB 5ID0A 2DDQH 3G6AA 4XNUH 4XPHH 4BFEA 1AGFB 1J1PL 3MLSL 4HFWA 3TPKA 1UYWL 1NDMA 2OCFD 3K3QA 1TQBC 5L6YH 3RWDB 4O9HL 5E6IC 1TVBA 5CLWA 1GIGL 4U1JB 1P2CB 3L3OB 2VLLA 1N6VA 4MWFB 4XP4L 2QV2A 5D5MA 2BCKA 3G5VB 4BKLA 3NMEA 1I1AD 4WO4A 4XBPA 2O61A 3UTSA 5I1KL 1JPTH 4YK4B 5L2JA 1A7OL 1ZWIB 2VIRA 5HHOB 3D3VE 3SDXE 3RX5A 1DQMH 2EH7L 4PJ7B 5IWLC 2Z8WC 4LSPH 4MZ3A 4KZEH 4H1LG 1IM3A 3CH1B 3GGWA 5DRNB 1LO4H 4TUJB 5J8OA 1NCNA 2Q76B 1MRFL 4J3WA 4OZHE 1F90H 1ZHBA 2VWEC 4HJ0C 5I0DA 4R90H 3BESR 4JO1H 4KKNA 4BFGA 2FO4A 3HE6B 2DQJH 2WQ8A 3D9AL 2FJFA 3DI2B 4HJJH 4M7ZB 4JO4H 3ZE1E 3O2WL 5IGXH 3TZVC 4NFBA 1BFOA 2K7QA 3FB8B 2RB8A 4MA7L 3TN0C 3EDKA 3QXAB 3O11A 3ULUC 2ZUUA 2CKBA 4GG6B 5TDOB 5GHWL 1MFNA 4QRRA 3GM0A 4QTHA 3LQMA 2AV7B 5GZND 3VXUB 4G9FE 4Q9RL 2EYSB 2X4TA 3TLRA 2EE2A 3VI4F 1QHPA 2IQAA 1HXMA 5EZJA 1ZGLP 4NUJA 2HYMA 3BT2H 1U8LA 3D3VB 3SDXB 3DMMD 5KS9F 5D1XD 5FM5O 1YN7B 4OZIB 4KDVA 1JMZA 3LDBC 1SY6A 2EE6A 1B88A 2Q8BH 2CGRH 3I02A 5B39G 3LPGA 2WNGA 5J6HA 3JWDL 5HGAB 4NQSA 1XGTA 1UA6L 4CMHC 1K8DA 5D7KE 3ZTJH 5SX5H 1DL7L 1S78C 4KRPB 3TO4C 3FFCD 1AQDB 2EDFA 3TH4T 5FECA 5FEBA 1UKSA 1VCAA 3AY4A 4ZTOL 1KENL 4GS7C 1JPGB 3PWJA 1T7ZA 2ITCA 3FO9A 5JQ6L 3GB7B 1KG0A 4JR9L 3D25B 4DKEH 4N9OB 3T3MF 2F19L 5KSAD 2HKFH 4PJ8D 3GSXA 3MNWB 4G6FB 3HE7A 1LEKB 3P9LA 5C09B 4H20H 5D7JC 3EYVA 4PJ5D 3U6RA 2NY7L 4LDOB 4RIRB 4WIQA 2E7BA 5ICYA 4CNIB 5HVHC 3IFOA 5EUKA 1AJ7L 3HAEH 2Y07L 1CFVL 2VQ1B 3OMZA 2X4RB 5DRXB 5D1ZC 3H7BA 5EBWA 4LSSH 3MFGB 4F7PB 5L7XL 4D9LH 1N59B 4XCEA 4M9PA 2V7NA 4U1KA 3TV3L 4OLZL 3GSWA 3JTSA 2ZG2A 5D7SL 3MRBA 2AEQL 3EYQC 5C0EA 1KEGH 12E8L 1QRNE 2BNUB 4V1DE 5KVDH 1VFAB 4NDMA 1OQOA 4JJ5B 4OFYD 1M4KA 2MFNA 3ARFA 1S9XA 4QHKJ 2HT3C 2ILLA 4JKWA 3VFNA 4AIZB 3QQ4B 5I76B 4LLAA 5I8KL 1IC7L 3EOTH 5DK2B 4HIEB 3VFMA 1FNEA 5ADPL 2GUOA 4HUVA 3A6BH 5FYLL 4NNXB 4OF3A 3UBXB 4P4KB 2VQTA 5HYSA 4FQLL 4P2QD 2GT9A 4S11A 4KK8D 3VA2C 5JQHC 1AC0A 2FO1A 2Z93B 4FG6D 1P7QD 3W9EB 4JFDE 4HBCH 1JF1A 5JW3H 1BQUA 1ZHKA 2ICES 4U05A 4ETQA 5EZIH 3BISA 3IDJB 2I27N 5FO9A 4D9RD 4PJFF 1W8OA 1T04A 3IDGB 3O6ML 4EKXA 3VRJA 2HT4C 2CKBL 5C92A 3MRRA 5CD5D 4AENB 1I1AB 2WIIA 3FQWB 1WCBA 3WL9A 3FFDB 3QH3B 3S97C 2X4UA 3BQUC 2M2DA 4NZTH 1A5FH 3JV6B 1KCVL 4JLRB 5EPMA 2N7AA 4MNHA 3GO1L 1MF2L 3UYRL 3DPBA 4QHLB 4KI5D 5T3ZE 3QXVA 1DLFL 3T4AA 3OWEA 4G8FA 1SJHA 1NC4D 1H9VA 4ELMF 4FFVC 1ORSA 5E7FA 4KHTL 1SY6L 1BMGA 4RNRB 1HSAA 3ULVL 2PW1A 1M7DB 3PGFH 1EUTA 3MUHL 4HLZG 5JOPE 4NM4L 2X2YA 3VE0A 1U8NA 4H88H 2X89D 1CDJA 1OY3B 2HJKA 4CVZB 3MNZB 3PP4L 5I16B 2VE6B 2CLRB 2F15A 4HF5L 1G7IA 4NKIL 1JNNH 5KVMC 5KG9B 1Q94B 5MEND 1XCTB 4Z7WE 2ZCLL 4K8RC 1ZSDA 1MCOH 5ADOH 5JUEL 3NABL 5C8JA 3OXSB 3B2UD 4LCYA 4I2XA 2ZSWB 3FL7A 5FYKL 1JGDB 2IGFL 1H3PL 4M5YH 7CGTA 4O4YL 1G6RB 3OZ9H 5HI5D 1CQYA 4YWGH 2F58H 3MV9D 4WWKD 1CFTB 3S37L 4Y5VA 9CGTA 3RTQA 1I3UA 3BXNA 3DMMB 5D1XB 4ONGL 4KRNA 1DBAL 3VD5A 4NN7B 5E00B 5J9PA 3MV7A 2VQUA 5GGRA 2V5SA 1KPVB 1MCPL 4NBXB 3BMWA 4UTAL 15C8L 3HMXL 3OTTA 8FABA 1IE5A 3DV4B 3H3KA 1LO0L 3DYPA 4IRJD 3BGMA 3PWVB 4NRXB 5K59F 1P1ZA 1MJ7L 2A6IA 4R0LB 1KCLA 3TNNB 4MQTB 3FFCB 5HGGS 5IHUL 1PEZA 1YEJH 3S4SG 2A0LC 2J5LB 4JPVH 4Q6IA 1XF3A 1RZKC 3FQRB 4N5EC 2IH3A 2XNAB 3CDCA 5DFVD 3WSQL 1KACB 2IFFL 3PDGA 4H8WC 5DJ2B 5KSAB 3EYSL 3F7YB 1T6VN 1KCUL 4PJ8B 1LP9E 3BN9D 4Z7WB 1MI5A 3HNTL 4K9EH 4HV8A 4L4JA 4PJ5B 4S1DD 1WLHA 3V6ZA 2P5EE 4OZGE 3V2AR 3EJYC 1HHGA 1TPXC 3QPXH 1R3HB 1IQWL 4OGAD 5MEPA 1QNZH 4DKAA 1I7UB 3BZ4A 3I50L 5J06A 4J8RB 1XGUB 2H1PL 4NUGH 3C09B 3SQOH 3IDUA 1T4KB 3WDJA 2PTTA 1MCRA 1VACA 4PBXA 5FYJD 3FCTB 4BSJA 1NGXA 4DVRL 5IJVA 1INDL 4ONOA 5BJTA 3MV8D 1I1CA 2AJYL 4HPYH 4F8QA 1FZOA 4UT6L 4PRBB 1YECL 1NJ9B 4OKVA 4KI5E 4A2MA 4BQBA 1CFBA 4DUWA 1CGSL 1SVCP 4Y5XC 2NY5L 1S7XB 2ZNXA 1TJGH 2DLFL 1M05B 4JDVA 1HH9A 2DYPD 2A74B 4P5TA 3IDMA 3ZDZE 5DD3H 4P2QB 1JVKA 4HFUL 3Q6GL 1FAIH 4LGSB 4R8WH 2H3NA 1P7QB 4QXUL 2DQUL 5TH2A 1UACH 32C2A 3HNVL 1YNTB 2RHEA 1NCDL 2E9IA 3HPLB 1RMFH 3MLPA 4OD1L 3DX7B 1SHMA 1KXTB 1MWAA 1A6PA 2DQDL 4UT7L 