4CSPA

Structure of the f306c mutant of nitrite reductase from achromobacter xylosoxidans
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEACELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Impact of Residues Remote from the Catalytic Centre on Enzyme Catalysis of Copper Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 91
structure length 335
sequence length 335
chains with identical sequence F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2014-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cspA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cspA02
3HEIB 2VW6A 4KO5A 1MZZA 3X1FA 3GDCA 1JZFA 3HB3B 4E9TA 2DY2A 2IDQA 1A4AA 1PY0A 2AVFA 1E5YA 2BP0B 3AG2B 3QJUB 3NJJA 2FQFA 4WTQA 3TA4D 4CSZA 2XXFA 1PZCA 1IBZA 1JVLA 1RZPA 3TBBA 4G7RB 1EHKB 2B3IA 2FNWA 3KW8A 5B1JA 1L9RA 5PCYA 3SQRA 2ZXWB 2AZAA 2WO2B 2XLLA 2VW7A 3QJVB 2UXTA 2UX7A 2DYSB 4X4KA 1AZCA 3EHBB 3EH5B 2FT8A 2GHZA 3U25A 2HX7A 3NP4A 3PXLA 4BWTA 4DP9X 1L9SA 3NP3A 2PPEA 5LDUA 2EILB 3IE9A 3NJLA 3NJHA 3NSCA 5FC9A 3N2JA 1MG2C 1NDTA 1NICA 2FWLB 2P80A 4MFHA 1NWOA 2DWSA 2H5UA 5D4JA 3ZBMA 3JTBA 1HFUA 3CDZB 4YSPA 4YL4A 2H3XC 2WSDA 1TU2A 4YSUA 3NJGA 2H47C 1AR1B 3NJIA 4DP4X 1ID2A 1AZBA 1JERA 1FWXA 4PAZA 1W6LA 5F7BA 3ZIYA 1QHQA 2I85A 2J5WA 1B3IA 1A4CA 1GYCA 1GW0A 4AI7A 4G7SB 1E5ZA 2IH9A 4G71B 4DP1X 3CZUB 5I6OA 1L9OA 1J9TA 1PZAA 4TXVB 2VM3A 1EZLA 2FQGA 1L9TA 2QPEB 1AZNA 2LLNA 3FU8A 2GB2A 4M3HA 4BWUA 4E9YA 3IBOA 2YAQA 4E9VA 4F2EA 1CUOA 2ZONA 2EIJB 2CBPA 1TEGA 4QLWA 1CYXA 2FT7A 3AW5A 5B7MA 1AOZA 3OD3A 1UATA 4HAKA 1AS7A 4NAJA 4NB7A 5AZUA 5B7EA 3GYRA 4UANA 4BWWA 3T6XA 4DP7X 1J9SA 3FU7B 1JXFA 3EF4A 1AG6A 1GSKA 2PPAA 3PAVA 4EF3A 1IUZA 2EINB 1ZIBA 4A2GA 2HXAA 2TSBA 5TK4A 4ZK8A 3S3BB 2PCYA 4N4YB 6PAZA 2Y69B 1QLEB 2PP7A 2ZOOA 3ERXA 1BQRA 4ENZA 2YAFA 1T5KA 3AG1B 7PAZA 1KCBA 3NJMA 4UF7C 3UAAA 1W6WA 3FQYA 4GP4B 1JZIA 1PNDA 4FAAB 1F56A 3WKPA 2J55A 1MG3C 4KO9A 1GS8A 1E67A 5I6MA 2BO0A 2PP8A 2IAAC 1BQ5A 3ASOB 3OMAB 2BWDA 3NYKA 4AKOA 1WA2X 5I5JA 2XXGA 4F2FA 5I5MA 4A67A 3NSFA 2Q5BA 2HX8A 5E9NA 3WNJA 1ZPUA 2XUWA 2YAPA 1XB6A 2BWIA 2PP9A 1KGYE 2FJSA 2MTAA 1ADWA 3ABLB 2UXGA 4P5SA 4AKPA 1J9RA 3NT0A 3X2QB 3ZX1A 2N0MA 1J5CA 1KDIA 2IH8A 1X9UA 2R7EA 1AG0A 4RH4A 1R1CA 1PLCA 1BXUA 4K9JA 2PLTA 4W9ZA 1NIEA 1ASPA 4GYBA 1V55B 1KBWA 2HRGA 1X9RA 4A2EA 3UADA 5D4HA 3QPKA 3NJKA 1KV7A 4G7QB 3CVCA 1URIA 2Q9OA 1M9WA 2UXFA 3AG4B 1AS6A 5I26A 1BXVA 2P80D 4DP2X 2QDVA 2IWFA 2CJ3A 2FQEA 2BP0A 2EIKB 3ABGA 1JZHA 1SF3A 1SHXA 1PMYA 1NTDA 1WAEA 2HZHA 4GP5B 1AAJA 3RYMA 2BHFA 2XX1A 1AZUA 1J9QA 5B1JC 1NINA 4W1TA 4JHUA 4YSDA 1GR7A 2GBAA 2BP8A 2BW4A 2BZCA 3N55A 4YVUA 1GY2A 5EHFA 2XWZA 3H56A 2YAHA 5B1BB 4YSTA 3D12B 1KCWA 2GI0A 3BVDB 1ET5A 2DV6A 2WO3B 2XVBA 3QJSB 4F7KA 2XU9A 1GS6X 4HALA 2GSMB 3S3CB 1OCOB 3WI9A 4AX3A 4GY4A 3FU9A 4CSPA 2JKWA 2XV0A 3T71A 5PAZA 1FFTB 1OE1A 2PPCA 4BDVB 2W88A 3FS9A 1NZRA 3FT0A 3FSZA 2OV0A 3G5WA 1RKRA 1OCZB 3CDZA 2E86A 1NIDA 5I6NA 3SBQA 4KNUA 1ASOA 3FSWA 3WG7B 4YSCA 1IC0A 2I7SA 1AIZA 4E9RA 1AQ8A 1KDJA 5A7EA 3MBWB 2YXWA 3H4FA 2BZ7A 1BXAA 4YSRA 3WKQA 1OV8A 3QQXA 1XMEB 3T9WA 1MDAA 4E9SA 1BAWA 3S8FB 3FPXA 4E9QA 1SFDA 1JZJA 3ABMB 2B08A 3NSDA 2HX9A 1AZRA 2DYRB 4A68A 3FQ1A 1BEXA 1ZIAA 4UAHA 3PCYA 2YAMA 1JZGA 5B3SB 3ZDWA 4YSAA 3OM3B 1BYOA 1PF3A 1SJMA 2A3TA 4HCFA 4Q89A 3TBCA 8PAZA 3IEAA 5F7AA 1CURA 3IN0A 4M4RB 3TU6A 1ET7A 1SDDA 4WKXA 2UXVA 4YSEA 2I7OA 4YSSA 2BW5A 3FU7A 2MRYA 3JT2A 2QT6A 2CCWA 2YAEA 4DP5X 5AKRA 2IDTA 1DZ0A 5B7FA 3L45A 4KNSA 1RCYA 3WNIA 1IKOP 4E9WA 2VSKB 1AANA 3UABA 1OCCB 4G70B 2ZWNA 4A2HA 1ILSA 3ASNB 1KBVA 2YQBA 3FSAA 1CC3A 4YSOA 6PCYA 1MZYA 4A2DA 2QDWA 3PLYA 3PAUA 3SBPA 3DTUB 1SFHA 2OCCB 1I53A 1A65A 1TEFA 2AANA 1VLXA 4Q8BA 2J57A 3NJFA 2PPFA 1E30A 2GC7C 5TK2A 4DP8X 1SHWA 3X1EA 1NIAA 4YVNA 2FT6A 4BXVA 5I5IA 4HZ1A 1NPNA 4L0PB 1ZDSA 1V54B 1BYPA 3PPSA 5B1AB 2FQDA 1NIFA 4HCIA 3QJRB 4YSQA 4BXSV 4FA7B 3S8GB 7PCYA 1PLBA 1GS7A 1SF5A 1SNRA 1FA4A 4GP8B 2GIMA 2VN3A 2PCFA 4A66A 1N68A 3FPYA 1ZDQA 2IDFA 3C75A 1L9PA 2BP8B 3FQ2A 1BQKA 2RACA 3AG3B 1NPJA 1WS8A 3KW7A 1JZEA 3X1NA 1ETJA 1CYWA 4PCYA 1WS7A 3UGEA 3NJNA 3PAZA 1GY1A 1AS8A 1PLAA 2HRHA 3FYEB 3H4HA 3SBRA 2VMJA 2AFNA 3FSVA 3S3DB 1OF0A 1A8ZA 3T6VA 2CAKA 1N70A 4QKTA 2XV2A 3NSYA 1M56B 4E9XA 1TKWA 1RZQA 4JHVA 3OQRA 1JOIA 1XB3A 1IBYA 4KOBA 1L9QA 3UACA 2GC4C 3V9EA 2CALA 1PCSA 2JXMA 1A4BA 3GXUB 4HHGA 2X88A 2AZUA 4N8UA 2HLEB 3CVDA 1JXDA 5ANHA 3QJQB 5B1KA 4DP6X 1ASQA 5IY5B 1XB8A 5I28A 3V9CA 2TSAA 2CUAA 1A3ZA 4AZUA 5I6KA 2J56A 4HIPA 1NWPA 1YLBB 1DYZA 3CG8A 1E65A 4KOCA 4NERA 4AKQA 4BDVA 2YARA 1WA1X 3T6ZA 3WIAA 1OCRB 1V10A 4JKNA 4P5RA 4DPBX 2X87A 1NIBA 1WA0X 2UX6A 4KNTA 1OE2A 1OOWA 2IDUA 1ZV2A 9PCYA 1JXGA 2IWKA 1HAUA 2IDSA 1AACA 3FYIB 1ILUA 2VSMB 2Y1AA 2NRDA 4BK5C 1SDDB 1M57B 4KO6A 1KYAA 1J5DA 2VM4A 4DPCX 5D4IA 2YXVA 1ET8A 1PNCA 4A2FA 3CVBA 3OMIB 4G72B 2VW4A 3ABKB 3DIVA 2FTAA 1W8EA 2PPDA 2DWTA 2YAOA 1QNIA 2QPDB 2EIMB 2JFCA 3TASA 1HAWA 1JVOA 3T6WA 4DP0X 3EH4B 2IWEA 3AY2A 5I6LA 4DPAX 2OJ1A 3OMNB 2W8CA 3EH3B 5AFAA 1PAZA 2XX0A 3UAEA 3BQVA 5I6PA 3X1GA 2R7EB 1OE3A 3QJTB 4KO7A 3MX0B 3AZUA 3X1BA 1PZBA 2XYBA 4HCGA 2XV3A 3IN2A 4GXFA 3DKHA 4HHWA
