4CSPA

Structure of the f306c mutant of nitrite reductase from achromobacter xylosoxidans
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEACELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Impact of Residues Remote from the Catalytic Centre on Enzyme Catalysis of Copper Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 91
structure length 335
sequence length 335
chains with identical sequence F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2014-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cspA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cspA02
4QLWA 4BDVA 1A4CA 3NSDA 4PAZA 4DPAX 1A65A 3CG8A 1YLBB 4DPCX 3NSCA 1L9QA 2IWKA 1NIFA 4HAKA 2YAQA 2W8CA 2UX7A 1BQRA 2EINB 2OCCB 1IKOP 1OCOB 3H4FA 4YSQA 1GS7A 4YSUA 3T6XA 1E30A 3PAZA 3JT2A 1N68A 5I6LA 4CSZA 2IDUA 2TSBA 5LDUA 1HAUA 1KDJA 3NSYA 4YVNA 2MTAA 8PAZA 2QPDB 1ZDSA 3FU8A 4G70B 5I6NA 3DKHA 2OV0A 1NIEA 4KNUA 1J9RA 5I5MA 2IAAC 4G7SB 5B1BB 2AZUA 2E86A 3SQRA 3T71A 2FT6A 4YSRA 5B3SB 2N0MA 3FYEB 4E9TA 1J9TA 4FA7B 4GXFA 1AQ8A 4E9XA 1J9SA 3AG2B 3CZUB 1GW0A 3L45A 5D4HA 3OQRA 1ET7A 2YAHA 3JTBA 3GYRA 2FQDA 2EIKB 1OF0A 4E9YA 1W6LA 2ZXWB 2R7EB 4HHGA 5B1JC 3WNIA 1HFUA 4ENZA 2B3IA 3QPKA 5B7EA 5E9NA 1BQ5A 1M56B 3EH5B 3AG4B 4HALA 1AG0A 1A8ZA 1FFTB 1RZQA 2HZHA 1BAWA 2AANA 4YSDA 2BWDA 4BWTA 1BYOA 2H5UA 3N55A 5D4JA 2VN3A 4KO6A 3QJVB 3T9WA 1AOZA 4G7RB 2PLTA 3S3DB 2IDQA 2IWFA 4BDVB 1W6WA 2VW6A 1XB3A 3ZX1A 1ZIAA 4L0PB 2QDWA 3NP4A 1BXAA 1GY2A 3V9EA 1JZHA 2HX8A 2HX9A 1OV8A 3FPXA 2IH9A 2AVFA 2CBPA 2VW7A 4YSPA 5F7AA 3EF4A 2IDSA 3BVDB 3ZIYA 2FWLB 1OE1A 4UF7C 4FAAB 3CVDA 1V54B 1WS7A 2Y1AA 4AZUA 4A2HA 2XWZA 1URIA 1IBZA 2PPEA 4GYBA 3EH3B 5FC9A 3NYKA 4GP4B 2Y69B 5TK2A 4YL4A 2BW4A 3S3BB 1JZEA 4GP8B 4N8UA 7PCYA 5B1AB 1FA4A 4AKOA 4YSEA 3X1FA 1JXFA 3H56A 3AG1B 3UAEA 3ZDWA 1SF3A 2EILB 5AZUA 1V10A 1J9QA 2X88A 1AZNA 3WIAA 2FT8A 2OJ1A 2XV2A 4QKTA 1ETJA 4NB7A 2EIJB 2LLNA 2YXVA 4F2EA 1SDDB 2R7EA 1SHWA 1PY0A 4E9SA 5B1JA 1EZLA 2GC4C 2PPAA 2TSAA 3GDCA 1AR1B 1N70A 3X1NA 4KNTA 3OMIB 3X1GA 1BXVA 1HAWA 4A67A 2PP9A 2BWIA 2YAOA 3D12B 1JZFA 1NIDA 4AX3A 2WSDA 5I28A 1E67A 2BZ7A 1CUOA 4MFHA 3FS9A 3AY2A 4W1TA 2FQEA 3NJIA 3S8GB 1MZYA 9PCYA 3NJFA 1ILSA 2MRYA 1GYCA 4NERA 4JHVA 1PZAA 1WA0X 5I6OA 3TA4D 5D4IA 1KBWA 4N4YB 4ZK8A 4A66A 3WNJA 4F2FA 1WA1X 1L9TA 1PMYA 4WTQA 1OCZB 4A2DA 1AS6A 5A7EA 3AW5A 1AZBA 3ABGA 2HRHA 1T5KA 1M9WA 3AZUA 3C75A 3PPSA 3SBRA 1I53A 2QPEB 1XB6A 2WO2B 1ASOA 1AS8A 3OD3A 3NJNA 1R1CA 1BQKA 1IC0A 1ID2A 1E65A 2HXAA 3QJQB 1PNCA 1B3IA 2W88A 3TASA 1JVLA 3BQVA 4HZ1A 3NP3A 4WKXA 2DWTA 2WO3B 2J5WA 2HX7A 1SDDA 4AKPA 3SBPA 2GC7C 2VM4A 4JHUA 3OMNB 3NJJA 3NJKA 1PF3A 1SHXA 1ZPUA 4YVUA 1CURA 1A3ZA 3FSZA 5PAZA 4YSSA 4YSCA 4K9JA 3UAAA 3X1EA 2BHFA 3CDZB 1F56A 4YSOA 4KOCA 4Q8BA 3WKQA 4DP8X 4G7QB 2J56A 1JZJA 7PAZA 3FSAA 2IH8A 2DY2A 4G71B 2JXMA 1NIAA 3H4HA 3IN2A 4E9WA 3FQ1A 5I6PA 2DWSA 1NINA 1AAJA 3T6ZA 2FTAA 3IEAA 2XVBA 3IN0A 4W9ZA 2AZAA 2QT6A 1ZV2A 2DYSB 3HB3B 3X1BA 4GY4A 1TEFA 1AZRA 3FU9A 3MX0B 1X9UA 3OM3B 2VSKB 4AKQA 2PPCA 3NJHA 4TXVB 2J55A 4P5SA 2GHZA 1KDIA 1SNRA 1SFHA 2YAEA 1FWXA 2FJSA 3ABLB 1KV7A 2RACA 2ZONA 3S3CB 1SF5A 1PLCA 2XLLA 3OMAB 3FSWA 2XU9A 1L9OA 3X2QB 2FNWA 1NPNA 1OCCB 1WS8A 1JZGA 1RZPA 2HRGA 2UXGA 2XX0A 4X4KA 3GXUB 3UACA 3QQXA 1NWPA 3CDZA 1NDTA 2UXVA 4KO5A 3ASOB 1V55B 1NICA 3UADA 2BP0B 2ZOOA 3HEIB 2VM3A 2Q9OA 5EHFA 4E9RA 1NIBA 1MDAA 2UXFA 3RYMA 3QJTB 2XV3A 1RKRA 1L9PA 1AZUA 1BEXA 1CC3A 1MG2C 4G72B 3CVBA 3FQYA 4DP2X 1BXUA 2CAKA 3FT0A 4Q89A 1A4BA 2BP8B 5B1KA 2IDFA 1KYAA 1EHKB 1ET5A 2P80A 3FU7B 3N2JA 3SBQA 4M3HA 1CYXA 3QJSB 3ABMB 1JOIA 1OCRB 2FT7A 1E5ZA 4P5RA 3WG7B 1JERA 2X87A 2XXFA 2UX6A 3NJLA 1PNDA 4HCIA 3ABKB 3TU6A 4E9VA 1ZIBA 2QDVA 4NAJA 2GBAA 2J57A 3G5WA 3MBWB 1CYWA 5I5JA 1GR7A 1PLAA 1AIZA 2YARA 1A4AA 5I5IA 2I85A 2IDTA 1RCYA 5TK4A 2JFCA 2PPFA 3UABA 3NJGA 2EIMB 2P80D 1NPJA 2BZCA 4PCYA 1TEGA 1QNIA 1IBYA 1GS6X 1TU2A 1XB8A 1MZZA 1OOWA 3T6WA 4E9QA 3ASNB 4BWWA 1JZIA 3PXLA 3TBBA 3V9CA 4EF3A 2I7SA 1DYZA 2XXGA 2BO0A 4BXSV 4DP7X 4BXVA 1OE2A 1IUZA 3TBCA 2JKWA 4DP9X 1ET8A 2AFNA 2XUWA 3EH4B 2YAFA 1PZCA 3FYIB 4RH4A 1ZDQA 2H47C 3U25A 2H3XC 4HCFA 4HCGA 5F7BA 2BP0A 2CJ3A 3S8FB 1AACA 4KO9A 3QJUB 1NZRA 4DP6X 2VMJA 1ASPA 2Q5BA 2CUAA 3PAVA 2GIMA 1AS7A 2BP8A 2CALA 2PCYA 4A2EA 1UATA 1AANA 1KBVA 2PP7A 2GSMB 2YQBA 1WAEA 3FU7A 1KCBA 5PCYA 1QLEB 4DP5X 2VW4A 1JXDA 1X9RA 2YAMA 3PCYA 3IBOA 4A68A 1OE3A 4KO7A 1KCWA 1PAZA 6PAZA 3UGEA 1PLBA 1GS8A 2GB2A 4YSAA 4CSPA 2PP8A 1SJMA 2YXWA 5I6KA 4JKNA 4M4RB 4HHWA 3IE9A 2HLEB 4UANA 1PZBA 1KGYE 1JVOA 4DPBX 2FQGA 1VLXA 4DP4X 2A3TA 2UXTA 1M57B 4HIPA 4GP5B 1WA2X 3CVCA 4YSTA 5IY5B 3PAUA 1L9RA 2FQFA 5B7MA 1BYPA 2GI0A 2PPDA 1ILUA 3QJRB 1NTDA 3WI9A 2PCFA 1TKWA 3WKPA 3NJMA 3KW8A 3ZBMA 1L9SA 4DP1X 4UAHA 4DP0X 1QHQA 1NWOA 4KOBA 3FQ2A 2IWEA 3KW7A 1J5DA 2DYRB 1GSKA 1AG6A 2I7OA 2YAPA 2B08A 4BK5C 1AZCA 6PCYA 1XMEB 2BW5A 1SFDA 5I6MA 3PLYA 1MG3C 2NRDA 2DV6A 3T6VA 5I26A 4BWUA 1JXGA 1ASQA 4A2FA 3EHBB 3FPYA 4F7KA 2VSMB 5B7FA 3DTUB 2XX1A 1GY1A 2ZWNA 3DIVA 3ERXA 2XV0A 1DZ0A 1PCSA 3NSFA 5AFAA 1E5YA 3NT0A 4KNSA 4A2GA 3FSVA 4AI7A 2XYBA 1W8EA 3AG3B 5AKRA 5ANHA 1ADWA 1J5CA 2CCWA
