4CSPA

Structure of the f306c mutant of nitrite reductase from achromobacter xylosoxidans
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEACELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of Residues Remote from the Catalytic Centre on Enzyme Catalysis of Copper Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 91
structure length 335
sequence length 335
chains with identical sequence F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2014-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cspA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cspA02
4P5SA 2BP8A 2TSBA 1IUZA 1ZPUA 5ANHA 1CC3A 4ZK8A 1MZZA 1JXFA 3FQ2A 2XV3A 3FSVA 4F2FA 3EH5B 4KO6A 3NSYA 1SJMA 2BWIA 1XMEB 2YQBA 2EIJB 4AKPA 1MG2C 3GXUB 3TU6A 4GY4A 3FPYA 1IBYA 3CVDA 4DP7X 2UX6A 1OE3A 2PCYA 1W6WA 1ET5A 2FT7A 1JVLA 4E9QA 4X4KA 1L9QA 3UAEA 5B1KA 1NINA 5TK2A 1HAWA 3H56A 1E30A 3UACA 1GS6X 4FAAB 1J9TA 2W8CA 4GP4B 1ZIAA 2OJ1A 1AS6A 2CCWA 2AZUA 2FT6A 3NT0A 5PCYA 3G5WA 1OOWA 2XV0A 2GI0A 4A68A 5B3SB 2Q9OA 2VW7A 1KBVA 4YSEA 1V55B 3S8FB 3ASOB 3S3CB 3S8GB 4KOCA 3AG2B 4AZUA 1M57B 2N0MA 5EHFA 2VMJA 3MBWB 5I5IA 1CURA 3NP3A 3PPSA 2AZAA 1ZV2A 3PAZA 5B1JC 2EILB 3DIVA 4N4YB 1QNIA 2W88A 1KDJA 3PAVA 4KNUA 4AKQA 3HB3B 4YSAA 3D12B 2YAOA 1PLCA 2GSMB 2IDSA 2BZ7A 3AY2A 2FNWA 2DY2A 2XYBA 3FQYA 2DWSA 4Q89A 2BW5A 3X1GA 4E9TA 2OV0A 1ID2A 1ZIBA 2I85A 1WAEA 4KO7A 3EHBB 1TKWA 2XV2A 1GYCA 2PPFA 2UXTA 4K9JA 3NJKA 2DYRB 3ZDWA 2NRDA 2IH8A 3NJHA 4A66A 5I6KA 3CZUB 4A2FA 1GS7A 1N68A 1WA0X 4W1TA 3ABLB 3FYEB 2YAFA 2XXFA 1JERA 3FSZA 2PPEA 4G70B 1J9RA 1OCRB 3X1NA 6PAZA 2TSAA 1CUOA 2XU9A 4MFHA 1KCWA 1RKRA 1IKOP 2FQGA 2GIMA 1AR1B 2GHZA 3AG3B 1L9OA 2BHFA 2FQDA 5I28A 1OE1A 1TU2A 3AG4B 4E9RA 4BDVB 2HX8A 2YXWA 2J5WA 1A4AA 3NP4A 1PY0A 2FQFA 4CSZA 1URIA 5FC9A 1F56A 3FT0A 1WS7A 3S3DB 3WI9A 2IDFA 2WO3B 4G7QB 3FYIB 1N70A 1BXVA 2BWDA 3OQRA 4E9WA 1WS8A 1AIZA 5B1JA 4BXSV 2H5UA 2FJSA 5B7FA 3UADA 3KW8A 2AFNA 4EF3A 2XUWA 3T9WA 3GDCA 3QPKA 3BQVA 3ABKB 1BXAA 4DP2X 1AQ8A 5AFAA 1EHKB 1GY1A 1AG6A 3BVDB 3FU9A 3X2QB 3GYRA 2YARA 4G72B 2UX7A 1E67A 4F2EA 2PLTA 3FPXA 3N2JA 3T6VA 2X87A 2XWZA 4YVUA 3AW5A 2H47C 3OMIB 5D4IA 4YSPA 3IE9A 4WTQA 2XX0A 4N8UA 3WG7B 1HAUA 5AKRA 2ZONA 2CUAA 4KNTA 1QLEB 3T71A 3WNJA 1KV7A 2A3TA 1T5KA 3PCYA 4GP8B 1GS8A 3ZBMA 1NZRA 4DPBX 1ILUA 2Y1AA 3ZIYA 4WKXA 2PCFA 3WKQA 4KO5A 1AZRA 5B7EA 4PAZA 3UGEA 1ASQA 2HRHA 2IWFA 4YVNA 1AZBA 1ILSA 2GBAA 1NICA 1BEXA 1RZQA 3ABGA 1ET7A 2WO2B 3PLYA 1JZEA 8PAZA 2ZOOA 3OD3A 3UAAA 2PPCA 3IN2A 1FFTB 1BYOA 3NJNA 4YSUA 2ZXWB 1SHWA 1ASOA 3OMNB 5I6LA 3CG8A 2WSDA 2CJ3A 1ADWA 1PNCA 1A4CA 1WA2X 3QJUB 3SBPA 1A3ZA 3HEIB 4DP9X 1R1CA 2X88A 1KYAA 2YAQA 1A65A 2R7EB 2JFCA 3DKHA 4HALA 1JZFA 3QJQB 3SBQA 1KCBA 2HX7A 1SDDB 4YL4A 2HZHA 3ABMB 3WKPA 1SF5A 1NIAA 1KDIA 5E9NA 2VM4A 1PCSA 1JOIA 1X9UA 1AS7A 5I5JA 4QLWA 5B1BB 2QT6A 5IY5B 5B1AB 1GR7A 1ASPA 1BAWA 3QJTB 4QKTA 1SFDA 1QHQA 1JXGA 1GY2A 3PXLA 5I6PA 1GW0A 2UXGA 3PAUA 4P5RA 1M9WA 4G7SB 1XB3A 4GYBA 4DP8X 3EF4A 2XX1A 4DPAX 1A4BA 2MRYA 4L0PB 2AANA 5I6MA 1JVOA 1PZAA 2B08A 2PP8A 1OE2A 5I26A 1W6LA 1FA4A 2UXFA 4A2GA 1JZHA 1SNRA 1AANA 1AACA 1GSKA 2DWTA 3NJLA 2DYSB 1CYXA 4G7RB 5I6OA 2BP8B 1SHXA 3WNIA 4AKOA 2VN3A 2CBPA 4JHVA 4A2DA 2VW6A 2YAEA 1A8ZA 3TASA 3QQXA 4G71B 1ET8A 1SDDA 2VW4A 4UF7C 5A7EA 4YSTA 3QJRB 1V54B 1NWOA 3IBOA 3NJFA 4UANA 1MDAA 1AZNA 5I6NA 3V9EA 1UATA 3T6WA 2OCCB 2GB2A 1PF3A 4UAHA 2IDTA 4DPCX 1NPNA 4KO9A 1W8EA 4BK5C 1AS8A 1NWPA 1RZPA 2J55A 3L45A 3TBCA 1TEFA 2IH9A 4DP5X 4KNSA 5PAZA 4HAKA 5LDUA 5B7MA 3NJIA 1KBWA 3OMAB 2PPDA 5I5MA 5F7BA 2EIMB 2CALA 4HZ1A 4YSCA 2XLLA 1NIEA 3EH3B 1SFHA 1J5DA 1IBZA 4KOBA 4E9XA 1DZ0A 4AI7A 2BP0A 1L9RA 4HCGA 2QPDB 2IWEA 4NB7A 3NSFA 2CAKA 1PMYA 1PLBA 1ZDSA 4FA7B 3V9CA 1VLXA 2GC4C 3AG1B 2MTAA 3CDZA 3QJVB 1MZYA 1SF3A 1PZBA 2P80A 1JXDA 1NIBA 1J9SA 2QPEB 2IDQA 2ZWNA 4HHGA 3SQRA 4BWUA 1OCOB 3N55A 7PAZA 2IWKA 4JKNA 4W9ZA 4CSPA 1EZLA 1AAJA 3FSAA 3ASNB 4JHUA 2XXGA 4M4RB 1J5CA 3JT2A 5F7AA 2HRGA 4ENZA 1NTDA 3TBBA 1JZGA 1KGYE 1X9RA 4DP0X 1PNDA 1B3IA 4AX3A 1NDTA 1M56B 4E9SA 1PAZA 1DYZA 3KW7A 5AZUA 4YSOA 6PCYA 1IC0A 2BO0A 1AOZA 1NIDA 2PPAA 2DV6A 5D4JA 2QDVA 3FQ1A 2RACA 2LLNA 4GP5B 4HHWA 4DP4X 3UABA 4YSRA 1L9PA 1V10A 4YSDA 3T6ZA 2B3IA 4HCFA 3CVCA 2FWLB 1RCYA 1E5ZA 3C75A 3MX0B 2IDUA 4RH4A 3OM3B 3X1BA 3X1FA 3NYKA 2XVBA 3SBRA 2HLEB 2QDWA 3FSWA 1XB6A 1FWXA 2AVFA 2EINB 3NSDA 2BW4A 2GC7C 2I7OA 2VSKB 3EH4B 1MG3C 3T6XA 1J9QA 4A67A 4A2EA 3RYMA 2HXAA 5D4HA 2YXVA 4BXVA 1BXUA 1BQRA 2P80D 3IEAA 2Y69B 3CVBA 4BWTA 1JZJA 2PP7A 2EIKB 1XB8A 1PZCA 4F7KA 4E9VA 3FU7A 3CDZB 2R7EA 1WA1X 1JZIA 1OCCB 4A2HA 1ZDQA 3FU8A 1BQKA 2FQEA 2UXVA 3WIAA 3QJSB 3X1EA 4GXFA 4TXVB 2VSMB 2BP0B 4YSSA 3FS9A 4NERA 3S3BB 1HFUA 2JKWA 2VM3A 1AG0A 4PCYA 4M3HA 2Q5BA 2IAAC 3NSCA 1AZUA 3FU7B 1CYWA 1BYPA 4BWWA 1BQ5A 9PCYA 4E9YA 1E5YA 3DTUB 3NJGA 1AZCA 3TA4D 5TK4A 2E86A 4HCIA 7PCYA 2HX9A 2J57A 2YAHA 1ETJA 2YAMA 1OCZB 4Q8BA 4DP1X 4BDVA 2BZCA 1NIFA 1I53A 4YSQA 1OV8A 1PLAA 1OF0A 2H3XC 1YLBB 3IN0A 3ZX1A 1L9SA 3NJMA 2FTAA 2YAPA 3NJJA 1L9TA 4DP6X 2PP9A 1TEGA 3H4FA 3ERXA 1NPJA 3H4HA 1E65A 2I7SA 3JTBA 2FT8A 2J56A 3U25A 4HIPA 4NAJA 2JXMA 3AZUA
