4CSPA

Structure of the f306c mutant of nitrite reductase from achromobacter xylosoxidans
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
335
structure length
335
Chain Sequence
b'DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEACELGAAGHIKVEGKWNDDLMKQIKAPAPIPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Impact of Residues Remote from the Catalytic Centre on Enzyme Catalysis of Copper Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 91
structure length 335
sequence length 335
chains with identical sequence F
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2014-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cspA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4cspA02
1JZIA 1FFTB 5E9NA 1BQKA 5AZUA 3N55A 1ILUA 1J9SA 1NICA 3PLYA 4DP8X 2BZCA 2IDTA 3NYKA 1AZNA 1HFUA 2FQGA 1GY2A 3OMNB 1PLBA 3S3CB 2QT6A 4E9XA 3NJKA 1EHKB 4HZ1A 3V9CA 3FQYA 3H56A 3TA4D 2A3TA 5I5JA 1A8ZA 3ZIYA 2AANA 2XXGA 2VW6A 1T5KA 3JTBA 4P5RA 4E9WA 4WKXA 2GHZA 4BDVA 2DYRB 1SDDB 1ID2A 3QPKA 1PZCA 4GP8B 5F7BA 2P80A 2YAEA 5B7FA 3GDCA 1ZDQA 4KNSA 1V10A 4MFHA 4HCFA 4HAKA 2AFNA 1NPNA 1J9TA 1JZFA 1V54B 2UX6A 1SF3A 1ASQA 2FT7A 3IE9A 1NWOA 1GW0A 1BQ5A 1NIFA 3NJJA 1IUZA 3NJGA 3T6ZA 2XLLA 3GYRA 4W1TA 1TEGA 4BXVA 1AACA 3FYEB 3DKHA 1QHQA 3QQXA 2J56A 2VW7A 1R1CA 3UADA 1PNCA 4PCYA 5B1AB 3NJNA 1CYXA 5B1JA 1URIA 2CJ3A 1SHWA 1JZEA 5D4JA 3AW5A 2UXTA 3IN2A 1RZPA 3UAAA 3SBPA 1ZV2A 4G7QB 3ZBMA 2UXVA 2J5WA 1AIZA 3NJIA 8PAZA 3AY2A 1TU2A 1NWPA 2AVFA 4G70B 4L0PB 2BWDA 1E30A 3CVCA 3TASA 2IWKA 1AS8A 2UX7A 2YAMA 1SF5A 3CDZA 4YSTA 2HRGA 1XMEB 2B08A 3S8GB 1M57B 1FWXA 2IDQA 4JHUA 2XU9A 1ZIAA 5A7EA 5I26A 2PPDA 1ASPA 3X1EA 1XB6A 3CVDA 4YSSA 2BZ7A 1L9RA 4AKPA 1JERA 1BEXA 1BAWA 5B1BB 4AKOA 1IBYA 2YAOA 3KW8A 2HRHA 1PLAA 5D4IA 3UABA 3C75A 3SQRA 1QNIA 4RH4A 2XUWA 3ZX1A 1AR1B 3EH5B 3T6VA 3FS9A 4AI7A 4YSRA 2VSKB 3NP4A 3ABKB 4KO9A 3UAEA 4HCIA 4G7SB 1PMYA 4HHGA 2DY2A 3BVDB 2YQBA 2PP7A 7PAZA 1PY0A 4FA7B 3S3BB 1NIDA 1WS7A 2IAAC 2HX9A 4KO5A 3RYMA 4GYBA 2W8CA 4A67A 2GIMA 2IWEA 2FTAA 3NJMA 3GXUB 5I6PA 1E5YA 1ILSA 2BO0A 1A3ZA 4EF3A 3AG4B 3N2JA 6PCYA 2VN3A 4E9VA 1AOZA 1PZAA 3OMIB 4WTQA 2XYBA 1WAEA 1W8EA 2FQEA 1NZRA 2FQDA 5B1KA 1RZQA 4YVUA 2HXAA 1FA4A 3FSAA 3TU6A 2RACA 1NIAA 4NB7A 1W6WA 1BXAA 1M56B 2R7EA 3PAZA 4YSEA 2VW4A 1KDJA 1RKRA 1OCCB 1NIEA 4YSCA 1ZPUA 1EZLA 1GS8A 1KBVA 1TEFA 2BP8A 1QLEB 2PPCA 1ZIBA 2JXMA 1KYAA 3T6XA 4YSOA 1JXDA 1AZBA 3CZUB 1AZUA 4G72B 2EINB 1ETJA 1JZHA 2BP0A 4DP9X 3L45A 2UXFA 4DP7X 2WSDA 2DWSA 2DWTA 2IH8A 3FU7A 4E9YA 2VM4A 5IY5B 2YARA 1IBZA 3NSFA 2YXWA 2QPEB 2IWFA 3KW7A 4GXFA 4CSZA 5AFAA 4NAJA 3T9WA 1ADWA 3X1FA 2ZXWB 3JT2A 7PCYA 4CSPA 3ASNB 4KO6A 4KNUA 1CYWA 1GS7A 3NSYA 2Y69B 2GSMB 4JHVA 1I53A 4KO7A 3FYIB 5I6NA 4DPAX 2QDWA 2FQFA 4DPBX 1KBWA 1WA1X 4NERA 4DP0X 4BDVB 2XV0A 3WG7B 3NP3A 1SHXA 2IDSA 3HEIB 4GP5B 1J5CA 2CBPA 3CG8A 3X1BA 5PAZA 4E9RA 2ZONA 3FT0A 4BWTA 4PAZA 1JZGA 3CVBA 3EH4B 4JKNA 3TBBA 3DIVA 4X4KA 1DYZA 1OE1A 2CCWA 4A2GA 1KGYE 2PPFA 5F7AA 1J9RA 2WO3B 4YVNA 5TK4A 2IDFA 2CUAA 3FU9A 1L9SA 3AG3B 2TSAA 1AS7A 3WNJA 3S3DB 2CAKA 1E67A 1KDIA 2OJ1A 5I5MA 1J5DA 1XB8A 1HAUA 3IBOA 1OV8A 1BYPA 2LLNA 1M9WA 2YXVA 5I6MA 3QJSB 1PAZA 1AAJA 2GI0A 4FAAB 1PLCA 5PCYA 2X87A 4KNTA 1W6LA 1A4AA 3WKPA 3UACA 3WNIA 1L9PA 1OE3A 1SJMA 1PZBA 1AG6A 1NINA 2XXFA 3QJTB 4GP4B 2HZHA 2H47C 4UAHA 1MG3C 3NJHA 1KCWA 3CDZB 4K9JA 3NSCA 2XVBA 1JXFA 4AZUA 2WO2B 1L9QA 2FJSA 5I6OA 3QJQB 4A2FA 2HX8A 5FC9A 3NJLA 1OE2A 2QDVA 4HIPA 4UF7C 4YSDA 3IEAA 3OD3A 1L9TA 2YAQA 1IC0A 1UATA 4F2EA 1X9UA 2X88A 1GR7A 4KOBA 5I6LA 1N68A 2PCYA 4E9QA 4HCGA 3PCYA 2YAFA 1MDAA 2Y1AA 2IDUA 3QJRB 2ZWNA 1ET8A 1X9RA 1J9QA 2EILB 3MBWB 3TBCA 3FPXA 3PXLA 1SDDA 2I7OA 2P80D 4QLWA 3PAUA 2PPEA 2XWZA 3ABGA 4M4RB 3EF4A 1BQRA 5B7MA 2GC4C 1AZRA 2EIMB 4DPCX 2H3XC 2GBAA 4DP2X 1ZDSA 1MZYA 2BW4A 3FPYA 1AG0A 6PAZA 5I28A 1AZCA 2Q9OA 1XB3A 1YLBB 4DP1X 3DTUB 2GC7C 2Q5BA 3SBQA 3NJFA 3FSWA 1ET5A 1KCBA 4ZK8A 5I6KA 1F56A 2DYSB 1AANA 1AQ8A 2PCFA 3WKQA 1CC3A 1ASOA 4M3HA 2HX7A 3X1NA 2H5UA 3X2QB 2XV2A 1BXUA 1CUOA 9PCYA 3WIAA 2DV6A 2OCCB 4YL4A 4AX3A 5TK2A 4AKQA 1GYCA 2R7EB 4Q89A 5D4HA 1JVLA 1HAWA 1BYOA 2N0MA 2BP8B 2CALA 4HHWA 3H4HA 1JZJA 1N70A 3AG2B 3OMAB 3X1GA 3FU8A 3ZDWA 1PCSA 2J57A 2BP0B 1BXVA 1NDTA 4TXVB 3U25A 3PAVA 3T6WA 2B3IA 1KV7A 3ABMB 1JXGA 3ERXA 1GY1A 2OV0A 3ABLB 2PP9A 1L9OA 3FU7B 2QPDB 1OCZB 3EH3B 4N8UA 4BXSV 4YSQA 3H4FA 4P5SA 1WS8A 5EHFA 2VMJA 2BWIA 4DP5X 1JVOA 3HB3B 4E9TA 1PNDA 1PF3A 1A4BA 4YSPA 3EHBB 2PPAA 1WA2X 1NIBA 4G71B 3T71A 3G5WA 4UANA 1JOIA 3D12B 2NRDA 2EIKB 4YSAA 1MG2C 4F7KA 1A4CA 1AS6A 2XX0A 1GS6X 4F2FA 2AZUA 1CURA 2FWLB 3MX0B 5B1JC 2YAPA 3V9EA 4DP4X 1E5ZA 1A65A 1V55B 2EIJB 1SFDA 3PPSA 2UXGA 1E65A 3FSVA 5B7EA 1OOWA 2IH9A 3OM3B 2I85A 4KOCA 2W88A 3NT0A 4A2HA 4DP6X 3SBRA 3QJVB 1MZZA 4QKTA 4A2DA 3IN0A 5LDUA 4E9SA 1NTDA 3BQVA 3QJUB 1DZ0A 4A68A 5I5IA 1VLXA 4HALA 5B3SB 2JKWA 2MRYA 2PP8A 3FQ2A 1OCOB 1TKWA 2I7SA 2VM3A 1GSKA 1NPJA 1RCYA 2ZOOA 2YAHA 4W9ZA 5ANHA 2E86A 4A2EA 2PLTA 2J55A 2FT8A 3NSDA 4ENZA 2JFCA 3AZUA 4BWUA 1WA0X 2MTAA 4BWWA 3S8FB 4BK5C 4YSUA 1IKOP 5AKRA 1SFHA 2FNWA 2VSMB 4N4YB 3FSZA 2XV3A 4Q8BA 1OF0A 3UGEA 1ET7A 2FT6A 1OCRB 4A66A 2BW5A 3AG1B 2AZAA 4GY4A 2GB2A 2BHFA 3WI9A 3FQ1A 1B3IA 1SNRA 3ASOB 2XX1A 2HLEB 2TSBA 4G7RB 3OQRA