chains in the Genus database with same CATH superfamily
3NZSA 4M3JA 1F4WH 4WJ5B 4V33A 1VZHA 1A2YA 1A65A 3FTZA 4M4RA 1C1EL 2G9KA 1HWHB 3GEFA 4HAKA 3QBTB 4JKPL 3QUHA 2FJHB 3KXFE 5AOJA 2R0WL 5F1NA 1NCDL 5DS8A 4LBEA 4L2YA 1OPOA 4YSUA 4IGBC 1E28B 1KTDA 1MNUL 1U8OA 2A1WH 5IP4A 3H7LA 4LLMA 2DM2A 1DJGA 1A9BB 3EGXB 2QQLL 3MRNA 1JFHA 2OXHB 1G1KA 4PMFA 4FXGB 3VJ6A 4IOSA 1Z9LA 1CLOL 4M8QB 3S37H 3WXWH 4OV5A 4LB8A 4OT1L 1Y7VA 5H37A 4QRPD 2Q86B 4G7VH 3VE0A 3D2TA 2Z93A 3CQFA 3KHOA 3U46A 2X0WA 1OD9A 3FO0H 4KROB 5G4OA 1XGYL 3ZKNC 2W0KA 3D2UB 2NOYA 4MB5A 4TQHA 1J1OH 1F1GA 1ZY9A 3T2PA 4YR6A 5K9KB 2LTQC 4WDIB 3G5ZB 1MJ8H 3SD2A 1T7VA 1KJMB 2IV8A 4OGAC 4BFFA 4Y2DC 4TM9A 1FHNA 3F7YB 3IJEB 3KXFA 1YDPA 2HG5B 2GEEA 2JVUA 1UA3A 3E8UL 1MCDA 4JL2A 5A43C 5MENB 2HFTA 1FL3B 2D7NA 1HIMH 4UTAA 3ZYIA 3PHQA 5F7MC 5SWSD 4YHPA 5AW1B 2VLKE 3FT2B 2MEJB 3DRQB 5AOLA 5E2UH 4FLQA 1X7SA 2H32H 5EB9A 4G82A 2K1MA 3LEYH 2ZSVB 3QAZB 2J1YA 1RIUH 4GI9A 3LVEA 5DZ9A 2FR4B 4YFDB 1O5PA 2R29A 3HN3A 4OH2A 3N3EA 4Z7NE 3VXRD 1MLBA 5F89B 1IBHA 2EEDA 5C0NC 4ZAKB 1KY7A 3UCRA 1LILA 1PIFA 4QCIB 3IJ7A 3M45A 2BM3A 4JREB 4Y4FC 1I7TB 4YLQT 4FGMA 3UTSB 1GC1C 1WG3A 3DOSB 4JPIB 1P53A 3NFPB 3TNMA 3D3VB 1OTTD 4ZX3A 3O4OB 2CMRL 3H1ZA 3O2VH 1FL5B 4P59L 2WYTA 4V11A 3WDHA 4R96B 2E6JA 4U1SB 5HDWA 2W65A 2BW4A 4N2DA 3HZVA 3IJ9A 1XEDA 3P0VL 1TQUA 3QQNA 5JUEH 2KZKA 3SKOA 4CJ0A 2OZNA 1TO5A 1LWJA 4WO0A 3DMMC 2D31B 3QT2A 3Q3GB 4EN3B 4FKHA 5L7XH 1WC7B 2EILB 4CVXA 3IDJA 2ZXAA 4S0HA 5D96C 4M62H 2F8XC 3UC0H 5ANME 4FXKA 4ELDA 2VLKA 3TZVC 2GSIA 5I0ZA 1I85A 4X6EB 1HYSD 3RUGB 5IGXH 5E56A 2BS9A 5HYEA 5J7CC 2VABB 1XL4A 3P9WB 4MS6A 3E6FA 4OF0A 2GC4C 5CP7B 4YQXH 5SX5K 5JNYB 4B9JA 1PZDA 1YVLA 4CC4A 2VXQA 3QSKB 3R4DA 4PRHB 1KZYA 1T22A 3QHTC 3VXNB 2QZQA 3L3OA 4C4KO 3FHEA 3SO5A 3IRPX 1NIDA 3JV4B 4I5BA 2WSDA 2WXOA 4Z8FL 4CGUB 1M7IB 1KPVA 1QATA 4MFHA 2OMXB 3B9KB 3LS5L 1WBYB 1ZVYA 5F8RC 2EC9U 2E7DA 1KCUH 1Q9OB 3LPFA 4OF8A 4YWGL 2R69H 2EZ0D 3RWHB 4FQ1L 5BVJB 3U2SB 3LH8A 1NBYB 5I1HL 1CTMA 5DJ8A 3K6SA 2HYMA 4IBVA 3B2MA 4JHVA 2GYSA 3NFNB 1TJGL 1I9JL 5D7JD 3TA4D 1RK1B 4M6AA 4X5LA 2VDKL 1NC2B 3MODH 1YMME 1DUYB 4U1GB 1H5BA 3B1TA 4OQ1A 4AE0A 5HHOB 3S5ZA 1D9KD 3HZMA 2R8SH 3SGJA 4ZXBC 3QIBD 3LJ3A 4ZTEA 4AYEC 2XZZA 5ANMA 2V9TA 2VOTA 2VC2H 2IJ0C 3UZVB 4FERA 4L05A 5T3ZE 1C08A 1W8OA 2P28B 1ZK5A 3EO0B 3QR0A 3SO3C 3NABL 1H8OA 35C8L 5CEXB 3ZN6A 2WGNB 3CFDB 5DT1L 5BO1H 1I53A 4LARL 2Q7AA 4H0GA 4QT5B 2WMPB 1ACCA 1AI1H 3EGDB 3VD7A 4GH7B 4XO5A 3MRGA 4OZIE 1MRFH 2HWZL 1JVLA 2ALWA 5D2LA 4RZCB 1YNKH 2B1AH 2WXKA 3VSTA 1RIVH 3SE8H 3V0HA 4JMXA 1SDDA 3SHSA 2GC7C 4AYDC 3D25B 1S9VA 1CT8B 4LCCC 1JF1B 1CXLA 5FYLD 2ZUVA 3IETA 3S88H 3WNMA 4OJEH 1ZJBA 3V5DA 1YMMA 4XX1E 5DWUH 4YLCA 2VQ4A 4YHZL 4TLKA 2AABL 3ZSTA 1O6VA 2R27A 4LHUB 4Q9QH 2QQQA 2P5WD 3CZNA 3MCLL 3NG5A 4ZS6C 2F9BT 4P48A 3LNHA 5EEWA 2UZYA 3D5OF 2XPZA 2QZ5A 5GRUH 4EKJA 5JW3H 2QT6A 4NJAH 3MBEA 3KL5A 3MRMA 5TQ0H 3BUYB 4GW5A 3TFBA 1W0WA 5T1KA 5TGBA 4OZIA 3MUZ1 1GYVA 5CIPA 5K59F 4TTGA 3OKOA 3DYPA 4CILA 3O2WH 5ICZB 4RFNB 2WAHA 4PLKC 4XXWA 4M29A 3SY0B 4X7FC 2ZCHH 1J10A 3MUJA 4GIPD 3ZE1B 4UM9B 4ONHA 4WTZA 5EUKA 1KLGB 3ZE1F 1XGQB 4MD4B 1BQHG 3T0VA 4ODWB 1IE5A 3S9DB 3WMQA 3MV9B 4B5ZA 2DWDB 4XE5B 2XI9A 1AIFA 2DWEB 3S3CB 3VU2A 3ZQXA 1SHSA 2HFGH 3LHPH 1LO4H 2ID5A 2FAUA 4OGYL 4TUJA 4CU7A 2R2HB 1HNGA 3QI9C 3X2QB 1LK2A 4MA8H 3NIGB 1MHHB 4HS6B 1TCRB 3E7JA 2GFBB 3J27A 3NIGF 1KCRL 4X6DB 5DUPH 1MHCB 3P02A 4X6DF 2HJKB 4NQDD 4QMEA 2MQGA 4JRXA 4ZO8A 4ZMAT 2Q3AA 4QJ5B 4DO4A 3VRJB 4CVZB 2Q9OA 5F9AC 4LEXL 1NIBA 4PS4H 2OMWB 2VM9A 2WWNA 4F7PA 2MQCA 2H6OA 3QHZL 4I3SH 1WZMA 4BFJA 2X70A 1ZV9A 2DQ6A 2BP8B 1OSZB 4PM1A 1O6SB 1ET5A 4FNQA 3EGSA 2X41A 1BYNA 4JCMA 1E9PB 3L5IA 4YE4H 1HEJC 4TV3A 4KY1L 4U6HA 2Y36L 1E5ZA 3WG7B 3CFKA 4MJJA 1JERA 3ZDZE 5EOQH 1NMBH 3B34A 3V6OE 5DJYA 4F37K 1B9KA 4NAJA 1JNNH 4QXUL 4A6YA 2Y1YA 2X53A 1IGMH 2PYFB 2NY3C 5C0EB 4NZ8A 3IGUA 3JXAA 4QTFA 1REIA 3IGAA 4M8UA 4Y5XC 5JHLH 4XOCA 2CJUL 2PPFA 4GKLA 3UABA 3HZ3A 3FRUA 3HRZA 1T80A 2P80D 1NPJA 1R3JA 5C0CB 4NKIL 2W60A 4NUGL 3A21A 4QHLA 3VXUD 4E5XB 1GS6X 1I1FA 5K93A 1I9RH 1TU2A 1VFAB 3FKUS 3NZ8A 3WTWA 1QACA 3HNTH 1CFQB 3TBBA 2BIHA 3NPSB 4GAJH 1M6OB 5KVDH 2PWGA 3SPCA 2CKNA 4MMYB 1RZIB 1HHGA 2Z7WA 5E94A 4GKSA 2Z0UA 3T1WA 2GG1A 4CADB 1P9MC 3VW3H 2BY0A 3GT6A 4ELME 1ADQL 1MFUA 3FYIB 3KDPB 4JFZL 3K81A 4BK5A 4HWUA 4MZ3A 4YDVA 3ZVVA 3TEWA 4XNAA 2YQ2A 4OZFH 3SQBB 5LWYL 4IS6A 2VZ1A 2CKBH 4NC0B 4KJYB 4AEHH 1X6NA 2YRZA 1ACYL 5I71C 1NZRA 5D2NE 2ZF9A 5IJDC 3V6OA 4IRJA 1I8IB 2OBGA 1A7RL 2PABA 4KQ3H 4QYOB 4ZTPL 5M94B 2XQYA 2O6DA 3D09A 2O6PA 5F6HI 4LP4A 2GIMA 1T6WA 2CALA 3PXHA 4HLEA 5BV7L 1UATA 4XPFH 3DARA 4TMPA 2LU3A 1X7QB 4EI5C 4JM4L 1I75A 2QMKA 1QI4A 3C6LD 1JGEB 2BSBA 3ECQA 1JGDB 1NCBH 4YDMA 5E4AA 3M7FB 4UOQA 4WI0B 6PAZA 3X17A 1BZ7B 1JRHL 4V2BA 4M7KL 1IE4A 2OTPA 1UKTA 5FW8A 5AZEL 3P4LA 4KXZH 5D93C 5J06A 1B0GB 3GSOB 4IMLA 3MA9L 1VFBA 5I2IB 5JDJA 5D71L 5M7QA 3ETTA 4AE1A 5DJDB 2Q6WA 3ATDA 2O5YH 1P5UA 3LN4A 3ZYJA 2A3TA 