4CSPA

Structure of the f306c mutant of nitrite reductase from achromobacter xylosoxidans
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEACELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of Residues Remote from the Catalytic Centre on Enzyme Catalysis of Copper Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 91
structure length 335
sequence length 335
chains with identical sequence F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2014-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cspA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cspA02
2PCFA 1KCWA 2IDUA 2XYBA 2EINB 2VM4A 3FPXA 2I7OA 2XX0A 3NJFA 4CSZA 2MTAA 2DV6A 1J9RA 1JVOA 1PMYA 4YL4A 1JOIA 1R1CA 1NWOA 1JZJA 1ET5A 4DP5X 1URIA 5B1AB 4A67A 1IUZA 1JXGA 2R7EA 4RH4A 4E9SA 1IC0A 2GC7C 2CAKA 7PAZA 2GIMA 8PAZA 2FWLB 3X1BA 1BYPA 1KDIA 4KNUA 3ZDWA 4HALA 3S8FB 1JZGA 3X1EA 4GP4B 3CZUB 1BQKA 1ZDSA 4BDVA 2XX1A 2YAEA 3BVDB 3IN0A 3NP4A 4DP6X 4DPAX 3JTBA 2VSKB 1AZNA 1GS6X 1X9UA 3QPKA 1JXFA 1ZDQA 2PLTA 3RYMA 1L9RA 5B1JA 3UABA 2IDTA 1BQ5A 3NJJA 3QQXA 1OCCB 1B3IA 1DYZA 2AANA 1T5KA 3NSFA 2YAQA 2YAHA 2FJSA 2ZOOA 4NB7A 2ZXWB 4BK5C 4DP2X 1RKRA 3X1FA 2UX7A 3TA4D 4YSCA 2JXMA 4NAJA 4DPCX 1PLBA 1GS7A 3H56A 3X1NA 2B08A 1TKWA 1XB3A 2FT7A 1YLBB 3WG7B 1XMEB 5AFAA 3ABKB 3UGEA 3NJMA 1WS7A 4FA7B 1BXUA 2TSBA 1A4BA 1V55B 1PLCA 5D4HA 2HX8A 1JXDA 3BQVA 1NIDA 3NJIA 4AKQA 4G71B 1JERA 3H4HA 3PPSA 2XWZA 1SFHA 3FYIB 1NIBA 3ABMB 3ERXA 2GB2A 1GSKA 2BP0A 2UXFA 1KGYE 1V54B 1NDTA 3PAZA 3ABLB 1CYWA 3QJVB 2PPDA 3FQYA 3DKHA 4E9WA 2IAAC 4YSOA 4MFHA 3FYEB 2FT6A 5TK2A 4GY4A 1L9PA 4JKNA 5B1KA 2FQFA 1A65A 1MDAA 2PP7A 3G5WA 3WIAA 2FNWA 5PCYA 6PCYA 3NT0A 1M9WA 5D4JA 3SBQA 2GI0A 5LDUA 1W8EA 3AW5A 1GS8A 4W1TA 2YXWA 5I6NA 2PP8A 2LLNA 1X9RA 2JFCA 3NSDA 5F7AA 2HRHA 1MZYA 4X4KA 1SDDA 1OE3A 2FT8A 2Q5BA 1HAUA 3TU6A 3IE9A 2BHFA 4DPBX 3X1GA 1L9QA 4YSAA 1GY2A 1PCSA 2FQEA 2Q9OA 1AAJA 4KOBA 4YSDA 4A66A 4ZK8A 4DP9X 1AR1B 2H47C 3X2QB 1A4AA 3OMNB 2NRDA 4AX3A 5B1JC 3ASNB 3U25A 2UXGA 1A4CA 2XXFA 1TEFA 3QJUB 1WS8A 1SJMA 3L45A 3FQ1A 3QJSB 4KO7A 5I6KA 3FU7B 2QDVA 3PXLA 1CC3A 2EIKB 4A2FA 7PCYA 2XXGA 1WAEA 3WNJA 1NIEA 1CUOA 1W6WA 2WSDA 5B1BB 1J9SA 2YAFA 2DWSA 4QLWA 5EHFA 2BO0A 4N8UA 1BYOA 1NPJA 1NIAA 1EZLA 2PPEA 3WKPA 1ADWA 3OD3A 5I5MA 1OCRB 2IWFA 5E9NA 3UACA 3IBOA 2BW4A 3ZIYA 4ENZA 3EHBB 1E67A 3CG8A 3FSWA 1KV7A 2AZUA 3T6VA 1ID2A 3PLYA 9PCYA 1KYAA 4E9VA 5IY5B 1JZEA 3T71A 3JT2A 2IDQA 3NJNA 1M56B 4CSPA 4DP7X 3T6XA 4M3HA 1OF0A 4YVUA 2IDSA 3TBBA 2BW5A 1MZZA 3WI9A 1AG0A 3WNIA 2HX7A 3FSAA 1RCYA 3QJQB 1J5DA 1SHXA 1L9TA 2VW6A 2PPFA 4P5RA 4FAAB 3AG1B 1E65A 2J55A 3EF4A 2GBAA 4E9QA 2IH9A 2YAOA 2BZCA 2UXTA 1A8ZA 3FSVA 3CVCA 3NJLA 2FQGA 3T9WA 1MG2C 5PAZA 6PAZA 3HB3B 3UAEA 3FT0A 5B3SB 2QPDB 2H5UA 3V9EA 5TK4A 2XVBA 1OV8A 1SFDA 1A3ZA 3HEIB 2VW7A 3S8GB 3CVBA 4AZUA 2XV3A 2A3TA 4YSPA 1AACA 3IEAA 2AZAA 2GC4C 4JHVA 3TASA 4A68A 4F2FA 2BP0B 1I53A 1J5CA 4YSSA 4KNSA 3NYKA 5I28A 1XB8A 2GHZA 2FTAA 4HCIA 1E5YA 2DY2A 1PZBA 3S3CB 1NPNA 5I6LA 4UAHA 1BQRA 3FS9A 1AZRA 3FU7A 1OOWA 2CUAA 2DWTA 2XV0A 1JVLA 1GY1A 2YAMA 1WA0X 2J57A 2IWEA 4YSQA 5A7EA 3AG2B 5I6OA 4WKXA 3AY2A 3H4FA 4HAKA 3S3BB 3GDCA 3T6ZA 4DP4X 3NJHA 3CVDA 4HIPA 1ILUA 5AKRA 2MRYA 1E30A 2QT6A 3SQRA 2IWKA 1E5ZA 3AG3B 1AZUA 4A2HA 3GXUB 1HAWA 1MG3C 2BWDA 2EIMB 2CBPA 5D4IA 1IBYA 1OCZB 3UADA 2PPCA 4KO5A 4NERA 1DZ0A 2VM3A 1ASPA 2WO2B 3AZUA 3OMIB 2OCCB 1PY0A 4L0PB 4BWUA 2Y69B 4DP1X 3ZBMA 3OM3B 3FQ2A 4A2EA 4GP5B 3CDZB 4G70B 4BXSV 2XLLA 4DP0X 1BXAA 4M4RB 3FU9A 5I6PA 1SF5A 2PP9A 4YSUA 4YSTA 3MBWB 3N2JA 2AVFA 2OV0A 1BXVA 2ZONA 1PLAA 1XB6A 2HLEB 2XV2A 1RZQA 1W6LA 1J9QA 3PCYA 3QJTB 1ILSA 4G7RB 3ABGA 1TU2A 3DIVA 2TSAA 2VSMB 3OMAB 2YARA 1WA1X 5AZUA 5I5JA 3ZX1A 1ASOA 2OJ1A 2UX6A 1M57B 2XUWA 4A2GA 1ET8A 1F56A 2H3XC 3EH5B 4Q8BA 4HHGA 1FA4A 1AS8A 1ZPUA 1GR7A 1AIZA 2WO3B 1AZBA 1ET7A 3AG4B 1AS6A 2J5WA 5ANHA 2BP8B 1PAZA 3PAUA 1WA2X 3EH3B 2PCYA 2DYRB 1TEGA 4E9RA 4E9XA 4Q89A 3D12B 1PZCA 4AKOA 1KDJA 2BP8A 2CCWA 2YAPA 5B7MA 4EF3A 4F2EA 3T6WA 3PAVA 1JZFA 1PZAA 4PCYA 1OCOB 3DTUB 4G7SB 2EILB 2XU9A 3IN2A 1ZIAA 2QDWA 1FFTB 1QNIA 3MX0B 4BWWA 3KW8A 3N55A 1HFUA 1N70A 1ETJA 4QKTA 4WTQA 4BXVA 2QPEB 4HCFA 3V9CA 1QLEB 3EH4B 1NIFA 1JZHA 3GYRA 2VW4A 5I26A 2W88A 1V10A 2PPAA 4UANA 3FPYA 3UAAA 2B3IA 1BEXA 4HZ1A 2FQDA 5F7BA 1ASQA 1JZIA 1OE2A 1NWPA 1SHWA 1AG6A 3C75A 4HCGA 3CDZA 5B7FA 2IDFA 1IBZA 2VMJA 2HRGA 1AANA 2HXAA 3SBRA 2EIJB 1PNDA 1KBWA 1L9SA 2BZ7A 4KNTA 4BWTA 4UF7C 1AOZA 1GW0A 4KOCA 2ZWNA 2X87A 4PAZA 4A2DA 1NINA 4G7QB 4GYBA 1AZCA 1SF3A 4YSEA 4G72B 1NZRA 3KW7A 3NSCA 4KO6A 4KO9A 2BWIA 3WKQA 4YSRA 1BAWA 1N68A 2YQBA 1CYXA 2CALA 2J56A 3S3DB 2W8CA 4E9YA 1ZIBA 1FWXA 4P5SA 2YXVA 2P80A 4TXVB 1PF3A 2E86A 4GP8B 1PNCA 1ZV2A 2I85A 3FSZA 2RACA 4K9JA 2DYSB 3QJRB 1SDDB 4DP8X 4JHUA 3FU8A 1KBVA 4GXFA 3NP3A 5FC9A 1L9OA 5I6MA 4AI7A 2I7SA 1GYCA 4AKPA 3NJGA 2JKWA 1NTDA 1IKOP 2IH8A 4W9ZA 5I5IA 3NJKA 1OE1A 1UATA 4N4YB 3OQRA 2HZHA 1AQ8A 1CURA 4HHWA 1NICA 1EHKB 2Y1AA 3ASOB 3TBCA 2VN3A 2R7EB 2X88A 1SNRA 4YVNA 2UXVA 1QHQA 5B7EA 1VLXA 2HX9A 1J9TA 1AS7A 1RZPA 2AFNA 3SBPA 2P80D 2GSMB 4F7KA 2CJ3A 3NSYA 2N0MA 4E9TA 1KCBA 4BDVB