chains in the Genus database with same CATH superfamily
2EYRA 4F1SA 3VFMB 4XWGL 1ORQB 5C0CD 3HZYB 1RVFH 1DJZA 2W94A 3FN3A 4OCNC 1FYTE 1KV3A 1HXYB 1NICA 3BH9A 4UZSA 4PBVC 2KC0A 3PY9A 1PFCA 1XZ0B 2FQGA 2JI3A 3FFCD 1AHWC 3T4YB 1CFQB 2V5TA 4KRPB 1EHKB 1H5BC 2OTWA 5AB1A 4A7UA 4ZAKC 1KLFA 4PJ5B 4OTXL 2VAAA 1HL9A 2QFRA 3EADA 3HN3A 4J39A 3WXWH 4K7PH 2F8IA 1LQBC 3DIDA 1HHHA 2FIRT 4YDJB 3KMDA 1INDL 4CRPA 4XAWL 1BVNT 5E1QA 2AQNA 3AMKA 3V79C 3QPKA 4H1LB 1DQJB 3GJFK 4P3CH 3WKYA 2R69L 1OPGL 1G7HB 1NAKH 4CNIA 1AXSA 3CN0A 1OAUH 2WK2A 3IJYB 4HUXB 4K0OA 2AFNA 3JVGA 1JYXA 3BAIA 1JZFA 3EUUA 5KJRL 4NQCE 3SDYH 5JOFA 2R0LL 3GMOA 4NQDD 3NJJA 5KSBF 1NC2A 4P49A 2K3HA 3HUJA 5FYJD 3VFTA 4N1HB 4GQ9L 4X8JA 4ADGA 3EBIA 1I85A 5KYYB 4ECNA 3W2DH 4ZO6A 4PJXF 5HYSG 4JN1H 3MOAL 1C08A 3TH3T 4H8PA 5ERWB 5JOPD 1G5AA 3HRPA 3EGXA 3ESVF 1H3TA 5D4JA 4TVPD 5CJBA 2YS4A 5HYFA 4P3DB 2GIXA 3DX2A 5D5MF 3TT1L 2MPVA 1P84J 1O7SA 4PY7B 1IBBA 2YGQA 2KZWA 4U3HA 3VXSD 1T1ZA 3OVUB 5DJXA 4X9BA 4PJGB 5E7FA 5EU6D 2VDNH 3KVQA 4MB3A 3QUKA 3IDNA 3IKCA 1FQ9C 2VN6A 4X6EA 1AS8A 1BYNA 3QCUL 1ZHBA 3BISA 1S9WB 3LRSB 2F7RA 4X99B 1XMEB 4JFTA 1UM4H 2CA4A 4QYAA 3KPSE 4M5ZH 1GCFA 2PW1A 3HZKB 4QMEA 3X11A 1QPKA 1KJVA 1R3IH 4YJZL 1LWJA 4G2AA 4MLSA 5E2UH 4CW1B 3VWKB 1H3XA 4Y4KD 2HKHH 3QHZL 4U0QB 2VN4A 1ZAGA 2E4FA 4B9FA 1H19A 2OYLA 4RFNC 1EFQA 4JY6B 4DT2A 1AQDA 4LSTH 4LEOB 4NQED 4QO1A 4W68A 1HZKA 5GPRA 2G4GA 3F65A 4MSWB 4N8PA 4R0LA 1EHXA 5DEGA 3RWIA 3I3EA 4L5FE 1KTBA 1ZA3A 2GCYA 5IW1B 2MOQA 4F3FB 4MRCA 3NP4A 3T77B 2JWYA 2R0WH 1X7QA 4CMMB 3LZOA 1KY6A 4D0BB 4FFWD 4BFEA 3U6XS 2IAAC 2Z65C 2D2OA 2BSED 1AIFA 2DQJH 4GYBA 1U8JB 5DUJA 1P7HL 1U3HC 4FFZH 1MI5B 4YBQC 4E2OA 3DHUA 5DJYA 2XETA 2ZUQB 3ZTNH 2VMDA 3GXIA 4K9EC 3RTLA 5KG9B 5DJ0B 2C9XA 4NRYB 5KSVB 4GG6B 3BE1H 4AGPA 4DEWA 4XODA 3L3KB 3Q2NA 6PCYA 3SDCC 4KROD 4A7TA 1CLVA 4XC1H 4KKAC 2Z7WA 4YHLL 3SPVB 3VDBA 4GXUM 3JV6B 4ZFGL 2R2HA 2NY0C 2QQKL 1RZQA 3TU6A 4OD3L 3D0LB 3OAZH 3BEWA 4XBGA 1J1OH 1WC7A 4FXKB 3TBTA 5ABZA 4ZW3A 4WW2B 1ZPUA 1RJLB 1SXAA 3R8QA 5IJVA 4KRPC 4OCYL 3VE0B 3IU4H 4HUUB 4K7FB 2DQEL 5CGBA 2H8PB 3NA4A 3EGSB 5T1KA 3S35H 5DD3L 3D2UA 1G0DA 1D6VH 2QPFA 3H2PA 2IPTH 4FCHA 4NWUH 3MCLL 3S5YA 2AV1A 1FFOB 1NSNL 2IH8A 3CDGB 4E9YA 3KPNA 1OVZA 3BVNB 3II1A 2AI0H 4P5KB 2J6EL 4UT6A 3U30B 2VLRA 2D7TL 3QIBA 5BZDB 1NAMH 4M7ZB 1I8LC 4PG2C 3B6SA 3GI9H 3REWA 1T03H 5FB8A 4UQ3A 1HWHB 2N0KA 1WIUA 1J05A 1LK2A 1W15A 3MRBA 5CZXC 2YA1A 1CPUA 2WIIB 2Y36H 2BPBA 2Y69B 3GZKA 4FADA 4KO7A 2Z1KA 3R19A 3VFNA 1TTAA 2XQYA 1RFDH 1OM9A 3RX7A 3JWDC 3KGUA 4HD9A 4LU5L 3Q1SL 1ZPLA 1GL4B 3BKCH 3P77A 3EZJB 4L8BA 4LPWA 2EDXA 5JIIA 3U0TB 3VGFA 3D07A 5CN3A 4HT1L 4TQ8A 1IV8A 4YHPA 5DRZB 2AMGA 3QZPA 3HEIB 1MWAL 4N8VA 2V4LA 1IAKB 3LKOB 5AL8A 2DQFB 3F01A 1K6QL 3T3PB 2WNKA 1G9MC 4XXCC 3KLQA 5INCA 2YK1L 4I0CC 1PU0A 1PJWA 5H37A 3MAWA 4FI8A 2DEYX 3BP4B 1PDKA 2Q2LA 4HS8L 4TLKA 2QR0A 3TVMA 2PWGA 4ZNCD 4DGVH 5DZPA 1YQ2A 4K7PX 3ULVE 2HVJB 3KBFA 3PXHA 4KKBC 4ABVA 1OV8A 2KQNA 3QJSB 1PAZA 1JS4A 3O45B 4JFEB 3VWKC 3K6IA 3HMWL 3S5LB 2JQZA 1HOCB 1KF9B 2VQ4A 1TVDA 2GAZA 1WT5C 4LBEB 4FQHA 1L9PA 5IB5B 3REVB 3W0WE 5E08L 4JGNA 1HE7A 4TF4A 4UAHA 4WEUD 5HDQH 5GHWH 4BQCA 3NJHA 3KLHD 3C5ZA 5D7IB 3E7JA 1BZQK 1ZHLB 5AOKA 1DBBL 2P5EE 4MCMA 4HWEL 4XN8A 1YMMB 4S0HA 1PYWB 5I6OA 1E6JL 1JV5B 3UC2A 4UDUB 2E6PA 1V3MA 2AV7A 4GKNB 1MFDH 3WMQA 3WOVA 4XMPL 3NJLA 3I50H 3KCWA 1Z66A 1TJIH 5AYUH 3U2SA 2ZUQC 4IRSC 3QDGB 2H26B 4Z0BL 5I74B 3M17A 1X9UA 4K71B 4G6AD 5CEZL 3CXHJ 5DD1H 3BIBX 3MOQA 4IRJA 4U1IA 1PSKL 1NCWH 3VXQB 1GGBL 4TQEL 2VE6B 3QQ3B 2G3MA 1MCRA 1EJ6A 3Q7JA 4L3CA 1HESA 1NL0L 1F3DH 1F8TH 2MQ0A 3I02A 2ZX6A 3P3YA 1VKXA 2IQAA 4WUKL 5LG1A 4LP4A 5GS0C 1HZHH 3DETD 2GC4C 4XMVA 4FXKC 2EIMB 3EIFA 3KAAA 3CK0L 2GBAA 4XE0A 2QGEA 3VRJB 2PO6D 4WW2C 4I1RA 5DQ9A 1O5PA 4XH2A 4KQ4L 3A67L 3SPGA 1CXHA 5C08A 5FUCE 4XXDA 2WVSA 1FJ1A 2R2BB 2X1XR 1CU4H 4FZ8L 1YNKL 5EULV 1L9MA 5J1SC 3H9SE 1BAFH 5KSBB 1EXUB 1EQWA 4OFYA 5D71L 2OXGB 1CDYA 3CN2A 3DA0A 3FCSB 4MNGB 4MQTB 5DURB 4PSRA 3KDPB 3GEWB 1SYVB 3U30C 4KVNH 4PJXB 4GG8A 4M7ZC 4AX3A 2IOIA 1AI1L 1RP9A 4AEFA 4LP5A 3ILQC 1K4DA 1JVLA 4Q9RH 2CUMA 5EO1A 1MAJA 3HI6L 3VXNA 1YMHB 5HHXL 5E2WL 1JZ3A 3IETA 1MCQA 3QRGL 3ZMRA 5D5MB 1B4JH 4GI6A 5TQ2H 1D9KB 5DJAB 3ATDA 3WN5A 3ZDWA 3EYFA 2J57A 2BP0B 2ESVE 3L9EA 3QDHA 1VSCA 2NW2A 3PAVA 3NACH 2IFGA 4U1HA 4QTIH 2D31B 1NEPA 3F05A 5J6HA 3QCTH 4N87A 2FUQA 2X0WA 4KTDL 3H2QA 1LD9A 3EH3B 3ISWA 4ZW5A 1U92B 4LARL 2ZAGA 3T6QC 2OZNA 3INOA 3DECA 4J3OH 2VDPL 1UXSA 1DJGA 2EXTA 4JQIL 4UQEA 2FYYA 2DMBA 2PYEA 1NLBH 1Q9WA 1I1AA 2FBJH 2A6KA 1R33A 4ESKA 5I1KH 1U42A 2BIMA 2IADB 3IFNH 2NNFA 3OX8B 2N59A 2PTTA 4G71B 4NN6C 3CVHA 2WVTA 4JO8A 1EAOA 1KGCE 4QF1A 1I1FB 5CFAA 1CCZA 4GAAA 3P02A 4ONGL 5F7NC 5E24E 3RL2B 4N86A 1CGWA 4OD1H 3UO8B 4QRTA 5I1JH 5K9OB 3UTZB 5ESVA 4LCWD 3S35X 4LVHB 3PV6B 1KJ2A 3RGHA 2BY1A 2Q3ZA 5CUSH 4H5SA 3CLEL 1UVQA 4LRIA 5C09B 