4CSPA

Structure of the f306c mutant of nitrite reductase from achromobacter xylosoxidans
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
b'DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEACELGAAGHIKVEGKWNDDLMKQIKAPAPIPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
molecule tags Oxidoreductase
source organism Achromobacter xylosoxidans
publication title Impact of Residues Remote from the Catalytic Centre on Enzyme Catalysis of Copper Nitrite Reductase.
pubmed doi rcsb
total genus 91
structure length 335
sequence length 335
chains with identical sequence F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2014-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cspA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cspA02
1NICA 1SHWA 1MZZA 1QNIA 5I6NA 2BP8A 3TASA 1IBZA 1A3ZA 5F7AA 2J5WA 2GBAA 2BZCA 8PAZA 1PNDA 2VSMB 4HZ1A 4KOCA 4YSPA 4DP6X 5AFAA 3X1EA 2OJ1A 4GY4A 2XX0A 4A66A 3OQRA 1L9OA 4YSTA 4E9YA 1ZDQA 5B3SB 3KW8A 4RH4A 5D4JA 3FSVA 1RZQA 4P5RA 3BQVA 1ZIBA 3TU6A 3FQ1A 1JZGA 5I6PA 3CG8A 1RZPA 2JKWA 1XB8A 2AZAA 2XYBA 5D4IA 5I26A 1AS6A 2IWFA 2GSMB 2CUAA 2VW7A 4HCFA 1F56A 2Y1AA 2XLLA 3FU7B 2HX9A 3PCYA 1PY0A 4F7KA 4TXVB 1PNCA 5I5IA 4KOBA 3ABLB 4CSZA 9PCYA 4W1TA 4G71B 1ZPUA 3ZBMA 4HIPA 1OV8A 2YQBA 2P80D 3OMIB 4DP8X 1J5CA 2VMJA 1TKWA 2I7SA 3V9EA 1KCWA 1SJMA 1CYWA 1SDDB 3N55A 4YSUA 5B1AB 3AG2B 2IWKA 2J57A 3SBRA 6PAZA 3ZDWA 2AANA 2H47C 1HAUA 3ZX1A 1PCSA 2CAKA 2FTAA 3CDZB 3UAAA 2HLEB 2EIMB 4A2EA 2QPEB 4YL4A 4A2DA 2XX1A 2PCFA 1AZNA 5TK4A 4DPBX 4FAAB 1KYAA 3S3DB 3SQRA 3T6ZA 1A4CA 2QDVA 2PP8A 2GC4C 1QHQA 1KGYE 1UATA 1JXFA 1AANA 1KDJA 2CALA 5B7FA 2IDTA 1URIA 4GP4B 2FT6A 3ABMB 2GI0A 4P5SA 2TSAA 3X1FA 5LDUA 4BK5C 3AW5A 2EIJB 4HHWA 4A67A 5TK2A 1PLBA 3UADA 4YSAA 4YSQA 2ZXWB 2XV0A 3IEAA 1OE3A 4E9SA 1JZFA 1WS7A 2IDQA 1AACA 1ADWA 4HAKA 4YSOA 4DP9X 3C75A 2EINB 2MRYA 3X1BA 1XB6A 4AZUA 1NWPA 2UXGA 3QJTB 3S8GB 2HZHA 2GB2A 2XWZA 4MFHA 2YARA 4DP2X 2XV3A 3NSCA 1KBVA 4E9VA 4HCGA 1GW0A 4JHUA 1BQKA 3WG7B 1A8ZA 2XXGA 1GY2A 4UAHA 4E9XA 1TEGA 1J9QA 1BAWA 1CUOA 1GS6X 3UACA 1JXDA 4K9JA 1OCCB 4KNUA 5E9NA 3PAUA 4NERA 1BEXA 1GY1A 1B3IA 3H4HA 2Q5BA 1AAJA 1NINA 1KBWA 3UAEA 3OD3A 2Q9OA 2BZ7A 2X87A 2QT6A 2I7OA 2QDWA 2DYSB 2LLNA 2YAPA 1J9SA 3PAZA 2A3TA 3FQYA 1J9TA 4E9TA 2BW4A 1JZJA 1J5DA 2FWLB 3GDCA 1SFHA 1NIEA 3D12B 2VW4A 3DKHA 3PPSA 3SBQA 4CSPA 5B1BB 4JKNA 4A2FA 1OCRB 3NJFA 3S3CB 2B08A 1AR1B 3CVCA 1V10A 4PCYA 2HRHA 1PAZA 3ABKB 7PAZA 1GR7A 2VM3A 3FPYA 1YLBB 3JTBA 1ILUA 1PZCA 5B1JA 1AZUA 2X88A 4BWUA 1SF3A 4PAZA 2XXFA 3NSFA 2DV6A 3IN2A 5PAZA 4BWTA 1MZYA 4DP0X 2R7EA 1EHKB 2FQEA 1E5ZA 4WTQA 2YAMA 5A7EA 1GSKA 3WI9A 1AS8A 1WS8A 3T6XA 1CURA 2YAHA 1SFDA 2GC7C 4BXVA 1AQ8A 2BWDA 1A4BA 1JVLA 4G72B 1PLCA 4NAJA 2JFCA 2PP9A 3EH3B 5I5MA 2WO2B 1AIZA 1EZLA 2CJ3A 4Q8BA 2GIMA 1NIDA 1ET5A 5B7EA 3NJMA 1QLEB 4N4YB 3X2QB 1GS7A 1L9TA 1XB3A 2YAQA 3OMAB 6PCYA 2DWSA 2EIKB 2HX8A 1KDIA 2TSBA 1AOZA 3NT0A 2YAOA 2ZOOA 1FFTB 2P80A 3FYEB 4UANA 1DZ0A 1OCZB 3L45A 1MDAA 3UABA 3DTUB 1MG2C 3DIVA 5AZUA 4DP7X 4KO6A 2J55A 3G5WA 4HALA 5B1KA 2FQGA 2Y69B 2FQFA 1M57B 1V54B 3IN0A 2BWIA 3SBPA 4HCIA 1L9RA 4WKXA 3QPKA 3WNIA 1BXUA 4DPAX 3FSAA 4M3HA 1NWOA 2VM4A 5B1JC 1JZIA 1IBYA 2ZONA 1AG0A 2DYRB 1W6LA 4QLWA 1JERA 2IH8A 1T5KA 3S3BB 4YVUA 3NJIA 2H3XC 3N2JA 3BVDB 4QKTA 2PPCA 3QJRB 1NTDA 1ASOA 3FPXA 1WA2X 3MBWB 1WA1X 2DWTA 3IBOA 1ILSA 2PPDA 1AG6A 1OE2A 2UX6A 3EF4A 1HFUA 4G7SB 4A2GA 4ENZA 5PCYA 3X1NA 1J9RA 1WAEA 1GYCA 3T6WA 4YVNA 2FQDA 3WNJA 2ZWNA 4YSRA 5EHFA 1OF0A 4DP5X 5I6LA 4BDVA 4KO9A 1IKOP 1TEFA 2HXAA 1W8EA 1CC3A 2BP8B 4F2EA 4F2FA 1HAWA 1SF5A 2FT7A 3FU9A 3IE9A 4UF7C 3TBCA 3OM3B 3U25A 3NJNA 1TU2A 4N8UA 4AX3A 3FQ2A 3H56A 3ASOB 1KV7A 1X9UA 1E30A 2FT8A 2AZUA 2W8CA 4W9ZA 1SHXA 1JZEA 3T9WA 2MTAA 1IC0A 1BYPA 1NDTA 1NZRA 2XUWA 1BYOA 2RACA 3ABGA 1PZAA 2YXVA 5IY5B 1PLAA 1I53A 4L0PB 1M56B 1JVOA 2UXFA 3AG4B 2XVBA 2PPAA 4E9WA 3CZUB 2UXVA 1ASQA 1R1CA 2XV2A 3AZUA 2VSKB 4YSSA 3V9CA 3GXUB 2EILB 3CVBA 3H4FA 1L9PA 4M4RB 5I5JA 4GP8B 1BQ5A 1V55B 2N0MA 7PCYA 5I6MA 5F7BA 1WA0X 3CVDA 3NJJA 4BWWA 1NIBA 3FSZA 3NSDA 2OV0A 3FSWA 3EH4B 4FA7B 3S8FB 2YXWA 1FA4A 4E9QA 1N70A 2BP0A 3AG3B 2PPEA 2CCWA 2FJSA 1PMYA 3HB3B 3TA4D 4YSCA 2VN3A 3NJKA 1ETJA 4AKQA 2PLTA 2AFNA 5D4HA 2J56A 3NJGA 1NPJA 4Q89A 1ZIAA 3PAVA 1XMEB 4KNTA 3NYKA 2IDSA 1NPNA 1BXVA 3FU8A 2W88A 3KW7A 4YSDA 2WO3B 2B3IA 2UXTA 4GXFA 3WIAA 1PZBA 5I6OA 2XU9A 1E5YA 2BP0B 1FWXA 1KCBA 3NP3A 4YSEA 3FU7A 1VLXA 2R7EB 2PCYA 5I28A 1SNRA 3NP4A 1NIAA 3FYIB 4AKPA 1OE1A 1NIFA 4BXSV 1ZDSA 2BHFA 1E65A 5AKRA 2CBPA 1W6WA 2YAFA 3QQXA 2PPFA 4GP5B 2NRDA 3QJSB 1ET8A 3FS9A 4G70B 3NJHA 2BW5A 3CDZA 1RKRA 3WKQA 4AI7A 1DYZA 1OOWA 1L9SA 3PXLA 1E67A 2H5UA 4KO5A 4BDVB 1CYXA 2DY2A 3AG1B 1M9WA 2UX7A 2I85A 2GHZA 2WSDA 4DP1X 3QJQB 2IWEA 1IUZA 1AZCA 1SDDA 1ASPA 3OMNB 3AY2A 1PF3A 1AZBA 1BQRA 1A4AA 2QPDB 3GYRA 1MG3C 2FNWA 2AVFA 4NB7A 4HHGA 2OCCB 3JT2A 2YAEA 3PLYA 4JHVA 3RYMA 4A2HA 1N68A 3NJLA 3MX0B 3NSYA 2BO0A 5ANHA 1L9QA 3ZIYA 4A68A 3T71A 1AZRA 4KNSA 1AS7A 3ASNB 3FT0A 1X9RA 3TBBA 1A65A 1JXGA 4EF3A 2IDUA 1BXAA 2JXMA 3EH5B 4GYBA 2IDFA 1JOIA 1ET7A 4E9RA 1ID2A 4X4KA 1OCOB 4KO7A 4DP4X 4G7RB 2PP7A 2E86A 3WKPA 3X1GA 5B7MA 2IAAC 3QJUB 4G7QB 5FC9A 3ERXA 5I6KA 3HEIB 1ZV2A 3QJVB 3T6VA 3UGEA 4AKOA 1GS8A 3EHBB 1JZHA 4ZK8A 2HX7A 4DPCX 1RCYA 2HRGA 2IH9A 2VW6A