2EDYA 3QG6B 2QLVB 3SE9L 3MLRL 4WHTB 1IL1B 2ZG3A 3ZTNL 4WI8A 1RHHA 4GBXD 4GXUN 4TSCH 1EBPA 4OAWA 4YDIL 5HHPB 3IS1X 1AQKH 2YWZA 2RCSL 3UPAA 2ADFH 2IADA 2RFXB 4P3WA 4YXHL 4KJWC 4Z7VB 3KHQA 3NCBB 3LOWA 4JRYA 3Q1SH 4X80L 3T1FB 2C4FT 4PYHA 3RWFB 2EDKA 4FFZL 5D5MF 5E5RB 4U6HA 1QBMH 1FBIH 3G04A 2GJ6D 4AYFA 1XGRA 1NC4B 1QLFA 3KJ6H 5HVFB 5E6ID 2P8LA 5C0RH 4E5XB 4ZG1A 1J8HD 3ECBA 5TDPA 5GGSB 2HA1A 2YR3A 4U1HB 4G8EA 5KW9H 4WU5B 3TESA 4AEIL 2R1XB 1U8IA 2FJHB 1N7ML 4LRIA 1A3RH 2WP3T 2DLEA 2YXFA 3MRFB 4E41A 4KY1L 1GOGA 4M6ML 4JRXA 5MENB 3B9AA 3D85D 2EDQA 4WFGE 2YD1A 1WZ1H 3VGBA 3FN0H 4NC1C 1LMKA 3EO9H 3UAJC 1QBBA 1ZVHA 1HNGA 1WF5A 2QL1A 3MV9B 3G6DL 4WWKB 3GMRA 4HJ0D 1LWRA 5BV7H 3HZVB 1EHLH 4KRLB 1CLOH 3WS6C 4M8QA 4P4RB 5CJXA 1FGNH 1LNUB 3Q3GA 4PJCB 5C0JB 4K3JL 3RGVA 3WS3B 1S7VB 4LLVB 3U9PL 4OQ1A 3TJEL 3DSFL 3TN0D 5IR1B 2O5XH 4IRJB 3D0LB 5IB3A 1IBGH 4GKNA 1QKZH 3MRJB 5CEZD 1RK0B 3MV8E 3P0VH 3P9MB 5HGBB 4I3GA 2VLRA 2Y06H 4YC2B 5HYJE 3O9WA 5BOPA 1B4RA 5DA4A 4YE4H 5CSZA 2EYRA 3TBVB 1HHHB 2DIAA 4HKBB 5IMKB 2D7QA 4XMPL 1RZ8B 3JZ7A 3EGSA 3F58L 1CBVH 1S9YA 4HBQA 3IXTB 1IVLA 4E42A 1KIRA 5DD6A 4Z7QE 1R3LA 3LB6C 3U48A 3MXVL 5E8PB 3VFTB 2GITB 3ZHLA 5TGBA 4DN4H 1BJMA 2J88L 4NSKA 5JLZA 2VL4A 4L8CB 3WIHH 4NQXA 4ZPVA 3FHAA 1SYSB 2BVQA 2PXYA 5I1HH 3PABA 3ZT7A 3GHBH 5L88H 2ERJB 3TWCL 3BKYL 3DETC 3KDMB 1W72A 4LVEA 4U2YA 3UJIL 4YHZH 2A83A 3BO8A 3TO4D 1KN4L 5DMGC 5CD3A 1A4JB 1K8IB 1OT2A 4WEMB 1IGCH 1NFKA 3SGDI 5J6GA 5ESQA 1OF2A 3FB7A 3MGTA 5F7EL 3HAEG 4U1IB 3MV8B 4NP4L 4O51A 1HHIB 3VFPA 5IVXA 1U8PB 3B9KB 1FIEA 2VAJA 5D7JD 3VWJD 3RNQB 4PIRF 5IROC 3IXAB 3KPNB 4GAJH 1ES0B 1YPZB 5CIPB 3ORJA 1RUMH 2DYPB 1LDPH 4QHMA 5H37G 1A0QH 2C3VA 2BFVL 4B41A 2XI9A 4M5ZH 1AD9A 4UDUB 2ZOKA 4JEGB 1Z3GH 5D1ZD 1AH1A 1GYAA 2UZIL 4MJIA 3RJQB 3VCLA 3CUPB 4PRID 3KLSA 4NKDA 4UB0H 2HKHL 3NA4A 4XXDA 5TFSH 3RVVD 3VI3E 5ERWA 4I77L 1DUZA 1GGCL 3EYQD 4NWUH 5EH1A 1IM9D 1FNSH 2R2CA 1B0GA 4DOHB 3EDDA 4MA3A 3O3BB 2ZJSL 1DANU 3X14A 4ZOCA 5D4QA 2HT3D 1FL6B 4DZBB 4GBXB 5J13B 5DLML 4PJ9A 3GSQA 3BW9A 3JWDC 3I3DA 1XF2A 2UUDK 4FQIL 2VZ1A 1EMTH 4O02H 2DQTH 2IWGA 4G6JL 4JREB 3VXMA 3O4OC 1G7MB 2VWEE 3QHTC 4TSAL 3EOBA 4KWUA 1PLGL 4PREB 1QZ1A 1S9VB 5DK0A 4H0GA 4HXAH 3VXOB 1U8OA 4APQC 1T22B 2GJ6B 1FZMA 3UZEA 1J1OH 4LU5H 1E6JH 2YN3A 4OJFL 1QVOB 1BP3B 2W65B 1C5BL 4XCNA 1MCWW 2BSRA 5E6IB 2GK2A 1B0RA 1NCWH 3QO1A 3QXDB 2WAHA 4P23A 3ULUE 3QUYA 3HG1E 1J8HB 5CEZE 3VGGA 5EO1B 2QQQA 4IIQB 4ZUTB 3K1DA 2HT4D 3KR3H 4MNGA 2IAND 5B38B 3ZDXF 4G80A 5I1EH 4XPAH 3IJSB 3RVUC 4ZPTB 5BVJA 4JZOA 3LS5H 3SKNB 1D3CA 2EC9U 5CJQL 4F33B 2FIKA 3QUXA 3BQUD 1EEZB 1UJTA 3BYTA 3FB5B 4ISVB 2P49B 5CILL 2EDDA 3K2MC 3D85B 4Z78B 3S5LA 4N1HB 1Q1JL 4NZDA 3MJ7B 3MREB 2X4NB 1JYVA 1DE4A 4FFVD 4P2OC 4QRUB 1G0XA 2DOCA 4WV1C 3V5KA 3EYOA 4WO4C 4PG9A 3CLEH 4FQ2L 3VXPB 3PQYA 3REWB 2G5RA 3U9UB 2FB4L 2IH1B 2YMXH 1FHGA 3HLAA 3GUTA 4F7TB 5EIQA 3MOQA 1L0YA 5JHDE 1UEMA 3X12A 3TN0B 4ZSOB 2CDGB 4KPHL 4GRMA 4S10A 4KTYA 5B4MC 3W5MA 4K8RD 5EUOA 1DUYA 3P30L 1F5WA 3HC3L 4PUBL 5ICXA 5FUCC 2Z92B 2C1OB 1L7IH 4QHUB 1CE1H 5DDHB 4ODTL 2H45A 1P9MA 2ICWJ 3H7LA 1A6AB 5H35B 2YKLL 3B3IB 4LLYB 3V6FB 2J8UE 2JTDA 3LEYH 5DYOB 4HZLB 2E7MA 43CAB 4X5XA 1UT9A 3TIEA 2B2XH 1PYWB 2R29H 3AREC 4Z7OE 3LDBB 1UC6A 4BZ1L 3C08H 4M1DL 1U8QB 4PLKC 2BVOA 4S0TD 4XCFL 4W81A 4ODVH 4JQXA 4CMHB 3C6LB 1LK3H 1MREH 3BP6B 4MAUL 1JHTB 2IAMA 2H41A 4NC2B 3X13B 1IC1A 3TO4B 1MAMH 3P9WB 2A0LD 2D31B 1Y18A 4CN4A 2H9GB 2VLKA 4N0UB 1CT8B 4N5ED 2A73B 1B0WA 5CWSA 1ZTXH 1TVHA 3E8UH 3QA3A 3ULVC 3T0DA 1F3JA 2AK4A 3NIFF 4GG8A 5A2FA 5DT1H 1OAUL 4R96A 2YRZA 5D7JB 3VWJB 3WEXA 5HVHB 3IT8D 3RY4A 1QSFB 2E8YA 2E7CA 5CJBA 5JOFB 1EO7A 1CIUA 3UJTH 3AY4C 3GSOA 5DQJB 5EULV 1T03L 4UQ3B 4XHJC 4TNVF 5D1ZB 1X5YA 4ZO9A 5ANMA 2P45B 1RU9H 3NCJL 3T8XB 2P5WA 3KPTA 4L8DB 4PRIB 3ES6B 4KI1A 2IANE 4LEXH 3AS0A 3HE7C 4Y2OA 4JFZH 2AXFB 3ZE2F 1NCCH 1S5HB 1CDYA 4LKCA 1IM9B 1SEBB 2WK2A 1MVUA 2F5BL 3VXTA 4X7TB 3STLA 4I1NB 3AU1A 3DVIA 1FVEB 4FN0A 4NHUA 5FA3A 5E2WL 5JNYA 