3ZL1A 3RE0A 2F8VA 2I69A 1SFDA 2NY5H 4PS4H 5IFHL 3EBAA 1CLYH 3D30A 4RX4A 1B6UA 3RDTA 1BZEA 4EXKA 3WFCL 5ISZD 3AY4C 1CLZH 1YY8A 2ALAA 2WWMD 3F3HA 5GGSY 5C0IB 1JG9A 1A5FH 3RHWK 3TO2A 4XNAA 3WY1A 3V5HA 5DJZB 4ODSH 4JGJA 3US0A 5HGDB 2PXYD 3CSBA 5IROA 1YY9D 5I5IA 3E9TA 3CHQA 1HHKB 3IT8D 1ND0A 4L9LB 5BQ7B 1JPGA 4HQQH 2DBLH 3FQ2A 4JM2A 4ZI8A 3FMGL 2ZYHA 4XVSH 1KN2L 1CT8B 1UT2A 3OLDA 4GRLA 1CFVL 1CK0H 5C71A 3JZYA 3T0EB 4OUUA 4JJHA 4FQQB 1QNZH 3B2MA 2MTAA 5DQDH 1ETA1 3OKMA 1MCWM 1YNTA 2NQCA 4YSUA 2P24A 5E5RB 5HPMB 3BDBA 4WWPA 3KBEA 1GH7A 5I74C 5KVEH 4K71C 3FHAA 1ZGLA 1QRKA 4YHOL 5AAMC 1OP3K 3IDMA 1RHHA 3ZU8A 3K71A 4PRAB 2OQJB 4N5ED 4OCXL 4BE6A 3F7QA 5AVVB 4RAHA 4DAGH 5EG6C 2M26A 2YMXH 3R18A 3N9GL 1ZV5A 5GJSL 5C0DB 2XBTA 5MERB 4DP8X 5I8OH 3ECBB 1HEZB 3LZFH 4LHUG 4NQSA 3ZN6A 5GS2H 2DPKA 5A2JH 4OLZH 5FLUA 1A1NB 3GZPA 2EE3A 2MHAB 5IBUG 4P2QB 3WSQL 1CF8L 2BVQA 1SXSA 1J0ZA 1XCQB 4JM4L 4YQXH 2XRAL 3VH8G 1C9SA 1EEYA 1MF2L 4NNXB 5T3ZD 4HCRA 1E4JA 4DN3H 3QDJB 4AEEA 3N1GC 4BDVA 1BF5A 3QUMB 1UGKA 4B95C 5DRWA 3ZHLA 3I3DA 4MCYB 4DZBB 4R7LA 5KN5B 1VAHA 4RMWA 3LPPA 2YD0A 1HYRC 4G83A 2X4TA 4G9FD 3O2DH 3O3UN 2R4RH 4OQTL 5DK0B 1DZBA 4UT9L 1UCBL 2OCFD 1N3NB 1GW0A 1KNOA 5A6LA 5J9PB 1NIFA 1IL1A 3B7YA 4RMTA 1D9KC 2JJVA 2UWEF 1WCBB 3T1WA 5JPMA 1S5IL 4HSAC 4ICXA 3BO8B 5B4MD 3BUYB 2C3XA 5C0BE 3DYMA 1JMXA 3RA7L 3TPKA 4JG0L 4G82A 5C0AE 2UV3A 3IJHA 4MKTA 3ARVA 3RB5A 2JELH 1Z9MA 3KYNA 3BUDA 2NUTA 2OK0H 2BXZA 5SWSA 3JV5A 3BGMB 2EXSA 4C56B 3SBPA 4BZ2A 3K6NA 1AKJA 1BP3B 3RNKA 5I1DB 1BQLL 1PGRB 2BRQA 4BFIB 1ZT1A 2PNDA 4K7PY 1XCWA 2WQ8A 4HWBH 4EOWL 4LXFA 1NCAL 3F7PC 2AABH 3LZNA 3QQ4B 1EHNA 1OPOA 3ZO9A 2RAMA 4YPGB 4X6DF 1AD9A 4U3XA 4JFYA 1KB5A 4LVHC 2BSRA 4BK8A 3VXPB 2RQ8A 5D1ZB 3WTSA 4MVBC 5EF3A 3KR3H 4LE8A 1MCBA 2WQUA 3SKOB 4UM9D 3EYSL 2E47A 3HZVA 4GPVA 3IMSA 3V4PL 2B1AL 4JO2H 3RZWA 3B1TA 3SQRA 4LNRB 1DL7L 4OBRA 4NKDA 1QNIA 4XVUC 4HUMB 1DANU 1TTGA 3EH5B 3X3FL 1HJCA 3MRGA 1UXWB 1EGJH 3D4GA 3UX9B 1BJ1H 2KBGA 5K9QG 5MP6H 3SIKA 1A3LH 4UCFA 2EVHA 2ZXEB 4JE0A 2CJSA 4K4KA 3RILA 4JHWH 2DQDL 3T0EC 3BZEA 1CFNA 2WMPA 2Z4QA 4KO5A 4PJ7A 5T3XH 4ZSOA 4ANWA 1DBAH 3V8OA 1EJFA 5T1KD 4OZFB 3D2UD 4LLDA 2QKSA 3ZKNC 4AV4A 2D3VA 3MV9E 2K9UA 1FYTA 5FYKU 4GSQA 4M7LT 4OFVA 4PGBA 3NIDE 2MNWA 3VMNA 5E94B 1J5OH 2X3BA 3RGVB 1NCDL 2XA8L 4WENB 5EORL 4L18A 3T8XA 2C4FU 2VLRD 3OMIB 3APMA 1ETZA 3F5WA 4OJFL 4WTQA 3OJDA 2UZXA 4KK6C 5KYWA 2X6AA 1D5RA 1PG7H 2A77H 5FYKL 1XSOA 4GSRA 3SDAB 3ECWA 5IBTH 4S0SD 1G9HA 1YPZE 2DQHH 2G60H 2BSBA 4HJIA 3ZKSD 1HI6A 2P43B 1KDJA 1RKRA 1QI3A 3CQQA 1CL7L 4R5TA 4YAQB 1L0PA 5CZVH 1GS8A 4M5YH 1Y1UA 4N2LA 5B39A 1ZIBA 1KYAA 4YSOA 3RPKA 2NNAB 2Y7MA 4KKCD 4NQCA 1SN0A 5D1XD 1E27B 1V27A 3U4AA 3EJTA 3HC4H 5FO7B 2X0UA 4N2BA 1JGDA 3O8XA 4KY2A 4WFHD 3PWPD 2DWTA 4P23B 4ZUWB 1EEZA 1RZ8A 1A1MA 3PF2A 1NBQA 1E4XL 4B0MB 1E8WA 4GT0A 3DURA 3G5ZA 5D7KD 4OJDH 5HHNA 4JL2A 5AFAA 5JO5A 1GOFA 3CSFA 3F7VB 1TSHA 5E4EB 1U58A 2J3SA 1NFIB 4FFVC 4LEXL 4CSPA 1FL6A 3I9IA 1AVAA 4FQ1H 4HLJA 2H1PL 1CTOA 2WBJD 5F9OL 3TVMD 3ZZQA 1GS7A 3OB0H 1DTUA 4P0DA 4X4YA 5ID1A 3PS6A 2V5SA 2BX5A 2PCFB 3P4NB 3NH7H 4NUPA 4E0RA 4JFUA 1QBML 3D9AL 4BBWA 5DC9B 2NUPB 2KYIA 1XR8A 3MX0A 2A38A 5FS5A 4QRQA 2VNCA 3EJYC 1HXMA 3KPSA 4P04A 4L1TA 4F8NA 3WLWC 2HG5B 3PGCB 2ROXA 4QRPB 4HFUL 2X10A 5CMAB 1MFNA 5F2FA 4AYID 1QYGH 3DVGA 3DRQA 1JNJA 3HAEG 1FBIL 1I9EA 3M8OL 4PAZA 1JZGA 3QI9D 4WI8A 4LRNL 3SYPA 3QT2A 2DKMA 5M7QA 5DWUL 2YD9A 2CUAA 1BBDL 2A5UA 3E80A 3HG1E 2Q7YB 4HIHA 3EOTL 4JFZL 4JRYB 3BKYH 1G1OA 3NPZB 3BUQA 4GUPB 4QUOA 5MI0B 1ACYL 1HAUA 2WD0A 2BHUA 4D8PA 5I76B 5D1ZC 1DJWA 1KT2A 4OVUA 3RPBA 5ALCL 1DQML 3NIGF 4IRJD 2Z92B 2ITCB 3FUNA 3O6FA 1VHPA 1AJ7H 1A9EA 2VDKL 1BPLB 4HKBB 3RIAK 1AY1L 1F1AA 4K94L 4KUCD 2C9SA 4BKTC 3V6ZB 1QFUH 4MMZB 1UD5A 4HPOL 4MA8H 2N3JA 1W72H 1F90L 1J10A 2YBRA 3FN9A 2XVBA 3IDIB 5LCVA 4Z3FA 1ZGLM 2WO2B 3EO0B 3H53A 3N91A 5J57B 4GRWF 3UTTB 4N68A 3QRFM 4MNQD 1AD0A 3TJPA 1T3FB 5HYJE 1VERA 2VC2B 2Y7SA 4CILA 2E5EA 4WK0B 1II4E 2GIYA 2KPNA 3CX5J 5DZOA 4U1NA 2VDRL 4N9GA 5FOBA 4N2OA 4IJ3B 3QGVA 4RGNB 1R3KB 4DETA 4FI7A 1XH2A 4KI5E 3RGVC 4AMXA 2BNQE 1PQZB 4GKLA 1JZ7A 1JWUB 3MTXA 2VZ3A 2BOCB 1XGPB 4MYWB 1RZJC 2W9DL 1QSEE 2N1KA 3SDXE 1RVFL 3D6GA 2WLIB 3SDAC 1IMHC 2CG9X 1S9KC 3LZLA 3ARED 2HRLA 1M05A 3VSTA 4HDIB 1GAFH 5BV7B 5HYSB 4HYTB 4U3SB 1P7KA 3EH2A 1SLUA 3V6FB 4OZGE 4DOHB 4F7EB 3MUZ1 1DJYA 1U8MA 3UZEA 5E5UB 2W92A 5IWLC 3CFJA 2CBMA 2EKJA 2FE0A 2PYED 5D70L 1I1AD 2DYPA 4P23C 2UWEB 5J89A 3ZE1F 1OAXH 1IC4L 2FATL 2HFEB 1AO7B 4M43H 1LE5B 1OAUL 5MEQA 4Q9BA 3RDJA 9PCYA 3MOBH 4F58H 5E4EC 5HHQB 5CJOL 1AR1D 3TA3D 1XIWA 3U4EA 2XA3A 2KZ1B 1G1KA 4RWHA 5HVHB 5I1EH 2N0MA 1RUKH 4QRRD 2BP8B 3I6GA 2ZP8A 4ZD3L 4F7PB 2FL5B 1Q94B 1N70A 2JXMB 4I2XE 3AG2B 1E5BA 4MQ7A 3PQYE 4Y2OB 1UD3A 2I27N 3V4UH 1ZLWK 5E99H 2A9BA 2JJTA 3KPPA 3QXDA 1OM3L 5AUMA 1G6RB 4D9LH 1B88A 1U91A 3P69A 3RDTD 4CKVX 1D5XA 4G11A 2HKAA 3D18A 4KKLC 3ABLB 3S9DB 1OCZB 1Y07A 2V2XB 15C8L 4N8UA 3T65A 4JO1L 4YGVB 4X6DB 4WHYG 3KPRB 2XPZA 1Y18A 1PG7X 4YN3A 4FA6A 1A4BA 5F3FA 5D7LE 4JMXA 3FU3A 1YG9A 5G4OA 4N90D 3AU0A 