chains in the Genus database with same CATH superfamily
2NR6D 4JFFB 3S37L 5AD0A 5AW4B 4PGEB 2E9WA 3CAFA 3O8XB 1F90L 1RJCA 5FM8A 5EBLA 2V2TA 4N2IA 1YECL 2EO1A 1E9PB 1AHWB 3BSZA 3HR5A 5D9SB 4ZX5A 1T0MB 4XP6L 5C0FB 5AFAA 2XV6B 3X1EA 2P28B 3BYTA 2FB4H 3WXVH 2A9ML 5CLWA 1JV5B 1WAAF 2ZKYA 4BA8A 2I9LA 1DVQA 5IWLA 1NC4D 3Q6FB 3TO2A 3UYRH 5D7JD 5GGSA 3HI5L 1IX2A 2ZSVB 3G6DL 4P4KD 2VLKB 2R1WB 5CEYB 1CBVL 1PGRB 2YZ1A 3B1TA 4NZUH 3BQVA 4AYGA 2DQCL 1PEWA 1QP1A 1PG7H 4PJDA 1DVXA 3CXDH 3WO3B 1NCWH 1TJXA 1UACL 2VLMD 2G3XA 3G04B 3PXJA 5D7LB 3LJ3A 5AVWB 5GPRA 1HQ4B 2AZAA 2XYBA 4HX1B 3I75A 1GRWA 3TH2T 1N6UA 5TQ2H 4G8GD 3E7JA 3ARWA 3MYZA 1F56A 5KUMA 3K6OA 2HX9A 3F01A 4PHXA 2EO9A 4OJFH 1QEWB 4AW7A 9PCYA 1OY3B 3C5SA 3LS5H 1E3ZA 4OM0L 1FZOB 1JNNL 3B9AA 1E9OA 1K2DA 3ECWA 3WY1A 1TKWA 1LWHA 2J5LB 4JPIA 1KTRL 1Q1JL 1ONQA 2W9EH 3K3QA 4LOVA 5B8CB 4OGYH 3RAJH 3E6FB 3RJDA 3OWRA 1NPUA 5CINH 3UAJC 1E2WA 2DH3A 2X0WA 5B1AB 4YHNA 4GRWE 1LO5A 1JFQH 4MJ5B 1XEDA 2AANA 4HA1A 4PLJC 4MMYA 5LBSH 1JFQL 2Z4QB 1YVLA 3K0WA 1KFGA 1BJMA 4TKWA 3EGDB 5DUPL 5JW4M 1F4XL 1U8PA 2XX1A 4JFXB 3WNNA 1ZSDA 1RUPH 3ATEA 4JDEA 1I1RA 2WXLA 3U0TB 2GITA 3CZFB 4XH2A 1OXYA 4PLKD 4MXVE 3BCFA 4N8VG 2PR4L 4LPCA 4JJHA 5ERWA 4ZSOA 3OHXB 2GTWA 1I1FA 4TUOB 4AC4A 3AC0A 1PLBA 4FQJH 3UADA 2XN9B 2OTPA 3PDGA 5FYJD 1NFIA 2QGCA 5I1CL 4RGNE 3DETC 1ZT7A 4B53A 1JZFA 5IMLA 2V33A 4HAKA 3FFDB 3IXTA 3VI4B 1Q0XH 4FQQB 2MQCA 4F27A 4HSQA 4A6YB 4J27A 4EZLA 2XA3A 1IGFH 4IIQA 4LNVA 3VCLB 1JBJA 3RIAF 4B9CA 4XMXA 5AYTA 3BUDA 1YA5A 2AAAA 1VGEL 2LLGA 5J6SA 3BLKA 4DQOL 2OQJA 1WBXB 1RUML 3RWIB 2XG4A 4JFWA 5J9PA 5FB8B 4G6ML 4UAHA 2Q6WA 4E9XA 3B2DC 2E47A 3R06A 3V4VB 3JYBA 1JDDA 1N7MH 3WE1A 3OPUA 3HMXH 1YNTF 1PD1A 3T3PB 4RGNC 1ORSA 2RTTA 1PZSA 2RBLA 4ODVL 1AD0A 3MOBH 1OZUA 4MD5A 2H1LM 4P3WA 4IIQC 2DJSA 5AL0A 2AKRA 2VDPL 2EP6A 3J27A 1P84J 3SGEI 5CBEA 3FTGA 3HHMA 4FERA 1F1GA 2L4OA 1KXHA 5IUCA 1I7RB 5JA8B 1AQHA 3IM1A 5D2LE 4YN3A 2R2BB 3PWNA 1D5BB 4G8GA 2UYLB 2YZ8A 3GTTA 4XE0A 3ROOA 2AV1A 3GDCA 3OXSB 4I88A 1LO3L 2OR8A 3JUZA 4UAOB 2LABA 1GA2A 3DKHA 3AAZB 3GINA 2ITFA 2ZAGA 3A5VA 3NZHH 3CFKA 4V1DD 3BVWA 5G5DA 3ZKSD 3CHOA 2F53D 4CRPA 3L1GA 5FDYA 3BC9A 1MREH 3D0LB 4OCWH 3L9EA 2B15A 4LSDA 3REVB 3VDBA 2DLGA 5IROD 4UMSA 3RVXD 5KJRL 1TCRB 3SQOL 1MJJA 4ENEC 5IQMA 3UTSB 1FV1B 5C0JA 3GRWH 4BWUA 1VFOA 4PRBB 5C0NC 3S3JA 1ADQH 4Q74A 4XP4H 2BMKB 1OP9A 4QWWD 2W59A 3BVVA 4JHWL 3EYFB 4LSUH 2Z91B 4ERSL 5A7EA 2YAMA 3GBML 4KK9D 2VZ3A 1KF9B 5MENB 3FOLB 2QKSA 1ZXKA 4JPKH 5DRNB 4GAFB 1ZTXH 4U31A 4ZX3A 1PG7X 3MJ6A 1K9TA 3LH9A 4YBQD 3AQYA 2Y6SC 2J5LC 4K7FB 1KIUB 1CFQA 4MTMA 1NDGA 2XWXA 5C09B 4BELD 3PREA 4NUJB 1MPAH 2NNRA 4P99A 3RG1C 1TETL 1NGXB 2J8UB 3BP5B 5E2VH 3RKDC 1BDYA 1L9TA 4JCMA 2OMBA 3C6LD 2FUQA 3K72A 4U1NA 4ALAH 1BM3H 4L5FE 5F7FA 1FJ1B 4P8QA 5HI3C 3GMRB 4TVPD 2PCFB 4X6DB 3ESMA 1U8KB 3IU3B 4LARL 3T0EC 2J1YA 5I1HH 3LXBA 3ZDXB 2EDTA 3PWPD 3ULUL 1BZOA 1E6JL 4QMEA 4BZ1L 3MRJA 2CO6B 1CI5A 3ELAT 4ZMAT 3HRPA 3V9FA 4X8CA 1DSYA 5L88L 3K46A 4PTTA 4HJIA 1YEGL 4AV5A 3IN0A 3VMPA 2XN9E 1D9KD 1AO7E 3AGVA 4O2FB 1LDPH 2LHAA 1F8TH 3P9LA 1A1NA 5D93B 4DPRA 5JDSB 2X6MA 3B7UX 2ZE0A 5CEZH 3VXTA 2J2ZA 1DE4B 2ISDA 5BXFB 3I85A 3QCUL 1U92A 2X4RB 3WNLA 1EJ8A 5AW3B 2CSPA 4YVUA 1FH5H 4HIHA 1Z32X 4ZYKA 5K9JL 2ZZUT 3BVDB 3HC3L 1E9QA 2KS0A 5FO2A 1ASOA 3FPXA 4H2CA 1WA2X 2MPAH 4OU3A 4PRHE 4XN5A 5JO5B 4F7CB 2BM3A 4KUZL 2NSMA 4ZMPA 1KB9K 1S9WA 3VFGL 1UFUA 5FW8A 4NQCE 1RZFL 5HYJA 4H8PA 1KGCE 2VN5A 3FUHA 3T6WA 1IB5A 3T2QA 3TYFA 3NESA 2ZOLA 1DFBH 4F9PA 4ZO6A 1X7TA 4I18C 5LWYH 4DNLA 4XC3L 5J12B 2PTUA 4NUMA 1KN4L 4D8PB 5CCJA 4D94A 5KSBB 2XPGB 2MCPL 2BP8B 1CC3A 4JZOA 3KXFE 1OTTC 4Z0BH 1M42A 4OF3A 1INQA 3X3FL 2BSSB 3EDJA 1MVUA 3GS4A 3NABL 3FTVA 4PY8J 4Z7AA 2F6AA 4WW1B 4XN7A 2QQLH 3G6AA 3Q8EA 1EIBA 3CFTA 1TU2A 1H5BA 1BFVL 3HG0A 1D5ZA 4OLVL 4UTAH 1KV7A 4UI2A 1CK0H 4U1HB 4QF1A 3P4MA 3EYQD 2R0ZH 1W2KT 2D8KA 4I2XB 3PG2A 3PP4H 5H35A 4KFZC 4HWBA 4OR1A 1FGNH 4BZYA 4K3JH 1LEKA 3SKOA 1R3LB 3CZUB 4CMMB 1CL7L 4PIRF 2EAEA 4M3KB 3OGCB 4HHAA 2LW3A 1X5YA 5DJ6A 5EBLB 3GM0A 5IIEA 4R8WH 2NNCA 2V2XA 1A6ZB 1RLBA 3BT2L 4M8QA 2WXQA 3NSDA 4N8CL 1VFAA 3QHZL 3UZEA 2WK2A 1FA4A 3MLTA 3CVHB 2ZX7A 2G60H 1VDGA 3CFMA 1GGBL 1PKQE 4KZ0A 5GGSB 5LQBL 5C0AB 3C5XA 4N2GA 1JHLL 4LLUA 5TH2A 4B0MM 4DFHA 4F15B 3MXWH 2IAMC 3QNFA 5KVEH 2ZNWA 3MJ9A 4MA3A 1YYCA 4XO8A 3OJDB 3G9AB 4PUBL 5H2BB 4YWGH 4J5VA 1J11A 3LH2H 5GXBB 2NW3A 3O2DA 2J8UF 4M7KL 2YRLA 1Z2KA 1WG3A 3QYMA 1KLUB 4F57L 1QAWA 5ABDE 3V7AG 1IO4C 2Z8WC 1B2YA 3KXFA 1MIML 3RA7L 3UAJA 3UL4A 1O7SA 4PJBB 5I1DB 2R8SL 3WUWA 5KAQF 3BDBA 5GZOD 2D2OA 4W68A 1KIQA 3IJHB 5BVPL 5I28A 1T7VA 5DD3L 3V6OE 3FYIB 2JCCE 5D1ZI 1T5WA 4U0RB 2L0DA 1UH2A 4N0YH 2EUZA 3VDCA 2FBJL 4JREC 5CZRA 4ZFGH 2D7TL 1R47A 5A40E 5DEZA 1I8KB 1Q1PA 3LHPH 4XNUH 2AQ3A 3CDZA 4G9FD 3A67H 3RFRA 3S3SA 2JE8A 4ANKA 1CICA 3CHRA 1HN1A 3NEEA 