3VD4A 4ALAH 4ZS7L 1FFNA 1WVZA 5JMOC 4PLJC 5K9JH 3LKPA 3T2NL 4QXWA 2VLJD 2ORBH 1FNGB 5SWSE 1XZ0B 3THMH 4XAKD 3QFDB 1D5ZA 3AAZB 3QEQA 4UOJA 4TPRL 4FHBD 2ZPKL 5ITBH 2CMRL 3ARFC 1RZJH 5I15L 3T4YB 1J12A 1F8TH 3CX5K 4Y19E 3L3HA 1NGPL 5IW6B 4QF1A 4XCYB 5T3XD 2EDWA 3UP1A 2HJFA 5I19H 4I0CC 4XMLH 1FDLL 3IDXL 2FX8H 1U58A 1KLUB 4LF3A 1QD0A 1NBVL 3MNVB 2IANB 4M1GH 4PP2A 2CIKA 3WUWG 3R8QA 1OP3H 1EEUA 3GKZA 3H9SE 2GCYB 3IS0X 3BQUB 4MD4B 3VG9C 5FA4A 2QSCL 4BFBD 1PY9A 1LEGB 4OUUA 2MWCA 4S1RL 5C9JA 5CBAA 1N3NB 3ZYZA 1CTNA 1KB5B 5D71H 1W0WA 4N8VA 1JWSA 3CFCH 1KCKA 3MCKA 4LAJH 1H0DA 3KLAA 2FWOA 5I8CA 1R3JA 4C58B 2VUYA 1KLGB 3OF6A 1WFNA 4KK9D 1L7TH 4PJEB 3CU7A 3O3EA 3IAGC 1OW0C 2NY5C 4OZ4B 4IOIA 4HK0A 3MRCA 2EDOA 1EIBA 1CFSB 3DO7A 1TETH 1FZJA 4RA3A 1OLZA 1V3MA 3ZYIA 2J8OA 2Y7QB 2JK5B 3O6LH 3C87A 4K7PL 3QJFB 5F6HI 3VXNB 3C2AL 4X6DE 1AGEA 3OKNA 1HXYB 4HIHB 1QSED 4YHOH 3VI4E 2R2EA 1ONQB 4N0YL 1WK0A 2AEPH 1IMHC 2FLBT 4NM8H 4QOKE 2KQMA 1C1EL 3MRMA 5KS9E 4MD5A 4XZUB 5ID1B 3UAJD 1P5UA 4HKXB 4HS8H 4X9GA 3L6FB 5LCVH 3S7GA 1U92B 1MJ8L 3RPKA 3QULA 2H32H 3M17A 3S36L 2HT2C 4RRPG 1JGUH 4YBQC 1HHJA 3HCVA 1LEIB 2DQCL 5SX5K 2HFEB 4EOWL 2ZSVB 4UU9A 3W0WA 3OG6B 4NNPH 2HH0H 5F1OB 4OUOA 3QXWA 3BH9B 3VA6A 2BP3A 3GBML 2VYRE 4XGZB 4YBLC 5GS0L 4F37K 4ZUUB 3G08A 4IHOA 4ODWB 4AZ8A 3Q5YA 5BZDA 1ZLUH 3EOAA 4NJAH 2PR4L 5J0BA 4Y5VC 3Q6FA 3GMNA 1EJOH 1Q72L 3T3ME 3N0PB 3RTQC 3GJFB 5I75C 4KHXL 1FYTA 4XBGA 2CQVA 5IM7A 1CFNA 2XACC 3QIUC 4YDVA 4JG1H 1BECA 3EDEA 1N0XH 1F6FB 5F21B 4HJGA 1WIPA 1RUKH 2AGJL 3MA7B 4I3RL 4CDGC 4UDTA 3WHXB 1WUNT 2A77H 4JVUA 3LB6D 5JXAH 5DJXB 3RDTA 3TO2B 1T20A 4Q74A 3DRTA 2W60B 4EDWH 4MXWH 1XCQA 5KS9B 3EO1A 3O4LA 4LRNL 1TZGL 2JB6A 5IBTH 2R9HC 5CZVH 3RY6A 2NLJA 3DUHA 1CDCA 1TPXB 4Q6IC 4LMQE 1PD6A 3P77A 5J1AB 1UM4L 2P8PA 5IVXF 1IZJA 3DETD 1NFIA 1OM3L 1RIUH 5BQ7B 4KMQA 3HNSH 5DMGD 2HWZL 2WINA 3FQXB 4UILH 5LAXA 4HWZA 1P69B 3R06A 5ISZA 4I18A 4P2CG 3WE6A 1NGQL 2D7MA 3QFJD 3PWNB 5DEFB 1PW3A 1QLEH 2GJZA 1CXIA 2WP3O 1G7LB 1T2QH 4PTUA 2F54D 3UDWA 1HHKA 2VLJB 1F4XH 1TNMA 5KVFH 1XF5B 2HVJA 2VDNL 4WEUD 2FR4B 1F3DH 1AHWA 1WBYB 1LO5B 3WO3B 1CFQA 2EXYC 2JJWA 1OGTB 5IVZB 3U0TA 1MFCH 1MFBH 4PJFE 1KXVC 2GK0A 3MA9L 2G2RB 3EFDH 2BNRB 1F4YL 1Y6MR 2Y36L 4L3CA 4IRZH 4N0FA 1OTSC 1QSEE 3V0WL 4NO5A 3T2PA 1BVKA 2WM0A 4P5TC 1A21A 5D6DA 1OAQH 5C08E 4FFWC 3J8F7 4NQDD 3W39A 4BH8A 4NC1E 1FC2D 1KCRH 3EO0B 1BX2B 4Y89A 2RR3A 1SJEA 1RZFL 5I1IH 5MERA 5C0AA 5H2BA 1N6UA 3MBEA 3SEPA 2VH5H 5I30L 1NBYA 1FN4A 1KC5L 4MCZA 1JWMA 2EYTB 2XTJC 1MFDL 1ZS8A 5EU5A 3LKNA 1J0JA 4GUPA 3JUYA 5E99L 1JTPA 1EVUA 4GXUM 3GMOA 5J57B 5J56B 4NBYB 1I8IB 3QNXA 2HRLA 3V4UL 4BFIB 3C6SA 3QDJD 2YBRA 3LN5B 1RD6A 1B2WH 3GIVA 4RDQG 3PHOB 5FYJH 2H8PA 1KN2L 2HTLC 4UV7H 3RVUD 1CR9H 4XPTH 5F9JA 1CD0A 2I9TA 3FT3B 5HHQA 1QSEB 5IB1B 3KPQA 1NAML 1DDHA 3MLUL 3QHFH 4LLWA 4QYOA 3T0ED 5GXBB 1BQLL 4JHWH 5CIPH 2KH2B 5IBLC 2FBOJ 4LRIC 4P2OD 5IIEA 4KQ4H 1PVHA 4JFYB 1UH4A 4XPGH 1QQDB 1T0PB 4ELMB 4W6WB 1KYOK 3UTSD 2MMXA 3OXRA 5EUOF 1JPFA 4P3CH 1BAFL 2VDKH 3BWAA 3WIFA 4ORGB 1K4DB 5K59E 1V7NL 5JPMA 4OCSL 5FYLD 1QLRA 3S88H 3VDBA 3VGDA 1LK2A 4J1UA 2OMNA 3HB3D 1NCBH 1D6EA 2HVKB 4G6KH 5EORL 4D8PB 1FO0A 3HZYB 2B1AH 3RX8A 1FNFA 4HHAA 5KN5B 2Y9RT 3UBXG 2A2QT 1M71B 2E9JA 4CW1A 5I1JL 5B4MD 5IFAL 4BSWA 2OL3A 3NIDF 1BJ1J 3KYAA 2W1NA 5CLTA 1EHNA 1IJ9A 5DJ0B 1LE9B 2FYYB 1A9BB 5CJXC 5I1LA 3VMOA 4ONHB 5H94B 1VFUA 4HXBH 1MRCL 3HR5A 4OGXH 3LN4B 3RGVC 5DRWB 3ARXA 5GIRA 3KPRB 4FTVE 4GRWB 2IPTL 5DQDL 1GCFA 1RJCA 4PRPA 3ARED 4L9DA 3O9WC 4QRRD 2VN4A 1Z2KA 4PR5A 1NMBL 1VB9A 5T5NF 4PLKD 5BXFB 3GM8A 3UTQA 2NYYD 1DN0B 3DTXB 4XVTL 3QO0A 1C12A 5DD1H 3AMKA 5ALBH 1TJHL 4ZFOA 4HIIA 1MCSA 3MLZL 4XP9L 5JR1L 1HYSD 1OTTC 1XGQB 3E3QC 3UJJL 2D0GA 3MXWL 5D2LE 4JFPB 1BGXL 4DCQB 1QPXA 2K3TA 3ULVD 3QFJB 3FOLB 5DJ8B 2FX9L 43C9A 2GY7B 2PXYC 4OLWL 3VFRB 3QEUA 2DQFA 4PRNB 3B9EA 4WY7L 3WFEL 1T1WB 4OLXL 2CIIB 4YZFF 5I66A 2F54B 3K46A 1OD9A 4HGKC 3FB6B 3ARTA 4A6YA 2WUBH 3DLQR 1F00I 1R6VA 4QRSA 1C5CH 