1ORSA

X-ray structure of the kvap potassium channel voltage sensor in complex with an fab
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
214
Chain Sequence
QIVLTQSPAIMSASLGDRVTMTCTASSSVSSSYLHWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQFHRSLTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords 33H1 Fab light chain
publication title X-ray structure of a voltage-dependent K+ channel
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 54
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1orsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1orsA01
4PJXB 3G5XB 1I1YB 2IPUK 2NW2A 3QEUB 1ZE3C 3SDDD 3VWJC 4Q9RL 1TVHB 3QPQD 3ESVF 2F53B 4NFBA 12E8H 1QACA 1W0YT 1WGOA 2IPTH 3QCVH 5K9KB 4MQ7B 1OLLA 1V05A 4P2OA 1JV5B 4X7TB 2EDOA 4OZGA 4HMDA 5TE6L 4MLIA 3P77B 3RL1A 3MCG1 3LKRA 4XH2A 4IRSA 5DMYA 3VW3L 5CJ5A 1DLFH 3FQUA 1CD9B 4LGPB 1QA9B 4R2GB 3C6LB 1HYSC 4YE4L 1MFAH 3OKEB 1GYAA 1HIML 1NEUA 1HHHB 4XI5C 4LSDA 4J8RA 1E4WH 1UJ3A 1PKQE 4PJ7A 4LKCB 4YK4B 2D7QA 5GZOD 1SYVA 1MJ7L 25C8H 3ZE2E 3MRDB 2ZJSL 5D2LA 4FS0A 2D0GA 3ARBB 1DN2A 1A3RL 3REVA 2M26A 4K3DH 2DJSA 4OIAA 5EOTA 4FXGA 4LCCC 4HQQL 3OSKA 4K9EL 1KEMH 4JY6B 4RX4A 1A1NB 5KTEL 5IFJA 4KWUA 3KPNA 3ZDZE 5A2KH 2R69H 5IVXB 4XPHL 4WRLA 2BSTB 2UZIL 3TBSB 4NZRH 1NLBH 3CK0H 4PRHA 4X99A 1M4KA 3VFVA 3MLWL 2VN4A 5C0BE 5GS2H 4D8PA 5C8JA 2HVJA 4KRPD 4P3CL 2R0WL 5FHAH 1WCBA 2VLLB 3HMXA 3DHJA 5EA0H 4P2RE 2QR0B 4XCNB 2FNBA 1MRCL 3VFWB 4W70A 4WHDA 5JOFA 4WI8A 1H8SA 4M5ZH 2OLDA 4P4KA 4RRPG 2EDNA 2VZSA 1AXTL 3C5SA 3O3DB 4W4OA 4YXLL 3QWRA 3ELAT 4CU7A 3FO0L 1IGMH 5FV1L 4F2MA 3SGEI 2X4UA 4MCYB 3T0DA 1OAUH 1FE8L 2MCG1 4I0PC 5C08D 2LU3A 1TCRA 3LQZB 4LEXL 1JPSL 2W0LA 4U7SA 5T5NG 3JTSB 3LKSB 4HJJL 1H0DA 3WXWH 1WF5A 5A2JH 2VSDA 1HH6A 4XBEL 4QRUA 5IB3B 4LHQB 2OL3L 1U8JB 3ZTNL 1I9RH 4MA8L 2AQ2A 2VLKB 4RAHA 3HB3D 3JV5A 3JWOC 4M1GL 4PREA 2GTWA 5E2WL 1UKSA 4MD0A 4IHOA 4AEIL 3S5LA 4CU6A 3IDGB 3KPSA 4KMLB 1NSNH 4S2SA 1OSPL 1GGCL 5IVNA 1KV3A 1PSKL 3JWOL 3GMMB 2NY2D 1KELH 2YD6A 35C8L 5BVJB 4AZ8A 5JPNA 3CZJA 4UV7H 1NCWH 2AJSL 1JF6A 3SKOB 3RVUD 4MCZA 1XMWA 3AREB 4TYUA 5KANI 2A9NL 3NACH 3SE3A 4CAGA 2R29L 2BNQD 3V0WL 1IRAY 5HVHC 1XF1A 3U4AA 3OL2A 4YNYA 4HH9A 3O6ML 1IM9B 3BH8B 1IEAB 1T0PB 3HI1B 2IFGA 4IIQA 2BVTA 1YN6B 2NQCA 1F58H 3V6BR 1I3RA 3SKNA 4TVSa 1MAKA 5CEYA 4YLQT 5I1EH 1VFAA 4P5TB 2FR4A 5MENE 4JPWL 4LP4A 3JVGA 4K71B 4X6EA 4JM2C 1JGVH 3TYFB 4WNQA 3L1OL 