4ALAC 2BC4A 5DCCA 5BS0B 4S2SB 4JN1L 2H26A 4H8WL 4XCYB 3RY5A 1JDCA 4LAQL 2ZUWA 5B7MA 2X1PA 4LESA 2JJSC 3O11B 4Y4FB 3KW8A 4XMVA 4J8RA 5D2NA 5IQOA 4UT9H 2CBMA 4Z0BL 5FOJA 2L0DA 3BQUA 2E7LC 3QNYA 5AAWC 1T1WA 1QHQA 3FB8A 1BPVA 4UTBL 1MWAH 4FZEH 1J8HE 2WLLB 1KZQA 4WNJA 2XN2A 4TLTA 5F0LB 2BINA 4X9BA 4N6RA 2CGZA 2I7OA 3RL1A 4FI7A 5GGRY 1LNUA 2XPGA 2BW5A 1TJIH 3IJHA 2HT4D 3VDAA 5KOMC 1BZEA 2PW1B 1FE8H 1LEKA 3EFDL 1A5FH 2NQDA 3M8OH 1IRAY 1BOGB 4R2GD 2WXMA 3R18A 3RNKA 2R23B 4JJHA 4OF3A 5IVZB 2AJZA 2ZJSH 3GJFH 5EC1A 1A7NL 3I3EA 5DQJA 5B4MC 2YC1A 5SWZE 3NT0A 3BP6B 2F19L 3I02B 4BCXA 3FB7A 4GLRI 3CSPA 3FTGB 3QXTA 4CBPA 1OAUH 4PAZA 3HAEB 1GGBH 1JVKA 4OLYL 2OSLB 4R90H 1HJBC 5IREA 4GUQA 3SOBL 3PQYB 4KFMA 5E8OA 4ZFFB 3MRJB 5FKAB 3T3ME 4F57L 2VITB 1ECYA 1J8HA 1F1AA 3K91A 3MCKA 5EFIB 3JVGC 3ARQA 3G5XA 1OAZL 4JFFB 1Y0LA 1TNMA 5LKNA 1IBBA 1SEBA 1PLGL 3K4AA 2P43B 1OM3L 3C2AH 1JP5A 4JANB 2HVBA 2AEPL 1NPUA 3LZFL 4JLRB 1DQDH 1P7QD 3UJJL 4HIQA 1TTBA 2ED8A 4BEIA 1QFUH 4CW1B 5LJYH 4OI9A 4YSRA 3VGFA 5MEPA 2NQ3A 1F13A 3ZO9A 3NEOA 1MAKA 1VZGA 3KVDD 3L3GA 3RDTD 5BRQA 1FNFA 4YPJA 1EJOL 3M7OA 2IG2L 2DQCL 4FN0A 4NLHA 1UXWA 2FGWL 4X6BA 3FT3B 3F58H 3DSNA 4GSRA 3HI1A 3KG5A 4FMFA 4GUPB 1SMOA 2VISA 1DQJB 3KPTA 4KGJA 4DERA 2HJLB 4BQBA 3TVMD 1DO5A 4LNVA 2G3XA 3UPAA 2HFFA 5E8PA 3K72A 1BAWA 4Y88A 2E47A 4YSDA 4F58L 1EIBA 3N55A 2YR3A 4ZPVB 5J9PB 2YGQA 1D2OA 5EU6D 2GJZB 2OSYA 3S3SA 1XB3A 3BN3B 1NEUA 2HVJA 1AGFB 1ZGLM 1KYDA 5DGQA 1IKFH 4Y4KA 3IS0X 5F9WC 4QRPB 2XA3A 1RAMA 4WHYG 1JZHA 3VFMA 2Y22A 3MJ9L 3UTTD 1RSYA 1A4KA 5KJRL 3QFJB 4G3YH 1DEDA 1ZA3B 3BVWA 5LCVH 3NCEB 4PJCB 3EZ8A 3QO0B 4I1RA 4AQ1C 4TNEA 4PJCF 5TDNA 5GS3A 4P2OC 3TBSA 5EZIH 1WS7A 5F71A 3NVQA 2Q8BL 4PB9L 5FO9A 4X9GA 5JW4M 1BGXL 4P06A 2RB8A 5HYSA 5TK2A 5HYQB 3QXVA 5D55A 2C9PA 2H7WA 4AUYA 1VPOL 1JZEA 2FX9L 3VFOB 5GRVK 1A6VL 1KJ2L 1G94A 5DI8A 5HJBA 3INUH 4LVHC 1DVSA 3VQ2C 4DZ8B 5L8LB 5SWSB 3ARGA 4GJTB 2R0LL 5D7LD 3NCBB 2OJ1A 1JGVL 4JQVC 3CZGA 3MLTB 3V4VB 4Q9CA 5B1JA 3SDDA 2FUTA 4I77H 2IVFC 1XD1A 1DQMH 2DLIA 4DVRL 3BT2H 1TPXB 1UFUA 3OMIB 1BZ9B 1HAWA 4B0MB 5KBMA 1VDGA 2YLHA 1CB4A 2ESVE 5KS9B 3TV3L 1NFIA 3W3BA 5KS9F 4IMKA 1MCKA 4Y4HD 3HBPA 5IJBC 5KVFH 1X5KA 4LF3A 4O58H 4N0CC 4EIUA 3OXRA 2ZX7A 1HI6A 4Y5YB 2VR4A 3DRTB 1E6JH 1PZAA 3KM1A 4NOFA 4GKZA 2WKGA 2E76C 3V4UL 5IROC 3HMXL 3B5HA 3QUYA 5KN5B 3WFZA 4XBGA 4XZ4A 2GIXA 4G9DA 4HWZA 4IIZA 2ALAA 2E75C 4MYPA 4IDLA 1WWBX 5EU7C 1FORL 3O3AB 4ZG1A 4IEFB 4UB0L 5C6TL 3NIDB 4LVOC 2C3WA 1A1NA 4PLJC 5BZXA 4IK6A 3NMEA 4NX0A 5DJ0A 3LVTA 3NIDF 5DRNA 3SBRA 4Y5XB 4M48L 3WUWG 5DEFA 4TTDC 3EO9L 1RFDH 3BGAA 2FYVA 1J88A 4U1HA 3ROLA 3CDFA 3FOMB 1I31A 3L9EA 4HJTA 2VWEE 3QWOA 2ESVA 5L9DL 5LUMA 3O41A 5HI5D 3Q6GL 1KT2A 3SKMA 4Y16D 5J12C 4PR5B 5KTEL 1RK7A 2CRZA 1HHJB 2VMEA 3L1GA 1D2PA 4FQQA 4GRWH 1ONQB 2AXGA 4P9MH 1MI5D 4JEGB 3LKQB 5JIHA 1A3ZA 5D7JB 5FGCE 1MNNA 2GIYA 3A6OA 4PP1C 4OLEA 1AGCB 1WAAE 3O6FD 2YUZA 2BHZA 3U9PL 1NFDB 3Q7JA 3R1GH 4OFPA 3WELA 3AT9A 1JBJA 1NFDF 1YNTB 2DLHA 5KSVA 3LPWA 4NQUA 2NR6C 4FLHA 3NN8B 1YNTF 2WSKA 5A3IC 4N3UA 2KI6A 4RX4D 3MA7B 4JZOB 1NCWH 5B3NA 5DJ6B 1OWRM 1T1XA 3WJJA 4V1DE 3JQOB 2M1KA 3AGWA 2UY7A 4YHOL 5KVDE 5CD5C 3J7HA 4KH2A 4BCZA 4UIMA 2D7OA 4D0CB 2IXQB 1DLFL 1ULVA 3FCTA 5L4FA 4AKQA 3NJHA 2YD6A 5ILTH 1WIUA 4JFQB 3TO4A 1R24B 4ZW7A 4FFWD 4WSKA 3UMTA 4TRPL 5CZVL 4G1EB 2FX8H 3V4PL 4CKQA 4Z77B 2IQAA 1RSFA 2XNAA 5DUBB 2P24B 1FV1A 3S4SA 5CLZA 1WAAA 3T1FA 4E41D 5I0YA 3FK3A 3D8MA 1BQHB 1MAJA 1AD0B 3CFJB 4G8FB 4I48B 4XP4L 1SHMA 2NZ1A 1GC1L 2P5WB 4LEOB 5CCKL 5AOKA 1YA5A 3K2IA 1HSAA 1LMIA 5BQ7B 1PPIA 3DJTA 2V8LA 2G3MA 5AEAA 4FQPA 3QUML 4L3CA 2VXUL 5HGBB 4G8EB 3V0VA 4V1DA 3T08A 3Q9QA 3K6NA 4M1GL 4P2RA 5C0JA 2P42B 2BP0B 1BF5A 2EVIA 2UXFA 2Z8RA 1XH0A 1X44A 1P7KA 1YEFL 2NX5E 5BZZA 3KNBB 3CHRA 3UG4A 2QV2A 3CFQA 5EA0L 2LE9A 2WUCL 4PREA 2C7FA 1XR9B 3EYFB 1BFVL 3OG6B 2APWA 4MBRA 1MQKL 1BZ8A 5E8NA 3N2JA 2NSMA 4ONGL 4LPTA 4AC4A 2CO7B 1CF8H 4W4NA 1ZLSL 3HHRB 5E08L 5E5MB 4H7VA 3VD2A 4N2GA 4E68A 4TNFA 4HH9B 3DGGB 1MCPH 1OOAA 4KV5E 5I76B 1LO3H 3K80A 2NY5H 2VERN 3GMLA 3IGFA 3OKDB 4KXZI 1XL6A 2W9DH 3KWTA 4MKMA 1PZ5A 3ARFD 4PJIF 4NQDB 1A3RH 3D07A 1U8HB 4NS0A 2RR3A 4PJBB 3ZE0E 4CU6A 3KYMB 3ARBC 2BZCA 4XRCA 4PJBF 1UH2A 3B9AA 4ZMLA 4NXSA 4RBPH 2JK5A 2OYMA 3T65A 1UH3A 4Y2OB 1HCFX 1Z9SB 3T6WA 1LHZA 1S7XB 3DO7B 1AKPA 4OZGE 3F6LA 2NX5A 4ABVA 3CMOH 4CMMA 4UM8B 4U6VH 1A7PL 2DIAA 4JFSA 1DYZA 1QSVA 4GQ9H 4FTVE 3RWEB 1XDTT 4BXSV 3TBCA 1IUZA 1HNFA 2JKWA 3TF7C 1A7QH 3PGDB 1BBDL 3RTQC 2DYPA 5INCB 4ERSL 3HHSB 4LLWA 1HQ4B 2V2WA 3C8KB 5D72H 4JAMA 3IMSA 1CFSB 4EVNB 5DFTA 4XMWA 3VXOA 4M4PA 1Q94B 5I1IL 2HLAB 3EKCA 3FFDB 4DFHA 3L9RA 1J11A 1OSEA 3RKDC 4DN4H 5JLZA 3ZZ1A 4M5TA 3E1F1 5ECJE 4I9WD 5B8CB 5FPIA 2JB5L 5ADPL 4P05A 3VXUB 2JLPA 3UX9B 4OFKA 3BKJL 2GB2A 1KLUB 2EO7A 3RGVD 3BP7A 1OAXL 1HU8A 3REVB 1HKFA 1SJMA 4OZGA 4DGVL 4DGWC 2DBJA 1DVFD 1IBGL 2TAAA 4HHWA 3ARTA 1A6AB 3CC1A 3IU4H 3LB6C 4FTVA 1QG3A 3OAZH 4DPBX 1F00I 3LAFA 4F1SA 3TYFB 4DP4X 4BQ8A 5DHEA 4KVCL 5TD4A 5EIIA 5I15H 3HUJB 4Z7VE 3GMQB 2WIIB 3IGKA 5IFJA 2ICWI 5IEKA 