chains in the Genus database with same CATH superfamily
4B60A 3T77B 3IJYA 3TH3T 4DWHA 2X1OA 4HWBH 1ZGLM 2RHEA 5FYKL 3FPXA 2VDQB 4LSUH 4WWID 3P0YL 4FTDA 2ZG3A 2VOTA 4JDTL 2E6JA 3FO2B 2QPSA 2DV6A 5T1JA 3QFJB 3F85A 1YEFH 1ZHLB 4YHOL 4LVHB 3S88H 1KFAH 4XCFL 1CFSB 4RRPG 1TFHA 4R0LA 4UV7L 4LSPH 4GKLA 3DVFA 5AD0B 4L3FA 2Y7MA 3WCYA 3P0VL 2I27N 2JCWA 1ETZB 1OCWL 3QDME 3UO1L 5IROD 2VR8A 3UTPE 3BSZH 3U1PA 3ZXAC 5C0JB 4X99B 5DUMH 2HN7B 4HYTB 3WTWA 2IALB 4YDJA 1Z9PA 3NIFB 4OJDH 3RWFB 2AITA 2HLAB 3NPSB 1TZHB 4KROB 2Y07H 4FNTA 5C0GA 2X05A 4X4MA 1ZDQA 1GC1L 2FWOA 4JFZL 2IMMA 4QDGA 3SPGA 2CGZA 3HI6H 2O1AA 2V5TA 3NRQA 4MD4A 1IKFH 3FQWA 4NT6A 4K5NA 2AANA 2XN9D 1KCVH 4G2AA 1N0XH 3WL9B 1MRCH 2ZXWB 1NEPA 4ZXBD 4ECNA 2HLFD 3AQYA 3S34H 1JF6A 2YWZA 3BP7A 5E9DA 1G7HB 2W9EL 3RRQA 2Y7OA 1UA6L 3WG7B 2GJRA 2ZXBA 3MNVA 1SN0A 3QHTC 3AREB 4ZW5A 1T7VA 5AAWA 4F1SA 1FJ1A 2BRRH 1PEWA 4N3TA 5D96B 5C0DA 1UD5A 2PUQT 4G9FA 3QEQB 1BXXA 3AS1A 2K3HA 3BO8A 5CN3A 3MLUL 4PUBL 3CFTA 1NBQA 1AHWA 2PXYA 4OFYA 2XWZA 2J5LC 5J13B 1IBGL 5FHBL 2GCYB 3SHSA 1ZK5A 2RA1A 1EZUA 4QRQA 4JJ5A 2WINB 1A0QH 1PVHA 1F4YL 4U1JA 1X5IA 4LKCA 2FR4B 3HG1A 5IBTL 3S2AA 3V7MA 2CXKA 3GSWB 1DBKL 1NCOA 4H5SA 5HHPB 4R26L 4N8VA 4C47A 1NBZA 2X4OB 5D1ZA 3D2UD 1NUNB 4N0UB 3RIAK 3ROOA 2C1OB 1A6ZA 4BFKA 4EIUA 4ZMLA 2A9DA 3OWRA 5CD5C 5JIDA 2ZTBA 3AC0A 1QLEH 2YPLA 1RHHB 2R29L 3MMEA 1EX0A 2HTKD 1AXTH 4CGTA 2DL2A 2ITDB 3ZZ1A 2WXPA 4UM9B 5MEQB 1X9RA 2NY0B 4XGZB 2GTQA 3BDYH 5C7XL 5KJRH 3C8HA 5TE7L 2VABA 2B77A 1EJ8A 1XGRA 1GZPB 4I3RL 2D7TL 1L9QA 3AAZA 1PCSA 2AEWA 4LHUD 4FA6A 5B8CC 4I87A 3B7TA 4M6OH 1YAIA 3WN5B 4LZKA 2F53B 1A4AA 2JKSA 2Z4QA 2J71A 3QORC 1CLYL 3OX8B 4Z7VA 4WSGA 5IEKB 4EIZC 4GUPA 4XN7A 1SYSA 2IG2L 2MMXA 2NNRA 3KGRA 2WZ5A 1HWWA 3R18A 4XMLH 4RFOH 5CINH 4AMWA 4CU7A 3GT6A 1WAEA 1GGUA 3CZLA 4BZ2A 3DHUA 3R7QA 4J23A 4FQHA 2VRQA 2G3MA 1SXSA 3LHPL 4H8UA 2VITB 3RHWK 4GQPH 3OD3A 1L5GB 2EIZB 1BPVA 1WFOA 1IFHH 3LS4L 4H1LG 2PW2B 2PCPB 4OZHE 3CG8A 3LRHA 1NCBH 2J44A 3HG1D 5L88L 1KYAA 4X2UA 3QDJE 5I1IH 2A74B 3EBHA 2OMVA 3QC5X 5GGTH 2A4CA 1WWBX 2OZ4L 4RFEA 2NY2B 4LOEA 4Y2DD 2Y6TE 5FIEA 3H0TA 1NPUA 4K3JL 1S8DA 1TQTA 1V8HA 4U49A 2C9SA 4R4ND 1OW0A 3I50H 1UD3A 4P46D 4YHZH 2C1PA 3RVUC 4LQFH 2NX5A 4DEUA 5JR1L 3OKKA 4LCYA 3E3QC 1LEIB 3DROA 1A6AB 3CVCA 4HUVB 1U95B 5TFSL 5JR1H 4JFQB 4HPYL 2UY6A 5CZVH 5DJ8A 1AYRA 1DN0B 4XOCA 3VB8A 3LOWA 2Z9TA 5AAMC 4J8QA 5K39B 4HPOH 1II4E 5J89A 1GL4B 3VFOA 3S35X 1I1FB 3NVQA 1VFUA 1W72H 2VLME 4L3CB 2V5MA 3OR7A 2VM9A 2NY5H 3BKJH 3LZFL 5L4JA 2W9LA 1NCAL 4YHIB 3FHQA 1I8LA 4WI4A 1QABA 2Z35A 4HJTA 5D8JL 2WLLA 2PTVA 2XNAA 1AP2A 2Y06H 4AIZA 2WKOF 2CLVA 2VLJA 4FKHA 2VDNH 3JWNH 2WXMA 3AWEA 4HS3B 3WFBH 3CX2A 3MNZB 5D7KE 5ABDE 3P4NB 4AQ8A 3S36H 5I74C 1PZBA 3LHPH 4I0PA 5DLLA 2XPGB 4F8OA 2DQFB 3MLTA 1GGYA 1F8TL 3QORB 3D48R 3RTQD 2VTFA 3SKMB 3AXHA 3U30C 3VDBA 3MN8A 2CUAA 4JFHE 3LEVH 4FTVA 4YSQA 2XG4A 5TDPB 3W5NA 5JORA 3GUFA 3GHBH 3IFPB 5I8EB 5KSAB 2AK1H 4LRIA 4HIPA 1FVCB 1SLUA 2AXGB 1T2QH 2YA2A 4TNWF 5DUPH 1R6VA 3ULUD 1IM3A 4B9YA 1X5JA 4WGWB 4L8BA 5F7YC 2XIDA 2VLRD 1BEYL 2AJZA 5D4IA 4AXWA 1KIUA 3T4AC 3RDTD 3H9SE 1SOQA 3L48A 4JKLA 2C4FT 4TOYL 4XBGB 2WWOA 2XQYA 4J28A 4L0PB 4MQXD 1CFQB 5C07B 3GUTB 4I13B 4U3CA 3QCUH 2VZUA 4M6NL 5K9OB 3QIWD 1A6VL 3EGXB 3M7FB 4TPRH 1IRAY 4ODWB 4X9FA 4KVNL 4YHLL 3OGOE 4UMSA 1A6WH 1C5BH 1ZT1A 3UBXI 3WO4C 1RY7B 4NZRL 1C08A 2WKOA 1Q90A 4G6ML 4J6RL 5DJYA 4OTXL 4YFLF 5HYJE 2DJSA 2DQ6A 4GI6A 1IGTB 4GNKB 4L3EA 3WXWL 4FZEH 5DFWH 2B5IB 2IQ9H 3LY6A 3KPRD 4HIIA 3NCWA 1BZOA 4N9GA 4UYPA 3RWFA 3KPNB 1BLIA 1A0QL 1ILSA 4G6KL 4XODA 4RNRA 5I1DB 3CFNA 1RURH 3BT2H 2W60A 3O2DL 4XXDB 3ZX1A 4H40A 1E2WA 5HI3D 2IQ9L 3RL2A 3BJ91 4OLXL 1G9NH 4JHWH 5KANG 4MDRA 2WBXA 1T89C 4HWZB 1IAOA 4JKKA 1G7IA 5IF0A 4FTVE 1GR7A 1H3WM 2MOGA 2WMPA 5DHVB 3KPMA 3IJYB 4XO3A 3UTZB 4TNGA 4FFYL 4BFEA 3JQOB 2BCKB 5LNEA 1ONQB 2ZAGA 2LU3A 4H8VA 3OHXB 3PGDB 4YX2H 4U6TA 1TSRA 4LAQL 1C08B 1W15A 1J8HB 2PCYA 2OCFD 4JO4H 1QVOB 5D7JA 4R9HA 1EEZA 3RGVC 5DQJA 5DJDA 4OD1L 4H26A 4CAGA 4U3SA 4XWOD 1I1AB 4ZMAT 3QRFM 2FDBP 1MCCA 4KDVA 4U1SA 1F42A 3T2OA 3WELA 5JIQA 5KVGE 5GGUA 4GG6F 3VMOA 1P7QB 4ZQKB 1HQ4A 2PO6B 3CBKB 1B4LA 2YPVH 4XBGA 1VIWA 5EIIB 4G1MA 4HIQA 3QJHA 2OJEA 3GSNL 5C92A 3G5ZB 1V7NH 2MQCA 4EXKA 1AGBB 4JPVL 2GAZB 3ETTA 2B4CH 2I9LA 3MA9L 1JWUB 4WTQA 4BXVA 3HMWH 3G5YB 3JWOL 1T89A 2VZTA 4LHUB 3ZDXE 1FYHB 3L95A 2CQVA 2IQAB 2CNZA 3IU3A 4F93B 5I1KL 3P3RA 4JFFD 1QR1B 2WBKA 5DA4A 1FFPB 4UIKL 3U2SB 3FFCB 1QTPA 1KB5L 5HP5A 1HCVA 1J8HD 3SDDA 2AF2A 3LS5L 2JXMB 4N20A 2VXUH 3UTTB 2IDFA 2FUTA 3A23A 4X5PA 4UTAL 4WNJA 2A4EA 2Z7WA 1AQDA 1P5UC 3A0OA 5GJTL 3ZKMC 1U58A 1XSIA 3DBSA 3DX1A 2VDNL 4U33A 1H6FA 4LLDB 1P7KB 2WBJB 5EULV 3NEOA 1QHOA 1BWMA 1KYFA 3CUPB 2D3NA 1NINA 3MRPA 4G7QB 1AZCA 5DWPA 3TA3D 1Q0XL 2V2TB 4FLOA 3QDJB 1SLVA 4XPTL 1FO0H 3W3BA 1YEEL 4OLVL 2KZWA 4I2XA 4NZDA 4O4YH 2J43A 1HH9B 4NYLB 4M1GL 1ORSB 3T4AA 1N2RA 4EBQL 1KC5H 1VEPA 5SWSA 4JK0D 1CICD 4OZFG 1SHSA 3P73B 1YMME 4GXUM 1LEKA 3WHXA 