1ORSA

X-ray structure of the kvap potassium channel voltage sensor in complex with an fab
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
214
Chain Sequence
QIVLTQSPAIMSASLGDRVTMTCTASSSVSSSYLHWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQFHRSLTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a voltage-dependent K+ channel
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Membrane protein
molecule keywords 33H1 Fab light chain
total genus 54
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1orsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1orsA01
5F9DC 5C9KA 2AKRA 1PYWB 3PDGA 4PY7A 1YEJL 4X7EC 2CDGA 5F8QC 2QLVB 2GEEA 1F90L 4KJWC 1CD1B 5IEHB 4FQJL 1FYTE 2VXQL 3MRNA 3U0PB 2O5YH 1P4LA 5TDNA 4LIQL 4PJCF 3SDDD 1P4BL 4RAHA 4X6EB 3O6FD 3MLUH 3Q3GB 4ZO8A 2DQTH 4RAVB 4DTGL 5FM8A 3JXAA 4PRHB 1MCQA 2XFXB 2Z93A 5EBWA 2DIJA 2IPKB 3J8F7 1R3JB 1NBZB 1TZHB 2AV7A 1BREA 3MRLA 3I75A 4ZS7L 2XQBH 2Y06H 2VQ1B 5C09E 1G9NC 1OD9A 2CLVB 4X7CC 1SVCP 2HJFB 4K8RH 2N4IA 5TGBA 5EOQH 2RCSL 4BUHA 3AM8C 3B5GA 1L9NA 1WZMA 2OTUA 3DHJA 2H32H 1PD6A 4XMKL 1NMBL 2VIRB 5KN5B 1FE8L 2BVYA 1M7DA 3VWJB 5DT1H 1B0RA 1E4XL 5EO9B 1MCWM 2W9DL 4XT1C 2PYFB 5JORB 4QRRA 1ZGLM 1EO7A 2Y6SD 3VGGA 1PEWA 4Q9BA 1T80A 1VGEH 4KK5D 1MQ8A 4PGBA 1AE6H 1BLNA 1CGXA 4JFEA 3ZMRA 4XPGH 1BVKB 5GZND 3CCHA 1WZ1L 4LVEA 5DD0L 4PPTA 1F2XK 3MLTA 3DUSB 2VR4A 3VXPA 5IT2H 4I13B 1T0NA 2WLZA 4OQTL 5JO5B 1EJOH 2XG5A 2RIKA 3ZKND 1YYLH 1N59B 1G6VK 3INUH 4GAFB 5HVHC 1J1PH 5I66A 4OLXL 5D72H 1OLLA 1DBAL 4UILH 5D1QB 1BQHA 4N5UA 4MA8H 3R0NA 3N1FC 4PJ9A 4IOIA 3S8WA 3LMJH 4GO6B 2HH0H 2BDNL 3B43A 1JZ7A 1KIQA 3QNYB 1WWWX 2BOBA 3DXAD 3MMEA 4Z78A 3GSXA 3CNKA 2VDPL 2Q86B 3AAZB 1I7TA 1XF5B 5C3TA 5FF6A 2GQHA 3ROOA 1NEUA 2CLRA 1LO2L 2Y1VA 4GRMB 1DE4A 2J4WL 5B8CC 1QOKA 1I8LC 4LSRL 3OPZL 4OGAC 3L3KB 4ZUSB 5JOPE 1Q9WB 3MJ9L 1OWRM 5ICYB 1AR1D 1V3LA 4YEFA 1WCBA 4X6DF 5DGQA 2JK5B 1P5VA 5K9QG 4ERSH 2X7LB 1OWWA 1G7JA 1O7VA 4FZ8H 4NKIH 3MROB 1IGYB 5K9KA 3FO1B 3LN4A 1MVUA 5D1ZD 3EOAA 4H25B 4WHYG 5FO7A 3GBML 4G42A 4G6ML 4LL9A 4U6XA 3TFKD 4LF3B 4DK6A 3VWKD 3WEXA 3MRGA 2YPVH 4YXLL 1RSFA 1C08B 1KFAL 2VZSA 4FFYL 1AXTL 3KYNB 3ZE0E 5KSVB 4UV7H 1KLGB 1MCCA 2BVOB 3UTOA 2Y36L 4PLKD 3TV3H 4F15B 3ARXA 4XVSH 3BH9B 3L1OL 5K9QI 1S7TB 2MCG1 5LJYH 3FKUS 4IRJB 3O3EB 5DRZB 4P3DA 5HYFA 3PWLB 3FFDA 5A43C 3ZHDA 3BKML 1CXLA 1GZQA 1CK0L 4H20H 5DK0A 1HILB 4R90L 3QIUD 3GIZH 2HH0L 3G08A 3UYOD 5DQ9A 1X5HA 1BFSA 4U1MB 4PJBA 1T1WB 4X5XA 1I9IH 3SKNA 3Q5OA 4XRCB 3ZE0F 1OAUL 1ZOXA 4R4BA 2FX8L 5IFHL 2H8PB 5BJTB 4KU1A 5FHAL 5K93A 2DLIA 2V2TA 2NY2C 4M7JL 5HI5C 1PG7W 3V4UL 3WO4C 3GSWB 3WE6B 5HD8C 1E6OH 2QQLH 1U0QA 4XHJD 2MHAA 2C3WA 1WK0A 3FTGA 2V2XB 3FO0H 1CG9A 4HWEL 5GRJH 3RAJL 1A7NL 3MFFB 4AMKH 3WSQL 3S96B 3IETB 4EOWL 2BERA 4JZOB 1HQRB 4LRIA 3W9DB 3GSOA 2ZOKB 3I84A 1MSPA 3WFCH 4G6MH 3BD5A 4JY5L 2ADGA 2YD3A 4PJ7B 2GJZB 4J4PD 3CMOH 5F1IA 3OJVC 2Y6SC 4EZMA 3UDWC 1XGYL 1MJ7L 1UM6H 2HTKC 5DD5H 3MBEC 2YD4A 1BX2A 3DX9B 4GW1B 3QJFA 2YUZA 4PY7B 4MA3A 4NUGL 4PJCE 3ARFB 4K94C 1G6RH 1UXSA 43CAA 4ODUA 4RWYH 2DJUA 5J9PB 4NQCE 2EC9T 5DJCB 5A40E 2ERJC 1QFHA 1FVCA 3KYMB 3MV9D 1FYTA 4RAUB 1X5XA 2IAMD 3LEXA 4NNPL 3MJ7A 4FQJH 5JXAH 2IFGA 4TNVK 2L0DA 2EC9U 4EI5D 3MBED 3ZL4H 1QBLH 2Z93B 5EBWB 3M17A 2V5YA 1FC1A 1YY9C 3X3FH 2DQTL 1DL7L 4PLNC 4G8GA 3LB6C 3VFNA 4MJ5B 5J3HD 3S34H 3UTTD 4M6OH 3K7UA 4E5XA 3ZTNL 1RZGA 5FDWB 4XCEB 2X6MA 1K4CA 3GFUA 4A2LA 4WI5A 1N6UA 4FQXB 4G43B 4GMSL 4U6YA 5IQ9B 1NFIB 1YNKL 4KJQC 3O6FA 3LKSA 4EEEA 4JHAL 4Y5XA 5EO9A 1IC7L 1E6JL 2IH3A 3SO3C 4Z7UF 4NQDD 2OZ4L 5KS9E 4LFHD 2PR4L 1S3KL 4OAWB 2DQUH 3HZVB 3DGGB 4YDVA 1R0AH 1T03L 1EAPB 5F88B 2DICA 1MRCH 4NQEB 4WWKC 1E4WH 3L7FA 4XP4H 1YEHH 1LO5A 5F3HB 3PGDB 3V6FA 2JJTA 3QDHA 1RD6A 1RHFA 5I73C 2RR3A 4P46B 1FH5L 1EEQA 1NFDE 5HYSG 3DPBA 3PQYA 2Z31B 4IBLT 4LVHB 1A6WH 3H9SE 2IQAA 4JFED 4QCIA 4HKXB 4HS8H 3M1BA 4PJCA 1OGAB 3O41B 5FGSA 5FEBA 2PXYC 5FYKL 1QLRB 2DQCL 2PTUA 2V17L 4XBGB 2FIKA 4TSCL 5KJRH 1C7TA 1UJ3C 1BWWA 4HWZB 5I75B 3FB6A 1E27A 1U3YA 4AM0A 4D8PA 3JUZA 4H5SA 5K9JH 3U46A 5FO9B 2EDEA 1JBJA 1JWMA 1MRFL 4PRDA 1NCNA 3WNLA 5CSGA 1JNLH 3VXSE 1II4E 1KF9B 4Z7VF 3QUXC 1CFQA 4NQCB 1U91B 1UACL 1S78D 4M6NL 4C4KO 3BPLB 5I76A 5K59F 1CYGA 3AU1B 1M71A 4OFKA 4Y16B 3GHBH 4H26A 3CVHH 4MQTB 4WW2C 1UQSA 1BFVH 4HC1H 1KCVH 5E5UB 1KN2L 2EDFA 1C16B 3HZYA 4AT6A 5EOCL 1V3JA 1LP9F 1KCSL 3HPLA 1NDMA 4OZGA 1ETZA 2F74B 3CDGA 4JE4B 5DJXB 5MHSE 1NAKH 4XC3L 2GITB 2EH8H 3RBSA 4Z7VA 3BKJL 5HYEA 2O93L 4I4WB 3BT2H 4BJLA 5EU4B 3SGDI 1TQCB 3D0VA 1YJDC 1KTLA 3NMEA 1QBMH 1QLFA 4JREC 3OXRA 3L95A 2E6QA 1N3NA 5ISZB 4Z76B 5IJKA 1ORQA 3DETD 4AJ0A 4K3EL 4JGJA 2EDRA 3TNMA 5J0BA 3MLTB 1A6ZA 2V5MA 4UZGA 3RQ3A 4NT6B 3W2DL 3BDYL 3NZ8A 2H2SC 3GZKA 5CJXC 3EJZC 4OM1L 5D1XC 5EZJB 4YHZH 5IOPA 4HKBA 4YPGB 2AQ1A 5E9DB 1AO7E 2IPKA 2HAZA 5J3HC 4G6FD 3VXSD 5IROA 4D2NA 4WW1A 3V79C 3MFFA 4K7PH 3PDOB 1H3PL 1J8HB 2YN3A 4I18C 4OZ4B 3X3GH 1TQCC 2ZOKA 4Z8FH 3U0TB 4BUGA 1NGPL 4KRPD 5AAMA 1QVOB 3RP1A 1IAOA 1JIBA 1WITA 1S7VA 3MLZL 1DBJL 1T66D 2ZUVA 5J1AB 4NZJA 