2VSCA

Structure of the immunoglobulin-superfamily ectodomain of human cd47
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
115
structure length
115
Chain Sequence
ELLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords LEUKOCYTE SURFACE ANTIGEN CD47
publication title Paired Receptor Specificity Explained by Structures of Signal Regulatory Proteins Alone and Complexed with Cd47.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vscA01
3GBMH 4IHOA 4Q6YA 1B4JL 5INDB 3W0WB 4A6YA 3B5HA 3JV0A 4JO1L 4R8WH 5IKCA 4KROC 4Y4HA 3U36B 4YAQA 3CU1A 1JHTA 5JXEA 2X7LB 3DX6A 2GTWA 1DVFB 1UEYA 4M7KL 3UYPA 3OBAA 1RZJC 1WQVT 4XMLH 1T20A 2A2QT 5E99H 1IFHL 2APWA 2I26N 2F74A 4Y5VB 3QIWC 4CVZA 3NPSB 2DQEH 4LLVA 3NA9H 1T1ZA 4ONGL 4WU7A 3JWOC 4BH7A 2DIJA 3MUGB 3UYRL 1XEDA 1IL1B 3QHFH 1S7WB 5A16A 3IDXH 1A6WL 1LEIB 1ZHNA 5AD0A 1IC4H 3C6SB 5T3ZH 3U1SH 4M93B 5C0JB 4WI3A 5EO9B 1JNHB 4YBLB 4QOKA 4YQXH 1P1ZB 4YHIB 2LAAA 5LBSH 1HYRC 2XZCH 4G8IA 3L7EB 4TUJA 4NFCA 5GGQL 4OIIH 3RL1B 1LO5A 2EYSA 4OGXL 3L1OL 4MAUH 2WWKO 1YEJL 4PGBB 4QGYA 2GCYA 5D7SH 1FZMA 3P4OB 4R4BA 5GRVL 1BFTA 5GS2D 1KTKE 1T83C 1DCLA 2FNBA 2ESVA 3BHBA 4OCSL 3BKYL 2BJML 5E4EC 1A7PH 4PGDB 1U3JA 3SCMD 1NGQL 3VRJA 2BFVL 3R4DA 5FK9B 1UH3A 4GBXC 4D8PB 1BOGA 2AGJL 2E7LA 4FQHA 3C60A 4WU5B 1YECL 1YNLH 4ZUUA 3S37X 4CBPA 5BV7H 3QT2A 3EJJX 4CVWA 4N0FB 4XP6L 2GK0B 2CO6B 4X6BA 4GG6B 5IHZA 4WY7H 2ILLA 1ZKAA 4NQXB 3DYOA 4N8VA 1G6VK 1FC1A 2HLAB 2ADJB 2D0FA 4K2UH 5CLWA 3ARDC 2IF7A 5IMKB 1QOKA 2V2WA 2XKUA 3DHMA 1G9ML 1RJCA 4HWNA 4X83A 5E7BA 2R56L 3X13B 3EJZD 4UT6L 3BQUD 1Y6KR 5E5MA 2H6PA 3WJLC 3S5LA 3ZT6A 5EBGA 4JFED 2A83A 5IWLC 3MUHL 1ZS8B 1U93B 1YPZA 4HFUH 5HDQL 1D5IL 2X1XR 4P2RA 4TQEL 4ZO6A 1AE6H 2OZ4L 3PWVB 4R4FL 1RK1A 4GT7A 1OD9A 1J88A 2AJ3A 5GJTH 1HK6A 4O00A 2OMNA 3OXSA 4X7TB 1WBYA 2PTTB 5IESH 4IMKA 1YEHL 3LIZH 4P3WA 1FVDA 2DQFB 3H9ZA 2D9CA 4B53A 1FFNA 1N5AA 5BZDA 1T1YB 3QPQD 1C1EH 1JL8A 3GHBH 4KZDL 1GPOL 5D1XC 4HS8L 3NFSL 4F7MA 1XF3B 4NQVA 1JI1A 5E1HB 4HKJA 4JRXD 5IR1B 1VGEL 5EU6E 3D25A 1BVLA 2VXUH 4DN4L 3FOMA 4AH2A 3ULUE 5IB5A 5EZIH 2NXYB 1A14L 4G9FB 4YZFE 1N8ZA 2DIBA 2IPUG 4PJEF 4JVUA 3FO0H 5IB2A 1MPAL 4R7NA 1CQKA 4YHNA 1EX0A 4J6RH 3ARFD 4TNVK 5DO2C 1PG7W 5J0BA 1AC6A 1NLDH 3EUUA 3UJJL 4LDEB 1M71B 1XAUA 3GIZH 1N7MH 4ZAKB 4DFHA 4P3CH 4P23C 4U1KB 2V5TA 3QBTB 3U0WL 1F6FB 3TZVD 1CYGA 5HYJB 1S7RB 4POZD 4OSUL 2GUOA 3B9DA 3W39A 1I9IL 1NCUA 1CK0L 3KPLA 4K3EL 5F9JB 1WUNT 1EEQA 3FO1A 2B0SL 2JELH 1DFBL 3B3IA 1ORQB 4XRCA 5I1HH 3OGCA 4TULL 3CJJA 2O5XH 5TDNB 3GSVA 3DMMA 3VGBA 4P48A 4L9LA 2BVTA 3MRHB 1YEIH 1KT2B 4WV1A 4XPGH 2CKBA 5EN2B 1MHPL 1S7UB 3WYRA 3T09A 3DETD 2F19H 4PJBA 4RRPA 3LPFA 4LCWB 4JDTL 2B1HL 2NY4D 3BKML 3ZTNL 3UEZA 1EFXB 3KXFD 2R1XB 3BJ91 4KHTL 1HHJB 2DQJH 4KFZC 4XXDA 3OSKA 3Q5YA 4Q0XL 1F3JB 3QCTH 3UTZB 4K3JL 3EYOA 5I1IH 4OLEA 1OAKL 4M61B 2CIKB 5LXGL 4YXHL 2WZPD 4Z77A 3H9HB 3AXLB 3MV7B 3VD5A 3PWJA 1FFPB 1U8JB 4KQ3H 5HD8D 4IDJL 2I9LB 3H9SD 1U8NA 3WFZA 4PJ7B 4WNQA 5ADPH 5IV2B 2NXZB 3IJSB 2F54A 3DSFL 2DQCH 4ZUWA 2R0KH 4JKPL 3ZKNC 5I15L 4X6CA 3MRPA 3L3IA 5IVZA 4BSVA 1N0XH 4PR5A 3F5WA 4OF3A 1IM9B 2Z4QA 5H37G 3U7YH 4LF3A 2VAAA 4JM4L 3IJHB 4K7PY 4L5FH 1S78D 2BXYA 4NNPL 1KSRA 2ENYA 1S7QB 4JFPB 4YHYB 3SPVB 2E8ZA 5DDHA 3FFDB 2NTFA 3AS2A 1ZLVK 1WJ3A 1R3JB 1UWGH 4A6YL 2DQGL 1KB5B 2EEBA 2FRGP 3QWRA 4AL8L 4GRMA 5ICZA 5FGCB 4KDTA 3GSQA 3PWPD 4P59L 4L4TB 1PVHA 4KY1H 3QDJD 4RMWA 4CRPA 1QBLH 3QUMH 1ORSB 2AJYL 5MHSE 1UACH 3OMZA 3JTTB 5DJ0B 5CJOH 1MSPA 3GZKA 2IFFL 5GJSH 4C56E 5ERWB 3EOTL 4I9WE 5ESAB 5TQ0H 3VXPB 2X9WA 5EU3A 4FFYH 5B8CA 5FYJU 1P4IL 4QRPA 1UADC 4R4NC 5DRXA 2PO6C 4C59B 1R5VB 5EA0H 3VXMD 4J3SA 1LO4H 4JZJA 1KXQE 4HWBH 1OARH 4YHZH 1MAKA 3MODH 3LN4B 5D2LA 1MCRA 2Q76B 3QI9A 4O02H 4MAYB 3SBWC 1ZLWH 1PZ5B 5D2NC 5DD1H 3QNXA 1B0RA 5CCKH 4NKIL 2VL4A 4IRJA 1FPTH 2J8UA 1F90H 2D7TL 1QUNA 1NBYB 3G5YA 3MRKB 2RAMA 2H3NA 4OQTH 1PDKA 3GSXA 3NIGF 3NAAH 1AGCB 5IEHB 3K4AA 4H25B 5IF0B 3SJVD 5IHUH 2C9AA 4KKBC 1KPUA 3DXAB 2JCCA 4J3UA 3EKCA 5TGBB 2JJWA 4GAGH 2BOCA 4FQ2H 1AR2A 2Z91A 1E4XL 3RWCB 4K94L 3DRQB 5IOPB 4YPGA 4Z5RB 1BFVL 4M5YH 5EUOF 4JKWA 5L6YH 5D71H 1GGCL 3QWOB 4LBEB 4GAYB 4X4YA 1LNUB 2XPGB 4PG2C 1WK0A 1EDQA 5D7KE 1A7QH 3MRCB 4P9MH 5ISZE 3HNSL 3J7HA 2BERA 4PJ5B 1MCBA 3DVFA 1UQSB 2I9TB 2FH6A 4OCRL 1UXWB 1UH2A 5JHDA 1MREL 3EO9L 4JN2A 2VDRL 1T1XA 5LJYH 5FUCC 4P9HC 2YBRB 5DUBB 3ALXA 1IM3B 4MD5A 2NY6D 1X5GA 1F4YL 4IJ3C 3QEQD 1T21A 1T4KA 5DK0B 2BY1A 3FQNB 1OM3H 2VXTL 3K4DA 1FO0B 4G3YL 4DEPC 4KRLB 5HGHA 2B2XH 5MEPB 4F80A 1VSCA 1YYLL 1G6RB 3ALPA 4TOYH 4AG4H 1IZKA 4X5WA 3N1FC 3QXUA 3QP3A 1V05A 5C0AB 4GKNA 3T04D 5DJCA 4G43A 5D7JB 2OLDA 3TA3A 4MD0B 4MDJA 2AI0H 1MCOH 2Q8AL 3W0WD 3IDMA 1UB5B 5F6HI 1REIA 1RUQL 3UCRA 4EN3D 4HKZB 3IKCA 3VA2C 3HE6C 3WO4B 4JRYA 4U1JA 5SX5H 2ORBH 5C0DB 5FYLE 3PGCA 3MRIB 4WI6A 5DJXB 4NJAL 4XHJC 2H2SC 3DUUB 3NZHH 4LP5A 3JZ7A 4BH8A 2BVPB 1GGUA 5DUPH 2HRLA 1UT9A 1SJHA 3U46B 5T3XE 5F7LB 4K3DL 3PL6D 4UDTB 4M1CD 5FO7B 1TETL 2AJSL 3GMMA 1DN0A 1RSFA 5KSUB 4KKAD 3P11H 1KIPB 1WFUA 1DQJB 1V7MH 3FQXA 