chains in the Genus database with same CATH superfamily
3QEGL 2K45A 3V5KA 3WTUA 2AJXH 2HVKB 2PO6D 2XDHA 3HMXL 3QI9A 1ZTMA 4LLAA 2EH8L 4ZS7H 5F7EL 3HMWL 4RX4A 2EIBA 2HUEA 3VRLE 5JZ7C 4Q97A 2X2UA 3MO1B 1G6RB 3WKYA 2JF1A 3ZDXB 5I30L 4TPRH 4M7LH 1A3LL 2VDQH 3VD2A 1FYTD 1Z5LA 4KK9D 1WF5A 2VN6A 3O6FD 2ODHA 5DJ8B 1NCDL 1JGVL 1CFSB 3ECBB 1C12A 2AXJA 4PQXA 3MLTB 3US0A 1A9EB 2D03L 5FGBA 1NGZB 4CBPA 3EKCA 4X0KA 1MAMH 2F9BT 3Q13A 5TE6L 3FT4A 3QIWD 5ERWA 4JPVH 1NL0H 3CIAA 2B9AA 5PCYA 1DANT 2ZXWB 3J8F7 5IOPB 3HE7B 2OMYA 1SN5A 2H32H 3VQ1C 1H5BC 1KJMA 2UXTA 2O61B 5DC0A 5IJKC 1DBAH 2G60L 4M9PA 3WV0A 2UWEF 2X4PA 4R7LA 5J12C 2EDMA 2ZSVA 4KTGA 1XZWA 1J1XL 5DJZB 3OGCA 4HUXA 5LDUA 4HIXH 1MQKH 1J8HB 2UUDK 5IQ9A 3VAEA 4XE0A 1GC1L 1MG2C 4GS7C 2VNCA 3ZDYB 1MIMH 2FWLB 2P80A 4QTIH 2GFBA 3MRPA 1NWOA 1GMIA 5AOJA 3GZQA 2CKBL 3L9RA 2X89D 1PL3A 3PV6B 5F88A 3C8HA 4KJPC 4OAWB 2EIZA 4HUKB 4JZNA 1ZOXA 1S6NA 2FBRA 2I24N 5EORH 3MV9A 1KELL 4NRYA 4YOKA 5HHXL 4R7NA 3WEAA 1FFNB 4AW4A 2EVHA 4NM8L 4OZGA 2YD9A 1E8YA 2ZJSH 1QHQA 2I85A 1DTUA 2ZTBA 2WZPD 4HIJB 1G7LB 3EOAA 2P24B 3FTYA 5M7QA 2WANA 1H6EA 1ZLEA 1DVXA 2R83A 3ILQC 4Y4HA 4Y5VC 4O9HL 1MWOA 4P5MA 3SOBH 5EH1A 3NZSA 1AY1L 1CVSC 1JGLL 1ORQA 3L9BA 3DV4A 3M1BB 1LP9F 1MHEB 5J11B 2CO1A 4NKDA 3QYCA 4HEME 1JMZA 4FKEA 2Z8WC 3GFUA 4MBOA 3UZQB 3QCVL 4OR1A 2WWMD 1TQSA 1TJIH 3RUGF 2J8UA 3SKNA 3ATBA 3MCLL 1BGXL 4AZ8A 2EAEA 3P4OA 4QRBA 1C16B 2TRYA 2DQFB 2MJWA 3SDAC 2VDPB 1WVZA 2ED7A 1JGUH 1J9SA 2NQCA 2AF2A 1E9QA 2EDLA 4DETA 1WT5A 2GJPA 2VH5H 5FO7B 3UAFA 3TVMD 1A6TA 3N85L 1LO3L 3I3EA 1RHHA 4PJBB 3BIBX 2QVIA 5D7IA 5T1DL 3TGXA 4A7GA 4BELD 1S2EA 3HKFA 4PJ9C 3KPNA 5M94B 3SDDC 3Q5OA 1QHOA 4C4KT 1RK1A 1UWXH 4KUZH 5DC2A 3LY6A 4AL8L 3MRGB 3WHXB 5DJ2A 1B0RA 1JGIA 1XZ0B 3FQYA 4CVWA 5IGXL 5D2LF 2YA0A 3MCKB 5GGUA 3OKKA 1BJ8A 1DJIA 2AQSA 4UM9D 3TS8A 1P6FA 2C9VA 1AHWC 3HC2A 4I0PD 3MR9B 1UA6H 3NFNB 1UKTA 4IMLB 1A4JB 4UTAL 2VXTH 5CZKA 4XHQA 2GITA 4WW1A 1J0YA 5HXMA 4WI6A 4A67A 5FM4A 1MFBL 5E9NA 3V4VL 1RIHL 4IKNA 4NP4H 4EXPX 1JZ5A 2B1HL 3VH8B 1ZEAL 3L7FB 4WAFA 3W0WB 3K1DA 4L8SB 3VFMB 2ZX7A 3ZJAA 4BQ8A 1NGPL 3WMSA 1CGSH 1MFAH 1RIUH 1CFBA 2ED6A 3EOTL 5ACMA 2ITCB 5F1IB 4LLQA 2GSIB 4LDOB 1CFNB 3QG7H 1LEIB 1WHPA 1S78D 2V2XB 3RA7L 1U0QA 3TH3T 2J44A 1R1CA 4CC1A 1KJ3L 2E7CA 4UMGA 2YC1B 4XB8A 3DK2A 1E9PA 2P9RA 3VCLA 5CJ5A 1V05A 1V55B 1T6BX 3Q6GH 5FM8A 1X9RA 3DV6A 4X9YA 2NY5L 3IMWA 1AQKH 5I1DB 1ZHBB 3NPZB 3T3MB 2F53D 4YFEA 4TN9A 4XN7A 1TR7A 2FBJH 3LIZH 2Y5TB 4GMTH 4BZ2L 4KK5D 2FQEA 3R1GL 2WUCL 1VGEH 1XH0A 3EYOB 5DHMC 4WJ5A 5GPRA 3VXMB 4JHAH 1TCRA 4WEBH 3RZCD 3ZE1F 3F5WB 1OEZW 4CU8A 2JLPA 3TNMA 1JTPA 2BHFA 1FL6A 4UT6H 2B4CC 2RH0A 1U8JB 3AS0A 4EBQH 3L3IA 3D85A 3MQIA 4ZBJA 4X7SL 2Y1YA 5TDNA 5E5UB 1SOQA 2YBRB 1YNLL 2EH7L 3IJYA 1SUHA 1M05A 3E9UA 4BV1A 2AEPL 1BG9A 3OB0K 3QJSB 5TFSH 3GDBA 5CZVL 3GSNB 4NQED 2XJKA 2YUVA 3OR7B 1VKXA 4YZFE 5EO9A 4N3UA 4XP1L 4GY4A 4UT9A 3QFDB 5EO0B 4HEPG 2WQ8A 3E1F1 1FSKB 3KEHA 1OAXL 4KAQH 5BV7B 4WHCA 1JF1A 1CE1H 4LKCB 4CGUB 2AI0L 3D5OF 4FA8A 3OAWA 1ZE3C 5FYLH 4D0DA 3LB6D 4TSAL 5CIPH 3SE4C 1KG0A 3T2NL 2CHWA 3IMRA 1MNUH 1XEUA 1XFPA 1VENA 4ACTA 1OF2A 2WXJA 4I85A 1MRDL 3IVKB 2QVTA 1SEQL 3D30A 3S8FB 3PG2A 1CQYA 1A1NA 4HT1H 4ES8A 1XR9A 3FUMA 4IOIB 1YVLA 4N0UA 1JD7A 4U7SA 2B4CH 3WEMA 1S7SB 1I1YB 4LBEB 1BWWA 3NSDA 4QHLA 1DFBL 4L05A 2W0KA 1AZRA 4BHUI 3HLKA 3U2IA 4KX9A 4W9FC 4WWKD 3AB0C 1ZVYA 3GXIA 3WAJA 3P9LB 3DMMD 3ZN6A 1IL1A 1SEBA 2FRGP 3J27A 3NQKA 4G6AD 4JFTA 4R0LC 3QUHA 5FYKH 2EXSA 2IH1A 1T0PB 3GT6A 3NFSH 1NGWB 3QUZC 4MGXA 5E9DD 3DRTA 4FXTA 4MLIA 1KIRA 1TZ8A 4F24A 1R46A 1NAKH 1ZGLB 3PREA 5DD5H 5KW9L 1QRND 4Q0XH 5CGYC 3OX8B 3WL9B 2CJUL 5DWPA 1Q0YL 3ARPA 3B6SA 4HIIB 3P30L 2DRUA 1MEXH 4LSVH 3WJJA 2L7QA 2FGZA 1AGCA 5FF6A 1N7ML 2Q8AL 1ZE3H 1EO5A 2XQBH 2NNFA 2WBKA 1Z5LB 2H2PC 4X99A 1L0QA 3GO1H 3V4PH 1HHGB 4LHUG 1DZBA 3OWEA 2D7NA 3FHAA 4XC1H 2WINB 2P5WD 4EAEA 5I8OL 3WD5L 3QUYC 4PRBA 2QGDA 5ERWB 3VB9A 3KCWA 2ZOLA 1SHWA 4AEHL 4ZI8A 2VN5A 1KJMB 1BMZA 4R7DA 3VFVA 4BXVA 1EJFA 3DIFB 2NR6D 3WY2A 3CTTA 3JWNG 5E6ID 4ZX5A 2ZSVB 1M42A 4C4BA 4EOWH 2WXFA 3OGCB 4EKJA 1JK9A 3MJ8A 1TJGH 1UOWA 4F33A 2WIIB 3IDIA 3T3PF 4P2QA 4G2AA 1GS7A 3DGCR 2Z0UA 3MRPB 1JIBA 5ITFB 3UYOD 3P9MA 2VMDA 5DZJA 5BVJA 3QHFH 5AKVA 2AEWA 3L9RB 5F88B 3UTTA 2EIZB 4JFZL 4JZNB 5FWRA 3NH7H 1WBZA 4QLRA 3BOVA 2X4OA 4YPGB 4NRYB 1AQDA 2JJTA 3IFPB 4KZCA 1LDSA 3UGEA 2WBWB 1WUNT 4NO0B 2OI9C 5DR5H 5F1KC 5JHAA 4OZGB 1HKFA 2P3YA 5C9JA 2X6VA 4FMVA 4PD4J 5J7CC 2R8SL 5FOJA 3EFDL 3LRMA 2VMJA 2YJLA 5E1HB 4YZWA 1ESOA 3PL6D 4TNVK 1ZY9A 2CMRH 3FJTA 3KGSA 1X5JA 3O6FC 2A6KB 5DYOA 1HH9A 4Y4HB 4P5MB 2WUBH 4I9WE 1G87A 5ANME 4G6FB 3FTXA 2AJYH 5EU5B 4NKDB 2YPVL 4JO2H 4HMDA 2Q3ZA 3CDYA 2XY1A 5E8DH 3WNOA 1CO1A 4DEUA 1M1SA 4Y2OB 5GSVA 2LTQB 2X88A 3PV7A 3V6FB 2VISA 4DERA 4ZNEE 2J8UB 3SKNB 1J9CT 1JWSA 1JPSL 1FFPA 3P4OB 3CFBA 1EK3A 4MA3A 4O4YL 5DHVA 4PJDE 2CUAA 2W9DL 1TQWA 4JMNA 3N43F 4QXWA 5K9JH 3VVVA 1E9QB 3RILA 1E65A 2RR3A 1H6UA 1RURH 1I8IA 7CGTA 1RHHB 