4TSBL 4KKAD 3WKNA 4X6FA 5F7LB 3REWB 2PN5A 4OB5H 1YPZA 4YHKL 1D5ZA 4NFBA 3L5JA 4L4VA 3RKPA 2KKQA 4OIBA 3U9PH 3OAZK 1QFPA 5E6IC 3DV4A 4NNXB 1J87A 2PYEA 4Y5YA 3RY6A 3RRQA 4PJ7E 5D8JH 4XNQB 4QTIH 5B3JE 2FRGP 3S7GA 4AK1A 5KSVA 1HHHA 3RGVA 4MJ5A 4IM8A 5L6YL 3QH3A 1KCLA 3TBSB 2YEZA 4QT5A 3QG6A 4D3CH 2R2CA 4XCNB 4WFGE 4N0FA 25C8H 5T3ZE 2IAMA 4XPHL 3QHTC 3FFDB 5CJQL 2V7NB 5DD6A 3TT1L 5BZDA 2R0ZH 5ALCH 5LWYL 2BY2A 3S88L 5I0DA 4EI5A 5SV4A 4OTXH 5D2LE 1KN4L 3QPQD 1V7MH 3WFBL 2A74B 3A67H 1MAMH 3LIZL 5ICYA 1NAMB 4YGVB 3G5YB 4KJPD 3HZVA 4U6VL 2YC1A 2NY1C 4D0BA 4UT7L 4G7YL 1OPGL 2G5BA 2YD8A 3HNVL 2QSVA 3BN9C 2XN9E 1CGSL 1Z5LB 4D9QE 3G5ZB 5D7IE 1QSEE 1E4JA 5K9KB 1D7FA 5I6XB 4NQSB 4MZ3A 3WIFA 1IGIH 2C1OB 3CSYA 4LU5H 1HQ4A 3RWEB 4KTEH 5IMKB 1CICB 4NCDA 4Z7UE 4IDJH 4WO4C 3UC0L 4I48A 5JUEL 1JPGA 1FNEA 4JPVL 1N4XH 1C8PA 1BBDL 5EC1A 4LVNB 4GXVH 4YHLH 4BFBD 4TTDD 1WIPA 2EE3A 3ARSA 3FRPG 2GSGA 3MLXL 1OVZA 3VWJA 4S1DD 4PD4K 1T0PB 4IOFC 4K71C 5INDB 1RZJH 2VLMD 3VD9A 2CXGA 3FB6B 2AJVH 1EFXB 4CL7A 5CLTA 1FZJA 3VFTA 3O6LL 3VXPB 3EYOB 1ZHLA 3OX8B 1U8HB 1UT9A 3H9HA 4MB4A 5MERB 3PP3H 2YD7A 43C9B 5CUSH 4JKMA 1N0XH 4U1MA 1I8MB 4MAYA 4XCCH 3WCYA 4MA3B 4NNYA 4ZFZB 1YQVH 2IAND 5A2IH 4G6JH 1OM3L 2FEEI 5GGTL 2CRYA 3HRZB 1EIBA 5DFVC 4JGMA 1O7SA 1UB5A 5E56A 1KSRA 1T5WB 4MSWA 1FO0L 1T6VN 3QO0B 4DZBB 3VD4A 2NY4D 1NC4D 4AEEA 4RMVA 5SX4H 3TWCL 3EJYD 3ARVA 1FFNB 1BVZA 1MREH 4QOKD 4P59H 4WHTA 1QQDB 2BXYA 1U95A 4RISL 3CX5J 2CRMA 4MQXC 4G7YH 3U30B 1LO0H 4FQ1H 2IANB 3OKDB 1AD0B 4YK4B 3HI6L 1S9XB 4LNRB 1JF1B 2CR6A 1U3HA 5BO1L 4Z0BL 1ZS8B 1MCSA 1RU9L 5GRZA 1T22A 1NCCH 3W9EB 4L9LB 3VXMA 4OKDA 3Q1SH 4Z7VB 1LNUB 2E6PA 1CICD 5C7XH 4U2ZA 1AXTH 3EO1B 5L2KE 3CZJA 1NAKL 4XC3H 1LO3H 4Z5RB 3MXWH 4OCRH 3EO9L 1VFUA 3SJVE 1ORQB 1B9ZA 2C1PA 1T7VA 4C83B 3UPRB 4YBQD 2UY7A 4LRIC 4G8EB 2B0SL 4HBQA 5DJ2A 3THMH 3S5LG 3DRTA 4Y88A 1UJ3B 5C8JA 1AGCA 3RY4A 5GS3A 4U7KA 4UUJA 5IEKB 5E0QA 1T20A 3O6LH 4O4YL 1OAZL 3CFDA 4UNUA 3LSOA 2NY2B 4JQIL 1IGCL 1GXEA 3W2DH 5EDXA 2YD1A 2BZDA 3ZKXB 4P4KB 1J0HA 1YMME 3QDJA 4HK3N 5T1LD 3GI9H 3ETBF 3C08L 4XXDB 4HAGA 4IEFB 3BQUB 3GBMH 4FQXC 4F7TB 1R3IL 3JVGA 4NHCH 1J1XH 1BJ1J 4K3DH 4KUZL 3ZYJA 5JQHC 1FZOA 3NCJH 5CAYB 3UTZA 3C6SA 3WS3B 4FQQB 1KFAH 2NY6D 5EIIA 1F42A 2X4QA 4XWGL 2D7QA 4JRYD 3RTQC 3H3BC 5HVGB 3OJ2C 5DTFA 4Y1AB 5F3BA 1A7RL 3IJYA 1W72L 4P4KD 5F9JA 4YDIH 1JGUH 1HKLL 4IJ3B 3V6OC 3GSWA 4O9HL 4PP1D 4YXHH 3P0VH 4ZO6A 2MHAB 3SGKA 4NDMB 3N06B 3L7FB 1FBIL 1EEUA 1HI6A 1YEKH 4B7LA 1P9MC 1XGRA 5I1HH 1OB1A 1PBYA 3O2WH 5JW4R 1JYNA 1JL8A 1BQSA 5E1HB 1S7RA 4LSUL 1MCRA 2VH5L 3JV6B 4PJEA 3TPUB 3X13B 5GGSY 3W9DA 2F19L 2H2PD 5C0IA 4OZHF 2QSCH 4QCIB 3T2NH 2VIRA 1KIPA 4XNMA 3C09C 5I1LB 3C60B 3VW3L 1V7ML 3D2UA 1OSPH 1NGXB 4M1DL 2OP4H 3VFGL 2W0FA 4NC1C 2PYED 4OZGB 2P5WE 1E4KC 1Y0LB 5FFLA 3ZKMD 2NXYD 2NY3D 2B1AL 1DQLL 1YUHB 4XNXH 4JDZA 2A73B 4HUKB 4L3CB 4LQFH 4Y4FC 5DDHB 4HCRL 1FVCB 2QADC 3ARGB 3RWCB 4KJYA 1G6RA 1G1YA 4JQXA 4KGLA 4OM0H 3L95B 4FTVE 1JPFB 4L5FL 3SDYH 5SWSA 4D9RD 4IMKC 4MXWL 4NZUL 3ULVF 2PXYA 4OZFG 5MENE 1LEIA 4S1QH 1A6ZB 3C2AH 2XPGB 2NPLX 3PWNA 5KVGH 4LEOB 2HJLB 3UBXA 1U42A 2VDRH 3NA9H 4Z0XA 2NY6B 3RDTA 3K2UH 5J13C 1BFTA 1QEWB 5DQDH 3CUPA 3M8OH 3OV6A 1J1PL 1XGQA 3GMMB 1DQQB 2YUVA 3L3DA 2Q87A 4ZXBD 4OZHA 1K4CB 2C4FU 4QHUA 3V4VL 4YEEA 3S5LA 3B2VH 3E6HB 1OQOA 2X4OB 3BP6B 2ILLA 1JNHB 2IG2L 5DHVH 3S97C 4OD3H 1TPXB 4R26H 2WZPD 1JNNL 2FGWL 2K3TA 2JTDA 5EU5A 3TVMB 3ZL4L 4F15C 1I75A 3RKDC 4L8BA 9CGTA 3L6FA 5HDOA 4X6DE 2NQCA 3W11D 1UEYA 3VWKB 4M5ZH 3SOBL 1A6WL 4XH2A 1L0YA 4R6UA 1ZANL 5SX5K 1P4IL 2HT3C 4NP4L 2AK4A 4KDWA 5AEAA 1D5ZB 4BH8A 5GS1A 5F96H 2I27N 1WBYB 2NTFB 4A2MA 2C5DC 1L9MA 3OG6B 2ED9A 2A6DA 4GW5A 3R8BB 3KPQA 3P40A 1TTUA 1KTKE 2X4PB 5EU6B 2XXMB 3KHQA 3TBTB 1JZ4A 1E4XI 1U58A 1AFVL 5CD5C 5GGTH 1NLDH 5I18H 2LVEA 3V6OE 1MJ8L 4LSQH 4F3FB 2E7MA 2V9TA 2DMBA 12E8L 1RURH 5AZ2H 5E8PB 5C2UB 3S3SA 4XP4L 4MAYD 4U1KB 2IANA 2GSIA 3OKDA 1YECL 4PBWD 5E9DD 1U3HB 5ESAA 1RFDL 4G6AC 1R3LB 4IRZL 1IAOB 3PUCA 3BIKB 2RCSH 1LNUA 4KROD 4R4BB 3OJDB 3ZE2E 2V2WA 4Q9QH 1KCVL 1CFQB 4X6CF 2SEBB 4WJ5A 4AEHH 1I9RL 2I60H 4RGMB 5B39B 4FQIL 3UBXI 5IMLA 4I18A 4Z7NE 4DOHE 5L9DL 3QCUH 5EIVA 5I15H 4B53A 5LQBH 4FNLL 5I1IH 3DMMD 1U3HD 3T3PE 4OKVB 5B4MC 1QNZH 3PP3K 1AH1A 5DS8B 1FVEA 3WIFB 2A6JB 2PTTA 1CDYA 2WIMA 4JB9L 1CICA 1ZLSH 4XNQA 3T4AA 4L8CA 3I85A 2EIZA 4N0UA 1T1ZB 5KG9B 1MJ7H 5DRXB 1BGXH 4I0CC 4GFTB 3OTTA 3TO2B 1NEZA 3ARWA 4ZPTB 1RIHL 3UO1H 4M6NH 3QULA 3GM8A 3SDAD 4F9LC 4OT1H 3LKNB 3D0VB 4NSKA 3T4YA 3TLRA 4I2XB 3HUJE 1N3NB 1JTTA 5EO0B 5FUCE 2WMPA 1MY5A 4LCCB 4Y4FD 3HUJF 3HE6D 3VRLE 3DWTA 4EI5B 1HXYB 5SWQB 3TJEL 1L7IH 1CXHA 5DTFB 4HHAB 5JNYA 1SVZA 4KH2A 5TE6L 4HDIB 5EBMB 1XR8B 4MAYB 2F9BT 3LKRA 5EZJA 5E4EB 1BVLA 2MTPA 4ZD3L 1DVFA 2H9GB 1SY6L 1CU4H 2R0WH 2NMSA 2H6PB 3O8XB 4OLZL 5T3ZH 1LE9B 1BQLH 1BEYL 1FNGB 2HLFD 5FYKD 1CT8B 1BZ7B 4DGYL 3FQNA 3PDOA 2GCYA 2ZNWA 3H3PL 4HQQH 3RWEA 2APTA 4GKZB 1NMAL 4JRYA 2GK0A 2AV1A 2Z0BA 4L8SB 4U33A 3RWJB 4YHKH 5FGBA 1FNEB 2K9UA 1K3IA 5F44A 3X3FL 4PG2C 1N2RB 3TIDA 5F6HJ 2DKSA 4C4KT 