3VG0L 2DQIH 3C8KA 4RQQB 3C5SA 4TSCH 3TYGH 2E6PA 3QO1A 3I6KB 3G5ZB 3I50H 4OV6F 3PG2A 4M4RA 1QFWH 4NYLA 4YDKH 3BRFA 2HT3D 5FA4B 3X3FL 2GHWB 4HLJA 5ID0B 1CE6A 4JN1H 2FR4A 4Y1AA 2X4RA 3VW3L 4EI5A 2JJUA 1C16A 4JVWA 4NQEA 2P8MA 4GG6E 1ACZA 2CKBL 5CMAB 1QKZL 4PUBL 3QQ4B 4QRSA 4KUZH 1P84J 3GDBA 4DCQB 1ZGLA 3N50A 4UV7H 3IFOB 3QIUC 1L9MA 2Q7NA 1NEUA 4ONFL 1IRAY 2VITA 2DM2A 3JTSA 3LD8C 2ITDA 1NFDA 5FHBH 4JPVH 5DYOA 4JHBA 2Q8BL 2EDFA 5KVFH 3VXNB 2VXSL 2X4TB 3MV8A 2CDEA 4HIEA 1N6VA 4P2OC 2Y06L 3AY4A 3PWNA 1I3RB 2F8XC 2FSEB 5B38A 2VWEC 1AHWC 4HX1B 4NWUL 4BK5A 2IH1B 2HAZA 1C8PA 3BN9D 1SEQL 4D9RE 4ALAL 2QQLH 3G04B 3KPMB 1YQVH 4NO0A 4I18C 4JY6B 2XNAB 1NAMH 1YEDA 1II4E 4G42A 5CEYB 3VFVA 3QISA 3CXHK 4XVJL 4Y5YC 5KJRL 3KLAB 5C09B 5BO1L 4QLRA 3UBXB 2IQAB 5LWYL 1OCWH 4M7JH 1NL0L 4N0CC 4R9HA 5DD5L 2HRPH 2VQ1B 3DNKA 4MYWB 4PJAF 5J11B 3LRHA 3P0YH 1JRHI 3CMOH 4KV5F 2R9HC 5DD0H 3T0DA 1G0XA 5KSBA 4PJHE 3O4LB 2L4OA 3RGVC 4N9GB 4NBXB 3SKJH 4RMVA 1QRKA 4WTZA 4LPVA 4UAOC 2W07A 3BKCH 3WKMH 4NCC1 4WO4C 1RJLB 1RUML 3HRZA 5J13C 5C1MB 1F42A 1T1WB 4HPOL 3M17A 4EZMA 5T33H 3VGDA 4G9FD 2Z35B 3CD4A 5ICYB 3DVGA 4Z7OF 3MXWL 1KCSL 1CLOH 5DHVH 1FRGH 2C4XA 4P46C 3R8BB 3DVNB 4OM1L 4TSBH 4Z78A 3CPLA 4PJ9D 2ENSA 4XCFL 3TVMA 1VKXB 3DGCR 2HP4A 5C9KA 3VJ6B 2CR3A 2G2RA 4FG6C 1B4JH 1VFMA 1JWUB 4HW6A 1LDPL 2BNUB 4JO1H 4LSSL 4R2GB 4CADA 4HS3A 5HYJD 1YJDL 3VMOA 4LCWE 1KXVC 1WV7T 4M7KH 1KLUB 4ZPVB 3CX5K 1SY6A 2EDKA 2AXGA 1IFHH 1NMCB 3L3HB 1F8TL 1LO2L 1A6TB 3M07A 4WI8A 4U6XA 6FABL 4FQ1L 5IB4A 3UYRH 3MV7E 4M7LT 4TTDD 2VDKL 3KJ6H 1FN4B 4JQVC 1A6WH 4EI6A 4NQDA 1GIGL 3HR5A 1EFXD 3FONA 5C8JB 1NJ9B 4Q97A 5EORH 4UINL 5I66A 1MEXL 5J4MA 1FJ1B 2GY7B 3ZSSA 1OWWA 5TF1L 4MZ2A 3QAZB 3QUXC 1YMHB 2Y4SA 5GGQH 3FO9A 4CUCA 2NW3B 1FNLA 2ATPB 1MCWW 1T3FB 4OGXH 1FNHA 2Q7YB 3L1OH 1UJ3C 4ZUVB 3VXSB 1EH9A 1YEJH 1H8OA 3BAEH 4GG8B 4ELMA 2NXZD 5F89A 3VE0B 4APQD 4X80L 4WTWA 5KTEH 3C6LB 5FGCE 4PREB 5A2LH 4TVPD 3BKYH 2BJMH 3SKOA 5JXAH 1NGQH 1ZGLP 2YD5A 2BFVH 5EO1A 4JANA 3VXUB 4PRPB 4LGSB 2EDRA 2ARJB 3IU3B 1YECH 4FQXB 1OW0A 4XP6H 3UPRA 3MROB 4OAWA 5I75C 1TNMA 3BD4A 2OSLB 1TVHB 1MFBH 3LPGA 3HE7C 4J4PC 5I19H 3RY6A 5D7IB 2YMXL 4L4TD 3LKQB 1CXFA 5DZNA 3QDGE 2R56H 4KVCL 3D3VD 3D85A 4UT6H 2UYLB 2P1YA 4L3EB 1ZLSL 3U30C 1I9RH 4M48L 3RWEA 1T7YA 3VFNB 5ID1B 1XGUA 2IAMC 3MLYL 3L5WB 3TYFA 3ZHLA 1ITCA 1WF5A 4MDIA 3FQTA 4RGND 1D5IH 4JDZB 3NABL 4TQEH 2R4RL 4PGEB 2OZ4H 5CGTA 2APTA 2ICES 2A74A 4X9FA 3LQAL 3R0MA 5EPMB 3DXAE 1CICB 4MAYD 2J2ZA 1YEHH 1QPPA 4PJ8B 1UG9A 5FV2A 3KHOA 4XT1C 4F2MB 3JWDH 1JF1A 4KZDH 1GPOH 1MQKL 1UZ8A 4HS8H 3O3EB 3NFSH 1E4KA 3ARGA 4LASL 3QDMD 1VGEH 4U1SA 1Q0YL 4DN4H 8CGTA 4XBPA 4J8RB 2AV1B 2MJWA 4F7CB 2A6JA 4B41A 4WENB 2AK4A 4GAJL 4LLDB 5E2VL 2XWBB 4PJ5E 3INUH 3U6RB 5JZ7C 3I3EA 3OKMA 3D69B 5D9SB 1MPAH 2WINA 1DBJL 1V3JA 4X8XA 3MYJA 4G6JL 2ED9A 2ZSWA 3UJJH 3TF7C 4XPHL 1I1YA 3FQWA 1J10A 1SMOA 2HWZL 1AGFA 1AO7D 3OXRB 5E24E 1U6AL 2V7HA 5C0CB 3U0WH 1HQ4B 2V6HA 5IUSA 5FYJD 2K3TA 4BQ9A 5BJTB 4OSUH 1U3ZA 3I75B 4K7FB 1XZ0A 2VL5B 1CK0H 2COQA 2XN9D 1MFCH 4K3EH 4FRWA 4ZDHB 1RZ8B 3ILPA 2YOCA 2B0SH 3HMWH 1DFBH 1R3KB 2YRZA 4ETQA 4JJHA 2G75B 4P57B 5DJ6B 4CU6A 2Q86B 5C0AE 4TULH 3VRIA 3LS4H 2J5LB 3VXRA 3D1MC 1ZT1B 5ETUB 3KPOA 3CXDH 5SWQA 5JQ6L 2VQUA 4OLZH 1CCZA 2GKIA 3H7BA 1NUDA 4POYA 4XH2A 3TBTA 3C2AH 4WW1B 3PABB 1ZWIB 4HUWB 1MI5B 5FDWA 3AVEA 2ARJQ 3TBYA 3D39B 1YMMB 3O3DA 1WT5C 4JDTH 3BKMH 1QVOA 1KFAH 3EOYG 5AEAA 4KHTH 4AIOA 5J06A 5L2KA 4OM0L 5C0AD 2ZOKA 3E0GA 4Q0XH 1CFQA 2NQCA 4NPYB 3T4YB 4OKVA 4XC1L 3RU8L 4K3JH 3SE3C 2LVCA 1OAKH 4MNQA 5B39A 3CFEA 1VEOA 5DJ8A 1I1AD 4HAGA 1LEKB 3FL7A 1MAML 1AIFB 1CZ8H 1ADQL 4FQXC 1MFDL 2D7MA 2WBJB 4UILL 4I0PB 4IDJH 2F53B 3NFNB 4JGUA 4L8SC 3DSFH 1A1MA 4JKPH 5ESVA 5I15H 1NBZA 3O6ML 1DEDA 4MVBC 4PRAB 3A6BL 3EYSH 1M7DA 3LEVL 4LARH 1W2KT 1TTGA 1G7QB 4DGIL 3SKMA 5K9OB 2HTKC 3L3OA 2X4UB 4NNPH 5E70A 2J6EL 3PGDA 5JDJA 1P4BL 4UQ2A 1G7IB 5DJYB 1DUYB 4JFHD 5DMIL 5T5NG 4A6YH 2DQGH 2FCBA 3MGOA 4PLNC 1CG9A 3RWIB 2D7PA 3W9EA 4P59H 2E6JA 2Y5EA 1BWWA 4G7VL 3WSQL 4NRZA 1S5HB 5I8OL 4GBXA 5EZLA 2YN5A 3BQUC 3UO1L 5GRJL 4IS6B 4PJEE 1V5JA 2A6DB 3EOTH 3RWGB 5JPNA 5KZCB 3V8OA 3L95A 4Z7UA 3MLTB 1P4IH 5BW7C 4CW1B 3LVEA 3BP4A 1R5IA 4NT6A 4Q6IA 4O4YL 1EO8H 4GUPB 1FG9C 3ARDA 5MERB 4NKOA 3F6LA 5C2BL 3OKEA 3RDTB 4L3AA 5K9KA 3TN0C 5KSAB 3OF6D 2NY3D 1QSFA 3DRTA 4X98A 1WWBX 3MBEA 2P24A 4PJGA 5AWNL 3GSRB 4NKIH 1A4JA 4X5XA 4I48A 2EH7L 5EOTB 4XWOC 3V8CA 1P5UA 5C09E 4RIRB 4LCYB 3ULVL 4X7CC 3BPOC 3H8NA 4PGCA 1OT2A 2V7NA 3G5XB 1NFIB 2VZOA 3WBDA 1BZ7A 1MCIA 4GKOA 1MQ8A 4KJWC 2GJ6D 2P7TB 3L5HA 2QQKL 5T5NF 1E4XH 4K94H 3EIFA 1V3MA 5TDOB 1FYTB 3RUGF 5CEZE 4ERSL 4YDJB 2YPVL 1OP9A 5CSBA 3C8DA 2P5WA 1GGCH 2LQRA 3PV6A 5J6GB 4KKNA 2VLJA 1GOHA 4ZFFA 2BSSB 3UTSD 1BZ9B 3HNSH 3LQZB 4BQCA 1KLGA 1ZHLA 2WBWB 1B0GA 3QH3A 3WDJA 4OCRH 1QR4A 1PKOA 4WWKB 4OFYA 1MREH 3EO9H 5JDSB 2VDRH 3V5DA 3VFPA 3O4LD 3HS0A 5CEZD 1OD7A 4H8WL 3HI1B 4RA0C 1U8PA 5FCUL 5DMYA 1SVCP 4YXKL 1Q94B 3MTRA 5CUSH 3A6CL 2FJGB 2DI8A 2NY4C 4G3YH 4IIQC 4NHCL 1YYLH 1OTSD 3QXDA 2W1NA 