chains in the Genus database with same CATH superfamily
3FO9B 2BP8A 3EGDB 1IUZA 3FHEA 4HC1A 3FRPB 3MR9B 4F7PB 5I1AA 4AXWA 2NCEA 1NCDH 2YZ1A 3F62A 3NSYA 5KJRH 3MN8A 3D09A 3CLWA 5E2VL 3FONA 1VFBA 1D5XB 2NXZB 4J3BA 3LPWA 3HMXL 4DVBA 2MPVA 4HPHA 3V0AC 2R0WL 4FQCH 4Y4HD 5C0FA 1UA6L 4OCXH 3ULVF 1A7NH 3BVVA 3KWUA 3TTYA 3DTXB 4IIQC 1E42A 2Z7UA 3Q5YA 1OAUL 2FO4A 4JGUA 4RSYA 4X4KA 4XODA 5BJTA 5KVEL 5B38A 4ODHH 3B3BA 1HAWA 3P9MB 5JOPD 3UACA 4XE5B 4JUSA 1ULVA 1XV8A 3OX8A 2OTUA 1E4KC 4TM9A 3LRLA 2DQFA 5GRVL 2ENJA 5E0FA 3Q2WA 5IROD 5E94A 4APXB 5DYOA 3CLEH 4Z1PA 5EUKB 4S1SL 4HLZH 1BF2A 4OLUL 5DK2B 2J2ZB 5DSCB 1TYRA 2DQMA 3O3BB 3MBEA 1R75A 4XX1G 5DK2A 1E27A 5I1EL 2DQTH 2AV1B 4HF5H 5I5IA 4XP9H 1FHGA 2BVPB 3HFML 4NUPA 2H9GA 2VERN 1O0VA 1B4RA 2XN9A 2GT9A 5AVWB 3U4BH 3ML8A 1NC2B 3DO3A 4N2KA 4X8JB 1IEHA 1ANUA 4QNPE 1A1NB 4GO6B 3ZY7A 1NCHA 3Q06A 2BZ7A 2HT4C 3TBTA 2CDEA 4N28A 1ID2A 2QV4A 1JYWA 4YHLH 1DBBH 3NCBB 4LLDA 5HVHB 5E8OA 3ZDYE 2ZCZA 5IW6B 1F45A 1HH6B 4DEPC 1Z6JT 3FRPA 3MR9A 2C9SA 5FV1L 2EXYC 2YUWA 3H9YA 1FZMA 1TQBC 4F24A 3F6JA 2KDGA 4NKDB 1CBJA 5FECA 3SOBH 1MHCA 3K1KC 3WUWB 2MKLC 3LXUX 5DURB 4LIQE 3C5ZC 3VGBA 1VCBC 4L37A 2ATAA 1SUHA 4TNFA 1H15B 2OW7A 4U1LB 3WS6A 3K4ZA 1YYLH 2P3YA 1N6VA 3DX9A 5IESL 2VXTL 1MUJA 2W0FA 2V2XB 5KSAD 2YPKB 4JG0L 2NW3B 4JO4H 4FQLH 2LV4A 2WNXA 5I1GL 1E4WL 5C0GA 1UCBH 4HDIA 3H7BA 4ODXA 1BJ1H 2AK4D 2KZ1B 3S0PA 4Y19D 4TTGA 1X44A 1ZGLP 4P2YA 2XWBA 4JM2D 3M1BB 4L1SA 4PJHF 2PCXA 3FH7A 3U1QA 5I23A 1NGYB 4LHUB 3L3OC 1PG7L 5F3HB 1S46A 4RA0C 1HL9A 3PNWA 1CGSL 5T33H 3EBIA 5IEHB 1LQSR 3LEYL 4R3SB 1UXWB 1KELH 1Z0MA 3TPKA 2KDYA 2XWTB 4BH8A 1NCUA 4Y8AA 4LOUC 4OGXL 3E2HC 4OLVL 7CGTA 2Z4QB 3ABKB 2DL2A 3HG1A 1YEIH 5L8JB 4PCSA 2YA0A 1G1KA 1RULL 2R1WB 3K5RA 4OU3A 5I8KL 1EEYA 1HXKA 3G5XA 3HR6A 2BVEA 4Z0XA 4DOHE 2FZ3A 4YAQB 1T6VN 5FPIA 3BPNC 3FTGA 3RVXD 4B60A 2NUTA 2D7TH 4FG4A 1HHHB 1UWEH 1MAJA 5GRXG 4ADGA 4YHIA 3BZEB 1QP1A 2XX0A 4RZCB 2HMIC 3AREC 3K2KA 1MNNA 2ZONA 1RIVL 3QUGA 1JV5A 3IJ9A 4LMQE 1JZ3A 3BKCL 5IFHL 3EJCA 3U4EB 3ZTCC 1E6JL 5H2BA 3HRPA 1L7TL 1OPGH 2ZT9C 1T1XB 2CLVA 4KO5A 5AB2A 3EJZC 1AZRA 3KYOA 5B7EA 2L7JA 2OTWB 5TPWH 4CADA 1LE9A 1S7QA 1YPZA 1AZBA 2P8PA 4P0DA 3UL4A 2VISB 4NOBA 5KYUA 2A77L 5I82A 5DK3A 2BCMA 2GTQA 6FABH 4Z7OF 1AKJD 4LSSH 5EU4B 2TAAA 3JTSB 4MNGB 1FP5A 4OR1A 1MNUL 1P84K 4Y2DB 3U7AA 3WOVA 1IQWL 3HAEH 3LXCA 2HPOA 1YJDL 2DI9A 1U2HA 4S1QH 1EXUA 3CV5A 2MH4A 2DMCA 4RGND 4PJ7E 5K9JH 3G5VA 3BJLA 4G8EB 4LL9A 4XHJD 1BM3L 3J07A 4AM0B 3BO8B 5IHZA 2HFGL 1LO2L 5JQ6L 2XN9E 4FNLL 4P3CL 5D4QA 1JZFA 3R18A 3JWDL 4FQXC 4PJ5A 4UINL 4W9EC 4KPHH 4PJDF 3TO2A 2EVGA 5DVOA 1HQRB 3I6SA 3QDMB 1RZ7H 2A83A 1NGWB 3C8KB 4PWEA 1ZA6A 5F9WC 3BFQG 1FNGB 4JCWA 4OSUH 5D71H 4F7TA 5CIPA 1P53A 1FN4A 5B1BB 4LSQH 3I75B 5AKTA 4GRWF 1GR7A 4PJIE 5JO5B 4YFLI 5ITFA 4JQIH 3D25B 2GJZB 4L2LA 1I9EA 3VRLF 3IJYB 4FLRA 4FZEL 1E6OL 4HEME 3KPRD 1JI1A 2K6YA 2NPLX 1SRDA 4GNKB 3PXJA 5CSGA 1DANT 1QQDB 5EH1A 1A4BA 1PIFA 3L5JA 3UAJA 1ZRUA 5DHVH 4WUKL 2W9DL 1IM3B 1AQHA 4Y2OB 4P46D 2VDQL 4DAGL 2UXFA 3BWUC 1DLFL 4Z76A 2CNZA 2Y36L 4PV1C 3CDCA 4GXVL 1ZGLB 4GLRI 4XBEL 2Q86B 3D06A 3VCLA 5EPMA 1JGIA 3X14B 5DC4B 1XCTA 5EUOE 2B2XL 2X9WA 3C5JA 2MQ0A 4HIHB 1OSZB 4LU5L 4JDEA 4W9LC 2GJJA 1JXKA 4JMNA 3SPHA 1V7ML 3SKUD 2ZYHA 3WEXB 3U9PH 1AZNA 4N3UA 2NZ9C 5DZAA 2OK0L 1XH2A 4JM4L 2CHDA 1N5AB 4JFXA 1Q1JH 4Y8DC 2DS4A 1X5ZA 4OF5A 4DIXA 3JYCA 1WWBX 4NLAA 1V8HA 2VQTA 1CR9H 1OAKH 2CR0A 2ZOWA 5DMKA 3T8XA 3MCKA 4NPKA 2EE9A 4HMDA 3HI5H 1OD9A 1HTYA 1KYOK 2XV6B 4OAWA 4K7PY 1UM6H 3BGAA 5A2KH 5LDUA 3DO7A 5BZDA 2Z3FA 1V27A 2E46A 3CH8A 1DL7L 2Y1ZA 2B7DT 1Q9LB 1HCFX 1OP3K 5I5MA 1UFGA 1JHTB 4ES8A 1YYCA 4GXVH 3JWDH 3MV7E 3ROOB 2Y23A 5K59F 5D2LE 1A21A 4HCGA 4LVHB 1QSFA 3RDTA 5HYEA 1BFTA 2J8UA 2IMMA 4DAGH 3D18B 5LXGL 2GSGA 4GKSA 4PJ6A 1CDBA 3BISA 1ZDSA 4J2QA 1KCUL 3NDYE 2BVPA 3P73A 1VLXA 3AG1B 2MTAA 4HD5A 2ICEA 4KVNH 3UPAA 1K6QL 2FR4A 1MCPL 4H8HA 2EC8A 2GJPA 3B2MA 1T22B 5FUZH 1G7HB 5C0IB 4ONHB 1R24B 5IGXL 3EJUA 2ED7A 4LKCB 4X6DB 4XVSH 1Z5HA 2KQMA 2ZUQC 3WNKA 1BZOA 3B9KA 3II1A 3VFOB 2A74B 2Z35A 3T2PA 5I9QB 3UTTA 1U33A 5F7HA 2OTUB 5F7AA 3FTSA 3QDMA 1SQ2N 4JREC 3BAWA 1O7VA 1NAML 1IBFA 3EHBD 3X17A 1IM9B 4KMTL 4JQIA 4WSKA 4HULB 5F88B 1TZ8A 1WGVA 3L3OA 1KTBA 3OLDA 5EC1B 1IL1B 3TH3T 1JUFB 3D9AH 5I1EH 1IGFH 3ULVL 1R3HB 3P0YL 5HI5C 2RMNA 2LOEA 1ONQB 1PQZA 1VEOA 1XL4A 2AJYL 2CK0L 1W9XA 2QGBA 2OMYB 4FP8L 4FMVA 1RJZB 4UM8A 1A6WL 4TVSa 1FFOA 4WGKA 5M95B 3C2AL 2QDVA 2FECL 1ECZA 5AG8A 3BAEL 2LE9A 4NJ9L 3BD3A 1I8KB 3S98A 2VQ1B 5AW8B 1EO5A 2ADJB 4M6NH 1ZS8A 4PVLA 2YK1H 4QUOA 3LSOB 5F3BB 4U33A 1CTNA 5KYUB 3S7GA 2VM9A 3LPOA 1WLHA 3X11B 2D3VA 1GC1C 1JGDA 1R5VA 3C75A 3A24A 5FA4A 3UTTE 4B9JA 2Z93B 2IFGA 3I6GA 4QHKJ 1FCGA 1RZ7L 1S8DB 2VZOA 2C3GA 1PD1A 1T04B 1IQDB 4HJJL 4HS6A 4JVPA 2VE6B 2ZUSA 5E5UB 4LPXA 1KB9K 4PVNA 1XH3A 4PJ7B 2ESVD 4X6BA 1TTRA 4BKSC 3AMLA 2VXQA 3KPQB 1C5BH 3PG2A 5JXAH 2LT9A 3CVIH 4UQBA 1A25A 4U3SA 3QCVH 3I2CL 5KG9B 3RBSA 3US1A 5MEPB 5C0RL 1CMOA 4NRZA 