2DDQL 4M6OL 1H9VA 1CFBA 2W38A 4I9WD 4WHYH 2DYPD 5ALBH 5KAQF 2GFBA 5TDOA 1BP3B 4X6FB 3ZTJG 3GJFB 4G8FB 3DX8A 5INDA 5E4EC 5GRVK 3BMWA 1L0XA 3LRGA 3KPRE 4PTUB 4ZS7H 3MLPA 1EFXA 5JIKA 4LLVB 4HJJL 2EEAA 3P0YL 3RL2B 3S6CA 2ADJA 3BGFC 1FG9C 2Q8BH 3NFNB 4OLVH 4HXBH 5JR1H 5DRNA 4BK4A 3BO8A 4KKBD 2FX9L 5DVMA 1Y6NR 4JY4B 3KDMB 4EIGB 3BP7B 3T0EB 5GS2H 3RX8A 3BIAX 1A21A 1T89A 4LEOA 4F37F 5CBEA 4FFVD 2PUQT 3QUZD 1F90H 3P4OA 3LAFA 1T2QH 3N1MC 3JWDH 1KB9J 1KV3A 3MRFB 2EDNA 4GG6B 3JV4B 1UA6H 1WT5C 3QIWB 3CLEL 5F7UA 3PABA 5FA3A 3WN5C 5DJYB 4Y4HB 1MWAA 2NY4B 2OS7A 2V7NA 2BJML 5DD6B 1N6QL 3WHE1 3MLYH 2N7AA 2HN7B 1JF1A 3IJHA 35C8L 4ODHL 1YC7A 2H26B 3NPSC 3IDIA 5C0CD 3QUZB 5BRZB 2NY5L 5EIIB 2X4UA 3RDTD 1T22B 4Y5VA 2A6KB 4PBVC 5HGGS 1UM5L 4M8QA 1CTNA 5FGCE 3ULVD 4Q6IA 4HS3A 4ALAH 1I8IB 1M4KA 4NFDA 3G04A 1N5YH 3PWUB 4Q74A 2L7JA 1JPTH 4N1EA 1ACYL 5H35B 1MOEA 1XEDA 2CUIA 1RUML 3PG2A 3GB7B 3H7BB 1WC7A 1U3HC 2A2QT 2A6DB 3FB7B 2PCPB 3QI9A 2B2XL 4IIQA 2DWDB 5DWUH 3MRIA 1IEBA 3P4NA 5LGKA 4EDWH 4RMWA 3QXAA 4H88H 4MD5B 3CFBB 5CJBA 1KG0B 1U58B 3VD3A 1I7UB 3GMRB 4OZIA 2RJMA 1FLRH 3JBG7 1IQDA 4J4PC 5EA0H 3OKEB 4KQ3H 5BZWB 1FV1A 3X13A 4N0UE 4Z7NF 1RULL 3S9DB 2AK4D 3MZTA 1UB6B 1FNSH 2UZIL 2X4SA 2NY2D 1RUAH 3BJ91 4C58B 5BV7L 2W59A 1W0WB 2M26A 3BPLC 3D25B 5BOZG 5F9WB 2NZIA 2Z31D 1KCSH 1T0MA 4QHLB 1FZOB 4XPBH 4KI1A 3C6SB 3WS3A 1G0DA 1KT2A 1F4XH 1XF1A 4ZFOA 2VKWA 4YHLL 3MV8E 5A2KH 2AXJA 2RFXB 2XY1A 3JTTB 2A1WH 5EFIB 3IDMA 3NIFE 1U8PA 1SMAA 1YZZA 5FKAA 4ETQB 1S7QA 3QO0A 2RAMA 3VXSB 5D7SH 2CK0L 3WUZA 4Z9KB 3HKFA 4ZSOA 3Q5YA 1RJLA 5KSAB 1L6XA 2B4CL 1QUNA 4IRSD 4WFED 5E9DA 1D5MA 1SJVA 4UOJA 1MI5D 3NIGF 3DO3A 1R3HB 2OL3A 3DRQA 3IB4A 3V7MA 1IKFH 1A2YA 1KPUB 4JCMA 3Q1SL 4XMPH 5JPNB 4YIQA 3UTPD 3D6GA 3SJVD 5LAXB 1B2WL 5IB5A 4HWUA 3UTSE 1V3KA 3HFMH 2ZCKH 3WIHA 1MFDH 3U2SB 1T1ZA 2X9YA 3FT4A 2B1HL 4OZFA 5CP3H 4M4PA 3V6OA 5I16B 1QVOA 4WUUE 2A6IB 3GSRB 4NQUA 4OB5L 1ZT4B 3QISA 2W65B 1R24B 3P73B 3HG1A 3SGKC 3K0WA 4LDEB 4RIRB 4TPRH 3BXNB 5ICZB 2GHWB 3OKKB 4NJ9H 1YPZB 1U8QB 5K33A 3OBAA 1IGTA 5C0JB 4L4VB 3RJQB 1DDHB 3GRWL 3ARGC 3GMQB 5JDSB 3TH4T 1R5IA 4PGCB 5GQBA 2LTQB 3DRTB 1AI1L 1JPST 3BKMH 4BSWB 4X6EA 5GISL 3ES6B 4LLUA 3GSQB 4WNQB 5IVOA 4R0LA 4YR6B 2H9GA 4X8JA 3SDAA 3DNKA 2F54B 3U9PL 5DR5L 1I8KA 2WP3O 4JR9H 5CEXA 1SYSB 3GBNH 3PGFL 2MCPL 1Q72L 4R7NA 3GKWL 4Y4FA 3U36A 3HE6A 3GMMA 3PL6C 3QG6B 6FABL 2GK0B 4KXZH 3F8UB 3LPWA 3SDDA 1HKLH 2JCCF 1OTSC 5FO8A 4IMKA 3AM8A 1SJHB 4NN5C 4U1JB 4UMGA 3TIDB 3MCLL 1MCWW 1MRDL 1OAKL 1MFAL 2R1YA 2DQDH 2PYFA 4WTZA 4MAUH 4GG6F 5F3BB 1IGCH 4YHPB 3F7RA 4YUEH 3U7WL 4UQ3A 4BQ9A 1L0QA 1TJGH 4OLYL 4U6TA 4M5YL 3DI3B 2CKBA 1T0NB 4JO2H 4OSUH 3FQWA 1Z9MA 3L3GA 2FCBA 4RA3A 2CO7B 2HFFB 4D9LH 4XNZB 1FZMB 2GJJA 3MNZA 3MO1B 1WBYA 2NTFA 4CVXA 2VDMH 4ZSOE 1HHGA 3BKYH 4YHNB 3CAFA 1PKQE 1R3KA 2OMBA 4JFXB 4NRYA 4MDIB 1CF8H 4ZOAA 2BNRD 2OQJB 4L29A 3MMEB 3QXTA 1EFXD 1FJ1A 1DN0A 4TTGA 1GPOL 2MOVA 5HVWA 1MIMH 5MI0C 2XKUA 2ZUSA 3SPVA 3LV3A 5D7IF 5I8CA 1GC1H 3GGWB 3K81A 4X80L 4NQXA 5BMFH 2V7HA 4ZUSA 1S78C 1YQVL 2AJZA 1UZ8A 4I2XA 1CN4A 1NDGB 3ZKXC 1ZEAL 4RFEA 3DXAA 5DA4A 3SDCD 1K8IA 1Z0NA 1NCAH 3EHBC 4PJ5B 4PTTB 5IVZB 1F3JB 4KI5C 3OGCB 5FCUL 1ZVYA 3PJSB 2V2WB 3U7AA 3EYSL 1T5XA 1NKOA 5AYUL 4YX2H 2SEBA 4WJ5B 2EEDA 2VR5A 4UU9B 1QPXA 4Z7WA 1OY3B 4ZG1A 1K5NA 2UUDH 2FBOJ 4CVUA 3QPXL 3NACL 4H8WC 4J6RL 1MH5A 4YK4C 1KLGA 2BVOA 1ES0B 2AGJL 1J12A 3U4EA 3D39A 4FMFA 5JW4Q 1H15B 5DMYA 3CX5K 4X5WB 3K8MA 5ADPH 4U1SA 4RCAA 5HYSA 2UZXB 3LQZA 1JHLL 3NA4A 3UMTA 4XXCA 2OXHA 1VFMA 2R2HB 3O11B 5D1ZA 5EULV 4RISH 4AEFA 3TO2A 4OCRL 3AREB 4QTIL 2D0FA 2ZUYA 3HZKB 3VWKA 1B0RB 4MQ7B 1JGDB 2JELL 3DX7A 4LASL 4M93B 3LN5A 1DR9A 2EIBA 3HMWL 3O2DL 5HGAA 4AQ1B 4JFZH 3FFCB 2J5LC 3GMNA 1BLNB 3I02A 2BFVL 1KYOK 3RVUC 4WW2F 4HMEA 4OJFL 4UIKL 2LQRA 4WU7A 4K7PX 5LBSH 4LBEA 2WUBH 5KJRL 2P5WD 3KPQB 3T1FB 1AGEB 4AG4H 4TULL 2HT4D 3F5WB 5T5FL 5C2BL 1PZ5A 1T20B 3VXME 1ZKAA 4FXKB 4W6XB 2XZZA 2ITCA 1J8KA 3LEYH 3QIUA 3AS2A 2CH8A 5GGRY 3VFUB 5FA4A 3UPAA 1WCQA 3EYQD 4WCYH 4BK5A 2AJ3B 4K3EH 4UINL 4M1CC 1KIRA 1ERNA 1NCUA 3VFOB 5AYUH 4B50A 1WTGT 1OTSD 1WEJL 3H7LA 3ISWA 2ADGB 1J0YA 2IBBA 1N2RA 3GI8L 5F9OL 5GGUB 3UC0H 1NUGA 1CDCA 4POUB 1UWGL 5DK2B 3G6DH 5EZOH 1UVQA 5HYQB 4J6RH 2FX7L 1DEDA 3FMGL 3ROLB 4HJ0D 4AQOA 5F9JB 3ULUE 5E2VL 1W2KT 4HT1H 3SJVA 1BM3L 4KI5F 2XKNA 2DYPB 3KPSB 3WLWC 2X7LA 1I1CA 5L2KA 3B9DA 4DK3A 3CVHL 3O2VH 5J6GA 1FHGA 2YSSA 4BQBA 3PXJA 2F19H 5L2JA 1HZHH 2R0KH 3ARFD 5ITBL 4QHMA 2YKLH 1WWCA 2RHEA 4DGIL 1XF3B 2MKLC 2CMRL 2VXUL 1QBML 1C08A 2PW1A 1FBIH 2ZG1A 3TEUA 5C0FB 2ITDB 1HSBB 4I0KA 4JG1H 3CIQA 1CXEA 2NY3B 1H5BA 2I25N 4MHHG 3ZT5A 2HVKB 4P5TC 4ZPVA 2A83B 3GMRA 4OZIB 1NGXA 2XZQL 3T4YB 4MX7A 4PBXA 3SE3A 3GKWH 3BN9D 3VGBA 1TJGL 3I2CL 4OLYH 4PS4H 5T5NF 3D18A 3TJHC 3MXVL 4DFIA 2Y7QA 5D7IA 5DDHA 5ESQB 1GHFL 4S0SD 4DN3H 3T0EE 1T0MB 4QHLA 4D9LL 4JRWA 3RL1A 2DL2A 3QDMD 1IAMA 3RWCA 2NY3C 5C08E 5GHWH 3UTTA 3MCLH 4YFEA 2FBJL 3D3VB 4F7EB 3L5WA 1TJHH 1NEZG 4XNXL 1VEPA 4OFYD 5CGMA 3Q6FB 4PJHE 4U1NB 3RJDA 3IDXL 5CJ5A 2WIIB 5IHLB 3L3GB 5E7FA 