3NIFE 1BIHA 2PYFB 4W4OA 1H5BC 3B9EA 5D8JH 3GMPA 4HIIA 5DF0A 3T4AB 1OGTB 1XR8B 2O5YL 3C2SA 2A9MH 2APFA 3X12B 4HK0A 5HGBA 3IF1B 4RFNC 1RUQH 2HN7B 4R2GD 5E2WL 1RZIB 5LAXB 3E1F1 3QUZB 1HHIA 5BS0B 3LHPL 1MCEA 2DTML 1KJMA 2EXWD 1QSEA 5IROC 3QUKB 5SV3A 5TDPB 1TDQA 4ZO8A 3MRDA 2NZIA 4NJAH 5DMKA 4RMQA 4DKFH 2OJZL 3P9WB 4ZTOL 2JJSC 5CZKA 2Q6WB 3WDIA 1ZLUK 1OAUH 3D2UB 2X10A 1K3IA 4QRQA 3NCJL 3PQYB 1TETH 2AJSH 4B5EA 2FYYA 3TM6A 5BV7C 3VXSE 4GJTB 3KDMA 5KVGL 4QT5A 5C6TL 5DC4B 3VG0H 5I8CA 2R69L 3SDXB 1N59A 2QSTA 1JP5A 2EDDA 3QFJD 5HVGB 5E08L 4ETYA 4UV4L 1PKQA 1FFQA 3B2VL 4MWFB 1L0YA 43C9B 5IMLB 3VXUE 4PRPE 3T77B 2BOBA 1AQDB 3HZKA 4GFTB 3HPJB 3GO1L 3MR9B 1G7MB 1X5FA 2CKBH 3V2AR 1QKZH 4PUBH 5B3NA 3C09B 2AKRB 1UB6B 3IXAB 2X4OA 4R96B 3SN6N 2EIBA 4MXQC 2HLFD 3C6LD 3QG7L 2WBKA 1E4JA 4JFOA 1HILB 1RZJL 5D7IE 4LPTA 2ZOLA 4PJFE 2Q8BH 2YSSB 2VXSH 3FTGB 2O61B 4MQXD 5FYKD 1IGJB 3DTXA 4LKXA 4L3EE 5E9DD 3MA9L 3JWOL 5DRZA 3WL9A 2D7OA 3R0NA 1KB9K 3H42H 3NH7L 3MLPA 3BEWA 2Y06H 3DHJA 2E6QA 3D5OF 2PTVA 4Y19D 3ZTJG 3MLXL 1JHLL 4MSWA 3PJSA 2DWEB 4U1NA 3MRJB 5JW4R 1TFHA 3BDYL 1SEQH 4ALAH 1CD1B 3OKLB 1QLFB 5D2NA 5IK3A 1J1PH 1QNZH 32C2A 5GZOD 5AG9A 1S7XA 1FAIL 4OF8A 1F97A 3WXWL 1CXLA 1I1FA 1DEEA 1X6NA 4XVJH 4V1DB 1FVCA 1BBJA 3EOBA 1INDL 4HH9A 4HUMB 1UCBH 2A6KB 2OTUA 4S1SL 3HNVL 3HC3H 4CKVX 5LWYH 1ZA6A 1NL0H 3FB8A 5DD5H 5LGJB 2CJUL 3FO2A 2CK0L 5EOCL 3S36X 3QEGH 3WE6A 2Z31D 5F1KC 1BLNA 4XMKL 2BVOA 3REWB 2AEQL 1BD2E 1D5ZB 5DSCA 1MIML 3L3DB 2NY2B 1CICD 4I0CC 2DWDA 2J1KA 4PJ8D 4X6FA 4C4KO 5EU5A 4U0RB 3ARBB 3TC9A 3ZDZE 3KLHC 4W6WB 3LKRA 1CT8A 4KGLA 4PG2A 2IADA 3UBXG 2YS4A 5IBLD 1RUMH 3VH8B 1KTDB 1FYHB 5C0CE 5L88H 4QY8A 4Z0BL 4HPOH 1YEEL 2Z8VC 5GS1A 2NX5B 3MXWH 4C83A 1KCSH 5DQ9A 4YJZL 1EO5A 4Z76A 4JM2B 1T6VN 4OM1H 4QYOB 4XCFH 3P77A 3FFCA 3QEHA 4M6ML 4CL7A 3AS1A 5J1TC 4MCZA 5IFHH 4KRPC 5E8OA 1XIWC 4F57L 5F9WC 2VXQL 3BN3B 4DGVL 4XPTL 1CDHA 1LDPH 4JAMB 1QEWB 4LSSH 4EN3C 5TH2B 1EHLL 1VHPA 2BZDA 5C0CD 1FZOA 4UDUA 1YJDH 3D39E 2PW1A 3SDDB 3UTTB 2VYRE 2PW2A 4JO4L 2X4QB 2RBLA 5C0BE 1IAKB 2X4SA 4X4ME 4YHKL 5FOBB 1F8TH 2VN4A 1LO2H 1FH5L 3GSOA 4RX4A 3W5NA 1A1NB 4U6YB 3MREA 3GGWA 1JGUL 3NZ8B 4FQ1H 3PL6C 1X5AA 4H0GA 3Q1SL 4ONHB 3HG1B 3WLBA 4LCIL 1JTOA 3CLFH 4KKAC 1MI5D 5DLML 1PX4A 3HE6A 2VDKH 3D39D 1YMMD 2F53E 4MB4A 4IM8A 5HXMA 4DFIA 3UTQA 3B83A 4OZHA 1YNTA 4ZUSA 5D1ZD 4CMHC 4G9DA 4UINH 5I1CL 1A7NL 3KYMB 3E6HA 1MEXH 4MA1C 3GSWB 1OGAE 1AD0A 1ZVYA 1BM3L 2EDEA 2HT3C 2YRLA 4JJ5A 5T3ZE 5HI5C 1E0OB 5E8EB 5TF1H 3U48A 3RI5K 5TFSL 2HFGL 5ELIA 2APBA 3G6JF 2C1PA 3VGGA 4R97B 4S1DD 3ZE2F 3IJYA 4Y16B 3AMKA 3MNZA 3L5JA 4NO5B 1UGNA 2B39A 4CVXB 4X80H 3G08B 4WHTA 3OAYK 3MO1A 2RR3A 5IVXB 2NZ9D 2W9EL 4JFDB 1R5WA 4LSQH 5D5MB 5D7LB 3TPUA 4PJAE 2W60A 2X41A 3KNBB 2VR5A 4D9QE 4ZOAA 1HKLL 1MWAB 3QRGL 1RD6A 1U0QA 5T3XL 1AGDA 2P8LA 4AEIL 2JIXB 4LMQE 4C55A 1CFTB 1BQLL 3BWAA 3Q3GB 2D4DA 2GJJA 5I17B 1QA9B 3H6JA 1NGPL 4XAWL 1Y18A 1CVRA 2DN7A 2YMXH 4K7PL 3C5JA 4UOW1 5MENB 4F7EA 2XFXB 4YDVB 2IALA 4FTVB 4PRIE 3S4SB 1E27A 4KVCH 4YBHA 3ZL4L 4D2NA 4Z7OE 1PAMA 4QXWA 1ZLSH 4DK6A 4M48H 3MMEA 2Z93A 4PB0L 3UC0L 2K1MA 1QPXA 4P2OA 1WEJL 5A2KH 5EUKB 5C07B 3MLYH 1CWVA 1M7IB 4FNLH 2ZPKL 1JI2A 1A02N 3NABH 3U9PH 1QTYT 4DTGL 3MJ6A 1FNFA 1NGXB 2DYPB 4LKCA 2LAGB 3LQAH 3TT3H 3RDTD 1CS6A 1R3HA 4I18A 5KS9A 5HGDB 5KSAD 3FN0L 1FZKB 4HIJA 1INQB 1L7IL 5F6IC 5DA4A 1NMBL 3HUJA 4NN6B 5JIHA 1MQKH 1FYTE 2AEPL 3BH9B 1S9YB 4M1DL 1T7ZA 4OD3H 4UUJA 2V5YA 3MA7A 1CDUA 3X3GL 4HWUA 2UWEA 5JW4Q 1HYSC 2JB6B 2Y9RT 2WIMA 4GW4B 4PJXB 3C5ZA 4FABH 5C9JB 5E2VH 1ZSDA 3ULSB 1HSAB 4JKKA 4PJ9C 1S9XA 4LGRB 3RGVA 1FVEA 3B4NA 1DBJH 4QHKI 1OOAA 1BPVA 1CTOA 3W9DA 4XPHH 4JREB 4LPUA 2HWZH 2HT2C 5SWSE 3FRPG 1AGBA 4WO4A 4KZEL 1U6AH 5JNYA 4ISVB 1EMTL 3MCKB 2GAZB 4PJDB 1FL6B 4YNYA 1VFUA 1IBGH 1U8LB 4I5BA 4P46A 3O6KL 3SGJC 3SE9L 2NYYC 4WWKD 3RPIA 2EYTB 4OV5A 1PYWB 2CR6A 3JBG7 4H5SA 1JBJA 5FM8A 5JQ6H 3FT2B 5FECA 3KYOB 5F88B 5DRWA 3ME0A 3I02B 4OB5L 3D0VB 1WAAE 2XZQL 3TO4D 4PRDB 4UNUA 5BS0E 1BFOA 3F62A 3FQUA 2CH8A 1CE1L 4OM0H 5I16B 4NSKA 5MP6L 4N5ED 1DJSA 4KRMB 4R0LB 1NGZA 5EBWB 1GVIA 4DN3L 3WDHA 3MFFB 4XC1H 1I8LC 3VFWB 2YD8A 4OUUB 4ELKB 1HH6B 1J9CT 2UZIL 3FCTA 1HHHB 1J8HD 3O11A 4Y4FB 3QRFM 7FABL 5J56B 2SEBA 2ZCHL 1ZE3C 3T2PA 1A3QA 4KXZH 1MFDH 3GJEB 4UILH 4PTTA 1S7SB 1LE9B 4JB9L 1AC0A 4APQC 5JR1L 3QUZD 3LH2L 2R8SL 1K4DB 4HXAH 5CBEA 3K1DA 1BOYA 3O6MH 3CDCA 1KLFA 3CK0L 3MRFA 3A6BH 2YA1A 3SDXE 3LEVH 1PD6A 5FO9A 2ATKB 3WJJC 4DGIH 4KK8C 1LE5A 4Z7VB 4P9HL 1R0AL 4GW5A 3MV9A 3PQYD 2L0DA 1P4BH 5DMIH 2ZCLL 2FL5B 3U7AA 5F1NA 4HAFA 5EO0B 4PRHB 3EZ8A 4LSRL 1VADA 4WHCA 4OLVL 4NC1C 4M9PA 2C3VB 4AMKL 3WHXA 1XH3B 4KK6C 3PGFL 4G7VH 3WSQH 5GS0D 3MUJA 5I8OH 4MA3B 3SDCB 3GUTB 1ZTXL 4OIAA 1XCTA 4ZOCA 3UO1H 2JLLA 5GRJH 1EO7A 4EVNA 1SEBB 1YNKL 3G6AA 2A0LD 2YPLA 2PYEA 4I3SL 3DBXA 2OK0L 4RGNC 4P3DA 1TTFA 4JZNA 3HE7A 3MRMA 4KJPD 1RV6X 4J4PA 5MI0B 1SJVA 2DMBA 3RVWD 5F96L 4DK3A 4KJQD 1GGTA 4JFXA 5C2BH 3A0OA 3IDGA 4XNZC 4S1QL 4KK5C 5FHAH 2QBWA 1WC7B 3Q6FA 5AWNH 4WUUE 1LK2B 4LVNB 1VPOL 3QCUL 5CD3B 3K0WA 