1H3UA 2UVFA 4QRQB 5HI3D 1DBBL 3M17B 3OR6A 4MA7L 5C07B 1Z3GH 2VABB 4D9LH 5KVFH 4PBWD 5E9DA 4OD1L 5TH2B 2DI9A 1YPZF 5C71A 3OR7B 1T7XA 4R4NC 5DGQA 3TIDB 2FYYA 3QIBD 4R4BB 4F7TA 1QLFA 4KRMB 1R5WA 4RFEB 5EOCH 5CSZA 2PYED 1QPPA 5T1MA 4ZPVA 4GG6F 4G6ML 3Q5TA 3NH7L 4ONGL 3L3IA 1KB5L 3VFSB 4I77L 3X3FL 5JHLH 5DC0A 2DQTH 3GO1H 3Q1SL 5IOPB 3DV4B 5H35B 5I1GL 4JREB 3WN5A 3O6FD 1AHWC 1X6LA 3MV01 5BRZB 4JO1L 4PIRF 3VCLA 3W0WD 3UTTD 4X98A 2OTWB 3TN0B 2Q6WB 3ZLQC 2VQ1B 1XEDA 4OI9A 4C56A 4KHXH 5D7JA 1B3JA 4P2QD 4MNQA 3V5DA 1LO4L 2MKWA 5IB4B 1DQTA 1WIPA 1MRDL 1ZS8A 4P57B 3O8XC 3VFPB 4MQSB 5I17B 4GBXC 4HCRH 4AQOA 4OZHE 2DWDA 3KNBA 2A9MH 4MXVF 2JLLA 3CC5B 5I75B 5J1TC 3PHSA 4ZUVB 1VPOL 1TENA 4LVHB 1KG0A 5IMLA 4MDJB 2P44B 1NCBH 1GIGH 3OMZA 4NRZB 2X1QA 4RFNC 4ETQB 3F12B 1W8NA 3SDCC 1I9IL 1NANI 3MRIB 2ERJC 1IT9L 3GRWL 3X3GH 1E4JA 1FORL 3RVVC 4YHOL 4PJFF 1QRNE 5CJXA 4LCWA 3B4NA 4PGDB 1YEIH 1P6FA 5SV4A 3RVXC 3K0WA 5CS7A 3LDBC 1JN6A 5ESAB 1J1PH 5I1KH 1FYTB 2VDKH 3DUSB 2LABA 2OQJB 4K3EH 4KJWC 1J1XH 1Y6MR 4OFYD 4GG6E 1OP3K 4XNMA 2ENYA 3EOTH 3QDGE 4JKKA 3RWCB 4GW5A 5LQBL 1EJ6A 4XXCA 3QIUB 5DS8B 4FMKA 2AJXL 3IDNB 3L5WA 1FL3B 1TIUA 5FA3B 1BQSA 2Z93B 5IGXL 1JK8A 1GHFL 3OV6A 2XKNA 1GC1C 1Q94A 1CICC 3DX6B 2YPLE 4WEBH 5E5RB 1UZ6E 3P73B 4JHWL 3TA3B 5ID0B 4PG2A 3NFPB 2H2SC 3CH1A 2ZCKL 4AM0B 1G7LB 4HH8A 3MV7B 3TBYB 4Y4FB 4JKPH 1NJ9A 5F89B 3MV8D 4KI5F 1R5IB 3MRRB 4YEEA 1QFUH 3VRLF 5KSAC 1JNHA 1T66C 1YNKL 1RK0A 4K94H 3ULSA 1QBBA 4PRPE 4ELME 3A6OA 5FFLA 2BX5A 3STBA 2VXQH 1QFWM 1WFOA 4OB5H 1EFQA 3KS0J 3CAFA 5FYLD 4AEHL 2Z9TA 2BJML 1YQ2A 3W2DL 5IQ7H 4YR6A 3IAPA 1EUUA 2K9UA 4LSVL 4XMPH 2CDGA 3L3DB 4ONFH 2VITA 4LPUA 3FB8B 1Y6NR 2RAMA 1UYWH 2DQJH 1WLHA 2AEPL 3W11D 4LSTL 4MD5A 4R7NB 1T22B 1D9KD 3AROA 2PR4L 5KN5B 5FGBC 5BO1H 4BZ2H 1ONQB 3I50L 1KJ3H 4D0BA 1Q9KA 2O5XH 1W72A 2P24B 1FN4A 4APQD 3WIHA 5ICYB 2X9YA 3QDJE 3QJHB 5FM8A 4HKJA 1T2QH 3SKJH 3GK8L 2J8UF 3CPLA 4R0LB 4TUOA 3ROOA 4JANA 5L2KD 3PWUB 4HC1A 4FQCL 2I9TB 1N5AB 3LKNB 3U9PL 3QUXA 1OB1A 3UBXG 1FZOA 1LE5A 3KR3L 4JRYE 1NFIB 3PWLA 5IW1B 1EPFA 1AGFB 3ZE0E 3ZYOA 3QEQD 3U1SL 2GSGA 3GGWB 2FSEB 2JJVA 1RY7B 5D5ME 2F54B 4JKWA 3MO1A 3IDIA 2Q8BH 1JGLL 2R4SH 2RQ8A 2HKFH 5J0BA 3DMMB 4D9RD 3MJ7B 4JQIH 4QT5B 2AJYH 1WZLA 5B39B 4BA8A 2YZ1A 3MLYH 2X89A 3D85A 3FT2B 5GZOC 3ULVC 1CGXA 2VH5L 1XGUB 3K4ZA 3BZEA 2F5BL 3HZKB 4Q58C 5BZWA 3P0YH 1G7JB 1KCVH 5BVPH 2I9LB 4PGEA 3D0LB 4JFFD 5EBMA 5L8KB 4GRLC 