3ZKMD 1MVUA 5I8KL 5B39A 2K6WA 1VA9A 4NGHH 2EYRA 5CP3H 3WFCL 2WWKO 2IGFH 5F7DB 1N10A 3VXNA 1XF5A 3SD2A 5GS0C 2B16A 3FU8A 3BGAA 4FG0A 4GXFA 4FQIL 3RY4A 4F3FB 1YNTA 2XDHA 1RSFA 2FNBA 4K3JH 4HGWA 1V7MH 2X5PA 5L8JB 3FO1A 5EBWA 4YHNB 5JLZA 4M9PA 5F21B 2HZHA 3FO9B 4M5YL 1FGNH 4N0FB 4DW2L 5HHXL 4PRHA 4HHWA 1OM3H 2CDFA 2Y1AA 1YSOA 4FI8A 3MAWA 3E9UA 4XNUL 5CZKA 3VXME 4AL8H 5C0IA 1INEL 3STZB 5B38A 3KPOA 3MCG1 4J27A 2UXVA 2F19H 4GRLC 3WE6A 3UZVB 3BKYL 1WBYA 5FYLH 3ZYOA 4LHJB 1IAMA 5BV7C 5GRUL 5D9SA 2H3KA 3AXLB 1Z3GH 4IRZA 3TH4T 5MEOB 4P2RB 5BQDA 4LCUB 2F19L 1A7QL 5FA4B 2CHDA 5K9QG 2MCPL 1HT6A 1YDPA 2LQRA 1M05A 1GIGH 3TJHC 1PD6A 4GRLB 5M95B 4W9KC 4PR5B 4Q2ZA 5BV7B 1ET5A 1F45A 5AW2B 1V7ML 1EVTC 3KHQA 5K9KA 4RH4A 3VX0A 4C4UA 1MKFA 1H3VA 4HGKC 5T3XD 3UP1A 5FDYA 3V6OC 5T33H 5I16B 4ODSL 2XFXB 3INOA 3EJYD 3KLDA 5E1GA 1N0LA 2CKNA 2FSEA 5FYKU 1V27A 4IJ3C 5IBUG 4CMMA 1KCUH 2RQ8A 3EAKA 4EDXA 3LNFA 4Y1AE 5JNYB 1OP3H 5BZDA 2OMWA 1MQKH 3H9SA 4ODVL 3ARBB 4DCQA 5CN1A 4EUPB 3R06B 2WBJC 4FXGA 4ZNCD 4ZPTA 3I6KA 4G11A 3LNDA 4NQEE 2WK2A 3WNMA 5ITBH 1KJMA 3NABL 1YVLA 1NMCB 5JDSA 4TS6A 4F9LC 1JF1B 4WHCA 3RVTC 1AD0A 3KWTA 1Q0XH 2JK5B 5ICUA 1G7QB 4U6XA 5F9DC 5K1VA 2J73A 1LXMA 1TLMA 1TPXC 1CLZL 3GXPA 2ZOOA 4QEGA 2XWBB 4WDIB 4BK5C 3UTQA 2EJ1A 2WCSA 2WB1A 3CQFA 1RKRA 3RIAF 1UB5B 3N44B 4X80H 3TA4D 3VDCA 1O7SA 4KI5C 4AEIH 1E6OL 1R4XA 4P99A 4UQ3A 4UOJA 3REVB 5JXAH 4M6ML 1NBCA 3G08B 2B08A 1Z7JA 4GXUN 4M7JH 4UDTB 1B0RB 2IGTA 3IFPA 2AAVA 5SWZA 4HG4J 3MKGA 4NKDB 5D5MB 3G5VA 3HPJA 4W4OC 4NO2B 1BYNA 1X7SA 3W81A 4ORZC 4ZFOA 1JI1A 5DD6A 4OGAD 1HE8A 4TTDD 5D6DC 3ROLB 2AV1B 1IMHC 2V2XB 3QORA 2P7TA 1FHNA 2E9JA 3F04A 1QBML 5EPMA 4WEBL 2QADB 1NANI 4AKQA 4QRBA 2AQRA 2E46A 1TTCA 3RIFK 4AE0A 5KVEE 2DMKA 4NI6A 3QO0A 4KJYB 3VI3F 5HDQL 2QBWA 4RVBA 4AIZB 1CGVA 4ZXBC 2O6PA 4GAJH 4CNIB 2VXQH 4CC1A 3F7VB 4ANXA 1RUAH 5EU3A 5G4MA 5HJDA 5C0AD 4OGAC 5D1QE 3WNLA 3ARFD 4OIIL 3C12A 4GY4A 4V2CB 5BUPA 4UQDA 2H1LM 4JM2D 4PJGE 4XNXH 5DGRA 3WIAA 4IBLT 1S7VB 6PCYA 1X9LA 1ZEAL 5KSBF 3MYJB 1F1GA 2E7CA 4FFTA 3RUGF 4LARH 4PLNC 4GQQA 2DM3A 4R90H 4QHNA 4U6VL 2ZCLL 3GIVB 1X9QA 3O11B 4GEIA 5FUOH 1HQRB 3AS3A 2F54A 4JFOA 3LKQB 2JFCA 4LNRB 3NGBC 3FF8A 1OAKH 1HSAA 2OLDA 3HB3D 3OSVA 4PJEB 5ERWB 5I5RA 1DSFL 5FB8B 3NSXA 2E3VA 3MRCA 1G6RL 2EYRB 5DZVA 4AGOA 1JGVH 3BJLA 1D3CA 4LSPL 4U6HB 1PKQE 4PRBB 3MRFB 1KJVB 3D4CA 4KKBD 2VUOA 3MRMA 5KN5B 4ISVA 1N9PA 3QA3B 2GK2A 3TC9A 5FLVA 3ARDC 4M3JA 1C12B 3MUGB 2OR9L 2O5XL 3PV6B 2IADB 2XXGA 3O3EB 4TPRL 1MIMH 2EEDA 1R5IA 4PIRF 1CUOA 4M6NH 5EU6B 2MCAA 2EDXA 3BGFB 1PD0A 4JKWA 3KLHC 4XMKL 3CK0L 1ONQA 3P73A 2NUPB 5EOQH 2NDFA 4JFPB 4JRYD 2XQBH 4IDJL 4ZQTA 5I2IB 4MASA 4MMXC 4DSYA 2HH0L 1TIUA 4LLUB 4KZEH 2RIKA 3IBOA 4OLEA 3QIUA 1E6OH 4JY6B 2WWMC 4QNPF 1A6UL 2NCEA 3FQUA 4I48B 3O2VH 5E8EB 4XZUA 3RL2B 3L16A 5ALBL 1YNTB 4ODHH 4Z7VB 1P9MA 4M61B 1WFJA 3BMWA 1HOCB 1NGQL 5ICXA 4XMTA 4OCWL 5KJ7E 4HJIA 4WUKL 2ISDA 1RFDL 2OL3B 4HUUB 3V10A 3SCMC 1E2ZA 5FF6A 5DHEA 3MLVH 3Q8FA 2CO6B 1AG0A 1MUJA 3G5YA 1BD2A 1ZSDB 1QSEA 2PPFA 1S7RB 3ECWA 4XNQB 1AQKH 2GBAA 1UXWB 4WFED 4K5LA 1A8ZA 5E4EB 4MD0A 3QDJA 4AYDC 2DQMA 5DA0B 2QSTA 4NHUA 3U2SA 4ERSH 5BMFH 5BS0D 4KRPB 2WXJA 3CH8A 3ZMRA 4KZEL 1G5GA 4POZC 2DW5A 3QDGA 1EA9C 5EC1A 4JX0A 1IIIA 5ACZB 2AJXH 2X4OA 1W0VB 2Z64C 5HHOA 1BFOB 3HC2A 5I74B 4CMHC 4D3CH 3SCMD 4RIRB 2I9LB 4KGJA 3R8BB 1U33A 1PPIA 4QT5B 4AZUA 2XKNB 2V9RA 3OHXA 3DVIA 4U1KB 3PJSB 4ODXA 4UAOC 2B59B 3B8YA 3FULA 4G9FE 3AT0A 3VU2A 5IZ7A 3DO7A 3E2HB 4FEMA 4KRNA 4PGBA 4LCWD 4UV4H 4ODTH 4JFPA 4P2RA 2EYSA 3OL2A 4Z7QE 1RIHH 2ADGA 1EO8H 3EJZC 4X8CA 5T3XE 2DY2A 3MRJB 4V1DA 2HKHH 1CFNB 1DSFH 3HZMA 3ZKSD 1J1OH 3KJ4C 3QUMB 1KBGL 3UJJL 2CD0A 1K5NA 2GAZA 1LP9B 1CF1A 3A4EA 3RA7H 2IWEA 1FGNL 5A7EA 3AG2B 1TJXA 3SPVB 1P4IL 2FLMA 3QIWA 3WJLA 1HZLA 1OQXA 3GXTA 1RZFH 2HLFC 3G6AA 4ZS7L 4HUNB 5I1LA 5DD0H 4DP4X 2L0DA 1SHMA 4GMSL 2WSKA 2A77H 3TIEB 4XNYH 4OJFH 4BE6A 1RI8A 4TUUA 4XNXL 1ESOA 1A9EB 1ZTXE 3UTSA 3GXUB 3WO4B 1HAWA 1V3LA 3KPRA 5BPPA 1KXTB 4AQAB 4NT6B 1CR9L 4PM1A 1MVUB 1GCYA 4HIXL 1ZGLA 3VFGH 1H19A 1CQKA 3AZUA 4AQAA 4JFDB 4X0KA 25C8H 3AREC 5BVJA 3P11H 3SKNA 2VLRE 2UY6B 3ZTDC 2BSSB 4C56E 1IAKA 3PYCA 3LN9A 5H2BA 4IOSD 3AADB 3GNMH 4TLKA 3AY4C 2I26N 4N8CH 4QXTB 4Y2OA 2M26A 3KVQA 4FYSA 3VXRD 1V05A 2BIMA 4H1LH 5I6PA 3S7GA 4CKQA 1H9DA 1T03H 1MJUL 3C5JA 1ROWA 3CN4A 3WS6A 1F90L 2CRMA 1DVXA 5GJSL 2W91A 3MROA 3ZE0F 4HJUA 1ZTMA 1QFWI 4UT6H 4X6BA 3VD5A 2CGRH 4E41E 4KUZL 4GRWF 3LPOA 1OWWA 3Q5OA 3SBWC 1MY5A 4UT6L 4CC4A 3BSZA 4CJ1A 2APFA 1CDGA 2P43B 1I8KA 1MCSA 4XPFH 4A2GA 2BY1A 3EO1B 5MENA 2G5BA 3V4UL 2DTMH 1AIZA 2OZNA 3BMVA 2PCFB 1AZBA 3GINA 4ONHB 5L2KE 3DBXA 1ZHKB 2XQYG 2Y9RT 4HUMB 4N8CL 1PAZA 3GNML 2RFXB 1KN4L 1PZ2A 4NNYA 3CLEH 5T1MB 3WUZA 4QRPD 1HEJC 1DBJH 3GSNH 1BBJB 3B5GA 1RPUA 3FDWA 4NXKA 3A22A 3WNPA 1WGOA 1DJGA 1JZFA 3K6NA 1DN0A 1I7TB 1CTNA 3DUSA 3MLPA 1EXUB 2P8LB 2HT3D 5JQ6H 3TN0A 1NM9A 1C5DA 3MOQA 1OP9A 2J6EL 3LRGA 4IIZA 1T1ZB 4EDWL 4NIYE 2V8LA 2ZOUA 1GZPA 3OR7B 4JO3H 4LDCA 2E9IA 3KW8A 4GMSH 3WMQA 5IMLA 1VHPA 4ZPTB 4W9HC 5JHBA 5L2JB 