1S7RA 2HJFB 4Q0XL 4AW4A 1ZHBB 3OKMA 5FFGA 3VWJD 3KPTA 1PX3A 4XCYA 3VA2C 3VXSB 1INQA 1XF2A 3MUGB 2IJ0C 1XGUB 4YDIH 1N7ML 2UXVA 2VDNB 5AOMA 4PW4A 5BS0A 4AYFA 5HDLA 1QTYT 1NLBH 4W4OA 3WEBA 1KG0B 1BQLH 4L3EB 5CJ8A 3TA3C 4HUKB 1E4XI 1IAOA 2XQYA 4IQHA 4U7KA 1N64L 2XA8L 3WJLC 5L9DL 3REVB 4NNXB 4ODTH 2ENYA 2GSIB 4E9YA 2BNRE 3KYAA 3RUGB 3MRCB 3SCMD 2ZOKB 3TN0A 2YAHA 3WS3A 4HU8A 4P9MH 2R2BB 4DJMA 2CHXA 2YAMA 4HMEA 5L4IA 3B6SB 3GZKA 1HT6A 4PP2A 2WLKA 5CGYC 3DVFA 4HUUB 3R8QA 4NBXB 5FLVA 5JNYB 3TWYA 1NGQH 1JZ2A 5G4NA 3D4YA 3NJMA 1DZBA 4U0QB 2VR7A 2QADC 5C09D 1KB5H 3HB3C 4MJIB 3SGEI 3TVMD 2VZ3A 4MMYB 4NO5A 3GJEA 5AOJA 3UGXA 3ILPB 2BRRH 2JTDA 3TV3H 1JWUB 3LN9A 4IGBD 3AC0A 2EVFA 1LE5A 5DO8A 5F7YC 3OAWA 4KZDL 1NFDE 4FA6A 3W9DA 4Z7NE 2CO7B 3DIDA 1CC3A 2VKWA 3NSXA 1DN2A 1KBGH 4JPIB 4KI5E 2BRRL 4K73A 3VYPA 2PWGA 1CVSC 4OIAA 4PRHE 5HI4D 1NQBA 3KEHA 4OM0L 4AKPA 3ZDZB 1U8MB 2EEDA 3FT1A 4HK3N 4L4TE 1XWVA 2QJDA 3DX7B 3ZSSA 4JZOB 4JFPB 1YNKH 1UWXH 4MB5A 1W0VB 2DM4A 3UAFA 2F1AA 2X2IA 1QFPA 3DVGA 4GS7B 3H85A 1UGKA 4KY1L 4X7SL 3UCRA 3KPLB 5F8QC 1YMMB 3KPNB 1GS6X 4X4ME 1YPZF 1IAKB 1MKFA 2CCWA 5MEOA 3Q1EA 1WGOA 1PZ2A 4Y5XC 1XFPA 2GUOB 4U1JB 1QEWA 4GBXD 4LFHD 1RZGA 5DQJA 5EU6B 3RUGE 4ZFOA 3D2UD 5L88H 5L2KB 1RZGB 1WP6A 5DQJB 3RGBA 1INDH 4L4TD 2WZPD 2YMXH 3NEOA 4LRNH 1G1YA 2H32A 2GPZA 1SJEB 3NEEA 3QFDB 4XP4H 1MIML 2HFEA 4NZUH 3DSFL 3GLAA 3LN4B 1NCBH 5EIQA 2F58L 4MZRA 3V4PH 3RWJB 1F4YH 1A9EB 3MJ9H 4NCDA 5GIRB 3RB7A 5J13B 4H1LA 3PJLA 1CLOH 2WVVA 4N4YB 4QTIH 4L1BA 4M02A 3MLWL 2YOAA 1CE6A 2WW8A 1P7QD 1ZTXL 2VXVL 1F4HA 1CLZH 4GKNA 3RIFK 4DVBB 4L4VB 2OV0A 3ZKMD 4FERA 5C0BE 5CBEB 2NXYD 4KO7A 1VEMA 3K6SB 2PPFA 3MOBL 2P8MA 4LAQH 4CSTA 3NJKA 3GNMH 4OZFG 2CJSA 2N4IA 3HNSL 4L1HA 4X2UA 2VLLB 1EV2E 3R7QA 2IH8A 4JZJC 4C54A 3DXAB 4A2FA 2QFPA 1O75A 1W0YT 4J4PC 3KM1A 3MTXA 3L5XL 4H8WH 2YJLA 3MBEC 4XPGH 1SXSA 1HYRC 3MRGB 3T0WA 2EDRA 3FUKA 1RLBA 4Y9CA 4FYSA 2PO6D 4WI0B 3K7UA 2JELL 3SPVA 3CXHK 2WSKA 3RDJA 5KTEL 1VZIA 4UM9B 2WGXA 3IM1A 4PUBH 3IJEA 1MOEA 1HI6A 3WNLA 5IQ7H 4I4WB 1L5GA 2JTYA 2OCJA 3AGVA 4XB3A 1BF8A 4MB1A 2VMDA 3B9VA 3CZFB 5I2IB 2BHFA 5I9QC 5C0JB 2O6CA 4MS8C 1UA6H 5IB1B 2CK0H 2HX8A 4LLMB 5LCVL 3UTQA 3F7VA 1H3PH 1DSWA 4OTXH 2IF7A 3KPPA 5C1MB 5DD3H 1YCSA 4XB7A 1U21A 2FLRT 5I1IH 3DBXA 1YEGH 4X4ZA 4HWZB 5HI3C 1BXVA 3OQRA 4BGLA 4N1HB 3VGAC 2ZWLT 3OTTA 5FKPB 4N2CA 1DDTA 5B1JA 4BXSV 4HOMA 4AMKH 1P5UC 1SZNA 3SDCD 4K23L 4YX2L 1EO7A 4NZFA 5L2KE 4Z77B 2VLKA 2IG2H 2NSMA 4Y19E 3C5ZA 4EZKA 1F90H 1ZHBA 1U58B 2BOBA 4Z6AT 1Q94A 2V7HB 3U1SH 5ESVA 4J12A 5E4EB 2EH8H 3QA3A 4KXBA 2ZQKA 3JQOB 5F7FA 5KYXB 5CHNA 4IHBA 4QI3A 2YARA 2JK5A 1I1AA 2UX7A 5BVJB 1G7MB 1IC5L 2Z6FA 5CD3A 1H3GA 4PJ7A 4U6TA 4Y16A 2EIZB 3LEXB 2WO4A 5L2KD 1JPTH 5KYWB 4WTWA 5KS9F 3T0XA 2HB0A 4DW2H 1IKFL 5CN2A 4L4VD 4U1IB 4NKMB 4M5YH 2NY1C 4K7PL 3VRJB 5J56B 1ZLUK 5T3XH 1O5DT 3BWAB 2NY7H 3QI9C 3PGCA 1WZKA 1IO4C 4FGMA 1H3WM 1GW6A 3LEVH 3QZWB 4MNQD 1JK8A 1JE6A 3HMWL 3UC0H 1XF3B 2FSEA 1YEHL 3CK0L 2E75C 3QIWB 4IRJD 4IK6A 3ULUE 1U8HB 3LZFL 5F7DA 2VMEA 4MX7A 5I6LA 1A02N 5CMAA 2BSED 2NY3B 2X4RB 3VFPA 4G9FB 1PNCA 1B90A 4D9LL 4I13B 4MWFA 5AUMA 1N3NA 5EOTA 4GBXB 1BWWA 1S7WA 2L7QA 2WLLB 3GBNH 1R1CA 4ZAKA 3F7PC 3LRMA 3TT3H 1ROWA 1PPIA 3QEQE 2QVTA 3EYQC 2WY3B 4KI5C 4WO4D 1JRHH 4OB5L 1HSAB 2CO1A 3ZDYB 2VXUL 1NIAA 1UA7A 1D2OA 5AD0A 4ZMQA 4NN7B 4WV1C 1KGWA 2Z31A 1SEQL 1A6VL 4ODUA 1SUJA 2IADB 3DYPA 4F7CB 1R24A 3MRNA 3D39D 1FH5L 4GUCA 2YJQA 5F6HI 4ZW3A 5I0XA 4NPJA 1HINL 3PXLA 2R69A 3P3UA 2HSIA 4TSAH 2ZAGA 2VXQL 3MFFA 4P9HL 1CIUA 1MI5E 3U36A 3ZHFA 3F5WA 4F2MB 3IT8D 4MJ6A 4RMVA 4WO0A 2FEEI 3GKWH 4P4KB 4XCCL 3RGHA 4NQUA 4BGDA 5LGHL 3ARGA 2VUYA 1M1SA 3K8KA 3OKEA 4MX7B 1AI1H 2WZAA 3HBZA 3ARBB 1IE4A 2EABA 4WJG3 3CWGA 1Q9LA 4JQVC 4HFWB 4KAQH 4GKZA 2DWTA 3HG5A 2PN5A 1MIEH 2X4TB 5DC0A 4P3CH 3VWJB 2HG0A 1KIPA 5DF0A 5F44A 4P23B 4R8WH 2G4GA 3ZDZE 2MCAA 5ABAA 5DMKB 1MRCL 1QFOA 5K9JL 4XVSL 2VDML 4HG4K 5E7FA 1RFDL 1FYHB 2PCPA 5F72S 1HHGB 4DT2A 1MCPH 4O58L 4X6CE 4LLQB 4HLEA 5EIIA 5I1HL 4LHUG 3L7EA 3NPZB 2Q0ZX 5ICUA 1SVCP 2QMJA 2YRBA 4WZ9A 5KYWA 1NCNA 2WZPA 4WW1A 3SDCC 1I1FB 3TCLB 5D1XC 3HLAB 2V3FA 3MV8E 5D7SH 1JXJA 2Q7AA 3OG6B 2G2PA 5DHYA 1Z3GH 3EOTH 4NZTL 4BFIB 2KYIA 4XN8A 5C0AA 1I9JL 1ZK9A 4Z7QE 3ISRA 5KYXA 1F4XL 1NCAH 2J12B 1OHQA 1HHIA 4MXQD 2AXFB 4KHTH 4HG4J 2X70B 2NY3D 3A67L 3X13B 2HKFH 2XLLA 2R0KL 1IM3A 25C8L 4E9XA 2UZXA 4XXWA 4ZNCD 4G6FD 4FFZA 4J4PA 4GQRA 1R3KB 4PS8A 1JNLH 2IWEA 4I3SL 3CN4A 3P4NB 4XC3L 2V2WA 5EOQH 3C6LA 2A6DB 4ZMWA 3CN3A 1MZYA 4JJHA 1PZBA 3D4CA 3HR5A 3L95B 5E00A 2OULB 1VGEL 4PY7B 2ODHA 4J8QA 3CPLA 4EIGB 3SQBA 3N1MC 5DD1H 1FIGL 3EAKA 3EO1A 5ANME 2BLFA 4GSDL 5CSZB 1S7XA 2YXMA 4HHAB 5T3ZE 4P5TD 2NX5B 4Y5VC 2XXGA 2NYZA 4J3UA 5DJ0A 1KELL 3B2XA 3K6FA 3D8MA 4PJ5B 4BKTC 4IRSA 5I1KL 1NTDA 3A6BH 1KFAH 2VIRA 3QO0A 3V6FB 3ULVD 1XBDA 3OZKA 2AJXL 2Y7NA 5FGRA 3UBHA 4IRZA 3VXMA 4B96A 3G5VB 4G8EA 1V3JA 4ZO7A 3N1PC 1FYTB 5GGUB 5IROA 4NM4L 1OGAD 2XTJE 3NUKA 3OVUB 3MNWB 5FYJE 3LIZA 4DGVH 3UXFA 3BUBA 4AEIH 3VGAB 1YMHA 4LVEA 1XF3A 1M53A 3GHBL 3KWWB 1IC0A 1SN5A 