2FEEL 4XCYB 3ULVL 1EO5A 5IVOA 2HVKA 3C5ZA 4D9QE 4PJIF 1AQDB 4EDWL 3GMRB 1QSED 2R1XB 1UM5H 4YGVA 1D5BA 1CYGA 1MFDH 4PJAA 1OAZH 4A2LA 4PJ5D 4U1HB 4KQ4L 1BFSA 1U6AL 2Z92A 3PDDA 2XYCA 4KRPC 5IIEB 3D3VE 2A0LD 1KEGL 4U2ZA 4ZFOL 4MAUL 3VXMB 1BGXL 3K8LA 4GW4A 1A8JH 2A2QT 3V5HB 1E6OH 2OJZL 2J8UE 1CK0H 1CL7I 1X7QB 3TC9A 4PV8A 1OPGH 3LQAC 3WO3B 2KZWA 3PQYA 4C57C 1AE6H 4NNYB 5I15L 3S9DB 2IPKB 5LG1A 1BVLA 2C1PB 3MR9A 1HWHB 3BGAA 1MHEB 5GRYA 5FUCC 1D6EB 1MFBH 3MOBH 2DL9A 1YC8A 2Q87A 2NNAA 3LQAL 1S7RA 3TGXA 2VERN 3Q5OA 4OAWA 1KCSL 5CZVL 3KYMA 5E99L 2C7UB 4BH7B 4PJXF 5IK3A 2ZUSA 2WQRA 4QXUL 5D1ZD 5B3JF 5JO5A 3S3PA 3BKCL 3BQUB 1U8QA 3GFUA 1FFQA 1AKJB 1FCCA 3HB3C 1FVEA 4PJCB 3B8SA 3HE6D 5CHNB 4MZ3A 3RL2B 3DRQB 5CKGA 4K7PH 1G0YR 3SY0B 3ALWA 5JORA 2V9QA 1N6UA 5FDWA 3T0BA 3U7AA 2X4SB 2FRGP 1NMCB 1PY4A 1SY6L 1D5MA 5L6YL 1CLOH 2DI7A 5C0RH 4UB0L 2CUHA 1KJMA 3ZYJA 4HS3B 1EXUB 4P9MH 1H3VA 4L9LC 1DUYB 4DOHB 2AJVL 5DFWH 3BWAA 5C0AA 1J05A 1L7TH 3CVIL 3NAAL 5DHVB 3RZCA 2Z8WC 2PXYB 2Y06L 1T7VA 3GB7A 4LIQH 4R3SB 5DSCA 1JCKA 1WBZA 2QHRL 3H9SD 1JUFB 5CSBA 5C0ND 1ZK9A 5IVXF 4MAYB 2NR6C 4AIOA 5ITBH 1OGAA 2XN9E 4Y1AA 3O3BB 3EJZD 1VADB 2OI9C 2LTQC 1NMBH 1M6OA 3X11B 4RZCB 2YUWA 4PJHA 1MCQA 3BESR 2GAZB 5KW9H 3WKMH 3DO3A 2DN7A 1FHGA 3B2VH 4GO6B 2ITCA 5D7LE 2YD2A 2X4RA 3GKWH 3DYPA 1CS6A 3HI5L 4OGXL 2PW1A 5ISZB 2EYRA 4PJXE 1DEEB 5E95B 4ZTPH 5JW3H 3IF1A 5T3XH 3C8DA 3QIBC 2D9CA 3V6FB 1ZA3A 1EEYA 3OJDA 5DEGB 3M8OL 3FB5B 2N7BA 4U1LB 4BK5A 2J5LB 1S7SA 1CXIA 1SEBB 2AGJH 3SQBA 3MMEA 1TMCB 4HXAL 5EWIL 1DBJH 4PLKD 4RIRB 3F7PC 3RY6A 5I1CH 3F7VB 2YN3A 4MX7B 4O9HH 4YQXL 3QQ4B 5GJTH 5L7XH 2X44D 3BXNB 4RGNC 3QJFB 3BGFC 3BPCB 5C09A 1RUPH 4NDMB 2VLJD 5JQHC 4P46A 5C0CB 1K85A 4DKDC 5E8NA 4NQTA 3KYNA 3U0WL 3VFTB 4Y2DA 7FABH 3P30L 2DKUA 4E9LA 5DMGD 4J23A 5DUML 2IQ9H 4JFOA 4LKXB 1FH5L 2X42A 2JELL 2HT3D 2DQGL 3HAEB 4HXBL 3SGJC 2HJLA 4A6YH 3VGGA 1UA6H 1NL0H 4X6FB 1OP5H 2CRZA 3H3KA 3NBNA 1HQ4A 2CKBL 4ONHA 5A16B 1GRWA 4LRIC 4UV4H 4DZ8A 1RVFL 5IVXE 2V5TA 1DUZB 4JY4B 4NKOB 1MJJB 4L3ED 1UB5A 5D7KD 3AB0C 2DMCA 1VGEL 4JB9L 4HZAA 2NY6C 3QG6A 2GY5A 3GJFK 5ESQB 4HIIA 2FJHB 1H15A 2XZAL 3S3JA 5C0DA 4W81A 1YEEH 3UO1L 3E3QE 3WBDA 5F7NC 2OTUB 4BZYA 3MRLA 1V7MH 3QHFH 3FQXB 1JNLH 4NRXB 2OK0L 1Q38A 2V17H 2NMSA 4EI5A 2W9DL 3BRDA 4QXTB 4K2UL 1L9MA 1UH2A 4GS7B 4R90L 1X5FA 4Y4HC 1N0LA 4EBQH 2AJUH 3PDOA 1KN4L 4FN0A 4JR9L 3NZ8B 3IAQA 1G9NL 3C08H 32C2A 1T3FA 1U8KA 