2QPEB 3DV4B 3X11B 3OLDA 4DCQB 5BUAA 1EMTL 4M3KB 1RZFL 2A6JB 5E2VL 2EXSA 4MMXA 3PREA 4JLRB 1H15A 4I7ZC 4P46A 3V0HA 1GIGL 1SQMA 3FRUA 5I6XB 2A9BA 3HE6B 4JN1L 4XP4L 1MHPH 2WLKA 4P9ML 1G9NL 5MEPA 1COBA 2AKRB 5FHAL 1A7QH 5IMMA 2BSRB 5DR5L 1QWHA 5D1ZC 4DKDC 2BX5A 3W39A 4X98B 3OF6A 2VMJA 1F3RB 3MJ8B 1L0QA 3BE1L 1BVNT 5IVZB 1L9NA 2KH2B 3PQYA 1AOZA 1UM6H 4JZJB 5D7IF 4IKNA 3LZOA 1ZMYA 4OD2B 2WYZA 4R5TA 4GYBA 3O3AB 3SGKA 1EDQA 4JJ5B 5L2KA 4G72B 1NSNH 2XY1A 2ZUQB 2ZE0A 4EXPX 3CN0A 1PLGH 2R2HB 3PHOA 2ENYA 4V11A 3H85A 1QASA 1JHKH 4ISVB 4Y5XA 2OTPA 3GI8L 4ZAKD 2GT9A 2A73A 1MLBA 3ARWA 5I9QC 2EE0A 2J8UA 1RJZA 5AVXB 3DYMA 4LF3A 2BS71 1TFPA 4TXVB 5KSVA 3OZLA 1FHGA 2VYRE 4XE0A 5IJKC 4QF1A 4J5VA 1BOGA 4K9JA 4I77H 2P52A 1OB0A 3BFWA 3HIZA 1ZLUK 3ZDZF 2KZ1B 2BOCB 2W0FB 1NMAL 5JIKA 3UBGA 5KWYC 5INDB 3GTVA 1VFBA 2JV6A 5CZRA 1P53A 2W0KA 1YJDL 2IPKB 2BNUA 4NDMA 4FZ8H 5HHOD 1OE1A 4N4YB 3TVMD 1ID5I 3BIBX 1QATA 4NAMA 3V6FB 2VDKL 1QFUH 3D0LA 3TL5A 2XBZA 2H6OA 4FQXD 4OCRL 3TBCA 4LKXA 5J6GA 3VI4B 1MFCH 3DMMB 4IDLA 3ZUNC 4ACPA 1UCBL 3OWEA 1HU8A 2FD6L 4HKXA 5IOPB 3L5WA 1J9TA 2OW6A 1SN5A 1QI3A 4LLVB 1J0JA 2EDHA 3DK2A 2Y2TA 4X98A 4J3OF 4KX9A 5SX4H 1JUFB 5D7SL 3O6KL 3S9DB 1Z0MA 5EO1B 2HUEA 1IJ9A 3F7YB 4XMKH 1ITCA 1OK0A 3DXAA 1LHZA 3JWNC 1DBAL 5CD3B 4B50A 2W07B 3MBXH 4D9QD 3II2A 2V6HA 3T3PB 2ARJB 3HE6A 1S3KH 1XF4B 2G9HA 1S3RA 3RY5A 1CFVL 1J9RA 5AQ0A 1JVOA 2FZ3B 3QULB 1DUYB 4FQXC 1NWOA 2X6UA 4H5SB 3MV7B 3WTUA 1YEKL 3HVNA 4OH2A 1XGRB 3ZRCC 4BZ2H 1K3IA 4Z7WB 2CDGA 1U3NA 3RDTC 1IFGA 3EOAB 4N8PA 3AWGA 1I1RA 2D3LA 1TQBC 2R7EA 4QCIA 4U1JB 2A6IA 4Y9CA 5KBLA 1CF8H 3QISA 4IRJC 2OFQA 2J6WA 1FDLH 4PJIE 4QRQB 3UBXA 3RURA 4JFQA 3NRFA 4Z0XA 1JV2B 2CCLA 3JWOC 1NH6A 5HDLA 4EN2A 4ODBD 3EFOA 5CCHE 1BQKA 3ARBC 1ZDSA 2VO5A 1WFMA 3HNVL 3K6DA 3L6FA 8CGTA 2FWUA 4DPAX 4YHZL 2R51A 5FUOL 5BQ7A 4WKZB 1G7MB 1FJ1B 4OLZH 4XTRD 5TDOB 4ZMVA 1HXYB 2FGWL 3UYOD 5TQ2H 2QL1A 4PRIA 4RDQG 3RX9A 5E8NA 2Q20A 3EGDB 2ID5A 1NSNL 3REWA 3N9GH 4W9IC 4R84A 5TF1L 1FNEA 1CT8B 2D31B 1HHHA 4LEOA 5EZLB 3HRZC 3PQYE 4B7LA 1JWSB 3T65A 3GBNL 2B0SL 3IJ8A 4FNSA 4HKZB 4HDIA 4XRCB 3H56A 3Q3GB 4LP5A 1FZMA 2EDNA 4QRRA 1ZA6B 3T4YB 3AMKA 3NCBB 3PGDA 3OBAA 4YEEA 3SDAA 4Q9RL 4Y7OC 1JPST 5C0AA 1EO5A 3VGFA 2YD4A 3H9YA 1IBBA 2LFEA 2R4RL 4CA4A 3RGVD 2C9UA 4J6RH 4ENED 1OD7A 4PU2A 3HRPA 1N7MH 4MCYB 3BP5A 4XMWA 1E27B 4GUPB 2WIIB 3KXFB 4NQDB 4FQPA 4GRLA 4ZTEA 3QHZH 5EA0H 3GS7A 2F9BT 2VJXA 4KQ3H 3WJJC 3T0DA 5D1XA 4PJ7B 1AGEA 4F7PA 2UWEB 4TTDC 2F7QA 2JQMA 1HXMB 2WXLA 5T1LA 1WYJA 2APXA 5E6ID 4XBMA 4CGUB 1CYWA 2VN4A 3TCLA 3VU1A 2BY3A 4JL1A 5DI8B 5LN8A 4GBXD 2H7WA 1HH6A 4YS4A 4ZMTA 1FAKT 4Y9EA 5EMYA 4IKJA 1KY7A 1KB9K 2BHUA 1GHFH 5BVJB 3AW5A 4FMVA 1P84K 2YEQA 4S1RL 1HL4A 5FGCE 1A6ZB 3KBHE 4B9GA 1N7ML 3KLQA 3N42F 4EMZA 5E2UL 1USZA 3DI2B 4X4XA 4XH2A 2ORBL 1IGYA 2B9AA 4XOEA 1EZVY 5KVGL 5DD1L 3N50A 2FX7H 4YSAA 2NW2B 3LHAA 3FJTA 4DP9X 4IIQC 3V0JA 3V6OA 1B2WH 1U8LA 4G80A 5IVXE 4RMUA 3X2QB 1D6VH 3WTTA 2NY3C 2NLJB 1OAQH 4AVIA 4MB5A 5JHAA 4JANB 1ZKAA 1FSKC 2PTUA 3ULUL 3SKMA 1U0QA 1FE8H 5I66A 1CICC 1U91A 3BZDA 1KBPA 3N9GL 3V4VB 4B9PA 3EO0A 3QDMA 3SYAA 3GLEA 4F92B 4WSKA 5LXGL 4PJ9B 2Q2LA 1AJ7L 2ZWYA 2CKBL 3OMZA 2V3FA 2QQLL 5DK2A 5E95B 3EBAA 5EZOL 3BISA 5GGRB 4ZW8A 3SO5A 4BUQA 4Q9RH 3HNTH 3LPWA 3UACA 1ES0B 2HFGH 3KH3A 3W11C 3QQ3B 1PKQA 4IK7A 3BXNA 1UJTA 3FSOA 1A5FH 2YQGA 3NFPA 5GSVA 1MVYA 1IKFL 1JVKA 2VKWA 3EKCA 1KIRA 2IDQA 2ZX8A 2D3VA 2CXGA 3GXNA 5JZ7C 3OC8A 5IQ9A 3WIHH 3AUVA 1IO4C 3M1OA 3INUL 3T6XA 2WWMD 2AEQL 4ZMZA 1URLA 2XWJB 5C0BE 1E4HA 3LRKA 5CR1A 2YD9A 4ZX4A 1RP8A 3C9NA 1CGSL 4V2BA 2IH9A 2Z7UA 4H8QA 4MA3A 2BOCA 1Q9LB 2UXTA 3QIUD 4ANVA 3Q6FB 4HFWA 3H3BC 2FQGA 2F1AA 4PJDE 4LCVA 4KRLB 2A9CA 3J2PA 5CZXD 1TSHA 3ME0B 3ASWA 5LVEA 4OF0A 1F11A 2J8UB 1HKFA 5LCVH 3PPEA 3LN5B 1HOCA 2VNCA 4L1LA 4XXWC 3CPUA 3O4LE 2CKBA 2HVKB 2DJ4A 2ZSVB 2GY7B 3HEIB 4NSKB 4XAKD 2PWGA 3A21A 3CVHA 1ND0A 4M03A 3VH8G 3WHE0 4RISL 4HJEA 4A68A 1YEWA 2HSIA 2IANE 1MWAA 4IU2B 3C2AL 3KPMB 4P59L 3KCPB 2FHCA 2VC2B 3U9UA 1J5CA 2AJXL 4Z3TA 3SKOA 3UGXA 3CMGA 3VFWA 4ZAKA 4XHJC 4ZOBA 2Y7LA 3QDJD 4U1NA 3UPRA 3VSTA 2RJMA 3MRDA 4FQCH 5IUSA 4G5AA 5HYSB 3D5OF 1FL5A 3GKWL 2XV0A 2DWTA 3QIBC 5AKSA 1KB5H 3CFEA 5ISZA 2X1XR 2Q6WA 3BWUF 1SBSH 2R0LH 3WY2A 3OVUB 1AXTL 3GIVA 3O11A 4NQXA 1C5CL 5F71A 3OAZH 4RQQA 3T0XA 2ZCKL 3BPCA 4DAGL 1MFAL 5EBGA 5LNGA 3EJTA 3HBZA 3QXDA 1CL7I 1NBYA 3FOMB 5EZLA 4ELMF 4IS6A 4TVPL 4MXQC 2DQIH 4GPVA 1SXBA 4PG9A 3RWIA 3VTTA 1G9ML 2W38A 3STBA 3U0WH 4OBRA 1NFDB 2K8MA 4QXUL 4DEPC 2O61A 3B2VH 2Z8SA 2ZUUA 3WYRA 3HBPA 3EJZD 2AJZB 4QHNB 4WHYG 3CQPA 4AUYA 1S7QB 2EE9A 4MNQE 3Q0HA 4M1DL 1HVXA 2CSPA 4Q74A 5E8PB 1S7TB 2EC8A 3HHRB 4PJ8D 1T66D 2FYVA 3U83A 4YGVB 1LE9A 3D39A 4EKXA 1SF5A 4NQVA 2VDQH 3NZ8A 2NY1B 1XMWA 5BJTA 5DJXB 3QXVA 5F96L 2ADYA 2R8SL 3GMOA 2GUYA 5HBBA 1IEHA 1JNNL 4ZNEA 1CB4A 5D7IA 2HPTA 1QOKA 5JW4Q 5AUMA 2VDOB 1RK1B 4P3DB 1BFVL 2VSMB 2YARA 2CBOA 3BZ4B 2W9EH 1CGWA 3H9SB 4CVXA 1X5LA 3DIFA 4GRMB 2NXZC 3IMRA 4CJ0A 3ZDZE 2X41A 4A6YH 1J5HA 3IDXL 5C0DB 2APSA 4Q8BA 3OJVC 2XBTA 4HHGA 4EN3A 1DBJL 