4KTEH 4U7KA 4OFDA 1ES0A 3ULVH 3ZKQD 3BDXA 5H2BA 1W72A 2ZUVA 2BSTA 2Q1EA 3BGMB 2V2XB 3WUZA 3ZKMD 3OR6B 1FL3A 1S7VA 2EDWA 4JFFD 1XF4A 5C0EA 3KPPB 2QQKH 4W81A 1A1OA 2AJUL 2ZUQC 4FXKA 4V1DD 3RVUC 2YWYA 1H9VA 1YY8A 3GMLB 4HLZH 1QO3B 5ICXA 2YPVH 5E00A 5KG9B 1JVKA 4QHLB 4HZLA 5IW3A 2YD2A 5E5UB 2HJLB 5GQBA 4BYHA 5HHNA 3DYPA 3MRGA 2EKSB 3BZFA 5CJBA 5HI4C 3BH8B 4TPRH 3O41A 1K2DA 3NACL 2ICWB 2NX5E 3KWWB 2NY2D 2AXHA 1J1OL 2A73A 2Y25A 3K2UH 2HTLC 4OZFA 4X4XB 3SOBH 2NW2A 3W81A 5CHNA 4H8WH 2FJFB 3VI4F 2VDML 5A40E 4L8DA 3RTQD 5FCUH 4X7DC 1I7ZB 2HG5B 4YXKH 2HVJB 4YC2B 2BY3A 4S11A 1YY9C 3ESVF 3HB3D 1F4WL 3A6CH 4JO3L 4NHCH 3BZEA 4J1UA 2PF6A 2CMRL 4GRLD 2DOCA 2IBZX 4BSWA 2NX5D 2R0ZL 4XAKE 3MJ8A 1CDCA 4JM2D 2YZ8A 3HI6L 4X6CF 4MNGB 2KZ1B 1P9MA 1DDHB 2DM7A 4NKDB 5EZOL 3V0VB 1I1AC 5IEKA 1F45A 2O5YH 5F6HJ 2N7BA 4M5ZH 2GSGB 3LOWA 5T1KB 3DV6A 1KPVB 3QSKB 3HG1E 3M1BB 3PDOA 3A67H 1JGEA 5E2WH 4F37K 1AFVL 1ED3A 4Z7WB 5DC9B 3SDDD 3UTTD 4F15B 3LHPH 4HS6A 3DO7B 1XF2B 2X70B 4WW2F 2DTMH 4LEXL 5I2IB 1XR9A 4D0DB 3SE3A 1IAIL 4L8BA 4FQCL 2OJZH 3EYQD 4ZTOH 2OS7A 3U4BL 3IDIA 3HG1D 4S1RH 4M3KB 3WIHL 2OI9C 3NCJH 4XZUB 5EUOA 3RZCB 1PX3A 1C08B 1XGQA 5K9JL 5KVGH 1JK8A 5DURB 5C6TH 2MKLC 3OKYA 3SCMA 3EO0A 3OKKB 4HWEL 4XI5D 5IVXE 1HXYB 5E08H 1IT9L 4HK3N 3B2VH 1UYWL 3WUWB 5IB1B 5ECJE 2QJDA 5HHOD 4QRRB 5D2LF 4EXKA 5JPMA 3O2WL 1YEGL 3DUSA 2XXMB 3QULB 4EKXA 3GO1H 1OHQA 3O3AA 1SYVB 3L3GB 1U8KB 3AREB 2J8UF 4Y16D 4IHOB 5D93C 4XBEL 2DLEA 3FB7B 3QG7H 1MNUH 4A6YB 5JQHC 5IKCB 1A6PA 4JFDD 4QCIA 5IM7B 5D7LD 3BQUA 4YAQB 1K8IA 4UIKH 2NY3C 5CJXC 1BP3B 5IBUB 4FTVE 3DX6B 3SDAB 4JFEA 2YD4A 2JCCF 5FM4A 3BPLB 1DR9A 3NH7H 4GAFB 1O0VA 4LPYA 5GRUH 1A7RL 4JDVA 3JWDC 3MLXH 4BH7B 1T1ZB 3IXTB 4WU7B 1JHLH 3IDJB 4DQOL 4XBGB 2J4WL 5MEND 2AW2A 3BDYH 4YK4C 5A16B 2OTWB 4TUOA 4YWGL 5GSRA 1MLBB 3IAPA 3OHXA 2WWMD 3DGGA 1AXSB 1P6FA 2I07B 4DAGL 1FAIH 2ZNXA 2PXYD 1X5HA 3WXWH 4JRXA 2HFEB 5C07D 1TJIL 4S1SH 3HNVH 1KN4H 3CSYA 2H32A 4TUJB 2CJUH 1FNGB 1EERB 2R1YA 2Y07H 4ODXB 2CK0H 5EOCH 3Q5OA 1JCKA 2DYPD 3CH1A 4Y2OA 2EYSB 4BZ2L 3ARFA 4JFQA 1MIMH 4P4KD 5GSVB 4XPAL 3L6FA 2GJZA 3AROA 2ZKHH 4LLWA 4R4BB 5DC0A 1U91A 4IRZL 4PRBA 3NVQA 3TZVA 4NQCB 2MSPA 5SWZE 1RZFL 4J3VA 1OTSC 3S35X 1U36A 1FIEA 3JVGC 2VISB 1OF2A 2EIDA 2H2PC 4Z0BH 4PJDE 2PCPA 1YEEH 4F15C 2WLZA 5IHZB 3QA3A 2CLZA 3JWNC 4I0KA 5GIRA 4WDIB 1TZGH 2FEEI 2ZWLT 3FB6A 3LV3A 1AXIB 4N8VB 2YC1B 4M6MH 3BGAA 5E0QA 4L4VD 1T04A 3VXTA 2XZAL 4NOFA 4X9GA 3V7AE 4F57H 1UEMA 4ORGA 2V2WB 4XPTH 4DGVH 3JSSA 4OBRA 1F3DH 1PY4A 3KXFA 1EHLH 2BC4A 3QNZA 3QJFB 2H6PB 3VH8G 4CAGA 5FGBA 1F6AA 1FE8L 3S5LB 4YR6B 3AB0C 3PNWA 5J12C 1VEMA 4B50A 4JO4H 3RAJL 3KYKL 1H5BA 1SYSB 2A83B 4E41E 5IBTL 4YHKH 3VMNA 2MQ0A 3GKWL 1NMAL 5F1IB 5AYUH 3O6FD 4P2RB 2ADFL 3CVHA 4XNUL 3VGEA 1JGUH 2AJ3B 3H9SA 5H35B 4JGJA 2X1QA 1NCWL 5C0GA 1C12A 4LCIH 1JGDB 3CX2A 4OCYL 5DLMH 2VLRD 1FFNB 1N5AB 5BZDB 2XXCB 3OZ9H 2CSPA 2Q87A 1UH4A 4NQVB 1BVLB 1G7LA 4GXVH 1K9TA 4Y4HC 1BM3H 4CJ1A 3FOMB 5E6ZA 4OZIF 2NR6C 3ZT5A 4Y4FD 2V5SA 5TFSH 1GRWA 1N8ZB 1NFDF 2G9HB 2HFGH 4LEOB 3H0TA 4YDLB 1CXIA 5J9PB 4Q9CA 4R7NB 5BRZD 4XVTL 3PWPA 1IGYA 4YUEL 4M7ZB 4M8QB 5CLTA 3QDJA 3O4OB 2HLFC 3VWJB 5JIIA 2I5YH 4PRHE 3C08L 4EDXA 3KPRD 1N3NA 4HBCL 1U9KA 2W9EH 5DJ2B 2FX9L 4MJ4A 1NCDL 3WIIL 4FQJH 4NUGH 5SX4H 4MQXC 3W39B 3UZQA 3KPLB 4XGZA 1HKLH 3QRGH 4BFBD 3FO1B 2EDTA 2IPTL 3T65B 2V17H 2Z8SA 3VCLA 3VXMA 1N5YL 4ZPTB 3OGCB 2EH8L 1XGYL 2R15A 1YC8A 3F58L 3GSVB 3DMMB 4AEIH 4L9LB 5I6XB 1BQLH 3BPNB 4WV1B 2CKBB 4XAWH 1KXTB 2APXA 3IB4A 1H8SA 4K7PH 4MD4A 3P9LA 4N90D 4AEHL 2JB5L 1I7RB 1HHGA 5E8PA 3ZL4H 4I1NB 5CD5D 4PB0H 3UC0H 4XXDB 4RWYH 3WN5B 5I1DA 2EE2A 4ZUTA 5KSBF 1WEJH 4YFEA 3B8YA 4U1HA 5C0IA 3WFCL 2W0KA 2ZPKH 1XFPA 3SJVA 3BW9A 3WHE0 1LP9F 4Z77B 4JZOA 2B5IB 4DTGH 2E7LC 4Z18A 3PWJB 2Z31C 3C60C 3TBWA 2D2OA 3V5KB 1DSFL 1J0JA 3O81A 1U8NB 4WNQB 5HYQA 1BQHA 1OTUD 3S4SG 1Q9WA 1L7IH 4ZUWB 5BZWB 1U8IB 1NMBH 1BIIA 4JHWL 4BM7A 1T2QL 1CLCA 2AEPH 3GHEH 4XCEA 1OWRM 3F5WB 4M1DH 2GSIA 1HCFX 5HVFB 3IVKA 4LF3B 4HMEA 3FQRA 3X11A 1URLA 4NZUL 4G5ZL 5DDHB 2VLKB 2Y6SD 1IEAA 2NTFB 3MJ7B 4P5KB 5DI8B 4BQ6A 3LB6D 3QEQA 2E5EA 2R0LL 2DJUA 3REVB 4GRMB 3GSQB 4JPKL 3BI9X 2NLJA 3L3KA 3LKNA 4PJCF 2ERJB 1YYMH 3OAUH 5F3HA 5C08D 1MVUA 4KZEH 3FRUB 2FLBT 3G6JE 1EMTH 4WI2A 3WNLA 1KN2L 5ITFA 5KSVA 2EYRB 2DL9A 1I7UA 4E5XA 4FP8H 4ZOBA 1IQDA 1TXKA 5EU3B 3NTCL 5B8CB 3O6KH 3SE9H 1QRNE 3FT4A 3PV7A 5EU7C 2XY2A 4DUVA 3V9FA 4GKSA 4YGVA 4MNGE 3W0WA 2P42B 3U36A 2KL6A 1MCQA 3DI2B 4QRUB 4NM4L 3ZT7A 4EN3A 3QI9B 5EBLB 2C5DC 1B3JA 2BP3A 4Y4KD 3MLUH 5DR5L 3QNXB 4PG9A 1B0RB 4HIHA 4IRSD 2XZQH 5D1ZC 4Z7WE 1EEZB 3O4OC 3G5YB 1DBBL 2H3NB 1XMWA 3GSXB 1CE1H 3L5XL 4J3TA 5HDLA 3MUGA 1F6LL 4DN3H 5F1OB 1DN2A 3CLEL 3PL6A 3G9AB 4S0SD 1IL1A 1UENA 2EECA 2UZIH 5I73B 4N0UE 5T1KD 2VQTA 3ARWA 5CIPH 4JFZL 2BOCB 5IHBA 4JB9H 5JR1H 2Z91B 3I6LE 2R8SH 3KGRA 2VN7A 3DMMC 4KU1A 4KTYA 4PP2A 1G7HA 1O7SA 1P1ZA 4YHIA 3CK0H 1EJ6A 1GOGA 2Z92A 3KJ4C 1NFKA 2F8VA 1JMXA 4TSAL 2DI9A 2BSED 1Q72L 4PLOB 4X4YB 2NY0B 2WP3O 1A2YA 1QLEL 3S9DB 4OCXL 1H0DB 3OG4B 1Z9SA 