5F9OH 3PUCA 3RAJH 4LAQL 5DJ2A 4TUJA 1KIRB 3UTPD 4NQVA 3W9EB 4I0KA 5E8OA 5CBAB 1MIEL 5E6ID 2X4OB 4F57H 3TNNB 3VXTB 2FO1A 4HK0B 3U7WH 3IKCB 5CP7A 2J6EA 5IBUG 2VLKE 2R2EB 4OZFG 1HQRA 4HS6A 1H8NA 2UWEE 5IMMB 2Z31D 3W9DA 4Y5YC 2P5WA 1G7HA 1B0WA 4I3SH 2CK0L 4M7JH 4HKXB 2AERT 1CGWA 1RJYB 2CLRB 2J8HA 2YOCA 5FF6A 3QUYD 3BDXA 4IRZH 1WSST 3IDYB 3DX7B 4Q2ZA 3LEYH 3O41B 1DQMH 3WMSA 1UACL 2MPAH 4OI7A 1HHGB 1F4XH 4NHUB 1W2KT 2GK2A 2E7LA 3FFCA 4PBXA 4HGMA 1IC1A 5KS9B 1H3GA 5IB1A 2X6MA 4W4NA 4HBCL 1MI5B 4XP6H 1T1ZA 3GSNL 5DJ8B 5B38B 1X4YA 3VWJB 2IQAB 4ZXBC 4LP5A 3GMQB 2GFBA 3W11C 1N7MH 1LNUB 3WLBB 1AD9A 4WCYH 3OB8A 1KFAH 4YHLH 4PV9B 3H7LA 5D96C 1D9KC 4QGTA 3UDWC 3N85H 4NKDB 4XPGL 4M6NL 5D93C 5CJQH 1QNZH 1GGBL 2LVEA 1B9ZA 5IR1A 2QQNL 4ZNCD 3BOVA 4WHYH 5SWSD 4IOFD 4U6HB 1RSFA 4APQC 5L2JB 4LVOC 4MMXC 3KHQA 1G9EA 1FL6A 1R3HB 4MJ6B 4HMEA 1B4JH 3IU4H 4PG9A 3HE7D 3KYOA 1U8HA 2CLVB 4FQJL 2HRLA 1EFXA 5DR5L 1U8LB 1QBLH 2BNQE 3U6RB 2Q20A 1H3PH 3SDXB 2D7TL 4FNLL 4LCCB 4TNWF 4ZS7L 2VSCA 2NCMA 1ZGLM 1JWUA 3SCMC 1KCRL 1CE6B 1FFOB 5DRXB 1DN0B 1AO7D 1I3UA 3FTGB 3ZKXC 3IETB 4ODXA 4F80A 1JBJA 1PGRB 1INQA 4MJ4A 4GXVL 2DTSA 4R26L 1A6AB 1GZPB 5IBTH 3DXAD 4S10A 4YFLF 3RVTD 3NA9L 5FO8B 2R0LL 4PJGB 2NY0D 3DVGB 1C5BL 3BPLC 5DHVH 3IU3A 5HGAA 5EUOB 5INCA 3FO1A 1GZQB 4MHHG 3PHOA 1U8PA 3MJ9H 1RIVH 4NUGH 3G6AB 5IW3A 3L3JA 3QFJA 4LNRA 1ETZB 1OOAA 1IQDB 1N0XH 4F7PB 1A1MB 4KZDH 4UINH 2XKSA 1U3ZA 1JYNA 1ES0A 2XY1A 3WDHA 1MFCH 5GGTH 3QXAB 5DMKB 2ESVD 4N0YH 2BZDA 1A7NH 4M43L 2VMFA 1FDLL 4R96B 2OL3B 4I0PB 4F7CB 3N1PC 4HEPG 4UQ3A 3IAGC 2C1OA 4O51B 5FUZH 1AFVH 2R23B 4G9FB 2A0LC 4P2OD 1QYGH 3PGFL 1MCRA 2DM4A 3MXWH 1FYTE 4JRXE 2BHUA 3WFBL 4G8IA 2ZSVA 4JJ5B 4TNVF 1R3IH 1SYSB 3HRZB 4IRSD 5FHBH 4UT7H 1UT9A 1A02N 2ADGB 5DHXB 2AXFB 4Y89A 3OG6B 2V2XB 2EDEA 2P5ED 5JHDA 1KPVA 3T65B 3O2VH 5DZLA 3VFOA 3DVFA 3MOAH 5FYKH 3D9AL 2V2TB 5T1KB 2JB6A 1WAAA 3OKDA 1KLGB 1OAQL 1MY7A 4DAGL 1G7QB 4U1GC 3VXPA 4KKBD 3U4EB 1UWGL 4NC1C 4ZS6D 3FO9A 1WT5C 1MEXL 3HNSL 4LRNL 4OFDA 5TPWH 4OQ1A 4CVXB 3DVNB 5D1ZC 5HVHB 4XNUH 5T3XE 2H1PH 4NQXA 1TTFA 4FXKB 2OJEB 3VGAB 1ADQA 1HSBA 2I24N 3OF6A 4LF3B 5HTSA 3Q5YA 2P46B 5HYJA 4PRHD 4M6OL 4N8CL 3JV4B 4JKMA 2SEBB 1B0RA 4DW2L 5AZ2H 4JZJC 5CMAA 1MNUH 3VFUA 2C4FT 2PN5A 3NN8B 1YECH 2NPLX 3I3EA 4MDIB 5CP3H 1J0YA 1EZVX 4XZUB 3SKMA 3R0MA 4LK4A 2F74A 5E94A 4NFCA 1TPXC 4P4KD 3WS6A 4XNXH 5T5FH 1PZ5B 1TNMA 2CPCA 1KB5B 1XR8A 4NCC2 1RUKL 4Z7QF 