3PJSA 4IRSC 5CMAA 1BQHG 2DQJH 4GEIA 3IFNH 5T1LD 2E4FA 4IRSB 3UC0H 1VERA 5JHDE 3L08A 1ZA6A 3HBZA 4F80A 3NFNA 1XIWA 2HKAA 2WKGA 1NH6A 3QWOA 4BFNA 4MMXC 4D9QE 4X5WA 4FOMA 1KGCD 2GJ6B 4ABQA 1QSFB 3W81A 5CGYD 5TF1L 3FO2A 4PRNA 3VQMA 5F9WC 3LV3A 1GJUA 1GZHC 4U6HB 4R4BB 1X5KA 3T1FB 2GI7A 4B27A 2AJYH 5CR1A 4JEGB 2X4UB 4PJAB 4A2HA 1Q9OA 3QW9A 4FXTA 2ATAA 3RL1B 2CDFA 2CMRH 3G6JA 3I9GH 1N8ZB 4N2LA 4OZ4A 4KRPC 2Z4TA 1WIUA 3BAEH 3SDDB 5DJDB 4OFPA 4K94L 4LNRA 1RERA 4ZFOB 3UTPE 3BH9A 3VI3A 3L5JA 1MXDA 1YUHB 1T6VN 3RDTC 4PSPA 2IDFA 3GSNL 3M17B 3OBAA 4NQUA 4U1LB 5SWSD 2FGWH 3RAJL 4EDXB 3UTSA 5C0JB 3QQ3A 4TNWK 1CFVL 5CGMA 2Q8BH 4BKSC 4H7VA 1IC7H 1FI8C 3INOA 4K3EH 5AVYB 4BFKA 2IAAC 4AM0A 1YZZA 4PD4J 1G9EA 4UT6L 3J07A 3KLSA 5CD3A 1IZJA 1UA7A 4FEMA 4JRXB 4ZFFA 3WN5B 3D39B 4FQLL 3DUHA 4FL4C 4KXBA 5DDHB 1NAKL 1P1ZA 2NNXA 2Z35A 4J3OC 3NIDE 2NSXA 1HHIB 1Z9SB 4V33A 4B7LA 1AGDA 4PG9A 1EAJA 4GSRA 1A3ZA 5DJXB 35C8L 4Y1AA 1M2VB 2GBAA 2CJUL 4YXKH 1U3HC 2VH5H 1Q9KB 3QI9D 5DVNA 2C3VA 1GVIA 1Z9MA 5D2NE 4HIEA 2DAVA 1FYHB 3IETA 5CCHE 3P9MA 5DEGA 5EIQA 5A1AA 4C54A 3ZKNC 1DJZA 1YMHA 3GB7A 4LO9A 1XF5B 4CADB 5FAAA 3UTSD 2VR6A 3QZWG 4NYLA 5LB1A 1S6NA 1TVBB 2N7SA 4MCZB 3SJVD 1NUNB 5BOPA 1K5WA 2KL6A 5LGHL 1TFHA 3QI9B 4PW4A 4FLOA 4P5RA 2Q7NA 3QIBB 1C12A 1N8OE 2YRPA 4QAMB 4N3UA 1UZGA 3O4LE 1U8QB 1OPGH 5EF2A 1DVFC 4AYDC 3LN5A 5CIPB 1R0AL 3GMMA 1ZHLA 2ICEA 2UY7B 2E9BA 2V8MA 4GINA 4JPQA 3RPIA 4F24A 4F1SA 3FUDA 1SM3L 4YHIA 4R7VA 3VI3E 3HS0B 5E94B 2Q86B 3DJZA 4ADGA 4W9KC 1KB5B 1KB5H 1ZPUA 5E1GA 3BIBX 3OMIB 2P80D 1A5FL 1ONQB 2EKJA 5C6TL 4PN6A 4HLZH 1HCVA 5F72S 1FHGA 4PWEA 1Z66A 1J0HA 3VD7A 2B9BA 2XWTA 1IC4H 2CO2A 2MH4A 3RNKA 4CJ0A 3QXVA 2XIDA 1BG1A 4EEEA 4AH2B 1ZGLA 3ESNA 3QUYA 5D7KE 2AEWA 3WTUA 3C12A 2FJGB 4IDJH 1W0WB 5GISH 4M43H 5JZ7C 3DX7A 4S1RH 1OM9A 1QFWH 4FQ1L 4XMPL 2EIMB 1NUGA 2YFNA 3CFNA 1AR2A 4QRRD 3VXSD 4XBEH 4PJ5D 1DDHA 1PZ5B 4X7SL 3ET9F 5C8JA 4L9LA 2A9NH 3C8DA 2R39A 1FH2A 3C09C 5DTFA 1HC1A 1A3RH 1IAOB 1LK2A 2GI0A 4NGHH 1JWSB 4KHXH 1QLRA 2EIJB 5MEPB 4C56A 4YSAA 4HWEL 4UNVA 4IGBD 1NCBL 5CZXD 3K4ZA 5I8OH 3K2MC 3VXOA 1QSFE 3BP7A 2H26B 3LPFA 2J71A 2ZYHA 1UWGL 3DXAE 4ZBJA 2NZ9D 4A38A 2YBRA 6FABH 1IEBA 4PFEA 1N59A 1UD8A 3SGEH 3TC9A 4LEXH 1J5HA 1J05A 4G59C 3SDDC 3ZDXE 4NCDA 1NFAA 4PG2C 4Z7VF 4NC0B 2LGNA 3CK0H 4POZC 4QHLA 4PJ7F 3LS4H 2E7BA 2HA1A 3OR7B 3Q48A 2R4SL 4ONFH 2R4RH 4BQBA 5CEXB 3EXLA 1WEJL 1TEGA 4XNMB 3CUPA 3HG1D 1X5HA 3GXDA 1CO1A 5E6ZA 2X6VA 1OEZW 4TRPH 1MCPL 5T3XH 2BNRE 9CGTA 2WLKA 1MUJA 3F7KA 3SZKC 5D72L 5I18H 3RIFK 2BOCB 4PJBE 2CK0H 4GQZA 5AOIA 2A4CA 5AKVA 3OD3A 3US1A 3HC2A 5DRZA 1UZ6E 1E4KC 4EOWH 4IS6B 2DWEA 2OX5A 3L1EA 1BVLA 5IJBC 1TZGH 1FFQA 3ZK0A 4FI6A 2AJZA 3BVXA 5HVHB 1MCDA 2R0LL 3S88L 3T3MB 1J9TA 1TVHB 2Q76B 4NRYA 4PJ8A 1SFHA 2DH2A 3ZR6A 2NSQA 3ARGC 1YNTB 1RLWA 3W39A 3KBHE 3L5WB 5ENWA 5D2NC 4DZ8A 3S8WA 3FT1A 2Y7OA 2WOBA 2DEYX 1CXEA 4KUCF 4M93B 5IMLB 3RX7A 1U6AL 2Q8AL 2NX5D 5KBMA 3S4SA 1F58H 1RIVH 4MLIA 2ICCA 4IK7A 3ABKB 3CPUA 1S9KC 2HT3D 3VXRE 1EBPA 1I9IH 2BRRL 4JHAH 2VM3A 3PGDB 5HSFA 3O9WB 2DQFB 4KQ3L 2X2JA 4HF5H 5C86A 4UQ3A 3FU6A 3HFML 3VSQA 1NC4B 2XCMC 3ZTNL 5F88A 2ADGB 2R0WH 3P3SA 2HRLA 5GSVB 1QKZH 1U3YA 3UAFA 2F7IA 5MENA 1WBXA 5IBUB 4PYGA 4CBZA 4Y5VC 5DJAA 3UX9B 4N2OA 1ACZA 4MQTB 3UEZA 4OCRH 4Y19A 1ID5I 4OZIB 2ZOKB 3MKGA 1JAEA 1FFPB 2VDLB 3MNZB 2QQLL 3JTTA 3S35H 4S1DD 2JI2A 8CGTA 5JHLL 1FSKC 3QR1A 4JG9A 4L4VB 5LBVA 1FSKB 3CBJB 1KCKA 1XB3A 4PJFE 4LASL 1H3PH 1AOZA 3DX8A 3CSYB 3KPSD 4UV7H 1NGYB 1DZ0A 1U9KA 2YO3A 3IKKA 4BQ9A 4PJBA 1PLGH 5HD8C 5H94B 3KXFB 1CFMA 1DVTA 2AV1B 3DIVA 3II1A 5JXAL 1AQMA 4X2UA 2VDRL 3EHBC 4MCYA 5DXWA 4DIXA 4NN7B 1MCWW 3OX8A 3O0RH 1GOGA 3KR3L 1A2YB 3V0JA 1CT8B 4Q7DA 3TURA 2HSIA 4Y89A 5T3ZL 3FN9A 5IFHL 3VFWB 4KKCC 2DBLL 2LU4A 2VLLA 5HHNA 4WU5B 1EXHA 5A2IH 1RK1B 3MV8A 2OW6A 4GG8A 1M6UA 1FNEA 5TF0A 5B4MC 3DRQB 3EO9H 3CC5B 4FQQA 1D3CA 3KPSE 4I13B 4Z7QF 3UYOD 1TZHB 4H1LB 1JERA 4YIQA 3RKPA 2HMID 4JGNA 1D9KB 1C5BH 3RVWD 1WA1X 2C7UA 3CFCH 1I3RA 3JWOH 1IBBA 1OE2A 4RBPK 2VSDA 2XNAA 2WKOF 3BE1H 3HS8A 3CLEH 2QSTA 4LT7A 4M7KH 5KJ4A 4MB4A 1RZ7H 2XTJB 1AFVH 3JWNC 4WIQA 3SKNA 4XPFL 3QAZC 1YQVL 4Q6YA 5D7SL 3HZYA 4PV9B 5JHDA 4LU5L 2AXGA 2GUYA 4FLHA 1UM4H 4JZJB 3WFBH 2EECA 2R8SH 1B0WA 1CL7I 2W9DH 3M7FB 1DEEB 1TEFA 3EYSH 4HSCX 2YUVA 2FDBP 2GVYA 4ES9A 1CF8H 4JFPA 5IR1B 2WAQA 5D4QA 2JV6A 2Y5TB 5E2VL 1JNLL 4Z95H 3IE9A 4Z7VA 1CXIA 3GI8H 2XZQL 5FIEA 2WNWA 4Z95L 3SO5A 5E00A 3QQ3B 1XCXA 1SJEA 4YZWA 4JPWH 5B39B 1HYSC 1QLFB 4OZGA 3GEFA 2FT8A 4ZAKD 2XQYA 2W8CA 3CDGB 2I69A 1RIUL 4JL2A 4XTRC 2R69L 2CK2A 1XR8A 5E6RB 4TVPH 5I2IA 2V5MA 4IHOB 5BQ7A 3FNKA 4XMVA 2F15A 1SXAA 5IW1B 5JDSA 4I3RH 5G5DB 2XVBA 3W38A 3K6SB 3ZKQD 2MNJB 2EDJA 3RVWC 4ELKB 1CMOA 3IGLA 5F89B 4CNIB 1XO8A 5EU5A 4YXLH 1P84K 5F7MC 5FK9A 4ZUWB 1BQSA 5GGRY 4I48A 4KKPA 4V1DB 4NRXB 4Z3HA 2EDEA 2BNUB 3DOSA 1CG9A 4OGYL 3I9PA 4BM7A 4OF0A 5EZOL 3BFWA 3WHXB 2BOBB 1T1ZA 4JQVA 2WCSA 1E40A 3WIHL 1WWBX 1I1CA 3HB3B 4PJGA 3RVUD 3O6LL 3KLDA 2IANA 4X42A 4XX5A 1KXVC 4O02H 1WIPA 1ZAGA 4X5RA 4Q89A 4HKBB 3OXRB 1SMAA 5E8DL 4DGUA 1IFHL 1ZLEA 4LPTA 