3HUJF 4HULB 4GRLD 5IBLD 3QDME 3S5LG 1QRND 4YHYC 3CZJA 3GSVB 1JZ7A 4GI8A 4KZDL 3DBXA 3OKYA 3RX5A 4YDIL 2OJEA 2ICWA 3FO9B 3AWGA 2AXJA 1KB5B 1WCQA 3ARWA 3KYNB 2Z31C 4HWBH 3TA3D 1UM6L 3SDXB 4ETQA 3VD5A 1XQ4A 2YPVL 5CJXC 1KWKA 5LG1A 3SDXF 3HNVL 1TLKA 1GGIH 1E4WL 3C6LB 1KYOJ 3T2LA 4QF1A 3VG0L 4C47A 1I1AA 5JHDB 5TJWK 2D73A 2YBRA 3RIAK 1QPXA 2HTLC 3PGFH 6PCYA 3RX7A 1U8QA 4LVHB 1OSPH 2P8LB 1FFPA 2X6CA 3GJEA 5I6MA 5SV3A 1I1YB 3OKNA 1RK0B 4K7PH 1VEMA 1PD6A 4GAAA 4H4NA 4XPBH 3AXIA 1DSYA 4WCYH 5DD0L 3CZSA 1BX2A 3UTQA 1GY1A 4FNUA 5AD0B 2X4UA 5CILH 1ZV5A 2QHRL 1XZ0A 2HRPL 1O7VA 3FSVA 4OAWA 3R06A 1AFVH 5I8OL 5DD5H 5IKCA 1FYTD 3QDMA 1MFEH 2IH1A 3BYTA 3DX4A 5HHVL 3BPCB 4JRLA 4JPQA 1N4XL 4H2CA 4OD1H 2WVVB 1S7TA 3U9UA 1VGEL 1T83A 4NENA 1D6EB 4HJ0D 1VESA 1Q4NX 5CINL 2FLMA 3QYCA 4JFDD 3OJ2C 4GRMB 3KPPB 4KUZH 2WZ6A 3QEQE 2HLFD 1GS7A 3A24A 3KGRA 3KYAA 4XP5L 3RVWD 1J5OL 4XNYH 4B50A 1DVZA 1T89A 3X3GH 5LDUA 4MBOA 5C0RH 4KKLC 3RHWK 2X6AA 3RBSA 3S36X 3AREC 4R2GB 3D0VB 2QPDB 4JPKL 4Y19A 4F8OA 2RA1A 2ATKB 5LCVA 3UZEA 4KI5D 2ZYRA 3TT3L 2A38A 4X4ME 4MHHG 1NCJA 5A7BA 5FECB 5KVFE 3KMDA 1RZKC 3MRPA 5E0FA 2WKLA 3B6SB 2VR3A 3V0JA 3OZLA 2X0VA 4JRYD 4NZTH 4WWKC 2ZQKA 4K07A 4JFXB 4ZO7A 1GW0A 1G7LA 5JIKA 1ZLWK 3FUMA 3C5ZA 4RMWA 4UBDC 2FLBT 3WE6A 3DX7B 4TOYH 3U4BL 5J6HA 1GL4B 3CFUA 4QR7A 4EDWL 5I8KH 1K2DA 4YAQB 1S7QA 3GHBL 1HQRB 1B2WL 3N1GC 1EGJH 4AV0A 1FZMA 4PJ8A 4QDGA 5GISL 3FQUB 3QEQA 3US9A 2GK0B 2EIZB 4ZMWA 1IL1A 4NQXB 2LLGA 2ZAGA 3KL3A 4WJ5A 3NTCH 1Z0MA 2DBLH 1EWHA 4HUUB 2VW6A 5TF1H 1P7QB 2J8OA 5F7YC 4X98B 4PHXA 4JDZB 1R6VA 5MENE 2NZ9C 4PU2A 4X4MA 3FPXA 5L2JA 1E28A 3W0WD 2VW7A 3SYOA 3HR6A 1T66D 1FVCB 2WO4A 4J6RH 1YNLH 3RDTB 2EDMA 1PCXA 1YEGH 1A9BA 3EGXA 1OF2B 4OFDA 5EUOA 2OXHA 4FXGA 4OZ4B 2JJVA 4CMHB 1MCOH 1PG7H 2CDGB 4XO4A 2CD0A 2H0EA 2XC8A 1NUFA 1JYXA 2GW5A 2Q86A 2RCSL 3TVMB 1FG9C 4ALAL 4LSRL 1RUAH 1KBKA 4P3DB 2NW2B 4XE0A 4DW2H 1UT2A 3BJ91 5CAYB 1S7WA 3UAEA 1UD3A 2DPKA 3D2UA 1H3GA 2YUXA 2K0RA 3UTSE 1IAOB 3G5ZA 3D3VE 1KJMA 1K72A 1ZAGA 1QBAA 4P9HH 1V3KA 3H42L 3NFSL 4F2EA 3US1A 3F7YA 3IJEA 2HG5A 3MRKB 3VYOA 3HAEH 1AOHA 3FQ4A 4I2XB 5GQBA 3UTTB 4XGZB 2Y2TA 3EDFA 3G5VB 5MENA 3TEYA 1FPTL 2BRRH 4UMGA 2EC9T 1FL3A 5BVPL 1BXVA 2OR7A 1IQWH 1BPLB 2QMJA 5FCSH 3K8KA 2HPOA 1JZFA 3CZFB 1MFDL 1HXMB 1RXLA 1E67A 3FT2A 1FUNA 2WLHA 4FRWA 1RLBA 1RZGB 3DRQA 3RUGE 1NCCL 1YEJH 3QPXL 1KTJA 4LSVL 1J87A 2ZSVA 2C9XA 1S46A 2BS71 3P3RA 4IHOA 2VO5A 2W9EH 3GPEA 4HIJB 4PRHE 2XHNA 5F89A 4KAQH 1FO0B 5GSVB 2DJUA 4JK0D 4A66A 1JN6B 1G1OA 5DMGD 1E5CA 2EDDA 4QCIA 2C4FU 1WA1X 4U33A 3KYOB 4L4TA 1I7TA 1JGUH 1I9IH 5D7LB 3NCYP 1JE6A 1MKFA 4HX1B 3UTSA 3DOSA 4JPIA 4M6NL 4QRRD 3NFPA 2Y6SD 3D3VA 4XAKE 4O51B 1XAUA 4J3SA 5KSAC 5EEVA 4FMVA 12E8H 1FL5A 1CN4A 1OCWH 2ZT9C 4R96A 4Y1TA 4R0LB 4L5FE 1CCZA 4Q9RH 5HHOE 4FNSA 1MCJA 2D31A 3Q3GA 4EN3A 1WC7A 4MZ2A 1QLEH 2IALB 1EHXA 2G5RA 3U7WH 1FG2B 3AROA 4FC3E 3SE4C 3RUGA 4MXWL 4U31A 4XNBA 2VABA 4X42A 5CNHA 5CP7A 1PF3A 4OZHE 2E27H 4TSCL 4PRHA 5FKPA 1P6AB 1IAIM 1EAJA 2ZP0T 5F7DB 4UILL 1FI8C 4JGNA 1XXFC 1F90L 3TEXA 1X3DA 3QEHA 2IWGA 4ZNEE 3WKQA 3JV4A 3LYRA 4G7QB 4XO3A 4Q97A 1M7IA 3P73B 1KIPA 2EIEA 2OMXA 3B9KA 1U21A 1WBYA 1MREL 4M1CC 4NQQA 1Q9OA 4R97B 1DQLH 4PRDB 3RWHA 3WS6A 5BVJA 2WYHA 4FQJH 3KEHA 1J8RA 3U2SA 4KKNA 3LMJL 2RAMA 3BZ4A 3NFNA 2E0PA 3O3UN 3IEAA 3PWNB 1YAZA 2QSTA 2I5YH 1OZUA 4K5NA 1NC2A 4CA4A 1DUYA 1J5IA 4U1KB 1V7ML 4WFGD 1J1XL 2ZXGA 5HHOA 4H1LB 4DH2A 3HNSH 5FR3A 2DI7A 3EO1B 4LSPL 3LZNA 4TXVB 4EDXA 1F6LL 3DX2A 2C3HA 3FF8A 4Y16B 3TWYA 5DMKB 3DX3A 3EO0A 2EE3A 4YHKH 2Z0BA 1MW2A 5CEXA 3TS8A 1MI5B 1SNRA 3CFDA 4QT5A 1OKEA 1H6TA 2WMPA 3BWUC 5IHHA 3L5XL 1NAMB 3BPOC 3EGDA 4OZHA 4TLUA 5G55A 5K5YA 2ICES 2C5DC 5K59E 2Z1PA 1N64L 3RPKA 3SKJH 4EXKA 2ZZUT 2HCZX 2D7TL 4ZNEA 1MIEH 1U2CA 2AKRB 2BVYA 4RZCA 4AMKH 3QUKA 4XP6H 3WNLA 3IKCB 4HOMA 2BVUA 3O6ML 1RUMH 4U0QB 1E4HA 1RUKL 4FLOA 3OBAA 3ZE1E 3D25A 3UTZB 4B9CA 5CM1A 1F58H 4EUPA 1JF1A 1G9NL 1NBQA 2X7LB 4YBLC 2ZPKL 5ICXA 4JFWA 1W0VB 3P3YA 3MV9E 3RVVC 4RRPA 5AW5B 1EZSA 1KCVL 1KWGA 1GIGH 4MNQD 4N8VG 1YN6B 1DBAL 1CXEA 3HEIB 3I6LE 3FHQA 4E9RA 1EO7A 3AU0A 4J5VA 1KXVC 4LHUA 3RYMA 4E9LA 1S7RB 1RKRA 3CC5B 3NIGE 5IFHH 4M8RA 2IFGA 4X6DE 1T5WB 6FABH 1XV8A 1IQDA 4PJDA 1EJFA 1BXUA 2YKKA 1JWSB 1AC6A 1JS4A 1SY6L 3ARDD 1CJYA 2VDPL 2HMIC 2WWMD 1U92B 1F8TH 2XKSA 3T0EC 5DEGB 2ZYHA 4E41B 3BUYA 5DD6B 2FT7A 3GRWL 5GGQH 1H3PH 5K69A 5JPNA 4MXQD 3BISA 1L3WA 1NKRA 4JFHD 4LSQL 3G5WA 5AVQB 2JJTA 2IPUK 1PLAA 1PEZA 2L4OA 3K2UL 1FZJB 3SY0A 1NCAL 1JZ4A 4UM9A 2V2TB 2J4WH 3ALXA 1KLGA 1XGQA 2WM0A 4PY7B 1RURH 4ANXA 4AEFA 1N0XH 1QAWA 3MV9A 4KTYA 4Z3FA 2WVSA 3BJLA 1QNIA 5HVWA 2DWEA 2FATH 3GLEA 3TH3T 1B9ZA 5BCAA 1S7VB 3ARUA 3QUXC 2R2HA 2NW3B 2WQ8A 2EEFA 2CR0A 1FL6B 1TKWB 4G6ML 3V9CA 2G2RB 2DMKA 1QWNA 1MHHA 5DLMH 2WNKA 5DVLA 3HR5A 1TSHA 4APQA 4X6DA 2GFBA 3S98A 4LCWD 4BXVA 1MHCA 1N0LB 1SJHB 2HJKA 3V5KB 1QFHA 2QADC 4K4KA 4XN9A 5AW2B 5C0CE 4RH4A 5E99L 5AW3B 3A0OA 1S5HB 4HWBA 2H3XC 3VRJA 4CVZA 4LIQL 2KDYA 1KYUA 2MHAB 3APNA 4F2MB 5H4ZA 3PL6D 2OMWA 4WWKB 3BDYH 5MP6H 4FG6C 4DP6X 1AGBB 