3QNXA 1CD8A 4YDKL 3Q6GH 4DVRL 2V6HA 3D0VB 1RU9L 2DQUH 1FVCB 4GQPH 4WU7B 4XBPA 3BP4B 1TETH 4YHIB 4JFED 5A3ID 5DT1L 3KPPB 5JW5A 3LKPA 3GKZA 1DP0A 2YMXH 3B5HA 3BP6B 2WIIA 5F1OB 1TJGH 2HA1A 2IWGA 5DQDL 5TGBB 5I66B 1PQZA 5TFSH 3GSUA 1DQDH 3AXLA 1AHWB 2JF1A 4P9HC 4P5MB 4B50A 1WBYA 1N2RB 3V6OA 3KPSD 4I48A 4FQHB 4YBQD 3L7FA 1HHIB 1Y18A 3MV8E 5D7SH 2ZCHH 4QTHA 5E8PA 1ORSA 5F7YC 4XHJD 4CVZA 1P7QA 4UUJA 4W6WB 4X5XB 3O8XB 5B8CA 4QHLA 5GZNC 2F58H 4QRPB 3PF2A 2XY2A 8FABA 4K7FB 3S4SA 1CBVL 5HDLA 2ITDA 5JQ6H 5SV3A 4TOYH 2F54E 4YFEA 1CXHA 1FO0A 3LKQB 4RA0C 4RFNB 4AH2A 4YXKL 4OLZL 1S9YB 2GUOA 3SDCB 5BMFL 5JOPE 3PWNA 2ERJB 3VDAA 2YD9A 2EYTB 3T1FB 5I16B 4PJCF 1J8HD 1J8KA 2X70A 3CXDL 5TE6H 2AV7A 4JDTL 5DJ6B 1L6XA 4Z7QE 1T7WA 4M1CD 2DIBA 2EDDA 3VW3H 1HHJB 1YJDL 3HG1E 4UI2A 1BQHG 4GAFB 3CFKB 4F8QA 4S1RL 4CMMA 5GGQL 4PJ8A 1HIMH 2FBJL 5A40E 2VR9A 3DYOA 3NTCL 4ODSL 1G9ML 1P2CB 3K2MC 4O2CB 1LE9A 3WIIL 1MJ7H 4PR5B 4N5ED 3BWUC 2ZJSH 4NO3B 3B9DA 4C83B 5CJBA 1KNOB 3BYTA 4QCIB 4HUUB 1UZ8B 3VXME 1U95B 3GBLA 1UB6A 2HLFC 5EU5B 4JFQA 1UQSB 4RAVB 4OD3L 5KTEH 5F70A 2XWBA 5GHWH 4JFXA 4XPHH 5JNYB 5J13B 4Y19D 5GS0L 2ICEA 4OFIA 3RUGA 4EUPA 3MLWH 5IHZB 4HULB 1SVCP 2FCBA 1NCUA 3MSPA 4C56D 4P3CH 1H3WM 3CX5K 2R0WH 5D7JD 1MUJB 5E1AA 3D39A 2XZCH 4MNQD 2GJ6A 5KSAB 3U2SB 4O2FA 1CD1A 3WUWG 4YHML 2VLRE 3BEVA 4PB0L 1MRCH 1V7NL 4V1DB 1IAII 1F11B 5DTFA 4JFFE 3CSBA 1EDQA 1AXTH 4JN2B 4YXLH 5GGRB 3FRUB 3D2UB 3G5ZB 3FO0H 4ZDHB 1NCCL 4ORZC 1FE8H 4PJ5E 2GQHA 4RQQA 3D25A 1M7IA 2KZ1B 5HGHA 5E70A 1HSAA 1J0ZA 1A6VL 1JPSH 4HJJH 3QUYC 5IBLD 4LCWD 4ZO9A 2EEAA 4U2YA 1VGKB 2OL3H 5DD6A 2E6PA 3ZTNH 4MA8H 3TYGL 1QSFE 3VD9A 4M61A 4M1GH 5I76A 5E2WH 3DO7A 4AEIH 4KAQH 4DOHE 1MCCA 1T21B 3MROA 2C5DC 2J88H 2WWMD 1T4KA 4DFIA 3QHZL 4MSWB 3KJ6H 4V2BA 1GGCH 4UU9A 3S96B 4U1IA 1WBXB 1PSKH 1BD2A 3JWOH 5DUBA 4H88H 4UOW0 3T0EB 2AJSH 4M1DL 3VG9C 2A9NH 3QO0A 5CIPA 3WE6B 1F45A 3QUML 3QRFM 4IM8A 5DJYA 3O6MH 4PTTA 5JXAH 1WWBX 2X4TB 5MP6L 1EGJL 3TZVD 4IOFC 5ISZE 2HTLD 3EO0B 5E7BA 1R6VA 4F37K 4WFGD 4U7MA 4LU5H 1IZKA 4CKVX 3CXHK 5EBWA 2CGRH 5E1HB 3JUZA 4K8RC 4EXKA 5IEHA 3MGTA 2GSIA 3QFDA 3VD4A 3ULUL 3HE7C 5I74C 5AD0A 2KDGA 5I1DA 2DLGA 1H5BC 1QBMH 1GVIA 3VI3F 3VWKB 3KPLA 4PPTA 3LVEA 4HGWA 1HCFX 1UC6A 5TDNA 1XGYL 2YRPA 4GRLB 1I7RA 1KB9J 4JG1L 4K8RL 3O0RH 4JQVA 3PL6C 3FO2B 4ZFOB 2NX5B 5GSRB 1HINL 3CDGB 2D7MA 4HZLA 4KKLD 2WBJA 3RVTC 2ZOKA 3NH7H 4ONGH 1KB5H 2NY0C 5DQJB 1T1YA 4G8EA 