2AS5M 4NZTH 1XT5A 4PGBA 1R0AH 5JHDB 4BK4A 4JN2B 2YA0A 1T1XB 1OB1B 3M8OH 4F7TA 3IDYB 5TPWL 1AXTH 3CSPA 1F3DJ 2ZCLH 3ILQC 1NGYB 3K80A 5I9QB 5JOPE 4LSRH 4O5LL 4OLVH 5D1QB 4PGDA 5DURD 2UUDH 1LQSR 3MOQA 4H20L 1T4KB 4AMKH 5KVEH 1A9EA 4XPFL 5FK9A 5FKPB 3PGFH 3VMPA 1A7OL 1H8NA 4PV9B 3ARRA 5HGHB 1ZTXH 4WU5A 1IC4L 3K81A 5T3ZL 4X5WB 4QRRD 1IAOB 4YBQD 4I3SH 4GKNB 2QL1A 1TQBB 1U92B 1Z2KA 4NQXA 3BEVA 1GXEA 2OK0H 5DJCB 4ACPA 1NC4D 3ARED 3S37L 4P5TD 4K55A 4MDJB 5IMKA 2FEEL 5GGVY 3IDMB 4JKLA 1XGRB 4S1QH 4E0RA 4WW2C 3H3PH 25C8L 4XWGL 3SDAD 2DM4A 1U8HB 4JRYB 4U1JB 3W11D 1GOFA 1U93A 3WEXA 1DQML 3PGCB 4O2FA 5ACLA 4KDTC 2C4FT 1VPOH 2YXMA 4GKZA 2OXHA 4NN5C 2VRAA 3HAEB 4QOKE 1RMFL 2DKMA 4LPWA 5J3HC 3P4LA 3KLSA 1EVTC 5BV7L 1SJHB 1YNLL 2X9XA 1T5XB 3SKUD 4K8RD 4X8JB 2DQFA 4WY7L 1NCNA 1PGRB 3T0VA 3GMMB 3AAZA 3SE8H 1JZ8A 3AC0A 1ERNA 5I18L 3FQXB 2AJUH 4JZJC 3C8KB 4KJYB 5KAQG 3QO1B 4HC1A 3RWJB 1GZQB 2ESVE 1AQKL 4X9HA 3STLA 2R1WA 1JPST 4G9FA 2F5AL 1CE6B 4RAUA 3S98A 3T1FB 2X4RB 4IRJC 4EI5B 1D9KD 1A4KA 5C0NC 4PJ9A 4Z7VF 3D48R 4HFUL 2GFBB 3NACH 1WITA 1JZ3A 1J1OH 4D0BB 1A5FL 2YD7A 5F8RC 1ZGLB 1KG0A 2CRZA 4GMSH 1EAPB 3C8HA 2JF1A 5F8QC 4WFHE 5GJTL 4TVSa 3T0ED 4KGJA 2VDMH 1ODAA 4U1KA 1YN7B 5HYJA 4NQCD 3CMGA 2QR0B 1F4WH 1AKJB 4JO3H 4KI5D 3TO4C 3MV8B 5BXFA 5HGAA 4PJIB 1L0XA 1ORQA 2CMRH 1FBIH 5BVPL 4HIEB 1RHFA 3PWNB 4JY4A 1F2QA 3HI6H 3MRHA 1YPZE 4EIZC 4XVUD 1KT2A 2LU3A 4LPCA 1S7UA 4P2RE 5EZOH 1CLZH 2XTJB 3GJFA 1PJ9A 3FO0L 1C5BH 2FIKB 1W0YT 1EFXA 2R1XA 5T1LD 1HHJA 5DVMA 1YEDB 1AFVH 2VNCA 5I71B 4G42B 2HJFB 4E9LA 5IMOB 3VFVB 1V3LA 3GIZL 1WCBB 5DHYA 1N7ML 1F3JA 5D6DA 4NDMA 4LEXH 3OB0H 1RJYA 4P3CL 1KCUL 2CIKA 1I8LA 3H9HA 2X44D 2LE9A 1IAIH 2IANB 4FQCH 1JYVA 3B6SA 3SO5A 4Q2ZA 4HQQL 3U9UB 3ROLA 3U4BH 1RPQA 4PJ7A 5I1HL 5IV2A 3KPSD 3K1KC 3LEXA 4LSDA 4YLQT 3WIHH 4APQA 3QDAA 1J0HA 2ITCA 3QFDB 5K9JH 1T7XA 3FHQA 3J8F7 4XCYB 5H94A 3TA3C 3EJYC 4FQIL 3B9KB 4NZJA 3CUPA 4JKMA 3WJJA 4OD1L 4HWEH 2BVEA 2R0WL 3EHBD 1LD9A 1IT9H 2ZG2A 4JQXC 4XTRD 1UYWH 3DJ9A 2MPAL 1S7QA 1PBYA 2EE3A 3SPVA 3OX8A 2A0LC 3FFDA 1CXKA 3LKSB 3TJHC 3DVGB 4U1GC 3O2WH 2BDNL 1YEGH 1KB5A 4JLRB 4RNRA 4AQ1B 4PJGF 4KJPC 3ZE0F 3T2QA 4L4TA 2EDNA 3VWJD 2G2RB 3ZYJA 4AIZA 1ORSA 3D3VA 4HULB 2KQNA 3JTTA 3DSNA 5DJ0A 4KQ3L 4AT6B 3NFPB 4LRNL 4PJBE 1F00I 5ERWA 4ZS7L 3OAZH 5ESAA 2DQCL 3OTTA 3VXPA 3WUWG 3WNKA 3LQAC 5INCB 1V7NL 3RL2A 4LRIC 5LVEA 1R5VA 2YD6A 2ADIA 1A7RH 3U7YL 2ED8A 3RJDA 4XP4L 4ZQKB 5F7MC 3MACL 4OF6A 2V9QA 3V7MA 4X0KB 4DQOH 2Q76A 5IB4B 2J4WH 4MAYA 1PZ5A 3V79C 1KB9J 1GGIL 4YWGH 2AV7B 5F7YC 2IBGA 5IBUG 4WJ5B 3MRKA 2F54E 3HR5B 2BNRD 3QDMA 3DWTA 4X6CE 1RK0B 3V52L 5I66B 2P43B 3QUYD 1QBLL 5FO8A 1TJIH 2VR9A 1HOCB 2VERN 4MX7A 5GJSL 3E2HC 3TIEA 1R6VA 1CGXA 4YHLL 5TGBA 4U05A 1DLFH 3HFML 2I60L 2Z9TA 1DQLL 2P48B 2VLKE 5EA0L 5FGSA 3DRQA 4XPAH 4GRWF 4Z5RA 4ELMB 2MOVA 3RTQC 3OR7A 4HWBL 1AO7A 1OARL 2BMKB 1YDPA 4IRZH 3VGAB 1IGIH 1LNUA 4XC3L 4HCRA 1WZLA 3AUVA 15C8L 3BGFB 4BFGA 5LGHL 4X7EC 5EO1B 2XN9A 3QHTC 5DD1L 4CN1A 3SE4C 1UQSA 2R2HA 4GRLC 2I9TA 4MMZC 4RGMC 4D3CL 3UPRB 2VLKD 5DFWH 1VA9A 2CPCA 4OAWB 4F3FB 2YBRA 5GRXG 1IM3A 5DEFA 4OGAC 4X6EA 3MUY1 1RFDL 1RULL 3RIFK 5DK0A 3VWKD 3L7FA 4EEEA 1T22B 4N5UA 2BNQD 5E8NB 5AYQA 1G6RA 4FZEL 5I8KL 5D2LE 5F3BA 1IAMA 1PLGH 3HCVB 4G6ML 1JNJA 1S8DA 1BHGA 3JV4A 5IQ9A 5C0AA 4OCMC 1FE8H 1CGVA 4NN7B 3KYKH 5IBTH 4ZXBD 4MD0A 1NMAH 1I1AA 1A7QL 3BRDA 1A0QL 2ADFH 2E7BA 1TQCC 1UB5A 1JPFB 4N8VG 4XNUH 2A74B 2KUTA 4EBQL 1TJGH 1NKOA 2CXKA 1NCWH 3MNWA 2VDLL 4FA8A 2JCCE 4O51A 4OCYH 1X5JA 3EYVA 2VE6B 4HC1L 5I8EB 5C0DA 1OP3K 2DI7A 3GRWA 3TVMC 1SBSH 1Y6MR 1I4FB 1JF1B 3V6BR 3CU7A 5DJXA 2CQVA 1UZ8B 3LSOA 4OZGF 1GC1H 5C70A 5DD3L 2D7NA 5IQ7L 2DBLL 4PP1D 1N0LA 4AG4L 5FO7A 2CK2A 4OZFH 2AK4B 4BQ8A 5AUMB 3EDJA 1KIPA 1I75A 5JHDE 2WINB 4UB0L 1U3HD 1BECA 3MYJB 3RHWK 4RQQA 3I85A 4YUEH 2ZSWB 5FKAB 4H1LB 2HFFB 3G5ZA 1MJ7L 1I1YB 1I85A 4M6AA 4HMCA 4LPXA 4NHUA 3MLSL 4HBCH 3RNQA 3ZDXE 5FA4A 2E9IA 3PIQA 2CRYA 2K7QA 5A3IC 3D9AL 2V7HB 4OLXL 1CR9L 4OIBA 4ZOEA 5ID0A 2FX9H 2NY0D 4GOSA 1NCDH 4X6DF 5EU4A 3LKPA 1XZ0B 2AXFA 4N68A 4KI5F 5CMAA 3ILPB 2IPTH 3QQ4A 4Y8AA 2AJZA 1N5YH 4KMTL 3NZHL 3VFGH 1XGYH 3DROA 3VFSA 3F58H 3VXRB 2F9BT 4LSUH 3S3PA 5C3TA 3ARZA 4N1EA 5SWQB 3UBXI 5D1QD 1BX2B 4KROB 2XG5A 3TJEL 1T89A 3H7BB 3QIBD 4FFVD 3OF6A 3TBTB 3O2DA 2WWMC 5H37H 4AEHH 4QXUL 2RQ8A 1G9EA 2KH2B 3O3DB 2PXYC 3FT3A 4QNPF 4U6HA 2M2DA 3HR6A 2DQIL 4JRYE 2C4FU 5DVKA 5L2KB 1JYXA 2FSEA 1J18A 4FFWC 2XOTA 3QIWB 1CFQB 3WFCH 1PSKL 3BUYA 5IFJA 5B39B 3CFEB 1KGCD 3QO0B 5DJ8B 1TVBB 1K5NA 5GS2H 4O2CA 2QKIA 4JY6A 2GJ6A 2QEJA 2XNAA 4TVPL 1ZANL 1G9NL 1DSFH 3QDHA 1TVDA 5CWSB 2IPKB 4KUZL 3KLAA 4UV7L 5ESVB 3UBXA 8FABB 1NBZB 4LLQB 1T2QH 4NKMA 3H2WA 5F7HA 1X4ZA 1C7TA 1KPRB 3RFZC 1CF8L 5DFTA 5HHMD 1TZHA 4OUOA 2F5BL 4MMXC 4XXCC 2JJTC 3UTSA 3VRLE 1MUJA 3SKMB 3L3OB 1S3KH 2IBBA 4DZBA 5DVOA 3QNYA 1JNNL 4NZUH 3G6DL 3E3QE 3GBNL 3O4LA 4NQEE 1U41A 3TESA 3MGOB 2R0LH 1CG9B 1J0IA 4R7DB 4WFFE 3KPNB 4JPKH 1A7BA 1QQDB 1TENA 1D5BA 3O9WD 4GBXB 1JF6A 1T1WA 4LHUB 1EK3A 2QADC 1NFDE 4ODHL 2FB4L 2H26B 