3OLDA 1UWEH 3FU3A 2Q87A 4QLRA 1UWGH 3EJQA 2LAAA 2BP8A 3ARFB 2PCYA 4FXLA 1OSZA 2GSMB 2ARWA 3JV0A 5FUCE 2B9BA 4TNVK 1UJTA 1TVBA 2BDNH 2PXYC 4S1QL 3PWLA 1JXDA 1E9PA 3V0FA 3RA7H 4ODHH 1BEYH 5I0DA 3RLSA 2QKIC 3SCMC 4OFYD 3UGEA 2QQKH 2UZPA 5E6SB 2ZF8A 1URZA 2PYFA 3HC2A 1ORQB 5C0EA 3T3PB 2DLFL 1U9KA 1PZBA 1KGYE 2OJZL 2YQGA 2DQGL 3T3PF 4BFOA 5FB8B 3EDJA 1S8DB 2KPWA 3T2NL 3M88A 3WMPA 1URLA 1DJIA 2X1XR 5C0CA 5E2JA 3KGUA 1P0SE 5EO1B 4E5XA 3MUUA 3ZKXC 2Z91B 1VFAA 2DQIH 4B96A 4HF5H 5C09D 4Z7OB 3QJRB 4G43A 5TDPB 4WTXA 1CFQA 3GSNB 4KRPD 3VGEA 3H54A 4UOJA 1M6OA 4Z7OF 2XIDA 3V9FA 3S5LB 3O4LD 4MMYA 1RZIA 4L3ED 4ANVA 3GMMA 5E1AB 3D4YA 3QJHB 4N68A 2ZKXA 5GJSL 1EAQA 4KOBA 1UOVA 5LBVA 3U0TB 4CADA 4LL4A 4JO4H 5IQMA 5BS0E 1W91A 2FBOJ 3F8UB 3N0PB 1KJ3H 3IJSB 3W39A 2VQ1B 1HZHL 3LNIA 5D1ZD 3SQBA 3QNXA 2CLZB 3PWPD 1M53A 3PIQB 3RGVB 1JUFA 2FH6A 3K3QA 3H3PL 2BFVH 5DK2B 4QYOA 4WO4D 3D87B 1DVFB 5C1MB 3RVXD 3CN0A 3RP1A 2NUTB 3RJDA 4HUNB 1WEJH 1QYGH 4K3EL 4TYUA 1X7QA 3TLRA 3BAEH 4J3XA 5I9QC 3IXTB 1I3RB 1JGEA 2WQUA 3B43A 5MHSE 4WENB 3KS0J 3GO1L 1LDPL 1KN4H 1W8EA 4KJWD 1F02I 1BZ7A 3GI9H 2PWHA 3NA4A 4FFZA 2VDMH 4NUQA 3QS3A 3PXJA 3HVDA 4N0RA 1KIUB 1B0GA 3GSOA 1RZFL 2NY4D 3BKCH 1NCTA 3OXSB 5I2IA 3BUIA 1L9QA 1MCFA 1PSKH 2F53B 5DJDA 4ADJA 4P23C 5C0GB 4XP1H 2JKRM 2R2EA 3MMEB 5BS0A 4S2SA 2N59A 3CQPA 2GTWA 4B9PA 4XCYA 1FN4B 3DUHA 5T1DL 5E4OA 3WO4B 1NANH 3UO1H 1DHKA 2LGNA 3CUPB 3O11A 1G1CA 4Y4FA 5IW3A 1AY1H 2WYZA 5GJTL 4BKLB 2ADGB 1CTNA 1X4ZA 4P46D 3PQYE 1G6RL 3C6SB 5E03A 1Q9KB 4JJOA 5HDBB 1ZDSA 2DQEH 5HDBF 1FVEB 1A6UL 4J12A 3KLLA 5E1IA 3LNDA 1YJDC 1X6LA 2YQ3A 4YDJB 5JXAH 1ANUA 4PWGA 3CPUA 3CH1B 3BN9C 4JFFE 4QRSB 3NRFA 3GXNA 1FYTB 3MZGB 4M56A 1J9TA 3BP4B 5I66A 2R51A 5C08D 2PW1A 3EH2A 1FBIL 2H1PH 4UOW1 4UDTB 2LQRA 3JTBA 1BOGA 3G08B 1T7YA 2F54B 2R23A 4GAGL 5IVZA 4E9YA 3RZCD 1YO4A 1HOEA 1XCTB 4I18C 4MJHA 5F0PB 4K8RL 4JFDB 3BLBA 1BAFH 2YZ1A 4ENZA 2B3IA 4UZUA 2VJXA 3F05A 4HH8A 3BP6A 3ECBB 3I75A 4OCSH 3I02A 1MLCB 1BYOA 1RV6X 2EVGA 3FTGA 4JQXC 3GBML 2F74B 4AH2B 3BKMH 1B4LA 5F6HJ 3HAEA 3WKML 2BHYA 4OLWH 4AVHA 2IDQA 5LGHL 3SPHA 4AT6B 3PQYA 1V7NL 4L0PB 4ZFFA 3MRJA 5FKAA 4KZEH 2VITA 4W9IC 3D34A 1IKNA 1NOFA 1L7TL 5EFIA 1KBGH 2R4RL 4KI5F 1KB5H 3MLXL 4RAUB 3ZL1A 4KRMB 2ICEB 1N2RA 1NQBA 2J44A 4IJ3B 3RIFK 5BOJA 4JFFA 4HJGB 2P49B 1T1ZB 2XIIA 3FUJA 4OQTH 4JRYB 4S1SL 4UF7C 2YUVA 3D08A 4I4WB 3B7TA 1JYVA 1UD4A 3TJHC 4JANA 4JO1L 3DOIA 4JLRA 2PPEA 1CZ8H 2XWRA 4QRPE 4K94C 2BRQA 3EH3B 3A4DA 1UT9A 2JTDA 3PP3H 3CCHB 2XN1A 5HYFA 1QEXA 3QFJE 1C1EH 3NRPA 4CW1A 4JKPH 4LRIC 1IEBA 4PJCE 3MV7B 2LU4A 4V2CB 1JZ2A 2R0WH 3TTSA 4FKEA 4EZKA 2X6BA 2A6JB 3QISA 4WTWA 1FNGB 5DVPA 4WY7L 3FT3A 1MNUH 3D0LB 2CA4A 3L95A 3N1MC 1H8NA 4ZOAA 3IDYB 2P4AB 3KGSA 4GUPA 1DQJA 4QXGL 2HJLA 4YBLB 3CX5K 4XCCL 5EORL 3W0WB 3LSOA 4LNRB 2FEJA 2YIHA 2MCG1 1CLOH 2X9WA 3HC0A 4UQCA 4BFEA 4YDZA 5SWSE 4ZPVA 1Q72L 5J9PA 1SYSB 2G3ZA 3PV6A 4OT1H 4S0TD 3RWCB 4Z3TA 1E3FA 3MLZL 2XIBA 2GJZA 1CR9L 2NXYD 1ZVSB 1CQKA 1F18A 3NPZB 4Z9KB 3Q2LA 5HI4C 3VNYA 4QRPA 2E74C 2DDQL 3WTXA 3IRZA 4NT6B 3BEVB 1KBWA 3GKWL 2Y0SA 3QFJA 3F5WA 4JKKA 3UFIA 1ZA3A 4F2FA 1T6VN 5KS9E 3MLSL 1T21B 4PJCA 5JO5B 3QO0A 1R3LB 2BIIA 1L9TA 4IOIB 4I0KA 2G2NA 3GXDA 1XH1A 3G6JB 2DD8L 3G6JF 3WHE1 3AW5A 4RGMC 5C0BD 4ECNA 3QIUD 3VD0A 4OSUH 3SBWA 2GJJA 1XX9C 2VLMD 1XB6A 4XAWL 5IMOB 1J0IA 3ZL4H 1KF9B 1E65A 3QWNA 1B3IA 2ZX5A 4DZ8A 5KWYC 2HT2C 4HC1A 5SWSA 3D18B 1QW9A 4BZ1L 4L1LA 4OVUA 4LVEA 4IRZL 2J5WA 3NIDE 1ACXA 2AC0A 4KXDA 2HX7A 2M83A 3MLTA 3V4VA 1BHGA 4A7GF 3Q9PA 3I85A 5F0JB 2E59A 4JN2B 2DLEA 1OANA 2IAMD 1BZ9A 5CP3H 3I6KB 1RZKL 4N2HA 4ZBJA 3JYBA 5KS9A 4PB0H 4NEHB 1GRWA 4QRRB 4UAOC 4GBXD 4M93C 4WHYH 1XHHA 2ENJA 5JW4Q 1TZ8A 1UFGA 1E40A 2SEBB 3UOAB 4D8PB 4Y5YA 2GPZA 3DRTA 3VM5A 2EKJA 2O6CA 2X3AA 5IJVB 1XSJA 2E4TA 1AR1D 1G87A 3IPBA 2EXWD 4HS8L 1NFDE 3V52H 1N7ML 1QOKA 1D6VL 2QKIB 4JPWH 5EO0B 2W81C 5EBWA 2FSEA 1ETZA 4XH2B 3MX0B 1AR2A 1F4AA 2AEQH 3KJ4C 1U8NB 2NSQA 3L1FA 1A0QH 3NACL 1JDAA 5FYJD 5I1LB 2ADIB 2Z4QB 2EADA 3LQAC 1R0AL 3O3AA 3INOA 3LKRB 4IEFA 4MNGB 5JHBA 4MD5B 5F21B 1F4HA 1ZXKA 4Z8FH 2XTJC 4Y5XA 4NZRH 3LS5H 5B21A 2A6KB 2X4QB 2Z7UA 3CU1A 1SN5A 3CFCL 2V0AA 1GKEA 4FQ1H 3ZKMC 1R17A 5I1HH 3CHOA 3DPBB 1V8HA 4ZUVB 3LCYA 3O6KL 3U0PB 3ESVF 1R46A 3WE1A 1VRSA 3JWDL 1I9JH 3GZOA 4FS0A 2XLLA 3FCUB 5CLXA 1C8PA 4D9QD 2K8QA 1L9OA 3F6IA 3VI3E 5AW8B 4PR5A 2WXGA 2FNWA 4M7JL 1PZSA 4DUXA 1HHJA 3ZTCC 5KEZA 5FYLE 3UROR 3TBVB 2AEIT 3LKQA 1VB9A 3H3KA 3PYCA 5AOMA 3GXUB 1FSKB 2DMGA 3NAAL 2W9LA 3OV6A 4R8WL 1E7UA 4XHQA 3NABH 1NFDA 3VQ1C 35C8H 4FP8H 4LQ1A 1M4KA 4LARH 1YNTA 4X80L 2ZG1A 4PBXA 2P5WE 2JKIS 3OB0H 1ZGLB 2VE6B 4JM2C 3BKYL 4MMXC 3MA7A 4JZOA 5DJ6A 4XR8C 2KKQA 1DFXA 2MJWA 4E42B 2CHNA 3FU7B 5I9QB 1MAMH 3OC5A 1SOKA 3HE6C 5BZWA 4D0CA 2IXQA 4PWJA 2CIKB 4CUCA 2CH8A 4JPSA 4FCHA 3D4ZA 4HWNA 1FHGA 4JFQA 4KVNL 1R24A 5I5JA 3RWJA 4NJ9L 3BCDA 4HSCX 5H94B 1AIZA 3VI3A 3VWKD 3A67L 2BSED 4I87A 4OM1H 4YHZH 5EOTB 3BPLB 2I85A 4Z77A 2YK1L 3GMPB 4P57B 1G9EA 5DUBA 3K0YA 4F5CE 3LN9A 3MCLH 3TBYB 2VDNL 2YZ8A 4MNQB 1KGWA 4ZFOL 2VERA 2ZXDA 