2RQEA 4K3EH 4LLAA 3CHQA 2R0KH 4AGMA 4CVZB 3FQ1A 1FZKB 3RY6A 5G4MA 3RPKA 1T5WA 2VISA 4QRPD 4YSRA 1HZKA 4KUZL 1ADQA 3NCMA 2CZNA 5E6UB 4L4VA 2V9QA 5CLWA 2CMRH 4WI3A 3GS0A 3MX0B 4PWHA 4RH4A 4XXWC 2Y06L 3X1FA 1BMGA 3CDFA 1FRGH 2WV3A 2AJSH 4OCYL 4H1LB 5DZPA 5C08E 5DJZB 2W5PA 4KKQA 2ZUYA 5D70L 1FORL 4E5XA 4UV7H 4I3RL 1I3VA 3NAAH 4KKNA 4ZUTA 3EGSA 1EVUA 1TIUA 1SJEA 1GZPA 3QFDA 4MJ4A 3S34L 3T6XA 2IANE 5J6HA 3U46B 3VXUE 2BOBB 4BXVA 2X89D 2PR4H 2FL5B 4BWTA 4JFFB 1USZA 2PWEA 4BFBD 3QYNA 3WL9A 4NO0B 1CBVH 1MRDL 4M93C 1WE5A 1PLGH 2ISDA 2VWEE 1CI3M 4TSCH 3GFUA 3C08L 3ZDYF 1CLVA 3T0BA 5DJ6A 4G8GB 2DQCL 4LSDA 3LNIA 1UXSA 1W0VA 1TQCC 2F1EA 2FBJH 5FM4A 3MGAA 1IE5A 4PRPB 1MLBB 4QCIB 3VI3A 2N1KA 1WCQA 1DJXA 4YHYB 4P2RB 4YR6A 3NRPA 4GG6B 3LTVA 3QNZB 1UWEL 3W0WB 1X5HA 4U31A 4CDGC 2O6DA 3SY6A 4K71B 3DTUB 1MJUL 4V33A 1OAYH 5TK4A 5BVPL 4RBPH 5E95B 4WV1B 4ZODA 3NGBC 4UZSA 1WC7B 4QHNA 1S3KL 3VXQA 4XPHH 3CN0A 4LASL 4YBLC 1KZYA 1YN6A 4KKCD 4FN0A 1TETL 3P4OB 1PLAA 2VLJD 3MOAH 2H3XC 4ORGB 4OSUL 4NQDE 3HHSB 4HOWA 5HVWA 5EEZA 4PLKD 3GJEB 3A21A 3QDMD 5JZ7C 5FDWA 4I0PB 4IRZH 1EHXA 5BQDA 3NK4A 2OMVB 5JW4N 4XCFL 1YJDC 5MI0C 1FAKT 2IPUK 1QPKA 3QXAA 1LK3H 1CK0H 2Y2WA 4RFOH 2XKUA 2J56A 2H1XA 5TDPB 4YGAB 1NCWL 2WINB 3OKOB 4JM4H 1MJJA 4F37F 1GH7A 1W72L 2ITEA 5HHMD 1CGVA 3KL3A 3MJ8A 2ED8A 5B3JF 1PSKL 4JKMA 4MVBD 1JZ6A 5EEWA 4YNYA 3REVA 2JI1A 4U1NB 1YYLL 3GXUB 4JHZA 3BKYL 4F5CA 3S37X 1AGEB 4I0PD 4XC1H 3IVKA 2P5WB 5C8JA 1KG0A 4G8GA 4CL7A 3I3DA 1AGDB 1XF4A 1FUNA 2I07B 3SPIA 2VLRB 4HAGA 5DS8A 3MUY1 1I4FA 3SJVA 1G7IA 1FVDB 1JF1B 3QG7L 1E40A 3ZL4H 2JMRA 5CN3A 4PG9A 2EYSA 5DHVB 1B0GA 2G9HB 3FUNA 5PCYA 2NY6C 1WWWX 3QZWG 2H0FA 2B1OA 3QEHA 2A6IA 4D0BA 5JQHC 4YSEA 3AROA 3F12B 3SD2A 2KL6A 1GZPB 1N26A 3RX7A 4WTZA 1TFPA 1W0WB 3ASOB 3FT3A 4KJWC 4JW3A 2DMKA 3CSYA 3WGVB 1QABA 4RBPK 1DVFB 2YGVA 2CJUL 4JG0H 1HHKB 5B38B 3R06B 5EU5B 1DFBL 1P6WA 1UA3A 3B7UX 2G0KA 2AQ3A 4ZDHB 4HS6B 2AEQL 3IS1X 2BP5M 4YSAA 4TQ8A 2Z7ZA 1EAPB 2CGRH 5I0DA 3LQZA 4ELKB 1AQMA 3MRHA 4I18C 4AV5A 4YWGH 4ZBJA 1ZIBA 3EGXB 3QO1B 4ZXBD 2A4EA 1XO8A 3PF2A 1LE5B 2XA3A 5DJXB 2G3NA 3BI9X 1GKEA 4L5FH 5IUCA 2VQ1A 3D1MC 4KRMB 3CFTA 4YDVB 4R0LB 1J1OH 4P2AA 1FFOB 1T1YB 2X3CA 2C8NA 3BPCB 1G9NC 1AIFA 4F93B 2XXFA 1VEPA 5HHPB 4XCNB 1FGNL 5ABZA 4G70B 4F7EA 1M3JA 3CBJB 5GSRA 2HTLC 3D85D 3L4XA 1MQKL 4HXBL 1JRHL 3HAEA 1EWHA 5AOKA 2VLRE 3NG5A 4WFHE 2IBZX 3SQOH 3VYOA 1IKOP 2OYLA 3QHTC 1E9PA 3L5XH 3P69A 2WXGA 5EBLB 4FJZA 4HIQA 1I8UA 1MVUB 2ZF8A 3U6XS 1YO4A 2D3LA 1XVSA 4D94A 2NR6C 4LBEA 4KV5E 4NDMA 3AG4B 4AE1A 4CGTA 4P06A 3O4LB 2JV6A 4BDVB 1CZ8L 1IAOB 2XXMB 5GGTH 1Z66A 2DWDA 4HVBA 1M42A 4XCEB 2HUHA 2O5NA 1DLHA 4DO6A 1QW9A 3QO1A 3IMBA 4O2FA 2D31A 4PJHA 4WK4B 4PP1C 1KNOB 1KBKA 2HAZA 2Q20A 2V2WB 2ZXQA 4LLWB 4Z9KB 5EO9A 5FFOA 2FJHA 4IEFA 1A7BA 3MRQA 3QP3A 4BHUA 4E9WA 2Q8AL 2C1OA 1VJSA 3DRQB 3UGUA 3T4AC 1CG9B 1TDQA 2J3SA 4ZDHA 3JTTA 4JLRA 4B9YA 2OMUB 3NZHH 4OFKA 1LD9B 2OR9L 1OM3H 4H2CA 4EF3A 1OP3H 5E2TH 2OQJA 5HYIA 2OR7A 3EOAA 3GSNL 3QQ9D 4NQQA 2CRZA 1QTPA 4PLKC 3HZYA 2DJUA 2A74C 2XQBH 2ZWSA 5FYJL 4QRRA 4K71C 4E68A 1WYJA 3F12A 4NZJA 2ZUQB 4OLWH 3U6RB 3RPBA 1HEZB 2XRAL 1C8QA 3ULUL 2OXHA 2WLYA 2H47C 1RP8A 2Z91B 1T83A 4KDTC 1SXAA 5AVQB 4NUGH 4G43B 4ZAKC 5A40E 4WW2B 2DLIA 1M7UA 2XC8A 4K2UH 3ARPA 4ZFFA 1T20B 4QEGA 3KPLA 4PJIF 3Q5OA 4QHLA 2ITDB 1QO3B 3VFRB 2ZTBA 4QOKD 2DYPA 1ASQA 4YNYB 3MRJA 4AMKL 4IDJL 4TQIA 2VDNL 1AGCA 1JNNH 3BSGA 2P24A 1DBKH 1NCGA 1T0NB 3ARFB 4PYHA 4FQCL 2HN7B 1DQJB 3FU3A 3OD3A 3VXOB 4ALAC 2OMZA 1MCOL 3ALPA 4O02H 1J87A 3KE0A 4GUPA 5DVMA 1RH8A 1OO2A 5HXMA 3BPOC 1JFQH 3KS0J 4HS3A 4XXDB 3RAJL 1G0XA 1NSNH 1IKNC 4UB0L 2YAQA 4H7VA 5H8DA 3MA7A 4JY5H 1J5HA 4U3HA 2WXOA 3F58L 4HALA 3AABA 3ULUD 4HWBA 1KCBA 3U0WL 3VXNB 2HX7A 4P3WA 4KXZI 1ZTXE 3O3EB 2VLMD 4CDHA 5HGBA 4NUGL 3EDJA 3FC8A 3VFVB 3OJDA 2OSLA 1VFAB 4RFNB 1AO7D 3WS3B 5FHAL 5HD8C 2FR4B 1GGIH 4D7PA 3TIEB 3AADB 4H0HB 5GGTA 4I18B 3RJOA 5I8CB 1LEIA 1KJVB 3NVQA 3DK2A 1RK0A 3ZYOA 5EN2A 1FC2D 3SDCB 2EUWA 4EUPA 1LLAA 1E3ZA 3AXLB 4M1DL 4UOQA 4X4YB 4AW7A 1VKXA 4MJJA 3GTNA 2PYFA 1MW0A 1EGJA 1CWVA 4FJYA 4XN7A 1OE2A 3F01A 5CP3A 2AW2A 3K2UH 5IQOA 4FHBD 1JSYA 1PSKH 3EJPA 5ID0A 1JK8B 3WHE0 1NUGA 2A38A 2WNWA 1CYXA 5KVEH 3BGMA 2ALWA 3F00A 4NO0D 5E1IA 1MWAA 3OF6A 4M7LL 4AJVA 5IR1A 2JELH 4I1RA 5J57B 3I3BA 3BP5A 3LPFA 1KV3A 4PJEE 5HJ3B 2WLHA 4UYQA 1CU4H 4HWBL 1Z9LA 1QBLH 4RFOL 3QBTB 3ATFA 4HWUA 3GMMB 1SBSH 1A1MA 3RNQB 2ID5A 3DHJA 1NWOA 4QGTA 1OAXL 4UANA 2EIZA 3SKNB 2AQQA 3O4LD 3OKNB 2N7SA 5DMIH 3O9WD 1A6UL 2OL3H 4OZFA 4DPCX 4PJBB 5CHNB 1KY7A 1N0XL 3HAEG 4M43H 3RY4A 1BD2D 1BIIB 4Q97A 4Z0XB 2JCCA 2C9AA 4NRYB 4Q6YA 1QKZH 1OB1A 3L4VA 3K2UL 5T3ZH 3ZE0B 1KBWA 2LW3A 2MCG1 1NMCC 4LAJH 5FA3B 1R17A 2NY5L 1T3FB 1NJ9B 1I7TB 1KPVA 3N42F 2E9JA 4HS8H 5ELIA 3CVIL 5DQ9A 3GJFA 4UILL 2OMYA 1J8KA 3BW9B 1NC4D 4FQ1L 2CAKA 4GSQA 1JZ7A 4B5EA 4Z7VA 4I85A 1MFDL 4X99A 1FGVH 5ICYB 3P77B 4IKKA 4Y9BA 4LNVA 4FXGB 4BRJA 3M1BA 1FHNA 3UTPE 3W2DH 1YY8B 3FU6A 4TUUA 2K9FB 3TFKD 4Y4FA 1T2QH 1BMWA 3N55A 5D1ZI 4HKZA 4ZX4A 3CQQA 3FMGL 4K8RC 3IFLL 3SQOL 