4IKLA 4ZZFA 1F5WA 2E9IA 4XBGB 1EXGA 2OLDA 3KPNB 2YGVA 2DF3A 1Z9SB 2NCMA 4JAMA 2IDUA 4DK3A 5F7MC 1N19A 2WXKA 5DJ2B 1IM3A 1B0RB 5C0BD 5F3BB 2WXOA 5LGYA 3HHSB 4PJXE 5GGUB 2VSMB 3OKKB 3KPSD 5C71A 4BK5C 3GM0A 4KO6A 5CEXB 1CS6A 2O6CA 4MJ5A 1ZT7A 4TMPA 3UBXI 5LGKA 2EDJA 4RDQG 1QZ1A 2FSEA 4EPSA 4RGOH 4WW1B 2EIMB 3TPUA 3LH9A 5D7KE 3TJHD 2IWEA 5DJDA 4FTVE 5IHUL 5DUBA 2EDXA 4W9KC 3F12A 3V6OE 3FOLA 3KPTA 1P7QD 1Q72L 1LILA 3WFEH 1CICA 1E42A 2CGRH 3GI9L 1S7VA 1UEYA 2WWMC 1CXLA 3IGAA 2BIQA 1XIWA 4LHJB 1YUKB 4CC4C 2VR6A 4M8QB 3X1BA 4IOSA 2HT2C 1NGQH 1AC6A 1E9PB 2BRQA 5JQIB 4GXFA 3IM1A 4IK7A 4G8FA 4J39A 1RH8A 2RJMA 1GJIA 1T89A 2FATH 2ZXCA 1SBBA 2L7EA 1IGJB 1BBDL 1QO3A 1YEFH 3RIAK 4AQOA 3NUKA 4LLUA 2EDOA 4N2DA 5B4MC 1TMCB 1L9NA 2Y3AA 2WVTA 2R4RH 3PPEA 1JGEB 1BVNT 4WJ5B 1TCRB 4TVSa 3SQBB 5D7LE 5EEXA 3NIFF 2QHRL 5D96C 5FUCE 3RU8L 4APQA 3NPSC 1EO7A 1RJLA 2B3IA 3EH2A 3RWEB 4MJIE 2JMRA 1JNNH 1L9RA 3L3IB 3D85B 4KMTL 1IAKA 5E00B 4MB4A 1K6QH 1DO5A 1J88A 2XLLA 3GMMB 4Z5RA 5BRZD 5LCVL 2OP4L 4Z1PA 3IJEA 5DUML 3VDCA 2CBTA 4OM0H 4IOFD 4RFEB 3GHBH 1M05B 4PMFA 2GHZA 3WUWA 1E50A 1D6EA 4ZO7A 2WWNA 1G1YA 3VWKC 2FL5A 2VR4A 3ZYZA 4I2XA 1VKXB 2EILB 5KG9B 5DEFA 1F4WH 4HBCH 3VD0A 4GKLA 1TKWB 3KYNA 4KNQA 1UUSA 5F7UA 2YD6A 3TZVC 4K55A 3AT0A 1JF1B 2JELL 3GJEB 1M3IA 1S78C 4Z7QF 4D0DB 2F7PA 2F54E 4Y4KA 1FLRH 4H13C 3EAKA 3IU3A 3PDOA 5G55A 2FUQA 4TTGA 1LO0L 2EDRA 4AVIA 1D5RA 1G6RL 1R75A 4JGMA 4ZXBA 3PWLA 1KG0B 2GJJA 2EKSA 4IGBC 2ADIA 4KJWD 3G5YA 3VI3E 4F7PA 4Z3HA 4K3JL 2MMXA 2WP3O 5I75C 1E5ZA 4B9CA 5TDPA 2P1YA 4XNXH 4MQTB 1GRWA 4UZGA 1ZGLM 3MSPA 2OZ4A 3D9AH 4NHUA 4WUUD 4DEPB 1XR9B 5F7WC 1KIQA 1M7XA 4G9FA 4RMWA 1ID5I 3TL5A 3THML 2BNQE 4Q4IA 3KJ6H 1IL1B 1SEBB 2F15A 4GSDH 4ICWA 5BPPA 3SHSA 2JJWA 2VT0A 2IH1B 2K70A 4JVWA 4YK4B 2R29H 2ADGA 3DRTB 3ZKXB 2WYIA 3T8XB 1TEGA 2EP6A 2VDOH 1O0VA 2CBMA 4PBWD 5AZUA 5B7EA 2I60H 5IJCC 4CJ0A 4FERA 4UYQA 4FOMA 2KPWA 1KYDA 1WITA 2PPAA 4XWOC 3I9AA 4GO9A 2IAMA 4RAUB 4WJKB 2R69A 4LK4A 1TPXC 1AGCB 5FX3A 2XN0A 4AM0B 2Z8RA 3ERXA 4PWFA 2VQ4A 1PX3A 3QAQA 3NSJA 2YAFA 1LK3H 1U95B 4GOSA 5JW4R 4PJFA 1PNDA 2Q76B 1D5XA 1QVOA 3Q5YA 1JSYA 2J55A 5JMRA 4J27A 1MG3C 1ZANH 4J23A 3BGMA 3U6XA 3QARA 4JFEB 1E6OL 3D2UD 4MNQD 2AVGA 2NXZC 1T21A 3NIDB 1A6WH 1WO2A 1AZZC 1U8MA 1ZLDA 4OF3A 5H37G 3FFCE 1P4LA 3BPNB 4PRHD 4R7DB 2B1AH 3VFVB 5LNGA 4ZDHA 4FXGC 4ODUA 2CK0L 1DSFL 3B2XA 1A7RL 3IDXH 3GKWL 1LK2A 2NYZA 1JK9B 3LNDA 4XNYL 5IQLA 2UXGA 2IGLA 4Q52A 4U3CA 4PY7A 3VI4A 3ZUCA 1NBZA 4F33B 3FOMA 4P2QB 4XNZB 4G8GD 4BUQA 8FABB 1S7WA 2WZ5A 3D69A 2KZ1B 2ZWSA 4RGNE 4XVSL 4M43H 5DMGD 5BVJB 3LAFA 1G84A 3DUUA 1PQZB 1A7OL 2PN5A 3W57A 4OV5A 4XMZA 5C97A 3UTTB 1OT1A 3IDYB 3QIUD 1OGPA 4MNHB 3CPLB 1IT9L 2X4OB 5D4HA 1ZT1A 15C8L 1BXXA 3GSWB 4H26B 1UUNA 2NDGA 4BIKA 4FZ8L 4U6YA 3OXSB 1H0DA 4Z3IA 5C9JB 3DVNB 4UV4H 2GHWB 3NCMA 5AL8A 4F57H 4OM1L 1I1AD 2WQSA 3DX0A 5IHWA 1SHXA 5J1AA 4OZIE 3PWPB 1R3IL 1HH9B 5DYOB 2OYLA 3T65A 3VYNA 4ALAL 4AVJA 2HH0L 3SBWC 4LLMA 4JPQA 1J9QA 1EVTC 1MKFA 2AERT 1J0HA 3I75A 5DJ6A 1EFQA 1GR7A 5AENA 4N6RA 4P9HL 5HPOA 1OIOA 1S9KC 2ZF8A 2F58L 4YR6A 4ADGA 4DFIA 3EZJB 1TTCA 4YNYA 4H20H 2VISB 4XMKH 3FUJA 4NWUH 3NTCL 2ZQKA 1JWSB 2D3LA 3HI5L 3Q1SL 4NKOB 5CXPA 2DEXX 3KR3L 4MA3B 1R0AL 3C5ZD 3VFSB 1XGPA 3B7TA 4LHUD 4URTB 1G7MB 5E6IC 3G6JA 3HVDA 4ZTPL 3A6CL 3RDTA 3U46A 2W88A 2V4LA 4Q9CA 1I8IB 3INUH 4BINA 2DICA 4Z7WA 4HXAH 2BIMA 3MJ9A 4LLDA 4P07A 3GMNB 3CIQA 3BFQG 1W8OA 3IBEA 2Z31B 4E41B 5HYSG 4JAMB 3GPSA 1IM3B 4YHML 1VJSA 3STLB 2IANB 4MHHG 1N6VA 2K4WA 4AK1A 4OFKA 4RFNB 4XXCC 3KZ8A 3F7RA 1GTNA 1DJSA 4GNKB 4WDIA 3WKQA 1DQTA 1PD0A 3L3GA 5DLMH 1OP5H 5D1QA 3MUGB 4QRSA 1W91A 3LS4L 1P7KA 2C9QA 1ZT7B 2VDLB 3KWVA 4MJ5B 1JYVA 1S9YA 3FPXA 3MODL 4K9EL 1PU0A 4UOZA 2FSEB 5EN3A 1DVFD 2XN1A 4E0RA 4Q6IC 5T3ZH 2LABA 1QNZH 4A68A 1WSST 5DJDB 3HG1E 3E0GA 5DUBB 2BDNL 2NCEA 5DQDH 3F12B 4X98B 3FOLB 2DMHA 4X8CA 4HVBA 1SHMA 1PF3A 2A3TA 1CICB 3TBCA 4NN6B 4F15B 2VDMH 1N26A 5GGSA 4JHBA 3LKRA 1S7VB 2NTSP 3TO2A 4BJLA 3A4DA 5L2KE 3GSNL 3IGAB 4F8NA 1RZGA 1Z32X 2P8LB 4OFYD 2EE3A 3K0YA 4FYSA 1UWEH 1HZHL 4XCCL 3ZQ9A 4OCWL 3S34H 4G8FB 4M6OH 4L4TD 2YZ1A 1WZLA 2JVUA 3F64A 2UZXB 1QO3B 2YQ3A 4D9QD 1SBSH 5IJDC 1CC3A 1DBJH 2FH6A 2V7NA 3CFTA 3CCHA 1CXFA 4AQ1C 1H6FA 3DTUB 3UGUA 2F8OA 4XX1G 3LZOA 5ILTL 5I0DA 2I5YL 3BVNA 1FBIL 4OY9A 4O2CA 4Z95H 4APQB 4XPAH 1GGIL 1DVSA 4DO6A 2WC7A 2WY3B 2E47A 2R2HA 4WU5B 3VJ6A 1IAKB 2ZXGA 2Q7NA 4OF7A 1Y6KR 2FBOJ 2IJ0C 3JWDL 4Z7VF 5DVPA 1KUMA 3WIFB 4HZ1A 5HHVH 4ETQA 4IM8A 2LU5A 3WUWB 1D6EB 4IRJD 4KI1A 1WISA 1JVKA 4LLYA 4HGKC 5DEFB 4OW6A 4M7ZB 3RRQA 4PG2A 3MRFA 3KPLA 4B7IA 1CL7H 5ISZE 1F4XH 4WW2B 5IQOA 4BZ1A 3HPJA 5ENWB 2BP8B 5HBBA 2FLRT 4KY1H 1T5XA 1JZDC 1MCHA 2W65B 3FO9A 2KLTA 4HC1H 2NX5D 3AM8C 1BZ7B 2OMVA 4YQXH 1DSYA 3EBHA 5EOCH 4XT1C 1P53A 2APWA 4ZXBB 5JPMB 3I50H 3PWLB 2HRHA 5ISZD 1O6TA 4IDLA 3Q2WA 3CHQA 4F7PB 4N2LA 2E27L 1AD0A 5TDPB 4KK6D 4DGVL 5K1JA 4X5PA 3V0JA 1CF1A 4NHUB 3OQRA 4JKPL 5FA4B 1QUPA 4IU2A 5LXGL 1MHPH 5GXBB 5B8CA 1KIQB 2VGLM 4G9FB 3ZGIA 3BCFA 4KHTL 1F58L 3GS0A 1JWUA 1VEPA 1RULL 2XKUA 5KZCD 