3LPFA 3QQDA 4HC1H 1A6WL 1C5BL 3MLSL 1FN4A 1XL4A 4S0HA 1VACA 3LCYA 3C60B 2WHVA 5IVXF 2KT6A 2I32A 5FYJD 1ZHNA 5F7UA 1TR7A 4JDVB 4NPYA 1CLOH 5D5MF 5A2AA 1MREL 3MRIB 4LEBA 5ANMA 3DJSA 4R4NC 4Q89A 5T1KB 3TCLB 2BP8A 4P2OD 3DMMA 4OAWA 1S7WB 3FQNA 4OW6A 4JCMA 1BZQK 3T6WA 2AK4E 1RUAL 1CIDA 1DEEA 5JHDE 3SO3B 4PCYA 3UO1H 4Z7IA 2ALAA 2VDOH 1A6AA 5TE6H 4HUVA 4QRRD 3MFFA 1QO3A 3PGCA 1FFTB 2FX8H 2YPVA 4G8GD 3CLEL 4E42B 1VPOL 3B2MA 4BWWA 4UM8B 3DA0A 4YNYB 1N70A 3S4SB 1CXIA 5CEZL 4HSAC 1KWGA 1MELA 4QRPB 3S3SA 1WAAA 5D6CB 1QLEB 2PO6C 2OMYB 2ZOWA 4EDXB 1GPOL 3QUZD 4RGMC 5E0QA 5CEZH 2DB8A 1SY6L 4R5VA 15C8H 2E75C 5I75C 2P24A 2KZBA 4HH9B 3QB7C 4MQ7B 2CO4A 5LUMA 3VRIA 1BGXH 4OUUB 1SOKA 2AEOA 5BZZA 1JSYA 1P9MC 1PZ3A 4L1TA 4BFIB 3C2SA 2ADFH 5FO8A 2VLKD 1ZS2A 1BSIA 4JZJC 3HN5A 4RAHA 2DEWX 3GMOB 5HTSA 4G8AC 2N1TE 1N6VA 2YGNA 2GJZB 2P5PA 1KGCE 1N8OE 4RX4A 2QGBA 2PR9A 3BKJL 3TVMA 3VWKC 1MCRA 3QXUA 3QZWG 3MRKB 2BWIA 4G7VL 3WKQA 1OZTG 5E5UB 2X12A 4NQEA 3D0AA 3CWGA 4WWPA 2DLTA 3U7YH 4WTZG 2E59A 1TLKA 2X1QA 3WEAA 4HV8A 2EECA 15C8L 2ADIB 3OF6D 4JFSA 4Y1AA 3J8F7 1PNCA 3WHXB 4MDIA 4PRNA 3RWEA 4KK6D 2CHNA 1SDDB 3HZKA 4JFFE 4P05A 3TX4A 2Y36L 2ZKWA 3ZR6A 4M4RA 3MVSA 3RAJH 2APWA 4LOVA 3NJGA 3V7AG 4HXBL 35C8L 2R23A 4K3DH 3T0EC 3F5WA 1ZS8B 1UGNA 3C5ZB 5EU5A 3FH7A 1JPTL 1QSED 1JZ6A 1G9HA 2AJSL 4FQQB 4M56A 5F7HA 5AB0A 4JVUA 1QHQA 4PV9B 2YGPA 4WI9A 5GSVB 2A6DB 3QDMB 4G5ZL 2OMXA 4G83A 4W70A 3APMA 3FQUB 2GITB 4OUOA 3HS8A 2AI0L 1R3IH 3IDIB 2ATPB 3CFDB 3BD3A 4M8QA 3SCMA 5AW0B 6FABL 2R39A 4DGVH 2EINB 2VM4A 4IU2A 4KDWA 1NCJA 4P46C 4G80B 2IPKA 4F8LA 1HZKA 1PL3A 2X42A 3KPSD 4GUQA 4G3YL 2X1PA 4NPKA 4N0UE 4DP5X 2ZCKH 2AQ1A 1FORL 4K7PY 5JYMA 1CD1A 1KB5B 4LLMB 3ZK0A 3CVIH 2CRZA 2E9WA 2CJUL 4A6YA 5EO9B 3D6GA 2X6AA 1R5VB 2A73B 3KYOA 1E9PB 1NFDE 3DPBB 3LIZL 1XFPA 3PIQA 4MAYD 1F02I 2V4LA 4JG0H 2X10A 3DYOA 3V0AC 4BDVA 2VLJE 2NUTA 4WW1A 5J1TC 4PJIA 5ERWA 5IV2A 3R4RA 2D7NA 3W0WB 1GS6X 2VXTH 3FQTB 5EOQL 3C09B 5FCUH 4D0CB 3D25B 5LGJB 3TO4D 1DL7H 4P4RA 4LDEB 5DJYB 4OCWH 1FFNB 1WEJH 2EP6A 43CAA 1HOEA 2OPCA 2X0WA 5D5ME 1B6UA 4BH7A 4H0LC 4XTRC 2CO3A 4R7NA 5JIMA 5IVXB 5FUZH 4JRFA 5BRQA 5JHLA 1H8OA 5IBTH 5KZCB 4OV5B 4FCHA 1MRDL 4NAJA 3KJ6L 4ONFH 4OVUA 3HFFA 2JCCA 4JQIL 4W4OA 5C07A 5ENWB 4KKZA 4F8NA 1E7VA 1PX4A 3FTZA 2VUKA 1VFAA 2OMTB 1WZAA 4FG6C 4JLRA 4Y4KB 3UROR 3HJEA 3SE4C 3KL0A 2K8QA 4RGND 1BXUA 4YE4L 2HTLD 1IGJA 5D4HA 2YQ2A 1J10A 5IJVA 2H8PA 1GGBH 2K7PA 1T04A 2OR9H 2HX8A 4K5MA 4WW2A 3RPKA 3BVWA 2C26A 1EEQA 4NPJA 5EUOB 1IGCH 1TXKA 3MRJA 3CSFA 5J13C 3RHWF 1AO7A 1SFHA 3TN0B 3WIHL 5FO7A 4RESB 4R7NB 3FQXA 1FFPA 3ZKQD 2JSFA 4ZZKA 3EXLA 3EYUL 4L37A 3JBG7 5EN2B 2YXMA 1QPPA 2RMNA 3DURA 4ZUSA 4AUUA 5DO8A 3SDAD 4GXVL 1U8KB 3L81A 2XA3A 2XTJC 5AVSB 2D4FA 3SY0A 3MLZL 3VH8B 4B9KC 4OCSH 3SDCD 1MDAA 3QPQC 1CE1L 1MJJB 3GMQA 1RUML 1SJHB 3RE0A 4WUUA 3PDOA 2Y22A 3QDGB 3WFDH 5E03A 4ZXBB 2UYLA 4NUPA 4MRBA 4TLUA 1SJHA 2EIDA 3L2MA 3LQZA 4A6YB 1GZQA 2W80C 4Z7VE 1J12A 4MNQA 2WLIB 5GS0H 3GJEA 1Q1JH 4X0NA 2ZAHA 4Q58C 4WIQA 1H3XA 1BW8A 2JI3A 4QCIB 4HOMA 2F7PA 2R0ZL 1QMUA 4YBHA 1MUJB 4LT7A 1OAQL 2JCCF 3IE9A 4MA7L 4BCZA 4ZUSB 4X8JB 4TL4A 3EYVB 2R1XB 3EYQC 4LO9A 1ODAA 4A66A 1EFXA 4AYBA 1NAKH 1JV2A 4OZHA 4QRSB 1EO7A 5JPNA 4UOZA 4MCZB 3U25A 1TJHH 4XVTL 3CMOH 4LVOC 4GBXC 3PDGA 2AC0A 4MA8L 1CLZH 2CDGB 2QDVA 2UZPA 1QW8A 4Z7WA 5CCGE 1ZA3B 3FB7B 4FLHA 3BQUC 2D7OA 5HHQB 1UTDA 1IGIL 1DL7L 5IBUB 2JKNA 3V0IA 4DUWA 3NIFE 1D5IL 4H8WL 5C0CA 1KFGA 4FCAA 1MCEA 4K8RH 3KWXA 4ZSOE 4N5UA 5EU6A 2QEJA 3EFDL 3N42B 5FUCC 3WIFA 1PEZA 1QTYT 2X2HA 3TESA 3IGAB 5AWNL 1MAJA 4Y19D 4ENZA 4Y19E 5GZOC 4OY9A 2K9FB 3K72B 5DGQA 3L4VA 2C7UB 2GY5A 1R3LB 2OMNA 2DLEA 5IY5B 3BEWB 4M7KH 4Q6YA 1WDAA 1J1PL 1Y07A 3CV5A 1NKRA 2DD8H 4ZFQA 4QTHA 4QF1B 1JE6A 1HX0A 1MFEH 3C60D 3MV7E 5E8NB 5H35B 1LP9A 2HT4D 4YVUA 5FR3A 5CJQL 4HV8B 4QTHB 3WSQL 3DHJA 1E0OB 3S4SA 5E9AA 2BNUB 2GSGA 1F3DJ 3LXBA 5D55A 1P6FA 3AGVA 3L6FB 1SYSB 4S1SH 1JHTB 4NO0B 2OW7A 3WGVB 3X3FL 5C07E 4TQHA 4OD3L 3MACH 5DFVC 1ZVSB 1WV7T 4M7ZC 2AI0H 3MGOB 3SCMB 5GS0D 3C09C 5IKCA 5CBEB 2LV4A 4DTGL 2F7OA 3ALXA 4IMLB 4NUQA 3L4WA 1HIMH 1O6SB 2YS4A 3RQ3A 5DWUL 3SKJH 2E4TA 1YYLL 1JZ5A 4QY8B 3RZCB 4OGQC 2H26B 3EBGA 2GJ6B 3K74B 4M7KL 3GPSA 4Z3IA 2R2HA 3R19A 1UC6A 1A02N 1CTMA 2O26U 4H8WC 3DPDA 1FLTX 1MXDA 4JCLA 3NACH 3CUPA 4L1HA 4YHPB 4FXKC 5D1QA 5ABZA 4MSWB 3EJUA 2VR4A 3RIFF 5D72L 1VENA 2EKJA 3FT9A 3KPQB 5TQ0L 1Y18B 1YQVH 1QLFA 5IWLA 5K9QI 4G8IA 2XN0A 3CZFA 1TENA 2GBUA 1P6AB 5DMKA 3U30B 1QSZA 2G3NA 3VD3A 5SWSE 4PREB 5I30L 1KC5L 3OX8A 2XWEA 4Z7OB 3ZHFA 4BSVA 1WT5C 2OZ4H 2YMOA 4P23A 1ILUA 1ZXQA 3UFIA 2VQTA 3DWTA 5GSRA 3KDMB 3X11A 3FU3A 1ORQB 1UB5A 2IWKA 5D93B 4R4BA 5T5NG 3QFDA 3CFCL 1XTMA 2OXHA 3FTUA 2PWHA 2UVFA 5DVKA 1AE6L 2JB5L 1VSCA 4WO4B 1BM7A 3RNKB 1EXUA 3A3YB 2X6VA 3TNMB 1HHJB 4RAVA 1PY0A 5HGHA 3CHPA 2B7DT 1BMWA 2EVJA 1G7HA 3AT8A 5I8OH 2HKFH 4HMEA 3LS5H 4J3XA 2PCPA 1I9JH 2WVTA 2R2EB 2XLLA 4FFZH 4ACTA 2GJ6A 3AQZA 3WD5H 4JVWA 4HPHA 4BQ9A 5EUOA 4ZOEA 1CZ8L 3MRMB 4LGPB 5GS1B 2XWTA 4YSUA 1T21A 1TVHB 2J2ZB 4GO9A 4JQXA 3MV8A 2ICEC 