4TTDC 3FOMB 5D7HA 5FEBA 2JTDA 3MJGX 2W95A 3FFCB 1VFBA 1JOIA 3NPSB 1A1OA 4ZO8A 4ZMYA 1BF2A 5C0JB 1B0GB 3W0WA 4M5ZL 2RR3A 2OTUB 3S97C 2VRAA 3MNVA 5KVFH 4YWGH 2IOMA 2Y9RT 2NNCA 3ZYIA 5MI0C 1R3IL 3HBGA 3BRDA 2I60H 2VQTA 5E1HB 4ZX5A 3RVUD 3TPUB 4BHUI 5D6DC 2P5EA 1P7BA 4PWHA 4R5XA 1R9FA 2BNUA 5J4MA 2YPKA 1FCGA 2CHXA 3BESR 2JQMA 3UMNA 4NNPH 3MJ9H 5FKAA 5LO7A 3COOA 3P4OB 1NMBH 3ARBA 1HJBC 5FGCE 4DGWC 1KENL 2FRGP 4MMZC 2XICA 3ILPB 5IIEA 4X80L 1OOAA 2CE6A 4MCZB 4PGDA 4YXKL 1Z3RA 4Z7QE 4B0MM 2FT8A 3E8UL 1NCJA 5DHYB 1N7ML 4A1RA 1BZ8A 2AQRA 2OMTB 3M45A 3TFKD 2XWBB 5LHDA 3MR9A 4JAMB 3ATAA 2BM3A 2FZ3A 1R24A 1LDSA 4W9JC 4MXQC 1P53A 3SPIA 2AF2A 2YFNA 3BE1L 3BH8A 3CHRA 5D7SH 2WKLA 4Y4HD 4IJ3C 4N4YB 5IK3A 5J3HD 1ACXA 4E5XB 2HKFH 2VL5B 1HWGB 3CNKA 4WU5B 3RU8L 5FO8A 3WAKA 2QV4A 1XGUA 1E3ZA 2W0FA 3ZW3A 1L0YA 1KWGA 2EYTA 3QQ9C 4AJWA 1T83A 3D2TA 1J1PH 3P0VL 3H9SA 1FNSH 4FYSA 1NCNA 4G7RB 5JYLA 4DGYL 2I9LB 5AYTA 1SN2A 3LDBB 1LYQA 1JCKA 3D39B 4TULH 1DBJH 1B9ZA 4XMKL 5LDSA 3IB4A 3SGEI 3S36L 4FERA 3EO1B 3PLYA 2BZCA 3EYQC 2GJJA 2P7TA 5BV7C 5TFSH 1P5UB 2K7QA 5C6TH 1P7QD 3OMNB 4Y4KB 1PLBA 2FHCA 2UZYA 3DIFB 4G7YL 5J1AA 1JGVL 5HI5C 2VIRB 4AQEA 5DLMH 2VDLL 4NQEB 1OAZH 3P2TA 1ZS8B 3QRLA 3PWNB 4MLIA 4NCC1 2H7WA 4XPFL 5JA9A 1G87A 2CLVA 2FWUA 2VLLA 1WPCA 2AI0L 2ESVA 5SWSD 5KVEE 4M6OL 1NAML 2F6AA 4XP1H 3QIWA 4K55A 1S9YA 4ADJA 1JUFB 1HX0A 3FB5A 3K80A 1A6VL 1IGIH 2XPGA 1FLRH 3ZQXA 4HIJA 1OW0A 1WSST 5EF2A 5IJKC 5DEFA 1RFDL 2YOCA 2HJKA 2Z1PA 1AHMA 2ZUYA 3MV8E 1HZLA 2W81C 1XO8A 1RXLA 4JJOA 4FLOA 3FNKA 2R1WA 3QQXA 1UKTA 7CGTA 3VU2A 3QNZA 4JRXE 3LPWA 2DD8H 3NAAH 4G8EB 1BMWA 3TTSA 1K4CB 1VEPA 3OKKA 2AJYH 2KL6A 4K23H 3BFQG 3KNBB 4URKA 4NO3A 5JQHC 3C8DA 1DN0A 5DC2A 1TZIB 2JF1A 3NUKA 4OF6A 4AVHA 3LEYH 1A6TB 2DM3A 5K1VA 1XEUA 5BJTA 5GGSA 3NEEA 4NIKB 1BM7A 2WWOA 3HNTL 4Q2ZA 4OU3A 1FZOB 4WJKB 3Q6FA 4X98A 2RQEA 1T5XA 1MRDL 4K8RL 2XWJB 4AYFA 2OKMA 3U6RA 3NPSC 3CZJA 4L0PB 4X50A 1E30A 5AYQA 2YPLB 1PFOA 4NP9A 2YAMA 2FCBA 3L2MA 2DH2A 4PRPE 2Z8SA 1KGUA 3HVDA 4PFEA 1YNLL 2IDQA 3D7PA 2APVA 2ICES 5F7DB 1CFSA 4ZFOB 2QZQA 1YUKB 1EXHA 3TEZA 2ATKB 1S3KL 5EO0A 1KN4H 4GRWB 5J1TC 5TPWH 4YEFA 3DX7B 4AIZB 4XHQA 1FRGL 3SO3B 2R2CA 3DX8A 5E00A 5GHWL 5ILTL 5JUEL 2YRZA 4FNLL 2EDLA 3ZX1A 5LQBL 1BD2E 2IGFL 2WLMA 3PP4H 4YHZH 5HHPB 4ZTPL 3LKQB 4KO9A 1R6VA 4JQVC 1AE6L 1YEEL 2OL3H 1WUZA 1S7SA 2DY2A 3W56A 5CEZD 1MFDL 5I16B 1OKEA 3I50L 2HN7B 3PXJA 1H9VA 4PB0H 1A7RH 1E6OH 1U3YA 5K59F 2FTAA 3MRJA 2D0FA 3MSPA 3GXUB 3O8XD 3WEXA 3LN4B 2ZNXA 3O4LD 4NQXA 4J6RL 5I6PA 1NCWL 4FA8A 2WY3B 4U0RB 1ILSA 1TOXA 1IAIM 4PBXA 4UTAA 2YKKA 1BLNB 2O4EA 4XNYL 3OJMB 1FO0B 3VWJD 3OXRB 3O3BA 3ZK0A 4J28A 3EOAB 5CILH 3U9WA 2ZCLH 1IM9D 2AXWA 1CI5A 5CLYA 1A7PL 1MFCH 2IH3B 3J8F7 3L4ZA 2O5YL 1UWEH 2E8ZA 3HG2A 3ZE1B 2K4AA 1OLLA 3IDJA 1D6EB 4HWZB 1FF5A 2WTOA 4IKLA 3RL1A 3ZQ9A 3CLFH 5CLXA 1P5UC 3AADB 2XBDA 4Y4KC 1QLEB 4MMXA 5CCHE 1O7DC 3GSXB 3MRLB 1T5WA 2V5RA 5JPNA 1I7TA 2BCKA 3G9AB 1ETJA 3PABA 4L05A 2V7HB 4WO4D 5FV2A 5JHDE 4G6MH 3KPSD 2ZOKB 4RWYH 3L45A 4XMLH 4JPVH 2KI6A 3HBQA 3KLAB 4H8WC 5DS8A 5I71B 1RJYA 1LO4H 4YDVB 1UEYA 1OIOA 3L6FB 5C0BA 3IDXL 4HOZA 3PFQA 5C0AA 3OKOA 4HXBH 1CB4A 3RX9A 3RIFF 1BHGA 4FFWC 1ZLUK 3P11H 2X6CA 1DQLH 3RWHA 3NCCB 3VD1A 3ESNA 3V2AR 3HS0B 3TH2T 4ALAH 4R4FL 3HI5H 4NO5A 5DK2B 4Y2DB 4Q6IB 4M9PA 4AIOA 4Q58C 4L8DB 3NACL 4L0YA 1YCSA 5C9JB 2WYTA 3LHPH 2QKIA 4UOJA 3LRGA 3H85A 4K15A 4DPAX 1SJEB 3WHE1 1NBZA 4OJCA 3FQNB 4ZT1A 3ZPDA 1GC1L 4HU8A 5CJQL 3N0AA 1LEKB 5A2CA 1EAPB 4BRVA 4M4PA 4PVBA 3RAJL 1BOYA 5HYEA 1OWRM 4NNYB 5M94B 3IFNL 4Y1SA 2C3WA 4E9RA 1CGTA 1FG2B 1FH2A 1T1XB 5CWSA 3OPUA 1TLMA 5I18H 1F58L 1RH8A 1OLZA 1U8HA 5ICXA 4AQ1B 4LHUA 4RGOL 1IT9H 5TK4A 2J1ZA 3HFFA 4WV1B 1T6VN 3HBZA 4BFNA 4LDCA 4CDHA 5IP4A 2IC2A 1JXJA 4Y19B 3DYOA 3GXMA 2GK0A 1MREH 1TEYA 3FUJA 2D3JA 3ETBJ 4ZQTA 4XVJL 3RWCB 2J8OA 1NFKA 3QCVH 3KVDD 2EO1A 1XF2B 4PB9H 2XC8A 1P0SE 4PJFF 2Q3XA 1A5FL 4X7SH 4EUPG 1ZSHA 2E7LC 3L7EB 3ARGB 3NA9L 3SO3C 1QFWH 3OSKA 4GSDL 5J13B 1UUNA 3MXWH 2V9TA 3RNQA 4R7XA 2VUKA 3MV9A 1AG6A 2D4FA 4GP4B 4Z8FH 5DO8A 4N25A 2HJFB 4CVWA 1TG8A 4ODWA 4XVSL 3SSGA 4R97B 1K85A 4K9JA 1S7XB 1N8ZA 3FN0L 2EVJA 4AZUA 1JXFA 4HF5L 1DO6A 4AK1A 4UT7L 1ROCA 3GRWA 1V7MH 3K5SA 5DQDL 5IBUB 4A7SA 3VH8B 5F44A 4KAQL 1OE2A 3F64A 1UWFA 3MGTA 1YPZA 5FM5M 2HLFC 3TN0A 1R5WA 3QO1B 5ENWB 5I0VA 4XPAH 1XH3A 4U0RC 4AUJA 3BDYH 1N68A 2AKRA 4EZJA 1TVBA 4OGZA 5TE7L 3QJRB 4B27A 4AJ0A 5C6WH 3RFRA 3FPXA 4OCRH 1FDLH 2EVIA 4RZCA 1XIWD 3FQTB 4OGQC 4FFZA 4DAGL 2P80D 1G7MB 2XQBH 3I2CL 3JWNE 4LCWB 4NFCA 2WB7A 4XCNA 5I1AA 3BWSA 4DPCX 3LZFL 1ZTMA 3NOIA 1S7VA 1ZDSA 4PQXA 2FBRA 2ENYA 4PJCF 5E0FA 3VQ1C 2IPUK 3FDWA 2CDGA 3LY6A 1I1CA 2VWEE 2IALB 2YD3A 4XP9H 4DP1X 2JI1A 1UT9A 4Z77A 3H3PL 1DQQB 3SGJC 2D03H 5D7JA 4F57H 2PXYB 3ULVD 5I71C 4PJ6A 2MQGA 5DI8A 1CC3A 3SPCA 4KXBA 4BZ1A 3KLHC 2HVBA 2PWHA 4LASH 3UFIA 43C9A 2OCCB 4YL4A 3VNZA 1BIIB 4QHKJ 1MCOL 1O9WA 4JKLA 4M6AA 3GTVA 3IFPB 4N6RA 5DJ6A 3VCLB 1KLUA 4U4IA 5EUOE 5F7LB 1UZ6E 3W0WD 1OQOA 1XXDC 3D3VE 3HS0C 4FABL 4OGXL 1LO2H 4MA3B 4Y2DC 1DLFH 1LGVA 3OL2A 4N0CD 4NKIL 