4Z0XB 5BRZD 2BRRL 2GCYB 1F4YH 5TJWK 1UENA 3UJTH 4L5FH 2ORBH 3RVWD 1YNLH 4JRYB 3FMGH 4NQDA 3TBYB 1OAUH 4PJ7F 4S1RL 2BY3A 2BMKB 5DJDA 1FG2A 5E2TL 1EBPA 2M8XA 5JZ7C 4RNRA 4JFHE 4OF3A 5LGJB 4HKXA 3QXUA 5IBLD 2GTZA 2D7TL 4HC1A 3GNMH 2AABH 4PUBL 4LEXH 3GJFA 3IDGB 3PWVB 5IHZB 3B83A 2WP3T 2H41A 5M95B 3ARDB 1CR9H 5EBLB 3VFVB 3KYOA 1A7NH 1CD0A 5TQ2L 3WUWG 2JCCA 4QWWD 2PYEE 4JKPH 4OF8A 3UEZA 4XP6L 3QJFB 4JFYB 4KZDH 2P24B 5DI8B 5FV1L 5ABDE 4OF5A 4QXTA 2GY5A 3IAGC 4L8DB 4XVUD 3ILPB 4MJ2A 4QRPB 5CBEB 3AY4A 2R0ZL 5HPOA 2DLGA 3CFEB 4GG8A 1ZLWH 3X17A 3MRFA 4Q97A 2DQFA 2A0LD 1X5IA 4OGAD 2Q20A 4KV5F 4B0MM 5DT1L 1T2XA 1A1OA 3KWWA 5BXFB 1CI5A 3SDCA 5I8OH 5IIEA 3U4EB 1SQ2N 1AFVH 4ZYKB 1K9TA 3HPJB 1K6QH 2XWTB 1FL5A 5GS0L 4YBQC 4PV8B 2BP3A 2DI8A 5KSBA 1FAIL 1MCEA 4OZFB 4ZNCD 1J5OH 3HS0A 3LHPL 5DRWA 4LCUB 4K9EL 2CDGB 3ULUL 5I74C 4KTEL 3B6SB 3IGAA 3BIKA 1UWEH 5HPMB 1R24A 4I3SH 5EU4A 3V9FA 1ZWIA 4GRWE 2XG4A 2XI9A 1JWUA 1LEGA 4N8CH 3F62A 4Q58C 3FO1A 3LN4B 3MJ8A 5HYIA 5DUBB 4MLSA 4UQ3B 1CLZL 3D39D 5CEZL 1DDHA 1F00I 1MFBH 1RULH 3NAAL 2VABA 3UX9B 5T1KD 4DEPC 2EH7L 3A6CL 3HI1A 3WFZA 3BRGC 3OF6A 4MD5A 3FQTA 4P4RA 3FHAA 2NY5H 4UT9H 5CJXA 4BYHA 3EBAA 4Z7WF 2VLKE 5DMJB 2O5XL 1UM5H 3PHOB 1MQKL 1VFAB 5EOCJ 3UBXG 4CW1B 3QQ9D 3U0WH 1SYSA 4DUVA 4QGTA 1IC1A 5F6HI 5DJZB 3O41A 4ACPA 1P53A 5J06A 2LAAA 3HAEG 1KT2B 4HMDA 1RJZA 4LCWE 1YYML 2BSSB 1NJ9B 2XRAH 4LCCA 3VFMB 2LV4A 2VKXA 4HPYH 4NC2B 1AGBB 1IGFH 4LPYA 2G5RA 2MQ0A 3KLSA 1A3RH 1M1SA 2EZ0D 3VXSA 2Z8WC 4B41A 1N59A 1TVHA 4KXZI 3U48A 3EFFB 3WE6A 3QUMA 4OGXL 1BQHB 1X6LA 1SYVB 3P11L 2FJHA 3N1QC 2OJEA 4POZD 1P84K 1U91A 4RGMC 3T04D 2R1WA 4DVRH 1HYSD 4Q6YA 2EZ0C 4YHNA 5D7LD 5HHNA 3C6LC 2RB8A 1IFHL 1TXKA 4OLWH 3RWHA 4GBXA 4YHMH 5IFHH 3O6MH 2AI0H 5MI0B 5C09B 3D39B 3RGVC 3KPRB 2A83A 4JY6B 2YA1A 3HZYB 4AT6B 1CGTA 3J7HA 3IVKB 1T83A 2GJ6A 5AWNL 4XCNA 4Y16D 1UGNA 3DX9A 3P0YH 2E9BA 4PRHE 2V5TA 3ARFA 4LVOB 4NQXB 5D5ME 4F8TA 1DQDH 2ADFH 1QSZA 3B3IA 3U79A 3SKUD 2DD8H 4GUPB 1JNJA 3EO0A 4A6YB 2OX5A 2ARJQ 2VITA 1FYTB 4TQEH 1NDGA 1KTLB 1MJUL 4YGVA 3ZTNH 5HGDA 2NY5C 2W9EH 3GBLA 4CDGC 3RUGE 2Z92B 4FABH 4U31A 3WSQH 1DLFH 2XTLA 4LRNL 1KCKA 3EFDL 1IZJA 3MNWB 1NQBA 1ZLWK 4UU9A 2Y07L 3CSYB 4UBDC 3FQXB 4HK0B 4N0YH 5DVKA 1W0VA 4P5MB 1N6QH 4K9EC 1J05B 4AL8H 5CKAA 1BFOB 1IGML 2X1QA 3QDMA 4LPWA 4UQ2A 3O9WC 1ZLUH 4WO4A 3VFUA 4HFWB 4HUWB 4JDVA 4PJDB 1AI1H 5D7KD 3G6JB 4DKDC 5FYJD 1JGEB 2DI7A 1CS6A 2IH3B 1ED3A 4NQVA 4G8GE 4OFYA 1Q9WA 5KSUB 1CQYA 3WL9A 2R8SL 4X7TA 1JE6A 2YN5A 4G6FB 1Z2KA 2JJVA 3LQZB 3GMPB 4ENEC 3O11A 2PW2B 2VDRL 1KEMH 3CH1B 4GAYB 1NL0H 3VFVA 3U83A 5LXGH 3BP4A 3DJ9A 1VGKA 4E42A 3FONA 1MCJA 4M7KL 1UVQB 4H8WH 4PLJC 4MNGB 2K1MA 3H8NA 3RVXC 2WBJC 3DTXB 3MJ6A 1NBVH 3OKMB 2VLKA 4Y4KD 4Q0XL 2MJWA 1RIHH 2AJXL 4RQQA 4JFYA 3FL7A 5E2UH 4M43H 5H35A 2O5ZL 5C09D 1JGLL 3VFGH 3QXWA 5IKCA 5J57B 1YEDB 2V17H 4LCIH 1F13A 3HB3C 2EDYA 4ENED 5JIHA 4HULB 5T5NG 3GRWA 3QRFM 4NRZB 3T65A 2B1AH 4JZNA 5F8RC 4ALAL 1PZ5B 4NM8L 3IS0X 1UYWH 2N56A 2X05A 3L3IB 4WV1A 4DOHB 1FJ1B 1K6QL 4WUKH 5AG9A 2B4CC 3B9EA 4ISVB 4MCYB 3TO4B 1RUMH 1KXQE 1DFBL 2Q3AA 1QHPA 1R5WB 2OZ4H 4PJFF 2W9EL 5C0FA 5I8CB 3G9VA 2YA2A 1C5DA 4P9HH 1JNLL 4XVTH 5HDQL 2E8ZA 5J8OA 5IBUB 2DQEL 1I4FA 2NW2B 1BQLL 2XWTA 5C0EA 5DSCA 1BX2B 3BZDA 3IKCB 3LQAL 4NUJB 2QSQA 5EZLB 2CDFB 3D85B 3OGOE 1NC4A 2WQ8A 4N9OB 4X7FC 4GRWF 4YE4L 3RA7L 1KELL 4BM7A 5HPMA 1NMBH 3VCLA 1YEGL 2FECL 1Y6KR 2APWA 2BVUA 3D87B 5BOPA 1PFCA 4QOKA 3O9WB 3ULUH 1PLGL 2ZOLA 4NQDE 3GUTB 5DD1L 4F37K 3OXSB 3VD5A 1IKFL 5L0QB 3KJ6L 2BY0A 3VXNA 1NCBH 1LHZA 4U7SA 2CD0A 1EHLH 3FTGB 4U1GB 1C12A 3MQIA 3N1PC 4JG0H 5CP3A 5LXGL 3NFSL 3LRSA 4IRZH 5FDWA 3TH3T 1VFOA 4FFWC 1HEZB 3S4SA 4P5TB 3IJSB 4OGYL 2G75B 5IB3A 5IR1A 2GITA 3BW9B 2Y4SA 2R4SH 2ZP0T 3VA2C 3SY0A 2EXWC 5D2NC 1YY9D 1I9EA 4M9OA 2Q8AH 3CXHJ 4S2SA 5IESH 3O45A 1IAIL 3KXFB 1C5BL 1G7MA 5IQ7H 4L3AA 3DV6A 5KZCB 5IG7B 2DBJA 4WUKL 2NY7L 5CP7B 4P3CH 1NJ9A 4ODUB 2FB4H 3V52L 3AC0A 3DIFB 1D3CA 5HXMA 5MERA 3DVGA 1AGEA 3UJIH 2AJVL 4BSWA 1EXUB 4XPTH 1S7XB 4BELD 5T1LA 3SHSA 3UYRH 4UINH 3EFFA 1D6VL 2VOTA 2DLFL 2CLZB 2ZG2A 1SYVA 2VXTH 2FATH 1RZJC 1YEEL 3WXVH 1UB5B 4G3YH 3VH8B 5E5RB 1I7ZB 5F9OH 15C8H 4WGVB 1EV2E 4FHBD 5EO1A 4CU7A 3NIGE 3G5XA 4KRPC 2W07A 3KPOA 2NY1B 4R8WH 1FFOB 5F1KC 4EUPG 3VMOA 1QQDA 3O9WD 5E5MA 4HIHA 4AG4L 2QV2A 3VJ6B 3HC0A 5IIEB 4GRLC 1AP2A 1S7UA 4NBYB 5J1AA 3O3DB 2YD5A 1TVBA 5IV2A 1KJVB 3V7AE 2PO6C 2FYYB 3LEYL 3L7EB 5MENB 4OAWA 1J18A 3OZ9H 1CLCA 3H0TB 5EBLA 4L9LA 4JDZB 4I77L 1FCCA 2AXGA 5F88A 4NGHH 5D7LA 1TVDA 5DO2D 5C0BE 1HIMH 2NNAB 3IF1A 4FXLA 1T04A 3HA0A 1QFWH 5IB2B 3KS0H 4MXVF 1XGUB 5HGDB 4MCZA 1RY7B 4TQEL 3STLB 4NWUH 5L8JB 1NGWA 2XPGA 3TN0B 3KPMB 3ARZA 5D2LB 3U4BL 5BVJA 1F58H 4L29B 3S36H 3FZUC 4M8VA 1OP5H 1OF2A 5T3XH 4LSPL 4CADA 1C1EH 5IT2L 1EUTA 4KMTH 4HIJB 3BZEB 3LPFA 2F74A 1ZVSB 2WUCL 4UQ2B 5C86A 2LFGA 1ZHKA 5SWSD 4G9DA 2PXYD 3HNVH 2O5YL 4RMTA 2R0KL 1CVRA 4JKKA 4LSVL 4CMMA 1J88A 4MA8L 3CSBA 5FYLH 4N8VG 5I1CH 2FO4B 1IGIL 3OKLB 1A7QH 2HWZL 3T3MF 3HNTL 5DUMH 3S35L 4D0BB 4N5ED 1MFDL 4ONOA 3FO2A 1HHJA 4ZXBA 