2XTLA 4JFHD 3EFFB 5KEZA 2EUXA 5GZND 4OKDA 4XPTL 4AYMC 4P59L 4M4RB 1CF1A 3N1QC 1MAML 5F9OL 3WHXA 3S34H 1N10A 3TBBA 5I15L 3N04A 3QHFH 1DQVA 4QYAA 3OV6A 1VACB 5H4ZA 4HQQL 2W92A 6TAAA 1JP5A 1ZAGA 4Z7OB 1HDMB 2ZKXA 4G5ZL 2D7PA 4IBSA 2VDQB 4CMHC 2DICA 3ELQA 1JI2A 1E3FA 5EZIH 3O6LL 5F93C 4K3HA 3S88H 1WFTA 5AZUA 4O9HH 4J3SA 6PCYA 3ZE2F 2PPAA 2GBUA 2P8MB 5ADOL 5IW6A 4GP5B 4LPUA 4U1NA 1TO4A 4UOJA 1GKOA 1DUYB 1OGAE 2X6UA 2XTJD 3DETC 1V10A 3UEQA 4JM2F 3VD9A 2YFNA 2JH2A 5D7LB 2BNRB 2ZSVA 1CE6B 4JVWA 4MS8D 2Y9RT 1V3LA 5HHOA 1I1AD 3BAYA 4C56D 3U2SA 4XGZA 3TEUA 7FABH 2JXMB 3MCKB 4GG6F 2FX8L 1WPCA 3T8XB 2RH0A 2EIDA 4R7LA 4LPTA 3QUYC 5DJ8A 3RWJA 5HHNA 1ZT7A 4IYKA 2HCZX 4YHML 1IGJA 3NSDA 2NUTB 2D2OA 4X6DE 5F71A 3D5OF 5LWYL 1KBPA 2N1TE 5DO2D 1T80A 4BEIA 2LU5A 1TZHB 1E27B 1SLWA 5KVFL 1Y7VA 4OJDH 3P4OA 1S9KC 2NT1A 4Z78A 4UTBL 4EI5C 3MLRH 3TBYB 4IJ3C 2PP7A 2EIKB 4JO3L 5IEHA 1PYWA 5JDSB 2W60B 4Z76B 1MCHA 4HUNB 4ZD3L 2XY2A 4OLZL 1IGML 1WFUA 4WWOA 5BZXA 3FAWA 4NERA 5JYLA 4QCIA 1IKNA 4EKXA 2YLHA 4OUUA 2A9CA 4N2GA 5GS3A 4JO2H 4OIIL 1QFWH 5E08H 2ZKHL 3J2PA 1GPOH 3IJYA 3BPOB 3VXSD 4X6CF 4ZTOH 4M5TA 2JCWA 5K39B 2W59A 1MUJB 2PO6A 3FCBA 4FFWC 2DJMA 4TTDD 5HY9A 3VFSB 1LHZA 5IQLA 2HX9A 4J7RA 4WEBL 4QIRA 4F5CE 2X5PA 1ZOXA 5DRNA 3BC9A 2QHRH 4JX0A 4Q8BA 3GRGA 4GAJL 2BZCA 3QDGB 4J8RA 2DWEB 3LNEA 3M1OA 1YLBB 4PJGA 3H2WA 4LCCC 4NUQA 1P5UB 2WKOF 1L9SA 4X0NA 4ZT1A 3ZE0F 2BY0A 1OTUD 4MZ3A 5DFTA 1PBYA 1S7WB 1U8NA 2WLLA 5HHOE 3T2OA 5DJ8B 1D2PA 4M6MH 4B7IA 5IHZB 4LVOB 1ZA3A 3L1OH 1HEZA 5CUSH 5EC2A 1SOXA 1IGMH 2NXZC 1VGKA 2FT8A 5I16A 4Y4HA 3TJPA 3MRKA 5E8OB 4GW1B 4MRBA 3AZUA 4P5SA 1IGFL 1NLDL 5DXWA 4Q9QH 3E3QC 4BZ1H 3JTSA 1MZZA 4Y2DA 3GZQA 4X4MA 3V5DB 1DFXA 5HYJB 3O8XA 2L8AA 2BS8A 4JRYA 4KO6A 1RIUL 4DETA 3BAKA 5J6SA 4HJ1A 1P4BH 2WWOA 4RWYL 1WT5A 4U0RB 1NBZA 4LSVH 5MERB 4CU8A 4P2QA 3U9WA 1S7QB 1WSST 5D7IA 1UM6L 1UZ8A 1A9BB 2Q3XA 1OSEA 3ZZQA 4F92B 3MBEB 3MLSL 2VDPH 1J12A 5LN4A 5E8DH 2OJ1A 2FX9L 3CFKB 5HDBE 2D03L 4IU3A 4JZJB 5JMOC 3A4DA 3WBDA 4B9PA 1JZ8A 1LO5A 2EICA 1S7SA 4LPWA 1TT6A 1T5XB 4LU5H 3S8GB 3AT0A 4FLHA 1H6UA 2WN3A 4G7VH 4KOCA 4OKVA 1NKGA 1CB4A 1EIBA 1FYTE 1GOGA 1UACL 3W81A 3BVTA 1A5FL 4NOFA 3QGVA 2HRLA 4Y1SA 2IEPA 2F54D 4EEEA 1CURA 1S8DA 3HAEB 3I6GB 1UT9A 3LRGA 4LIQH 2IPUG 3APMA 43CAB 3DSNA 2ICCA 2VRKA 4XN4A 1P1ZA 2HYMA 3SZ6A 3X3GL 3VD3A 4E41E 3DX2A 1KDJA 2M2DA 4CN6A 3G6AB 4ZX6A 1PFCA 2JF1A 2CLZB 3FULA 3NIFF 3X1GA 3VFNB 2F5AL 5BZWB 1FYTD 2Z7YA 3SKJH 5EOQL 3F7QA 4PJAA 5KVGE 3MV9E 4JFFE 4PJ8D 2Y2YA 2FX8H 3NCFB 4ZXBC 3WDJA 3UJJL 3RKPA 4MB4A 2Q76A 3HE6D 4WI5A 3O8XC 3EXJA 3BD4A 3GWJA 4XNYL 1UWGH 4ELKA 1HNYA 4L3FA 4YHPA 3IFLH 5BRZE 2HG5B 3HS9A 4D2NA 5EC1A 3FSZA 1MHHA 1J9RA 3OAZK 5C2UB 5DUJA 3AS3A 3FB8A 4XBEH 5LG1A 4G1MA 4I48A 1B88A 2V7NA 3HLAA 2ITFA 1BBJB 3BWZA 3GBLA 4I89A 5JUEL 4YO0B 1DVFA 4PB9L 4PPTA 4L29A 2FLMA 2QLYA 1RZKL 3K8LA 4HS8L 3F3HA 1M05A 2NLJB 2XPZA 4RFNC 5AYTA 4BV1A 4YJZL 1E9QA 3QEHB 4GRWE 5EIIG 5D7KE 3IJ8A 4YHMH 3IF1A 4HQQH 4E9RA 3QJOA 1YEEL 3TIDA 2G60L 1A4AA 1HZHL 1M7XA 1G7HA 5C0IA 1TJIH 3VFTB 1YG9A 4PS3A 5IW3A 3AQZA 3P3YA 1Y18A 4X6CB 5GGVY 3VWJA 4A2MA 2KKQA 1YVLA 4BFGA 4LLDB 4JCLA 4WWKB 4G7QB 2X4NB 5DQDH 2BWDA 4Y1AB 4BH7A 4EAEA 3O6FA 2HTLD 1VKXB 5IZ7A 1X5KA 3D87B 2JIXB 5I8EB 3S35H 1MRFH 4N90E 4YZFE 3MUUA 1G7PA 1PLGL 3NQKA 5AW1B 1KJVA 1YEGL 4NQDD 4U6XB 1FFRA 2J1XA 2VOTA 4HF5L 3GUTA 1DJIA 1AZZC 4WSJA 5C0ND 1QLEH 4OF3A 2ZXGA 5HGAB 1RUAH 4RAVA 5CJQH 3RL1A 3VVVA 4B7LA 1AG6A 3X2QB 2EYRB 1A6ZB 4MXWH 3SYCA 3ARFC 4R5TA 2C9XA 4XBPA 4GRLD 2NR6A 4K3GA 5AOZA 5A16B 4ETQA 3FQTB 3FPXA 2RFXB 3ZKND 3FUIA 1KOAA 1EA9C 1N5AA 4JFXB 1X9LA 3SKOA 3T6VA 4APXA 4BELD 5T5FH 3V6ZA 1J88A 4KFMA 4N8UA 3WG7B 3FUDA 4JQXC 3O41A 5DTFA 3WAJA 5E4IA 1RZ8B 3P3SA 5TGBB 2RD0A 4M43L 4IIQB 5D1QC 3GSVA 3SY0B 2YA1A 3C60C 1VSCA 4P05A 3T8MA 3FOLB 1K3ZA 4L8DB 2KPNA 2BINA 3E8UH 3MNDA 3SGJC 2E8YA 3AM8A 1J9CT 3U4AA 2HRHA 2ILLA 3PWPB 4W9DC 2Y3NA 1X5YA 2E76C 3ABGA 4YZWA 1ICTA 1F4WH 3IFOA 3FF7A 5D1ZA 4J3TA 3TS8A 1XGYH 1TSHA 5ERWA 2APXA 3FSOA 2WZ6A 2VDLB 5D7IF 3VXRE 1FFTB 1CJYA 2LVCA 1MLBA 3VI3B 2EH8L 2E27L 3HUJA 3TA3D 1G9MH 2DYPB 1F3RB 3GMOB 3TO4B 1BOGA 2GTWA 3MRMB 2ZUXA 5C0CD 1K85A 2GAZB 3HEIB 4W4OC 3BSZL 3SDXE 4DERA 1QKZL 3QULA 3O41B 5DTFB 5DYFA 2ARJQ 3AAZA 2X88A 4H5SA 1W2KT 4KU1A 5IOKA 1H0DB 3SKOB 1BEYL 4HUUA 2QSQA 5HHQA 1FBIH 3LKQB 1FFQA 3VAEA 2P47B 4XVUC 3H0TB 4M5ZL 4BSVB 4EO5A 4Z7NB 1IBGH 3WKPA 3WN5A 1HQRA 3LIZL 1EJ8A 3KVDD 5DJCA 1CGSH 5EEXA 4AENA 3BPLC 3AY4A 4PJAE 2IOMA 3DX6B 2ZX9A 3D08A 3SE6A 4R4NC 5LVEA 1QNZH 2IXQA 2MTPA 2FJFB 1F1DA 3HE6A 4QKTA 2VDRL 4TN9A 1Q94B 2V7HA 4QXGL 1JHLH 1K5NB 2BY2A 4LLVA 3CK0H 3Q8AA 3T4YA 43C9B 2ADFH 1DBBL 1M9WA 2P46B 2GEEA 3MRRB 4KMQA 1WH0A 1IEAB 2O26U 1WZ1L 4E5XG 2ZYIA 4RDQG 2J6EL 2EVIA 3Q43A 5CLXA 2V17H 1M6UA 2R4SH 4JG9A 3SGJA 2V9RA 4A2GA 4XN9A 3KXFE 3RDTD 4PGEA 3NJLA 1GSKA 2Z8SA 3ROLB 1E9QB 4GRWH 1QVOB 5KG9A 1NDMB 5FUCE 3O2DH 2G5BA 4MLSA 1LP9A 4DKDC 1BGXH 2G2NA 1MW3A 4IGBB 3K2MC 1KF9B 1J0ZA 4YO0A 3B2UC 1PZ5B 2ZX7A 1TTGA 4X6BB 4RAUA 4YXKH 2ZUWA 3OKDA 3T65B 4W68A 4PJFE 3CMOH 