4R2GB 4XHJD 2AV1A 4FZEL 3ABZA 3DI3B 1OB1A 1RY7B 4NCDA 4L8SA 1I1FB 5FYKD 5GSRB 2ATKA 2G60H 3WFCL 4XX1E 5C0IA 4OBSA 4P9HL 4NQCE 3HE7D 1GZPB 4LL9A 4LSUH 1R24B 2BDNH 5FV1L 5A16A 1B4JH 4LEOB 1CVSC 3TVMA 5CJOH 1NANH 2QTEA 4NQDB 1EGJL 1DR9A 4X98A 5D2NA 1AD0A 4PLJD 2AJUH 1DLHB 4X6BA 5HPMA 1YYLH 4HW6A 3GKWL 2YN5A 1QO3A 3UTSE 3M1BB 1MCCA 4R3SB 1KTLB 1DBKL 1OAXL 4YNYA 5JIPA 2JJTA 4WHYG 5T5FH 2VDOL 3SE8H 5FOBB 3ARFD 3WNMA 1FVDB 3FONA 3VGAC 4JN1H 1UB6B 2HFFA 4PJ9C 2ESVD 1RZ7L 1MJJA 5C6TL 1ZGLA 4HKZA 3QDJB 2B1HH 4H5SB 4M7JL 4MQ7A 4O5LH 1FO0L 1LHZA 1WGOA 4IDLA 4U31A 2K9UA 5ID0B 1J0ZA 3G6AB 5FUCE 4ZUWA 5CSGA 4HFWB 4NQEA 1YEDB 5TF1H 5JORB 2DQEL 4OFIA 5D93C 3RWHA 3DBXA 4P23C 1XR9A 3I85A 3QUYC 5GRVL 1QFOA 3QDMD 3T0EB 1BD2A 3G5ZA 5FB8B 2J6EA 4QRRE 5GGTH 1QA9A 3BD3A 5D5MB 2BCKB 3SDDC 3BFOA 5IVNA 3GI9H 4P2OB 5IG7B 1T1XA 1A6WL 4NQUA 4WV1B 3P73A 3PJSA 4XBPB 2O61B 3UTSB 3KXFA 5L2JB 2VIRB 3QUZA 3I75B 1YNKH 1RUPH 4U6YA 4U1MA 1OSPL 4FQ1L 3G9VA 4URTB 1IM3B 1KNOB 1Q9WA 4JO2L 4KKLC 3QNZA 1S7UB 4OB5L 2APXA 4DKFH 2YD3A 1BOGB 5SWQA 1ZHBB 2ZP0T 1EO8H 3VFOA 5IMMB 2FO4B 3NN8B 4LHQB 1DBML 4XWOC 1JK8B 5IKCB 1R3KB 3N1MC 2FJFB 3O2DL 1S9KC 1BFOB 1CG9A 2HT2D 2OXGA 1DFBL 4YBQD 4RWYL 3SO5A 1D5XA 1QFWL 4L4TA 3RI5F 3SOBH 2F8XC 2NY1D 3O11B 2CKBB 4R9HA 3PL6D 4O2CA 5JO5A 3AREB 5FCSH 4EUPH 5I1GH 4QTHB 4OF8A 1E4KA 2VDQH 1T5WA 3QEGL 2XZCH 3PGCA 2X4TB 2XQYG 1CXKA 4WENB 2IQAB 4OIBA 1HXMB 3VD7A 5D1QA 5EZJB 2QKIB 5T1KA 1P9MC 1CVRA 3RU8H 4NUJB 5DJYA 4BJLA 3HUJE 1AP2B 1U8LB 3LRHA 4PRDB 3SGKA 4K23H 1ZT7A 1NGWA 3QIUD 4HLJA 3ILPB 4WI7A 1OARL 5E0QA 3MV7D 1E28A 2R0LH 4HUKB 4G9FA 2D03H 4GQ9H 4RX4A 2FNBA 3C9NA 4NQSB 4JQXC 1K8DB 3E6HA 1YDPA 1P4IL 2CRYA 1KB5H 2IAMC 1HN1A 1BZ7A 1JFQH 3WKMH 3UC0H 4RSVA 2F74A 4DW2L 5DO2C 4BH7A 2D9QB 5FECB 1BQSA 1WEJH 4OGYH 1J7VR 3STZA 3PWJB 2ITCB 3FO9B 4MHHG 2XFXA 4WI6A 4R97B 3S6CA 4JCMA 3M8OL 2F5AH 3E1F1 2B4CC 2P43B 4MJ5B 3OX8A 4YEEA 2DQIL 1I4FA 4YHML 3GSXB 5FF6B 3GNML 2F53A 3S35L 3HE7B 2I26N 1MI5D 1TIUA 2MCPH 2X10A 3P9LB 5TF0A 5ICYB 5CMAA 1HILA 1L4IA 1XF1A 3IFOB 3OKLA 2V5YA 3AS2A 4YDKH 5EUKB 2NXZC 2VABA 4G8IB 3WIIL 2W9DH 1ZXQA 3HS0A 5EBWB 4GAGL 1HI6A 4JFHE 1UCTA 5GS0C 1MQKL 4AL8L 4S1SH 4AH2A 2BSTA 4U1KB 5ALCL 3BKML 1YQVL 4GMTH 1OAZL 3JTSB 1HKLL 2NY4C 5C2BL 2J6EL 3STBA 5AZEH 4RBPK 3TJHC 2EXYD 1WZKA 4OCWL 3U7YH 1EUUA 1M1SA 4RGOH 3ARFB 4OIIH 5E2TL 5F9DC 3VFNB 4S1QL 4U7SA 5GRJH 4AEHH 2ESVB 5F3HB 4LKXA 5C86A 1MHEB 2DJSA 2AXJA 4XB7A 1OTSD 5ILTL 3ZDXE 4IMLA 3LPWA 2G9HB 3ILQC 1NCUA 3QXTA 4OCMC 5HYSB 4FFWD 4V1DA 3GJFH 4LLDB 4OFPA 3QXUA 3N9GH 2YUVA 1RFDH 1RIHL 4P2RA 4DN3L 2XN9E 4JFOB 3SKJL 4PB9H 3T2QA 2R2BA 3B6SA 1JUFB 4H8WH 5TE4L 3VG9B 3NIGF 4JZJA 2EH8H 5F7HA 3X11B 4P3DB 3QDMB 4CVWA 5E5MA 5FO9B 4K2UL 2YD4A 4PS4H 1T04B 2XTJD 3DX8A 4X6EB 3BAEH 4JY6B 3LH2H 4QEGA 3UTZA 3MRRB 4I2XE 5HHVL 1CGVA 5FIEA 2OSLA 2IBGA 1MIMH 2DLGA 2J1KA 2QQLH 2WIIB 3LV3A 4JFDA 4OM1H 4RGNB 5ICZA 3SPVA 2X4UB 4DGVL 1SEQH 1EK3A 2JF1A 4GO6B 2HN7B 1U3YA 4JRYD 4N9GB 1J1XL 5C0DA 4MNHB 1BFTA 3S34L 4G5ZL 3BEVA 3OPZL 1PZ5A 2Y5EA 4LSVL 2LFGA 3WFZA 3NBNA 4NZRL 3KPMA 2IBBA 2HTLD 1IGIL 3T4AB 1JNLH 2I60L 3CCHB 1A14L 4G8FB 1I9IH 4ZFGL 4M6AA 4XCCH 2VNCA 3X3GH 4U1SA 5KTEH 1ORSB 1UH3A 2NXYC 1HSAB 3TBWA 5IW1A 3SKMA 4LSDA 1F02I 3CFDA 3VXSA 4NO0D 4XP6H 3CC5A 3NGBC 2VN7A 3VE0B 1AFVH 5IBLD 3TT1L 5KVEL 2HJKB 1JTOA 2NY1B 2XOTA 2VC2H 1G7IB 3PL6B 2R15A 4JRXD 4EN3A 1S3KH 1X5GA 5JDJA 5T33L 2VDML 3VRIA 1YMHA 2BSSA 1EJ6A 5T3XH 1PKOA 2ICEA 4X4XA 1C08B 1CE6B 5B8CA 3LEVL 1CLYH 4BQ9A 2EE9A 5DUPL 1PDKA 3EKCA 3LQAL 4U6XA 4FFYL 4ZUVA 3HFML 1ROWA 2KPNA 1CGXA 3I6KA 4DUXA 1YMMA 1LO2H 3QIUB 1D6VL 3IJHB 3MV7B 4M43L 4Y88A 5GGRB 2EDRA 4WTZG 3DRQA 4IS6A 3U46B 5HVWA 3RGVD 3FN3A 1MSPA 1H3UA 3JVGA 1KJMA 3SE3A 2HLAA 1T0MA 4JG0H 1P1ZB 5D72H 1RK1B 1O7VA 1AY1L 2VLRD 2A6IB 3O9WD 3LS4L 2AXGA 4J3SA 4MJ4A 5B38G 2YPLE 4I9WE 4OCXL 2XXMB 5IHLB 3SJVE 1KJ2H 3GSRB 2IH3B 3WXVH 1EVTC 2N7BA 5K9OA 2BVTA 5HJ3A 1OTTD 5GJTL 1AR1C 5DRZA 1MI5B 3RDTC 4TVPE 4HV8B 1JNJA 3K80A 1A6VL 