4R2GD 1Z5LA 1ZWIB 1UYWL 4RWHA 5M7QA 1J1XL 4KUZH 4WO4D 2XA8H 1MLBB 2FECI 5IMKA 2F5BL 1PVHA 1DUZB 2R56H 4X4XB 3ILQC 4FXGB 1L4IA 3MGOA 1CR9L 3HI1B 1OB1B 4YXKH 3CVHA 5ID1B 3L3IA 4WV1B 3CFKB 4PP2A 1CDHA 5GJSH 5L7XH 5JIPA 2J12B 3T2PA 1J1OH 3EJZD 1TJHL 1VGEL 4U4BA 3TNNA 4OZIF 4LCYA 3EDFA 3P9LB 1ETZB 5C0IB 4U05A 2AXFB 4CKVX 5TH2A 2HP4A 3O6KL 4XMLH 4ZS6C 2LAGB 3MRMA 2B5IB 2EDDA 3KYOB 4XBEL 4OFPA 2HFGH 3ARDC 1S7SB 3FN0H 2DM3A 1WVZA 4GOSA 1Y0LA 4PB0L 3TWCH 4FQ2L 3M45A 2D0GA 5E2TH 2GW5A 4YHOH 1IEHA 5DJAB 4YNYA 1UKQA 3B9AA 3QHZH 2OTWB 4ZMAT 3IDJA 3HRZA 1OAXH 1YNKH 3DSNA 4FA8A 3E8UH 2CPCA 5JHDD 1SEBA 2VQTA 4L1HA 4NN6B 2NXYB 1GGIH 1NFDA 3HI6H 3L5IA 1S8DA 4RDQF 4ETYA 4Z7WE 1KJ2A 4K2UL 3RWFB 3SO5A 3W81A 2J6EA 4PJEF 1KOAA 4NN5B 4YDKL 4PRAB 3MLYL 3VI3F 2VLJE 2OTPA 1VEMA 3FQXA 4J3UA 3K4AA 4JFHD 1SJXA 7CGTA 4OZHB 3MOBL 8CGTA 3VI3E 3MACL 4PV8A 3HR5A 1FLTX 1Z6JT 2ZUTA 4TRPL 1BFOA 4GRWB 4RGOL 1G9MH 5E94A 1LEKB 3SY0B 4XCCL 4F7MB 5HYQA 3DMMA 4PJ8C 3WL9B 4W6WB 3ARBC 5C0GA 3MLSH 3ULUF 2UVEA 3DV6B 4L8BB 5KAQG 2W9DH 1EH9A 3KPRD 4P23A 5B22A 1E28A 2IG2H 4FFYH 5F97E 3TVMD 2WINA 1BIIB 4MNGA 5EZOL 3SE4C 4A6YA 5I17A 5KOMC 4I9WE 4XBEH 2P4AB 4RQQB 5E2VH 4FMKA 5DEFB 1LO4H 3JV0A 2IPTH 4YDLC 4EDXA 3IDNA 4QRPE 1OARL 5HHOE 3VXRA 4XI5C 1LO3L 4JPWH 4QXGH 2VR9A 4PYHA 4PJFB 1FFOA 5B39G 3JWOH 4E9LA 4LOUD 4FQQA 2IAMB 1RJZB 3QO1A 2O61A 2X4QB 4MYWB 1YNTB 5KN5A 3UAJD 3O3BB 1AP2B 2D0HA 3EHBD 1DVFD 2Y7QB 1U8HA 5D7IB 2AERT 3W0WD 2QQNL 3E6FB 3TYGL 4I3RL 4DCQB 2B4CH 4HLZG 2CDEB 4HD9A 5DYOA 2AK4E 1OGAD 3Q6FA 4NDMA 3AXLB 4U1NA 2VDLH 4FS0A 5C0BB 2ICWB 3DYMA 3O9WA 4NO5A 2IC2A 3OZ9L 3UAJC 1ONQB 2EH8L 1F45A 5DRNB 2F5AL 5TDPA 2FBJH 3CXDL 4K3HA 3BPNB 4Q7DA 1FFNA 2YPLA 4PRPB 5T1DL 3MRJB 4OV6F 4PJ9B 2DQJH 4QXUH 5E99H 4RMRA 3QQNA 4PLOB 2GSGB 2A9MH 5DS8A 2OZ4A 4ZUVA 5DLMH 4PJBE 3MFGB 3U7YL 4YXHL 2GJ6B 4MB3A 5JW3L 2J5LB 5GS2D 2VL4A 1TCRA 4KK6C 1MY7A 4S1RH 3TCLB 3W9EA 2EDJA 1YUHA 4OQTA 3VE0B 1CFVL 3IDIB 5DD3L 4QRQB 3GBNL 3VRJB 4OCWL 3QUZA 4M62L 3UTSA 5J6HB 3FQUA 3ZSSA 4XP9L 4K94H 4OZIE 5FYJU 4X6CB 2UWEE 2FJFB 3QQ3A 3ILPA 1GPOH 3LOWA 4MSWB 1HCVA 3OKOB 4W6YB 1UCBL 2P5ED 4EI6B 1IGYA 5E9DE 5EBMA 3PWUA 1FGNH 3K1DA 3SQBA 2UYLB 1DQQA 3L3DB 1W0VB 4P5MA 2X4RA 3WO4B 1NKRA 1P7QD 4M7JH 1NBZA 1TZHA 5INCA 5C0CA 2XYCA 5C6PB 1KEGL 1S5HA 3DYOA 3MCKA 2OJZL 1ZEAH 3EJYC 1OCWH 5LG1A 3G5XB 4JO2L 1TJIL 4OSUL 4GKZA 1NGZB 1LD9B 3VMNA 2R23A 5GRUH 5KANG 4HX1B 4L8SA 3WJLC 4F9PA 3H6JA 3WIIH 5DRZA 3VG0H 1WQVT 5H2BB 1HDMA 5IB3B 1QR4A 3QAZB 4JZJC 4DAGL 4ZUWB 4NIKB 4LSDA 1S7UB 1OAXL 5T1DH 4HH9B 2NCMA 3T0EC 1P7QB 3QAZC 4PRPD 5EUKB 2ZPKL 3QI9D 5T1KB 4N0CD 3QPXH 3S37X 5HGBB 4ODXB 4X5XB 1IEAB 1WBZA 5C0RL 3WMSA 4PJAF 5D93B 2HT2C 5AZ2L 1XIWC 3VFRB 1QRNE 2VABB 3MLWH 2NY6C 4QRTA 1AGCB 5E6ZA 1B0GA 2EDLA 2E9JA 5D2NA 1KACB 1J0IA 3FHQA 2IH1A 1S7RB 4JN1L 1JV5B 4U1HA 4ODTH 4K07A 5MEPA 1U41A 3WNNA 1JNNH 2FGWH 4X5LA 2QADB 4XP9H 3V7AG 2VXVH 5C0AA 4YAQA 1U93B 3KLAB 4NOFA 2F8VA 3T0AA 4WI8A 4GG6A 4PJDF 3KYAA 3EJJX 3RWGB 2BDNH 5ESAB 3GSOB 4M5ZL 1CZ8H 1T2QL 3MUY1 3KPPA 3SOBH 3QCTL 4LKCA 2X1OA 1A14H 3NN8B 2JB6B 4O02H 4WI7A 5DUPL 3KPLB 2CR3A 2NW3B 1I1FA 4P2QB 5I1DA 3MOBH 1LEKA 2NY1D 4IRSA 3O0RH 4V1DE 3OJDA 1TVBB 3H42H 1KEGH 5CINL 1MI5A 1U8KA 3IT8D 1YEFL 1I1YB 1G84A 3L5HA 1A7PL 2VUOA 5C0JA 3KNBA 4LEXL 4P23B 1HHJB 1N5AB 3Q48A 5C0DA 3ZKMC 2NXYC 1BIIA 2XN9B 2AJUH 4PJGF 4JM2B 1K85A 2NY0B 1WEJH 4TNWK 4YHML 1A02N 2PTTB 2YHGA 4LASH 1EGJL 4LP5A 1PX4A 3FB8B 3BDBA 3V0WL 4JDTL 3RI5K 4X4YA 3QEQD 3QI9B 2XT1B 4MHHI 5GIRB 3RVVC 4AIZA 2HYMA 1INDL 1Q0YL 1OGAE 3QQ9C 5IFJA 1JNHA 4YXLH 1N64H 3BT2L 4P23D 3WLBA 2QQNH 4Y4HC 4V2CB 3BH9A 3IAQA 1KLUA 4XPTL 3TVMA 3W0WE 3PL6A 1A9EA 4K3JH 1FN4B 1RUPH 1ZHKB 4G9FE 1MAJA 3IU3B 4LIQE 5IM7B 3HC4H 4L3CA 1NGYB 4JG0L 2VC2L 1T1XA 1NAMH 3NPZB 1TLKA 1BHGA 5LQBL 3MA7B 3VXRD 1XR8A 4JRYE 2JE8A 4HKZA 4RAVA 4F7CB 2VZUA 5JLZA 4XP5H 1DBMH 2AP2A 5CBAB 4ONGH 3UXFA 5IBLC 2ADFL 4UAOC 1CK0H 4H20L 1I9IL 2LU7A 2EYTB 5EORL 5EC2A 3N9GL 3TZVC 1WIOA 3RPIA 1EAJA 4PS4L 2HJFA 3DURA 4R2GB 3RWFA 4C56E 1BF2A 5AG8A 2YRLA 2WSKA 5TFSL 4NZRL 5FHBL 5H8DA 3BGMA 4DKEH 1VCAA 1FO0A 1KULA 1M7DB 4GSDH 4ZXBC 4LLWB 3UTPE 1JF6A 1OGAA 5CZVL 1JHKL 4NPYB 4NQVB 1LP9E 2BHZA 4JZOA 4TOYL 3WFDL 1J0KA 3KGRA 2WQRA 4OCWH 3MRQB 2OBGA 4HXBL 4Y16C 2AXHA 4Z7UA 5JR1L 5FV2A 2PW2A 3KLHD 2J7LA 2ICES 2W92A 4GMTH 3V0VA 5D7LB 4EOWH 5A2LH 3S36L 2BNRA 2R8SH 1GAFL 4ZOCA 5E6IB 2BHYA 2MMXA 5IKCB 2ESVB 3B2UD 1AJ7L 5JXEC 3WFCL 3ULSA 3OGCA 4LAQL 5BS0D 5IHUH 5FYLE 3O4OB 1RHHA 5HDLA 2P49B 4RWYL 3AVEA 4PLKC 3T0DA 1XGYH 4YO0A 4JJ5B 4NJAL 1KTDB 4NZDA 2D31A 1DBKL 5I75C 5T1MA 4OM1H 4XNYH 4QOKE 1JJUA 4GRLB 5FGCB 1IC4L 1UQSB 2OR7A 1X5ZA 1C5DB 5I1JH 4D9RE 2W0PA 4XPFH 3NBNA 4OF7A 1A4JA 1OP3H 1HN1A 4A6YH 1M6OB 3S3JA 5GJTL 5EORH 2F54E 5DSCB 5F1OB 2P5EA 4DN4H 3RWIB 4PYGA 3GHEL 4XPAH 1ACYH 4JLRA 2D7PA 5H2BA 1R3LA 5GGTA 1I9JH 4GQ9H 4GXUM 4YC2B 1U8MA 3VXOB 1YYLL 2EYSB 4XXCC 4ESKA 5KANI 4PGDA 4I4WA 1L7TH 2R1YB 3EGSA 4YC2C 5FUZH 3LN5B 4YHIB 3OL2A 5KOVC 3HN3A 4N8VB 1HSAB 1S7WB 4FP8L 4KK8D 3MV01 4Y4KC 4ODXA 3F7VB 1TFHA 2QJDA 3WEXB 