3JVGA 4RFOL 4B0MM 1OAXL 5ICYA 5KW9H 3CNKA 4P2CG 3MV8E 1MCKA 5JPNB 2P8PA 1GZPB 4Z7UB 1OTTC 4AYFA 3NTCH 3T3PF 3O6FC 1T03L 3ARGC 2FIRT 4OZHF 3BP4B 1R5IB 4NT6B 3VJ6A 5IFAH 5TE6L 2HKFH 4WFFD 1WISA 2P5ED 1GGBL 3ARDB 1UWXH 4CN6A 5J89A 5E56A 1EAJA 2F58L 3HLAB 4M6OL 4NM4H 1NC2B 4CU7A 4OTXL 1A6VL 2FO4A 1AKJD 2W65A 2XA8L 3DVIA 4ZPVA 1N2RB 3SKJL 2DKSA 2P24B 3KPTA 1A4JB 2HYMA 1OP5K 3L3HA 4I48B 4W4NA 3S96B 1DBBH 4JPIA 2H32H 4RFEA 4GQ9H 4PGCB 5IW6A 3MOAL 5CP3A 2D0GA 1IMHC 4XVSL 3CLEH 2M1KA 1BZ7B 2XTJD 3TCLB 3LEYH 5FFLA 4Q74A 3UTPE 4XB8A 1FN4A 4DKAA 4TSBL 4NBYB 5C8JA 1NJ9A 2MFNA 4HCRL 5KSBE 1GYAA 4MJ5A 5D1XB 5GRWA 2W0FA 4KUCD 2DLFL 3QFJA 1JZ6A 1FJ1A 5MEQB 1UKTA 2Y36L 5I74C 3VD4A 3EO1B 4TSAH 1Q72H 1YMHA 1ACYL 4OF7A 5B4MD 4A2MA 2DM3A 2IAND 2ATPA 4G8GD 3MQIA 1QLEH 3R8QA 1TLKA 4OCXH 1KLGB 3AMLA 1I8IB 4ZUVA 3BD3A 1B0GB 3QH3B 5IG7A 4FS0A 4RMSA 1KENH 5JA9A 1YUHB 5F7UA 4LAQL 3V5DB 3VFPB 5TPWH 1FORL 3C6LA 1W0VB 3EGSA 3SO3C 3CCHA 1H15B 4PREA 5HHQA 4K71C 3RVVC 4O5LH 3LKOB 5HPMB 3RI5F 3B9KD 1H3WM 4H20H 1F4HA 4P23B 4XPFH 2MNUA 3GM8A 3BO8B 1A7OH 3KJ6L 1NGWA 5E9DA 3IU3A 5KVDL 5CD5C 4HUUA 2X1PA 1P7KA 5EORL 5KS9F 1BMGA 3QXDB 2XRAH 3OWEA 4Y19A 1D6EB 3CVHH 1TVHA 3GMPB 3HUJF 4HIIB 3MRQA 5T1MB 1DL7L 3T3ME 1KYOJ 3LKQA 3NIDF 3S37H 4F9LA 2MTPA 1KOAA 3GRWL 5HGBB 4MXVF 1MJUH 2UYLA 2UWEF 2GK2A 3BAEL 1QD0A 25C8H 3RNKA 4XWGH 4F9PA 1KBGH 4NWTL 5KTEL 3L5WA 1OVZA 35C8L 1DQMH 5JXAL 3MRDB 2EC8A 5DMKB 1UZ6E 1RMFH 4MCYB 1HINL 2FBJL 1Z0NA 2Z31A 3BMVA 4KVNL 3ULVE 1CICA 2Y6SC 4MQSB 1C5CL 4CNIB 4PJ8A 3PUCA 3TBSA 2FYYB 4B7IA 3RVTC 4F2MA 1QACA 3LMJL 2OMBA 4C57C 1MFBL 4Q6IC 5HGGS 4ELME 4OKDA 5I1LB 3CFKA 3FRPA 5I19L 3BPCB 5I18H 5I8CB 3AU1A 3BDBA 2DQTH 2MCPL 1FGVL 3KPQA 3WIFB 1JTPA 3NCYS 1AQKH 4J8RA 1PKQB 3M45A 3T0XA 4UBDD 5CZXD 1KIRB 3HAEG 1I9RL 2V9TA 2F5AH 4LVHC 2XWBA 3ULVD 3U6RA 3MBEC 2BOBB 1NCCH 1R24A 2RCSL 1JHKL 3D69A 5D9SA 1JZ5A 2FECL 4YX2L 2VSDA 4FZ8L 4JG1L 4WHYH 1YQ2A 5ENWB 1A5FH 4YHMH 1ND0A 3O2DL 3T8XA 5CAYB 1DQDL 2NY5H 3KR3L 4LOUD 4QRTA 3OXRA 1WIUA 2VJXA 4TUKH 1M7XA 5C0CA 1FNSL 4OGYL 5HI3C 2J7LA 4Y4KC 5M7QA 4HXBL 3U83A 5BJTA 5I1EL 4UI2A 5E94B 4K7FA 4LVEA 4IRSC 5IGXL 4ZDHA 1RZ8A 3DTXB 3JWDL 4P57A 2G75A 1VEPA 5DRZB 5DJ6A 1TCMA 2EIEA 2BHYA 1P7QB 4M3JA 5BVPH 2QV2A 3BEWB 5E6ID 5LCVL 2PO6B 3MPCA 5IB3A 5FM5M 5DWUL 2VZ3A 1ZT1A 3O3BA 4W6XB 1MCJA 3W2DL 1X44A 4WW1A 4HUWA 4DOHE 1MI5A 4NUJB 2XT1B 3INUL 3D39A 1YMMA 2NY1C 4PJHB 5L7XH 4PS4L 2BVQA 5D2NB 3V0AC 5D1ZA 4NZDA 3RX7A 4Z7QE 1I1FB 4FQQB 4XNYL 1BBJB 3EOBB 4NPYA 1OLZA 5EU6D 3T4YA 2OTUB 1KCUH 2J8HA 3RJQB 3ULUD 4CDHA 2GT9A 4HV8B 1LEKA 1AIFA 3FO2B 1LHZA 2XZZA 4IOSD 1MFCL 4HQQH 2Z0BA 3HMWL 1DBKL 3NFNA 1QHOA 4IOFD 2BVOB 2AK4E 2CLRB 1T66C 4W4OC 2LABA 3LS4L 2DWDB 1P4LA 4Q9RL 2IH3B 4PRAA 5CIPB 4ZODA 5EU5B 3CXDL 3EOAB 2CUMA 3ARUA 4OLZL 4W6YB 2VABB 4HPYL 4QTHA 4FQIH 1CT8B 1M1SA 3C2AL 4XP5L 4UQ3B 1C7SA 1HKFA 4LMQI 4OD2B 4OD1H 5K9OA 2R0WH 1CVSC 4RGOH 3CZFB 2YUZA 1B9ZA 2X4UA 1MOEA 1KFAL 5K93A 2MPAH 4QY8B 1CFNA 1G7IA 5EIQA 1DUYA 2BDNH 3OL2A 4Z76B 3EDDA 2OXGA 3CDGA 5E6YA 3DV4A 3RWIA 1HHKA 3S8WA 4P5TC 3QEHB 4IJ3B 1KEML 2VLME 4WGVB 3VXRE 1QG3A 5CEXB 1CZ8L 4MCZB 5E8OB 3P9MB 4DEPB 4JG0H 1U42A 4LSVL 1OAZL 4M00A 4WTZG 3FJTA 4IS6A 1UM4L 4LRNH 1FZOB 4ZS7H 3RWGA 5KN5B 2ZJSH 4MHHG 2PW1B 4M1GL 5CGYD 4NRYB 1V7NH 2OP4H 3EYSL 2IC2A 3O8XD 5L2KE 1NPUA 4LARL 4WI7A 2BXZA 1NCAL 5T5FL 4CN4A 1CDIA 4XP4H 1EPFA 3MREB 3ZZ1A 3MACH 1S9WB 4K8RC 3RDTA 4MNQE 4MJ6B 2VR4A 4KROD 1RY7B 5KSAA 4WW2A 1GGIH 5E95B 3HE6B 1P2CB 3ZHDA 4U0QB 4S0TD 5KANG 3OJDB 1QBML 1YNTB 4LCYA 4RIRA 2OYPA 4ZUSB 3V52H 3WXVH 3G5XA 3QIWD 2OL3B 5BCAA 2HH0L 4YDIL 4WTXA 1IC5L 1UM5L 4RA3A 4PY8I 1NH6A 1D9KC 4YHLH 2C1PB 1ETZA 1H3UA 4IOIB 2ADGB 3HFMH 2I60H 2P7TA 1DQLH 1IGCL 1MRFL 5FF6A 5DD6A 2X4PA 4XCCH 2VLLB 1EO8L 3QQ9C 4UTBL 3T0EC 4YDJA 2JK5B 5FYKL 3TPKA 2OQJB 3D18B 4FHBD 4WHTB 3MO1B 3QDGB 1P84K 4XC3H 1E28A 1EEYB 5MHSD 15C8H 3MLVL 4KI5C 4NM8H 5LGHH 4C56D 3V6ZA 4I9WD 4WEBL 1ZA3A 3RWHB 1A6AA 1JPGB 2EZ0D 3VGHA 5FA3B 4WWKA 1QZ1A 5JDSA 4D3CH 4Y2DD 3JV6A 4Z7UE 3VFRA 1N4XH 3HI1A 3AM8C 5IIEB 1RFDH 3QIUB 1RULH 3LAFA 5DTFB 4XNMA 1Y18B 1UXSA 2BHUA 5EC2B 3LD8B 3I2CL 5BQ7A 4F7EB 3LN5A 4FZEH 5I8KH 3TO4A 4LHUD 4ODWA 4G6MH 2HMID 4RISH 4HLZG 4P2OB 4PJGE 5JLZB 2HVKA 3D87B 3L3JB 3ZE0E 2UVFA 1AHWB 2XQBL 3I3DA 3T4AA 1J8HA 2C3GA 4MXWL 1A0QH 5DEGB 4WI4A 2FX8L 4CDGC 1U2CA 3IF1A 4LKCB 4EBQH 5IVNA 1R3HB 4DWHA 5MEOA 4I18B 1NC2D 5GS1C 2VDLH 3QUZA 5D96C 3MGTB 4FXGA 1M6OB 4HC1H 4ZFZA 4Y5YB 4Y5XC 1MRDL 3ECBA 5TDPA 3B5TA 3AGVA 5J1AA 2R23A 2FHCA 3AS0A 5DD3H 4M43L 4UUJB 5CUSL 3MA7B 5IQ7H 2DBLH 5D7KD 2Q6WA 2P5WE 4LP4A 5ISZD 5DK2A 2EDOA 3MOBL 4F37F 3DYMA 1E6OL 2VLJE 3PQYA 1K8DA 4UTAL 3L9RB 1ZSDB 1IVLA 5D8JL 3RGVB 4UB0H 3VI3E 2B20A 3BP6A 1B6UA 5D1XD 2YRPA 2A9ML 3K7UA 4UAOB 1MJ7H 3TO2B 1ZLWK 1HE7A 1HZHH 4PRNA 3MLSH 5HVWA 2IG2L 1Q0XH 4JQXA 1AGBB 4MWFA 4WO4B 1WTGT 4LQFL 5J13B 5L8JB 3D9AH 12E8L 3D0LB 4OLXH 1CR9H 5IMLA 5JNYB 4XHQA 1JYWA 3RWFA 3HHRB 1DVFD 4HDIA 4JCLA 3MR9A 1G7MA 3HI5H 4I5BB 4P46B 3TNNA 3ES6B 1UB6A 3IXAA 3G9VA 2FH8A 3RPIB 4KMTH 