5HD8D 2Z4QA 3V6ZB 3VFGH 2YPVL 2PXYD 1U8MB 4YDLC 3C60A 1FL3B 2XKUA 5HHXH 3JV5A 4JY5L 4OCYH 2XTJE 2AJXL 3SDYH 5CP3H 5DJDB 1RZGA 1NLBH 4CU8A 2HRPH 4O58L 3NACL 2YEZA 4NPYB 1A1OA 3FQUA 2CK0H 1VACB 2P5EA 4HPOH 5FAAA 3RZCA 4I18C 1NGXB 3H0TA 3HPJA 1F58H 5IJVB 1J05B 2HAZA 4P9MH 1FNAA 1DQJA 1XH3B 5I18H 2EE3A 1FZOB 3BE1L 4XH2B 5C71A 2MKLC 3W9DB 3NZHL 1RJZA 2VRAA 4LASH 3UDWC 4JDVB 3RNKA 4PGJA 1BF2A 1HH9B 3MODH 1PG7L 3RUGB 1IGTA 4OCLC 5TQ2H 3IDMB 4NZJA 4KUZH 2NW3A 1AHWC 3AC0A 1UYWH 3TT3H 4JGJA 4MJID 4O9HH 1UXSA 5MP6H 5HPOA 5TH2B 4XTRC 3BKJL 4Q7DA 1YC7A 4GRWH 1NCAH 2O5ZH 4NGHL 3ARRA 3LKOA 4PG2A 5B39B 4Y4KC 4E41E 4HZAA 1OAKH 5T3ZL 2MHAA 2XTJB 3BYYA 1ZA3A 2X9XA 4U6VL 1RHHB 5DUBA 2Q3ZA 4PRHA 4WFFD 5DUML 3IJYA 3ZKXB 4OAWB 4LVHC 4PJ9D 1P4LA 3CDGA 1A7OH 2ENYA 1UZ6F 4OSUL 3VD3A 2WANA 2IADB 5IQ9A 3QEHA 2EH7H 1YEHH 4IDJL 4Z0XA 1IQDB 4W4NA 3VXMD 2XA8H 3QAZB 3MBEC 3CVIL 4JRYB 1JNHA 3IU3A 1IKNA 1BEYH 4POZC 4X5WB 3R1GL 5EBLA 1MRFH 4KH2A 2VDRH 1XGRB 3A6CL 4NO3A 1QLFB 2V2XB 3U36B 4KGLA 3V4VL 2ARWA 4LCWE 1KIUA 2CO7B 4P23D 4LNRA 2BC4B 3QUYD 2BMKA 4P9HC 3ECBB 5DEGA 5TDPB 4ZQKA 3JV4B 3OHXA 4NO0B 3TH2T 3O6FA 4PY8I 4MA7H 3OGCB 1UEYA 5EOCJ 4PJXA 1U8IB 3SDDD 1ACYL 5IQ7L 3PGDB 5DVMA 5GHWH 5J3HC 1ZLUK 4W4OA 3IGAA 3P11H 1V7ML 3I2CH 1RUAH 1CLCA 4Q9RH 3G6JB 4KJPC 4KU1A 4EI5D 4JRXB 1U42A 4BK4A 1U93B 4H26A 2XQYK 1FPTL 1UCBH 1N64H 3RIAK 4JGUA 1O0VA 1GZQA 1AO7A 3REVA 4KKLD 2B0SL 4RZCA 1ITBB 4Q97A 1UM5H 1MCFA 2A6JA 1ADQH 1VFBA 3GMRB 5FKAA 1YEFH 2D0FA 4OT1H 4RFOL 3MZGB 1UA6H 3TA3C 2KDGA 3RGVB 5F6IB 3NA9H 3G5XA 3O0RL 5IB3B 4GKNB 4GRLC 3GDBA 1KENH 4AJ0A 4E0RA 2VLRB 1JF5A 1JHKL 4YGAB 3SO3C 3O9WB 3TFKD 5JQ6H 4LCIL 4NQTA 2BOBB 3P4OA 4TRPL 2WZPD 5FOJA 5BO1L 3QCTH 2OQJA 5F96L 2FL5A 1S9YB 5BRZA 5EOQL 2UVFA 4NHCH 2NY7H 1KIRB 4YHIA 5DD6B 3L3JB 1DQLL 4JZNB 2MQCA 1C7TA 4IJ3C 1AJ7H 4LIQL 1WBZB 5I71B 5TGBB 5K9QG 5HYJA 5T1DL 1AI1L 5DC0A 3FMGH 5E9DE 1BBJA 4NQXB 3T65A 5DURD 2BVQB 4MA1C 1CYGA 3TV3H 4OLZH 2ED7A 2FGWL 5FGRA 1S7RB 2QR0A 5HHNB 3V5HB 2AEQH 2IAMD 12E8H 2A83B 3BO8B 2M1KA 3S3SA 5DO2D 1ZANL 5IT2L 5IB5A 2OYPA 1OF2B 1U8KA 3VXME 3FB7B 4KVCL 1MCQA 5I8KH 1IC7H 3O3UN 1NEZB 5IVXB 1DQQA 4OLEA 3GZKA 1F3RB 5FYLH 3U4AA 5BOZG 1EERB 3MQIA 2Q7YA 1DBJL 4FQLH 4U3CA 5E1AA 3HAEA 1H8NA 4ZFZB 3IF1A 2NXZD 4QHMB 4B0MM 4HWEL 2C3VB 4ONFL 3DHMA 3LSOB 1AD9B 1HIMH 1X9QA 1N5AB 2YS4A 2ZOKB 4DQOH 4HUUA 3PDOA 4MJIB 4UQ2B 5GS0D 1WFTA 4QRQB 4L8SC 3QQ3A 3DNKA 4NKDB 4M48L 3BOVA 3ZHDA 2YUXA 5HGHB 4C4KT 3O6KH 1GAFH 2BVEA 4Z0BH 3O6MH 3IYLW 4WDIA 5H8DA 1BWMA 4I48A 3TJHD 3EYFB 3X14B 3IU4L 3TVMC 3I6GA 2XWBA 3M45A 1U9KA 2P48B 3VGAB 3BDYL 4G8GE 4NWTL 4PJ9B 3GSQB 4QNPE 5D2NC 1A02N 1IC5L 1KCVH 3O3AB 3BW9B 3KLHD 1DQML 2ADIA 1MF2H 3UYRH 4KZEL 3TEUA 3VXMB 3K8LA 3RWIB 3G5YB 4D0BA 4LLMB 4PPTA 3P0GB 5DK0B 3PQYE 2JJTC 1F90L 1D9KA 1QBAA 3WV0A 1G7PB 4JO1L 1FZMB 3D18A 4JGMA 3ULVH 2R0KL 2EZ0C 4XCNB 3MUGB 2BSRB 1J87A 1UB5A 4NM4H 4JO4L 4P23B 4ZXBA 1K3IA 3QUYB 3MLWL 4UBDC 4X7EC 3B9VA 5DMKB 3PP4H 4PYGA 5DSCA 5EUOE 2C4XA 3PV6B 4K55A 3NCFB 3SDDB 3DVNA 4MNGB 4Y5YA 4HF5H 4NKIH 2V5RA 2CUHA 2BY0A 4G80B 3JV0A 1K6QH 2ZCLH 3DROA 5BVJB 4JZOB 3GSVA 1CF8H 2FATL 4LPWA 5FM5M 3NABH 2Q8AL 5JUEH 1WWWX 5IF0A 4JVWA 2P47B 4EI5B 5FYKH 2IGFH 3HKFA 1H3PH 3BUYA 1MCKA 4O4YH 3L3DB 2GTZA 5KZCD 3NIDE 1O5DT 3S5LB 2EKJA 2PYFA 1AXSA 2R4SL 3BT2L 4FZ8H 3ZDYE 1PG7W 3S37H 2EIEA 2OI9C 3PXJA 4ONGH 2Q3AA 1A8JH 1DBAH 1MHPL 4K94H 2E27L 2NXYD 2CGRL 2ZKHL 3V5KB 3EYOB 4JCLA 3OF6D 3PHQB 2UWEA 1YN6B 3UO1L 4UTAH 5JIIA 15C8H 3HMXH 3QUZC 1LO0H 1FVCB 4L5FH 3GUTB 4PJBF 4FQJH 5A2KH 3IETA 2DQHL 2VLKE 5IHUH 1Z0MA 4L4VA 1N6QH 2AK4E 3LAFA 4LBEB 5EZLA 3D39D 4U49A 2SEBA 2DL2A 2CXGA 3WSQH 3CMGA 1HOCB 3Q2CA 5E08L 2DWDA 3EYSH 3OR7A 5ICXB 2FDBP 4WW2A 1KCUH 3AXLA 4H20L 3RL1A 2VLMD 1X5JA 3AVEA 5ANME 4TTDC 2P5WE 3AROA 4CMMA 3TIEB 1IQWH 2P4AB 3TCLA 1QFPA 2VDLH 3I50H 2GW5A 4YZFE 1B9ZA 4OV5A 3CDFA 4UMGA 1E4KC 5DURB 2BVOB 2QADC 1EX0A 1A1MB 5D1QC 1KEGL 1S7WA 2NCMA 4F7MA 3MR9B 5ESAA 5KVDL 3VH8A 1XIWA 4JFQB 1A7QH 