2W91A 3DUUA 4YHIB 1AOHA 3FT2A 2EE0A 3BZEA 2EYTA 3KPSE 4WTXA 3E3QE 1DN0A 5INCB 5FYKH 5HGDB 1U3HA 3O0RH 4IDLA 5ILTL 4PJXE 4PJGB 2FJGB 1M7DA 1GSMA 5DJ0B 4KO9A 1U8LB 5F96H 4Q4EA 5KBLA 3MV8B 3H9SB 5LNDA 3K72B 4TUOB 3LSOA 1HQ4A 3HN5A 4N9OB 1UB6B 5B7MA 3CHSA 3HN8A 3MCYA 3GQFA 3LPGA 4WFGD 2CM6A 2GY7B 3EUUA 2CALA 2EKSB 4ZS6D 5HDOA 3IGUA 1COBA 1XSIA 5B8CA 3GNML 4KITB 2VSDA 3VNZA 2PTTB 4NB7A 3D0VB 4P2OC 2EIBA 2YEQA 3CLEL 5AW9B 4OM1H 4PGDA 5BXFB 1MCQA 1NMAH 2X9XA 4XI5D 3DUHA 2H3KA 2QPEB 4PJCE 5JHDE 1W16A 3CE1A 3CFJA 4HUMB 1MWAL 1F97A 3S37L 4B9ZA 4ORZC 1CICB 4ICWA 1MPAH 3GJFH 3WHE1 4ODVH 3BP6B 5IP4A 5JHDB 4HT1L 5ID1A 2VSCA 1M3IA 1U8PB 3PXHA 3VFOA 4F8LA 2XXCB 3B34A 4XX5A 2JJSA 1AD9B 3VXPA 2O93L 1QSFD 5CP7B 3JV0A 3QUYA 4FEIA 1QLEL 2HLAA 2F0CA 5L88L 1RJCA 2Y5EA 1H19A 5D7IB 5E03A 5FYJH 1GGIL 4IMKC 1YQVH 3D18A 2FBRA 4R6UA 2P5WA 3RBGA 5C8JB 5JPMC 4YFLF 4TUKH 3RDTB 3DVGB 3B1UA 1DCLA 1KGXA 4OFDA 3QUZD 1NIDA 4PU2A 1PZDA 4JG5A 1B6UA 3O8XB 4QXUH 5HJDA 3V6OE 4KZEH 3L3HB 4Q7DA 5CAYB 1AXTL 5GISH 5F9WB 3N40F 4PJIB 3HZ3A 4NRXB 4ZXBB 1LO3L 1PW3A 1U6AH 3Q3GB 1IGCL 4HCFA 3HC2A 1G7JB 4ZPVA 4JRXB 3SDAC 4I2XE 3B56A 5SV4A 3UBXA 2V5MA 2W65B 1KGUA 4KK8C 3ZUNC 4YHYC 1D7FA 1AYRA 1KPUA 2AJUL 3MJ9A 1DEDA 2H9GB 2WWKT 4YDKL 2QDWA 2H6PA 3G6DL 4KK5D 1MCOH 5FDWB 1GL4B 3HG2A 4WJ5A 4JKPH 1R33A 5CJ5A 5HYQB 1RUKL 1XCXA 4OZIB 4HUXA 5FHAH 1C5CH 3U30C 4F8TA 3PRZA 5DRNB 4I77H 3MQIA 4TS6A 4JZNB 2R29A 3VWKC 5C6TH 1X7TA 3CH1B 1QPPA 5GS1B 4MCMA 3IEAA 3BP6A 5JHDA 2Q6WB 4AMWA 3UAJD 4XNAA 1JZJA 3B3IA 3HG4A 5F1NB 1OT4A 4HKJA 5F1IA 2ZOKA 3ZLQC 2YUZA 4N8VA 3HOGA 4YHKL 1IAIM 2UYLB 1Q72L 4RWHA 3DVNA 2FEDC 2W9LA 1AGBB 4Y2OA 2IDCA 3DOSA 5J12C 5SX4I 4JJOA 4MCYA 4YBHA 1N3NB 2NYYD 1LK3L 4YDMA 4LVNC 1R34A 1O5PA 1X5FA 2DLHA 3DGDA 2SEBA 3PYCA 2Y6SC 4RMQA 4BD4A 2YQGA 2TRYA 3BVXA 1FNHA 3NK3A 3ZDXE 3GSXB 1ZMYA 1FSKC 1EFXB 4QD2E 4E2OA 4J39A 1NBQA 2KH2B 1GOFA 3KXFB 1DJHA 4MAYD 4OF0A 3H9HA 2NY4B 5E1AA 3WELA 5FGBA 4PJGF 2UY7A 5DD0L 3V7AG 2E8ZA 3RJDA 5T1KD 4NKMA 2FWOA 3ZIMA 4EOWH 1OV8A 1XZWA 2ZZUT 3HE6C 4I7ZC 5L7XH 3C2AH 3O81A 1AFVL 3BH8A 4MDRA 5G55A 5BQ7A 1H6EA 2JWYA 5DJZA 1U8KB 4KJWD 2VDKB 2A73A 1QTSA 3WTUA 1H9DA 2WXFA 3NACH 5A3IC 1I1CA 3H4HA 1G7MA 2I7SA 4HFUH 2AJVL 5GS0D 4JQVA 3IPBA 1T0PB 3LKRB 5GPRA 1AJ7H 5ESAB 1KT2B 2X6CA 5ANHA 2DL9A 3L48A 1HC1A 3FSVA 3SDYH 4JRYD 3HZKB 5D2NC 1HCZA 3OXRA 2WLZA 3P4LA 2Z9TA 5KVDH 1XGPA 2H2SC 3TESA 3QUMA 2CCVA 1BF5A 2YD2A 3DLQR 3OZ9H 2UX6A 3DJ9A 1XR8B 1BWMA 3GT6A 1J18A 3LAFA 1YYML 1BVKA 2OA9A 4E9QA 4LLVB 4LOVA 5J0BA 3ECQA 4AGNA 4UT7H 1U91A 5IMKA 1IAIH 5EDXA 3SDCA 5DC2A 3ALWA 1ZIAA 4Y1AD 3GHPA 4D0DA 5FYLL 3ASWA 5J5EA 2Z34A 3V4LA 4Z7WF 3E9TA 4NC2B 2GI0A 3TIEA 2Q9OA 3GXTA 4OZGF 1CS6A 2IFFH 4CNIA 3V0WH 3CQPA 3PWPE 4XO3A 4NWTL 4A7VA 3H6JA 4M6AA 3HG1B 3LKQA 3IJEB 4UTAL 5I8OH 3UZVA 1YY9C 5KN5B 1UJ3A 1AGFA 2R2EA 3H42H 1SDAB 1AYOA 4IKJA 1JPSL 3DRTA 3TYFA 4BE5A 2Q2EB 4TULL 3RA7L 1OY3B 4DUWA 1E9OB 4KKPA 4LHQB 4JFZH 1VPOL 4NNPL 2YKKA 3WO4C 3C6LB 3PNWB 4K07A 3WJLA 4AKQA 2BCKB 1CE1L 5IOPA 5DURD 5IMMB 3U6XA 3HNVL 4JRLA 5EU6E 3BUDA 2JKXA 4DFIA 3DMMB 1EDYA 4ALAH 1DVZA 4MMZC 2F53E 2ZUVA 2V4LA 4EI6A 4G82A 3RHWK 3WTVA 2C3HA 1ZLWH 5E6SB 2R0ZH 4JY4B 1TZAA 1BLIA 3BDYL 4FABL 1RHHB 4B5ZA 1NFKA 4HJGA 2PCFB 3NJHA 3WFBH 2AVGA 5I6KA 2PXYA 2XPGA 1NANI 1YNTA 4YEEA 5JPNB 1T4KA 3ESPA 2LFGA 4MJ2A 1CF8L 5FYLD 4ICXA 3MJWA 2QSTA 1VGEH 3FN0H 1ETZB 3GMQA 4BCXA 1CUOA 4KQ4L 4FG0A 3VSUA 4XPBH 1UHVA 2MQCA 4IOSD 3L2LA 3TYGL 2VB5A 3EO9L 2LAGB 4WJKB 3UIZA 5BRZD 4U4BA 2E7DA 3FQTA 1LILA 4D3CH 4PM1A 4ZZKA 2FQDA 1PG7X 4AJYV 3BMVA 4JFTA 5EU6A 3K4AA 2MMXA 2A0LD 1ESOA 3WXVL 4WW2F 2NSXA 5FLUA 4WTZG 2Q86A 3X3GH 1S78C 4MAYA 4G3YH 5DR5L 2QGCA 1YMMA 3KPNA 2CDEB 2K9UA 5F7KC 1S3RA 3S3DB 4OGXH 2EXTA 3E6FB 2WO3B 2CH8A 2ZD0A 3D4ZA 3UJIH 4WEUD 4GAYA 4GSDH 3DX3A 3MBED 5D7KD 3SHSA 4ACPA 1CXHA 5T3ZD 1U8MA 3CC1A 3NZ8A 5AZEH 5BRZB 4KI5F 4N0CC 1FLRH 4F58L 3OF6D 4GAGL 3T9WA 3CSBA 4Q9BA 3U2JA 4XC3H 1BXXA 2DEXX 1E6OH 1E4XL 1PVHA 2XWDA 1VPOH 3ZRSA 2QLVB 1BBDL 4G72B 4V2CB 4LP8A 5C0BA 1FLRL 3WTXA 3EBAA 3A0OA 3N41B 3V9FA 4LRIA 1T66D 5A3ID 3L3JA 3TF4A 1CL7L 1ACYH 3IE9A 2NY1B 4UMSA 3ARTA 2E6PA 4QTHB 4HSCX 1MLCB 2WIIA 3FCGA 3P3TA 3N3EA 3DTXA 3ZBMA 4WHTA 1UD4A 1A0QL 2KMWA 4V1DA 5EOTB 1ED3A 2AI0H 2JKLA 4WKXA 3KPSA 1FO0A 2X3BA 3EYOB 3ZOAA 4A7TA 4APQD 4EZMA 4JFDA 3CHOA 1Q0XH 2TRHA 4FX5A 1BEXA 3HS0C 1YEFH 4JM0A 3RL2A 3WE6A 3B5GA 1KCRH 3G08B 3CFNA 2V5YA 3EXLA 1G6RL 4MNGA 3VGHA 1BQHG 4BK5A 3BUYA 2R0LL 4GG8B 4U1HA 3UERA 5DJXA 4HIJB 1BYOA 3MREB 4E0RB 5D8JL 4MA8H 3N50A 2XQ0A 4R4FL 4QHLB 2WSDA 3EJYC 4QOKB 4B53A 3FF8A 2R9HD 4ZFFB 5BO0D 1XX9C 1P1ZB 3UTSD 4OZGA 2QHRL 3KGRA 4CVXA 1UTDA 3MLVL 3D3VD 4Z7WA 1XF2B 1NBVL 4N8PA 2AK1H 1MRDH 5D93B 3D05A 5BW7C 2CDGA 5IMLB 4G8GD 1E5BA 3T04D 4KK5C 4D8PB 1KXVA 2DEWX 3HZYB 1CU4L 1SF5A 4P9HH 2VN4A 5E8NA 2R27A 5HVHC 1ZANL 5I1HH 4LSPH 3NAAL 5IY5B 4WDIB 4WHDA 4IU3B 3H7LA 2CGZA 2RCSL 3ILEA 3RVVD 3ECBB 1MFCL 3ROLA 4HUVB 1GYUA 3IK2A 1WCBA 3RTQC 1XAUA 2J43A 2J8OA 1H8OA 1MWAH 4NQSB 4D9RD 2Y7QB 3UTSB 3SE9L 1QRNE 2NY7L 2Z93A 3NSJA 5HDQH 