1O0VA 4OIAA 1F5WA 1A0QH 1J86A 4C57C 2Q7NA 4XHJC 2DWDA 2WINB 3ARQA 3F5WA 1FNGA 1FVDB 4R4NC 3WD5L 1FAIH 1DQDL 1U92B 1UWXH 3LS5H 1MRCL 2A6JA 2X40A 1QACA 2I5YL 2EE9A 5GZNC 4PJ8A 4PRPA 1GZPB 1RZJL 5IK3B 4JFXA 2OQJA 4ODHH 1KB5H 2Y5TB 2DJ4A 4XCYA 1SM3H 3SEPA 1AXSA 2XQBL 2Y06L 4P23C 5KW9H 3ZKNC 1GZQB 2XIDA 1FH5H 1PZUB 4JPKL 2P5WA 3AREC 4LKCB 4UV4H 1TCRB 2JB6A 1ND0A 1YY8A 4M93C 4H5SB 5CFHA 4YXKL 4UAOB 3MBXL 4B7IA 2DLFH 5BJTA 1MI5B 3REWA 1MVFA 4X80H 4PRPE 4PJEE 3FQUB 5CD3A 4C59B 1ZSDB 1S8DB 2XKNB 4X9HA 3KNBB 1DVFB 5FOJA 5HYJE 4IHOB 5K9JL 2D4FA 3LN9A 4P46C 5ANMB 3D48R 3RHWK 5EO1B 4ONHB 3NH7L 4PJ5E 4RFNB 4W81A 4YGAB 4UTAL 4JRXE 3BESR 1T3FB 1JUFA 3QIWA 5J11B 3ECBA 3OMZA 2D03L 5C0BD 4XAKE 3S37H 3VH8G 3CJJA 1IM3A 1W72H 2FGZA 2ITDA 3BRDA 2D2OA 5D93C 3QG7L 3W5NA 1XF2B 3NACH 3C5JA 3FT2A 3HG1B 1H5BC 5E2WH 1G9NL 4KK9D 5L2KD 1KLUB 3EO9H 4G8FA 4MJ4A 1LO2H 1HDMB 1OT2A 3ZE2F 3JZ7A 1IGTB 3TYFB 2LABA 5IP4A 5I30L 1FRGL 2NLJB 4PJGB 4WEMB 1YMMA 3HHRB 5T3XD 3QEQA 4XB7A 4AEIL 3I6LE 3D9AH 4QRQA 3MROA 4OLWL 1ZHBB 4UTBH 3MJ7B 3WJJA 5HSFA 5ELIA 3R1GL 2YC1B 4KKLC 3ALPA 1KENH 4EDXB 2G5BB 3W39B 3VW3H 3NVQA 1CE1L 4HUMB 1IEBB 3P4NB 2J8OA 3NZ8B 4WFHD 1HIML 3QB7C 5JQ6L 3BISA 2HKFH 1WTLA 4BQ6A 4NKIL 3FO9A 3RIFK 3QUKA 2IMNA 5D2NB 3WFDH 4O58H 4TOYH 3RNQA 1JV5A 4U1HB 4NKMB 5E00A 1W8OA 3Q5TA 3TBYA 4Y1AD 1VPOL 4TULH 4GMTL 4U1JA 4YWGH 2FR4B 2XV6B 2FLRT 3GSNL 2DL9A 5IW6B 1GGCL 1G6RL 2H26A 5CEYB 1GAFH 3CC5A 2X44D 3NCCB 5DR5H 1WF5A 5BRZA 3VGEA 5EUOF 3P0VL 5L0QC 2VO5A 1FZKA 5D9SA 2V5RA 4JFFD 4HLZH 1U8PB 3IDMB 3UROR 4WW2B 3O2WL 2X70A 4C55A 4K7PL 4PJAB 4KC3B 5J89A 4TSAL 2WM0A 1GGBH 1JPSH 2FL5B 5IMOB 1WBZB 1QA9A 3GIVA 4PFEA 5MHSD 1OQXA 2M1KA 4NRYB 5L8LB 1MRDH 1OAKH 3EOBB 5KS9A 2H1PL 3DVNB 1KG0A 4A6YL 1EBAA 1T4KA 1HHIA 1QO3A 5IHUL 5HI5D 5TE6H 4QNPE 5DJ0B 2HFGL 1U95B 1UG9A 5M94B 3KLDA 2LTQC 3LKOA 1HHHB 3RGVB 5JTWA 5C0AB 5IMMA 4HJGB 3SDCB 5F1IB 4PJBF 4HCRH 4P2OA 1J1OL 4MX7B 3T2OA 3UTSB 2VN4A 5JHDB 3VD7A 2ZSWA 2YXFA 1SMOA 4ZFOB 2DQJL 3WFEL 4OI7A 2VZVA 2NW3A 43CAB 4WI3A 1YN7A 2W91A 3FRUA 3NCYP 1VACB 3V5KA 4YHIA 4EI6A 3WD5H 4XWGH 1U8KB 3PE9A 2YK1H 3MJ8B 1ADQL 5A16A 2I5YH 1NMCC 3HLAA 3QA3A 2KUTA 1GIGH 5CBAA 3AU1A 3I6KA 3RTQA 1I8KB 1JGUL 1JZ5A 1OAYH 3VFNB 3ILQD 1A2YB 3FB5A 4W4NA 4Q2ZB 5F71A 4WI4A 4N90D 4NYLB 4H8WL 2R23B 4PJ8B 3U2SA 5E4IA 2ZUWA 4X98A 4X8XA 2DI9A 3CK0L 3O6FB 4XWOC 5FO8B 3ALWA 4E41D 4F7MA 4LLWA 1RZ7H 4MNQE 1DBAH 4RZCA 1BD2D 1CLOL 3BXNA 5T1KA 5IHZA 5FYJH 2XTJC 5I2IB 5ISZA 3OF6D 3C8HA 4BH7A 4WU7B 2AGJH 2KZ1B 4KKBC 1EAPA 5AYQA 2CKBB 4PJ8D 1G7HA 3WDIA 3TC9A 2EECA 2BNRB 5TE4H 3ES6A 4LSSH 3DROB 4LAJH 4LSQL 3QUMB 3WKMH 3KPTA 4CVXB 1TMCB 3TBVA 2VDNL 1ZA3A 2CUMA 4HW6A 1BD2B 5C0NC 3K2MC 4NKOA 2FLBT 1FL3B 5JPMB 4PJHA 5D7JB 3ZT6A 3VXRB 1XCTB 2XWBB 2XY2A 1FCGA 4JQXC 4N9GA 2VXQH 4APQA 1YECH 2GI7A 4LNVA 4M1GL 5D96C 3JV6A 4U2YA 1MFCH 1D9KD 3GJFK 4V2BA 4GBXB 1U8LB 3S98A 4HWZA 1IAKA 3BGMB 2EKSB 1AKJB 4GKOA 5E8OA 4TVSa 3VG9B 1MREL 4JKLA 1EERB 3IVKA 3QPQC 5FKPA 5EUOA 1EK3A 5I8OL 5AD0B 1T83C 4MGXA 1G7LB 1PSKL 3IXAB 4H1LB 3DHMA 4BA8A 5AAWA 3RFZC 3IGAB 2DOCA 4PTTA 5ADOL 3LPGA 1MWAL 4UNVA 3ARPA 3IYLW 2VDOH 3F58L 1GSMA 4LVNC 3QUYC 4GBXD 3K8KA 4KTDL 4R90H 1JZ3A 5D7LE 1LEGB 5J7CC 1HINH 3CU1A 3P30L 5I1EH 5DUBA 1ZAGA 1RU9H 3C5SA 2YA0A 4GRWH 1M71B 2BVTA 5HHPA 2GJ6D 3BP5B 3ULSB 4Y16A 2XZAH 1ZE3C 5D6CB 3MYZA 1U92A 4ZUVB 2R39A 3EZJB 4WHCA 4FTVB 4HT1L 3LQMA 1IAIH 1YMMD 1J05A 3TIEB 4DFHA 3SGJC 5T1MB 4M7ZC 5DJXA 3MRHB 2HA1A 3QEGL 4QXUL 3BJLA 4Z7VE 5HJ3B 5H37G 1ED3B 2P5WB 3O8XD 2BVEA 1KGCE 4BQ8A 2HLAA 2BRRH 3UTTB 4JQIH 4NBZB 3TNMB 1FGNL 4G6KL 3AS1A 1F11B 4PGDB 5GRVL 5ITBH 2FJFA 4X7DC 3TN0C 1XZ0B 3PJSA 3MRRA 3G5ZA 1MIEL 5DEZA 5I1KL 2VLKB 4K3JL 3WDJA 4TTDC 3PGCB 3O8XC 4JFEE 4ZFOL 4ZS6D 4LGRB 1T7ZA 1PG7H 4IHOA 5B38A 3G6JF 5C0CB 4J8RB 3F7YB 3P4MA 5F7HA 3BWAA 1EHXA 5I9QB 1MCKA 5DMKA 2E8YA 2H2SD 3IDUA 1KIRB 2BSTA 4PJEB 2OL3H 4YDIL 4FZEH 1IZKA 2BSRA 1QZ1A 3ZO0A 2VLKD 1A4KB 4Y4KA 1FORL 4HPOH 5ESVB 4HEPG 3HZMA 4DZ8A 5C09A 3AMLA 1NLBL 1JGDA 5AZEL 2GUOB 1FNHA 4LHUG 4J3SA 4M61A 4Y7MA 1PGRB 3OJMB 1U9KA 2ZG3A 5BW7A 3TYFA 3VCLB 2WBKA 4X99B 4XTRD 1SHMA 4F9LA 5GJSL 3QNXA 5L7XL 1VACA 2DQDL 3V5KB 4Y5YB 3ARTA 4YFLF 4RBPK 4V1DB 2V9QA 5CGYD 3LEVL 2FO1A 5J4MA 3GUTA 4FXKA 1JPFA 5KS9F 5CZXC 1P69B 2DQFB 5GGQH 4P2OD 5C0RH 3I6KB 1JHTB 1RUAL 4G8IA 5BV7H 1EJ6A 5LKNA 3MNWA 1MAKA 1ZLVK 5F7YC 2R69H 3FO9B 4ONHA 1QEWA 1ZMYA 4XP6H 2V5SA 4WGWB 4HK0A 3QDAA 1M6OA 3KXFE 5TQ2H 4FQLH 3KPPB 1CFNA 4PR5A 4QHUB 4OV5A 3MREA 2QL1A 3G6JA 3R4DA 3UDWA 5L6YH 3WNKA 1QKZL 3NGBC 4ZPTA 2VL5A 4NBXB 3SQOH 3FT2B 2VRAA 4ODBD 1BBJA 1KJMA 3MRKB 4P5TD 5FGBC 4HKJA 4N0CC 3MODL 4KHXH 4BSVB 3L6FB 5TF1H 5D4QA 3L3JA 2J8UE 2VLJA 4OQ1A 4AIOA 2YZ8A 3RVTC 2OL3L 4S0TD 1RK1A 5SWQA 1V7NL 2Z4QB 4JY5H 3QEHB 5JNYB 3HFML 1BD2E 2AEPH 5EWIL 4BH8B 1YEFH 5GS1B 3WIHL 4E41A 3FN0L 5DD5L 1BD2A 3T77B 1AQDA 5JPMA 4TPRL 4XMLL 4EXKA 4OLXH 5D72L 5IFJB 2DKUA 1OP9A 3TBTA 2EICA 4GKSA 3SBWA 5ISZD 4KK6D 2BSED 2F15A 1PKOA 4JEGB 1QFOA 1Q8MA 2AJXH 1INQB 3FOLB 2ZJSL 3RNQB 4N1HB 2IGFL 5FECA 4OIIL 1A9EB 3PP4L 3HNSL 