3SGKC 1FYTD 1INDH 2FEDC 1Y18B 1BQHA 1OHQA 4PFEA 3VFSA 4PD4J 3QISA 2X70B 1R5VA 3WN5A 4ZNEA 4UT6H 1TVHB 3QA3B 1RZIA 2EDJA 1I3RA 1CGSH 3A6BL 3QEQE 2NY5H 4GG8B 2DLFH 4F58L 4R96B 3RDTD 3LMJL 1KOAA 2EKSA 5SWZA 3VGHA 3WEXB 5E95B 4XRCA 4Y8DC 3RQ3A 3LIZL 2QSVA 1JHLL 1A4KB 3CVHA 3O4LD 2NXZB 3Q6GH 3BP5A 1CIDA 3WBDA 2DQUH 2VZOA 1T0NA 2VDPL 1IGYA 3VWKB 5GS1A 1GC1H 5EZIL 1EEYA 4OD1H 4JN2B 4LHUA 2DQDH 4UT7H 4JM2A 7FABL 1UXWA 1I9RL 5EG6C 1WBXA 3MLRH 3LQAC 4ZYKA 5ISZD 1ETZA 2EIDA 4HKJB 1MVUB 3VU2A 1GGYA 4GKZA 2Z35A 3STLB 3BD5A 3I6LD 2AKRA 3BRGC 4NHUB 3RHWK 4GW4A 5JNYB 3L95A 4PY8J 4NZTL 2E6QA 1A5FL 4EQ3A 3OKOA 4X80H 1T7VA 3LKPB 3ULUL 5CP7A 5A43C 1MLCA 2BHYA 1ZV5A 2VR4A 1WFOA 2OZ4H 4LDEB 3EUUA 3ZDZF 2FD6L 1MIEL 2Z31A 4C54A 1JPSL 3I3EA 1G7HA 4P5KA 4XTRD 1T80A 1S9WA 4Y1AA 1I7RA 1WT5C 4AEIH 4HIJA 4QF1B 1XGPB 3NFSL 3FZUC 2VZSA 4Y4KD 1U95A 1PAMA 2B5IC 4LGPB 2HJFB 1P7KA 3SHSA 4LF3B 3RWJB 1U58B 4BYHA 5F8RC 3GBLA 4PP2B 4KY1H 1NANI 1MCOL 3OR6B 4X6FA 1NFDB 3HTLX 5C0AD 4Y19A 1OCWL 4ELKB 4YHPA 5LVEA 1BHGA 4JZJC 1R5WA 4OUUB 4YWGL 3W0WE 2F58L 3GMLB 5KZCB 4POZD 4PJXF 3X17A 1W0WB 1NDGA 2VISB 2ADGA 4JFXA 2V17L 4LHJB 3MCKB 3QT2A 3UTTA 5DS8A 3U1SL 3MFFA 4PJGA 2H2PC 2YC1A 4IOFC 2NXYB 2FWOB 1CZ8H 2B39A 3H9SA 3RVWC 3V0AC 1G0DA 3DSFH 3NGBB 3O3EB 2HJLB 3KPPB 3OAUL 4IOIB 4JQIL 3DO7B 1VADA 2GJJA 4F8TA 2XG5A 5JDSA 4MDIA 5J3HD 2M8XA 3OKNB 3OKKA 2CO6B 3FO2B 3WO4C 4KJPD 2R2EB 2YHGA 3D39B 5I8EB 5JW5B 3HR6A 4JFFA 4OGZA 3DJ9A 1AR2A 3CIQA 3IDNA 3MRMB 2DAVA 3JWOH 3BSZL 4K9EL 1PEWA 3DX9A 2K1MA 1FFPA 3QULB 2J88H 3DVFA 3HCVB 3IDIB 3CVHL 4X6DA 2D2OA 3WNKA 1DCLA 3QPXL 1C16A 2FSEB 2AQ2A 1QNZL 5GGUB 1Q9LA 4EN3C 4QOKA 3TWCH 5EC1B 3TA3D 1ITCA 3JWNC 1UZ8B 2XPGA 1JL8A 3UJIH 3FOMA 1PFCA 4NOBA 3G08B 1KN4H 3PWLA 4IHOB 1YNLH 1W0VA 4EI6A 5B8CC 3I6LE 2G5BB 3LD8C 4GRLD 2C7UA 1FL5A 3QWOA 3U30C 3BPNC 5BZDB 3EOAB 5KSBA 4HAGA 4WTWA 1JBJA 2DI8A 4U33A 3GMNB 1ZKAA 1CICC 5F7EH 3UYPA 1FYTB 1R5IB 3HRZA 5F70A 3NOIA 5IM7B 3BDXA 2JB5L 3SCMA 4I0PA 4YDVB 1MPAL 1CQKA 3NVQA 4NP4H 1A6ZB 1NAMB 5C0CA 4HJGB 4PRAA 3C5ZA 1JN6B 3H42H 3VXRD 5DD5H 2CKNA 2J4WL 4FQCL 3SKOB 1PQZB 4JY4B 1TJGL 1C8PA 1OGAD 5J4MA 3JVGC 4YJZL 3CNKA 5CJ8A 1WTGT 3RDTB 1AGFA 3SE3C 4PRPD 2BFVH 1T20B 3F6IA 3DRTB 1UQSA 4J2XA 4P46D 1CD9B 1XCQB 3EO1B 3WIHA 1FAIL 3O4LB 3VFUB 2JB6B 2UZIH 4R8WL 5EDXA 3RVTC 1UACL 4X99A 4U1JA 1P2CA 3L3OA 2NNAA 2QQNH 2IPKA 2HKHH 1QR4A 3P77B 4YDLB 1RMFL 3V8OA 2P8PB 2NR6C 1KCSH 1GGCH 5LGHL 1I75A 4TN9A 4YUEL 1CU4L 5LAXB 5AG9A 5ISZB 5C0AE 1ZWIA 5DLMH 4BK5A 1AQKL 1FRGL 2XV6B 3GJFK 5FHAH 2HG5B 5MEQB 3C60C 4MA8L 4ZDHA 3EAKA 5FXCH 3Q1SL 4PTUB 3V5DA 1PLGH 2M26A 2EDHA 4UTBL 5K9QI 1QBML 1FBIL 3IDYC 1NGZA 2HVJB 1AHWB 1H8OA 4RQQA 5EBMB 3KJ6L 3HE6A 3BIBX 3RZCC 3NIGE 3U7AA 1C5BH 4KJYA 1F2QA 5A1AA 5HGDB 1AXTH 1YEIL 2DIBA 4RMVA 3O81A 1KJVA 3U0TB 1JRHL 4NFCA 2X4OB 2GK0B 5C3LD 3FB8A 3BZFA 4N0FB 4L3CB 3QXAA 1G84A 3VJ6A 5FGCB 1ZA6A 4Y4KB 2P24B 4NO5B 4GG6A 5TDOA 4TULL 5DVNA 2AV7A 1PSKH 3VXUA 3W39B 1CDHA 1LILA 1T7XA 1BBDL 2EYSA 4LVHB 4OF5A 2PKDA 4N90D 1J0KA 2NX5A 3QDGD 1SJEB 5CILH 4KDTA 1WZ1L 4QXGL 2LAGB 1I85A 5GGVL 3FN0L 4PJFA 3JTTA 1V3JA 5C0AB 5H2BB 3EO9L 2CRZA 4G42B 2CLZA 5DZNA 2V5MA 2EEAA 4OZIA 2UUDH 4PG2C 4YEFA 1FN4B 1RZKL 4MCZB 4LPVA 4W6YB 2UY6A 1ZS8B 5EU5B 1EHLL 4U3HA 1CL7H 1EV2E 3LKNB 4FQ2H 4GUPB 2EZ0D 2FB4H 1SBBA 3BIKA 3GBNL 3GMOB 4XVUC 3L7FB 4XXCA 4UBDD 3QNXB 3NCYS 3C6SB 5EU7C 3CJJA 5KSVB 2YBRB 5EB9A 4NJ9H 1IBGL 1IKNC 2PUQT 4KPHH 3GIVB 1JPGA 3WDIA 2H8PB 3MBXL 4OI8A 3GB7A 1MAJA 1WWAX 4YE4L 2I9TB 2AABL 3P30H 4PUBH 3CXDL 3HI1A 1DDHB 4EBQL 2UWEF 3T3PF 4ODTH 2BX5A 4QYOB 5EC2B 1Q9KB 3PWPD 4WUUA 3O6FC 1IKFL 4ZS6C 3MV01 4ACPA 2P8MB 2VQ1A 5J7CC 3QCUL 5IIEB 3DUSA 3CSYA 2ZG1A 4W4OC 3WIHL 4F7PA 5IHZA 2ED9A 4M1DH 1N59A 3TNMA 1JPFB 2FECL 1IEHA 4XCFH 4J23A 5L88L 3QUZD 4AMKL 4J3TA 4WW2F 1K2DA 3TA3B 4D0DA 1QLRB 4MAUH 4YHZL 1LK2B 1N2RA 2BNUA 2OJZL 4J1UB 2XZAH 1D6EB 1VFAA 1FO0B 4YHKH 4HHAB 4KGJA 4BZ2H 4GRLB 4JE4B 4DGYH 4CW1B 2XZZA 5MHSE 3SO3B 5HYSG 4C4KO 2X1PA 3WXWL 