4XMKL 3LOWA 1BQHA 4NI3A 2JJSA 4X6CB 2CBOA 4O5LH 3CFJA 4G8FA 3T6QC 4XMUA 4HSAC 4I48A 2JB6B 2XVKA 4BWWA 2PCFB 4X6CF 2D9CA 2IIJA 4LEOA 2BP5M 1P69B 3C9NB 3K6FA 3B2UC 2I7SA 4BZ2L 1WP6A 4PJAB 1TMQA 4NQDE 4Z5RA 4RSVA 1EUTA 2EXYC 2X12A 3G04B 3WIHL 3ARDB 3GZKA 4PJBE 4PJAF 3G6DH 1G9ML 5HGBA 4G8EA 4PUBL 3QXDB 1JNHB 2C3XA 5IOKA 4Q6IC 4OJFL 3L5WB 2UUDK 5F7BA 2X89D 2BP0A 2CJ3A 3D33A 2YD1A 1HWWA 3SODB 5D1QD 5G5DB 4ZPTB 4NQTA 5DD1L 4POYA 4XN1A 1IMHC 2CU9A 2I26N 1XR9A 3EYFA 3MRFB 2NSXA 1AANA 2NNAA 2OMYB 4TKWA 1TZAA 2W0FB 1GA2A 2NCEA 4PRPD 2VDRB 2CO7A 2WLKA 3KL0A 5GZOC 5J5EA 4U0RB 1TTFA 4F5CA 4KO7A 1NCOA 2YJQA 4JKMA 3I74A 4KMTL 5DVNA 2IFFL 2WBJD 5E5MA 4YHIB 3DGGA 1DLHB 2VLRB 2ZUYA 3U2JA 5G2NA 2WQWA 4KWUA 4LCWB 2B2XL 4I89A 2C34A 4LEXH 4A1RA 5IWLA 3JWNG 2YA0A 1H6EA 3KYMA 3VXUE 1M57B 4HIPA 1WFMA 4MLIA 3BRDA 1LQBC 5F1OB 2FQFA 3T0BA 4M6ML 2EE2A 3PL6B 4Y2OA 1Z9SA 5CFHA 2ZUXA 4PYHA 1NLBL 3MNMA 2OL3B 3C08H 4W9HC 5D9SB 4YXKH 2DTML 4UM8A 3OHXC 1ITBB 4KY1H 2Y36H 3D39B 3QR2A 1ND0B 3RWEA 1T03L 3UMNA 5FA4B 5CSZB 3PGDA 5INCA 1MELA 3HHSA 3HUJE 4R9HA 1HQ4A 4QXUH 3C8KA 4RA3A 3QRFM 2XZQL 1HX0A 2X4NB 3QZWG 2LT9A 4K5MA 2B08A 1CFSA 2B1HL 1EFQA 3GD1C 3GXMA 3V6ZA 1Q94A 1GOFA 3C60D 4L3FA 3EXJA 2CJUH 2HLAA 4YEFA 1AMXA 3EJYC 3FFDA 1DN0B 4I3RH 3AB0B 1YPZB 4NKIH 4Y1AD 3SDXE 4PVMA 3L9YA 1PYWB 5D4QA 3ZT6A 1YPZF 3V7AE 3X14A 1ASQA 1JHTB 4WU7B 4PJGB 2D3VA 1MW1A 4K8RD 4PJGF 1NGZB 4HLJA 1DZ0A 1PCSA 5JHDE 4CN4A 1QR4A 4OJAA 2YA2A 3DJRA 3VXUA 2NY1D 1GTNA 1DBMH 1N3NA 5C09B 4ZJ9A 5CJQL 4A37A 1KLUA 3MYJB 2PR9A 1VA9A 4KRPB 4JFZH 4LCIL 5KJ4A 4HIXH 3EUDA 3IAGC 1N5YH 3ME0B 3Q5YA 5EBMB 3O4LB 4KRLB 4LEBA 3GHPA 4NCC2 1A6AA 5FW7A 2I60L 1YEEL 4JY4A 4H44C 2BSDA 5LWYH 1PAMA 2WGXA 4X50A 2XACC 1YG9A 3TYFA 3C12A 3CAFA 1MN4A 4D8OA 2JQAA 3TTYA 4FTDA 3HUJA 1QSED 2HFEB 4A55A 2OCCB 1QUNB 1OCOB 2WIIA 3GMQA 5JYLA 4I13B 2JWYA 4ONOA 5D1ZB 4PV1C 3PWPB 5BV7H 2N56A 4U7MA 1FRGH 1N68A 3CD4A 2LAGB 4X99B 5FV2A 5F1KC 2VUKA 4JM4H 2B0SL 4OKDA 4WO4B 1I4FB 2PO6D 3FO9A 3HZKB 3HFFA 1KB5A 2Y3NA 3S36L 1WF5A 1C5DB 5KYXB 3KLQA 5HD8D 4G70B 5CSGA 3LKNB 3DNKA 4M7KH 5I6NA 1GXEA 1GPOL 5AZEH 1H8SA 2VUOA 2F5BL 1QUPA 3C6LA 4RBPK 3ZZSA 3KAAA 2VB5A 2X4SB 5JHDA 3T71A 2DLGA 2FT6A 3MA9H 3QRLA 5D71H 1ZD6A 4XMPL 4Q0XL 4W9DC 2EYRB 2P8LA 1I1YA 3HLAB 5TE4L 1RK0A 5CZXD 1KACB 1L6ZA 2NY4B 3WTSA 4FXKC 2DRUA 4H8WH 1D5XB 4B97A 4ODXA 1I85C 5DUML 3V0DA 4D3CL 1HL8A 1LL1A 1E6OH 2APTA 4PRIB 1MVYA 2AI0L 5AD0A 1CF1A 4Z0BH 5SX4H 1F97A 3TN0D 4K7PY 1Q9LB 2HN7B 3CX5J 3MOBL 3WJLA 1ZTXH 3CV5A 5GGRB 3BPCA 3WEAA 2JKJA 2WVVA 1ZA6B 3QJVB 4N9GB 1QPPA 2PKDA 4P46B 2QPFA 1CO1A 1W6WA 2E5EA 1F4YH 2XPYA 4LK4A 1D6EA 4IIQB 4OGXL 1MCNA 4XWOD 1DSFL 3DROB 4FNLH 2QSCH 3GSNH 1L0YA 1GY2A 2YGOA 4GRMA 2ZKHL 2ZP9A 4L4VD 3EFDH 4P5TD 3S34L 2IH9A 1TTAA 3WJMB 3WTYA 5IROA 2ODHA 4LVNC 25C8H 1H5BC 2N7BA 3IKKA 1TQBB 5GGTA 5C08B 3T8XB 4R4BB 3LTVA 1OE1A 3DVGB 2BNQD 4WEBH 1TZGH 2EDYA 4ZMNA 3OAZK 5JMOC 3KLAB 1N6QL 1V54B 3ILQD 1PTZA 2F19H 5FYKD 2ZG3A 4C57C 1CE1L 1NMCC 2ATKA 2DI8A 3EJZD 4EZJA 3NYKA 3QJOA 2HVKB 1A64A 2ICWJ 4TULL 4B9IA 3ARYA 4PGEB 3SJVD 4GS7C 3O8XC 3SOBH 3B6SA 3TH2T 4D9LL 4YSEA 3ILDA 3KPRD 2KDGA 4WAFA 5IHWA 4F57H 5IMKB 2KERA 4N5EC 4JFXA 1Q9WB 2Z9TA 5JA8B 3DOHA 3MOAL 4X7TB 2XWCA 3DX7A 2W0PA 2E8YA 1B4JH 4KJPD 4YX2L 1OAZH 1VGKA 2JIXD 1A3LL 5FXCH 4YAQA 3U30B 3TYGH 2WXHA 1CICD 1HQRA 3RGBA 4AJ0A 4TL5A 4QUOA 5E0QA 3M46A 1OM3H 2A5UA 3FQUA 2BNUB 3HS0C 2GK0A 2EIZA 2AEPH 3LZFH 2Y07H 3MRQB 3TH4T 4NQXA 1JMXA 2YAOA 4IDJL 3A47A 3WNPA 3FXIC 2NY0C 2X9YA 3B5TA 4OIIH 2G60L 2NY2D 1GGYA 1R9FA 2WP3T 2WBWB 4QY8B 4HUUA 3VXTB 4ZMQA 4JM2B 4KNQA 4MMXB 1P7QA 3OR7B 4X98A 3U83A 4I2XE 2C4FT 4MA3A 2MRYA 1EK3A 4JDZA 3UTTE 5LDSA 1NBVH 1EJOH 1KLFB 4XC1H 4D7BA 3O3BB 3TJEH 4ES9A 5MEOB 4ZK8A 2FGWH 1U3HD 1FVCA 3MBEC 4WNQB 4B3VA 3RDTA 1V27A 1DL7L 1FCCA 2VDOL 3MNZB 1OF2A 3CPLB 2QGBA 4OZ4A 5CXPA 2DQMA 3OSVA 1VFUA 2NYZA 2CDGA 2EUXA 1YQ2A 2OTWA 4A2DA 2UY6B 3LV3A 4XXWC 5DD3L 4UT6L 3TVMA 1ZOXA 3BD4A 2BY1A 1L0QA 5ITBL 3OJVC 4P3DA 3ZOAA 2VR8A 2W0LA 1VFOA 4MSWB 4N90D 3L48A 4R7NB 5D7LE 2F15A 1D7CA 3L3DB 1IAOA 1FYHB 4HZ1A 3MJ9H 4ZTOL 1XH2A 5C2UB 2NXYB 5KJRH 2BSRB 4K3GA 3OG4B 1BVNT 4NM4L 3FMGL 3PJSB 4GSDH 4KXBA 5E95B 3ASWA 3W11C 4FQ2H 3MRKA 4LOUC 5EG6C 4I2XA 4XHJD 1K6QL 3FAXA 3UTTA 4XGZA 3G5VA 2F8VA 3MNWB 5C0AB 2Q8BH 4PB9H 5BJTA 5HYJD 4PRBB 2EDHA 3CZFA 5C71A 1HXMA 1BWWA 5CD3B 5I24A 1RZGA 3MLWL 1VPOH 1QTPA 2FX9H 3U7YL 1NC4D 2IOOA 2WXIA 1NIAA 3GI8L 4GPVA 7FABL 5JIPA 3FQ1A 3QIUB 3MJ8B 4HIJA 1AYRA 3RRQA 1BVOA 1IFRA 2XDHA 4KDWA 1JGVH 1FO0A 1M6UA 2B3RA 5GSVA 1CL7L 5M95B 4LGRB 4F8LA 1JN6A 4N6QA 2Y7NA 2B4CH 2ZUQB 2XVGA 2G4GA 1QR1B 4JKWA 3KYOA 2R0KL 4PJEB 5CJOL 3SPJA 5D7LA 4HJEA 3BRGC 4NNPH 4HX1A 1RZ7L 4PJEF 4CC1A 4D0DB 3ZTDC 4PD4K 4BFIB 1UA6H 4OD3L 1N9PA 3K74B 3RVTD 3MYZA 3MLPA 3TV3H 3NH7H 3HIZA 4R0LA 2J6EL 4EBQL 3C8DA 2H9GA 2ZXBA 3CSBA 2DF3A 3HRZC 5ALBH 3DX0A 3STBA 2V5YA 1LO2L 1WZKA 1IGTB 4HFUL 5FA3B 4AIEA 1FG2A 2OZ4L 2ZAHA 3BDXA 3TESA 2JCCB 4CDGC 4GBXB 3W9EA 3HBZA 3OHXB 2JCCF 1QNZL 1MI5E 2XCMC 1IC5L 3JV6B 4JUTA 4ZS7L 1NOAA 5F7DA 2XOTA 