4I77H 3X3FH 1BVZA 5JMRA 4HS8L 1E28A 5I1GH 5IEKA 1P53A 4YZFF 3I6LD 1M7DA 1YMMD 2FZ3B 4U1SA 3CZFB 2JTDA 1NGZB 1C7TA 4X6CB 4JO1H 4BQ9A 5FUOH 2CR6A 4KDTA 2P8MB 1Z9MA 3MFFA 3OXRA 4H25A 5HHPA 1I9JL 1EEUA 1CXLA 2QSQA 1JWSB 1MRDH 2YK1L 4N8VG 4MJIB 1U8MB 3WJJA 1F97A 4Z7UE 1VFBA 4X6DF 5KS9F 3QUXD 3ARTA 4FQXA 3BI9X 2EXWD 1ZVSB 1A7QL 2GHWB 3MRBB 3G9VA 5J1AB 5HGDA 4Z7NE 4P2OC 1KSRA 4U4BA 4WI5A 2C9AA 4ZAKB 1VPOH 2Q7YA 4OZIB 5D9SA 3FAWA 5GSVA 4IRSC 4PRNB 3DROA 4G6KL 1FP5A 3EJJX 1I9IH 3BPOC 3FQNA 4L3CA 3GRWH 3K8KA 3VI3E 3VRIA 3TJHD 2B5IC 4L4JA 3INUL 3G04B 3MRCA 5CZXD 2OYPA 1UJ3C 4K3JL 4LPWA 1LD9B 2FIKB 3BIKB 1NQBA 2X89D 3D85D 4TVPD 5LXGH 2VDOL 3ARUA 3ZZ1A 5GRXG 3G6DL 3EYOA 4KKBC 2PW2A 3C9NA 2VR4A 4L9LB 2NTSP 5J6GA 1JGDA 3WFCH 5T5NF 3FQTB 4PRBA 4Z9KB 3VXRA 3C5ZD 2AJXH 1RIHH 3B9AA 1T0NB 5KVMC 1NC2D 1NGWA 1SM3L 1FNAA 3LPFA 3SDXF 4XP1L 5IGXH 1TCMA 5ITFA 3B9VA 3MYJB 2Z91B 4YDVB 1CFQB 1RZIA 1PYWB 1JWMB 2AK4D 2YWZA 2GEEA 5GRWA 1HEZA 1YYLH 3ZDYF 1FFNA 4RGOL 5C0BA 3C5JB 4HUMB 2OI9B 4Q0XL 5BJTA 1MCNA 1TZGL 1PFCA 2LTQB 4HGKC 4PJGF 3E6HA 2ZCKH 2GK0B 3ECBA 3I3BA 3QZWA 5EUOF 1BBJB 4P2RA 4LSPL 4EQ2A 4P4KC 5F7KC 1GC1H 3AS2A 3OKLB 1ZHLA 1JF5A 1YN7B 2WINA 4W4OC 2F8XC 3HMXL 4UTBL 4FZ8L 1C5CL 4GJTB 1LDPL 1YNKH 3RWFA 4LDEB 1B0GA 3QIBB 1TTUA 4NQCB 3FOLB 1XGPA 3N1GC 4N9GA 2O26U 1AP2A 1IFHL 2UUDH 5A3IC 2YSSB 2BXZA 4AEHH 4XC3L 2BJMH 3UJTL 3W2DH 5LAXA 4RGNB 4LSVH 3WNNA 3BGFB 4XRCB 1ZT1B 4ZUSA 1KN2L 3I6GB 4HHAB 3VRJB 2FH6A 2O61B 3W0WB 3UTTB 3VGHA 3BAEL 1DJSA 5J8OA 4YBQC 1QZ1A 1ND0A 4LSTH 1I4FA 3MRGA 4ZUUB 1F02I 3L3KB 1VENA 2P8LB 4MJ2A 3DBXA 3HUJB 2HLAB 5GRUL 1VEPA 2XNAA 3RRQA 5EU3B 2IG2L 3I50H 4MQXD 5AUMA 1JE6A 3QG7L 1I8LA 5F7WC 5D1QA 5DRNB 1A0QL 1IKFL 1XGTB 4OCNC 3B83A 4WV1B 3SE3C 5K9QI 3GBML 2HJKB 4GKZB 5F1NA 5IHLB 1JJUA 3GK8H 4NIKB 5GGUA 4FQCH 3AB0B 4OD2B 4IIQC 2R56L 2NY6B 4OCXL 5DD0H 3CFEB 1J11A 1OCWH 1EJOH 2CLZB 3RHWK 2R9HD 1MWAA 2JIXD 3KR3H 4BUGA 2A6IB 2X9XA 3B9KD 3JVGC 3S36L 4G6JL 1K2DA 1OGAD 3U1SH 4Y1AD 2HRPL 3ARFB 5MENA 1RMFL 4Z6AT 3P4MA 1P69B 4G7VL 4M1CC 2QKIB 1BJ8A 5E8DL 4P23A 1JGLH 2ADIA 2OR9H 5DMIH 4P3WA 3EFFB 4Y4HB 1M05A 4NPYA 1NCDL 5DYOB 2DQEL 1BZ9A 1ZA6A 3ZKSD 2EIZB 3ARZA 3SGKA 1H3TA 3RI5K 4X6BB 1W0VA 1I1FA 4Y8DC 3KLHD 3SE9L 5E4IA 2FH8A 4G9FE 4Y16A 2DM3A 1EA9C 1MCJA 1ZT7B 3HPJB 4ZYKA 3ULVH 2Q86B 3NGBC 3R8QA 3E2HC 5DJXA 2H8PB 1ZHNA 1JP5A 1DLHB 1R24A 3WN5C 5C09D 3OG4B 1JZ2A 3TH4T 2MCPL 4P46D 3LRGA 4AMKL 4OV5A 