5DD6A 5ANME 2J8UA 1TJIH 3VGAC 3RWDB 3FTYA 1U30A 3MMEA 5HD8D 3VGAB 2NNAB 1L6ZA 3D3VD 3SCMB 1QA9A 4KKCD 3ARBD 4OJYA 4UBDD 3WIAA 3RX9A 3VXME 2X28A 3KMDA 5FYKH 2R27A 5C0BB 3B8YA 3BT0A 4PCKA 3ESVF 4NZJA 2BXZA 2JJVA 3O3EA 5F9WB 4XP4L 4QRTA 4YUEL 3VD9A 3G08B 1PD6A 2HVBA 3O3UN 1J1XH 1ZHKA 1IAIH 1R33A 2YUXA 1OE1A 2B1AL 3N41B 5FO8B 4LDEB 3TO4B 1IAIL 1H8SA 2I07A 4JRYA 2JIXD 4U7MA 5EC2A 5C07B 4B5ZA 1IM3A 3LZOA 3OKDA 3WKMH 4PWKA 4B9IA 4MLSA 3FRPG 3PYCA 4PB9H 3QJSB 3FBQA 4DGYH 2QTVA 3N1PC 5I8KH 2QKIC 1CFNB 4HX1A 3U82B 3KS0J 4FA8A 1QBAA 2DOCA 2PYEE 5IF0A 3GBLA 4DKFL 1OW0C 1E4XL 2V9UA 2Y1VA 3D51A 2WANA 3ZL4L 2WLHA 3C5ZA 3H7BA 5IHHA 3JVFC 3A4FA 5F3HA 2KYIA 1TXKA 2VLME 2XN9D 3L48A 4UINH 5IW3A 3W2DH 1ACYH 5GGRB 4U6YB 2Q3AA 4NN6B 2DWEB 4Q4EA 4A37A 4JZNB 4P5TB 1GC1C 1TO4A 2QELA 3FZUD 4HK3J 5C9JB 5DK2A 4G6KL 4P3DA 1WISA 1OAXH 1ZXQA 4HFWA 4U1KB 1HZKA 5D1ZC 4U1GC 4NN5C 2R59A 1EZSA 4ISVB 4C56B 1W72A 4ZUTA 1MLCB 2K3TA 3BSZL 5HGDB 1EEZA 1KLFB 3T71A 3UCQA 2ZKHL 5FOBB 2VABB 2E7HA 1VGKA 2FHCA 4OCXL 5I66A 4ETQA 5KSAB 4YFLF 3VFNB 3FTXA 1GZQB 3W37A 2DQFA 4NXSA 4YFEA 2NXZC 3NEXA 4OLXH 4QHLB 2V2TB 3I02B 2EDWA 2GFBA 2NY0B 3ARGD 3F64A 3QXAA 4MGXA 4XB8A 1URZA 2D4FA 4R7DA 4A6YL 1I3VA 2F08A 4E9LA 4PIBA 1BJ8A 4TUJA 2PCXA 2XN9A 3HG1B 3U36B 2AJSL 3DJRA 2EUVA 2QBWA 4KHTH 5T33H 3TIDB 2O72A 3P0VH 4I87A 3RZCB 4PJXF 3FFDA 1L5GA 3PWJB 2O6FA 2NY1D 2G4EA 2VDMH 3QRFM 1LGVA 3LTVA 1G1OA 1JSYA 1KGJA 2VZVA 3BGFC 4GKZB 2E56A 4EUPA 4XC3H 2DLTA 3AS2A 1HINH 4HXBL 2CPCA 4LCWD 4YLBA 5IOKA 3A6BL 8PAZA 2VSMB 4HZ1A 1BQLH 2Y7QA 4LSSH 3ULUC 2VLKD 2OJ1A 3D48R 3LPWA 3IMSA 1DQDH 5FDWA 2Y24A 4PR5A 3TBYA 3KHOA 3AITA 1KJMA 2OMWA 3MRFA 3HI1B 5J1TC 3EJTA 1B9KA 4OD1H 5HHOE 3LVTA 5AOZA 2VKWA 4NM8H 3KJ6L 4I0KA 5ID0A 4PJ8C 4X4ZA 5JQ6H 1S7WA 2VDNH 1XHHA 4Z6AT 2Z0BA 3CFJB 3SYAA 4G8EA 3BAWA 2IC2A 4MQXD 3F7PC 1TJHH 3NCEB 1MCIA 4C83B 4ATWA 5EH1A 2LR4A 2NW3B 1TTCA 1AYOA 4K3JL 4KGLA 2JKWA 4JFFD 3FUNA 4LIQL 4AQEB 5DWUH 5DHDA 5F70A 3KDMB 4OZHE 5IVXF 2VW7A 3QQ9C 4OIAA 3OAZK 5FFLA 1W15A 3QORD 3Q0HA 1G94A 1NSNL 1IARB 1MFBH 5T1DL 1L7TL 3U4EB 1AGEA 3D7PA 4RAVB 3W5NA 4P57A 5E9DA 1SLUA 5DUJA 4UTBL 5KUKA 2I7SA 4KK5C 3V9EA 4WUKL 2R2CA 4CMHC 4N1CA 2F9BT 1SDDB 2NUPA 5HYSA 3NIGF 1YEEL 4X80L 2LU3A 4KJQC 4OLZH 5EF1A 4WK0B 2H0PA 3CMOH 2H47C 3QZNA 1M05B 2CAKA 3S5LG 8FABA 1CGVA 4NBXB 3BAXA 3AT9A 1YN6A 3PFUA 1RZFH 1XH0A 1Z7JA 4FCHA 4FG6D 3WJMA 1CTMA 1S7QB 1LL1A 4E42A 1SJVA 2D7OA 2KH2B 2QDVA 4GBXD 1QHQA 4OY9A 4X5WB 4IBUA 5E5LA 3GO1L 3TBTA 2L7EA 4B50A 5KW9H 4XXWA 4WHDA 3UROR 3IXAB 1A7QL 3NIGB 5DVKA 3ZR5A 4PVNA 3HAEB 4HHWA 4L1TA 4OBRA 2VITB 1U42A 2X4QB 4JN1H 2VRAA 3VFWA 4C4UA 1JGEB 5FYKU 5EF3A 1KGUA 3OJ2C 3G6JF 5DUPH 4BH7B 3DRQA 3ESOA 3JTSB 1YO4A 5HJ3B 4F1ZA 1YEKH 1TQBC 3L6FA 3GMMB 1XB6A 1DUYA 1U3HD 3L3JA 4ZAKB 3NZHL 1Q0YH 3CZNA 3PGCA 1L6PA 3MROB 2H32H 1OCWH 1AH1A 4R4NC 3D25B 1JD9A 4M7JH 4JAMA 2X1QA 2XACC 4ZO7A 3T0BA 3VYPA 1OQOA 5AVXB 3PJNA 1J1PL 4AV4A 4ZRGA 5C7XH 2XBTA 1LO4L 4ZMZA 3ZUCA 1JP5A 4LHUG 2P5WE 1U3HB 3FB8A 4JRXA 4LGPB 4Q52A 3VFMB 4OI9A 3VM5A 4PH8A 2IH1A 4YHYB 4OTXL 2G2NA 1C9SA 1R24B 2C9AA 5DD1H 3R19A 5AYQA 3POCA 2GJZB 5K9OA 5IREA 1XD1A 3BO8B 4HETA 3A6CL 1A6UH 1LO0H 3MFFB 2X3AA 2AEPL 4G9DA 4XCNB 5DUML 5KVFH 1RUMH 4MQSB 4OZGB 1KC5H 3TCTA 1OB1A 3MAWA 4JB9H 2BW4A 5MEPA 4WU7A 2Q8BL 3M1BB 4O5LL 3NVQA 2AK4E 3PWLA 1GGCL 5I1IL 2CBTA 1JTPA 1FDLH 2LVCA 2VIRB 2XWDA 3C9NB 3SE4A 3V0IA 2B08A 2HT2D 1QNZH 5I71C 5E5UB 4DUXA 3EJYC 3NZUA 4M6OL 4ACPA 3IFLH 3B37A 3S37X 1VFBB 4PJHB 3JTBA 4OZGE 1IBDA 2AK1L 2BH0A 4ZDHA 3SE8H 3D3VE 1N9PA 1VZIA 2CIIA 5BRPA 1SJHA 2W0PA 4FYTA 1T3FA 4PM1A 3ATFA 1T83C 4UNTA 5DT1H 4XT1C 5PAZA 4BFOA 4DP0X 2EIEA 4X6DF 5JW5A 1EHKB 2X41A 4G1EB 4WTQA 2P7TA 3CGTA 1R5WA 4GKOA 1AXSB 3I50H 4A39A 4P4KA 3DSFH 4WUUD 4Z3EA 3H0TA 1EO8L 2GC7C 1AR1D 4QI3A 4F8LA 1JVLA 1UEMA 2WYZA 3QORB 2YQ2A 4HJJH 2OMZB 4XOBA 4HIIB 5CLTA 3ZGHA 1QZNA 4MSWB 1NLDL 4DEWA 2XWJB 4WHTA 5KYUA 2D0GA 4MNQE 2GSGA 4PRDB 1MFEH 3DHPA 2C3HA 2C9XA 5EOTA 1KDIA 2BCKB 2DQHH 3GSXA 2CDGA 1NAML 3F7YB 4LCVA 3L3KB 4M02A 4R90H 3L4TA 3FYEB 1T6BX 4HS3B 1E6OH 3MLTB 3IMUA 1CBJA 4IK6A 4LKCA 2H0JA 4POUB 1E28A 3NDZE 4MMZB 1RHFA 5GSRA 1KOAA 4IM8A 1QSZA 4MVBD 4O9HL 4Y9GA 5HHPA 4DQAA 2XWBA 1NCTA 3W11D 4LSPH 1BFVH 2OJZL 4GQRA 2WIMA 2I07B 3BUIA 4KBPA 2GK0A 1HXKA 3LKNA 2ZX6A 2VLRE 4G2AA 3IJ9A 1JHKL 2R1YA 4K8RD 5IT2L 4IRZL 3LKSB 3EOBA 3MBEC 4XN8A 1MEXL 3HPJA 3BLPX 3DVNB 1G5GA 4U6YA 3IDUA 1T0NA 1YECH 3RIAK 5FR3A 3II3A 4XNZB 3G6AB 3CZGA 5EU6D 3MLUL 2CD0A 4HLEA 1I1AC 1U8NA 1QRND 2FB4L 2PYEA 3DSNB 3NPSB 4ZNEE 4N2DA 4Z7NB 4L23A 5MI0C 4MAYD 4HJUA 4LSRH 4I5BB 1T1YA 1QI3A 2EH8H 2WY3B 4HS8H 4LP4A 1MVYA 4Z23A 3JV4A 2P4AB 3DX8B 2ESVA 4TNVK 1DO5A 4HV8A 3VXUA 1YPZE 2CRMA 4ZS7H 1SF5A 4AWJC 4UF7C 3VE0A 5KSAA 4RFOL 3OZLA 1O5PA 2QQKH 1ECZA 2IIJA 3UGUA 4FG6C 4J3OH 3STZA 2Z92A 3N44F 3L13A 3MJ9L 3TZVC 4L8CA 2BNRD 4DGYL 2BVOB 1QFWM 1WDAA 4M8QB 2MJWA 2Y2WA 4NAMA 3B8SA 3KCPB 4WO4C 1BYPA 3MYJB 1HXMB 1TENA 1YPZF 3DBSA 3QIBA 4LLYB 3TIDA 3L8QA 2OTUA 3U7AA 5CF3A 4L2YA 4LQFL 4Z0BL 4LLQB 3JV5A 1KMGA 3U9WA 3AZUA 4U4IA 3KWWA 4PMEA 4Z3FA 3R4RA 