2WLMA 4OLXH 3GB7B 6CGTA 4F33A 3RJQB 2R83A 4UQCA 1J8HA 3HZKA 3P54A 1JVOA 3QRGH 5F3HA 3L4TA 3QUXA 2ADJA 3ZKXB 1S5HA 1LNUA 2DYSB 2AJ3A 1TJHH 1AHMA 3UTQB 4GT7A 5IFHH 3WE6B 3FL7A 2HTKC 3FH5A 1MJJB 4N0UA 3Q2CA 3W39A 5GRYA 1TVHB 4O2EB 4Y16C 5DDHB 3MNZA 4PRPD 5L8LB 2B8OT 4OUOA 1GZHA 4PJDB 3W56A 4D0CA 4QF1A 1ZA3B 4KTEH 4BSVA 1W91A 4YHLL 1PZSA 4FCAA 1TUPA 1ZT1B 3JSSA 4URKA 5EO1B 3GXNA 2I60L 3GSNB 3MLTA 3MRIA 2A6JA 1UATA 4P07A 4NFBA 4JRXD 3O2DA 1AIFB 3QORC 4OQTH 4N2BA 4FQXD 3TT1L 3P9LA 5FUCC 3DVIA 3L45A 3SOBL 1M6OA 4R7DB 1FZMB 4A04A 4KNSA 5D1XD 1FI8C 4L1DA 2ZUTA 5D7LD 4FQ1H 2VDQH 4KKBD 4MA7L 3VXTA 3Q13A 3T3MB 2BJMH 5D1ZB 4LQFL 3NRFA 2MHAA 1LK2B 2E9BA 1IBZA 4BZ2H 1LO4H 1L9RA 5TDNB 2BHZA 3ME0A 4GKSB 5EOCH 2KZWA 5KANG 5A1AA 4PR5B 2FB4L 5JPMA 1JK9A 1QSFB 4NQDB 3LQMA 1IV8A 4AVHA 3A47A 5AVZB 2WBWB 4N8VB 1L9NA 25C8H 1AHWC 1NIBA 3ZMEA 1A9EA 3SQRA 1PYWB 5JDSA 5AEAA 5DHXB 4UTAH 2R0WH 1KPRA 4ZW8A 3I9GH 3RVTC 3U7YL 4Z8FL 3O9WB 5FX3A 3P0VL 3ZYZA 4UDTA 2H32B 1EERB 1XQ4A 5DFVC 2X40A 4ADIA 3DV6B 2Y25A 2MOVA 4X83A 1HCYA 3TCXA 2K0RA 4HW6A 4KZ0A 5E99L 4IRJC 2CLRA 4RAVB 3KWTA 5J1AB 3US0A 4KBPA 3DHMA 2CPUA 3ARGC 1NDTA 4M62L 5EBGA 5CR1A 4MQ7B 3BP4B 3PWJB 4HPOH 4RNRA 3RVXC 4ZSOB 4Y89A 1C5DA 5CFAA 3BUTA 2YMOA 4XN2A 3UBXB 1G7PB 2DMBA 4OZHB 1Q72H 2X4PB 2XIDA 3KYKL 1G9HA 2FO4B 4LPCA 2LGNA 4ZUWA 3BKJH 3RX9A 5KSBA 3VG9B 3NCJL 2R15A 1NUFA 1KN2H 2VWEC 5TDNA 4JDTH 2V8LA 4WNJA 2A9NH 2FIKA 4YX2H 3FW6A 1YMMD 1MCRA 4KTGA 3KPMA 3TJHD 4RRPM 5KVGH 3U2IA 1QBBA 4YLQT 2LHAA 4ERSH 4OD3L 2PXYD 2YPLA 5EORH 2FWLB 1Q9OA 3IDJA 4FG6D 3DMMA 1AO7E 3ZZLA 4GG6E 1IVTA 4B0MB 3V8OA 3QQ4A 2Y07L 4EN2A 4I0PA 4ZMOA 3M8OL 3PP3K 4PGBB 4FKEA 4R4BA 3S4SG 3WFEH 2EO9A 1I8IA 2RR3A 1KB5B 4GFXA 1OALA 3FB7B 4FQIH 2YHGA 4B6ZA 2O61A 5IW1A 5C0BD 5IQ9A 3EOBA 4YLCA 4N87A 1HU8A 3GSNA 3KH3A 4KKBC 5EO1A 2YD6A 3TM6A 3V10A 5DD0H 3AMKA 3B37A 3N43F 3JT0A 2QZQA 1KENL 4UB0H 2YXVA 3QH3B 1O6VA 3DX4A 3WLBA 3OKKB 3W39B 1NMAL 4V1DD 1JMZA 4XH2B 2YD7A 4XP6L 4RVBA 3WFCH 4DW2L 4P2RA 2F7OA 3BO8A 4NNXA 3WNMA 4OF8A 3OAYK 4FI8A 2H3NB 2NNAB 2NY2D 1D5MB 3T5WA 2ICEC 4ZSOE 5B39A 1E2WA 3H3KA 1J86A 2NQDA 3EJJX 3MOBH 1ODAA 4JE0A 5KYYA 3GB7A 3QQNA 1J0KA 3ETSA 4ILDA 3L08A 3P4NA 4FLSA 2EDLA 4PJGE 3QZMA 3NCWA 3OLEA 4L3CA 5BOPA 3WL9B 2CWRA 2AP2A 1XZ0B 1OP5K 4JFYA 5LXVA 3QJFB 3MXWL 3NJGA 3TA4D 1AXSA 1FGNH 1CLOL 2AXFA 3QIWD 2J57A 3PDOA 2BSSB 4ONOA 4P46C 3K6DA 4BFEA 3GS7A 3N0PB 5FW8A 2IAMD 4K7PH 2EVHA 4OZFB 1K3IA 1VHPA 3BZ4A 5T5NF 1OF0A 2XYCA 5DHYB 4IMKA 3STBA 3VDBA 3NTCH 2XDHA 3BFOA 2D8KA 2YMXL 1U8KA 4LRNL 4WFGE 4F9PA 4UQ3B 5E2WH 2ZOLB 4BFNA 5HDBF 1RAMA 3HG3A 2OYKA 3QUML 3PWNA 4AT6A 3DI2B 2A9BA 3RIAF 1TEYA 4QY8A 5FO2A 3GD1C 5I1JH 2WMPA 2XICA 3TBWB 1GCFA 3L1FA 4ZW7A 1QLFA 5IHUL 1N6QH 3NGBB 2V17L 5FOBB 3FQNB 3GMPB 1JDCA 3D39A 4WFHD 4JL1A 1I8KA 4PJEB 4KK6D 3QIUA 3O0RL 1U8JA 1G9NH 1UKTA 1UM4H 3AVEA 4LCYB 3RVWD 4IOFD 2OZ4A 4XAKE 4ABVA 5IT2L 5GRZA 5CLYA 2XFGB 3CVDA 2VN6A 1TCMA 2QKIA 5B39B 1K5NA 4Q4IA 2XBTA 1XGYL 2JQZA 1TQCB 1VIWA 2P7TA 5E5RB 4XMUA 1KBBA 2AEPL 4MA7H 3EYVB 2BVUA 2P5EE 4WHTB 1CTMA 1LEIB 2BY3A 3WMQA 5IJVA 4XNXL 1CXFA 5DD6A 3U4KA 2BX5A 3MFFB 4DKFH 2UYLA 3O2DL 4OFIA 3L3DB 2PW2A 2RAMA 3V2AR 4M8QB 5KSBF 3SCMB 3G5ZB 3WU1A 1SOQA 1SXNA 5JYMA 3OJDB 3AXHA 3L3JB 4M9OA 3KZ8A 2I9LB 5K59E 3S3CB 2GK2A 1V3KA 4XE0A 3GRWA 1H3UA 4G6AC 4O02A 1OF2B 3FO1A 4FS0A 5EHFA 2VMJA 3WTTA 1VZGA 2C9RA 4KK6C 3IFNH 4U3CA 5JIMA 2OJEB 1T22A 3B2VL 3I2CH 3TWCL 4TPRL 4D9QD 2Y7MA 4HEPA 1BOGB 4MXWL 4Z3HA 5K1JA 1BVNT 2W88A 2D3NA 3M17B 5I18H 2EZ0D 3GGWB 3FQWA 4NP4H 3UBXG 1PLCA 2IPTL 2W65A 4R5VA 4M7ZC 1C12A 3FQYA 4DTGH 4LHUD 5HP5A 5IK3A 1WD8A 1X4XA 1WAEA 2QKIB 5F7DB 3FO0L 3KH4A 5AW4B 5KOVC 3M88A 3HB3D 1BQLL 3CU1A 2X4OA 2APTA 3BN3B 4NZ8A 5LAXA 1ZLVK 4UU9B 4PJIA 1DQMH 2HP4A 2NRDA 5I71B 4NBZB 3DV4A 3OR6A 5F7LB 4K94C 1PJ9A 3CZUB 5BV7B 2X4PA 5IBTL 3WY4A 2H26A 3ABLB 2DDQL 3V7AE 3C9NA 5L0QB 2VL5B 5BVPH 5CJOL 1E90A 2BPBA 2FK9A 4DH2A 4NJ9H 5DFWH 1FG9C 3L7EB 5DO2C 4QY8B 4POZD 1QSEE 2XCMC 1TF4A 2XZCL 2XU9A 1PY4A 1NCBL 3DX0A 4N8VG 3ZT7A 1NCIA 4ACTA 2BJML 3MUJA 4TL4A 3L13A 3VWKD 1TVDA 2X0UA 4YBQC 1CFVH 1IB5A 2G3XA 2IH1B 3OKYA 3GS4A 4PTUA 2X1OA 1R5WA 4KX8A 5BVJA 5E4OA 1UZ6F 2ZP8A 2VLKE 5AAMA 1P7BA 2MIZA 4FXKA 2Y7SA 5C7XH 4X7DC 3INUL 3FT0A 4MCNA 4YDZA 2CUIA 3NDZE 2BZDA 1YEKH 1Y6MR 3U30B 5BXFA 1MCJA 4NWUL 3QWNA 4AJWA 5B7FA 4H13C 3BAEH 1PX4A 3FONB 4OM0H 3V0EA 4CN4A 2BHYA 2BVYA 1BX2A 5BOZG 3STZB 2GJZA 2FGWL 1I9RH 4Z3IA 1A6TA 2EDNA 2JSFA 1IBHA 2K7PA 2AJXH 5C2BH 4L9DA 4FFZL 4BHUI 3BQUC 1GY1A 3FU9A 4KX9A 1FVCA 1CICD 1YA5A 5FGCB 4N2HA 4A7QA 3BCDA 3MV8A 4A1RA 1EBPA 1E67A 2PYEE 5ECGA 2VDMB 3TGXA 3G5ZA 3N2JA 3ARGD 1Z5LA 5IG7B 3JXAA 2X87A 2AABH 4M8RA 4YVUA 4XT1C 2A6JB 1HKFA 1NC4A 4HU2A 3FTXA 4PBWD 1A7OH 1NOFA 2WBJC 4WTQA 4Z3EA 5IHWA 2XWJA 3QJHB 4UNUA 2F74B 4G7VL 4BA0A 3FQRA 4QRPE 1ZV9A 1F42A 3QXDB 1MFCH 3UJJH 5ICYA 4PJDA 4NT6A 5E8EB 1MSPA 2BM3A 4MJID 5FCSH 4ZNEE 1PZ5A 2Q76B 3Q8BA 2XSKA 1T1YA 3DDFA 3V8CA 2B1AH 1UT1A 2EECA 3PV7A 1NJ9A 1U2CA 1S5HB 1BM7A 3MROB 4M56A 2ZOOA 3VFNA 2GTZA 4H8PA 3VQ1C 3R0NA 5CWSB 3VSTA 