5AW3B 3SE3C 2Y7NA 3IDGA 4NZUH 1ED3B 1LEGB 4WI6A 5D7JD 1UUNA 2BK8A 3LXUX 1IGML 3PWVB 4WV1C 2QPFA 2J1WA 3SQOH 4JRYE 5SX5K 3VFTB 3FT1A 1VFAB 3L3JB 3RI5K 1CG9A 2DQEH 4G7RB 1R24B 3G7TA 3FN0L 4PJHB 3PS6A 4E0RB 1H5BA 3QUYC 5EBLB 4LVOB 4Z8FH 4Q9QL 2OJ1A 4XPBL 3E8UL 5I1DA 3CDGB 4ZJ9A 3VYOA 3LV3B 2WCGA 1OSYA 4J4PC 5GRJH 1FV1B 3P9LB 3SPHA 1J0YA 4AL8C 3DECA 4Z78A 3SDCA 3GZOA 3I9GL 4MD4B 3DLQR 4X7TA 2J4WH 2GK0A 2LGNA 3QC6X 5E99L 4A2LA 2X4TB 3FTYA 3UYPA 3FKUS 3EYSL 4JG1H 4DT2A 1S7XA 5DRWA 4L3ED 2HTKC 2VL5A 4LLWB 5F1SA 1DQDH 4DVRL 3D12B 1PZCA 5CM1A 4JQIH 2HN7A 4WFEE 4EF3A 4JFFB 2VDRH 4PTUA 3TN0C 4LGRB 3VWJB 3VFVB 2V9QA 5F7EH 5IQ7L 4Z0BL 4B9ZA 3IAGC 4ZS6C 3JV0A 4BZ1L 1XF2A 5SWZD 3WUWG 2IBGA 3PHAA 1KJ2H 2G60L 2EDYA 4FFYA 1QRND 4O5LL 4Z7UB 2BCMA 5JQHC 4OCNC 5IHZB 4IQHA 3M45A 5FGRA 2CJTA 3W0WA 3QJOA 4GW5B 4QHUB 3RWJB 4A7SA 3CZSA 1FGVH 3BKMH 4L37B 4L5FH 4IBZA 3CH1B 2GCYA 5I8EA 2NYYD 3CXHJ 4GKNA 1OOAA 1AKPA 4MMZB 3W11D 4OM0H 1B88A 2BLFA 2J1KA 3NZ8B 2DKSA 4HZ1A 4N0YL 1CDJA 3NFPB 2WQXA 1JZIA 1RPKA 3BQUA 4ZDHB 4L4TA 5DQ9A 1UA6H 4GO8A 4P2OC 3RVXC 4PG2C 3IPFA 4K55A 4KK9C 5GS2H 3DO3A 1AANA 4NSKA 4X6CB 2EE2A 4S2SA 5MP6L 3Q2NA 4XCYB 1TEYA 5EV7A 1BCIA 3FB6A 2OMTA 1W0VA 2FSDA 4LMQI 5D2LA 3VYNA 2I07A 3MBWA 4G6MH 5IW1A 3IMSA 3PWUB 3AXIA 5GS3A 2BFGA 4NKOB 2X70B 3ILDA 3VB9A 3TT1L 3E3QE 5E9DB 3MV9D 3TEZA 4X5QA 2HKAA 3OXSB 1A4KB 3ARXA 3FOMA 1EIBA 2VLJD 4GH7B 2NMSA 2PR4L 1OALA 2PO6D 3D51A 2R0LL 2DMGA 4R2GD 4KK9D 3EXJA 1JK9A 1KF9B 4E9YA 4W68A 2CHXA 1IC5H 4FKKA 2WO4A 2JKLA 2X4SB 1WP6A 4N0YH 4NCDA 2V17H 3CSYB 2N59A 1ZHBB 4K8RD 5FEBA 3QUML 4FDWA 4DP8X 3GBLA 3EDDA 5IJKA 2GW5A 3QDGD 4JO8A 3Q13A 3WFBL 3SQOL 4DGYH 4AKPA 1EMTH 2CK0H 4BQBA 2EYTB 3O45B 1QUPA 1JNHB 3DTXA 1FNAA 3KR3H 2H8PB 3MJGX 3TZVD 2ZUXA 3OB8A 2OL3H 1YDPB 2WJ7A 4LSVL 3P02A 2GYSA 4R2GC 2J6EH 2NX5D 4WENB 1NICA 1WD9A 4R96B 3LEVL 3FUEA 4PJ5D 2J3SA 5DK2B 4OZHF 3SOBL 4IGBA 1SJEB 1UH2A 1HH6B 1KXHA 2B9BA 2YEZB 2WUCH 4RSYA 1D7FA 2AFNA 3V4PB 4OU3A 1I1YA 3G6JA 3DOHA 1TZGL 4MXWH 1XSOA 3GZKA 4PJFB 1Q8MA 2JI1A 2DS4A 1GVIA 3ML8A 3VFWB 5I1AB 2VDRB 1CR9H 1N8ZB 4KTGA 2XYBA 4ODUA 4Z23A 1KT2B 4N86A 2C3WA 4EI6B 5B39G 3H7LA 2XZCH 4GKNB 1AMXA 2ZUSA 3ESUF 5ES4B 3M7OA 3DTXB 4U6HA 2DQHH 3CX5K 1KJ3L 2IBBA 3UCQA 4Y16A 5AOLA 2J12B 5D6CA 3RX8A 4YLQT 5EH1A 4OIAA 2DQUH 1ZSHA 2YKLH 4MCYA 1AD9A 4ZS7H 2UUDH 1JXGA 1C12A 3TZVB 5L6YL 4PRPE 1PZSA 3NA9H 5GGTL 4NHCH 1AXSB 4HH9A 3UDWA 3VGEA 3ECVA 5HI4D 2O93L 3Q6FA 1A5FL 4CW1A 4YDMA 4Z3FA 4NKMB 1XIWD 1OAJA 4HALA 3ELAT 4K0OA 3C08H 4GP4B 5FGSA 1EH9A 1ZT7B 2E6QA 2HKHL 3NTCH 1Z9NA 3NK4A 4FJZA 4MD5B 4JFYA 4XN4A 4DP6X 3CSBA 1PGRB 5D72H 3MRIA 3KLLA 1I8UA 2K70A 1CFQA 2VLMD 1E4JA 2PLTA 4HLJA 1ZE3C 3B2PA 1HHGA 1KY6A 5B1JA 3UABA 1KCSL 4U1IB 1Z5LA 2HKFL 4JPKH 3ULVH 5FKAB 4MB1A 3ES6A 4BSWB 3VQ1C 5AZ2H 1NUDA 4G6AC 2FBJH 4OZGE 2R4SL 5IHUH 1AY1H 2H32A 2MEJB 3CFJB 2YGQA 2AQSA 4ZT1A 1ZANL 4YDKH 3IS0X 3HC3H 2ZOLA 3P3TA 3N1QC 3P30H 1XO8A 1CXHA 3BSHA 1KLFB 1LWHA 2KLRA 1F18A 5JPMC 4LSQL 3HAEH 2BRQA 1ED3A 1LEGA 3V4VA 5CKGA 3ZQ9A 2WXOA 5C0AB 2ZOTA 3JZ7A 1O75A 1MJ7H 5JPNC 5JW3L 1QFWH 4IK6A 2BVQA 3BRFA 2Z1KA 1XCTA 5IGXH 4G71B 1CK0L 3REVA 1KBGH 5T5FH 4JFWA 3HLAB 4FEIA 3ZYIA 3B34A 3MNZA 2Q86A 3I2CH 1MFEL 2ALWA 1NCWH 1NIBA 4JW3A 3FTVA 3UTQB 3ARYA 4O9HH 4OGXL 5SV3A 4W9GC 1I8AA 2JELL 4AQZA 2DH3A 4QMEA 3QR1A 5EF0A 3ABLB 3B9AA 4U6XB 5I6XC 1JF5A 3MRNA 1P1ZA 4PGCA 4PW4A 5I71C 4KJPC 1B0RA 1E6JH 1PG7H 3DKHA 4PJBE 4YHIA 5F7NC 4E9WA 2UWEE 2OXHB 3NJVA 4FKEA 3SGKC 1NCTA 3G5WA 3MRKA 2XQBL 3CN3A 5AW5B 7TAAA 2VLLA 3B7SA 1YNTF 3JTSA 1NMBL 2DBLH 5D4JA 4G6FB 4E9RA 4GG8A 1K2DA 4E68A 3GDBA 4R97C 5EB9A 2XTSA 1GGTA 4BFBD 3RBGA 1JWMB 5C0NC 3D87B 1LD9B 2DDQL 2GUOB 2EXTA 3L9RA 5IG7A 5BMFL 2OYPA 4GKSA 5D71L 4RNRB 3NGBB 4H7VA 4NQQA 3J7HA 1FFRA 2ZP0T 3OKDB 3X3FH 5AVQB 1O6TA 3JV4B 3SDCB 1SJXA 1OLLA 4X42A 3F84A 1M71A 4EUPG 1SVBA 5TJWK 1KEGH 1S5IH 1XGYH 2H47C 2A74C 3PP4L 3ILQC 1J87A 5CSGA 3RLSA 1M7IA 2HPOA 3ASNB 5AOZA 3QIWC 3WJLC 4RWYH 1K4CB 1Q94A 2FO4B 4PJHA 1DVFA 1WS8A 1CN4A 3GMLA 3RUGE 1MFVA 1KENH 5KANI 1IC4H 2X2IA 1I1CA 4OZ4B 5DDHA 3DVGA 5ALBH 3WNJA 4OSUL 1S9XB 5DVPA 5D7LA 4Q6IC 5CJXA 4LARL 5AOMA 3RNQA 5HGGS 5A16A 2BP5M 3SKOB 1CU4L 3FN9A 3RTQB 1D5RA 1MOEA 5FW8A 3MJ8A 2Y5EA 5T3XL 2NY1C 3TTSA 2IWFA 4J3VA 1H8LA 1HL8A 1MHHA 3ESPA 3BZFB 4J3SA 4Z76A 4PD4J 3ZL4L 3EGSB 1VFBB 5DZPA 1AR1C 1T6BX 1VGEH 1JZEA 1MRFL 3HAEG 2WP3T 2Z31B 4JQIA 4AH2B 4Y4FC 2JH2A 3B9KB 4UINH 5IQ9B 3ZN6A 3M46A 1IC1A 3VGAB 4J3BA 2J55A 5FOBB 3AROA 4AITA 1WHPA 3I3DA 4I2XB 1OWRM 5AENA 2BZCA 2WJ5A 1BG1A 5AZEH 2ADJA 3FB8A 3T9WA 4LCCC 3WE1A 3T0EE 4FG2A 2XWRA 1QSEE 1FLRH 5HPMB 4ZYKA 5I1HH 4LLDA 4HQQL 1NDGB 2VCOA 1HILA 5EFIA 4Y5YB 5G4NA 3PQYD 2E9BA 3QVAA 5BJTB 3TV3L 3EJJX 1IVLA 3NDYE 4YQXL 1MRFH 4YGVA 3HG1B 3JUZA 4UQ9A 1LE9B 2C5DC 5I19H 4BH8B 2VDKH 5IVOA 1QWUA 3T8MA 2Y25A 5JOFB 1YC8A 3ES6B 4BSWA 3QS2A 4GUCA 5FCUL 1F1DA 4F2FA 5E24E 5D2NE 4IJ3B 1YAZA 3RP1A 2KQNA 1M3IA 1ERNA 5BS0A 4HF5L 3ARPA 4TLTA 4UAHA 1TJIH 2YR3A 5EWIL 1AO7E 1DN2A 2DDQH 4X6EA 3H53A 1OXYA 4HZLA 3AREA 2K6ZA 5CGMA 3O9WD 3P69A 1LMKA 