5HTSA 5IKCB 4EDXA 4WTZA 4HJGA 1CGYA 2N0MA 1CBVH 4AYSA 3IDXL 2OXGB 3QXTA 3PABB 1VSCA 3NJJA 3K8MA 1RPKA 3FSZA 4YDJA 3QK0A 4FA7B 4E9QA 4E5XG 1TEYA 4H0HB 2DQEH 1MLBB 2HVJA 1TZGL 5DJ8A 1N5AA 1EX0A 1IAII 2CCWA 2PPEA 2UV3A 1KTKE 4I9XA 3D0AA 4I1NB 5DJYB 5FYJE 4GMTH 3MRFB 5GISL 5JHDB 2PR4H 3VXNB 5ICYB 2BNRA 3IFOB 3REWB 2AFNA 4JL1A 2XWEA 5D5MA 2WNXA 1B0GB 2IV8A 1IKNC 3WMSA 5BVJA 2DRUA 1E50A 1NPNA 4Y2NA 5DCCA 2W0LA 1QFOA 1J9CT 4HJTA 4L4VE 2PCPA 4R8WL 3SKUD 4MHHG 4U2ZA 4EIZC 4KTEH 2EXWD 1TTFA 2PW1A 4R7NA 1DLHA 4HWZA 2O1AA 5IQOA 2Y72A 1SN2A 2XSKA 4B6ZA 5EN3A 1JPTH 4URTB 3MGTB 1AP2A 2EEXA 3L9RA 2HB0A 1XF4A 3GHBH 2ID5A 2A74C 1CFTA 1KTJA 2EEDA 3MJ7B 1OAUH 4PJEB 4U1GB 3VSUA 1BMZA 4GSQA 2BSDA 4YHKL 5T5FL 5SWQA 4KI5E 1XF3B 1X5FA 3CMGA 2ZOUA 4YHOH 2UUDK 2YAFA 4G6MH 4GP5B 4P23C 3TF4A 1FFOA 2EC9T 3W0WB 3RVTD 5E2UL 4QHKJ 3L1OL 1IAKB 3WTYA 1U8HB 4Z78B 4X5LA 2ATKA 1XCWA 5E9DE 5IHWA 1BBDL 5F0MB 3HS9A 3TLRA 1OAZL 4I4WA 5HDBB 3UPRA 4YLCA 5DD3H 5E23A 2WSDA 3QAZB 4DP1X 3DV4A 4X6EA 1D9KA 3OAWA 3L3OA 2F53B 1XEUA 4ZW8A 4JHBA 4JZJC 1NFDB 2P5EB 3FUMA 3EFDL 2FJHB 4UMGA 3WY3A 4P3DB 4JE4B 3FCGA 1DQJB 3OMNB 3BYYA 2XWCA 4IBYA 1V8HA 2BIMA 3MLWH 2AQPA 3OXRA 1Q9LA 4Z7NF 3C5JB 3GXIA 3K2UH 3SYOA 3GYRA 4G7VH 5C0ND 1BFOA 4FABH 1HHJA 1EAPB 2PYFA 3O41B 3H8NA 3OKOB 3FN0H 4TOYL 2VYRE 3DA0A 1KJ2H 5E8DH 4NQXB 4OCLC 2O6CA 3MNMA 4P23D 2B0SH 2GHWB 2VDOL 5BRZD 4DCQA 4M62L 2YSTA 2ZCZA 3LMJL 4EF3A 1NBZA 3HZKA 1DN0B 5MP6L 1GJWA 2MMXA 3OAZH 3TCLA 4JY4A 5IW6B 4PGBB 1OCOB 1LK3L 5E1IA 4ZFOL 2H8PA 2GABA 4RZKA 3X1GA 3QHFL 1QLFA 2YK1H 3QJUB 4J3OG 3IETB 3BP4A 4LLWB 1VHPA 4JAMB 1RPUA 3ERXA 3TN0D 4XMUA 4ZUUB 3EFFA 1EVTC 4QHNB 4AQZA 4EI6A 5LHDA 3QNXA 5CN2A 5DHEA 4F8TA 2WGXA 3DX6A 3LXCA 2YPVL 3EHBB 4ZK8A 3QZPA 4K2UL 4EDWL 4Y8AA 2LE9A 2C1OA 5JQIB 5J11C 2BJML 4YGAB 2HFFA 2VC2L 3LX9A 3BDYL 4RFEB 1R24A 3H2QA 5HGAB 3FT4B 1CTOA 4MAUH 1IGML 4AEHL 3GJEB 2OMYB 1BM3L 2NDGA 3IRZA 1YEHL 3RWJB 4P4RB 1WTLA 5J89A 4A66A 5T8IA 5JPNB 4RIRB 5I0WA 1WT5A 3M45A 4J6RH 4HOWA 5IB5A 1FL3A 5E08H 1NCAL 5AVSB 2BNQD 2WLIA 2WQ8A 1R0AH 3FKUS 4X4ME 3U7WH 4AM0Q 2K7QA 5D1XD 4ZTPL 2JIXA 1YYML 1P69B 4WCYH 1IEAB 4GRWB 1WD9A 3CFBA 4NC1C 2W94A 3DV6A 1AS6A 1QA9B 2IWFA 2K6ZA 3VH8G 4WCYL 2OAAA 2XHNA 1QACA 5DHYA 3QEQD 3UZVB 1XF2A 4EPSA 5KZCB 1UHVA 1MRFL 4GG6F 5JR1H 5J8OA 5EZPA 3UC2A 1MJ7L 4UYQA 5DURB 1TOXA 3MR9A 1QO3B 3O3AB 4ALAL 5JW3L 4J3TA 1F86A 1LJMA 3V55A 4Q9QL 4Z3JA 2ROXA 4Q14A 4BFFA 5B38B 5DA0B 3DVGB 5SWZE 2A83B 1P7KA 4YHNB 3TP4A 4H13C 4GKZA 1S2EA 2HN7B 8FABB 3PWUB 4IOIB 4F8PA 1CDIA 3MUUA 3PHAA 4JPKL 4TLUA 4DKDC 3D05A 3DUSB 3UAJD 1T0MA 1MHCB 5I16B 1A7NL 5LGHH 1AHMA 2QPEB 4GG6B 4ZMWA 3LKOB 3PL6C 4XAWL 3FCBA 1KYAA 3FTGB 3CHSA 1PDKB 4M93C 3EGXA 1GGUA 2NYZA 4JW3A 1JXFA 2D0HA 1J8HE 4OZHF 1GAFL 1D6VL 2CZNA 3EYVB 3QEQA 2GTWB 5HHMB 5I1GH 1JZ7A 5EUOF 1XZ0A 5GRJH 3JWNH 4LEOB 1RZJL 1NUDA 3IDYC 3ZO9A 3TA3B 5AOMA 1T1XB 1WS7A 3BZFA 5AW8B 3VI4A 4Z7OF 4DP9X 3GNMH 4MKMA 2AJVH 5L2JA 3GGWB 4OKDA 1K5NB 3FU0A 3X1BA 3TEYA 4KQ4L 4O51A 3BWAB 2Y22A 4YE0A 4OFKA 4KTYA 2EXYD 4XBMA 2DLEA 2BOCA 2GB2A 2SEBA 4RISH 5DJZB 2IV9A 1UT1A 4WI4A 1KBVA 1IM9D 3HI5H 5B4MD 4TNGA 4HCGA 2X2UA 4HMCA 4KQ3H 4JPVH 5AW7B 1AQDB 4MNQB 4M8RA 4NPYA 4UT7H 4WI0B 4HWEH 2A6IA 5G4MA 5C0CE 3UZQB 4AT6B 5FECB 3CHQA 1KACB 3HA0A 3SE9H 2KLSA 4R90L 2ZCHH 5FYKE 5LAXB 1RL1A 3QDAA 4LVNB 1S3RA 1MRCH 4N85A 1GY1A 4K7FA 2YWYA 4NO2B 2Q5BA 2LAGB 3CX5K 3RNQB 2FR4B 3SDCC 1GKEA 4KUCD 4PJXE 1HVXA 1IJNA 1RY7B 3N40P 5CSZA 3VE0B 3MUGA 4LSVH 5SX5K 5FK9B 2VDLL 1KTCA 3LQAC 4LHQB 2Q9OA 5AVQB 1LMIA 5I1KH 1HL5A 3HUJB 5TE6L 4FDWA 4XGZB 5EU4B 2A3TA 3HZVA 1JMXA 2QKIB 1E3XA 1KWGA 2A2QT 4Y2DC 4OKVB 2KLRA 3MBXL 5ESVB 4RETB 2HTKD 5ANMB 5EU7C 3X14A 4E0RB 2CJSA 1NBVL 2ITCA 4GW1A 1AI1H 3BDXA 5F1KC 5JPNC 3COOA 5EFIB 4CSPA 5ALBH 4JKNA 1QWNA 3LZQA 3RL2A 3QP3A 4QRRB 3VXSB 5IWLC 2HH0H 2XOTA 4ZXBB 5KSUA 3QDMA 3GHPA 2HVKB 1V10A 3TN0B 1GXEA 3IJ8A 2JQZA 3O2VH 7PAZA 5A2BA 1ND0A 2VZUA 1G84A 1NCOA 1A7RH 3IDGA 5B1JA 1AZUA 1OSEA 5FYLH 2VZOA 1E5CA 4Z78A 5E6ID 3Q05A 5B39A 3JYCA 1HKFA 1EZVX 3PY9A 4WHYG 3UC0L 5SX4H 4I4WB 1BQLL 4MS8D 4PRAA 5IHUH 5T1MB 4L4TA 4ZO9A 2BWDA 1YCSA 3LHAA 2YPLD 3TZVD 3HG3A 1Q72L 2JFCA 5I73B 5I5MA 2WO2B 3L4ZA 1P5UA 1A3LL 1DZBA 3EDFA 2TRYA 3CDYA 4NT6A 3IU4L 2D7PA 3KPLB 3ZLQC 2DL9A 2J3SA 2P5ED 3ZN6A 4FMVA 1YQVH 2RMNA 4QTFA 1B4RA 2P80A 2WWKO 1HU8A 4ZFGL 2A77L 4X50A 5I75B 3F2LA 1MDAA 2NY5L 5E0QA 1S7VA 3MGTA 1G6RL 4RLDA 4PJIA 3LRGA 3HZKB 2J44A 5AZUA 1FZJA 3UYRL 2BP5M 5FX3A 1F1AA 4PUBH 3B7SA 2CO6A 1AE6L 2WZAA 4ABWA 3K8LA 2WBXA 3EW3B 4FYRA 2CHXA 2Y69B 3HJ0A 3QC5X 1V54B 3FQWA 1VCBC 2XNAB 3GHEH 2RHEA 4XO4A 5FYLD 1SY6A 4EI5B 4L5FL 4Q6IC 3QCTH 3O4LB 2ADFL 5INDA 4EI6B 2VMCA 2K9FB 3LNEA 7FABL 2EVIA 2DJ4A 4FD0A 2IALA 3DX6B 4K5OA 2ZONA 1L0PA 1MRDL 2J8HA 3D39D 4I77L 5IG7A 1M3IA 1CGUA 1I8UA 5J6GA 5EZJB 1EMTL 1E42A 1BMWA 1EFXB 4XHQA 4RQQA 3KPPB 2QADC 3E9UA 2XC8A 3KR3H 1YNLL 3HE6B 3I9GL 2WTRA 2AHIA 5L4FA 4JRYD 3EGSB 4PWHA 1U8NB 5DT1L 3DI2B 1UYWL 4KTGA 4KKAD 3TJPA 4K3GA 3R06B 2I32A 4EBQH 2VN6A 1XCTB 4MJ5A 1HHJB 2X2IA 5LO7A 3UO1H 4YMPA 1JE6A 3PWJA 1L5GB 3KWTA 4N86A 