4Q6IC 2QGDA 4M02A 4S10A 3VFSB 1HHHB 2CM6A 1PCSA 3OR7B 3TS8A 1GMIA 1AZZC 5E4OA 1A0QH 4G6AC 2P5ED 2B3IA 1I8UA 4Z7UF 4NGHH 5C0GA 1WD9A 2OMUA 3AAZB 3I6SA 3WIIL 2ZUVA 5AW8B 5ICUA 5EOTB 3HG1A 1VFAB 3H4FA 4NC0B 3HTLX 4F93B 3G04B 4G8GB 1R0AH 3ARBD 1G9NL 2ZJSL 3BIAX 3FO2B 5BVJA 4NEHB 1FVCA 5IG7A 3N3EA 4E9TA 3AMLA 4UZGA 5C0NC 3DETC 3ES6A 3HE7A 3IXTA 4PVLA 1Q9KA 1V8HA 4PW3A 5IQLA 5FDWB 1BBJA 3WN6A 3GSNL 4KZEH 5IFJA 4HG4J 5JIHA 4WV1C 4Y9GA 2VDQH 2A4CA 4LCCA 1OGAB 1RUQH 3GPSA 3RUGF 4CN4A 4LSSH 3FHEA 1N0LA 4M8UA 3Q5YA 3QUGA 3STLB 4H8QA 4ONFH 4XBPA 5GSVA 4HZLA 3V9EA 4JKMA 1JPFB 1MFAL 3FTGA 1CD1A 4NJAL 4JUTA 1E65A 5IM7A 1N19A 3PHQA 2UZPA 3B5TA 5DJXB 5HYJA 1J1XL 3O9WA 1NGYA 3OM3B 4IIQA 4JPQA 4KOCA 4LVEA 4MDJB 2GY7B 3ARGC 2O5ZL 4G9FB 5J13C 1K3IA 1MH5B 2AQ3A 5DRXB 1MJ8H 4HVBA 4MXWH 3H9SD 1WD8A 3CC1A 4HSCX 2PMZA 1T21A 4C83A 1DQDH 1A3LL 1EANA 4R97C 5ADOH 1DDHA 5E6YA 2BNQA 1R75A 5L6YL 1EJ8A 4XP4L 3L5XH 3UTQB 1LO3L 1VZIA 5F9JB 1IGYB 3QZNA 1PX4A 2CO1A 5FHBH 1QSEA 4GSXA 3SDXA 2BY0A 4HIEA 5TDOA 1GOGA 4DNLA 3S8FB 3VB8A 3L5IA 3TZVA 1IKOP 4JY4A 2HFFA 1J5OL 1A7QH 3PWLA 5DEGB 3O2WL 5E95B 1F6LL 2ATPA 3CUPB 4QPEA 3CSPA 3QNXB 4OZGA 3PIQB 1JF6A 1WK0A 4R7VA 1Q0YH 3HNSL 4UMSA 2X3AA 1CXEA 1MCLA 2YGOA 2OR9L 1DVXA 4NKMA 4Q9QH 2G60L 3UPRA 1AIFB 5FO2A 1WBXA 2G3XA 3KCPB 4LIQL 1Q9OB 4UQIM 5EC2B 4BFKA 2QVFB 1GGIH 3C6SA 1QA9B 4JFVA 1RMFL 5IB1B 3S0PA 2EDMA 3I6LE 3KGTA 5IVXF 3TL5A 1LHZA 4JKPL 3CFIC 4UM9B 1UOKA 3S88H 1XCXA 4OSUH 2DWXA 3BP6A 4YFLF 3VD4A 1P2CA 2WWMC 2Z7YA 3ML8A 5I8CA 2LGNA 1PZ2A 5KVMC 4JFPB 3L3IA 4X8XA 4I2XA 2NT1A 3A6BH 1J18A 2AANA 2PXYC 1T04A 1NMCB 5ADPH 4TMPA 3D52A 1MW1A 3PQYA 1GIGL 3HAEB 4P5RA 3WNKA 1A4JB 4F15B 3OKDB 2B0SL 4GXUN 5DT1L 2EE9A 3FU0A 3HCVA 1WLHA 3WO4B 4ZFQA 3UBXG 5IJVB 4FQ1L 4M5TA 3MRNB 5AVYB 1LE9B 4AITA 2UX6A 3FW6A 2AJXH 3WDHA 5D7LA 5DD0L 1Z6JT 3QHTC 4ZS6D 5G5DA 2E56A 1RZFL 3BN3B 2OAAA 4TUJB 1QBAA 2XHNA 1OALA 2K1MA 4LNVA 3PV7A 2LABA 1E8XA 4AGLA 1ZANL 1BZOA 1KTLB 2E74C 2XWRA 5DFTA 4F9PA 3ME0A 2C3VA 3NJNA 3ZR5A 3WD5H 2LU5A 1QYGL 2EXYD 4N5EC 3TIDA 5LKNA 4M5SA 4AJVA 4WI9A 2UXTA 1CXFA 1KFAL 3D4YA 5T5FA 3ZTJG 5TDNB 1BQUA 5LBSH 4AT6A 1MJ7H 3GLEA 4P5MB 2CO2A 5FHAH 1FV1A 4PJFB 3AY2A 3MUY1 2K4WA 3M86A 4PJ9B 4O2FA 4JFDE 1EHAA 1TSRA 3BH4A 4IU3B 3S8GB 2DMGA 2WN3A 2IIJA 2GYSA 2P8MA 5D1XB 2GTZB 3X13A 1P6WA 3ARYA 3NFNA 4JPWL 3T1FB 3PWPB 3D48R 3L16A 4RAVA 5GRVL 4FXTA 3WU1A 1ES0B 1CBVL 3BP7A 4XCEA 4LPCA 4F37F 5G55A 3X1EA 1VGKB 4EXPX 5I23A 2XNAB 4QHPA 4QNPF 1JTTA 2YAOA 2IXQA 3KWWA 2C8NA 3QEHA 1ZEAL 2CIKB 3IK2A 2WBJB 3B3BA 2G9KA 5L2KD 2PETA 1T2XA 3OKEB 4L2YA 3JYCA 1QOKA 4M03A 5A6IA 1JPSL 3BKJH 3KJ4B 4XCFH 3C8KA 4ZX4A 4PV8B 3AXHA 1HCYA 4W4NA 1W0WA 3FH5A 3KE0A 2G3ZA 3JWOH 4L3EE 1YJDL 2DRUA 3OZLA 5KVGH 3GSRA 2Z64C 4O02L 3KPOB 4G3YH 4M7JL 2WQWA 1GYAA 4A37A 4CGTA 3WHE0 4ANXA 2X2IA 4N2AA 1OGSA 1I7RB 4PJCB 2JK5B 1G7IB 2CKBH 3QI9B 4MJ6A 4Y4FB 4E9VA 4NENB 4KKQA 4D9RE 1AOZA 1MFBH 1QTYT 2BS8A 5E9DE 2IEPA 3K46A 2GT9B 1GJIA 2FQDA 3QJFA 1M7IA 1JI1A 1MCFA 1TLKA 2SEBA 3WNPA 2A1WL 2HWZH 3HR5A 5CR8A 5DVPA 2ADFL 4D7BA 3VGGA 2QQNL 1XBDA 4OLXL 3QWQB 2VW4A 2WUBH 2XIBA 3C2AH 3VRIB 2EC9T 4LLMB 3RWEA 5L88H 2NXYD 2KUTA 3GLDA 4Z3EA 1RULL 2H4EA 1OD9A 2VR9A 3FUHA 3UMTA 1E2VA 3H0TB 4NJ9L 1E9OA 1OHQA 4I3RH 4L3CB 3V9FA 1JE6A 2ITDB 2Q6WB 4LPYA 4OZHF 5TDPA 1MW0A 3STBA 2ZZUT 3IGAB 3MV8A 4AEHL 1NMCC 3T5WA 3DROB 2ZCHH 4PLNC 2B5IB 2FO4B 2PR9A 4F15C 3UJTH 2EUZA 3MOBL 4B60A 1R5VB 3UBGA 4JRXA 4LLWB 4Z7UB 1DFXA 1MVUA 3P1VA 1RUAL 1JRHI 3N41F 3WO4C 2ZSWB 1G9ML 4NKOA 1X5GA 4G8IB 4MNQB 2FO1A 5D2LE 3VSUA 5FFOA 2B59A 4F7TA 4KZDH 1QEWB 2R69A 3EJSA 4UWQB 4UTCA 1IJ9A 1XF5A 4OZIE 1RD6A 4D9LL 4JFXB 4HK3N 1CR9H 4LGRB 3MRRB 3IAPA 3BUIA 2G2RA 1N5AA 1F6AB 3OGCA 4L4VE 4E41E 5K33A 4WJ5A 3WJJC 1INEH 4RBPK 4BSJA 5DGRA 4PRPA 3IS0X 3CN1A 2X9YA 1C12A 2VERA 1YEFL 3BSZL 3MGAA 3QORB 4GOSA 3RUGB 5C97A 3BVWA 3IETB 3VI3F 3QUZA 4XNMA 4X4ZA 3AREB 2AK4B 2ZWSA 4P9HC 4ELKA 4BCYA 3B3IB 4WI5A 1VEMA 4L29B 3CFKA 1YEKL 3PGDA 2ZXAA 3KPTA 4UNIA 3U79A 2CCWA 4HKJB 3ZXAC 4ZUSA 1LNUA 2D4DA 4PJ9C 2K6WA 4O58L 1UA6L 1J9RA 5B3NA 4FHKA 5IB2A 4TSAH 4YWGL 4KKCC 3IJEB 4PPTA 1UD2A 5C2BH 3T3ME 1HHJB 2NX5E 5D1XC 3FZUD 3II3A 1BD2A 3MGOA 4QOKD 4WGKA 4QHUA 3BVUA 5I73B 3QNYB 1I1AB 4P5TA 2H6PA 2YQ3A 2AEPH 1IQDB 5EDSA 1VB9A 1YSOA 4HWBA 5ESAA 4BFJA 5JW3H 5DUML 3UAJA 1L6PA 1XF3B 4G42B 1MCIA 3WKPA 3TA3B 5LN4A 1WEJH 2Y7QA 4G6JL 4QRRB 2WBJC 3B5HA 3S5ZA 1X4YA 4TNWF 4FMKA 4K07A 4BSVA 1SXCA 3H9HA 3EDJA 1DUZA 1FE8H 3KJ4C 4HHAA 2GUOA 4N22A 4J2QA 4RAUB 1AQKH 4W4OC 3KYAA 4LDOB 3ZDZF 2E9GA 3T4AA 5KBKA 2OMXB 5HHOD 5I0WA 1MNUH 5CAYB 4QXUL 4U1JB 1KEMH 3Q1EA 3NJVA 2ARJA 3IPEA 1RK0A 1A7OL 1FUNA 2CXKA 3MLTA 2VXQL 5T33L 2OMBA 5A2LH 2Y25A 5EB9A 1I1RA 2KERA 1KYDA 1ND0B 2X88A 2ZNWA 3DSFL 3PJSB 5IVXB 3CC5B 3N85H 4QXTB 2YAFA 3L3HB 3I9PA 3OHXB 4UIMB 1UKQA 3ARXA 4HX1B 2SODB 4Y4FC 5ALBH 4JDTL 1N6UA 2BSSA 5H2BA 4NQVA 3SY0A 1JFQH 1ZE3H 2Z93A 5JHDA 3FBKA 2N7AA 5JW5A 1YEHL 4HIXH 2D3LA 2XWZA 4EN3A 2OX5B 1T4WA 3UTPE 4HUVB 3QUYA 5E6ZA 3F12B 5EOQH 5AEAA 2UY6B 4OKVA 4H40A 2IG2L 1A7NH 1CFTA 4M8QB 2IH1B 3GXFA 2CMRL 5AAWA 