1U6AH 1ORQB 3PGDA 3MRJA 1MCOL 4KMQA 2FJFB 5D7JC 4Y2DD 4NN7C 1KEGH 4OTXH 3O11B 3MNVB 4HEME 5DJZB 3MV9B 3V4VL 1YMHA 2OJZH 4U1JB 5IMOA 4KV5F 2EKSA 4GRMA 5HHNB 1OL0A 1BX2B 4JAMB 3GSNB 2V2WA 4CGTA 2G2RA 5I15H 3BRFA 1G7IA 2IAND 1NFDA 1FV1A 1A14L 1CGTA 4HFUL 4ODHH 1SMAA 4OZHA 4QRTA 1ZLSH 1PEZA 4BSVB 4YPGA 2UV3A 3LQAH 2L7UA 1PLGL 1IGYA 4RBPK 4OLWL 2G75A 1KCSH 2K7QA 3SN6N 5CZVH 3E6FB 4ZXBB 5E99H 5HI4D 2GJZA 2DLHA 5JA9A 4QXUH 3R06A 5CJXC 4H0HB 2R1YA 1KTKE 5C6PB 1D9KB 2UY6A 3KYAA 3OXSB 4FFYL 1QRNA 3IGAB 5D93B 3CFDA 4QHNA 4EI5D 1XAUA 5SWQB 2BVOB 5FKPA 3P9LA 4HJGB 5D7IE 1Q9WA 1VDGA 3IDMB 2J4WL 3MREB 4X4XB 4NNPH 2WWMC 4LVOB 1N64H 3UX9B 2HFGH 5EO0A 4XXCC 3KPQB 4GG6A 5MI0C 5L2KB 1SY6H 2OZ4A 2VAAB 2Y7QA 1WZMA 5GGSY 1CIUA 3QDGA 4PP2A 1FG2B 1RULL 3VJ6B 4WFEE 1GJIA 4IS6A 2MFNA 4UB0H 5I1HL 4B41A 3K3QA 5HJ3A 3PV6A 4HWNA 1KTDB 1OARL 1BEYL 1I8IB 4JGMA 2G5RA 4ZFZA 2AJVH 1GGIL 1F4AA 1U2HA 3BKJL 3CVIH 2LAGB 3NAAH 3IJYA 4L4TE 3SCMB 4OQTL 1X9QA 5KSVB 2BVPB 1WFTA 4PG2C 4YHNB 4DZBB 1X5JA 4KV5E 4KKNA 3ZKXB 3BGMB 2P5WD 2YPLA 4GT7A 1ACYL 1Y0LB 4LSUL 2HTLC 3C2AH 4JO4L 1RPQA 4YO0A 1Q9OB 3UPRA 1RUAL 3BPLB 4NWUH 1W0WB 1KOAA 5C0EA 4L8BA 1A5FH 2APFA 4QRPE 3L3OA 1EEZB 1MAML 3C60B 5C6TL 5FYJL 4LLVB 5E2VL 4OV6F 2OR7A 3PWJB 3MLXL 3UC0L 3QIWA 3FFCD 4ELMA 3CFIC 3HI5H 4OGXH 2MNUA 3WFZA 5IF0B 3PABA 3NIFF 4I5BA 1U41A 1S5HB 4N0UE 4ZD3H 1T5XB 4M62L 4N68A 4DEPC 1BF8A 5C9JB 3M8OH 5FKAA 5ESVB 4KKLC 1NGXA 5JLZA 3NCEB 4G8GE 3I02B 3CMGA 4JFEE 4HXAH 3HLAB 3MGOB 1FIGL 4WI3A 4DK6A 2JJSA 3FONB 1G6RL 1BMGA 4B7IA 4IRJB 2NLJB 1A3LL 3IS1X 5C0IB 1QFWL 2H3NA 3VI4F 3EYFA 1BZ7A 1MPAH 4FA8A 3U0WH 1RZJC 4PLNC 1OT2A 3JBG7 3QDJA 2JELH 2R1WB 4PY7B 2DQGH 4GG8A 5ICZA 3H9HA 4U1GB 2ZG2A 4O2EB 1W72L 3QUXC 4R7DA 4JVWA 5F88A 1EFXD 2EXWC 5C0JB 2E7BA 5GJSL 1AGEA 4RISL 1JZ4A 1T83A 2Y5EA 3PGCB 5D1ZB 1KCLA 5CWSB 4CDGC 3WL9A 3LD8C 4HC1L 4GAGL 1A7PL 1QFOA 4JRYA 2BSRA 4JB9H 1NKRA 2E6QA 1IQWL 3LRSA 3CSGA 1QQDB 1RHFA 4U3HA 4RNRA 5D5MA 3TJHC 3UO1H 1PEWA 3R8BB 2ARJQ 3I85A 3KS0H 4JZJB 5JIHA 5FXCH 4N90D 2PETA 2KKQA 3QWOB 4FHBD 2YA1A 3NIFE 2HG5A 4V1DE 4HDIA 3MRHA 4PY8J 2FX8L 4MGXA 2W9DH 3QXWA 1HI6A 2WP3O 4K2UH 1NCTA 1F4YL 1ZXQA 4M6ML 3RTQA 3RX8A 3V95A 4BZ1L 1CQYA 3MUZ1 3S35L 3BZ4B 3ULVF 3OKMB 1KN4H 3GMLB 4U3CA 5DF0A 2FX7L 4EN3A 4TVPL 4PGBA 1PG7X 3C5ZC 3GJFH 3DTXA 4LAQH 2FHCA 3RJQB 1IGJA 5IVZA 1J7VR 2APXA 4LVNC 4O02H 1X5ZA 2A77H 3TT3L 4L5FL 2FBOJ 2FDBP 4JQXA 1CXFA 1ZKAA 2H26B 