1EFQA 1OF0A 4HYTB 3UO1L 2R2HA 4QAWA 5I1LB 3GMRA 2P5WA 2CM5A 2JK5A 3MLRL 4F2EA 5EIVA 1HAWA 1WAPA 2R9HC 1EZVY 1I9RL 2NXYD 4ELMA 5IHZB 1FVCA 1YMME 3VWJC 1HXYB 2R56H 5TDOA 5JNYB 3K1KC 3NJNA 4MJ4A 1ZTXL 1MJ8L 2Q2LA 2FO8A 2MCPH 3CLEL 3EAKA 1EEUA 2VDNL 4PB0H 1QBLL 1AR1C 1MFMA 1A1OA 2YC1B 1QBLH 2E6JA 2IQAB 3H9SB 1MPAL 3UBGA 3QEUA 2QGDA 2VDQB 4HP5A 1PLAA 2AK4A 3QUZD 5D7HA 1O7DE 4W9GC 4NN7C 1JVOA 3DVGA 3QDGB 4KTDL 3SPVB 4CUCA 4X8JA 2PPAA 3POHA 2YJQA 1R3KB 4G9FB 2OMNA 3WFHA 1AGBA 1MJJB 4YSSA 4ZTOH 2EILB 3D85A 4PJ8D 3H4FA 3C6EA 1NGWA 1FL6B 1FBIL 4UILL 5LG6A 5E0FA 5L0QC 3D09A 4D9RE 4YDZA 1TTBA 6CGTA 4QYAA 5K93A 4ZMTA 1S4IA 2H1PH 1PMYA 4FXGB 1C8QA 4U1MA 5C3TA 4XCCL 4X9BA 1F41A 2PLTA 3MHZA 3V0AC 1I7UB 3Q3GB 5D4HA 1DN2A 2VISB 4YZFF 1D7FA 2MFNA 2ZTBA 4LEOA 4HV8B 1JZ4A 4YK4C 4KK6D 3SDXB 4KQ0A 1I85C 3TA3D 5EIIA 3C87A 1DQVA 3AB0B 1JPST 1P2CA 2XKUA 2R29L 1TQWA 3VAEA 2DIEA 3GUTA 2BIHA 5I0YA 4NPJA 3MLVH 1D5XB 2Q2EB 3L9RB 1XL6A 4W4NA 3SJVE 3ZTJG 3HI1A 3FU7A 3GSOB 1A1MB 1M1XB 1VLXA 3Q6GL 2D7TH 3QFDA 4KJWC 3RZCC 4S10A 4F7EA 4L3ED 3CLWA 1JTTA 2R7EB 3TA3C 3WFDH 1JV2A 3TV3H 2VNCA 5D7LD 4UQEA 4JCWA 2F18A 4GSDH 3KGTA 4XXCA 3T4AA 4F7PB 2DJUA 1ZKAA 4K94C 3EDDA 3ZE2B 3ULUF 1ZANH 3FS9A 3NH7L 4JX0A 1EUUA 1FO0A 3QHTC 4RX4A 1OHQA 1QI5A 3QE5A 5F9OL 4MAYA 3VNZA 4AQEA 1Z3RA 5IB2A 4P3CL 2DQUL 2C4FU 1CYXA 1H8LA 2J1WA 5CWSB 4AL8L 3BKJL 4JK0D 2I85A 4GAYB 4U6XA 3SBWC 3DV4B 2YD0A 4X6EB 4PGCB 4BUQA 4D0DA 4F7CA 4O2EB 1OZTG 1I1YA 2CLZB 1FUNA 1IUZA 2HG0A 3V5DA 2QMKA 3HS0C 3RWFA 5C6PB 3FAWA 1AZCA 3FHAA 3QEQB 5KBDA 4OCYH 4UDUA 2W5PA 3LV3B 2OJEB 3IE4A 1NOAA 2DEXX 3D87B 5T3ZD 4NI3A 1L9MA 3BFOA 3DJ9A 5CGYC 4YDLB 4PJXB 4YHML 1CDHA 3WNOA 1MCCA 2APFA 2BNQB 1YUHA 3GFUA 3WLBA 4ZFOA 1C5CH 1HE8A 4KDTC 3H9SE 1ZVSA 4XXDA 3D85D 3QUXC 32C2B 2FX9H 3KNBA 1QFPA 3RHWK 2YXMA 2KC0A 4XP1L 4GW5A 5B7MA 2PXYC 5HDLA 3L7EB 4UNIA 2X5PA 4WV1B 1YMMB 3AWFA 2Z31C 1EHNA 3BUYA 2YD8A 1FFOB 4ODHL 1ZV2A 4LGRB 3T6VA 3WN5A 4LEXL 4XMKH 1CLZH 1HILA 3JSSA 4N2MA 4QHKI 1IEHA 3VGBA 1PKQB 1HHIA 1E4WH 1EAQA 3PGCB 1NICA 4F91B 3B6SA 4HIHB 1AKJD 1NOFA 2KUTA 2YQ3A 1JIBA 2J5WA 2ITDA 3V5KB 1IILE 1AGDB 4PG9B 5DJXA 3ZE0E 1S5HB 3BRGC 1IZKA 2IEPA 5CO1A 2ZUWA 3RWJA 4FZEL 4LVHB 4M03A 3ME0A 5L2KA 4KI5D 4UAOC 3P40A 1J8HB 4EVNB 1IT9H 2WXOA 5CR8A 3RJQB 4E9YA 3O6KH 3ARPA 3M6DA 3O41A 3U6RA 4HIIA 5I9QB 3O6KL 3VXUE 2GCYB 4H5SA 5CZVH 1HINL 5I75C 1ZLUK 3P3UA 4QY8B 2CLVB 3T0EA 4IQHA 4MA7H 4WW1A 4NC2B 3ILDA 3V0FA 1HS6A 1H0DB 4IDLA 5K9KA 1XGYL 4KX9A 2IAND 2F5AH 4XTRD 2H8PB 5E4EB 2A6DB 3VFVB 2MNWA 2EDRA 4UOQA 4W1TA 2DL2A 4ZW7A 1XGPB 3PP3K 2MCMA 2FYYA 4B9YA 1CE1H 3O6MH 4K3HA 3M1OA 5MEND 4UUJB 1BVKA 5DHVA 4HH9A 2DD8L 3K81A 3ZTJH 4X6DE 4AQ8A 3VFSB 3QARA 3U7YL 1YDPB 4L1BA 3TNMB 1FL5B 4WK2B 3FAXA 1JRHI 3V0DA 4JM4H 5C6TH 1CICB 2FD6L 2C9VA 2MCAA 4QJ4B 2EUWA 2FJGA 1L3NA 4PRHB 1RJYB 1KIRA 2MHAB 2DTML 4U3XA 3SY0B 4A2DA 2GJJA 1BQHB 2VWEC 4EN2A 3Q8FA 1R5WB 5D1ZD 4LSRL 3T77B 1OB0A 1RIHH 5J13C 1KZQA 5AL8A 4NZUL 4AG4H 3QRGL 3O2VL 1B4JH 2CO7A 5EIIG 1B4TA 5IQ7L 4U6HA 1PG7L 2HMIC 3EYOA 3BAIA 4GKNA 2Q76A 2WYTA 1DBAL 1C12B 3WKNA 4K0OA 4FQHB 4OLYL 4B41A 4D0CB 1Y07A 3JV4B 1WRFA 2WQWA 5BOZG 3LN4B 3T2LA 1U8PB 3GLAA 2LQRA 2HRPL 2EINB 4AGPA 3OR6A 3GSUA 1KJ2A 1LXMA 3ZZLA 4AQ1A 4ELMF 4PV1C 2OW7A 2HZHA 4J8QA 4LU5H 2IXQA 2V0AA 2F1BA 2RCSH 4PCTA 1ORQB 5DC0A 5IVOA 4XCNA 3R8BB 4NNPH 2C9UA 3IDIB 1QR4A 1PZ3A 2CKNA 3N3EA 5CEXA 4HDIB 5JW3H 3BWSA 5I8CA 4KV5F 5AB9A 2PO6D 4CVXA 3PAUA 3QFJD 3UG5A 3LS4L 4KPHH 2C5DC 1E2VA 2VZTA 1OGSA 4S11A 3D4GA 4GMSL 2AAVA 2DI9A 3WHE1 2R51A 1HKLH 4O2CA 4W9EC 2EDYA 3VXMD 4M48L 1AIFA 2ZICA 4XPHH 3QZWA 3ATAA 3BKCH 3G04A 3MNWB 2QT6A 4ZW3A 3FB7B 5IMMA 3QT2A 1XGZA 2JJWA 1HXYA 5TDOB 5JNYA 2G0LA 2XG4B 1ROWA 4EKXA 1CXHA 3DMMC 5A16A 3UP1A 2AJZB 3EH1A 2VDKH 3UJIL 3DMMB 2AXHA 3IFLL 3OKEA 1QLRB 3EJQA 2VXSH 4D3CL 2XPYA 1KZYA 3N42B 3U83A 2FIRT 3E2HC 3H9SA 3SE8L 2Z8RA 2XTJC 3SPGA 3VXOB 5ADOH 2OMUA 3NQKA 1A9EA 3R7QA 2FRGP 2HVKA 4M8VA 3TN0A 5BMFL 2AKRB 3O6FA 1KXTA 1ZTMA 5JOPD 4M1DH 4U0QB 5CILH 4CVWA 3IJYB 4TQHA 1HWGB 2DBJA 5I8KL 4GW4B 4BK4A 1QWHA 1S9XB 3FQNA 4LCWE 4MAYB 4QWWC 3GNML 1HWWA 2PUQT 3O6FC 1JHKH 2DV6A 4R4FL 1A3RL 5EU6B 2FLRT 3HMXL 5IROC 4FNPA 3DBXB 3ZGIA 1FYTB 4YHZL 5DQ9B 1JYNA 2PP9A 5CGTA 1OK8A 3IDYB 2BVQB 2XA8L 3LPPA 1JN6B 2O4EA 3U30C 1MCOL 2YPKB 1HOCA 2JJUA 1PLGL 5SWZA 4DT2A 1L3WA 2W07A 2UWEA 4XVTL 2YAQA 4NIYE 1E4HA 2ZOOA 2UY6A 2WN3A 5E9DD 1T2QH 3MREB 1GHFL 1HH6A 1H9VA 4UANA 4HC1L 4RVBA 3ZHLA 2ADJA 5HY9B 1TNMA 2WP3O 3NA9H 3R1GL 3AXLB 3DXAB 2CCLA 1E4XH 3EDKA 4HALA 1A7OH 5FW6A 3D07A 2V5TA 3BQUA 4RFNB 4J23A 2AC0A 2X4PA 1CZ8H 2PO6B 5I1AA 2O5ZL 4FP8L 1UM6L 3OHXC 1OWWA 5FWRA 3QH3A 1NCUA 3KCWA 5IP4A 3OKOA 3MO1A 1UGKA 3IDJB 3WNIA 5A7BA 4P9MH 3TO4D 1FO0B 4B9FA 3CZSA 4OT1L 3A24A 3KPRD 1WBYB 4IBSA 4IRJD 1IBYA 2ENQA 5I76A 1UWYA 1W6LA 3S9DB 2Z4QA 1DN0A 3BE1L 4LZKA 3S3BB 2N4IA 4P5KA 4OZFG 5C71A 3N2JA 4HKZA 4QKTA 3CIQA 2PPCA 4X6BB 3UTQA 5IB1B 5J56B 5EDSA 2IGFH 4Z7WB 3ARDA 2F7RA 2PTVA 5FO9A 3N5AA 4JN2A 4I48B 4NKIL 2VO5A 3WFBL 2J25A 4B9JA 1BZDA 1P5UB 1UM5L 3LZNA 3L95A 4DTGL 3E38A 5EPMB 1UM5H 1KPVB 4HKJB 