3PUCA 5AQ0A 2UXVA 4R83A 1IT9L 1PD0A 3P73A 1I3GL 4M48H 3REWB 4MQXD 2PN5A 3EO9H 3BPNB 2XV3A 3V6OC 4IRJC 4PRDA 3R0NA 2YD2A 5FGRA 3LD8C 3NQKA 4X9HA 5B3JF 3MCG1 1G7MA 4OLUL 5C92A 4Q89A 1UENA 5BNXD 3PWNA 4DKEL 1HXYB 2CG9X 3Q6GH 1SOXA 5BMFL 3SBQA 1WTGT 4BGLA 3IPFA 4J2QA 4U1KA 2O72A 4H1LA 5KTEH 4J28A 2XQBH 3HI5L 3QIWD 4ONFL 3EO1A 2X87A 4IU2A 1M05B 4DWHA 4QOKD 2QDVA 4Y16A 5DMKA 3MRCB 1J48A 4AQEB 4U49A 1MI5A 1EXUB 3D0AA 1JTOA 1TQVA 2Y06H 1W16A 1KB9J 1NAMA 1P5UC 2RTTA 3ARXA 3CH8A 1YCSA 4E41E 3VWJD 1TEGA 3DV6A 5GZNC 1FP5A 1J0KA 1D3CA 4OLZH 2AKRA 5DK0A 2WWKT 4WI9A 2AJVL 3ASNB 4JJ5B 3IKCA 4N9OB 4G5AA 4KK6D 5D2NC 4BFNA 3WN5C 4RX4A 4YPGB 4X0KB 3UTZA 1DLFH 4RGOL 3C6EA 3GBEA 4DP9X 3B2DC 2X7LA 5B22A 2JH2A 3PRZA 1W0VA 4XVTL 4IKIA 1R19A 5IEHA 2VO8A 5FFOA 1BD2A 4TRPH 4X6FB 4GIAA 3HE7C 5ESAB 3PWJB 5EMYA 1YN6A 4LCUB 4PJ9D 3V4PH 2Q2LA 5BOPA 1IFHL 1FH5H 1UWXH 2OI9B 3BMVA 2Z92A 1S7RA 1PG7W 3MXVH 4H20H 4Z3GA 3CC5A 2ITEA 4W93A 3VWKB 1T5WA 1ASPA 1BF8A 1I8MB 1JWSA 4HCRA 3V0WH 1WAEA 3JWOL 2XICA 4N2IA 4W4OA 1U92A 4XP4H 4WK4B 5JORA 5DEGA 3VUAA 2Y9RT 1CGYA 1MFCL 2R39A 4A7QA 1KCWA 4F2ME 1EQWA 1QSZA 2Y72A 1HOCB 2P8PA 3F3HA 3QUMH 1T5XB 4N1HB 4AENB 2G9HB 4M1GH 1H9VA 3KPSD 2JMRA 4W6WB 4UNUA 1FZJA 1WGVA 2V2TA 4DNLA 3OKLB 4QWWD 4JG5A 4ANUA 2GTQA 3MACL 4TQIA 4NAMA 3V0EA 2D7PA 1YEFH 3ULUD 2WKOF 5AALA 2WUBL 3DECA 4GP5B 4GW4B 2AGJL 2WUCH 2BVQB 5IHUL 4ZNCD 4LVNB 4H0HB 5D1QB 5AUMA 1QFOA 1MQKH 3LN5A 2GI0A 1NBZB 3P1VA 4YDKL 2NW3A 1FL6A 1TKWA 4ONGH 4UU9A 2G2RA 3T3PE 5C7XH 3LQAL 1P4IL 1YHPA 3DLQR 1ZLSH 1UYWL 4LHQB 2G3NA 5E08H 1ZTXE 1NMCB 1N0LA 1RUPL 1SJHA 3V5KA 4CC0A 1I9EA 4PRPB 3M07A 3LZRA 4YH6A 3NEEA 3BUTA 5AL0A 1Q90A 1S5HA 3Q8EA 1Q8MA 5KVMC 2WBJB 4Z7OE 5J3HD 2MHAA 2ZSWB 3SDCD 3FO1B 4DTGL 4F2MA 4WWKA 2JE8A 3QZWB 3T09A 5C0FB 1WVZA 1SFDA 1M7DA 1AGBA 4GXUM 1CXHA 3FOLB 1H3WM 1KY6A 4YN3A 3ARFA 5DJZA 2W07B 3SE6A 4I9WE 4MDJB 2IH3B 5GS0L 2CCLA 1AVAA 5DQ9B 5IW1B 4WZ9A 2XV0A 5GRVL 1A7PH 1K8IB 2L3BA 1IM3A 1XSOA 3QQ3B 5F96L 5SX4I 3FQRB 3V0GA 4ABWA 1BBDH 2CZNA 3VG9C 4HZAA 4KTEL 1P5VB 4ERSH 4GKOA 2ETWA 4BDVA 2WLYA 1ORQA 4N0YL 3RZWA 3G6AB 1DE4B 5E6IC 3UAJD 5FB8A 3W56A 5I1IH 5ELIA 2YAQA 1S8DA 4Y4KC 1EH9A 3HJEA 2UX7A 1BJMA 4TSAL 2VKXA 5EO1A 5IVNA 3ULAB 2KS0A 1AXIB 2Z91A 5IHBA 3C60B 2DH3A 2JJWA 1KELL 2ADJB 5TDPA 3KGTA 3WL9B 3GSNA 1HAUA 4OD2B 4FE9A 4YZFF 3NSYA 4XNQB 1B0IA 4JO2H 2F53E 3JTTB 3N91A 3S5LA 4JFOB 4NUJA 1HWGB 2GKIA 1FNSH 3CN4A 2WW8A 5E1AA 4ZRGA 1YRKA 4KKZA 3QJHA 3SOTA 2E6QA 4QD2E 3U0TA 1E3ZA 1QBBA 3GNML 2OV0A 1CDYA 3FCBA 1NFKA 4G8GB 1QKZL 4MAUL 3IJSA 2NY1B 3QGVA 2VQ1A 3QH3B 4H8UA 1IBGH 1MVUA 4MAYD 5J11B 5JZ7C 1JTPA 2CLZA 1USQA 4RFOL 3RGVA 5A2KH 4AWJC 4FA7B 3AMKA 2VDRH 1KTCA 4W6YB 1DEEB 5DK2A 2H1LM 4CBZA 2N4IA 3ZKQD 5HDBE 1FGNL 4NC1E 4XN2A 2NUTA 3B3IB 2EIKB 4PBVC 1OF0A 4P4RB 4HJSA 5I66B 2ZXWB 2FEEL 4GUCA 2XBZA 4YDIH 5B1JC 3D4GA 1QSEB 1I3RA 3IXTA 3VXMD 4OGZA 4M9OA 1MRDL 1FYTE 1UM6H 1A7OL 1A8JH 2FZ3B 4Y89A 1EO8L 1KGUA 3KLHC 4DGIL 3VTTA 3HNVH 4MKTA 2WZAA 2PO6B 3O2DH 1KIUA 1V05A 3VG0H 4YJZL 5AG8A 3OXSA 3HG5A 2NY6D 2F54E 4M1DL 2F53A 1OGAD 1ZMYA 1ZS8B 4JFDE 4FJYA 1CS6A 2JJUA 2MOQA 4KKCC 5C0GA 2OL3H 5AB0A 4MA1C 4X5QA 2MQ3A 3G9AB 4XBPB 3U36B 1FN4A 2HKFH 2WC7A 3SN6N 5EDSA 5DD0H 4YSPA 2APXA 3CUPA 4AGQA 2WCSA 3QUYC 4BKLA 4OJDH 3TFKD 2ADGA 2QHRH 4MVBD 2DICA 2EDXA 1PEWA 3C6SA 5BO0D 1Q9KA 2CNZA 5I8OH 4ODTL 3CVHB 4KI5E 1I1RA 5GGVL 3SDAD 4YS4A 5HHVH 5IB3B 4F93B 2BJMH 3PE9A 4MHHI 4YL4A 5IHZB 4J4PD 1VENA 4NPYA 4YDJA 2Z35B 3CH1A 3K6OA 4QRSA 1FYTA 4JRYE 1JXFA 4OUUB 3CHPA 3BP4A 5DZNA 43CAB 1P4LB 3CFMA 1KEGH 2VMFA 3O0RH 2BIPA 2X88A 3PF2A 4G7YH 1KXQE 3WIAA 1F86A 3SE4A 4F15B 4QKTA 2WXQA 4XP5H 3SE3A 3MFFB 4NQCD 2F54A 1J5OH 2OMTB 1NCIA 3VXSD 1FQ9C 1XCTA 4J3VA 4JFDA 1AH1A 1ETB1 2D0GA 4L4VB 2UZIL 4XVUD 4P5TB 5HDQL 5EIVA 3ECBA 2JTYA 5K39A 3QUZD 3K4DA 3MV7E 3WFBH 3GXIA 4JPKH 3HI6L 2X6MA 1MLCA 3GZPA 1KTBA 4Y9FA 3D12B 3HMWH 3IU3B 1PU0A 2F74A 1SRDA 4AH2A 4TPRL 2QL1A 2BNQB 2EEBA 3TT3H 5CEZL 1BQLL 3EBHA 1WFUA 3OAUH 4BSJA 1M7UA 3D50A 5FFLA 4AT6A 4DEWA 3ZIMA 1YECL 2JXMB 3EBAA 5GGUB 3VFUB 5ALCL 2BWQA 2Q8AH 4RSYA 3DIFB 1ILSA 4OM0H 4HP5A 4K55A 4QRQB 3W0WE 4RAUA 2XWXA 3SJVB 1OY3B 3WJJC 3U4BH 4JZJC 4EDWH 3KPRB 4HJGA 4QKXB 1T1ZA 2GCYB 4Z3JA 1Q0EA 4JRYA 5FO8B 4UTAL 3GHBH 2VXVL 4HJIA 4I4WA 2VWEC 4WUKL 3FTXA 1XIWC 5GISH 1KXQA 3TO4C 1HN1A 1G7IA 2JIXB 2DKSA 2H2SC 5CBAB 3GQFA 4PD4J 1N8OE 1CICB 1RJCA 1YEWA 5EBGA 3CCHA 2WJ5A 2XY1A 1MUJB 2R29L 1KGCD 2F7IA 4JG1L 5BXFA 1HC1A 1BQKA 1IC0A 3MV7A 3GSRB 2FD6L 3S7GA 1PNCA 4UQ2B 3IRCA 3G6JE 2NY2B 3GTNA 3CZKA 3IM1A 5CGMA 1NGPL 1FNGA 3BQVA 3LRMA 4M43L 3L7FB 4DPRA 4GSQA 2V37A 1SXZA 2VR7A 3D0LA 3WN5B 3HLKA 4WUUB 4FA6A 4MJ6B 4N2FA 3VVVA 4MNHB 3N40P 5CLWA 3HC3L 3W0WA 3KJ6L 1CGSL 4LNRA 4XNDA 1U3HB 1KXHA 3UAAA 4Z6AT 3MRBB 1F56A 3QC6X 1SYSA 3GS0A 3RWCA 2RCSH 3ZMNA 4PJFB 5LG6A 1M1XB 2YMXH 4L9LC 2J43A 4LSRH 4PJFF 4R84A 1ETA1 1ZVSA 4PJXB 4OI8A 2R2CA 1MOEA 2CK0H 4PJ6A 3VFNB 1NCGA 1U3NA 1Z5LB 3CVIL 4I0PD 4H88L 2R9HD 3E0GA 4FJZA 3BEVA 5HGHB 3UZQB 4DKTA 2VXQL 3N06B 4XMXA 5JDSB 3HB3C 1T21A 2NXZD 2DYSB 3NFSH 5JO5A 