1MCLA 2B15A 2GJ6E 3LQZB 1PY4A 2K9UA 2E74C 1AGFB 2ED6A 3ZTJH 3P54A 4Z7WF 2LU5A 3F3HA 1OAUH 4J3UA 3NQIA 4NS0A 3DHPA 2BY2A 4LASH 4ZUWB 5ICYB 3DXAE 3FAXA 4HLEA 2P5WE 3IF1A 3WEBA 4BBWA 1UFGA 3GK8H 3RIKA 1MVFA 4H2AA 3BE1H 3ARBD 5DTFA 2FJHB 4IHOA 5C0FA 2EH7H 3OMIB 5I24A 1FVEA 4FQHB 4AEFA 4TQIA 1P7QA 2F54E 1FVDB 2J6EA 2EDLA 4ZQKA 4LU5L 1HINH 1PJ9A 3APDA 5KSUB 1A1MA 1NAML 3ZHDA 4PJFA 4KK5D 4OLWH 1K8DA 2WIIA 3KXFA 1HHIA 2PP9A 2GTZB 1OM3L 4JO5A 3LZNA 4HW6A 3QCVL 4C56B 4G9FD 3O9WB 1FH5H 5IMKA 4X6BB 2IBZX 1PLAA 4R96A 4P5TC 4C55A 2XV2A 3QE5A 3OKLB 3DV6A 3QXAB 5LN4A 4S1DD 3TF4A 3UZEC 1T1WB 1T2JA 2YJLA 3WXVL 1CWVA 3A6BL 1JPEA 2CM6A 4K3GA 1HSBA 5F3BA 3I2CL 3DJZA 4CN4A 4QXTA 3SGDI 3PP3H 3CHOA 4Y4FA 2NLJA 3BW9B 5I8KH 2GSIA 2H3XC 3ARFC 1NGXB 2B1HL 1NC4D 3ALWA 1FL3A 1RZGA 4UT6A 3OGCB 2YA1A 3TGXA 2VE6B 4WFHE 2A83A 3JT0A 1AS6A 2WYTA 4UT7H 4ZX5A 5L8LB 5AOIA 1CE6A 2CGYA 1KIRB 3PAUA 2EDWA 5KEZA 2E47A 1PU0A 3FCTB 1U8QB 4B5EA 4YO0B 3FTWA 4YDKL 5JO5B 5B7MA 4LDOB 2N56A 5EU4A 4OZIB 4F58H 4OCXL 4XWGH 3PAYA 3PUCA 3T0BA 1J05A 2BP3A 2GJJA 2JKTM 1GTNA 2G5BB 3DTUB 4X4YB 5J11C 4TYUA 2Q86B 4IOFC 4MTMA 1JPTH 3PWPB 4KUZH 4F37F 4RMBA 4QO1B 3UYRL 1J8RA 1NGPH 5GJSH 5KAQF 2DQFA 5IB2A 1WFTA 3DRQA 4WV1B 1P5UB 3HFMH 5IR1A 1FL6B 2X3BA 2XXCB 1BEXA 3CX5J 3W0WE 2IGFL 1MFBH 1Y6NR 4PBDA 5ETUB 4KI5D 2PF6A 5GZOD 5HHMD 3KLHD 3X12B 2I60H 4M8QB 3CU1A 2H32B 3CFJA 4AMXA 1YRKA 3CZFB 3CDZA 1IGJB 1L7TL 4OQ1A 5HYIA 2OMXB 3TN0D 4HIIB 1MSPA 1U8IA 2EIJB 3VFGL 1PNDA 2XG5A 4XPTH 4ES8A 2HT4C 2YKLL 4Y5YA 2BSDA 5IMKB 3KPTA 3VI4A 1E7UA 4QRRB 2YKKA 2VZ3A 1YHPA 2Z1PA 4J1UA 4W93A 4N0CD 3O3BA 2Z7YA 1DJHA 1A21A 3F5WB 3EW3B 5EF2A 3MUGA 2XETA 3PRZA 2WD0A 1XDTT 1PYWB 1BV8A 1N68A 2BSEA 4N85A 5FOBA 3THML 5HGAA 3UGUA 1HNGA 1E9PA 3HTLX 4PIBA 4QGTA 3GI9L 1MI5E 3CFIC 5I73C 1ZIBA 1RL1A 4P4RB 5CF3A 1VFOA 2SEBB 3CFKA 5DS8A 1ZLVH 3QR2A 1PF3A 2E86A 1SY6H 4NRZA 1SUHA 1RJZB 4NDMB 2QSCH 1UJ3A 4LSVH 1B4JH 2UZYA 1CLCA 3ZMNA 4G6FD 1L9OA 4PW3A 4N2CA 1E40A 3MFGB 4UINL 4BGDA 2AQNA 3P40A 4B41A 2AJVH 1EK3A 3N40P 2ED7A 1SN2A 2XG4B 4N6QA 1CURA 1EHKB 3PE9A 3MTRA 2NTFA 2MPAH 2OM5A 2VN3A 3HC4H 3I74A 2CH8A 4C57C 2CLZB 1VLXA 2HX9A 5GXBB 2R59A 3DETC 5BS0B 5INCA 3QJZA 5DDHB 1BZ9B 5CFAA 4Z3JA 3OAUH 2F53D 2CJ3A 3GI8H 3HN3A 2XZQL 3NSYA 3W1ZA 2ARJA 2BNQA 4X7CC 4JZOB 3MRLB 3L3KB 4APXB 4KKBC 5C2UB 3DGGA 4G7YH 1RUPL 3L3OB 3NJFA 5JOFA 2DWDB 1M7IB 4K8RC 3FCSA 4ZFFB 1X5GA 2EE3A 5C0CB 4AV4A 1JNHA 3U6XS 1PMYA 3H42H 1D5ZB 1S7UA 4JPWL 4L5FL 1R3KA 1S9YA 2VH5H 2CWRA 4YBQD 2D03L 2WUBL 4OLXH 4UZUA 5I8CB 3MUHL 3TZVC 4XPGL 3BP4B 3KBFA 1SXZA 3T3PE 2GC7C 3W56A 2QSCL 5CLTA 3B9KA 5DMJB 1NMCC 3QRGH 4B9FA 1NFDF 4URKA 3WOVA 4NHUB 1BYPA 4KNUA 4POYA 3MKKA 3O2VL 2WY3B 1OTTC 2DI8A 1EXGA 2G75B 4Y1TA 2ZYSA 3F62A 3BZFA 3A4FA 2R8SH 2XSKA 5L2JA 4H88L 3G3LA 3IJEA 3X14B 1A7OL 2V8MA 4OBSA 5LDSA 1JXFA 4WY7L 3OLIA 1GZHC 5FYJL 3AMLA 2ITDA 5E99H 1L9RA 5T1DH 1WAAF 4DEPB 1AIFB 3KVDD 3AGWA 1NDGA 3QCUL 4XC1L 4DO6A 4XHJD 2G60H 4WHDA 1UZ8A 3NA4A 3PXHA 2IPUG 4HVBA 2X3CA 1JGDB 3K5SA 1AXIB 4WSJA 4HUXA 1XIWB 3EJCA 2FB4L 3B2VL 1Y1DA 2PABA 4XZUB 4NNPH 4QI3A 3U0PB 1HL9A 4G8GB 5EIQA 1NBZB 5LCVL 3PNWA 4JR9L 3X3GH 4IBYA 3ZKND 3VXUE 4B3VA 5FKPB 3DIFB 3WDIA 2FLRT 2P24B 1FSKB 1UADC 1XB3A 2FT7A 4H4NA 3FFDB 4KROC 3TBSB 3VXRB 5JW4M 1IQDA 1E5UI 1XGQB 3MNWA 3MV9E 1OF2B 1CK0H 1KB9J 1CGSH 2K0RA 2Z31A 4GFXA 1WCBB 1SBSL 1EJOL 3F58L 2VXVL 4YNYA 1QBBA 5FFLA 1FO0B 2G4GA 3QA3A 2E27H 3BP7B 3N91A 2EKSA 4WW2B 3CNKA 4AE1A 1RU9H 2IH1A 2X4QB 1FZKB 3H55A 3UAJA 2GB2A 3FN0H 3BPLC 3T1WA 4EQ2A 3FQRB 1DEEB 4LF3B 5FA4A 1NDTA 1K5WA 3IFOA 2ED9A 3DMMD 1PQZB 1SLXA 2PWEA 5GGQH 1IFHL 4GAGH 2WKLA 1KBKA 1E5BA 1U3HB 4FULA 2FT6A 2XVGA 4L3EE 4EE2A 3L1OH 1NM4A 2FQFA 4XNDA 2BNRB 3J27A 1EAPA 4I18A 3KD4A 4JPQA 4MD5A 5IB4B 4A7TA 3V0VB 3TIEA 3AS2A 4UNUA 3SBQA 4LL9A 5I17B 5FO9B 4L1DA 1HDMB 4D8PB 3BGFC 3GPEA 3ROOB 4RFOL 5CINL 1ZVHA 5DS1A 1TYJA 2D2OA 1A3LL 1FAIL 1IEBB 1TMCB 4GRMA 3E2HC 1RLWA 1KXTA 2ESVB 5DRNA 2NY7L 3VDAA 1MFNA 3GSWA 1LDPH 4OF5A 5ADPL 4JG5A 4FS0A 2FT8A 3FONB 5JOEA 5IJCC 4ZFOB 2FECI 2FQEA 1ACYH 1HE7A 3G6AB 5DS2A 5I1LB 4N2GA 1UQSA 4R7DA 2QVMA 2LU7A 2NRDA 4XCCH 4OZIE 1U8OA 2OK0L 5JW4R 3NACL 3GB7A 4RMTA 1A1NA 3PJSA 3FQ1A 4TSBL 5KVDH 3CFUA 4APQC 5BV7H 5HY9B 3BWUC 3MROB 3H9HB 1NCBL 5FKAA 4IRZH 4ADJA 1Z5LB 1DO6A 4D0BA 3IXAA 5DJXA 5C0IB 1NIAA 3L3DB 4L2YA 3DUSB 2EIBA 2DLFH 5HYQB 2PETA 4MNHB 2ESVD 2QQLH 4Y2OB 3C8KB 3SPIA 2ICEB 4JR9H 1JNLH 3X3GL 1PFOA 3ILPA 3ZQXA 1JMZA 4UQBA 3DXAD 3WFHA 2AJYL 5I18L 1KV7A 5E56A 1ZRUA 1N5AB 5JW4N 2OJZL 1P5VB 5GGSY 1GSMA 4XN9A 3K4ZA 5E5MB 2XZZA 4AQ1C 2X4UA 2OMZA 4CKVX 1YYLH 2NY0D 5CJQH 1KTLB 5HHVL 2IPTL 3FW6A 4WY7H 4PREA 5FYJH 4JRXB 5AB2A 2DQCL 1KJ2A 3RGVB 3FHAA 3OKNB 3EADA 2X6BA 5D7LE 2VR3A 3QGVA 3IAQA 3PJNA 4X50A 2LFGA 4P5RA 2Y6SD 5GHWH 1N4XH 4XVUD 4KKCD 4FABH 3MACL 3NOIA 4JM2F 4X4ZA 4J3OD 2X09A 3SSGA 4B27A 1I9RH 1WZ1H 4PV1C 5CEXB 5C7ZA 5AWNH 2K3TA 2A0LC 4I0PD 4OCLC 4UB0H 5H37A 1Y6MR 1HQ4B 4PWEA 3QNZA 2NX5E 4KK6C 2H9GB 2DLFL 4APXA 4E9LA 2KUTA 4R0LB 1I4FA 4NZJA 3MPCA 4XP5L 4FGMA 3VFSA 3D33A 2JKXA 5BOZG 1ACZA 