3HG1D 1S7QA 4ZPTB 3K71B 4XX5A 4HUWA 4MD4A 5T1DH 3NJFA 4ZTOL 1Q0XL 2CDFA 1CZ8H 1IIKA 3X14A 3KLDA 5DYFA 5I6KA 3RX5A 2FIKB 2Y7LA 4C47A 3LNIA 3O2VH 4QAMB 2VITB 2B5IC 4N28A 3CMOL 2CCLA 4PG9B 2R0ZH 4NQTA 1I9JH 1N6VA 1WWAX 3EYOB 4Y7OC 4APQA 2X44D 2YPVH 2OMZA 2Y0SA 3MREA 4I9XA 1GZPB 3D1MC 4ABQA 4F8QA 4TVUA 3C5JB 4FYTA 4LSQL 4H20L 3THMH 3KJ6L 4MZIA 1FPTL 1HCFX 5I1LA 2P8LA 1ZCRA 1DN2A 2BY3A 3HN8A 4PUBH 3FU8A 1F11A 5JYMA 1JNNL 4Y4HB 5DR5H 1KPUB 2BIHA 2F7IA 2DD8L 2ENPA 2FO8A 4R8WH 1T22A 3FQ4A 1F6FB 2OYMA 1YQVL 2BLFA 3O9WD 4F27A 2CR6A 4PJIF 4WKZB 1XTMA 1OGPA 3Q5OA 3QZWB 2ZE0A 3UTSD 1WS8A 4WDIB 3VM5A 3QORC 1KTCA 2X89D 3OXSA 4A6YL 4O9HH 2WYZA 4JGUA 4DP5X 4ISVA 3IRZA 3MFFA 3QEQE 5C2UB 1TMCB 1WCQA 3AREC 4KI5D 1T0NA 1ZHKB 2BNQD 3JTSB 5KTEL 3BHBA 3EHBC 4EBQL 1J11A 3IPFA 1P7QB 2HT4C 4N8CH 4UDTB 1GGYA 3D12B 3NK4A 1JAEA 1E28A 1I4FB 1P4UA 3MJ7A 2LAAA 4O51A 1OARH 4YO0A 4GXVL 1AS6A 1HHIB 1ZLSL 1UHVA 4I3SL 3TZVD 2YUVA 5I73C 4BFOA 3DJSA 3Q2WA 1IFHH 5CM1A 3RNKB 5TPWL 1LMKA 3BI9X 2UXGA 3UIYA 5E2TH 4IHOB 5B7EA 4PJHF 2BSTA 4ETYA 2X6UA 3TA3C 3EBGA 3LS5H 1TZGL 4QRAA 2L4OA 3KYOB 4OD2A 1NCHA 3ZDXF 32C2A 1BOGA 1VLXA 4G7VH 5B3SB 1KB5B 3BSGA 2ARJQ 4B97A 1MWAB 3MA9H 1E2ZA 1M4KA 3B2VH 3F7YB 5SWQA 1KCVH 5E8NB 1QR1B 4W9ZA 1EAQA 4XCYB 3UYPA 2R29H 1A7RL 4B5EA 2E86A 2Z8WC 3H3BC 3VXRE 4GEIA 3QUHA 3ZR6A 4F91B 3NSDA 3J7HA 3AZUA 4UV4L 5DJ2A 3GMQA 3VXUE 2WQVA 4MJHA 4WAFA 2JB6B 2E46A 2VLMD 1MHHA 1SJHB 4LSVL 3LKNB 3RVWC 5AWNL 4Z7NF 4N3UA 1SFHA 2VOTA 4WTXA 2D3NA 1TVHB 3OHXC 3UZQA 3WFEH 2YMTA 3U4BL 5HDBE 4FC3E 3WI9A 3QG6B 1B3IA 1QLRB 2VYRE 4R3SA 5AALA 4JPKH 3U9PH 4WWKA 1NM9A 4BINA 2HJLA 5I1HL 2JB5L 3TNMA 3HB3D 3HZ3A 4LLDB 3LKRB 2Y5EA 4M6NL 4UYQA 4X0KB 4PIBA 4Y16D 2KQMA 3D87B 3MLVH 5DDHB 3RVVC 3WFBH 2K8MA 3M1BA 1DE4A 1N9PA 3RFZA 2G0KA 2J6WA 1H3PH 3D69A 2DL9A 1FHGA 2BCMA 3N41B 1T2QH 4X7TA 4POYA 2EH8H 5EUOA 3F5WB 5T5NG 2PN5A 4XMLL 1FVEA 3D3VA 3CPLB 4I48A 1H3VA 4JPVL 4HOWA 5CBEB 3LNDA 3ARPA 1BVLA 2BXYA 1CGSL 5T1MA 3CU7A 2Z8VC 2GHZA 2HTLC 3BD4A 3R06B 4BSWB 4LQFL 3S37L 1PZCA 4NUJB 2XZCH 5C9KA 2VN5A 4R4BA 3RB7A 2CBOA 3U1PA 4MFHA 2DDQH 4MRBA 3MRMA 3DK0A 1SF3A 4J3OD 1KPRB 1NWOA 2E7DA 1WITA 3F8UB 2IBZX 3FFDA 4AM0A 1KPVA 2YMOA 3O4LB 5IB4B 2R23B 4Y4HC 3MKKA 5J3HC 1WAAE 4QYOA 3BD5A 5ICYB 4OBSA 4EUPB 3VWJB 4PI0A 4RA0C 3E1F1 2J1KA 4MJID 3ESPA 5ACZA 1AGCA 2GVYA 4OUOA 5B1JA 1ZLUH 3HZMA 5GGUB 1IM9B 4EI6B 2OM5A 1GMEA 1JZEA 2C9PA 3G3LA 3WLBB 4ZXBA 3T0WA 4KKZA 3ZHFA 5EN3A 1DJHA 5LAPA 2WJ7A 3U6XA 3NZHH 4MDIB 4DHLA 4E0RB 2Y3AA 5EPMB 3ZVVA 4JQIA 3LVTA 1IZKA 1K8DB 4RIRB 1DANT 2Y23A 4WI0A 5BMFH 4M48L 4GW1A 4K9EH 3U7WH 4KRMB 4HUKB 2YLHA 3ULSA 4OGAD 4WO4B 3ZUNC 3LOWA 4M6ML 4PR5B 4U1LA 4P2RB 4Y5YC 3EDEA 1NPUA 2VR6A 4MQXD 5FM5O 1IC5L 4PB9L 2H0FA 4ODBD 2PPDA 3CVIL 2APWA 3VSVA 1I9RH 4W6YB 3QR2A 4PREA 4WSJA 1XB6A 3M7FB 4K5MA 5JIDA 5KOVC 3JQOB 4YE4H 3NABL 3C08H 4YSSA 5L7XL 2BY2A 2NPLX 2LAGB 1JERA 3MZTA 4I0PD 2WCGA 1NLDL 2X38A 3ZDZB 1IBYA 2I26N 4WWID 2J8UF 2CDEB 4FLRA 4R7NA 4RH4A 3QJZA 1NUGA 4FEMA 2RALA 4G80A 4I4WB 2XUWA 3MLRH 1HQRA 4NRXA 5I1GL 2F15A 5A2KH 1MRFH 3QG7L 5D96B 1P1ZB 3GJFB 4HCIA 4AL8L 2MFNA 4HLZH 4NAMA 3UGUA 2UYLB 2J2ZB 4P48A 1YN7A 2WCSA 3MJ9A 4YHIA 1DBML 4W93A 4F7CB 5CEYA 4XC3L 2ZD0A 3W9EA 1SHMA 2GIMA 1G6VK 1R3JB 3LAFA 1E4HA 3FO1B 4JFFE 3MV8D 4HH8A 3VFUA 4Q0XL 3POCA 1A4KA 4MD5B 4XP5L 3O3DA 4HKXB 4IQHA 4DTGH 3W5MA 4JRXD 4Y1AE 5GS2D 3ZE2F 1FDLL 2F54E 3DV6A 3BIKA 1QRNB 2XYBA 4S1SH 4UILL 2Z31A 1CGYA 4OM1L 4ZMTA 3LIZL 4B9ZA 4IIZA 3JWDH 3EGDA 4QR7A 3US1A 1IEBB 1NC4D 1Z3GL 3JYBA 4FQ2L 5GSRA 5HGGS 5AD0A 1Z9SA 4JZOA 4QRUB 4X5WA 5J0BA 2WBXA 1MCJA 1RURH 3CZKA 4HOMA 2ARWA 4MX7A 4DCQB 4XPTH 1TJHL 3HBPA 4ODTH 2IV9A 5DFVD 1AZBA 3KXFD 1RUPL 2G5BA 1RZGB 4G72B 2WGXA 5E8EA 3MODL 5EZOH 2W9EL 1QG3A 3R7RA 1LWRA 5JMRA 3TNNB 2WSDA 2DWSA 4FQCH 1LL1A 4D0CB 4JLRA 2J88L 4PJDE 4AM0Q 2ADGB 3PDOA 3MO1B 4IW4C 1T89A 4JGMA 1ESOA 3W38A 2YXWA 4IDJH 1IKNC 3IAQA 3HR6A 5LXGH 5DYOA 3SKMA 4PJIB 1GXEA 1IE4A 3Q44A 5GGQH 5AG8A 1UB6A 5I30L 5L8KB 4CSSA 1KCUL 2VSDA 2BRRH 3TV8A 2VXVH 2F74A 1GA2A 5D9SA 5HY9A 2JCCF 5IMLA 1CYWA 1GVIA 1BD2D 1DUYB 2ZUWA 3RGBA 1Y6KR 1PLGL 1IBGL 3LEXA 4GI9A 4OQTA 4P5TD 3TFBA 3PYCA 2OTPA 1WE5A 2X1WL 1OCWL 3FQRA 4HC1L 1UB5A 1DVFD 4JN2B 4ES8A 4NAQA 1EK3A 1IGFL 3VWJC 4JFDA 3A24A 1G43A 5CZRA 3UAJD 5IHLB 2PYFA 5HGAA 4NERA 4BKLA 4H8HA 1I7UB 3L5WA 2B4CH 4UM8B 2V5YA 4TUOA 3QYNA 1F42A 1DSFH 4BEIA 2EAEA 2X09A 5A16A 2IDSA 2P5WE 3FUDA 1NDMB 1I3UA 3VU1A 4KZEL 1X5JA 3F58H 5FWQA 2XTJE 2XZQL 5I1CL 1NEZA 3ULUH 3WELA 4XBEH 1TQWA 2FJFB 3KPPB 4PJHB 2IANE 3OMZA 1N6QL 5IQ9A 2W07A 1F4WL 5GIRB 2ZSVB 4AV0A 3NK3A 1B0WA 5JXEC 2AEQL 1OQXA 4WO4C 3FCTB 1ZLDA 3ZDXB 2B1HH 2KZBA 2ODIA 2R4SL 3BP5A 1R5IA 2AEOA 1MXDA 1J7VR 2GI0A 1ONQA 3NCYS 1F4AA 3CV5A 4J23A 5AZEH 5GS0H 2X87A 1JGEA 2QBWA 4L3EA 4NZDA 5T3XD 3MRQB 1Z9LA 2VLJE 3OG6B 4U3CA 2BC4B 1G7JB 2NOYA 4PV9B 5E6UB 1PZBA 2QMKA 3G5XB 2BMKB 4U6XA 4URTB 4ZMOA 2V2TA 3QIUD 3QXAA 4G5ZL 1T7YA 2QPUA 4KZCA 4N2KA 2MCMA 1U8IB 3DOSA 3P4MB 1KBGL 3V4PA 1KCWA 3CQPA 4WTWA 1NKRA 1VGEH 4EDXA 1M6UA 2NR6A 5KUMA 5HYQB 1CI3M 5I19H 5E9DA 1IAOA 