3N5AA 4AE1A 4ONFH 5DRXA 4NZUH 1CLYH 4DP6X 1F6LL 1ASQA 1N0LB 2VUKA 5CNHA 3S5LA 1XB8A 2A7BA 3IJ8A 3ZE0E 2TSAA 4KKLC 9CGTA 3S8WA 1J5OL 1KXQE 3LRHA 1HN1A 4PLOB 4DZBB 4IBLT 3ZOAA 5C0AA 1NC2A 4MA8L 2IAMB 3FO1A 1IAMA 3K4DA 2NXYC 3FKUS 5IQ7H 2H6PA 5F44A 1IBBA 2K7PA 5FUZH 5BMFH 2UX6A 4JKKA 3DX7A 2F5BH 4JG1H 4OZFH 3QORA 4WFHD 1DN0A 4QXGH 1E0OB 1F3RB 4DKEL 3P0YL 3QCTH 3QR0A 1S9VA 1A9BA 2AEQH 2CCVA 1KN4L 5E7FA 5AW3B 5AW1B 2YJQA 1RUAH 4PJFB 4D9RE 1D5XB 3KS0J 4AVHA 1YYLH 1UACL 2AXGB 3QQ3A 3W81A 4JO8A 3KWTA 5T5FA 3IDJA 3UTPD 2I07A 1FIGH 5TQ0H 1XH2A 4K5PA 2N3JA 3NDZE 1T21B 1TJMA 3CU7A 2YAOA 1HE7A 1U8MB 4L1SA 3TASA 4NQDD 1P4LB 4L8BA 4LNRB 4FKKA 1KXVC 5AZ2H 5CJOL 1JVOA 2CDFA 4ZDHB 1F1DA 4M61A 4WI2A 2I9LA 1FQ9C 1NCCH 2WVUA 2VRKA 2VXQA 2DQGH 1BM3L 4KRLB 5DHYA 2O6FA 4GRLD 3ZIMA 2QZQA 4D7PA 2VDNH 4PGEA 1PFCA 2ZD0A 1JV2B 1DE4A 1IIIA 1UH4A 2GVYA 5GZOC 2AABL 2O5YH 1CBJA 3EJRA 3VI4B 1C08A 4PY7B 5D1XE 1BZ8A 3FOMB 4KROB 3OQ3B 1LE9B 4K23L 1BZ9A 1S7WB 5DA0B 4R4FL 3ZK0A 5JQHC 4PSPA 3CVHH 3DUUB 4N2KA 5DZOA 4XI5D 5GRYA 1N2RA 4OV5B 4KJQD 1D9KC 4HKZA 2Y7NA 1RUPL 2M26A 3GJFK 2VSCA 1ODUA 3KVDD 1ZT1B 4HGWA 1RJYA 3CBRA 1RZ7H 5I6XB 1TZGL 3KGRA 5IKCA 5DD1L 4XCYA 4H8UA 4U6YB 1H0DB 1FHGA 1KYFA 2YLKA 1LGVA 1OM3L 4UV7H 3BKYH 3G3LA 1E5YA 4JFXB 5DVMA 3WTTA 3AROA 2IPTH 4U7MA 4CVXB 4RFOL 1BIIA 4HJJH 3T65B 3NIGB 1WLHA 3Q2VA 1IGIL 1SJVA 4GQQA 4LLMB 4HAGA 1H8SA 2HLFC 1ZLWK 4Z6AT 1EHKB 3QIBA 3I75B 1KCRH 2MCPL 4MASA 2PWGA 1T2QH 3OJMB 4CL7A 4GAJL 3TA3A 1B0IA 3D3VE 4YR6B 5DD3H 5ACLA 3QG6A 1GGCL 3FAWA 4N8VB 2XSKA 3A3YB 4PJCB 5D1ZC 4NI6A 3AGVA 2V5TA 4UOW1 1TTBA 3LKNA 3N1FC 4Q9BA 5JXAL 5A16B 3W1ZA 2KKQA 1U6AL 1XGPB 3CQFA 4JM2C 3MGAA 2I69A 1S4IA 2JB5L 2ROYA 3G6JB 4FQXA 2FE0A 2PWEA 3U46B 3S37H 1GZQA 2F7IA 3Q8EA 4Z7WB 1IQDA 4LLDB 3O2DH 2P5ED 4OD3L 3U48A 4J3TA 2J20A 3QXWA 1AYRA 1IBHA 2H26A 1I9EA 1NH6A 3ARGD 3T0ED 3CZGA 1Q0XL 1H9DA 3O6KH 1FWXA 1D7CA 4KTDH 3FQWA 1TTGA 2ESVD 4NT6A 4OCYH 3ZKNC 2IH3A 2J5WA 3MLVH 4G7SB 4WDIB 1H3PH 4GBXD 4LEXH 4CMHC 5DMYA 3DX8A 2BNUB 2X4RA 4QRSB 5D1QB 4MMYA 3RWGA 3F2LA 3CHXA 1P7KB 3VXTB 3DSNA 3GMRA 3KAAA 5EA0H 1S9YB 1KZYA 1QW8A 2EE9A 2XV6B 3VH8G 4CKQA 1QWUA 1B2WL 3B2DC 3MRKB 5KTEL 3CSYB 4GUQA 4FQCH 5KBMA 4TLSA 2EDHA 2Z1KA 3KBFA 3MRRA 5E8EA 5EPMA 1JHLL 1FDLH 4F5CE 3DNKA 1IJNA 2CDGA 2CLRA 1SRDA 4MJHA 1GCYA 2E4FA 1CUOA 3GNML 5D7HA 4H0LC 3VD1A 5GGSB 3TO2B 1HIML 3VG9C 1RZGB 2V2WA 2AJ3B 3NEOA 3QDJD 5HVHC 4I18C 2CUHA 4RZKA 1IC7L 2ADJA 2OBGA 1T1YA 3KLQA 1ADQH 5EZPA 4Q7DA 3WFCH 3MUJA 3OBAA 4ZX4A 3MDJA 1QFPA 1PZDA 3LRSA 12E8H 4N4YB 4FQQA 4ONHA 3SGEH 1F8TL 4HK0A 4JG5A 6PAZA 4B5ZA 4JHWH 5FHBH 4YDKL 1NCUA 2L4OA 1L0PA 1NLDH 1EPFA 4HKJA 3BWZA 4OGXL 3PQYA 5BRPA 2KUTA 1F4YH 4JFDD 2V7NB 3CCHB 1CYGA 4OT1H 4NS0A 4OCNC 4HG4K 4GSRA 4GQPH 4O2CB 2ZXDA 1KZQA 3D18A 3VJ6B 2R2HB 3ATAA 4NNYB 4Y4FA 3MV7D 5DWUL 5EBMA 4R26H 3H55A 3RVWC 1N5YL 3OMAB 3M8OL 4YHZL 3DXAD 4FZEL 4DAGH 5HI4C 2HX8A 2X2HA 3BDBA 4M00A 5AKSA 1S46A 4PI0A 3RGVD 4LLYB 5SWSE 5DMIL 5MP6L 5SWZE 4L4VD 4PJ6A 4LAJH 2A5UA 2X4SA 2A6DB 6FABL 1BFOA 4Y19D 3MRFB 3KPLB 4EZJA 5CGBA 3HI6L 3U2JA 5ES4B 4XH2B 1TETL 1C7TA 1U2HA 2VJ0A 3HPJB 3L5WB 4RH4A 2HRPL 1KB5H 4WO4C 4K9JA 1R17A 1NIEA 4JMXA 3FO9B 1ASPA 4GYBA 3WY1A 4OJCA 4DQAA 2BHZA 2FWUA 2A9ML 3H9SE 1G5GA 2OMVB 5KSAA 1Z6JT 3P3RA 2VR8A 4YUEH 1DJWA 2F8IA 1LMIA 5DHXB 1TUPA 4NSKA 5E1IA 4KRPC 1I8LA 3BQUA 3GBNH 4F9PC 1VFOA 1AD0B 5DFWH 1UWXK 4D9LL 3MLUH 3NCXA 3QEUA 4R2GC 3TP4A 5ABZA 4N25A 4FMFA 5AW2B 4X6FB 3SE6A 5IROC 3R06B 1NLBH 2VN7A 3K6FA 4DN4H 2QFRA 3NMEA 1EDHA 1ECZA 3ECVA 1CDUA 1XR8A 1HYSD 4NDMA 2GPZA 2CDEA 1IM9D 4HIEA 1MCFA 3SE9L 2CBOA 2GI0A 2F7RA 3A24A 5A3IC 4OJEH 5DRXB 1I8AA 2IPUG 2GABA 3S5LB 2ALWA 4EIBA 3LQMA 3BMWA 3HJEA 4QWWC 3M7FB 2WD0A 4RDQF 2AKRB 2JCCF 3L1GA 5A2CA 5T1JA 4J4PC 4E2OA 5C0AB 2X70A 3X12B 1OE1A 1U8KB 5C0FB 4X42A 1U42A 2GJZA 3FO1B 5EWIH 3JTTA 2W0PA 1QRKA 4JY6B 4E5XG 4ZFFA 4GG6F 3OLEA 2H6PB 3DARA 3AREA 4HETA 3UMNA 4X5QA 1M53A 1NIDA 4AYDC 2PYEE 4KNUA 4PJ7E 4OUUA 3QORB 4UINH 3WG7B 3HC3H 1UB5A 5C09D 2YD5A 3BP6A 4YHKH 1S9VB 1A9BB 1TNMA 1KDJA 5EU4B 3TFKC 4BCXA 3QQ3B 4CSTA 1OCWL 4L48A 1JDAA 3IDJB 4AV0A 2VQTA 1A6ZA 4FLSA 4OJDH 3S9DB 2I07B 2QPUA 3VQLA 4JQIH 3WSQH 4WF7A 2Z0BA 1EEZB 2MKWA 4IBYA 3EJJX 2CNZA 4KK6C 4PHZA 4M61B 1AE6L 5CF3A 4FTVA 3RI5F 5DHYB 1DR9A 4PJAE 1HKLL 3FL7A 1O9ZA 1FG2A 3QRGL 3V6OA 2JE8A 4PGEB 2JLLA 3D52A 5TF0A 1DE4B 5KBPA 4X8XA 4BQCA 5AEAA 2JCWA 4QOKE 1C08B 1SJHA 1QBBA 2P43B 1AO7D 4OFPA 1KCSH 1BZ9B 1QR4A 5HYJE 2DWEB 2BWQA 1A1OB 3V7AG 1ET7A 2WJ5A 4YSSA 3JT2A 3EO1B 1QHPA 4W4OC 2V17L 3ZLQC 2F19H 2P5PA 4HKZB 4JGUA 3H6JA 4ELMA 1GZHC 1IKOP 4FCAA 3SDCC 1RJYB 4E9WA 3TCLA 1BVKB 1JFHA 1G43A 1R33A 2Q86A 2V5MA 3J2PA 3LEVL 4XCYB 2HFGH 3SPVA 2GY7B 4KKCC 3ASNB 1HJBC 4KVPA 3UX9B 2K8MA 4LCVA 1IFHL 3CDCA 4M7JH 4QRPE 2W0FA 3ILPA 1PX4A 4O58H 3L2LA 3TN0D 3B5GA 3TCTA 2R56H 4V33A 3EDFA 3QUMB 4S1SL 5BZWA 3U2SA 1T3FA 1I7UB 3W82A 1I9IL 3SDXE 3QIBB 5GHWH 4MJIA 3FFDA 3UCRA 2DWDA 2JKLA 3AC0A 3N1GC 4YVNA 1F2QA 3O3AA 3A4AA 1ML0A 5BCAA 1H5BA 1H3WM 3GTVA 1FGNL 1CIDA 5HHOB 35C8L 4H1LH 1WTLA 3PPSA 4GSUA 