4AQOA 4DKFL 4R96A 3NPZB 4F7PB 4H0HB 3GJFH 4H5SB 1OAUL 5DVLA 3NN8A 4H1LG 1ZHKB 3GSUA 5FECB 3P30L 5HYSA 3TJEH 3E6FB 3NMEA 4P23D 2YEZA 3FTGA 4YGAB 2O61A 1IGJA 4QXUH 1HIML 3O3UN 2LTQC 5FYLD 4LRIA 2WW8A 5TE7H 3ARTA 2E9JA 4OCLC 3SQBA 1BFOB 3FQUB 3QUYC 4ODUB 3OV6A 3FB5A 4NSKB 1QSEE 4C4KT 1OSZB 4UT7H 2W38A 1PSKH 2DWEA 3KG5A 5T3XD 4U1IA 3ULUF 3O11B 5L8LB 1SM3L 5F21B 1CD1A 1Q9OB 2SEBB 4JFFA 3UDWA 5F9DC 3VG9C 4PTTB 1ZANH 1G9NH 4TVPH 4P2QB 3HZMA 1RI8A 1PG7X 4V1DA 4MLSA 1U8QA 4OZIA 4QHNA 1HXMA 3MRFB 2D31A 1CF8H 4OQTA 4TNWK 5FO9B 5LGJA 2F5BH 4PJEB 3QUXB 2QSCL 1PKQE 1G7PB 1KB5H 3IFPA 1KULA 1D5ZA 4NO2B 3H42L 4HKBB 1UJ3B 1JNNH 3GIVB 3MRNA 4GW5B 4ZO9A 3MV9B 4J3XA 3BIAX 3G6DH 3GBNH 1JN6B 3ZHKA 5K59F 5E2TL 3ZKND 4RBPH 3RTQA 3U4EB 5ANMA 3VWKC 4ZS6C 3WFEL 3S36L 3OJMB 1EZVY 3WHXB 3EYFA 3EBAA 1R3LB 4QEGA 3BP5A 1KTDA 1J1PL 1QNZL 3QQ3B 4HGWB 5SX5K 4XMPL 2DJ4A 4ODHH 3SE4A 4GRLA 2FB4H 4RFOH 1OAXH 4EVNB 2NX5A 4JVPA 1NANI 3K2MC 3TCXA 4JM2A 1UCBL 2YPLB 2PYEB 4ZXBC 4QYOA 3DBXB 5I75B 1UVQB 2A9NL 3HC3L 4P3DB 5K33A 4JZNB 1T03H 3HE7B 1JGVL 3MRMB 1JV5A 4KPHL 4L29B 5TE6H 2DQHL 4LLUA 4YEFA 5L2JB 3BZ4A 5GRYA 4D9RD 1GGBH 3QEGL 4JAMA 1QEWA 5TH2A 2BK8A 2F58H 4M6OH 1OPGH 4PTUB 4LLMA 3C5ZC 1J0ZA 3SDDA 3U30B 3TBVB 3UTTA 3ZYIA 4OTXH 1A6VH 1XGTA 4LHUG 2XA8H 5D2NE 4J23A 3ZKXC 1RHHA 5ESQA 2IAMB 1LP9A 5FOBA 3Q6GH 1P7QD 5DMJB 4LQ1A 4J12A 5I1AA 4TRPH 2PO6D 3BSZH 1A1NA 4U6YA 4GS7C 4UIMB 5HYFA 3MOAH 1FLRH 5L88L 3GM0A 4ONHA 3PDGA 3HG1A 4WEMB 2NXYD 4XVSH 5JW5B 6CGTA 1S7VB 4WUKL 1U3HC 5GGSB 4HJ0D 1QP1A 4HCRH 4PGJA 1AD9A 2QSQA 5FYJH 4D94A 1A1OB 1QFWI 2DLFH 3KYMA 5IFHL 4FXKB 3GSWA 1I7TB 5HTSA 5ICXB 4ZAKD 2Y36H 5E8EA 5EIIB 5E00B 3ARSA 5HHOA 2RGSA 3MBXL 4HZLB 1ACYH 3RKPA 4G8FB 4KKBD 5JORA 3HMXA 3MRGB 1KJ2B 2Q3ZA 3MLZL 4HD9A 1K2DB 3O41B 4Y16A 4NO5A 4P49A 1W8OA 4PJCA 4LAQH 4OZFB 4CVXA 3G08A 5FUCE 1FORH 2NW2B 1G6RH 1NUGA 5CHNB 3ZE1F 3FFCE 4JFDA 5D5MA 3GSNB 5D7LA 3QIBC 4L8DB 3P4NB 2GTZA 2C1OA 3CLFL 3NCFB 4HJJL 3SEPA 4LCWD 3VFOA 1MWAA 1UWEL 3BZEB 3BUTA 5KVDH 3GMQB 2EKJA 1EJOL 1X5LA 1X9QA 4RDQG 4D9LL 3MJ8B 1CFTA 1KUMA 1NQBA 3Q3GA 5I17A 1EXUB 1QA9A 3KS0H 5DJZA 2QSVA 1DL7H 5MENA 4Y8DC 4M4PA 5IEKB 5HSFA 3MV7D 2XFXA 5HDOA 3ELAT 3FOLB 4PIRF 3DV6B 3S4SA 3GRWH 3PDOB 5CJQL 1JYNA 1JGEB 2PXYA 4WEUD 1ED3B 3E8UL 4P4RA 4BELD 4MQTB 4NWTH 1X7QA 5C07A 4OZHE 3PHQA 4QO1A 35C8H 4E42B 4LSQL 3WS6A 1XR9B 2YPKB 1IM9D 4N1HB 4OLWH 1RJZA 1LGVA 1NGXA 4QWWC 1HINH 1QFHA 2FBJH 3VA6A 2EXYC 3PF2A 4PBWD 3IDIB 4L1HA 1F13A 4KVNH 5HGDA 4EUPA 5GGRA 4P4KA 1FZKA 4ZFGL 2VDQL 1C5CH 3K3QA 1INQA 5EUOB 4L8SB 5GZNC 1VFBB 3LMJH 5CP7A 5C92A 3BH9A 1S9YA 3QXVA 3EO0B 2MCPH 4PJFB 4XHJD 1FGVH 3O9WC 2H2SD 4XXCA 2JJTA 1P5VA 1TPXC 5EBMB 4M7LL 2JB6A 3ZTJH 3F7YB 2B4CC 4GW4A 4PJXA 5C9JA 2GEEA 1HSAA 5JPMB 2RCSH 1JHKH 4FNLL 4LVOC 3O3AB 4YX2H 4FZ8H 1ONQB 4JG1H 3U9PL 4L4VA 5L0QB 3O2DH 1DQDH 4YIQB 3KR3H 1T0PB 3QDGD 3TT3L 4QCIB 4HEME 1FNSH 3BQUB 4OGYH 4S2SB 4ISVA 2B1AL 3MCKA 3MJ9A 4NCC2 2GAZA 4HXBH 5I1EH 1GCFA 2DIAA 1FL6A 3UAJD 4LIQL 1G7JB 5IGXH 1U8LA 1FDLL 5I1GH 3TEUA 2AABL 3HN3A 1JZ7A 3O6FA 5FB8B 5FEBA 1GH7A 4OD3L 1PYWA 5LCVH 3GNML 2VWEE 3FMGH 5DWUH 4QHUA 4MS8D 3RY4A 3MZGB 3QIUD 5D6CB 5F88A 2BCKA 1GC1C 3W2DH 4FABL 1BD2B 1HWGB 2CDFA 3I02A 2VLRA 3DXAD 5DQJA 3TN0B 4TUOB 3MZTA 4LU5H 3RRQA 4PS4H 5GRVK 3OHXB 2QHRL 3DGGB 3U4AA 3U0PB 5E2JA 3UMTA 1MHCA 4JRXB 5I16A 3UJTH 3HUJE 1E6JL 4XNYH 4R0LA 2IJ0C 5F9OL 3T0AA 3PP3H 3MFFA 3BPOB 5CBAB 3VFWA 4OUUA 2E7CA 4ELKA 5I76B 2XY1A 4UNTA 4Y4FA 3SHSA 3CSYB 2H32B 1RZGA 1VENA 2R1YB 1T5WB 2UWEE 3GJEA 1H3XA 4PJ5D 1IBGL 1D7FA 5BRZA 1S7SA 5FUOH 1DBKH 1LE9A 2UZYB 4XCNA 4GG6F 4GXUN 3L6FB 4Q9RH 1J5OL 3U7WH 3KPRA 4R3SA 1YN6B 1U91B 1P9MC 4Z8FL 5JOFB 3ZDYF 1TTUA 4HPYH 2MKWA 3RGHA 4XP5H 1CL7I 1U3YA 4TYUA 1TJHL 2VH5L 4Z7VA 5FIEA 3V4PL 3DURB 5C0BB 1OF2B 3HC0A 1LVEA 1PEZA 3QA3B 4WFEE 3HZYA 5EO0A 5GIRB 5D7JD 2C3VA 4YHPA 1KEMH 2JKXA 4ORGB 2NY4B 1IGTA 4IIQB 1OAZH 4LSVH 4NC0B 5BVJB 3IGAB 1UM4H 3IKKA 3KXFB 1SEBA 5HHPB 1HH9B 4DUWA 3QNZB 1J8KA 4M1GH 4HXAL 2AP2A 1P6AB 4D0CA 1B90A 1H5BB 1OGAB 1RVFL 3SCMC 2AQ3A 3QQNA 1NCAH 2A6IA 1RQ5A 5T5FH 1RZKC 1MCHA 4BKLA 2AEIT 5JHLL 3H9SB 4RFNB 1KTLA 2E9WA 1WC7A 1JRHL 2X4NA 4YO0B 4P2QE 4AEEA 2O5ZL 1XF5B 3LDBC 1QBMH 5CD3A 5L0QC 1D3CA 4PJAB 3OB8A 2ICWI 1BFSA 4M6NL 4I3RL 2NNAA 3EJZC 3HMXL 4IDLA 2HH0H 4YDIH 5CZXC 1SY6L 1IC5H 2H45A 1UM5H 2P45B 2PETA 5J57B 1T0MB 2FZ3A 5J6HA 1MELA 2CGRH 4Z95L 5BV7B 1IGCH 3DPBA 4P2QD 3MV9E 1MRFH 1JZ2A 4RZCB 1B88A 4LOUC 1CLYL 3QDJB 4UTBH 1I3GL 3CFCL 1BVZA 1QO3A 5FYKH 5C08A 2C7UA 1IC1A 3ARYA 4PRIB 4QHLA 2ICEA 2UVEA 3MLVH 2HJLA 5FHAL 4ZYKB 3QUXD 3QPQC 3KS0J 2EKSA 4WEBH 4XGZB 2ICWA 1RUPL 5E6IC 4DW2L 4KTEL 1TZIA 3VCLB 4X4XA 2YPLE 2PYEE 4L3CB 2OJEA 3KVQA 2FJFA 2Y5TA 3PWLB 4HKXA 2DLIA 4PV8B 1NEZB 1I7ZA 4MJIB 1N6UA 5E1AA 1HN1A 2CD0A 4MD4B 3P9LB 1KCRL 3I2CH 4Y4KA 4F33A 1BJ1J 3A6OA 4KAQH 4PYGA 3ARFC 4IRSA 5ADOL 1HHGB 1W8NA 4PJ7F 3STZA 1OAQH 5DVNA 5C09D 4HBQA 3DX9A 5DEZA 4U1HB 3RWDA 1DDHA 1X4XA 2YUVA 3TZVC 3V0VA 2XQBH 4POZC 1U58B 5F7FA 4K07A 3BW9B 4MXWH 5T1KA 4J2XA 3WFBL 1U8MA 2FX8H 4LCUB 