4I9WE 4D0DB 2NY6D 3ECVA 2FLMA 3FTXA 4JFSA 3S2CA 5JR1H 4YSDA 3ARBB 1CQYA 1JPEA 1K72A 3QQDA 4JG5A 3DXAD 2H2SD 4D3CH 3VI4F 4TSCL 2GEQA 4H26B 2OL3A 1J0KA 3MACL 3ZHKA 5K5YA 4S1DD 2H0EA 3UBXB 3BJ91 1BVOA 3SKNB 1O9VA 1HSBA 1BQHG 4FI6A 1QZNA 1GGIL 1CE1L 1RU9L 1CLOH 1HC1A 3MR9B 1E9PB 2V3EA 2OYKA 3K6SB 1N0XL 1ANUA 5IQMA 5FYLL 4P9MH 2DKUA 5L8LB 3BH8B 1G7QA 2ZOUA 1OSZB 2FEEL 4QGTA 3L1OH 4PLKD 2BW4A 2V8MA 4DESA 3SKJH 4NUGH 4LPTA 5I28A 5D2LA 3VW3L 1UQSB 5F3HB 2Q9OA 1YLBB 1YEDA 2FJUB 1XGUB 4KDTC 4WU7B 2VB5A 4OB5L 3L2NA 2N1TE 3RWGA 2EYTB 4OZIA 1NCBH 3H9SB 1TQUA 1U8OB 5GS1B 1T1YA 3FB7B 1MCSA 1ASOA 5CHNB 4M3HA 5AVTB 2HX7A 4HS3B 4XB8A 2LW3A 2GJ6D 4L4VA 4E41A 4YDKH 3JV4B 4L1BA 3SE6A 3VUAA 5DMKA 4MJ2A 1M7XA 2R7EB 4J6IA 4Q89A 5ANME 2UZYB 5D1QE 4PP2A 1VA9A 1E4KA 4X83A 4J4PA 2DQCH 1WICA 4UQ2B 4LKXB 3AXLB 1KTDA 5DQJB 3J07A 3UOAB 4NM4H 3E6HB 3QXTA 4UBDC 4DVRH 2OMYB 4XE5B 1H3UA 1S7TB 2R39A 1GGCL 4HJJH 3VXOB 2X2YA 5AZ2L 5IEKA 1GZHA 2DI7A 1I1YA 2NX5A 1AHKA 5EHFA 3TWCL 4PY8J 2VMJA 1EFXA 4L3AA 1LMIA 1PS3A 2G2PA 1W80A 4AV5A 1KEGH 1DVTA 1JVOA 1KXHA 4U4BA 1SYSB 5DVLA 5LBSL 1MJ7L 1PF3A 1HH6A 4GW4B 4H44C 2Y5TB 3MRDB 4UUJB 4ATTA 5FHAL 2A74B 1WA2X 2FJGB 4FCAA 5I66B 4PTTB 2VZTA 3QNZB 2IQ9L 1SHSA 2Z7UA 3NEOA 3BZFB 5DHXB 1M6OA 3TCLA 4BH8A 2J8UB 2VZUA 4OM0H 4F33B 4F8LA 2XIIA 4ZZFA 1CGXA 1R3HB 5LWYH 4F2FA 4NO3B 1PZDA 3PNWA 4I5BA 2BVTA 2BK8A 1G4MA 3QAZB 3MNZB 4JPIA 1WZMA 2DKSA 3PPSA 1FZJB 4J3SA 1D7CA 1IILE 4XNXH 3FT2A 1HN1A 3WE6A 1BZ9B 1X5HA 2R2EA 2IH9A 2CK0L 3LQAC 1IKFL 1GHFH 1ULVA 2WYHA 3WDJA 2WWKT 5F6IB 2DI8A 1PZ5A 4XRCB 3C5SB 2ICWA 2E3VA 5BS0E 5LDUA 5LB1A 4IJTA 2HUHA 2NYYD 4N0CC 5AKTA 4N2HA 3CFEB 4NO2B 4HGMA 2DTMH 4IMLB 1I8IB 4W9FC 4AG4L 2VM3A 3MUHL 4EPSA 5A3ID 1YVLA 1M71A 4L37B 4ZO7A 3TJEH 2XACC 5B3JF 3ZE2B 2ZOOA 1T1WA 3O0RH 5GRUH 3G5VA 3EFFB 4U6HA 4XGZA 5C7XH 5KVGL 4HJTA 2P5PA 2JLLA 3LKPB 4JDEB 3D3VD 1CS6A 4OH2A 4GMSL 3B7UX 4BWWA 5BO0D 1TCMA 1HIML 3SODB 3TF7C 3LZRA 3EG9B 4QI3A 1K2DA 1WF5A 3MLWH 1AYOA 3PNRB 4K3DH 4P4KA 2PW2A 3HPLA 3WXVL 2YO3A 4L4JA 1H8NA 1S7SB 1V7NH 1C5DA 2FSEA 3ML9A 3T04D 4L8SB 3KGRA 5T5NF 3TO4A 3VQLA 4NIYE 4BGLA 3B9KB 5DD6B 4AXWB 2WSPA 3PE9A 2F1EA 2F2HA 3QDME 2DEXX 1NUDA 3L13A 2LTQB 2VDKB 3K3QA 5GGVL 4RFEA 3TYGH 3QAQA 5FXCH 5CLZA 2O93L 5TF1L 2OZ4H 3FOLB 1BFSA 1A6PA 2IDTA 4N0RA 1C1EL 5EIIA 2V6HA 4P2OB 3G5YA 2Z8RA 4I3RL 4MAYA 5DK3A 1G6RL 5EFIA 2AJZB 1OP5H 3KWUA 1QP1A 3P4LA 5D2NB 4LSRH 5E5MA 3TF4A 2JCCB 2NY1D 2WLZA 4PD4K 1FIGL 5D55A 2NY3B 5GS1C 6FABL 5L2KB 4YHMH 5DSCA 5AVWB 5C0EA 1P4BL 2XJLA 3NFPB 3FSOA 3VFOB 3EYVB 2TRHA 1SDDB 2VDRB 1M7DA 4IKNA 3GBLA 2C9VA 4LIQE 4KNSA 2Q0ZX 5B38G 1NGZB 3AS2A 4KTEL 1Q9LB 4DEUA 2VXTL 4MMXB 3GMRA 4O5LL 3RTQB 1IEAA 5CFHA 4F2ME 1VESA 4M7LL 2KLRA 1KXQE 4NZTH 3MXVL 3QEQA 4HGKC 3L3JA 3T6ZA 3G6JF 3GO1H 4WUUD 3MHZA 3G6AA 2D0GA 3PDGA 1RUMH 4HWNA 1INEL 5I17A 3QWNA 1EH9A 3SYOA 2P49B 1M3IA 4M62H 4AMKH 5IHZB 1H0DA 2X41A 2XG5B 4XOBA 1SM3H 1E40A 3PL6D 4ETQA 4DQOL 2ERJB 4IBSA 5C7ZA 2C7UB 1FFNA 1ED3A 3AW5A 1UWXK 3BQUA 35C8L 3BWAB 3IM1A 1OGTA 3P3RA 3J27A 2FD6H 2RD0A 1ZV2A 5EIVA 3ZBMA 1KELH 2A74C 3GHBH 2HVKB 4MJJA 3T09A 1OT4A 4IOIB 3LD8B 2NZ1A 1VADA 5F3BA 1P1VA 2MIZA 8PAZA 1A6WL 1K5NB 1L3WA 4NP4H 2BWDA 4LAJH 3CVCA 3RBSA 4EI5D 4V1DE 3MC0A 3DO7A 4ONOA 1BSIA 4H1LG 4RBPH 1FGNH 4K5PA 2UZIH 2AEPL 4GW5A 4LAQL 2X1PA 3U2IA 4TVPL 2AVGA 1JGLH 3BGAA 3FCUB 2VXUH 2R83A 5IFAL 1ASPA 3ARFD 3VXRA 1SOXA 2O5NA 4XO4A 3QFJD 5E2VL 4BK5A 1GKEA 3KGSA 2KKQA 3VXUA 3D8MA 3NCJH 2JLPA 2F0CA 4A2MA 5KYXA 4G6KH 4W9LC 5F6IC 3LEVL 2WXLA 3SGDH 4LLQB 4OLYH 2X4OB 2CPCA 4PS3A 4F5CE 7TAAA 3GMLB 3MBWA 4NI6A 5EU5A 3VI4B 1H3GA 1NGXB 4B9KC 1FAIL 1B90A 1UFUA 3SQBA 3WJMA 1I9IH 3S3JA 2F08A 3HC2A 4J3TA 2X2UA 3JUZA 5AVRB 2VDNB 4MHHI 2RMNA 5BVPH 3VVWA 2IOOA 4A67A 3I6KA 2G75B 1ZVSA 4QY8B 2YD1A 3GBNH 4J3OF 4DN4H 3MFGB 1HH9A 4IU2A 4PTUA 3DTXA 3KPQA 4I77L 3NN8A 4H8WL 3BWUF 1S5HB 3L95A 1P4IH 2ICWJ 4AZ8B 1EEQA 1AFVH 3E2HB 4HH9B 3GSQA 4Y5VB 5EC1A 3CDCA 2DLTA 2IPUG 2R8SL 3R0MA 1PEZA 4L8SC 4NRZA 5FK9B 5J6GA 1FVDA 3B9KC 1YEWA 3P0YL 4FHBD 3U9UB 5B1KA 3B2DC 1VCAA 4YVUA 4M7KH 2LTQC 1AGEA 1BFOB 5DHMC 5EOQL 4QOKB 3GIZH 1TYRA 4K94C 4U1MB 2O61A 1A7NL 3BN9D 2EICA 2V5MA 3IJ7A 1E7VA 2E75C 3B2UD 4PJ5E 4P2OC 5CP7A 4HCRH 2GJZA 2QHRL 4IEFA 5F96H 4AQAA 2HT3D 1CZ8L 3KYMA 4O2EA 5D2NC 4TSBL 2PUQT 3GXDA 3VQ2C 3ARDA 4RZCB 3FRPA 4QTFA 2J25A 1RK1B 1RZKL 3DDFA 4K2UH 4WEEA 4FL4B 3GXNA 2NY3C 3K1DA 2WANA 3EJZC 2R1XA 1NCIA 4JPSA 3FU7A 4OCWL 4XCNB 1WAAA 1OD7A 4GAJL 4XNQB 3D25B 5DUPL 1I82A 1JZ5A 3EFOA 2FH6A 4MAZA 5D72H 2H3NB 3NCEB 3BEVA 1BX2A 3RTQC 3EUDA 2F5AH 2BNRD 5HHOB 4LOFA 1XCTB 1C5CL 5CINL 3WKML 1UC6A 3O3EA 3NSYA 3LKSB 3QWRA 4R8WL 1K3ZA 2D9QB 4P57A 4XBMA 2IO5A 4TNFA 2Z0BA 1OANA 4ZFOL 4N0YH 1L4IA 1QTSA 3UCQA 1P6AB 3WFHA 3WUWB 3WJLC 4ENED 4Q9CA 2A7BA 3BVTA 4O9HL 3BCDA 1G7PA 1FZKB 4HOXA 4L8CB 5MENB 1EZUA 2ZTBA 2DQTL 4TUUA 1KCRL 4Q56A 3CWGA 4U1SA 5HDLA 3VYOA 2ERJC 3O6MH 4B6ZA 2GITB 3RWJA 5I1IH 1T0PB 1KTJA 2PCPB 3QWOA 4FXGA 4PRDA 5PAZA 4PJGE 3MV7E 1HQ4A 1U93A 4R2GB 2P1YA 3FT0A 2VQ1B 4BJLA 3CVBA 3LD8C 5JDSB 1WFNA 4PP1D 2VR8A 1EMTH 4D9RD 1NAMB 