2FNBA 2DRUA 4P9ML 3WJJC 3QIBD 3FT3B 4MS8C 1QBLL 1RZKC 3JWNC 1B6UA 2PO6B 2JCCB 1IE5A 1I4FB 3QFDB 2ARWA 3BE1L 3WN5A 5EUOB 2M2DA 2QADD 5KVFL 1KB5L 5IBUG 5JLZB 2MCPH 4DQOH 1M7IB 2APVA 5EG6C 1OLZA 1D9KA 3QIBC 2D7NA 4CGTA 2WIIA 2YMXL 1XGRB 4KRPB 5HDBE 4QWWC 5I66B 3VFWB 4UV4L 5FYJE 2D7MA 3EKCA 2ZPKH 4FZ8L 3TPUA 5DHYB 5K9OB 3KPMA 3B9KD 4JPIB 5DJDB 5L88L 1IM3B 2APXA 4OJFH 2P8MB 4UIKH 2BK8A 4JN2B 4JY6A 3HPJA 3BKCL 5DWUL 5FF6B 1B4JH 3ULUD 4PGZA 4N68A 2OXGA 3CU7A 3QI9C 4U49A 4IIQC 2ZNXA 4D0CB 4G9FD 3IFLL 4Q9CA 4TUKH 2NLJA 3B9KC 3NH7H 3ULVH 1CIUA 4X9FA 4WENB 4JB9H 2Q1EA 5D7JC 5DFTA 4KDTC 2GIYA 2HT4C 5CS7A 2W60B 5SWSB 4HUNB 2X4NA 1K3ZA 1F3DH 1X44A 5ENWA 2Q8AL 3UPRA 1RVFL 3QUXA 3RNKA 4EVNA 5HY9A 3W39A 3NIFF 3DVGB 2EDHA 2HJLA 4O02L 1PQZA 1I8IA 4JO4L 3BSZL 3LKRB 3CFDB 1CBVL 1GGCH 3FQTB 4P4RB 1ZHNA 4FG6C 2N7BA 1WC7B 2B7DT 1CFVH 4Y1AE 1FC2D 1LE9A 2MFNA 5AWNH 2AQ3A 1IQWL 3IFPA 1MCPH 3DO7A 4ZUTB 4UTBL 1I9JL 3KPOB 5IGXL 2AJUL 2BSTB 2YMXH 2OI9B 5EU5B 4TSAH 5C9JA 3P9LA 1FFRA 2CK2A 2YUWA 1FNFA 4LCUA 1KYOJ 1VKXB 4JRXA 3ZDYE 1TTGA 4GAYA 5D6DA 3QFJE 1RZIA 1J0JA 1HILA 4KROC 5TDOB 5EU3A 1BOGB 2IFFL 5DQ9B 1NMCB 1BF8A 1KN2H 2WANA 1LDPL 3RVTD 2ZUQC 3NZHH 5GXBB 3MV7B 3NTCH 32C2A 1X6NA 3P77B 5ALBL 4ETQA 5IB1B 1HI6B 5EU6A 4PIRF 4JZNB 3KPNB 1IGMH 3ULVL 1WLHA 1IGJA 3GEWB 4ZOBA 2AEQH 3L3OB 4MJIA 1NGWB 4UB0H 4OD1H 5J11C 5KVEH 5JXAL 3VGFA 3MOAH 4J3VA 5BQ7A 2EE2A 2GSIB 5EOTB 4PJ5D 4WWID 3TJHD 3BDYH 1KCRL 1BZQK 3SDAC 1AO7B 3HR5B 5BS0B 5J1TC 4J3XA 3BZEA 5HD8D 5JHDA 4K7FB 4MS8D 2YBRB 4F80A 3VDBA 2BSSA 3B8YA 5T3XL 2H1PH 3C6LD 2ENYA 1ZT1A 3ARBB 3MV11 4GUPA 1Q94B 1ROWA 4TUJA 4GT7A 5AD0A 5CGTA 4Y19B 1VB9A 3DMMC 4RFNC 5A16B 1XGTB 5IF0A 3CLEH 3SKOB 1UXSB 3RI5F 1F11A 3EYFB 2BNRE 4YUEL 3VXNB 3WIIL 4YQXL 1UCTA 1XR9B 1TETH 4LSRH 2BC4B 1T21B 5CUSL 2B20A 1GL4B 1OCWL 4U3XA 5GSRA 2R1WB 4QRUB 3QWOB 1YEHL 1C5BH 1NPUA 5IQ7L 2F54A 5DQJB 1HEZA 3MV9B 4HGKC 3MRIB 4DEPB 2IBZX 4JDVB 1P4BH 1CGUA 5IR1B 5D6CA 3OWEA 2H32B 4KZEH 1LGVA 1MPAL 2DBLH 2RGSA 2ZWLT 3IDYC 3KPRA 3NTCL 5GRXG 4ELKB 2NR6C 1XF2A 2EDOA 3MBEB 4ZNEA 2VISB 3R8QA 5CEZE 1I3GH 3GMPA 2AXFA 4QRRE 2QHRH 1A4KA 4Y4KB 1UB6A 1YNTA 3BPNC 3RPKA 3F6IA 4EDWL 3GKZA 2VAAA 4O51A 4XAWL 3TESA 1YDPB 1P4LB 3EUUA 5TDNB 1KENL 4ELMB 2WW8A 3U4AA 4K71B 3OKMA 3V0WH 1Q9LA 3Q3GA 3UCRA 2A9NL 2QHLA 1GVIA 2HLFC 1WFOA 2CSPA 4D3CL 1ZA3B 5DJ8A 4DUWA 5GS0C 2YZ1A 1FE8H 5EFIA 1KB5B 4OCMC 3P9MA 5FM5M 1S7QB 3T0WA 2QQKH 1I7ZA 1YN6A 4XPBL 3V6ZB 1B4RA 4GKNA 2XNAA 1DQML 1NFDF 2R2BA 4WTXA 5CEZH 1CZ8L 2QQQA 4WFHE 1D5MB 3W0WA 1R3KB 4BZ1H 5B38B 5E8NA 3MR9A 3QDMB 3VWJC 3IFLH 3EYUL 3BWAB 4HUUB 2EH7H 3A6CH 1CXKA 4UT6H 5ACLA 5LCVL 1MCOH 2KZWA 3VMPA 1YPZF 4JQVC 3HUJA 7FABH 4OV5B 4EUPH 1G7LA 3IXAA 2ZKHH 2CKBL 5E95B 3TCLA 3H0TA 4MMZC 4TNWF 3ESUF 5K59E 1VGKB 4E42B 3UYRL 2FHFA 2YPLD 4KPHL 5IJVB 2GUOA 1Q0XL 4JVWA 1OW0C 1XF4A 1B2WH 4LPXA 1G1CA 2IBGA 4GW1A 2KL6A 3VRJA 4ZOEA 4AMKL 4OLZH 5T3ZL 3DXAB 5D1ZC 3QWRD 4JVUA 4MD4A 1YEDA 4FFZH 1F3JA 4ZQKA 1E28B 4QYOA 3UZVB 4G6AD 1MCLA 3EOBA 5KS9B 4UIMB 4V1DA 3BRFA 3IS1X 4G9FA 4CU8A 1BWMA 5DEFA 2WWKT 1SEQH 4PJIF 1UKTA 4YR6A 2EIZB 4NJ9L 4ERSL 3SE8H 2YS4A 2VXSL 4H26B 4NQTA 4Z77A 3UTSD 2MWCA 1TZIB 4JKPL 5BW7C 4XP5L 3MV8D 4NN6C 5HHQA 2VC2H 4U3CA 3T2QA 3DO7B 3QUXD 3V5HB 1NGZA 2IADA 3LKNA 4NSKB 3QJHA 5D5MF 3SDDB 4PR5B 2KH2B 2Z91B 4ONFL 4WFEE 4PRNA 4L8SC 3WJLA 1OARH 5D2NE 2WLYA 3U4BH 3BZ4B 3WYRA 1FYHB 2EXYD 3FO2B 4ZXBB 2FHBA 3FRUB 1P7QA 4NJAH 4UDUA 4HS6A 5E1AA 4RA0C 1BMGA 1J9CT 1FQ9C 1OGTB 3REVA 2ZCHL 1TITA 1LO0L 1G7IB 1HOCB 2VLJB 4OGZA 1FIGH 3GB7A 3NGBB 3LZFL 2E5EA 4IS6A 3MCG1 1UA6L 3CGTA 4X4XA 1MFAH 1QSVA 3I75B 3FB5B 1ONQA 4KKCD 2UZYB 1B0GB 1MF2H 3NZHL 5I8EA 3KPNA 4HFUL 1J5OL 4KK5C 3VFWA 4JFFB 4E41B 1FFPB 4AEIH 2PETA 4OCYH 3MRJA 3R06B 5C70A 1AQDB 3QEQE 2DQUL 4NHUB 3ARUA 3BPCA 3JTSA 5KVGL 1D5XA 1U93A 3KLAA 1AD9A 2NR6D 1IM9A 3MTRA 3O2DA 2CXKA 4NZUH 5JORA 2Y07H 3B5TA 5F1NB 4J1UA 4JREB 2HTKD 4K8RL 2VZOA 3U0TA 4P2YA 5EU6D 3BWUC 1KC5H 4X4ME 4BZ2H 4ZUUB 4RSVA 4LK4A 1J8HD 1KCRH 2GTWB 3B5HA 3L9RB 1CF8L 1G7HB 1AR2A 4LP4A 4NZTH 4LHUB 1SEBB 3T0BA 5I1JL 5CILL 1I1YA 5C0AD 2DQHH 4PJ5A 2PO6D 4UBDD 3TBVB 4O5LH 5HY9B 1M7IA 1WFNA 3BP7A 4OD3L 4M62H 2AK1H 4IOIB 3VH8A 1QBBA 4OQTH 1PQZB 5HYJA 1T21A 1T66C 2IALA 4OLVL 2JLLA 4YDJB 4U1GC 1AR1C 1I7TB 1XF5A 5E2UL 5GJTH 4YZFE 5DHYA 1QTYT 3MBXH 3MUGA 2AS5M 4JPIA 1A5FH 1F6FB 5CJQH 1DANU 2NY0D 2Z8RA 3QH3B 3VJ6A 1UWEL 3EOTH 4YZFF 1QSFE 3BAEL 1WAAA 4OCLC 4ZPVB 5JUEH 3RZCD 4ZUTA 1U3ZA 1LD9A 1D9KC 3NCBB 2HRPH 4U1SB 2OK0H 3NOIA 1U8QA 2R2HA 3JSSA 5D1ZB 1JCKA 3GMQA 5JHLL 2KQNA 1G7JB 5I18L 1MLCB 5AUMA 5I1GH 1KJ3L 1NAMA 3RZCC 1GCFA 3OXRB 4LLUB 3LRHA 5JOFA 1F4WL 2AAVA 1CD8A 3U1SH 5FYKE 4X8JB 3SDAB 3O4LA 4DAGH 1CFSA 3HNSH 1MHCB 1D5IH 3RDTC 1DUYA 3LQAC 3S35X 1S9WA 4M4RA 2A9NH 3PL6D 1XIWB 2VNCA 5EU7C 4HBCL 4XX1G 4KTDH 2Z31C 5ID1A 1MEXH 3V6ZA 4QY8A 5I71B 4LLDA 1JPTL 5I73B 1QD0A 3TZVB 3QIUB 4I48B 1O5DT 3ZE1E 4P3DB 1ADQH 2BMKA 1F8TH 3MR9B 3E2HC 2XZAL 4JGUA 3IFPB 2W0KA 1I3VA 1K8DB 1VDGA 1TZGH 3C2AL 5MEQB 2AJYH 4M48H 5J56B 3WFHA 4DWHA 3EDJA 4FNLH 5E08L 