4XTRC 1TZAA 1YNTF 3FNKA 2ARJQ 4LSUL 4FQXB 2WYZA 3HE7D 4UOJA 1ZWIA 4R97B 3ULVE 5IJVA 5T3XE 3FPYA 3WIIL 3OAUH 3BPOB 4CU7A 3VFPA 1GZQB 2FEJA 1UADC 4NN5C 3WFDH 4EUPH 5IFAH 1IQDB 3DPBA 4L23A 3VD5A 1F2XK 4JFPB 4HOWA 2Y07L 3CXDL 1QACA 2DYPA 2H26B 2F54A 4GRMA 2ZP0T 2OSYA 4KJQC 1C1EL 4M6AA 1J8HD 1MWAH 2XXMB 1A6PA 1FNSL 1NBCA 5FHAL 4KY2A 5DZ9A 3WXWH 4MJ4A 4A7VA 5B39A 5I6PA 4NT6B 3MNZA 4K4KA 2KZWA 1N6UA 3SPJA 3VI3A 5HHPA 1U3HC 4X6DF 1Z1WA 4N1HB 3RWGB 3DSNB 3G5VB 5D5MB 1MN4A 5AB1A 2X38A 3SN6N 5MHSE 3KGTA 3UAJC 5E8EB 5EPMB 4Q9RL 1L9QA 1W72H 4QCIB 4X5WA 5E4EB 1C8QA 2R4SH 2DLFH 2CDGB 3PHQA 2CLRB 4XMLL 2BNQA 3NRPA 4L1DA 1IKFL 2ZUXA 1KV3A 1MJ8L 4EQ3A 4J12A 5HHNA 3GC3A 3QJQB 2IEPA 2FEDC 4XPHH 1KPVA 4MCMA 4XCFL 3SDAA 2XWJA 3O6ML 1P2CB 1KY6A 3OHMB 1PYWA 2DQEL 4W9LC 2GUYA 1CXKA 4YPJA 1RUQL 4BDVA 2ADJB 1T1YB 3N91A 4UDUA 3WMQA 4PTTA 1HOCA 2FLBT 3EJZC 3LRSB 2LFGA 4HK0B 4WHTA 1NKOA 3QGVA 2N7SA 1OE2A 1PG7W 4GQ9L 1GKEA 1ZV2A 3SDDA 2AGJH 3LIZA 1QA9A 3PQYB 4LVNB 4J6RL 3ARGC 2N7AA 1ILUA 2WQWA 4KRMB 4UYPA 5DZPA 2CLZA 1S3KH 5E8NA 4U33A 4RA3A 4JM0A 3TX4A 4K73A 5EBMB 3D39E 4Y4FB 3N42F 1U2YA 3OF6A 2VLRB 4HXBH 4GBXC 5AAPA 1JZ6A 3LOWA 5TE4H 2A9AA 4GI6A 5F6HI 2X1WL 3EG9A 1EV2E 3L4TA 2EDBA 5SX4H 4LSSL 2Z8VC 5ICXB 2W07A 3L95A 2XN9E 5I6LA 4V1DE 4P2RE 1LEGA 2J72A 4G5ZL 2CH8A 1BFOB 1UJ3C 3UAEA 3KJ4C 3X1GA 1QSFB 3GJFB 5LAPA 1JG9A 2R15A 1HCYA 1CDIA 1P4BH 1M9SA 4S0HA 3WHE1 1ZSDA 3SCMC 1I8KA 3AS1A 2ZUUA 3L1OL 1S7QA 3DKHA 1QBLH 3CZFA 4HHWA 4XPGH 4C47A 3OG6B 2PETA 4FYQA 3W0WD 5IF0A 3T0VA 3TT3H 4EEEA 5KSAB 1CDYA 2ARJA 4FQJH 1SY6L 2AK4A 2OR9H 4HAFA 4ZPTA 2DQTL 2OSLB 4GSXA 3DBSA 4DFHA 3HLAB 4U1LA 1FUNA 1GJWA 1R34A 4X6CF 4NSKB 2EACA 2V5SA 5HYEA 3BQUB 3L4ZA 3V5DA 4BRVA 3FB8A 4PJIE 5FK9B 1VPOH 4EMZA 4QKXB 2H2SD 1OZTG 5CJXC 2DQUH 4OZIA 1YEGL 3GHEL 2P28B 1JVLA 3RY4A 3S96A 1YYML 3QJFB 1PEZA 4BSJA 4FF9A 5KSBF 1LM8V 4AGQA 1XR8B 4NDMB 1QKZH 2CDEB 2ZX6A 4PBVC 4XRCA 4WFGE 2FJUB 4HIEB 5B3JF 4YX2L 3VXMD 5JOEA 4JRFA 5C70A 1H8OA 3LSOB 1WZMA 3U4AA 3F7LA 4J5VA 4HZAA 5IW6A 4DP9X 3ILDA 4GO8A 1GSMA 4P4RB 4LPWA 2WMPB 3NSCA 3M1OA 3TCXA 1IARB 3N2JA 4I5BA 4NQCA 2AV7A 4JK0D 2X70B 1NAMA 3BT2H 3H42H 1YEKL 2GJZB 4HPOL 3FMGL 4ZFFB 3GKZA 4Z23A 4Z7OE 3GSVB 2J71A 3AREB 1UA7A 4DW2L 2NYYD 4EKXA 4OUUB 3DO7B 3HRZB 1UB5B 1AR1B 1IAIM 3EYSL 1CDGA 4MD5A 3BP6B 1V3JA 4LOUD 1Y7VA 1QYGL 2OMUA 1AZBA 1J86A 2VDQB 3FBKA 3BAEH 4FFYH 1AGEA 4TTDD 3FU6A 4LPXA 3ZIYA 3VFOB 4N8PA 3SE4A 1GW0A 4NHCL 1NPUA 3JVGA 2O26U 3DUSA 4EI5B 1WWCA 3VMPA 3O9WC 2BC4A 1INDH 2UY6A 1A6ZB 2XIDA 3BT0A 3CZUB 5CSZB 5HSFA 4YEFA 3HAEA 1T0MB 3UZEC 5J6GA 2X7LA 4JO5A 5GGTL 4DTGL 1JNLL 4FNLH 3O2WL 4PRPB 3D0VB 3E80A 1WE5A 2H32B 3FCGA 5C0JB 5L7XH 1GGTA 2WLNA 3HC4H 3HG1A 4HIHA 4MCYA 4GAGL 4U0RB 1PJWA 4K7PL 4PS8A 4BSVA 2G0LA 4R0LA 1OAQH 3MOBH 4F2EA 1SJHB 3BVVA 3ZHLA 2HFEA 1P0SE 2V3FA 5JQ6H 2CPUA 5I24A 3ZTJH 5CMAB 4HAKA 5AG8A 3MNMA 1Q9OB 3T2PA 3O0RH 2OL3L 1UD5A 4QR7A 3BRFA 1I4FB 2A1WL 3B3IA 3PAVA 1ECYA 3II2A 4ELMB 3TURA 3KDMB 2HXAA 4YHOL 2Q86B 5I1GL 1N18A 5BO1L 2Y25A 2D9QB 3MGOA 2KHAA 1ZD6A 3BDYL 3RIFK 2RMNA 3O8XA 2J6EA 1OANA 3AJ7A 1UD8A 2P7TB 5HJ3A 2VLKB 3L54A 2JKSA 3AWEA 1YY9D 3BKJH 1G0XA 4U1HA 5BZWB 2EKJA 1FORH 3U2SB 3Q48A 4BH7A 1T3FB 4RX4D 1CZ8L 3HZVA 4PRDA 3N44B 5DS8A 3QUYA 4D0CB 3FFDB 3ETBF 1AXTH 3DRQA 2OJZH 4FFTA 3B7YA 2BWDA 3AADB 4YO0A 1UXWB 4HBQA 4F2FA 3CFDA 4ODHL 3GRWL 3HN8A 4OH2A 3BP4B 5IVXE 1H5BB 4PJEE 1BW8A 2R0WL 1ZPUA 3BP7A 2Z4QA 1BQSA 3IJ9A 4OCSL 4X7CC 1QBML 3L5XH 5JW5A 5L4JA 3QPQC 1B9KA 4WVRA 4AKPA 3ATEA 5E1QA 4ONOA 4QRUB 4GS7B 5IJVB 1G7PA 1UYWL 3JXAA 3UDWA 4Z0BH 1MJJA 5HDBF 3VFPB 2I32A 5FFOA 2X3AA 3H9ZA 2DKMA 4W9ZA 2DQIL 3NZUA 2NNXA 4A37A 3TTSA 5KJ7E 2PKDA 3VMNA 4KV5E 4A2EA 4GRMB 3ET9F 5FFLA 3AMKA 4M5ZL 1KV7A 1OWWA 1FJ1B 3MBEC 2UXFA 3WIHA 5B39B 2P80D 2XZAL 2VXVL 3PABA 5HHPB 4BRJA 4AMWA 4DP2X 5J6HB 4GRWH 2XACC 3O6LL 4ORGB 1PMYA 3SGDH 2ZKHL 2WLHA 3MV9D 4GP5B 5ESAB 1DDTA 5BOPA 1P5UA 4Y5VB 1AZUA 4WV1C 1O6VA 4WKZB 4XGZA 5FB8A 4I8DA 4UILL 4X5WB 3W2DL 4RMBA 1ZVSA 2L7JA 3PHQB 3H56A 3MLWL 4EN3A 4BFIB 3RVUD 4WK2B 1WD9A 3D4ZA 4WFEE 2O5NA 3BGAA 4LDEB 4HFUL 4B9FA 1T20A 2A0LC 1FZMA 2H1PL 3VW3H 4QXTA 4Y4HD 5DUJA 5IMKB 1EX0A 1F18A 1KPVB 4HD5A 6CGTA 2BINA 1OCOB 1KXQA 4YZFF 3SDAB 4G6FD 2XWJB 32C2B 3O41A 3V0WH 3IS0X 1PYWB 5GS0C 3ULVL 5T3XL 4BDVB 5FO8A 2ICWI 3H9HA 3GK8L 5DD0L 1NUFA 3LCYA 4UDUB 3I9PA 2FX8H 4PTTB 3ZDYF 1HOCB 3VXNB 2NDFA 3IDMA 2GAZA 1TSRA 1R24B 2FHCA 4WHTB 4WTZA 3SBQA 4C57C 3BSZL 3VA6A 5EIIG 3LHAA 1WH0A 2OULB 5HI5C 3N1QC 3SDDB 1QA9B 1A22B 5JHDE 3ZZLA 1R4XA 4YL9A 2BZ7A 2X10A 2IGFH 3HZMA 2OM5A 4BK5A 1T66D 5E8NB 4MHHI 5DRNA 4IU3A 1MDAA 4E9SA 1CLVA 5K1NA 2JKTM 4IBTA 3IK2A 4P48A 5IEKA 5AWNL 3EG9B 4JDTL 2P8PA 5INDA 1BD2A 4HKBA 2A77L 2CSPA 3C2AH 4GEIA 2W07B 1E4JA 1FO0H 3L95B 1YEIL 4MYWB 4ZMZA 1WFOA 4X4ZA 5KS9E 4HMCA 4OCRL 3W11C 3C9NA 3UTSE 1VFMA 1JZGA 4GXVH 1LEGB 1TQVA 1G4MA 2A74C 4N9GB 4HQQL 1WCBB 4WO0A 3RBSA 3WKML 2V8MA 3B2UD 1H3TA 4AIZA 4DPRA 4N22A 2NY2C 2YK1L 1WIUA 3H8NA 4ORZC 3IRCA 4YSEA 4CC4A 1ZSDB 2QVKA 3ML8A 4N0YH 1I8KB 1YPZA 5F9DC 1B4JL 1S7QB 4LZKA 2NMSA 