2DWYA 2BRRH 1SXZA 4IDJL 2ZWNA 3DX9B 4R7LA 2IOOA 5F9JB 4FHBD 1DVSA 1AHWC 3HB3D 1OANA 1SYVA 3MJ9H 3OF6A 2VDMB 1EUTA 1L4IA 4ANXA 3HMWH 5JXEC 1Z5YD 2WN2A 4M56A 4HKXB 4JVPA 3HKZA 5I82A 5ISZE 5HP5A 4DVBA 1MCLA 3P0VL 2LU7A 3TBSB 3QZBA 3WN6A 3IS1X 1TYJA 1G87A 5EOCH 4PJFB 2DN7A 3H56A 3NH7H 4AQ8C 4HH8A 2BMKA 2DICA 2WVSA 3BSZH 3BWZA 2AZUA 2OZ4A 3ECUA 4K7PX 2P8PB 1XDTT 4ES8A 4Y0GA 1QRKA 2JJTA 3RZWA 3O3DB 5E8EA 2F8OA 1BYOA 1WZLA 1F3JA 3TEUA 3BUYB 4IKKA 4TS6A 3WY2A 4AL8H 3MV8B 3QCUH 4X98A 1EJOL 2UXFA 4X8JB 4FGMA 2ZF8A 1ZOXA 2R69H 3D06A 4FTDA 4MJHA 4N2CA 2VN7A 4P46B 4ZQKA 3GXUB 2QQNL 4LARH 3WTXA 1L9PA 2AJYL 5DC2A 2ITDB 4OVUA 2EDBA 1CG9B 3PGFH 5GJTH 1Z5HA 4Q56A 1WA0X 3GJFA 3VXRD 3ZKND 5HYQB 2CG9X 1CE6A 1N0XL 3BW9A 1IM3D 5IBUG 2MQ0A 3OSVA 4KNQA 1VAHA 4KK8D 3Q8AA 1QQDA 2XZAL 4RAUA 3KH4A 4UQ9A 2MCG1 3U0WL 1X6NA 4XI5C 3V4PH 3SKJL 2C1OB 3S0PA 3QXDA 4MB1A 4NQCA 3HFFA 3N1QC 3A6BH 3SPCA 1YC7A 1DBML 1T04B 2ED9A 1F11A 4J3SA 4WFHE 3L81A 3STLB 1LEGB 1OLLA 2IDSA 4ZUVB 2R29A 2L3BA 1QLEH 1K8DA 2P52A 5DMKA 2ALWA 3CSYA 3SCMA 4H8HA 4W9CC 3L1FA 4KFMA 4UT6H 5IQ9A 1SHSA 5ACZB 5EO0A 1GC1L 3CFCL 4GXFA 3IGAB 3MV7A 2BP3A 3F6IA 5A6MA 2BXYA 2DQDH 4PBDA 1X5XA 4XN2A 1A6VH 1T7WA 4KKLC 4YSEA 1GZQA 2B0SL 4EI5C 4NENA 3FT2A 5I2IB 2JKLA 2Z31A 4GKSB 1AO7D 4GXVL 1NIFA 3WGUB 2FIKB 2EYTA 3I2CH 5JLZA 4HGKC 5CKAA 2FJHA 4GQPH 3V4VH 2CIKA 1F58L 1RIVL 3T8XA 1M6OB 4I7ZC 1KIUA 4WGKA 1ET8A 4Y2DB 1QHOA 4OCMC 1A6TA 3PWPE 2QGBA 1MFUA 2WVVB 1BFOB 4GB9A 2GPZA 4XODA 4PW3A 4ZUWA 4RZCB 3BWAA 4OUUB 2VUOA 5ICZB 2YKLL 2B2XL 4NQXA 2CR3A 2G9HB 5BO1L 4G6KH 1FHNA 2V17L 1T1ZB 4G7VL 5GRVK 1NKGA 1ACXA 4Z7WF 4XCYA 2AK4D 1AXTL 4GQ9L 4H8WC 3UP6A 1KCUL 4H8WL 4RGNB 1UWXK 2A83A 3DRTA 3P3RA 5I17A 3PP4L 4IU2B 1EHLH 2O5NA 4GO8A 1VPOL 1M2OA 5D1QD 4LCCC 5IHLB 2OCCB 3WXWH 1LQSR 1QW9A 5HI4C 1UWEL 2A1WH 2Z0UA 3HC0A 4F5CA 1AS7A 1I3GH 4MZIA 1MNNA 1INEH 4NQVA 4Y4HB 2OSLB 3RTQA 3EJJX 4LOUC 4KI1A 5DO8A 1UD6A 4W81A 1FF5A 3FUFA 1VGKB 5DYOB 5I66B 5AAPA 1TTRA 43C9B 3O3EB 2JELL 3H2WA 4CU7A 3PV7A 3HZVB 4N0UE 3BGAA 3KNBB 1J48A 3IAGC 2MKWA 1GKOA 1S8DB 5D2LF 3GSVB 5I15L 1IFGA 2GAZA 2E86A 3O9WD 1IIKA 4JFDA 2K7PA 4MXWL 3DO3A 2ITCB 4GW1B 2LAAA 3G5ZA 3X3GL 4B3VA 5CJXA 3IWUA 1AZZC 3MV9A 4X99B 3VXRA 4N5ED 4PP1D 5FFOA 4TF4A 3TA3A 3RLSA 3HEIB 3IDIA 1HCZA 4FTVB 3VFRB 3RZCA 3QEUB 3G5XB 4BSWB 3UGEA 4AKOA 4A6YH 4BGLA 1JUFB 3IJEB 1CFVH 5J1SC 1P4IL 3MRNB 4R3SA 1FGVH 1AC0A 1GYWA 1WYJA 3EJPA 1FNLA 5GS0D 4DGIL 4FF9A 2NY7H 2BP8A 5I6NA 3GXFA 12E8L 1MIMH 3RA7H 5DUBB 2FSEB 1BOGB 5K69A 4KOCA 2FJUB 5AAWC 4YFLI 5CN1A 3GZPA 3MLSL 1ZK5A 2QEJA 2DYPB 4GRWH 3RTQD 3SDAA 3F7RA 3PWNB 3N9GL 3O3BB 2L7QA 5E8NA 2ADJB 1DBJL 3ETTA 3P02A 43CAA 5LXGL 4OTXH 5LAXA 1KJMB 3SEPA 2PWDA 1MLCA 1HHHB 4NS0A 1V3LA 2HJKA 1P4UA 3DUUB 4L3EA 1HE7A 2BJMH 1Q94A 4JG0H 3TOPA 1CPUA 1GAFH 5GS0C 5CLXA 3VWKB 4GW4A 1JZGA 5LNDA 3CG8A 3T4YB 3IJYA 2N7BA 2H1XA 3ARVA 4TNWF 4LK4A 1Y18B 2OI9C 4U3SA 3IPFA 4DW2H 3PCYA 1L0XA 3VG9B 3N1FC 4P5TD 2EO7A 3D1MC 3B9VA 3LKOA 1VADB 4ANVA 5I5IA 2N56A 3ZBMA 4RBPH 4JDVA 2A9BA 3FQWB 4MYWB 4BZ1H 1KCWA 5FYKD 3QIUC 4HGWA 4X7FC 4XB7A 4U1JA 1FNSH 4NZTH 3K4DA 1LDPL 2F54B 1MRDH 4OLUL 4TVSa 2WAHA 2VJXA 1SY6H 1HOCB 1NC2B 3SBRA 1NGPL 3ZQXA 3ZTEA 4GRWF 4OLEA 2YGOA 3ZX1A 2MOGA 2I60H 4YLQT 3LN5B 5CIPA 5EZLB 2Q7YB 3SE9L 5F9AC 4JM0A 4BQ8A 3AM8A 1DDTA 3N43F 4LSPL 1LE5B 1QBMH 1YEEH 3GC3A 4X80H 3V7AE 5HI4D 1WQVT 5F3BB 1AZNA 1KFAH 4R2GD 4H1LH 3BO8A 4GAJH 4HIJA 5GIRA 4WKZA 1N64H 3RWEB 2PP8A 3VFPB 2HJLA 2BHUA 5CUSH 3C6SB 4JUSA 2YEZB 3I3DA 4JFOB 4WV1C 2M26A 5J12C 1T89C 3MQIA 4OFVA 5BV7H 1RUAH 3HCVA 3SDYH 3X11A 4BK5C 4K71B 3TVMB 3V0GA 5FYJL 2DQHL 3A47A 3TVMC 5BS0B 5LBSA 3CN0A 5C08A 1RMFL 3SE3A 1G6RA 4WI7A 3ENEA 4LL4A 4M3JA 1WK0A 3D69B 4EAEA 1RHHA 4KKLD 5FLVA 1U93A 4X0NA 4OUOA 3V6OC 1KB5L 3NMEA 4P46A 4QRRE 3VXSE 4TUKH 4F9LA 1WFMA 3DJSA 3UG4A 3BJ91 4IJTA 2OJZH 2X9ZA 3VRIA 1ORQA 4WRLA 1ZVHA 1JWSA 2VR5A 3FUEA 2HWZL 1E4JA 4WTZG 1EGJA 1UOWA 1AGFB 2ARJQ 2BVEA 4X5XB 2XXGA 4X7TB 5F3FA 3MV01 4L9DA 3SDAD 4DK5A 3MRQB 3CJJA 1O5DT 4U6VL 4UV7L 3L7EA 4XNQA 4PRPD 2EXYC 3H0TB 1OOAA 5HI3D 5DI8B 4OCYL 4K9JA 4NN6C 4HLJA 1D6EA 1OO2A 3C8HA 2EYSA 3E8UL 2EC9U 4G42A 4IEFA 1BGXH 2F19L 3FQ4A 3W3BA 4NQEA 3AVEA 4LVHC 2QR0B 2R4SH 4ONFL 3NA9L 4AGLA 1BGXL 2F19H 2NCEA 3QUMB 3V6ZB 5AD0B 3DVIA 4E41D 5E4OA 3GTVA 4PRDA 3MA7B 3SY6A 3U2JA 2GJPA 1U8CA 3ARRA 4JR9L 1ZLVK 3HBGA 3EGSA 4TQEL 2P47B 4XCFH 3WIIL 1J9SA 1RZIA 3HRZA 3PAZA 1VACB 4GI8A 4EQ2A 1L6XA 1JF5A 1HWHB 2XN0A 4FA6A 2UZXB 5G4NA 3SDXE 3CNKA 4AQAA 1G9NC 1A4KB 1KGXA 2FWLB 2Y7SA 3UIYA 4FKHA 3D12B 1A6UL 3K80A 2W0FA 5B3NA 3PPSA 1GGIL 1KN2L 4WQOA 5EU3A 2AJXH 1UD4A 2OL3B 1MCQA 4JO3H 3RX5A 1QBBA 4X98B 3HKFA 4PCYA 5KVEL 2XQBL 4FQIL 1TG8A 5TTRA 4JO3L 3ZL1A 1JPFA 1S9XA 1YEIH 3T8VA 3UBXB 4LSQH 3T0EB 2XQBH 3HAEG 5AKSA 4ZODA 1TTGA 4PGDA 2X88A 2Y1ZA 1QNZL 1W0WA 1XSIA 1N12A 4K5LA 2A9MH 1Q0EA 3U0PA 4X0KB 1PX8A 2G9HA 3S2AA 3LEVL 4O02A 1CLYH 3GJFK 4ODUB 1OGAB 1M53A 1E27B 4K7PL 5F9OH 3FH8A 1AKPA 1PLCA 1ZHNA 4WY7L 1AKJB 1UCTA 1X5JA 4PSRA 4RAUB 5C0CD 1X6LA 2GIMA 4Q8BA 3K8KA 3PGDA 4XN4A 2DQIH 3GHBL 3H3PL 4KK5D 3IJSA 