1FSKC 2JJUA 1KB9K 2GKIA 5JHLL 2D4DA 1ZLSH 1ODAA 2OR7A 2YPKB 4LSQH 5I1LB 1OAUH 2IPUG 3VXRB 3HR5B 2VL5A 5GIRB 3UXFA 2WUCL 4X6CA 1RUML 1U91B 4IJ3B 1LDPL 1OGAB 4PJHF 1A0QL 4PV8A 4QHNA 3MYJA 4TTDD 2Z93A 4M5ZL 4PRPB 1T03H 2GHWB 2RAMA 4MQSB 1JZ4A 1AGBB 4P46B 1T83A 3NTCL 4PR5B 2EDNA 1WIUA 1SYVB 4UB0L 4X0KB 4MA1B 2QADD 4N8PA 3AB0C 5TFSL 4JB9L 4MX7B 2OTUB 3QO0B 1C12B 3NZ8A 3V7MA 5D1QD 5T1KD 3OQ3B 1FNSL 5HYIA 4FTVA 2F5BH 3QP3A 4AENA 2BY3A 3CZJA 3FQWA 1CDGA 1Q8MA 3FFDA 5CSBA 5E2WH 4ZS7H 2IJ0C 3JV6A 5HYQA 4NIKB 4G9FD 3TYFA 4JLRA 5CZKA 2ZCHL 43C9B 5I0ZA 4O02L 3QEUB 4PLOB 4DAGL 2EIBA 2ZCKH 4JM2F 4ETYA 2VXTL 1F97A 2V5TA 4YAQB 25C8H 4PJAE 4HCRH 2CMRH 5D2LA 4RNRA 1E6JL 3MRIB 4QRSB 2AV1B 1M7DA 1U0QA 4HK3N 4L8SB 1UKTA 2NMSA 3EDJA 2ATKB 4MSWA 5C0IB 4CVZA 4AG4L 3MNZA 4LGRB 1IAIL 4DEPC 2VE6A 1B3JA 3N1GC 5DWUL 2CLRA 1NMAL 1MJUH 3BP7A 4LAQL 4Q2ZA 5KOMC 3IDXH 4NQEE 3GSNB 3QQNA 4Y4FC 3O3DB 1XCTA 2VTFA 3RWGB 2EDTA 3OXSA 2ENSA 3U7WH 2ZSWA 5HI4C 1BD2E 5D2NB 5L0QC 2QSCH 2HMIC 3QDGB 5CINL 3DWTA 2X4SB 5HPMB 4NQCA 1BOYA 2E7LA 4S1RH 4F80A 3EFFA 3NAAL 1QO3B 3T0VA 3KXFE 1A7NL 1J5OH 1AGDB 2FX7L 1D5BA 1TLKA 2VJXA 3D2UA 1QR1A 2R1YB 3MRPA 2HFFB 3KYOA 3HN3A 3C8HA 1CXHA 4NRXA 2PTUA 1I9EA 2FEEI 3FZUD 1F2XK 2ID5A 4HKZB 1ZGLB 1B6UA 5IFJA 4D9QD 4F9PA 3OJMB 1QP1A 1QRND 1RV6X 4K7PH 4V1DD 1TFHA 3C2AH 4AQ1B 2NW2B 1T1YA 2WBWB 3F12A 1D9KC 4ZUWB 1F13A 4PJGF 1ED3B 4N0YH 4XNQB 4BQ6A 3F7YA 4L4TE 4ZXBC 3DXAE 4PJ5A 1T21A 4WU7B 2JCCE 3H9ZA 1MJ8H 3OAZH 3MJ8A 3S36H 3PWPB 3G5ZB 3E6FA 3BGFC 5SX4H 1QA9B 2OI9B 4EOWH 1RURH 4RMTA 2H2PD 4IOFD 2BVPB 4KTEH 1FLRL 3C08L 4JFDD 2YZ8A 3PJSB 2AJSH 4J8RA 5M7QA 2AJVL 4NYLB 4ODVL 2NTFB 3QUZB 4LLQA 3D48R 4WHCA 1T4KA 3NCMA 1H3TA 4U1MB 2PYEA 5D7LA 1I1YB 1S7QA 1V05A 1Q9WB 2EXWD 3KJ4B 1NCTA 2BJMH 4X6DF 3T08A 3OL2A 1NUFA 2W59A 4Y4HA 3E8UL 3P4LA 1QBLH 4NO2A 3VFOB 1FFOA 2EO9A 1S7XA 1SM3L 1CXFA 2NY6D 2Z91B 2H32A 5E4EC 1SMAA 3X3FL 4OZFB 4P2QA 1CG9B 2DQGL 4CRPA 4FQXA 5T3ZD 1BLNB 5DVOA 4CL7A 4LRNH 4WFHE 3UJTL 5KSBF 1N0LA 5E6YA 5JO5B 5F7WC 3OB0H 3QYCA 4OZHB 2F53E 4EN3D 4JHAL 1UM4H 1RU9L 4FXLA 3DX7A 1DANT 3EZJB 5I1AB 2X1QA 5JOPD 1J0YA 4ZO7A 4XMKH 2QADB 4LEXL 4WW2C 4NN6C 3QG6A 1B90A 1KFAH 4JFZL 1MCJA 4M03A 4WHTA 5D1QB 1RVFH 2DTSA 5T1KB 1D5IL 5CUSH 2EEBA 5DJYB 1X4YA 1CICD 1NGWB 4J6RL 4YDJA 2V9QA 2RFXA 3WLWC 4ALAL 1U8JA 1RJLA 1AKJD 3FT2B 4N0RA 3U0WH 1E28B 5DMIH 4IRSA 4G9FB 3T1FA 5K9JL 3IFPA 2X05A 3RWFA 1KT2A 1OQXA 1A3LH 2ORBL 5HDQH 1G9MH 2W38A 3E6HB 4WHDA 4DFIA 5J12B 3THML 1NH6A 1BZ7B 4ZD3H 3HUJA 5HYEA 1XIWC 2F74B 3RX7A 4ODSL 2UZYB 1RZJL 3STZB 3V4PL 4M7LH 2XZQL 5F71A 2X1WL 1OVZA 5H37H 2XFXB 3MA9H 4WU5A 3CSBA 2NR6D 4D9QE 2Y36H 4WW1B 1I4FB 2X89A 2EC9T 4K9EC 4P2RE 2FX8L 5I1CL 1C5DB 4UAOB 1HILB 4DWHA 4M1GL 3C8KA 4OM0H 2NY2C 3HA0A 5K9KA 4LVNC 2KUTA 2VABB 3F62A 1A6UH 1VDGA 1RZFH 1DEDA 5JPNB 3C60D 2VXUL 1EXUB 5GS1C 5L2KE 5D9SA 2BSTB 1IC4H 3GMMB 2XQBL 5I30H 5DD0L 3MV9A 5EO9A 1TZHA 5D71L 1KC5H 3BHBB 5HY9B 4FOMA 4HUWB 4GG6F 3NPSC 1QOKA 5DZOA 3GMPA 1KPRB 4L3EE 3F5WB 3QI9A 2P5ED 5LJYH 3RZCD 5JXED 3KHOA 2WWKT 1LNUA 4LNVA 5D8JL 4PJCA 5KJRH 5C0JA 1S7VA 1ZHLB 2OLDA 5KVGL 5DHVB 3V4UH 2ITDA 2AVGA 1VERA 4LKXB 1YYMH 1UFUA 2J12B 3D0LA 5INDA 2F8OA 1DBBH 4R26L 1TETL 2DBJA 1RK0A 4IMLB 1QHOA 4WGWB 2B5IB 4OZIF 3O6LL 3IVKA 5BS0A 1KN2H 1QRNB 4V1DB 3INUL 3ME0A 3TBVA 2Z31C 4YHOL 5IMKA 1ZAGA 4HKBA 3T0XA 3VXSE 1RZ8A 4WI2A 3BDBA 2AEPL 1NAMH 1DJSA 4OCNC 3U2SB 3IXTA 1VA9A 3B6SB 3MOBH 1BQLH 3BWUC 2R56L 5E8PA 3VFTA 3PV7A 2GITA 5E5MB 1JGUL 1OAYH 1M7IB 4PTTA 4L8CA 5DEZA 3DX8B 4PP1D 3NH7L 4PRHD 1FFRA 4NNPL 3UTZB 2RGSA 1BAFH 2XN9A 4PJBE 3LV3B 4JFDB 4XVUD 3KDMA 5ICZB 1KLFA 3SPVB 3VFWB 4OCSH 1G0YR 4RDQF 1BZ9A 4R4ND 1QFHA 5A2JH 5EWIH 1NEZG 5EORH 2I9LB 1UWGH 1K8IA 1YMME 3WHE0 3BEVB 4NJAL 4NNYA 1K5NA 4HIXH 5CS7A 5I1JH 4U6TA 4LFHD 1FNHA 2X40A 4EIGB 4JG1L 5F89A 4ZNCD 3S3PA 4U1SB 1YA5A 5TE6L 3WO4B 2DMBA 1MCDA 1U8PA 2PCPB 3B9KA 1DVFA 2X5PA 1MRCH 5IW1B 2IPUK 3SKMB 3IXAA 2NY6B 3KPNA 3CFDB 1ES0A 4NN5C 3T0BA 1YPZA 2DYPA 3O6FD 