2Y9RT 1DZ0A 3CZFB 4TUOA 3KE0A 2P4AB 4AEIH 1HI6A 5IF0B 4GMSL 1A7PH 4QPEA 5ADPH 4YBQC 2ARJB 2AK4B 3FUDA 1IIKA 4ZPTB 2QQKL 4PJBF 2B14A 5ADOL 5KVFE 4U1LB 4CADA 3TH4T 2IADA 4XAKD 4EZKA 1FNEA 1I3UA 5CIPB 4AV4A 4IQHA 4YSOA 4XVJH 2OKMA 4ZFOA 3FB8B 4A2DA 3PLYA 1I85C 3HRPA 3EF7A 3DI3B 3L4XA 4LQFH 4DF9A 1I53A 4XODA 5IB2B 5FYJE 3RFZC 1OW0C 1O5PA 5E5RB 1F90L 3PWJB 4JB9H 3RVTC 3S96B 1IEHA 2O5XH 4X7DC 3WJLC 1D6VL 2P49B 1OP5K 1NIAA 4XRCB 2FWOA 1KENL 2QTVA 3D3VA 2D7QA 4MVBC 1IFRA 3F05A 3V55A 2VB5A 3E3QE 4MS8D 5EUOF 1BYPA 2R29A 4HCRA 4HCIA 5HVFB 5IW6B 1UURA 3VWKA 2IFGA 3J7HA 3RJDA 5E2UL 2ZCHH 4NQCB 2VJ8A 3D85D 5FV2A 1SF5A 1NAMB 4JVUA 4ODVH 3QSKB 5E03A 3WNMA 4CVZA 1BMGA 5BNXD 4LB8A 3TZVA 1KMGA 1JP5A 4HJTA 1DDHA 5CZRA 3VWJA 2VABA 2H6UA 4XOAA 3CH8A 3CZEA 4ECNA 5F8QC 2GIXA 2OMUB 2UWEE 2WZ6A 3PJSA 1AGEB 1GY1A 1YHPA 1AS8A 2B59A 2K6ZA 3CLFL 4L8SC 3V4PB 5CKAA 5IMOB 3SBRA 3T3MF 3QZNA 1DVTA 3DUSB 1X5ZA 2BC4B 2UY6B 1ACYH 2VDPH 5B38B 3LRLA 2XV2A 3JV4B 3REVA 2X7LB 3QUML 5IUCA 2O4EA 2HA1A 3TLRA 3QBTB 3U36B 3FTVA 2R1YA 1NCBL 5ABDE 4ABWA 1OB1B 1HE8A 5IR1B 3I9IA 4MCYB 2WOYA 3BLPX 1LWHA 3NZ8A 3AB0B 5FCSH 4LOVA 4OVVA 4BSVB 2OW6A 1T7WA 3RTQC 1SM3H 4ODXA 4R0LB 4XOEA 2OQJA 5CP7A 2MTPA 2QSQA 4R8WH 4FFZL 3CSBA 1C5CH 1NANH 3FSOA 2HFEB 4FG4A 2WLLA 3G5ZA 1X44A 2F5AL 4HWBL 5IY5B 1XL6A 4MD0A 1YY8A 5CUSH 2J56A 4LCYA 4ANWA 3GMOA 5EF1A 1K5WA 3B3IB 5ALCH 4KQ3L 4NOFA 1DUYA 1P1VA 3MLRH 4PJ5B 2WCPA 2ZYHA 4MA7L 3OSKA 3MGOB 3BPLC 4MA1B 4TOYH 5AOLA 3RUGE 5IW1A 4OSUL 2F1EA 4S1QL 5HJ3B 1EWHA 5JMOC 4LOUC 3QDGB 2ZWZA 4AG4H 2EEXA 4U1HB 3VRIB 3C60C 1HZKA 5E2VH 4BH7B 1M2VA 5KVDH 4DQOH 3HZVB 4N8VG 5TD4A 2WLJA 5A6IA 1HHHA 1KTDA 5AYUH 3QUYB 5BV7C 3DRQB 5EB9A 5EC1A 4RRPA 4YO0B 3U7AA 3CFDB 4K7PX 3SY0A 4LSRH 2Y06H 4HWEL 1MCWW 3HNVH 3QPXH 3T6WA 2YMXL 4QTHA 3GUTA 2F68X 3TO4C 3BP7B 5J06A 1OAYL 4IJ3C 3KDPB 3ZY7A 4HLJA 1R6VA 4XBEL 3ZL1A 5H35A 5JW5B 4W6YB 5D2LE 2RFXA 4JFED 4WK0B 5JW3L 5CCKL 1ZJBA 3RJOA 1VFBB 1DVUA 4OB5H 3UZVA 2E56A 4NQVB 1K2DA 5I1HH 4OF5A 4M4RA 5HDRA 3UIZA 1CBVL 3KVPA 4M1DL 1AQMA 3EDJA 3UO1L 1Y6NR 4HCGA 1FVEA 3IN2A 3MLSH 2WXGA 4UQIM 5GJSH 4XCEA 3QDMA 4G6JH 1Z3GH 4G80A 4PP2A 2NW3A 2XWDA 2APBA 3X17A 4HJ1A 1YEJL 4P2QD 1E4WH 1VF5C 2OI9B 1QSEE 4ODBD 3BISA 3PABB 3K74B 4NC2B 2ZOKB 5FCUL 3UTTD 3LXAA 1EIBA 4JFHD 2HTKD 4BCYA 3LKSA 4Z78A 4K15A 3MREB 1DQDH 5AB2A 4OIAA 1WPCA 2H1XA 4P9MH 4F9LC 3RZWA 3P73A 1S7UA 4P49A 5BV7H 4XGZB 5FB8B 3QI9C 3U0WH 2VXSL 1ZVSB 3I6GB 1MVYA 4R84A 3ZVVA 3VXQA 4M6NL 4Q74A 4CDGC 3CVIH 3QFJA 1QLRA 3QP3A 3GINA 1T20B 3S48A 3PWPD 1FZMB 2MOGA 3NP4A 5TJWK 5I0XA 4QXTB 1MCEA 2V2TB 5EF3A 3LQAH 1LO4L 3IE9A 1OGAA 3ZE1E 3O41B 1UGNA 2ATPB 1LDPL 5DO8A 3ZZ1A 1NMAL 5EEZA 4OCLC 5FO8B 1JF6A 4J2XA 1BQLL 3JTBA 3C12A 3IDMB 2GAZB 4RAVA 4WGWB 2HN7A 3F00A 1Q1JL 5I0YA 4XR8C 2PYEA 5DA4A 1UB6B 4UBDD 1JYXA 4MBRA 3K46A 5CBAB 3OAYH 4PAZA 3P11L 4D8PB 1T5WA 1KGIA 2WNXA 2HMID 2GTZA 3CAFA 3EDDA 3RQ3A 4J8RA 2M2DA 2EZ0C 3GF8A 3I74A 4U7KA 3HZMB 2C1OB 4Z7NB 3ENEA 4OZGF 4XXCA 3DHPA 2WAHA 2NLJA 4IU3B 4F37F 2BS8A 5BZDB 3EDEA 1KJ2L 2Z31D 3DSFH 4K07A 4QAWA 5F1SA 3P4NA 1CQKA 4XP4L 5FO9A 4E41D 3GSOA 2UZPA 4Z76B 3TESA 1IM3D 1BD2B 4HKBB 4FKHA 2IAND 3GPEA 5DXWA 1HT6A 3LDBB 3D05A 2DBLH 5HJGA 2HRLA 3RL1A 3KPRE 3C9NB 4PJAA 1OSEA 3ZZSA 4NI3A 3UP6A 5E8OA 1DQVA 1E5UI 2V7HA 2FCBA 4QOKA 4E9VA 4ADIA 1X5KA 3MBWA 4A39A 5HYJA 4KQ4H 2XWXA 4NB7A 1JWMB 3CC5A 2IQ9H 1CGUA 1YPZB 4WTXA 3HNTL 4TUOB 2OSXA 1HI6B 3FDWA 4HC1A 4MMXA 3ZSSA 1PZUB 1LE5A 1CICD 2AJXL 1MFMA 4ZS7L 2Z35A 4A7GF 2PP7A 4PVBA 4YH6A 1FNEB 1TFPA 2BOLA 1BF2A 1IBGH 4ZFOB 1NGYA 4TPRL 4W93A 1WZKA 4MWFB 4IOSD 3C5SA 2VDQL 2ZKXA 1P6AB 4M7LL 3L6FB 5C0RL 2EE2A 1OSZB 3K2UH 4XWGL 5HHME 4AQ1A 2QGCA 3RVXD 2DI7A 2F1AA 3Q8FA 1WT5C 1E67A 1OAUL 5D96B 3CHRA 1JJUA 1YYCA 1F45A 2DDQH 3SDXA 3NPSB 5E7BA 1V3KA 3RHWK 3PXJA 2EO1A 3L3JA 1T66C 1MAML 3GMPA 4NO3A 2F61A 2FB4H 2V9TA 3AUVA 1CGVA 2FWOB 3KWUA 4TQ8A 5J56B 4Y7OC 3RG1C 4B9IA 4TLTA 4P5TA 1UFGA 3EJQA 1T7XA 3R8QA 2LGNA 5FEBA 1MHCA 1X4ZA 2DMCA 2J7LA 5BOJA 5JO5A 2BWIA 1DBAL 1MW0A 1F97A 3AMLA 2MTAA 3MROB 2VDOB 3NCWA 1L5GA 3VWKB 1GHFH 4APQD 3IE4A 4EQ2A 3HG0A 4GPVA 3U1SH 3U4BH 3HJ0A 4HIXL 1MQKL 2VDRH 4NNPH 5IVOA 4CVZB 1J0ZA 4N68A 4B53A 3OC5A 5IBLD 4QTIL 3TZVB 3B2UC 5CS7A 2ZOUA 1O7DE 2BCMA 2VO8A 3JUZA 4RSYA 2A6IA 3LZPA 4R9HA 2FIKA 4P05A 3PJSB 1QATA 5KVFL 3AG4B 4HA1A 4YGVA 3TBSA 3FCUB 5I26A 4ELKB 2EXYD 2IMNA 4MDRA 4YXLH 2XQYK 3F3HA 4IEFA 5MENB 4IGBB 2FAUA 3T3PE 2IWFA 1UOVA 2EIKB 4NQQA 5I75B 3TT1H 2CBQA 3WXVL 4J8QA 5FYJL 1WAEA 1Z9PA 3GIZH 1FYTE 5LQBL 2HKAA 1RXLA 4IBSA 2R1YB 4ZXBD 4LESA 2H0FA 2QGBA 1EFXA 4W1TA 4XMUA 3SOBL 3IDNB 4OGZA 4X8JB 3N55A 4IJTA 4XVTH 1GY2A 4LKXA 4JQXA 1CF8H 4L1TA 1B88A 3CH1A 3DOHA 2WV3A 3CU1A 3QO1A 5BUGA 1U8PB 4HS3B 3V6ZB 2Y5EA 3G5ZB 2ENJA 4RETB 4I3RH 4FYTA 1H3VA 4W68A 3LZFH 3S3CB 2XA8H 4G9FD 4NQUA 4LCYB 3GMOB 5PAZA 1PIGA 3U9UA 2OFQA 2VRAA 1IGFH 1SUJA 4I89A 4XXDB 1DUYB 2MPAH 3K8LA 4XCNA 1BAFH 1TJHH 4LFHD 4TRPH 3V0GA 1TPXB 3LVTA 1FZJA 1O5DT 4YDMA 3E6HA 1CD9B 3QHZH 5JDJA 1TTAA 1AQ8A 1CB4A 3C6SA 2ZCLH 5DRZB 2Q20A 4KUZL 5ELIA 2IFFH 