5ITFA 1JWUB 1F11B 4KPHL 3MRPA 1MW0A 3WJLA 4HJEA 3TJEL 3OMAB 3HN3A 1CFSB 1SOSA 5TQ2L 5DLLA 3T0VA 4JM2A 4YHOL 1S7QA 2OSYA 3OJVC 4FHJA 4PJBF 4Y16D 1KCRH 4E2OA 2WTPA 4HQQL 1RI8A 4KAQH 3T0XA 4MKTA 4HMEA 3LNFA 2JJSA 3V6FA 1ZS8A 4KO6A 4HZLA 2FQGA 2XZZA 3IMVA 3JWDC 3PNWB 1M57B 3IGKA 5KYXB 3EOAA 4MQXC 4D9RD 4TN9A 4JFEE 4XVSL 5DZOA 3SBPA 1F97A 1MQKH 2BRQA 5FGCB 2X40A 1I8KA 4DPAX 2OZNA 3V4UH 5C2BH 4FXKC 5CLYA 2QJDA 5IV2B 3QG7H 3NFPB 1DUYB 3L3JB 2X53A 2HAZA 2P8LB 1R34A 1UJ3B 2A73B 2CLRA 4IRZA 1T5KA 3D2UA 4KGJA 4WJ5B 1BIIB 3ARQA 5DD5L 1TT6A 4AIEA 1PZ5A 3BD3A 3CPLA 1UA6H 1UKQA 1T66C 4G8AC 2JLPA 4ZTOL 4KKZA 1BVLB 1D5IH 4ZS6D 1C5DA 2G75B 3BPOB 1YEWA 2Y0SA 3B5TA 1GYCA 3BPOC 3CLFL 3ISYA 4FHKA 5SWZB 1U8OA 3N1MC 4ODSL 4GRLC 3PXHA 3K5RA 1ORSB 5EHFA 4PLJD 1QTSA 3B6SB 1HYRC 4ELME 2VE6A 1PY9A 5GRXG 5JIIA 3M46A 4O2CB 5LGKA 1T22A 2ZAIA 4LNRB 3ZZ1A 3TS8A 2CDEA 2X4OA 3UBFA 1A4JB 4MDJB 2O26U 3RGVC 4PJFA 4Y4FC 3MNWA 3VD5A 1XXDC 4UT9A 1T5XB 3DSFL 3I9IA 1I31A 3BQUB 3SGKC 3EYSL 3IFPA 3PWVA 3QNYA 1MCHA 3BN9D 3HN5A 2ZSWB 5D7LE 5GRYA 3I74A 2BSED 4OZGF 2R29H 5SWZD 1JHTB 1IGMH 2X10A 4AEHH 2BDNL 4HS6A 4TYUA 4LEBA 3PHQB 3NOIA 1LVEA 1DQML 2RD0A 3PL6B 1J5IA 2ZOKA 2NW2A 3DJTA 4H25A 3UXFA 3WEMA 2GSIB 3F7VA 2Z7WA 2R1XB 5KZCD 4K5NA 4XRCA 4M1GH 2VLRB 3MV9E 4MQ7A 5FKPA 3K5SA 1T3FB 5IVXA 1VPOH 4Z7UF 5INCB 5JOFB 2W95A 1XGPA 4X5PA 1NGQH 2EC8A 5D8JH 4PS4L 4Y16A 1LO3H 1N70A 1BG9A 1Y1DA 3ETSA 2J88H 4R5XA 3TA4D 4NRYB 4PJ8B 5EUKB 1ETJA 1JGLL 5D7IA 5AG9A 2OMZA 2UZIL 2FX8H 1OSZB 4ODWB 4KTEL 1LO5B 2DQEL 4MDRA 5E5RB 5FFGA 1FCGA 1W8OA 2JH2A 1X44A 4NP4H 4BV1A 2BCKA 2Z7ZA 1MHPL 1KPRB 5IJDC 1NCGA 2VMDA 4IGBB 1BECA 4G6FB 1ADQL 1EDYA 1JGDA 1Z9OA 4MXQD 5DUMH 2GTZB 4M43L 4XOEA 3UDWA 2UXTA 4U1IB 1C5BL 4UQ3B 4GSDL 3V0VB 4CGTA 3TIEA 1J8HA 4EVNA 4L4TD 1C8PA 3L3DA 3LZPA 1IU1A 4N0CC 4S1DC 1WWCA 1SNRA 2CBQA 2JKIS 4IKLA 2Q3XA 2NXYB 2Z9TA 5I24A 1E5UI 1NCHA 2BHFA 5I74C 1E65A 4UM8A 3NCXA 4TLTA 3JT0A 5AVVB 3IF1B 3U46A 1U8LB 2P24B 4IBZA 2XYCA 2GY7B 1JK9B 4OLWL 1OGAD 3C6LA 4DKEH 2IWGA 1K4CB 4OVVA 1H0DA 4P2AA 5K9KB 3CSBA 4WW2C 3RFZA 4ONGH 4YL9A 3UTTB 3RDTB 3N43B 3H9HA 2H3NA 3OG6B 1UURA 3AG1B 2DS4A 2D31B 1JPEA 4NUPA 2P43B 1CE6B 4G1EA 4HIQA 3ZL2A 1A14H 5KVEE 3P54A 3MRRB 1UA3A 5I9QC 4HH9B 3OKYA 4RMSA 4H0GA 2ZXDA 2IWEA 2OQJB 3RWIA 3MUHL 1N0XH 3FN0L 4TOYH 3T2NH 5EUOB 3WY4A 2DMHA 1A4AA 2DW5A 2QPDB 4MNGE 1URLA 1DANU 2GTQA 4WFFD 3NJLA 4H4NA 3WE6A 4PRHD 4A68A 3RDJA 4HISA 2F7QA 5F3HB 2ICWA 1P7QB 1RSYA 4YXLL 5D55A 4HS3A 1MVUB 1UD2A 1BVZA 1KYFA 3BIKA 5ESQB 3RFZC 1J05B 3D0VA 4WI8A 4I1PA 2B3RA 2E9GA 5IB3A 3SN6N 4UM9D 3BVNB 3MRMB 4OF7A 5EU5B 2CO7B 2CGRH 4JY4B 4R26L 4DP4X 5IW6A 3EF7A 4AJ0A 5DZPA 4YOKA 2H2SD 2NTSP 3C60C 4NNYA 4ANWA 2QTEA 2R0LH 3KCPA 1NLBH 3ESPA 4RESB 4HXAL 4O2FA 4ABVA 4U6TA 2FEDC 5ICUA 1WHPA 3I9AA 4PRID 4G42B 1D6EB 1MIEL 4KJYA 4PV8B 4AJWA 4WWOA 2VW6A 4XO3A 4ZOEA 4OAWA 4QRPA 4JPVL 2WQUA 2NQDA 2AXWA 1KEGL 2NY6D 1S7SB 4A7SA 2GFBB 2QMJA 5T1KA 1EERB 4TSCH 5IVZA 2O5XH 4HD9A 5JOEA 1LD9B 1A6ZA 2FD6H 4GY4A 1P9MA 2ZCLH 3OSKA 3FBKA 4MVBC 4M5YH 5KVDH 3GZKA 4N6RA 5HYJE 5DJYA 1ZJAA 1A9BA 4F92B 2K70A 4XNYL 1J8HD 2FWOB 2RR3A 4NDMB 2WXJA 4BK8A 4XMLH 2EH8L 4HS8L 2BIPA 4IMLB 4NUJA 2Z31D 1L7IH 5GS2D 1N6QH 1IBHA 5FHBL 2OBGA 5HGBA 1IGIL 4AENA 2PXYD 4MRCA 3MGOA 3U9UB 5IUSA 1JPFB 5AALA 1EJOH 1BD2B 3QO1A 3R1GH 1JJUA 4WEBH 3PJLA 4IOSD 2J4WH 4FFTA 2YUZA 3D9AH 3S34L 1D5ZB 2CUAA 2A73A 2XLLA 1AP2B 2OSXA 3MRJB 1EMTH 2AVGA 5FGBA 2YS4A 3TM6A 3MNVA 1HDMB 5T1KD 5I30L 3QS3A 4OJFL 1BMGA 4TTDD 4J3WA 4X6FA 1ZHNB 1KNOB 1BAFL 3QUXD 5HPMB 3IMBA 5TDPB 1NC2A 2NLJA 1HI6A 2KHAA 1Z0MA 2FNBA 4KZEH 2DBLH 1ZVYA 3KYNA 1W72B 3BFQG 4NEHB 5KOVC 3FFCA 4AG4L 3SYQA 1EEYB 4GUCA 2IADA 1KJVA 5DU7A 1FDLL 5JOPE 2HUHA 5TE4H 4LPWA 2Z7YA 4JM2B 4DPBX 3FOLA 3D08A 4N0RA 3VWKD 2NUTB 3OLDA 4GRLA 4FAAB 5T3XE 3MLZL 2WGNB 4YBLB 3T6ZA 3ZUNC 3DDGA 4LCCB 1AD9A 2NY5C 3B43A 1RZ7L 2G2RA 3IDMA 1KDJA 1UH3A 2HT3C 4GP4B 5HYJB 1XGUA 2TSAA 1E8YA 3BMWA 3P73B 4H88L 4AK1A 4MA3B 3GSRB 3EOAB 2EE2A 2VLJE 2G3ZA 2EH7L 1M05A 4HIXH 3WL9A 3U36A 4ACTA 2VDKL 3FF7A 3ZDYE 5KSBA 4F7MB 3RU8L 3BEWA 3LSOA 2EH7H 3APCA 1DUZA 2V7HB 4EZMA 3MA9L 1RHHB 2DTMH 2JB5L 3WSQH 3NK4A 4JM2F 1Y18A 2V3DA 5HHMD 3UZVA 4Z0XB 4LVEA 2FO1A 1JI1A 2NTFA 3FOMA 2Z1KA 4WJ5A 3VU1A 3L3GA 2AEQL 3F65A 4J3OD 4E5XB 4E9VA 3VXQB 4YK4B 4YHKH 4OZHA 3P77A 2VDKB 4N0UA 5LXVA 2IBBA 4UIMB 4Y4KD 2Z93B 1R17A 1NCWL 2WJ7A 5EO9B 3Q43A 1GY2A 1AXTH 4R4ND 5FDWB 1J9QA 3V0WL 2B9AA 1OCWL 2G75A 2KQMA 4FNQA 2QQNH 4A7UA 3BWUC 1FG2A 3OHMB 4JGUA 4PB0L 1XX9C 4NO2A 3IJEA 5I76B 3F7LA 2YA1A 2ODIA 1DTUA 3CFEB 5D1QA 3OLIA 2PW2B 5BUGA 3QPXH 1KBWA 3RNQA 5IBTH 3NFSL 3Q1SL 3UAEA 5D1XA 1T2JA 3ZDYF 3JWNE 1E8WA 2VKXA 3FO1B 2QDWA 1VF5C 2ICWI 3ULSA 1MFBL 2LLNA 1S9WB 2VT0A 2YAPA 3HHRB 5DURD 5IQNA 5T1DH 4NJ9L 2ZUTA 3NJVA 4UT6A 1GZPB 5IMOB 1WAAA 4NHCH 3FMGL 4XHJD 2X2YA 5IQLA 2R2EB 4GO6B 3APDA 3GIVB 5GGVH 3EJUA 4BZ2H 5BQ7B 3A6CH 5EU3B 1CCZA 5B1BB 2VAAB 4HPHA 3ZYIA 4NFDA 5ACLA 1JGUH 4QOKB 4Y1AD 3V4PA 2EQDA 2ARJA 5CEZD 1AR1B 3QI9A 2WZ0A 4PREB 2YD5A 5L2JB 5DQJB 5INDB 2EEBA 1IQWL 4KKBC 1DL7L 3NJXA 1S9YA 1PZCA <