3CC5B 2IPTH 5DQDH 5FKPB 5E8DL 4UDUA 4QTIH 3CK0H 1H3VA 3LY6A 4HK3J 1NMBH 1ZT4A 5J11C 4EN3B 2W9LA 1UJ3B 1K3ZA 2BNQE 4PB0L 2OJEA 3CMOL 3VRIB 1YMHB 5B22A 1TJHH 2PTVA 2W91A 2VXSL 1VEPA 3O3BA 4X4XB 4UILL 4X6CF 5D6CA 5B8CB 3FQNB 2MJWA 5ITFA 3LD8B 2IALA 5DJ6B 3U30B 3UJJH 1BWWA 1FL6A 2DJ4A 3BPNB 4JO3H 5C0BE 3EIFA 4ZUVB 2XRAL 1BGXH 5BV7C 3I6KB 1CICB 1ZEAL 4NKOB 2QHRH 1OP9A 4OLWH 1AKJB 1MUJA 1T2QL 4WFGD 3VFVB 3KYMA 4IS6B 4WY7H 2J8HA 4RAUB 3WFEH 5AWNH 1JYNA 1S9VA 5E2UL 1KB9J 4PGCA 1KJMB 2J2ZA 2ZWLT 2R23B 1T0MB 1T22A 1E0OB 2GJ6A 1M7XA 5B3JF 4BQ8A 4B5EA 4FZEH 2AXGB 4PJDE 3RWEA 3SCMC 3QXDA 1II4E 4LP4A 1MFCL 1MFBL 2XA3A 1KIQB 3WFCH 4LIQE 3EFDL 4KXZH 5EO1A 4KRMB 3C5ZC 5F9WB 5BRZD 1CS6A 4IIQA 4ZUTA 3QG7H 2FHCA 4NCC1 5HJ3B 1TXKA 4G9DA 2ICWI 1TQCC 4UINH 2WMPA 5IESL 5DRZB 1OAQL 3S5LG 4ZPTA 3DX6A 3OV6A 3SKNA 5HYJD 1NEUA 4F33A 5D2LF 2Z4QB 1EGJH 3FB5A 4EQ2A 3UCRA 2YPLA 2C3GA 1FZKA 3SJVA 2O5YL 5IWLA 4Z78A 3H9HB 3C60B 3T77A 3LVEA 1QSVA 4G43B 1WQVT 1IGFH 2MKWA 3GKWH 4NRZA 2A9ML 4PRHE 4OD2B 2PF6A 1K9TA 1LP9B 5FHBL 1RZGB 3IDYB 1TNNA 2VDOH 2YEZB 1A1OB 1FV1A 3WNNA 3VXPA 2P5EB 4OZGB 3REWA 4DK3A 1BREA 3RZCB 5EU7E 1X4XA 3H0TB 4I5BA 3HPJB 1HH6A 1RZ7H 1DQJB 3MMEA 1ZVSB 5C6TH 1Q0XL 4YLQT 4M7JH 4ZSOA 4G6MH 1B2WL 1S8DA 1FO0H 1YUHB 2YUZA 4Y4FD 3RNKB 1Z6JT 3EJZC 1NGYA 3MO1A 1GGBH 1IGTB 1CR9L 4KVNL 3HE6C 5HI4D 3SE4A 1F6LL 2HMID 1CCZA 4QHUA 2P7TA 3FT4A 4KMTL 1JPST 5DDHA 5DHXB 4PJXE 2DD8L 2DWEA 4HS6A 2QQKL 1A6AA 1LO3L 4JM4H 3KYKL 2ZUTA 3LKOB 4KQ4L 4F2MA 1A6WH 3P0YH 4XPGL 1ZA3B 1JZ5A 5CKGA 4WJ5B 1T6WA 4PRHB 4ODXB 3GI8L 1CD8A 3JUZA 5IMOA 5JW4N 1P4LB 2VDKL 3MRNA 4FXKA 3C6LA 1AO7E 3SGJA 3BP6A 4QCIA 4KDTC 4TNVK 5IQ9B 1I85C 1VENA 3QEHB 3S88L 3KYNA 2MOVA 4KKBC 5T5NG 4Z0XB 1OSPH 1NCBL 2DIJA 3X13A 3VG0L 3IU3B 5GRZA 1JJUA 2AJZA 2C3WA 2D4FA 4OB5H 5C6WH 3RWCB 2A73A 5EBLB 1A22B 1D9KD 1ZT1A 1SBSL 3TIDB 3V79C 1LE5A 3DOSA 4L8BA 4NO3B 2FCBA 3MJ9A 1DBMH 4JAMB 3QR2A 5CBEA 2OMBA 4HXBL 2Z8VC 2DLHA 4RMRA 4LNRB 4XXCC 4ZXBD 3VWJA 2BMKB 5DEGB 3O2DH 3UEZA 4ZQKB 2FBJL 5MEOA 3OHXB 5GGTA 1QSFA 1X3DA 1WIOA 3O6FB 5EOCH 4N0CC 1QFWH 3N1QC 3V0VB 1OP5K 3IGAB 1VEOA 3TZVD 5BRZE 4J3OC 4QRPE 2V2WA 4PRIA 3QEGH 4LCWA 3ES6A 3K7UA 2RQ8A 1FIGH 3ULUD 4H26B 3HG1D 5IBUB 4XI5C 1KGCE 4HAFA 5GISL 1GZQB 4MB4A 3GSNH 3F7VA 5F88A 3REVB 4M3JA 1IGJA 4RZCB 3L5WA 1I7TB 2YSSA 5A2IH 5FKAB 5E8OB 3BUTA 1X5XA 4M4PA 4GQPH 3JXAA 1FNGA 4AT6B 4GKSA 3WFBL 4F15C 3C5SA 2Y6SC 3BPLC 3QFDA 3AAZA 3GJEB 2VAAB 2VKWA 3ARDC 4L4VD 4TVPL 2MPAL 4EUPA 1NLDL 1GHFH 3T4YA 4L29A 1ZLWH 4N1EA 5KSUB 2ATPB 3ZSTA 3P4OB 3M8OH 4MD0A 4TQEH 1G9NL 3PF2A 5IW6A 1S78D 1MWAL 1IRAY 2OQJB 1CGUA 2DQIH 3AB0B 4YHMH 3GNMH 3S35H 2FL5B 1N5YL 1WAAA 5BRZB 2OX5A 5JHDD 4JKPH 3QNYA 3L7EA 2BDNL 4YHIB 3HUJF 3TBTB 1OD7A 3WIIH 1X4ZA 3MROA 3WLWD 3ZMRA 5HYJB 1T83C 2GCYA 4HWUA 1BBJB 4M62H 4WFEE 4GAGH 2HFGH 3T65B 1MQKH 2AJUL 3ETBF 2Q6WB 4AL8H 4Z6AT 5IK3B 2WWMC 5ALCH 3BKMH 1YQVH 1YYLL 5CEYA 1KB5A 4Q9QL 3PIQA 1HKLH 1JCKA 3V7AE 5C2BH 1SJXA 2J6EH 4QGYA 1XIWD 4OCWH 5FDWA 4YXKL 1X44A 2AI0H 5EO0A 1Y0LA 4GMSH 1TCRA 1F11B 5EZOL 3M07A 4JN1L 1MLBA 5DQ9B 5E9DA 4S1QH 1TTFA 4PJEA 3SGEH 1VESA 1IFHH 4OZ4A 4Y2DC 3S96B 1Q0YL 5ILTH 4XNYL 4HGWA 5F7LB 2JK5A 2B1HL 2VR9A 1UG9A 4DEPB 2Q7YB 3QJFA 5C07A 5SWZD 3FJTA 4HIHA 4Y4FB 1FJ1A 1Z9SA 1BVLA 3GHEH 2UZXB 2NY2D 3IF1B 5E1HB 2ZUVA 1ONQA 4TUKL 1RIHH 4YIQA 2BXZA 3GFUA 5DMYA 3SKJH 5KANG 5TF1L 4PJCF 4HUUB 2XWTB 3BD4A 4X9HA 2VITB 5L0QB 3MJ9L 4HKXA 3ALWA 4FXGA 4IMKC 2APTA 4LHUD 3QQ3B 1VKXA 3TBYA 4WCYL 4XC1H 2CRIA 3CPLA 4OZFH 4JDTL 4K2UH 2ZSVA 4WDIB 3D69A 3LKQB 4JFEA 1TQBB 2VXQL 4ODHH 4I48B 5AEAA 1MCEA 4Z7UA 1EHAA 4KQ3L 3I6GB 3MRGB 5E2VH 2XWBB 5GZNC 3KPSE 1E27B 1JWUB 4DGVH 3LZFL 4RBPH 4XP5H 1GXEA 4MVBC 4ODWA 1KBGH 5E70A 1X7QA 2OTWA 3S9DB 3KPOA 2E7LC 4G5ZH 1BFVL 3OPZH 1P6AB 4LSVH 2JJSA 1W2KT 4S0SD 4NZRH 4P0DA 1IGIH 2I60H 4DKFL 1A14H 3TCXA 4ZFGH 2UWEE 1RZJC 4XPFL 1D9KB 4YHLL 1KV3A 3T3PE 3WDHA 3MA7A 3UYOD 4FMKA 3D18B 4G8GA 3ZKNC 4Y1AD 3IB4A 2LVCA 1EFXA 1UB5B 1IAOA 1A9EB 3LCYA 4ZXBB