1LD9B 5BRZD 1AHWB 4IOIA 4QRRE 3ZKSD 2ODIA 3G6JA 2EDEA 2EECA 3EH1A 5I18L 3U4EB 5EZPA 5A6LA 2YEZB 3MPCA 3QQ9D 5FWQA 1TOXA 3H0TB 3ZXAC 1HE8A 2YAEA 4HJUA 4UMSA 4ZOEA 1NMAH 4G6FB 4WI6A 3QPXH 4N24A 4LSVH 1A1MB 1AHKA 3VFWB 4RAHA 2D0HA 3PP4L 1QVOB 1F1DA 3TXAA 3QUXA 3HC4L 1NC4B 4NBYB 5FGBA 4ZODA 4MNGE 4A7GA 5I19L 1MY7A 3PP3K 4BGDA 1IGCL 1WS8A 1DJHA 5AL8A 3GSXB 1UACL 3VO0A 2HT3D 4KK9D 2YRBA 4JO5A 1G9HA 1ZLVK 4U1LA 2QFPA 3I6KA 3P30H 5E7BA 4BFBD 3QDHA 4POZC 4FQXD 1LP9B 3A6BH 3DYMA 3UADA 4GB9A 5FHBH 4MVBC 1LP9F 4QRRA 4O00A 1GH7A 3I84A 1TDQA 4FX5A 4KPHL 5I74C 1AZUA 5IQNA 5CO1A 3ZZLA 4NWUH 3NIFB 3FQYA 4G42B 4AQ8A 2SEBA 1UHVA 4HUVB 4D8PA 1UQSB 1L3NA 2PXYA 1KYAA 4WFGE 5IJVA 1D5RA 3AAZB 2R1WB 4FZ8L 3E9UA 4MXWH 4PMEA 5EO0A 2QKIA 3MXWL 4WU5B 4XH2A 3MX0A 1JNLL 2A83B 1U8NA 2WHVA 1R5WA 3Q44A 4NOBA 4X5XB 1ZIBA 3S2AA 2ADIA 1OHQA 4UILH 2M2DA 1F90H 3LKRA 4HG4K 1G7QB 4MNGA 3RWDB 4MD5A 3BI9X 3HS8A 1TJHH 4DCQB 5T3ZL 3Q43A 1D5MB 1FZOB 1U6AL 3CIQA 2A6KA 2H2PD 5FGSA 2X4QA 1QRKA 5ID0A 2FLRT 3S48A 1QQDB 3N43B 1RPQA 4HKJB 4FQLL 4GUOA 3LMJH 2GJPA 3N43F 3RVUC 4ZUVA 3U0PA 2F7PA 3ETBF 1XB8A 2PNDA 4W70A 3D85D 3T0AA 2W38A 1SLWA 3WS3B 1Q1PA 4P4KC 1DBKL 4GO8A 3M1BB 4U1IA 1JD9A 4QRTA 3TBVA 2QELA 4LSPH 3DV4B 3MUGB 1MPAH 4PJ7B 5GGSY 4ZW6A 2PTVA 2WQVA 4RWYH 2N01B 4NQED 3DVIA 5T33H 4GW1B 3KYKL 4MNQE 2IADB 2WYIA 4PJ7F 4X5WB 3VCLB 3WIIL 5ACZB 3V4LA 1UCBL 4WK0B 4UNVA 4X6CE 4RQQA 1X5JA 3QCTL 2RIKA 4QOKB 3L5XH 1ZGLA 4HPOL 2VE6A 5EO9B 3TT1H 3LEVL 4PJAE 1MIML 2WLIB 3GSUA 3ZRCC 1EBAA 2Q5BA 4YDLC 5JXED 5LLIC 2D7TH 2PP7A 4M5YL 3D30A 3FU7A 5PCYA 5GS0D 3OHMB 5IMMB 1GTFA 1AQHA 3NK4A 3PDOB 4HIHB 3O6MH 3VWJB 4GAYA 1RUKH 3FONB 4HUXB 5IV2B 4ENED 1WWWX 1YY9D 2CIKA 4JFHE 3KM2A 1G9NH 1NSNH 5ES4B 3FW6A 5H94A 1ACZA 4MD0B 1KCVH 2AITA 3WCYA 4I1PA 5J1TC 2DKMA 3TV8A 5EOTA 1DBAH 1CBVL 4R4ND 5DFWH 3PGCB 5D7KD 3HJ0A 3GMPA 3K4ZA 5JOFB 3SYCA 3W2DH 1MCQA 4MA1B 2RH0A 4MNQA 4TUOB 3W57A 1JXKA 4YSTA 3FB6B 5A2LH 3FFCB 1WZAA 5F1IB 4X6CA 1SY6H 4FADA 2VDPH 2PPDA 2JB6A 2PCFA 4R7DB 2VLRE 4GXVL 3C9NA 3G7TA 4LCWE 4A6YL 1QFWI 3GRWH 4PJAA 4YBQD 4GSUA 1LGVA 2AXFA 1HCZA 4Q2ZB 1K4DB 1A4JB 3ARDA 5FYJH 3TCTA 3QXDA 2IWEA 1JNHA 3UZEC 5J0BA 5KYWB 3TCXA 4MX7B 3IVKB 4HFWB 1AG6A 4I85A 1QO3B 4IYKA 3L5WA 5DRWB 1AQMA 4NN7B 4ANWA 2Y7QB 5D6DC 5HGAB 5F3BB 3U0WH 2ZYSA 5G5DA 4ZPTA 3GWJA 4NZDA 1GGTA 2R83A 3PLYA 3SSGA 3KPSB 3D39E 3CNKA 3F7PC 1IX2A 4HV8A 3L4WA 3MRFA 1YQVL 2W95A 4LPCA 2OMYA 3BH9B 2W0FA 5AKSA 4ZW5A 2EVFA 2O93L 2PMZA 2XX1A 2D7QA 4G6MH 3UPCA 3KVQA 3ULUF 3NSFA 1FNHA 1GJUA 1UZ6F 3OB0K 4LBAA 4AI7A 3TIEB 4EIBA 4F27A 2CLRB 5ANHA 4YHIA 1CFTB 2CCWA 1LWHA 1YPZE 1E8YA 5IOPB 1FNEB 4GNKB 4NZFA 1KEML 2VLRA 2QVMA 2PR4H 1YLBB 2VDLB 2MH4A 1PKQB 3UXFA 3ZHKA 2MFNA 4GO9A 4LIQH 4PJGE 4MZRA 2I9TB 2VDQL 1NEPA 2VN6A 1RVFL 5FM5O 1ODUA 1KNOB 4FFYA 4NYLB 1HHHA 1INQB 3VMPA 4PW4A 3O2DA 1SN2A 1K4CB 2K3HA 3EYSL 4KI1A 3VA6A 1M3JA 2YRPA 2E9WA 4J23A 1E3XA 5C09E 3OJDB 3GBLA 4K7PX 1WPCA 4JB9H 1E4XH 3SDCB 1LO0L 3T4YB 1XF5B 5FLUA 1B88A 2QR0B 3AT0A 3WSQH 4DN3L 5D9SA 2OL3A 3O4LE 4CNIB 4FHJA 3T4AC 5F7UA 3CX2A 3D39A 1XIWB 4FXGC 1ND0A 3CHSA 4N22A 5FA4A 2FYYB 5CSZA 3S35H 3GLDA 2YN5A 1O9WA 4KNUA 2V7NB 2X4NA 3PWPE 3OZ9H 1F4WL 5B1BB 1ES0A 1AKJA 2DLFH 2FECI 4L3AA 4LRIA 4KROC 2CXKA 2E7HA 2OJZH 3FYEB 4O4YL 3O9WC 1KPUB 2X6VA 1DN0A 5F9JB 4HQQH 3BGMB 1BFOB 1YPZA 1PYWA 3DX8B 3ZLQC 4WFHE 3V2AR 1JHTA 2FQDA 4WU7A 4PJGA 3VXPB 3T2OA 2R7EB 2A1WL 4F20A 1CQYA 2OX5B 2PTTB 4N0FB 3ZTNH 4XN7A 5C09A 5GJSH 4JMNA 1DVQA 3WNNA 1P6FA 1MCWW 3WXWL 4P2QA 1CWVA 1X5ZA 1OTSC 3ME0A 5EBMA 1NEZG 3O4LA 2XBDA 4G7VL 3DK0A 1HZHH 3UL4A 1TYEB 2R0ZL 3JWNH 1X5XA 5D1ZI 4PRIE 5C2BL 1RH8A 3FO0L 3H3PH 3QAZC 4HD9A 2MNJB 1AC0A 4OZFB 1Z3GH 4CSSA 2WNWA 2HFEA 4OCRL 1QUNA 2W1NA 2CKBB 2N3JA 2XWDA 4DKFL 5D1ZA 1OV8A 1IAIH 4PY8I 4ZAKC 4AK2A 1ICTA 1MJ8L 5MEQB 1W8NA 4X99A 3ENEA 4K3EH 2IDSA 2EC8A 2FWLB 2OM5A 2J73A 4C56D 5KBNC 3HZKA 5FM4A 5F9OH 4BCYA 1C5DA 3BFOA 3OB8A 5KYXA 3VAEA 4A2MA 5H37G 4JZNB 1IBZA 3LKNA 2GBTA 1J05B 3O4OC 1Q0YH 1FFQA 4FNRA 3VXMB 4KU1A 2CUIA 2X4SA 3HS9A 4MS8D 2XN9A 4JG0H 5C08E 3DX1A 3U82B 5TDOA 5E2UL 2Y24A 4KXCA 5EN2A 2EYRA 3ZRSA 4EN3C 3GTVA 3T0XA 1SF3A 3HLAA 3LEYL 4JR9H 2VKWA 2OSXA 2NY6B 3VFRB 1OGAB 1D5XA 1XFPA 4O2EB 2IBGA 1UVQB 4OF7A 4UZGA 3W81A 3HG3A 4PRIA 4E9SA 1SMAA 3CSFA 3ULVD 3H53A 4R4FH 5FO2A 3X1NA 1Q9LA 2HN7A 4P04A 4F7EB 4F7MB 1PG7X 5GGRA 3FU0A 4NRYB 2AJSL 5DRXB 2FJFB 2BCMA 1ZA6A 2X3BA 4N9GA 3O2VL 1CUOA 2HP4A 1U4EA 2V3FA 3B9KC 5L6YH 1RJLB 3VGDA 4G9FD 4IIQA 3SDAB 3WS6C 2VLKD 3QB7C 4LEEA 4S1DD 1OK8A 1HL5A 2GSGB 3F7LA 4NERA 1OVZA 5CF3A 5L7XL 4BKTC 1T0MB 4M62L 5IVXB 3U6XS 3UC0L 3N6YA 4U3SB 4I0CC 4YGAB 3T8XA 4ZDHB 3WNJA 5IVXF 5C08A 4R4BA 4B53A 3L2LA 4K8RH 4PWFA 2EXSA 3KLSA 3KDMB 2CQVA 2C1OB 2RALA 3GJFB 2OP4H 4NQCB 3W9DB 3QHFL 3QRBA 4WV1B 4C83B 4XCFL 2HVKA 4TQEH 3R19A 1PZUB 3WKMH 1IIIA 4PGEA 2DQHL 3QUZB 1JJUA 5LGHH 3DBSA 3OD3A 1IILE 3S96B 2NY5C 2Y5QA 3QJQB 2VGLM 5IMKA 2Z1KA 2X2JA 3N9GL 1Q9WA 3OMZA 1OLLA 3MLXH 1XGUB 4X7TA 2DWTA 2NTSP 3L2MA 4YHNB 4P4KB 3TF4A 2FBJL 1RMFH 4S1SH 4WW2C 2FGZA 3OMNB 3Q1EA 1KJVA 1R5VA