4P49A 3GMRA 4KKLD 2XVBA 3R8QA 1XGPB 1JDAA 2W5PA 3C6LD 1SFDA 1N18A 4JPIA 2QKIA 5CILH 1OD9A 1O6SA 2CLZA 4KITB 1FYTD 2ZKHH 3HC0B 4PJ5A 4EVNB 5BV7L 2AZAA 3WFEH 5D93C 1ZOXA 2B2XH 1GC1H 2GJZA 4QRTA 3MODH 2WZAA 3AXLA 2XZQH 3Q2VA 1Q9LA 3GRWH 4MQTB 2MJWA 4YC2C 4ZOAA 2P8MB 2LHAA 4NC2B 4MA1C 2XT1B 2WZ0A 3T3PF 1RJLA 1MY7A 1BQRA 4Y1AD 3K91A 1IKNA 3FRPB 3QHZL 4NGHL 3D07A 5DXWA 2BIOA 1OOWA 3RILA 1Z32X 5IW3A 4ZD3H 3V0GA 3R7RA 4XB3A 1LO0L 3HG5A 5GS0L 3WLBA 3BIKB 4G82A 3RPIA 3IRCA 4OJYA 4A7GA 2QSQA 3L3OC 1JK9B 4FXGC 2WGNB 4KTDH 5H94B 4NO5A 4R5XA 5J1AB 3DNKA 4YHOH 3CVDA 3S5YA 3ZYZA 3L2LA 5FFGA 4UQIM 5KYXB 4NZTL 2NDGA 1KIPA 3P77A 1FC1A 1LWJA 1OPGL 1N67A 5FF6B 3F6IA 1I1YB 3G6JB 4LEXH 4QRUA 4A2HA 1S7XB 3VI3E 4EAEA 2CBPA 2NNFA 5GGQL 5GPRA 3BVXA 1TPXB 4JEGB 4XX1G 1ASPA 5FW6A 1U8JB 1I4FB 1OZUA 5KS9A 3K6SB 2JB6A 5DEFA 4YDLC 4DP1X 2KYIA 2P28B 3MU3A 3F00A 1HEZA 1OLZA 3O6LL 4I88A 4XAKE 2QKIB 3TVMC 2Y07L 2J4WL 4IRJB 5TDNB 4P5KB 4UQ2B 3CIAA 3DC0A 2F8OA 2I07B 3MBWB 4HKJA 2IIJA 3B7YA 3BQUD 3BSZL 4FZ8L 4RWYL 5BZWA 4MAYC 5AVUB 4PBVC 4Q6IB 2VR7A 4BRJA 2LU4A 1OSPH 3QJTB 4Q14A 2ETWA 4ONFL 2EO1A 5AL0A 4EZKA 3PGFL 3V6ZA 1RK1A 4FE9A 1KFAL 4KHXL 4P3DA 4G8GA 1F56A 2AV1A 4PWKA 4XCFH 3TS8A 3V4PH 1EEYA 4WI7A 3V52L 3BIKA 4BUHA 1YMHA 3O0RL 4ZO9A 1H5BC 5CHNA 1FUNA 5IUCA 4JM2A 1ECZA 1CZ8H 1T5WB 4RBPH 1D7CA 5IK3A 3REWB 4AGMA 5D2LB 5DU7A 3MBXL 2DQJL 2OSLB 2R0KL 1JWUA 1CDIA 4HWBL 3Q1SL 2NY5C 1RZKC 1S9VA 1U8NA 2ZQKA 4IRJD 1CCZA 4WW2C 4AKOA 1S7TA 2YZ1A 4PRDB 5GRXG 4RMSA 5A6LA 4UIMA 3BLPX 5KYUB 3CCHA 5I2IA 5LLIC 1G7IB 4PTUB 3DDFA 1ZT4A 3JWNG 3VACA 3VM7A 4UUJA 1QBLH 2QDWA 3RKPA 5KTEL 1QNIA 4EZJA 1QFUL 1S9XA 4G6KH 4NIKB 5BRZB 1TYEB 1KTRL 1VEMA 2IEPA 4GLRH 3S96A 3VXUA 4B96A 1PQZA 3GO1H 5C9JB 3WKMH 3PU7A 3I6SA 3BUYB 1S7UB 3TCTA 3FT4B 3ZE2E 3MLWH 4KFMA 3GYRA 4NP9A 5DMYA 1GH7A 3QUXA 1AGEB 1LO4H 2W88A 3FH8A 3LZPA 4EI5D 1MQKL 5KVMC 4KNQA 2X4RA 1ZA6A 3T4YA 1ADQL 4MJIB 1T6WA 4AQEA 2WSPA 3Q3GA 3JWNE 4KJWD 4JRLA 3F7YA 1R3IL 4I18B 2DYPD 1DBBL 4L18A 3QPQD 3KDPB 5B7FA 3L08A 3VSVA 4XVOA 2KDGA 1L5GA 2ESVA 4PG2A 1OIOA 2BZDA 2OMZB 3AB0C 5IV2B 3CSTA 1SYVB 3HZYA 4F2ME 1U30A 1UT2A 4OQTA 5DJ8B 3MUY1 1YECH 2UZIL 4L0YA 3N43B 3JV6B 2CMRH 3CDYA 2NNXA 3ZE1B 1S9VB 3RAJL 1R46A 2OSXA 5IJDC 4NUJA 1JXKA 5LB1A 2ZP8A 4NBZB 1EV2E 1EHLL 2YUVA 2Q1EA 3NH7H 5JA8B 5JUEH 2MQ3A 1G7LA 1SDYA 3MRBB 3AT9A 4WKZA 4Y8AA 3U7YL 3IJSA 4ZW7A 5HHXH 3S36L 2CCVA 3HLAA 4PRID 3K2IA 2ZKMX 5FC9A 1WWAX 4L9LA 3EFOB 4TSAH 5DJ0B 2A2QT 5MERB 1IKOP 4W9ZA 4RGNE 1UQSB 3N43F 2QTVA 3QSKB 4WI3A 3O41A 4UTBA 3VA6A 4MHHG 4FQ2H 4KMTL 4P9HH 3GSUB 2VITA 4X6DF 4ZTOH 5K9KB 2X88A 5F9WC 2EDFA 5BO0D 3QK0A 2ZOLB 2AEPL 4PJIF 4IRSD 3ZJAA 5DFVD 5TE4L 4A1RA 3KEHA 3OKEA 1N6UA 3TYGH 3BXNB 3N85H 4DGUA 5CMAA 4XXCC 5EBMB 3ZU8A 3TIDB 5CZVL 1BG9A 2OQJB 1RH8A 2ZYIA 3CZGA 3KYMB 3QUYD 1BVZA 4KXZH 3SOBH 5EU5B 3H3PH 5IM7A 4Z7WE 1EAPB 2MTAA 1IE4A 2DIJA 4LQFL 3PJLA 3U82B 2VDMH 1P6WA 4H2CA 4L4VD 5E6IC 4WV1A 5A2CA 4YBLC 2Q8AL 5ESQB 3I6KB 2YPLE 4LVEA 5KBMA 5C3IA 3CFMA 1MCJA 5DVLA 3JTTB 1I7ZA 3SDXF 3UTPD 3VCLA 3MRRB 4OLUH 5CBEA 2QHRL 2CAKA 5KSVB 1NGWA 5I1IL 2A1WH 5JNYA 3G5ZA 2VRAA 2WN2A 4WHYH 1F4WL 3RPIB 4GBXA 2GABA 2BNQD 4B0MM 1CFMA 1QACA 5KZCD 5IJBC 1MF2H 2CUIA 5CP3A 5DD3L 4OCXH 2P47B 2SODB 1GPOH 1P84J 5DVMA 2VSKB 5ITFA 5J9PB 4DGIL 5HYSA 2NNAA 4HD9A 3SE9H 2HB0A 3KLAB 4U1HA 3G9VA 3DUUA 3MNDA 3US1A 3IU4H 3FQWB 4KI5E 5DURB 1KOAA 3BP6B 1E4XI 1I82A 5EG6C 4QGYA 1YECL 2UZIH 1RVFL 4CUCA 4L1SA 3DBXB 4ONHA 3P11L 1RXLA 5IVZA 3S37L 1UZ6E 4TULH 2XZAH 4EZLA 1CTOA 2D0FA 4GIPD 1KWKA 1YNKL 4FYTA 1Q9KA 3MC0A 4HIXH 4R3SB 1NCIA 4AQ8C 3IDXH 1I75A 4GAGL 4OGYL 3HC0A 4EVNA 4QTFA 5MP6H 4X9BA 1F5WA 1YN6B 4U7SA 4HS6A 1G7JA 3IE4A 1KCRH 1Y7VA 3FMGH 3HHMA 1CU4H 3I6LD 3MI6A 2WBJA 3L7FA 1CLOL 4PJ7F 4DO5A 1T1WA 4I8DA 1KCLA 3KPSB 4ORGB 1YPZF 3DVNA 1A4BA 3IMUA 4N1CA 5E8DL 3GSNA 4TKWA 1QEWA 2Y72A 4Y4HD 4YPGA 5DJ2B 3RA7L 1F4XH 4GQ9H 4K23L 5C08D 3LB6C 1FGVL 3T3ME 4A6YL 1PYWA 5DJZA 1JERA 3H4HA 4O02H 3KBPA 4GB9A 2W9DL 4LESA 4JAMA 5DHYB 1JTOA 1UM5L 2Y3NA 3FRUB 3E1ZA 2BP0A 3HKZA 4PVLA 3TPKA 3QXWA 4QHKI 2NW3B 3BP4A 4R26H 2Y4SA 2FJHA 4K9EL 1S7WA 3FQNB 3H8NA 1KGUA 1A6UH 2PPDA 2Y2WA 3KGSA 1ZTXL 1N5YL 5C0GB 1P2CB 5HHQA 4NNXA 5TK2A 2DQIL 3EGXA 2OSLA 4PGCB 5A2LH 1A65A 4JGJA 2VQ1A 4I4WB 4K5OA 2OJEB 1ZHKA 3QQ3A 4LFHG 3V0EA 5IOKA 2V9TA 2BOLA 3A6CL 2J88L 2EIEA 3QORD 1XVSA 4EN3B 2YBRB 2X53A 4NWUL 2ZNXA 1X7QA 5BRPA 2BH0A 4HJGA 2PXYB 3ZDXB 4TOYH 3V52H 3ATDA 3Q9PA 3NSDA 1QVOA 5HVFB 1MFUA 4UOQA 4QJ3B 1NCDL 2Q5BA 3U1QA 3KYKL 1JAEA 1ZLDA 1N64L 3HZMB 3SYPA 3CHXA 5FYLE 4Y4KD 2KMWA 3RZCC 4TVPH 3OZ9L 1JYNA 1AR1B 4YSDA 1SEBB 5BZWB 4CVUA 3FMGL 1IAOB 2ZIDA 4N0CC 5FO7B 3QQNA 1C9SA 3RVVC 1A6TA 1KGWA 3NCCB 2EE6A 5F6HI 1FORH 1SEBA 2W59A 3D09A 1MW3A 1L3WA 4Q9BA 5CR8A 3C2AH 4LHUG 4X7DC 1IILE 2HRLA 1N0XL 4I1PA 2VKXA 3ULUE 3FU7B 5F8QC 4BK5A 5I19L 1HEZB 1XSJA 2EIKB 4YQXH 4AWJC 4HK0A 4GI9A 2LVCA 1DUYA 1QD0A 1RUPH 4Q4EA 5B1BB 2X44D 43CAB 2DWSA 1KV3A 4F9LA 2L7EA 1EZLA 1GJWA 1KGIA 3BN9C 3UC0L 2QPUA 1FL3B 1RZGB 5HI4C 2JB5H 3GIZL 2ADJB 1QRNE 4OV5A 2NXZD 3EHBB 1NBV<