1Q1PA 4OAWA 2EIZB 4OZFH 5E9DD 4A2GA 1OARL 3UGXA 4GLRH 5FA4B 3W3BA 3VG9B 4DGIL 4O00A 1FNEB 4LLUB 3S3DB 1E67A 3RIFK 1J5DA 1AXIB 1PZSA 4NS0A 3IBOA 3D34A 1BYPA 4QXGL 2AP2A 3ES6B 5CCJA 1FFQA 5AQ0A 1RZJH 3B8SA 3CN3A 4LK4A 4D2NA 3VFWA 1PLCA 3MRPB 5FM8A 3LS5L 1FO0L 5DD5L 1RPQA 4GINA 3Q3GA 2X4RA 3WFZA 3O3AA 4QHKI 4PRNB 4JFFA 2ZYIA 5EU7C 1BGXH 4PCTA 1WJ3A 5SX4I 1O5DT 1MCCA 1S8DA 1SLWA 3B2VL 4AY0A 3II2A 3HC3H 3OJVC 2R29L 4RISH 1SN5A 1TZAA 3NSCA 4IBTA 4Y1AA 5AOMA 2AJ3B 2F54A 3GT6A 1YRKA 3D85B 2I5YH 5F7EL 4MJ5B 3FTGB 5DZJA 4FX5A 1F4YL 2BVUA 3CFDB 3FB6B 1MI5E 3QJQB 3MLSH 1TJGH 12E8L 5F8RC 3OKLB 3UTSB 1MAMH 4XMZA 4GG6E 3BAEH 3ARSA 3L4UA 4HMDA 4I13B 4XOEA 2YKLH 1T21B 3VXTB 5E6IA 3NFSH 5I6LA 4QT5A 5EZIL 3DSNB 3E2HC 4KGLA 2BNQB 4Y5VC 2WVVB 3RWDB 3CU1A 3CZNA 4L4VD 4CGUB 4E41D 5H35A 1RHFA 5BW7A 5SX5K 1A3RH 2P45B 3LXUX 3K6FA 4HKZA 1ZV9A 5DHDA 1MLBB 2B2XH 3QJXA 3MKGA 2ZG1A 4DK3A 5CSZB 3V0GA 5ID0A 5KW9L 5JHLL 3WEAA 1NGQH 4IYKA 4J4PD 2XV6B 2X4UB 1UZ8B 4PGCA 4PJDA 3EF4A 1H3PL 1LDPH 4IBUA 3U0WL 4AYGA 4PLJD 3GNMH 4HLEA 3QW9A 4DP2X 1XR9A 2CKBA 1U8LB 2ATPB 2OJEB 2XYCA 2YC1A 1U8CA 3DGGA 4KQ0A 3K0WA 1E3FA 4YBHA 3C60D 3QA3B 2GFBA 1JHTA 3LSOB 1JPTL 4TQPA 2EE0A 1U6AL 4FL4C 3OB8A 1AGDA 2DYSB 2NTSP 3G6JB 3TIEB 2VDOH 3P73B 5SWZB 3V0HA 4JHAL 1MCNA 2ZPKL 4FQIH 5DS2A 1YAIA 4DW2H 3TBYB 5CBAB 2F18A 4CU8A 1XWVA 4MXVF 5IHUH 4UNTA 1MJJA 4EDWL 2EE6A 3MBXH 4OLUL 3ZOAA 5I8CB 2P5WA 1HL5A 3V5DA 2AXFB 3GSWB 1C16B 3OAYK 1YECH 5JW4M 3WGUB 2CU9A 4JFQA 1LQSR 1CD9B 1VFOA 2BP3A 4F7MB 5F1NB 2IANA 3DMMD 1F86A 1M2VA 4C58B 3LNGA 3NSJA 4PJ8D 1L9OA 2OCJA 2QPDB 4XPHH 4P5SA 4XO9A 2NTFA 4X5PA 5FR3A 1GTNA 2FEJA 4XN7A 3T3PE 2GTWA 4IOSD 4XNUL 2A6JB 2X4NA 1FNGA 1ZWIB 2ZUSA 3HB3B 2YN5A 4X4ME 4Y16B 3FONA 1N4XH 1INQA 4R2GC 1ZT7B 2YUXA 2LVEA 1MIEL 3F83A 4L5FH 2VC2H 2YZ1A 1BA9A 5BXFA 2VLJA 3HRZA 1RJZA 4K5OA 1Y0LA 3VG9C 5FFLA 1A9BB 4OLVH 1ZVNA 1JF5A 2EXWC 4DH2A 4OV5A 1RZIB 4JFEE 1KCSH 4HBCH 4MMYB 1GZQB 1ZTXL 2WXRA 1JV2B 2HFGH 4B9JA 1RIUH 3DHJA 1D5MB 3TYFA 3V52L 4YZFF 1E5ZA 4DQAA 3DO4A 5HVGB 1AGFA 1U4EA 4P4KD 2W60A 4ZS7H 3WY3A 3RRQA 2F19L 1KTKE 4FG0A 4WNJA 5B8CB 1UOWA 4M1GH 4FYRA 4A2HA 1N64L 1TF4A 4NHUA 2XY1A 3QHFH 2R56H 3U36A 2W59A 3GHPA 5LCVH 4NYLA 5FUZH 3ATEA 4IRZL 4A2DA 1QHPA 1FFPA 3QUXA 3PWUA 4KY1L 5GZOA 1P69B 5D7IE 5EU3B 1X5MA 3BZ4A 1MRFL 5BV7H 2VLKB 3KEHA 1YMME 1Q1JH 4KUZL 3V0WH 1NKOA 1SY6H 3E6FA 2H1LM 1MQKH 1T4KA 4S1RL 3TT3H 2AMUA 4PW4A 1B2WL 1BZDA 1JI2A 5MEOB 3PWVB 4MAYD 2PLTA 1W9XA 2BVOA 1BLIA 2JJSA 4K8RC 4MJIB 4RSYA 5HGBB 3HC0B 3QDGE 1S7UA 1M9SA 3FXIC 4ODUA 4AH2A 1JP5A 4YHKL 3FO0L 4PWEA 1KJMA 5DVMA 5K9QI 4P4RB 4FQXD 2V7NA 1KWKA 2FNWA 2FWOA 2IBBA 3FSZA 4Q8BA 3EXLA 1UYWH 5IF0B 3GC3A 2B15A 4GAFB 4C54A 1OCRB 5FOJA 3V6OC 1IAIH 1XGTA 2CXGA 4LCYA 5T1LB 4QJ4B 5GGRB 3WHXB 3ZYJA 1U95B 4AVKA 1F3JA 5ITBH 4Y9FA 5L4JA 2QVTA 1FP5A 2R1YA 1EXGA 2EADA 3QEQD 2F7OA 3GHEH 3UBHA 2ED9A 2AJVL 4QRSB 3O6KH 3VXMB 2IAMB 1CN4A 4AYMC 1MFEH 3SO5A 4OCSH 1ROWA 5ANMA 3ABZA 3IKKA 5GISH 4UOW0 2ODHA 1JHKH 1A21A 3QPQD 5D1QA 5B21A 1TETH 4I0PB 4HZ1A 5CJXA 5KSBE 1PX3A 4RSVA 3GSVB 4NT6B 4KQ3L 2G9HA 2X4QA 2VJ8A 2X9XA 3QJFB 4KJYB 2PABA 1N10A 5DUBA 3HE6D 4KJPD 4PJXE 3UDWC 1QQDA 2H2PD 4AC4A 3J2PA 1JF1B 2AXGA 2F53D 4TLTA 4WCYH 2YWYA 5F8QC 2WUCH 9CGTA 5HVFB 2BRRL 1HT6A 1W0VA 4LVNB 5D5ME 1HL4A 2DQGH 2ICEA 2TRYA 1V54B 2CIIA 3IE9A 4NPYA 3U48A 5IR1B 5TDPB 3SBWA 5L2JB 5ICZB 1MJUL 1HE8A 4LSPL 4W1TA 1LO0H 2F1BA 2YZ8A 5T3ZL 4XN9A 3DKHA 4LLYB 1MCKA 2YPVA 3IJSB 1SJVA 4RRPA 2CGRH 4PYHA 1HINH 1KIRA 3RWFA 2ETWA 2EDQA 2K7PA 1X5YA 3CHXA 5GJTL 1YEGL 5B22A 4QWWD 4DKEH 2ZP0T 3LB6D 2O6PA 1EDYA 1JPST 2P48B 1T7XA 3HB3C 1JRHL 1NC4B 3ULUL 3UAAA 4UNVA 4Y16C 3MI6A 4DK6A 5DHVB 5CF3A 3WEOA 1DCLA 5LAXB 1YYCA 3QJOA 3VFGL 2CJUH 4XB7A 1E0OB 4OI8A 1UCTA 3NJIA 1TU2A 3NMEA 3P9WB 2AXHA 3TASA 4IHBA 3KXFB 2B1HL 1CDGA 3ROOA 3A6CH 3K72A 3TXAA 4MD0B 1NBVH 2D8KA 3CH1B 3QFDB 1FNHA 2WQRA 5D6CB 3VFRA 1XXFC 4ZMVA 5C09E 4B7LA 4NHCH 1QI5A 4Y5XA 2XU9A 1GPOH 5DTFA 1N2RB 3MRIA 5H94B 1OK0A 4LO9A 5KSUA 3X3GH 3UJIH 1BJMA 1NUNB 1MXGA 4JM0A 4ODHL 5KJ4A 4KV5F 3PGDB 5B8CC 1LO5A 3MLXL 1L9RA 3FQXB 4NM8H 4PWFA 1BECA 1BQHB 3QR0A 5EWIL 5IVZA 1IEHA 1I7ZB 4JG1L 3U7YL 3MLYH 1IC7H 1QD0A 1NDGA 4J3OC 4JVWA 43CAB 1MY5A 2CO7B 3DV4B 3BWUC 3FQWB 4AYEC 3T0EE 5LNDA 3QEUB 4YSRA 3FF7A 3VG0L 1BREA 1L7IH 5KYNA 3R1GL 3HHSA 4HHGA 5BRQA 4O4YL 1DVFB 5F1IA 1OL0A 5BRZD 1YEIH 3HIZA 4JS7A 4WK4B 3PGFH 4M4RA 1WS7A 1JN6B 2N56A 3GSNB 3MVSA 3VDAA 3QDMA 4CVXA 4Y2LA 2IWEA 2Z6FA 4JZNB 4LCIL 2Q7NA 1AHWA 5GRJL 3ZL4H 5FM4A 1Z5LB 4APXA 2X6MA 1KSRA 1H5BA 4ZAKA 3FUKA 2ZKMX 4DKFH 2NY5C 3MJ6A 1KG0A 2NMSA 3GJEA 3OR6A 3US9A 3VD5A 5G4NA 1H8LA 5TQ0L 1IGJB 4WWOA 2EEDA 1QO3A 1CLOL 1VFMA 2XZAL 3CMGA 4ZZKA 1A25A 3BMWA 4AIXA 4F37K 1MHEA 4P9ML 4JQXC 3APDA 3TBVB 4Z3JA 1CG9A 3QWRD 3UBFA 2CZNA 3GB7B 4MS6A 3V4VA 2IAMC 3NBNA 2WXHA 2WLLA 3O41A 2DLGA 4GAGH 4P2QE 1RERA 4HEPG 5ACMA 1QKZH 2DQUL 4I0PC 1NGWA 4UT6L 3U1SL 3MLUH 4F2MA 2VH5L 1QBLH 2DIJA 3QK0A 5EEZA 1KXQA 1MEXH 1TZHB 3QDJE 3H42L 5I8KL 1MLCA 4W6XB 4ZYKA 1MOEA 2UXFA 1AGBA 1PCXA 3E3QC 3MTRA 4KX7A 5CCKH 5JW5B 3QIUB <