2YD3A 3M1BA 3TBWB 4IOFC 4TPRL 4DJMA 5DXWA 5LGKA 3K2UL 1BQHB 5DT1H 3SOBL 3PHOB 3DO7A 1XF2A 4N1CA 4LCCC 2VZTA 3MRLA 1MRDH 2IAMD 3T0BA 3DETC 3U2SA 5SWSB 1NUFA 3QHZL 1WZ1L 4M43H 2GSIB 1ZEAL 2MMXA 4U31A 5JW3L 3IVKB 1DBAH 3FQRB 3X11B 2I24N 3ETBF 3OKNB 4U6TA 3MOBH 1MH5A 1F11B 1E6OH 5FGBC 3BX7C 4UTAH 4U1MA 5F93C 1IEAB 1WBXB 3I6GB 4NFDA 2OBGA 1QR1A 3GB7B 3VFMA 3VD7A 4M5ZL 4ZTPL 3LKNB 5HD8C 3WUWA 2VKWA 5B3JF 2IG2H 3A67L 5ILTL 4LQFH 12E8H 2VZUA 4QRRA 4OLYH 1FHGA 2APVA 1Q9KA 5ITFB 3QEUA 1ULVA 4E5XB 3VXOA 1HNFA 1SYVA 3O8XC 1IQDB 1NC4A 3AREA 1RIUL 4BZYA 2CIIA 3FT4B 4P5TA 1OY3B 1S78C 1HQRB 1FCCA 3T2NL 3TNMB 1FSKC 4GKSB 4YGVB 3FB7A 4KRPB 1XIWB 4AM0B 1MHHB 5F9WB 5IM7A 4KDWA 3P30H 1AJ7L 1BAFL 4S1RL 2XKNB 4EN3B 1TITA 2C3XA 3SDAA 2W59A 1IKFH 3NGBC 2AERT 4NQTA 1HIMH 3NIGE 4PG9B 4HIHB 1WWAX 1JUFB 5IJVB 2XWJA 3IXTA 1WSST 3QZWB 3IDJA 4XBGA 3PL6B 1JWSB 1IGFL 3TFKD 1SM3H 2OTWA 2OM5A 1E4XI 1MLBA 1SHMA 3ARQA 1CU4H 3D6GA 1AXSA 4NO3A 4OZGA 2I07A 3VXSD 4QTIL 1YEKL 5EUOE 4WCYL 2HFEA 1NBVH 1T2XA 1Z3GL 4CMHB 4AENB 1BZQK 1F4XL 1MNUL 4PP2B 4JFYB 4LL9A 1G7HB 2EEAA 2WIIB 4MA1B 2Z92B 4UIKL 4CMMA 4NJ9L 2NY5C 5GGVH 1FNGA 4ODXA 3VD9A 1A2YB 2QSCH 3VXUD 1TCRB 4PRPD 1D9KA 2EZ0C 3IYLW 3QUMB 4FQXD 3ROOB 3B9VA 3FN3A 4Y2DC 4LDLB 5GSVA 5GRUL 3MRRB 1CDJA 3LPWA 4F7TB 4G6AD 1CTNA 5E2TH 4RCAA 3T0EA 4Y7MA 2ZP0T 3ALWA 4MVBD 3WFEH 3S36H 4X6DA 4NQCA 2OTPA 2J88L 1A9EB 1A3RL 1MCWM 1WWCA 2DDQL 1IKNC 3B2UD 2HTKD 4XMPH 2VISA 2HMIC 1CL7L 4NNYB 4L3ED 3WV0A 3P4MB 4WUUB 4ODTL 2FGZA 4JFEE 4GXUM 1I8KA 2CDGB 1G0YR 4WDIA 3IDNB 4BUHA 4NZRL 3BEVB 3AM8A 1KN4L 2A9NH 1J7VR 2YC1A 1CDYA 3CFDB 4JO2L 4N8CL 1Q1JL 5JUEL 2D9QB 3S35L 1GJIA 3TGXA 1JGVH 4KPHH 3PXHA 1CXEA 2Y07L 2VIRA 2DQHH 3H7LA 4HWZA 2VDNL 3U0TA 5HVHC 5IT2L 5T1LA 3EFFB 1U8OA 3QJFA 4E0RB 3S3JA 1FFOA 2ZKHL 4YR6A 2NY6C 1SYSA 1E4WL 4PBXA 1CFSA 3WEXB 3RIFF 4O2FB 4JRXE 1PY9A 4ZNEE 5F1IA 2Y7QB 2QQNH 3OKOA 4GKZB 3BFOA 4UT9L 3K4ZA 4HHAB 3V6OA 3DIFA 4YEEA 5H35A 2FWOB 3KPSA 3LRSA 1JGDA 3QYCA 1BGXH 1BD2D 4C54A 3TN0D 2DICA 5LG1A 1FNEA 3AAZB 1TZGL 4JHAL 4WUKH 5F6IB 4AEFA 4Y5XA 3UZEA 5EC1A 1HWHB 2H8PB 4OZ4A 4XWOD 4HH8A 2WUBH 3SY0B 5DJDA 1C5DA 3BMWA 4KH2A 1BVKA 2PKDA 3SGKC 2XWTA 3STLB 2R1WB 4MA8L 1DVFC 4GW1A 3MBXH 3NOIA 2AJXH 2G9HA 5I1KL 4RAUB 4LEOA 1D5MA 4U2YA 5ALBL 2UZXB 5J9PA 3HZVB 1A4KB 4PJ9B 3MLZH 4KJWD 4MQ7B 4Y5VC 1ZLVH 4M8QA 5F7DA 5AYUL 3NPSC 2BSRA 3VWJA 3SGEI 3FKUS 1KG0B 2DQDH 1L6XA 2EEDA 1T7WA 3LZFL 3VFUB 4M1CC 5DJ2A 1U95B 3K46A 4QF1B 4PB9L 1LK3L 1T0NB 2G5BA 3V5HA 3CC5B 5CSZB 4BFIA 4HJJH 5BXFB 1UWEH 3KXFE 4M93C 4HGMA 5HGAB 1H3PL 3OZ9L 3RHWF 3T65A 5C0BD 5K59E 3MV01 4ZPTA 1EJOH 1BF8A 1NAKL 5IP4A 4YBLC 3CDFA 1JWMB 4D9LH 4GXVL 4JY4B 1LEGA 1BJ8A 2VUYA 4OZFG 3KYAA 3FHAA 3GJFB 1I7RA 2WBJD 3H9SE 3PDDA 4JR9H 4I0PD 1A6ZA 2F53D 4GO6B 2JTDA 5CJQH 2BNRA 2VDOL 2PUQT 3WN5A 4X4ZA 3E8UH 2I5YL 3QUYA 5I0DA 1MCPL 5DHYB 2R2BB 4NDMB 4WGWB 1OGAD 4G80A 1RJYB 5T3ZD 3T08A 5EB9A 3BXNB 1BJMA 1ZT7A 4FQJL 4NUGL 4KV5E 3V5KA 3B6SB 4Q2ZB 1EGJA 1A9BB 1IILE 3ROLB 2V17L 3GFUA 5IW1A 3RUGB 2BRQA 4ZFGH 2VDQH 3LEXB 5E4IA 5BZWA 4APQB 1U8IA 5GS0H 1RUAL 2ITCB 3PWPE 3HC4H 5JIKA 5DRNA 3BN9C 5H94B 3QDJE 2YUXA 3CUPB 5JW4N 5F9AC 4D9QD 4R6UA 4LSPL 1LD9B 2EIZA 4M7LH 2VLKA 3OX8B 4RWYL 5KZCD 3MJ7A 4P5KA 5DI8A 2R29L 4GMTL 4RNRB 3NIFF 3REVA 3VXME 2WUCH 3VWKA 1ZVSB 5DGRA 1FP5A 1NDMB 2FD6L 3MUZ1 2N7AA 2NMSA 2BNQA 4U4BA 2FX7L 1EIBA 4AIZB 4MJIE 3D3VB 3FRUA 4PRID 4RMRA 1ZHBA 2B1AH 1WTLA 3CFJA 3X14A 2ZNWA 2EYRA 4LIQH 3G5VB 1FDLH 4ZXBA 1NAMB 3F7VA 3RL2B 4K8RL 3GHEL 2AABH 4P5MA 4RGNB 4V2BA 2ADIB 3ZE1E 3GNMH 2IMNA 3VDBA 1VGKB 4MXQD 2NXYC 3SJVE 3TIDA 4QRUA 4MJID 4O2EA 5CILL 5EBLA 1YZZA 4XNZB 4HUNB 2WP3T 1VB9A 3HPLB 4HJ0C 1IQWL 2QHRH 4QHMB 1EEZA 3FN9A 1MHEA 4PFEA 1FYTD 3QDMB 1M05B 1YYML 1E6JH 3OAUL 5IMMB 4ZAKC 4I2XA 1JGLH 1INEL 5F9OH 2V2TA 5SWZB 4NP4L 1HI6A 5FO8B 2RFXA 3NCMA 2DBJA 2QQQA 2PN5A 4MX7B 5HYIA 1ZT4B 3TIEB 3T1WA 1YEFL 5KOMC 4FP8L 1I8MB 4H26B 1UM6L 4DZ8B 1D5XA 1U3HA 2B8OT 1KNOA 2KBGA 4KWUA 1J5OH 5DHVB 2R4SL 3QEQE 2ZUQB 3EAKA 3OR7B 1AO7B 1YDPB 4Z8FH 3MNVA 5SWSD 2PNDA 1RU9L 4TTDC 5DK3A 5D7IF 1CGYA 1W0WA 1TJHH 2MHAA 2VH5H 3C9NA 3MLUL 4PJFF 2XN9B 4PYHA 1DUZA 1H0DA 2CUIA 2R2HB 3V4PH 4E41B 5A2JH 2GITB 1OB1A 2C3HA 5D6DC 1Y0LA 1NGYA 4Z0XB 5DEFB 3MRBB 1JNLL 1WVZA 4X6EB 5D1QA 3RBGA 3QIBA 1CXHA 1X3DA 3N1QC 3KLHD 3L7FB 3W0WE 1K4CB 2PR4L 4JHZA 5FKPA 4HMDA 1HEZA 4PV9A 3JUYA 1EFQA 3THML 5F3BB 2NXZC 1KELL 2FJHB 2UV3A 1IAOA 4LLAA 1LDSA 1S8DB 3JV4B 5BS0D 5IQ9B 4R90L 1U92A 2XYCA 1G9NC 1H3VA 3PP4H 4IBLT 1RVFH 2NTSP 1NANH 1CFVL 4X5LA 4LNRA 1I1AB 5EH1A 1S9VA 2X89D 1J05A 3R06B 1KIQB 4KRPD 1XIWD 4U6VL 2W91A 3D2UD 1BWMA 4YHYC 4NZTL 5JHLH 1XGRA 3V6FA 1GGYA 3MNWB 3M8OL 1U8HA 1IEBA 1AXTL 4O51B 1JRHH 2DLGA 2EDYA 3ZKSD 3EYVB 4U3HA 2O5ZH 1L0QA 5ABDE 3LSOB 5KVEL 3HAEA 1PQZB 2JE8A 3ZDZF 4M6NH 4I3RH 5FV1L 3HMXH 4PY8J 1SY6H 1T5XA 4IMLA 4OF5A 4X99A 4X8JA 2LU4A 3F12A 3JUZA 4RAVB 2ARWA 2OI9B 2RJMA 4QXTB 4Z95H 3IFLH 3GMNB 4EDWL 1XGPA 9CGTA 5B21A 4KJYA 1CLYH 2WV3A 1HSBA 1VACB 3RWJA 1GZQA 1I3GH 3CFCH 3O9WA 1AP2B 3BVNB 1MWAH 4NHUB 5HI5D