2IAMD 1JDDA 2Z7ZA 4KGJA 1IE5A 1QTSA 2X44D 3IJSA 4ODWA 1HHHB 1KTDB 3UG4A 3NVQA 2CIKA 2CRMA 5AW8B 1SFDA 3GHPA 2NXZB 3ABMB 1JDCA 4EDXB 1UA6L 2E0PA 2GK2A 2OMWB 2O6DA 2ZXAA 3SY0B 1JL8A 3O3DA 2VXTL 3STZA 3TBWB 3GUTB 1NM4A 2QPFA 1HQRA 5I1AB 3FQ1A 2KPNA 4FXGB 4KK8D 4AIXA 3II3A 4R4BA 1BEXA 2XBZA 5EZLB 5J1SC 2YAMA 4QRFA 4X80H 4YSAA 4MDIB 1U8OA 4HCFA 1E28B 5GZOA 2TAAA 3UZVB 2X2IA 1YC7A 4O51B 1K2DB 2XVGA 4M4RB 1CGSL 1IC5L 1RIUL 2MHAA 1E27B 1UT9A 3BAXA 3FF8A 3T6QC 5C92A 2MRYA 3MLXH 3QG7L 4YBLB 5EIVA 3H53A 5I1CH 1D9KA 1FC2D 3QDMB 4G80B 4PP2B 2NW3B 2WTRA 3PNWB 3V7MA 3WY4A 1T03H 1IO4C 1N59B 3R19A 1T4KA 2OK0H 4KROD 4NZFA 4KTEH 3QEQA 5EN2A 3VXSB 1DCEA 1RFDL 3ARZA 4GMTL 1GAFH 1IEAB 5D71H 4GUPA 4UT9H 2CQVA 3LKSB 4Z78B 2ITDB 4ZMLA 5F9JA 3FN0L 3KL0A 4JHAL 4WEBL 1QFHA 1XF5A 3P73B 1S8DA 4NN7C 4BCZA 2YQGA 4N9OB 4WZ9A 4UT6L 2IBZY 1THAA 3WJJC 2QR0B 4JGNA 2R1XA 4EBQL 3SGJC 3NIDF 4O5LL 3QFJB 3B1TA 1FF5A 1QLRB 2G3ZA 1QABA 4XE5B 5CLYA 1NPNA 4ZO9A 1G7JA 5DJCA 5MERB 2CK2A 1NIFA 2YD0A 3DTXA 2VDMB 1I8MA 3T0BA 5TFSL 1G9HA 4QRQB 5I17A 1OGAB 5E24E 3MRDB 3NIFE 4JM2A 4KX7A 5E6IB 3TBTB 5F2FA 4C55A 3VXPA 1C5BH 3VGHA 2ZWLT 2XG5A 4MSWB 2HN7B 3ARDC 3CJJA 4C83A 5KOVC 4KAQL 1AJ7H 1A2YA 1NPJA 1D5IL 2XQYA 3P69A 4MXVF 2ZSWA 1CE1L 3SJVB 1RZJC 1A9VA 3C08H 3KYMB 1T5WB 4HS6A 4Y9BA 2BVUA 4J8RB 1XGRA 1P5VA 2A73B 1DJYA 4WSJA 3RX7A 1VCAA 3CV5A 4QYOA 1MNUL 2YRZA 2RQ8A 4PG9B 4L3CA 2F53E 3MNDA 4JHVA 5EC2B 4UOQA 1JOIA 4MQ7A 3ULUC 3GSOB 4IRSC 2HTKC 4HT1L 4OLUH 1SMDA 5F0LB 3EJUA 5DSCA 2B4CL 4N2GA 4R83A 3I6LE 3RL1B 1A4BA 4XZ4A 1TYEB 1UXSB 1Y1DA 5D1QD 4NUMA 5D2NC 2V7HB 3W9EB 3AACA 1RU9L 4M56A 4QOKB 7FABH 3U7WH 5B1KA 2ZP9A 5FYKL 1EANA 1PW3A 2GIYA 3F58H 5LBVA 4DKFH 1G9MC 3CC5B 4AZUA 4ABVA 1NWPA 1NAKL 1DYZA 5DD5L 1RJZA 3MZTA 4TQEH 3QWNA 4I18A 4Q0XL 4QT5A 1KB5A 4P57A 5L88H 5I16B 4MMXB 5C8JA 1LE5B 2WGNB 1EAPA 2YZ8A 1BFTA 4AGLA 2Z35B 4U1JA 2UY7B 1JD9A 2F7QA 5JOPD 4TVPD 3SEPA 4Z8FH 3MKKA 4KHXH 4AWJC 1NGYB 2XQBL 1M71A 4WTWA 3V0FA 3C5SB 2DM7A 4X9HA 3WNPA 3BEVA 2AHIA 4BA0A 4AQ1B 3V4PL 1U8QA 1YNKH 2YEZA 5DHEA 2YIHA 3RWHB 4RA0C 5ICYA 2HTLC 1BMWA 2NZ9D 3GMPB 4NO3B 4AMKH 2JFCA 4CN4A 4U3HA 4HU2A 1KACB 3RGHA 3RKDC 4DP0X 2J4WH 4P5TB 3EH4B 4OQTL 1NFDE 1WK0A 4DPAX 1MHCB 2WN2A 3NCYP 5JO5B 3T0DA 5EZIH 5K9OB 5LLIC 1UM5H 4PP1D 4NJ9H 5IG7A 4B3EA 3OR6A 4F9LA 3S4SA 3BUPA 1G9MH 1A66A 4JLRA 1CTNA 2MOVA 2GBTA 2A4CA 3K80A 5E9DE 4NYLA 4UB0H 4R3SA 4KKRA 4G8IA 5BVPH 3O4OC 4PGJA 1KTLB 4RMSA 1MIEH 4OZFB 3NH7L 1QRNE 2OXGA 2FIKB 4PV1C 1SMOA 5F96H 4M6MH 4PRAA 2DY2A 4IEFB 1KJVA 5HP5A 1I31A 3HZYA 2C9RA 2YRBA 4AEEA 4F9PA 4LHQB 5DHVH 3IB4A 5F9WC 4JDEB 1XIWC 3KVQA 3L13A 1K4CA 3A4EA 1KC5H 2OR7A 4NUGL 4B96A 2YGNA 3E8UL 1PD6A 4ZS6C 1ND0A 4GT7A 4QRRE 4ATTA 3G6DH 1EFXB 5EZJA 2WUBL 3BUDA 2EH8H 4DZ8B 2YEVB 2AJYL 2P5WE 2UV3A 3CH1B 3OLDA 2NY3C 5I30H 1YEHL 5EU3B 4EIGB 2VDNB 5C0GA 4QHNA 5GGVH 1IJ9A 4L4JA 1NCDH 3DJTA 4L37A 4JFFB 5D7SH 4ZMOA 3K81A 4LCIH 2YPLB 1O6SB 1T4WA 3DYMA 3QQ9D 3NJHA 3QISA 2D03H 4NUJB 4PGBA 4AYFA 4JREB 2RGSA 3CVHB 3U9UB 4J4PA 4MFHA 2VDLH 5TE6H 5K9JL 5GS2D 1U21A 2GK0A 3RVVD 2H5UA 4XCNB 2ZOWA 1R5IA 2NXYB 4WW2F 5E94A 4X5XA 1FZJB 2VZVA 2XTSA 3NJIA 1GIGH 1GYVA 1S7RA 4DP4X 2G60H 5JHDA 1UVQB 3C6SB 2BCKA 5F1NA 5C0AD 5ACZA 1J1XH 4TNVF 3Q7JA 1F41A 2ERJB 3ZHDA 2ZCZA 3RBGA 2FJFA 4H0IA 4N5EC 3IJSB 4ODWB 5K59F 1L9OA 2FHBA 2CIKB 3QORD 2FEEL 2CKBH 1SDAB 2NY0C 3TC9A 1BVLA 4J6IA 2YUXA 2WB1A 4TM9A 1IKNA 2GB2A 4Y4KC 2JKXA 1HQRB 4BWUA 2DLGA 1OTUD 1KELH 5HHXH 4P06A 3PIQA 2JQAA 4R4BB 5JPMC 2GQHA 3UTSA 1N6QL 3HBQA 4FFVC 4EXKA 4UQ9A 4Y88A 2ZONA 1B6DA 4BFRA 1E5AA 3WFEL 1UATA 5IFJA 2CGRL 2WWOA 2BSDA 1OTTC 3K5SA 4OGYH 4YHPA 3L48A 1OK0A 4KXZI 1EGJA 4Y89A 4O9HH 5C0CB 4G8AC 3VFUA 1MELA 1YMHA 2VZOA 4W4OA 4EUPA 1AY1H 1D9KB 1JGLH 1WC7A 1Y0LA 1J0KA 2WTRB 3SDCA 1UD2A 1BDYA 1ERNA 1KNOB 5AW0B 5J3HC 1NCGA 2FATL 5FUOH 3QCVH 3HBGA 3PDGA 7PAZA 3AG1B 3RB7A 1ONQA 2XC8A 2QV4A 1YEFL 2PW1A 3QEQB 3MCLH 5EN2B 2DD8L 1BGXH 2XKNA 4KKZA 2Y0SA 3I2CH 2G2NA 1CIUA 3OJDA 4FLQA 3O0LA 5EUKB 1X6LA 5F9JB 4KO9A 2R4RL 2COQA 1UG9A 1XF5B 3VDAA 1S8DB 2IAMC 3N85H 1AGDA 2FO8A 3FU0A 1JPGA 5DS2A 2NY5C 4TQPA 2R1XB 3QUKA 4PY8J 1JNNL 3QHTC 3NSFA 1K6QL 5CD5C 4NPYB 5L2JA 1G7JB 5DJCB 5D1ZB 2J1YA 4F58H 3GHBL 5AKTA 5IGXH 2R0KH 3G04A 3QIBD 4X83A 1ITBB 4JM2B 5IV2A 3X2QB 4JUSA 3L4WA 5E1GA 1F4WL 4HBCL 1FL3A 3VI4F 4X50A 1XCQA 2OZ4H 2XG5B 3B5HA 2VAJA 3RAJH 2D7TH 1BXUA 4C83B 5HHOD 1V7MH 5I1JH 2COVD 3MYJA 3SDYL 1XSIA 4Z7VE 3RIAF 2DLIA 3L5JA 5BJTB 3EADA 3OKNB 5KJRH 3CVCA 4FQXD 4HS6B 5F21B 1AS6A 1FLRL 1XGRB 1P5VB 4A63A 4Z3EA 2JI3A 1J1PH 1SQ2N 4ZMVA 4MDJB 4B9KC 1NGPH 4LL9A 4NENA 2CJ3A 3EOTH 1U3HA 3EBIA 4FRWA 3TIDB 4UU9A 4CMHB 1A6VH 1WYJA 2ATAA 4DVBA 4XNXL 1BSIA 1KJ3H 5G5DB 1U8CA 4MQ7B 4AYGA 3F7QA 1GVIA 3NIGF 4NKMB 3D9AL 1FPTL 1MHHB 5F1OB 3UAJA 2R69H 4YVUA 1AFVL 4KXAA 2ENYA 5DSCB 1KN2L 2NSMA 1UD4A 2NY5H 2X6UA 1XD0A 4PJ8C 3C2SA 4LSPH 4YXKL 4L3EA 2WO3B 2XVBA 3KJ6L 4GSDL 2LFEA 3F6JA 4PJCF 2K7QA 2WUCH 1BBJA 4M62H 4P46A 4KDTA 5D72H 5DEGA 3S3PA 5BRZE 2VDOL 3DOSA 3VG9B 4OJAA 4CSPA 4K5OA 5CFAA 1RJZB 1L0XA 2I60L 3FCSA 4I18B 