4R5XA 3DI3B 3L2NA 1ASOA 1JJUA 1SDYA 5DRZB 1SMDA 3GSWA 1X7SA 5HSFA 5DUMH 3KDPB 3MLXH 4KRLB 4RFEA 3VXUD 4AOFA 5MHSE 4DP9X 5GJSL 5DD1L 1GGBL 1MCIA 1DLFH 2DKMA 3OKNA 4ZPTA 4HAFA 5FO8B 5GS2H 3RVTD 1I3RB 4K9EH 2W38A 3IKKA 3SOTA 1XR9B 1A1OB 1RVFH 3DUSB 2DRUA 1SBBA 4NJAL 4JO5A 5ICZA 2OSXA 3QHFL 4M6ML 4PV8A 2VJ8A 4PRID 5J06A 2CLRB 5CZKA 2FZ3B 4YAQA 3IU3A 5CD5D 2PETA 2MFNA 1KY6A 1JOIA 3CPUA 4NAQA 4ZOAA 3H9HB 4F15B 5MHSD 4ZFOB 3RWHB 4CRPA 3KXFA 3NQIA 1A0QH 4AQAA 3F8UB 4G8GE 4NIYE 3RDTC 4UDTB 1T1ZA 1NCAL 4OZGB 3QDHA 1GW0A 1AVAA 1D6VL 3VTMA 4OQ1A 2CKBH 2XG5B 1VZHA 3EOTL 4JPWH 2FNBA 3TO4D 4DP8X 1G87A 4EUPB 4FMKA 2BERA 2WWMD 4HIJA 3NFPA 4Q9QL 5AOIA 2VDKH 4LASH 2OS7A 2IBBA 2EIEA 1LO0L 3P02A 3W37A 4MD5A 4TSAL 5ISZB 3QIWC 5T1LB 2QBWA 5JIDA 3DOSB 5D5MF 4FADA 2NY5H 4LB8A 3DDGA 5E1HB 2QQNH 4AKOA 2X6VA 1OGAB 3A23A 1CE1H 4J3OH 3PJSA 1LM8V 2HWZL 5FGSA 4JRWA 5C08B 5K9QI 2J6EA 2R29L 4P4RA 2XACC 1ET8A 1SDDA 2XOTA 1RURL 3L4UA 4BCZA 3GF8A 5GGVL 4GB9A 2Y7LA 4O00A 5A7EA 4E9LA 3HC3L 2YGQA 1D7BA 3H55A 4WI0A 2WIMA 3HNTL 4YQXL 2VYRE 3V9EA 2AGJH 4UIKH 3M46A 3WUWA 4Z3JA 3MO1A 3QQ4B 3MJ6A 1RIUH 3AS0A 2JJVA 4NN6B 4P4RB 1OHZA 1OGPA 4YUEH 1QBMH 5KUMA 2G0LA 3E7JA 3IMSA 4MAZA 4XXDA 4BM7A 4X5QA 2YO3A 5SWSD 1NKOA 2BNUA 2Z0UA 1Q1JL 3I6LD 1SHSA 3RUGA 3RWGA 3CC5B 4JRFA 3TYGH 3VD2A 4HZ1A 3SKJL 2ZNWA 4OJAA 1JYXA 3CDGA 3BD5A 3N9GL 4QO1B 3LEVL 4U6XA 4YBQD 2ZXDA 1F8TH 1H5BA 2IV9A 1OGTB 1AXIB 1JTOA 3L5HA 1YEDB 3CFQA 1G0DA 1PLBA 1IMHC 5GIRA 2WQAA 5CGMA 5ADOH 5DLLA 2BXYA 4NM8H 1QFHA 2YQ3A 4WWKA 5EF1A 3SDXF 2HVBA 4OF7A 4QRRD 2ZKWA 7PAZA 5IQNA 3BZDA 3D6GA 3QFJB 2IWKA 3QUXC 4PRHD 4XHJC 3RLSA 2D2CC 4W9ZA 1UH2A 1JN6A 4JG1L 1SLXA 2UZPA 3IF1B 4NZRL 4HZLA 3U46A 4NBYB 3V0JA 5LWYH 2LU3A 5JA9A 1WAAE 5J9PB 2B1HH 4DQOH 2WQ8A 3JT2A 4D3CL 1IAKA 2VC2B 2HRGA 1UKQA 1UZGA 4JO2L 2E9IA 3G7TA 1EK3A 4MZIA 4C4BA 1U3NA 2VDOL 3MNVB 1TLKA 4CILA 1IGTA 3QNYA 5IESH 1XXFC 1JPFB 3T3ME 5C6TL 1WTGT 1JF6A 2BNRA 2CKBA 3VX1A 1T03L 2AABL 5E9DE 2AXHA 2OFQA 1C08B 4IEFB 2DV6A 4KRPC 1VERA 2ZX8A 4GMSH 1RZFH 3LN5A 4GRMA 3FTYA 4O51A 4AXWB 5AVRB 1T5WB 4GINA 3L6FA 1IGYB 1EEUA 1Y6NR 2VLRD 5C9KA 3EOYG 5CKAA 3S88L 3VD0A 5KS9A 1F58H 4XNUL 1T0OA 4H40A 5F1SA 4L9LA 3QZNA 1RCYA 5F7NC 5IMMA 3VD5A 1BVZA 5AWNL 1X5AA 3RL2B 2FYYB 5GRWA 2UZYB 4IRSC 1JHKH 2B5IB 4HBCH 4OGZA 1KYDA 5E6IB 4ZFZA 3KM2A 1S78D 4NPYB 3SBRA 5FO7B 2HLEB 2R2EB 5L4FA 2VR8A 2AVFA 2EINB 1JGEB 1A3QA 4LGRB 3RKDD 4XPTH 3GTVA 3ARVA 5AZ2L 3QO0B 4OZGE 3V6FA 3PFQA 5L0QC 4TL5A 1AE6L 4RLDA 3PPEA 3PP4H 4OFPA 3LMJL 5BUGA 3MRCA 1ORSB 2WCGA 4OKVB 4IJ3B 2MNJB 3D3VB 3LNFA 3B7YA 4JB9L 4PCTA 4IGBA 5ESQA 3RGVD 5IJKC 3MKKA 5KVMC 2K3HA 3DPBB 2IOIA 4HOXA 3KYMB 4FYQA 3GKWL 1XB8A 1PZCA 3FU7A 2AQNA 5I18L 4ZMLA 4HSAC 4X99B 1OWRM 1UEYA 1JCVA 1UWFA 2ZKHH 4PGEB 5D93C 3TNMA 5A2JH 5E2TL 3T0EA 1GGYA 2JJTC 3UC0L 3QJSB 4GQQA 3KDMA 1DVTA 4BKLA 1U3YA 3PWLA 4LL1A 1CXEA 3RWEA 4PGJA 4U1GC 3DGCR 3IMRA 4M3HA 1B9ZA 1MAMH 2IAAC 1JTPA 1CLYL 1I8LC 3N85H 1BQ5A 2YPVA 2A4CA 3DK0A 1E5YA 1CFQA 3MV9B 4N68A 4YMPA 3U4BL 2E86A 4AZ8A 2R2HB 5GGQL 1BREA 1ID5I 5E2WL 5A2BA 2XHNA 1VGKB 1G7QA 3MLYL 2AEPH 4DTGL 1QZ1A 4YE0A 3UX9B 2J1KA 3KGSA 1II4E 2G9HA 2VDRB 4PG9B 1C16A 2GVYA 2EE2A 2YAPA 4QWWC 1PDKA 3ET9F 2FHFA 4X7CC 2PP9A 1DR9A 2X2UA 2OZ4L 1OZUA 1QWNA 1JGLL 4DN4L 2HT4D 4AE0A 4DKTA 1MF2H 5I76B 1CYGA 4N0YH 2QSCH 5IWLA 3GBEA 4IBWA 2B0SL 2Y5QA 5FKAA 2LFEA 2I26N 1SEBA 1L0PA 4P5KA 3MJ8B 2F8OA 3H2PA 4RMTA 1JDAA 1RJZA 1A6UH 2OL3L 1RHHA 3VGEA 3TT3L 2YQBA 2EH7H 3FFOA 3D4GA 4JUTA 5JOFB 2DQIH 3V4UH 1QI4A 4OCLC 2FRGP 3I3EA 5HGHA 3K1DA 3NA9L 4TOYL 1OANA 2E7CA 3GGWA 3V0HA 3S96B 3OHXB 1V05A 1DANU 1JVLA 3REWA 1H3VA 1MLCA 3AFLA 2WIIB 4KQ0A 4G8IB 4QTHA 1L9QA 3TNNB 3UAEA 5I1CH 5I66B 1BPVA 4HKJB 3B83A 3KWVA 5IT2H 5DJ2B 2YD3A 1SY6H 2OCFD 3BT2L 5HYJE 1C1EH 4XAKD 4O2CB 4I1PA 1P2CB 2Z31B 3I02A 3VFWA 3T3PB 2I32A 2QPSA 1JGLH 1PKQE 1VFMA 3B9KB 3S8FB 1FN4B 2PXYC 2DI7A 4QHNB 4K23H 1E43A 4GKLA 4XOCA 1KXTB 4X9FA 3MLZL 5GHWL 5IVXF 2YEZA 2VLJB 3CMOL 4NYLB 3S48A 3R8BB 5AVTB 1OEZW 4CUCA 3MFGB 4F3FB 3TO2B 3VE0A 1JGVH 5B1JC 1Y0LA 4YR6B 5FWQA 3OKLB 2GSGB 3F6LA 3CFDB 4OTXL 1T2JA 5GGQH 1IJ9A 2WXPA 3M07A 4ZPVB 5B4MC 4LCCB 2FSDA 3V5KA 2ZSVB 4Z7OE 3PGFL 1TYJA 1HNGA 4X7FC 5C9JA 1WVZA 3PV6B 5CJOH 4OAWB 4OZHF 3DJRA 2MKWA 5FOBA 1MI5D 2QV2A 2WQWA 5T1KA 4CMMA 1XHHA 3APCA 3PGCB 4UMGA 4BFOA 2P8PB 4F9PC 3FCSA 5SWQA 1GGCH 1AY1H 1J1XL 1RIHL 4TRPL 4EZJA 4U1KA 3HG1D 4WK0B 2A99A 4LEXH 4U7SA 4WI4A 1N18A 1HOCB 3A4EA 1CXLA 2CXKA 1HXMA 1C16B 2C1PB 5TE6L 1P7HL 3RX5A 2Q87A 5MEQB 3Q2NA 3BYYA 3DECA 1H3PL 1HSBB 3STLB 4L2YA 4TRPH 3AU1B 1F2QA 3HE7B 5BZZA 3A6CH 3S5LG 5I28A 1OE1A 2VXVH 1F1GA 3PDOB 3V4VH 1GC1L 2H32H 4G11A 5ACZB 3MOQA 3LRSB 4Q6IC 5IQ7L 4HKZB 1CFNB 1NEZG 3QNFA 4N0YL 4MYWB 4YDJB 3RVWC 3RZCD 4WHYG 4H88H 2XZAL 5EBWA 1VDGA 2D0FA 4NHUA 3VU2A 5JHDD 3J8F7 2C1OB 3NESA 4KKAC 1RZKC 1QSVA 4DK6A 1Q9KA 3QW9A 2FJHB 5AVYB 3KDMB 5HYSG 3QQ3B 4JFVA 3BRGC 3EZ8A 3HPLA 5FO9B 3T0EB 1T21B 4HUWA 4Y88A 1TITA 4LK4A 2DIEA 5IEKB 4PJAF 1F4WL 4RRPA 1KPVB 3SPGA 2MOQA 3NIDF 4TVPD 3GDCA 3B2DC 5EORL 3CNKA 2DF3A 1BXAA 3JBG<