2HLAB 5I0ZA 3SDCC 2HJKA 3DGGA 5I1DB 4OUUB 2EXYC 2J88L 4XP1H 3H9YA 2DQGH 4HS8L 2LE9A 2AW2A 3DECA 2C3VA 1JN6A 3HE7C 4L1DA 3JWOL 3ZHKA 1H3PH 3MNZB 3BKCH 3V6BR 4I3SL 5TDPB 2R9HC 3PGCA 4YHYC 1BJ8A 1UH4A 2OI9C 4DGVH 1BOYA 1WFUA 4N8CL 3VXUD 1D5BA 1F3DJ 1JYXA 3VXUE 4ELME 4LMQE 4BZYA 4UOW1 4NWTH 1RHHB 3D85D 5FAAA 3IAPA 4DZBA 3CVHB 4F58H 4W4OA 2B0SH 3HC3L 1KBGH 3U9UA 5BO1H 2QR0B 1YEEH 3WXVL 4O4YH 4R97C 1NGQH 5I16A 1LK2A 4AM0B 3MRMB 5ECJE 4D8PB 3QWRA 4P99A 3UJJL 4LPTA 5F70A 1G9EA 3O2VL 2YEZB 4QT5B 3CH8A 3K4DA 3VXUB 2FWOB 5IUSA 4CAGA 5BS0A 3PL6B 4V1DD 2VLRA 1K8IB 2DS4A 4KRMB 3LD8C 3BEWA 4ELMF 2EYSA 3FQRB 4JG1L 3IDJB 4N1CA 3L5XH 3EGSB 3EO1A 5F7EL 3I6LD 4WI2A 2CIIB 5BV7C 2XRAL 1JWUB 4YWGL 1HSAA 3EW3B 1Z9LA 1B90A 4Y19A 3MV8A 2E7HA 2R0LL 1NSNH 5MEOB 4R0LB 3DBXB 4JM2F 4TUKL 1OP5K 5HVFB 1KB5A 2FH6A 4XGZB 4PGEA 1PJ9A 3SE9H 3WNOA 4WDIA 5GSRB 2VDKL 3LSOB 4PJFA 4X5WA 2F8XC 2L7UA 5HHOD 5C6WH 1JPGB 1Z9OA 2F58L 5IQ9A 3MREB 1NCWH 1VKXA 2A38A 4XCYB 5EU7E 1OPGH 4BFIB 1AD9B 1F58L 3P2TA 1FO0B 3C2SA 5DD1H 1NUDA 4HH9A 3EDEA 4NPYA 3RVUD 2ENSA 4ORGA 4PRIB 5EB9A 1OOAA 4R96A 4Q0XH 5MP6L 2CDEA 4YDVB 4C54A 1RZKL 2R29L 5IWLA 1U8NB 2VLLB 4DKEL 4LPCA 4NQEA 1BAFL 4G7VH 5HHOB 3WLWD 3TO4D 1TJIH 1BGXL 4W68A 2NYYD 1YEIL 1PX3A 1AGFA 1T1YA 2IH1B 5CZXD 2XZCL 5C07A 3DSFH 3TBWB 4NZTL 3PQYB 1QSEA 1R0AL 1T03H 4KVNH 2B39A 4U6HA 5F6IC 1BQUA 2HFTA 4PJXA 3MJ9H 3LKPA 4TUOA 5MEND 4OIIH 3STZA 3QIBB 4WFFE 2J8HA 5BQ7B 3L5XL 4YO0B 5D2LF 4OUOA 3TP4A 1MIEH 2FB4L 1JGVH 2JELH 1YEJH 4J23A 3KR3H 1W0YT 5CCKH 1E27B 1ZT1B 3DVFA 3ZDXE 5B8CA 4ZODA 1ZGLB 2JB5H 4ZYKA 4N5EC 5JHDE 2QBWA 5F7DB 1OD7A 1P84J 4R4FL 1VHPA 2VDKH 5C6TL 4KJPC 1XGTA 5IF0B 3RX7A 1IL1B 5D7KE 3QIWD 2G2RA 4OBSA 1P6AB 4HEME 3W5MA 3DV4B 4NNXA 2DF3A 4WRLA 5C0CE 5C0BA 3B9KB 4NQEE 3TA3C 2WAHA 1RJYB 2EYRB 3MZGB 3QDGE 4Z7WB 5L2JB 3D5OF 25C8L 5JOFB 2EIDA 2C1PB 3AB0C 4KUCD 2UZIH 1CFSB 1CXFA 4RGNE 5FYKH 3UP1A 3O3AA 4TN9A 2XOTA 1AXIB 2H32A 2Z8SA 2R29H 2OR9H 1JYWA 1B88A 3L3HB 3DETC 1NCTA 3ZYZA 3MPCA 4N0FB 4NOBA 5FM5O 3CZFA 4PJFE 5HDBF 4EN3A 5L88H 5D7SL 5BZDB 3SGDH 1KNOA 3P30H 3I9GL 2MKWA 2VAAB 5GGRA 3E1F1 1G7PA 5ICXA 1NBYA 3ZKSD 1A22B 3CC5B 3NPSB 4M6ML 4U7MA 3QXDA 1N4XL 2JJSA 4YH6A 1RUQH 1CVSC 5TQ0H 5CIPH 1AHWA 5F89B 4GW4B 4XC1L 3OB0H 4LDLB 5DJ8B 3BP4B 4KZEL 5IVXB 4XH2B 1RAMA 5FUOH 4Y1AA 3PIQB 4QRTB 1YYMH 1JN6B 1C1EL 1KCUL 2VMFA 3HMWH 3O2DH 1TVHB 4NQSA 5CZVH 2AJSL 2QHRL 2WNGA 1VEOA 1IT9H 3T3PF 5JZ7D 2AEIT 3ALXA 3E3QC 3RKDD 2X4RB 5DZNA 2FJGA 3QQ4A 1MUJA 5EUOE 2ZSVA 4JM4L 1S5HB 5CHNB 2VZTA 1FNLA 4ZO9A 1A3LH 3Q6GL 4GLRH 4JFFA 2AJ3A 3I50L 5I9QC 4HX1A 1RFDH 3HC4L 4Y8DC 5DJ0A 1AIFA 4NRXB 1X7QB 4OGXH 5IMMB 2GY7B 4I77H 5I1KH 5JMRA 2DLHA 1CIDA 5GISH 2A77H 2FDBP 1L6ZA 4LCWD 2J6EL 1FPTL 1QFWI 4HUVB 1NFKA 1DQJB 3VFPB 6FABH 1P7HL 3PXHA 2CDFA 3D85A 1ZTXL 1KTRL 3FOMA 1G9NH 4QNPF 1U8JA 1I1RA 3CSPA 1JZ6A 3B3IB 4IMLB 4ZQKB 4PJGA 4LGSB 4ZTOL 3QG7H 4H0GA 5IB1A 2A0LC 5J6GB 3VGAB 4QRPA 1GOGA 4R9HA 1PG7X 2NX5D 3MLVH 3QDGB 1H3GA 2D31B 5ANME 1MCDA 5I30H 5AZEH 5IFAL 3BUTA 4M7LL 1HSBA 4JHWH 5DHVA 5HYJB 5DZOA 1EFQA 5FUZL 3OAUH 1NCDL 4LSVH 2VE6A 1U3JA 1CDIA 1DBJH 3RWGA 1BEYH 4ZAKD 2HTLC 3MUGB 2ID5A 1RIVH 4CNIA 2JIXD 4WO4B 2B8OT 3LVEA 1E6OL 4Y19D 1RZKH 1U8MB 3D69B 4Z7OE 1A0QL 1GGIL 3MUJA 1WICA 5GGQL 3RTQD 4PRIA 3ZDYF 4UDUB 4Z7OF 4Y5XC 3WFHB 3O4LE 4Y2DA 5I2IA 1KJ2L 1EEZA 1G7IA 2R1XA 4WTZG 4MWFA 1FZKB 5D9SB 5ETUB 2CRZA 1CU4L 3SGEH 3DIFA 1CD9B 2IEPA 4XB8A 4S1DC 1P1ZB 1CE6B 3PQYE 2JIXB 4JCLA 5F7WC 4UUJB 5IEKA 4PJAA 1AGFB 4PJHF 2BNQE 2JJTC 5BMFL 4ODWB 1KXTB 3PHOA 4M7KH 1K2DB 3MRLB 4NRZA 3T65B 2Y5TA 5E8EB 3QDJB 1BZ7A 1QSFA 4LCIL 1A6PA 5BVPL 1JWSB 1IM9B 3SDDC 2ORBL 4RFOH 3TO4A 3PNWB 2EDWA 1NANI 2E9IA 5D7JD 5J12B 4X7SL 5E5MB 3OB8A 5DFVD 1WZ1H 5DD0H 1ND0B 1YY8B 2R2EB 5FGRA 2EKSA 2GTWA 3JWDC 1SJEA 1T1XB 1QSED 3CXHK 1KPRB 3U82B 43C9A 5GZOC 1D6EA 3G6AA 3EDKA 4CMHC 1QHOA 2OJZH 1DQTA 3BYTA 3WXWH 3ZSTA 2ICWI 3GHBL 4NNYB 4ZFZA 2V9RA 5SWSE 4APQD 3OR7A 4MJ6A 1J11A 1RPQA 4CVZB 2FJHB 1DQMH 4CDHA 3P9MB 2ZJSH 4OFVA 1T5WA 3F65A 3S34L 1T04B 5ACMA 1OAQH 4P49A 3X12A 1HXMA 2VDPH 1HK6A 4HSQA 1DEEA 2YPKA 3WHE0 1EMTL 2DQEH 4QHNB 1UC6A 4JY4A 5BRZE 3AGVA 2DIAA 5JW5B 1N7MH 1EUUA 2Q7YB 2YK1L 5E8NB 4EQ3A 3TCXA 3MJGX 1OTUC 5F9AC 5IVXF 1JK8A 5BXFA 4KK9C 3P4OB 1KIPB 1QLEL 3SQOL 2G60H 1E6JH 5CILH 2Q86A 3SDYL 3T0ED 4M7ZB 2J8UF 4O5LL 3RWIA 4FQIH 3S4SB 3C5ZB 2JKXA 5DRWB 3ZZ1A 3IJSA 3CFJA 4XHQA 4KHTL 5DQDL 2DLTA 3QT2A 4KGJA 1XF4B 5JQ6H 2HKFL 2DQIH 4Z18A 5H94B 4FG6D 3MGAA 1HCFX 4X6CE 5H37H 2D03H 3RVXD 3DX6B 3OKLA 4W4OC 4X83A 2P8PA 5CMAA 3T08A 3IRPX 3OAZH 3C87A 1JP5A 3HAEH 1HXYA 1X3DA 5IJKC 4FQXD 1N26A 1Z9SA 4UDTA 4EN3D 4I1NB 1FLRL 5D5MA 2HG5B 1G9MC 5D1XA 5J13B 4JFOB 3MRGB 5IK3A 4FFZL 1BIHA 5SWZD 4NKOB 2GJ6E 2H6PA 3O8XA 4HFWA 4HUWA 4PJDA 1OL0A 3WKML 4D94A 2ATKA 3KPSE 4K8RD 1MFEL 4UI2A 5TE7H 1A4JB 5IROC 4PY8J 4BQCA 2ERJB 4RX4D 4P2RE 1OAQL 3BX7C 4QO1A 4X7TB 3CPLB 2I24N 2Z91A 3EZ8A 4X0KA 1LK3L 4PLJD 5F21B 1INDH 1Q0YH 1FL6A 3BMVA 4CJ1A 1AGBA 1S5IL 2EIEA 1AC6A 3RIAF 5E03A 5HHVH 1GOFA 3GM0A 2C3VB 2BOCA 2CK0H 3VFPA 4ORZC 1HYSC </