5HVHB 1KB5B 2PR4H 4P57B 1NCHA 3GXTA 1LP9A 2CRYA 3UPRB 5C8JB 3CSTA 2C3HA 1GTFA 1GL4B 5GZNA 4XHJD 1EAPB 4X7SH 4U1JB 4Z7WF 1E3ZA 2EH7H 4QNPE 3OPUA 5IB5A 5CZVH 1AXSA 1G7HA 1LK3L 3MGTA 3H4FA 1RP8A 3TNNA 3ZYIA 2YEZB 1U3ZA 2R1WB 4WCYH 4YHNA 4ZUWB 3RDTC 3PHSA 4ABUA 4DCQA 4D0BA 1OAXH 4DHLA 1ZANL 3QCUH 4GUOA 2H3NA 2KL6A 2MCMA 3H2PA 4L8CA 3ALWA 3L5IA 1OT4A 3PQYD 5EU6E 4PEEA 1ETZB 4G8EB 4WWID 2CIIA 4N2CA 4MB3A 4ZUSA 3QNZA 4LP5A 3CZNA 4W9HC 5D2LA 2ENQA 3BIAX 3T2NH 3VFNA 4KXBA 3IDXL 4HDIA 4Y4FD 3O4LE 4MZ3A 2WTOA 5I15L 5IG7B 5KBDA 3GSRB 1UJ3A 3QUXA 3OR6B 2R9HD 2OMTB 3S4SB 3IGKA 2IOMA 4JLRB 1SEQH 4NYLB 2CCWA 2YAEA 3SCMA 4JG9A 3NEEA 4WO4B 4XN2A 3S97C 4G8IB 4A6YL 1ZK9A 2ZAHA 1F1GA 3H0TB 4BFBD 2OXGB 4JN1H 2DEYX 5B38G 2E74C 4PRAB 4XX5A 1QSEA 3O3EB 1KJVB 1NDMA 3HZYB 2NUPB 4ENEC 6PCYA 3D09A 4KRPB 2H41A 4UV4L 4F57L 5AG9A 3FQRB 4JX0A 4TLKA 1K4CB 1FFQA 5AVXB 2AANA 4L5FE 2VE6A 3RFRA 5KSAD 4R2GB 4ZD3L 1ND0B 4AW7A 1E30A 5GGQH 4E9LA 1Q0YH 3S98A 3A23A 4G43A 1FRGH 5EZJB 3ML9A 3PU7A 3VG0L 1Z9LA 3X1EA 3MJ9H 3BQUD 4ZQKA 4NBXB 1FI8C 2Q8AH 5LGJA 3DVGA 1C7SA 2N0KA 2VLMD 4MZRA 5GS1C 5C0GB 4LEOB 4QHNB 2B15A 4MNQE 3CDGB 1IGCH 2WQUA 4H20L 4Y16C 4L37B 4LPTA 1DJHA 2WVVB 3CLWA 4NWUL 2L3BA 4PGBB 2J73A 4AYFB 3S8GB 4PRHE 2XWTA 1MCOH 2D7OA 3BH4A 1CGXA 2RALA 4M3JA 3T2OA 3CDFA 1QR1A 2AAVA 1R5IB 4XB7A 2BNRA 1AH1A 1R3HA 3KLHD 4RAHA 5E94B 1A7NL 1FE8H 4X5XB 4G8GE 2ZX5A 4HXAL 1RIVH 1PAMA 1W16A 3H7BB 1S7RB 1AQHA 4IBUA 2WBJC 2BCKB 1GYUA 5ACZB 5TGBA 4KVCL 3ZR6A 5HVGB 3QH3A 4DN3L 2XPGA 3WN6A 1QAWA 1OAZH 2ZT9C 2CGZA 1XAUA 3FTGA 3BWAA 1OF0A 1ES0A 2FJFB 5F3HA 1E2WA 3MLPA 3ARED 3O9WA 4K71C 3QWRA 1FYHB 4E9XA 1JZ4A 1RZQA 1AR1D 2NY6C 5DLML 2WOBA 3A0OA 1FZKA 3VFGL 3LNGA 3OMZA 3INOA 4JFZH 3RPIA 3ALPA 4XAWH 5A43C 2CO4A 3HKZA 4PB9H 3PIQB 1DLHA 3KPRA 3TH2T 1HSBA 4MNGE 1QNZL 4EI5D 4H1LB 5KANG 2Z34A 3VX1A 4AJVA 3EFDH 1XV8A 4UUJA 1FCCA 3CVDA 1D5ZA 4OBRA 1FH2A 3ROOA 4PRPD 4JJHA 2H9GA 2WAQA 3CG8A 3VFUB 3FRPG 3ZMNA 3BSHA 1YMHB 4EUPB 2XTJE 5E5LA 2W91A 5B8CC 1OCRB 3B4NA 1UWEL 1Y0LB 2CG9X 1SXNA 5DVKA 4L18A 1VFUA 3S34L 3SDCB 2J88H 1NIBA 3KPOA 5ITBH 3D07A 4M6OL 5FDWB 1MWAB 3EOYG 3RJQB 1NC4B 1PDKA 1ONQB 2Z6FA 4NCC1 2XKNB 4XBPB 4A04A 1JPSH 4KKQA 3IS1X 1SBSL 2IDSA 3N3EA 2W9DH 3OJDB 4X4XA 1SDDB 4QGTA 1M57B 3K71A 4PV8A 4BUHA 5AW7B 1AGDB 4BZ1H 1ZLVH 4MX7A 4QYAA 4XPAL 2X40A 2ZNXA 1W72B 1AP2A 3JWNE 5AVRB 3QUKB 1UXMA 2AQ1A 1GXEA 3ECUA 1PKQB 2D7MA 2VLKD 5L2JB 3MRHB 1YMMA 4KKBC 5LN8A 4ZTEA 4NQDB 4F80A 2QQNH 3BO8A 4IKKA 3SE3A 3UPAA 3OB8A 5HI3C 3RPBA 3G04B 4RMUA 2EVFA 5KVGE 5IV2B 3ZKQD 1FL3B 3L4VA 4JO4L 1XCQB 1CD1A 4K7PY 1UA3A 2ZYRA 1UT1A 4UAOC 5EFIA 4XMTA 1DBKL 1F4XL 4PLKC 5KSUA 4NN5B 4GKSB 4ZSOA 4PGCB 4S2SA 4UCFA 5E0FA 4Y0GA 1MZZA 4RLDA 4KY1L 4XNDA 3D4CA 3H85A 1ITCA 4V2CB 5GS2H 5IHUH 5K9QG 4B6ZA 2LVEA 3MBEA 5EOCL 3CHPA 1G9EA 5FLVA 1X5HA 3HC0A 4FNUA 3LNFA 3I50L 3JWOL 3GI9H 4L4TE 1I7ZA 4NENB 1U3HB 1MCRA 4UU9B 4MJ2A 1JPTL 2JTYA 1SN2A 5DTFA 1WZ1H 3ARWA 4HJSA 2BIHA 1NBYA 1FYTA 2JK5A 4P3CL 1EDYA 4UQEA 4WV1A 2K1MA 2VC2H 4RMQA 3B7SA 3LD8C 2WO2B 1J1OL 2WNWA 4PYHA 1KYOJ 4BGDA 1FO0A 1NEZB 1RSYA 3K5RA 2DYSB 4BH8A 1XWVA 4L3EB 3EH5B 2D2OA 2Z7WA 4XO9A 4ONFL 2R27A 4N2AA 1UD3A 1A5FH 4NZUL 4W81A 1CLYL 2WWKT 4ELDA 5T5FH 5JA9A 1VHPA 2QHRH 3GXMA 4OTXL 4C4KO 3FCSB 1W2KT 4X6EA 2BRRL 3GBDA 4F2ME 3AT9A 3QNYA 5E6YA 1LP9B 1XGYH 1DUZA 5ESQB 1QSZA 1WJ3A 2EIDA 3L4CA 1T80A 4FXKA 3CPUA 5AUMA 5C0DB 3TA3C 3L3DA 2BVPB 3LYRA 1D5MA 3OKMA 3NJGA 4UT7H 4YIQA 3VE0A 5BMFL 5FUZL 2VXQH 1W80A 1WEJH 1CK0H 4M1GH 5IB5B 4JFWA 3SDAD 1QLEH 4ANXA 2F5BL 1AXSB 1BP3B 4QXGL 3QCTL 3MGTB 2AEQL 2DQMA 3SO3C 4PFEA 2NX5E 4FQXC 4G11A 5CR1A 4MAZA 1QQDA 2EUWA 1CMOA 4DCQB 3MV8A 4D0BB 5CM1A 2ZWKA 3VXRB 4HJ0C 4GG6E 4LSQH 3RNKA 2H3NB 3D87B 5HGDA 1CGTA 4YJZL 5TQ0L 1YJDL 4TXVB 5D5MF 5LBSL 1KYOK 3SDDD 4X4YA 4YDIH 3QXTA 4L8CB 1AZNA 4XO4A 2EUXA 1RVFH 5I8CB 3P0VL 5AZ2L 3QNZB 2LLGA 5DK0A 1XL4A 2DQGL 3O2VL 1R5VB 4J3VA 5EU7E 3KD4A 2TRHA 4HDIB 4JFOB 2Y23A 2VDNL 2WXQA 3OF6D 2A74A 3QYMA 1UJ3B 3AW5A 1TXKA 2O5YL 3KJ4B 1ZHNA 3ARUA 2AV1A 4UANA 4WEUD 3T6XA 4OFIA 3I3DA 4M7LT 3SPCA 1T2JA 2EXWD 3EFOA 2OXHB 3H3BC 3SCMB 3CVHL 2ICES 4X4ME 3GIVA 4WI9A 1YCSA 4ERSL 5CCGE 3FZUC 1M7UA 1J5IA 2CZNA 3LN4A 1KCVH 4LLVA 2X53A 1TITA 1RZ7L 4FN0A 3TVMA 1NQBA 3ESNA 3ZU8A 5HGAA 5LDSA 2P45B 2UZIH 1J05A 4XBMA 3AABA 1I85A 2FO4A 4HF5L 1QPXA 3OAZK 3Q5TA 4UV7L 2PWDA 2XBDA 3QNXB 3G08A 4JFDB 2HJFA 2IPTL 2AK4D 5CWSA 5FYLD 1OW0A 2Z93A 4HJJL 3QS2A 3X13B 5IHHA 2EYRA 1MFEH 2BIPA 2IAAC 4G43B 3E6FB 4R6UA 4AIEA 1QEWB 5G4MA 1TNNA 3WJLA 1I3GL 3CFUA 1ANUA 3BAJA 4ZQKB 1T2QL 2FK9A 2XI9A 5IW3A 3DVGB 3UTPE 5LGJB 4JFSA 1CI5A 2E8ZA 5DD3L 3FTWA 4I0PA 2E7BA 1M3JA 3DJ9A 2XWBA 4KX8A 2OMXA 3B8YA 1B3JA 1NUDA 3FQTA 2XWTB 3TEUA 1RLWA 4ZODA 2Y7SA 5D7JA 3DBXA 2WXLA 3WOVA 4JNXA 3MMEA 2NNAA 2BNRB 2OA9A 1R3HB 1F4HA 3N50A 4LSDA 4P9HC 1BQHA 2HRGA 2QVFB 4ZO6A 5F3FA 2CK0H 3O2DL 3SYCA 2Q8BL 4RNRA 4NQCD 2PMZA 1T7ZA 3LHPL 2VJXA 3TM6A 4F8TA 1MCSA 2EE6A 3D8MA 3O6KL 3QH3B 5I2IB 3FTGB 3ZT7A 4OCYL 1HSAB 2VXUL 4UNIA 3BYTA 3HIZA 3MLVL 1KIUB 3O9WB 2VITA 4L5FL 1H3PL 2DWXA 2GYSA