3VI4E 3H9SB 2VISA 3RNKB 3P4NB 3EGSA 4OKVA 4X0KA 5HPMA 4B0MM 5EU4A 3I9GH 1FNGB 2EE6A 1KENL 5JPMA 1NUDA 4U0RC 3D3VA 4Y19E 4LASL 5FO9A 4KVNL 4B53A 2CK0H 3TVMB 1MCBA 2J8UA 4H26B 4XGZA 3LS5H 5J7CC 5JHDD 4ZSOB 1LEGA 2XWJA 3T0EE 2WUBL 4X6CF 1FNEA 1G7PA 2GJJA 4QWWC 1SJEB 2VDLL 4Z7WB 3HZYB 3GSWA 4JLRA 3WO4C 3S37X 3TH3T 3UYRL 4LFHD 2AXGA 3OGCA 2NW3A 1AR1D 2ZUTA 1S5IL 4N1HB 4HBCH 4ODWA 2VLME 2VLJB 3GSNH 3IJHA 3OF6D 4ELKB 4WDIB 5HYJD 3OQ3B 3OKKA 4LHUA 1IGFH 1NEZA 5FYLH 1ZT4B 4OZIF 3WUWB 5KVEL 4Q6IA 3PP3H 5KSBE 5JXEA 3ULVE 4XPGH 5C2BL 4M6NH 1GGBH 1EAPB 4MQXC 1RK1B 2CDFA 2QQNH 3RPKA 5DO2D 2X4NA 3RKDD 25C8L 5C86A 2FJGA 3BH9B 1X5IA 4OF5A 5DRZA 4JFPB 3SPVA 4WTXA 3MRKB 2P4AB 4GRWE 2NX5E 2PTUA 3PHQA 4UAOC 4ERSH 4L3EB 3RZCC 3LQMA 3RWIB 4FQLL 3VH8A 4NZJA 5M95B 4I4WA 2YA0A 1QFPA 3NCFB 3Q0HA 1NUGA 2R69L 3MA7A 3VXOA 3QNYB 2R9HC 5I30L 4NZRL 4QNPF 2QQQA 3CK0L 3TCLB 1T89A 4KUCD 4HCRA 1XF3A 2DBJA 2D7TH 4FNLH 1SJHA 4OSUL 3NABL 4ZS7H 1HK6A 4NZUL 1KCRH 1IBGH 5EIVA 5HHMD 4FTVE 5TDOB 4X6CE 5FHAL 4GAJL 2A73A 2XN9A 4NWTH 4GXVH 4JGJA 4R26H 4N0FA 1FFPB 3NA9H 1MH5B 1BWWA 2O5YH 2R0LH 4RFOL 5E2TL 1HH9B 4G5ZH 1DANU 1LILA 2PO6A 3P4OA 1P7QD 5D7LA 3KLHC 2P7TB 4PJXA 3V7AG 3ZYZA 3SHSA 4RWYL 3RY5A 1Q9LA 3L5HA 4S1SH 4KDVA 5KG9A 3LIZL 5ACLA 2R2BA 1TVHA 1N4XL 3RY6C 1F6AA 3BX7C 5MEPA 3L3HA 1TJHL 3U36B 3KWWB 1AGBA 1FDLH 1T20B 4RCAA 1UWXK 2VOTA 3P77A 4P46C 4CN6A 2ADJB 1I9RL 2V7NB 2AI0H 2UZXB 1J86A 2XTLA 4JPKL 3ZKMD 1XCQB 4Y2DC 1ACZA 3OKEA 4H5SA 4K7PY 3WFBH 1WJ3A 1YMME 5J89A 2YEZB 3FB6B 1YEKL 2I07B 1UXSA 3IKKA 2BOCA 2VWEE 2DM2A 3MRMB 4WW2C 2G5BB 4IMLA 3HUJF 4KMTL 1NCWL 3CDCA 2OR8A 1FVDB 4LVEA 4PJ8D 3V8OA 3D9AH 5T3ZD 4JY6A 2X05A 3QUMB 4OF8A 5ANME 5MEOB 2PF6A 4DAGH 1ED3A 1AIFB 2BSTA 1JPST 1TZHB 1UWGH 3WJLA 1NLDH 5HI4C 1MEXH 1C08B 1F58L 4ISVA 4U1KB 5I1EL 2BNUA 5K33A 5ALCL 4LEOB 4EI5C 3RDTD 4XCNA 4M6OH 4N8CH 3VFWA 1F00I 2P49B 4OBSA 1S9VB 2DDQL 3FOMA 2ZNWA 4DW2H 1I7UB 4HUWA 1FPTH 1QD0A 3O3DA 4NQCE 3D39D 1JTPA 1AXIB 2JJUA 3S97C 5MHSE 1A4KB 1DBAL 5I74B 3L95B 4JVPA 3T2QA 3AAZB 5KJRH 1G6VK 4F7EA 3LQZA 4JFDE 4QF1B 2RFXA 3JTSA 3EKCA 3HPLB 3ZKQD 3QUKA 3PL6B 1RUKH 4C55A 5LBSH 1QKZH 5JHLL 1HOCA 2DQTL 2XTJD 4YDKH 4Z7VB 3DX8B 2VLKA 4DVRH 1U8OA 1RU9H 2UWEA 4M4PA 3DXAB 2AK4E 2NY0B 5DT1H 1V5JA 1LP9E 1CGVA 4WHCA 5EPMB 1UCTA 3PIQA 1PJ9A 3T3PE 3EYUL 3BVNA 3CLFL 1O5DT 3RY4A 5I0ZA 1HXMA 3TO2A 3GMMA 1CG9A 4NO2B 3K7UA 3BIBX 4NUJB 1FNFA 3OKOB 4XPBH 3SGEH 3VXSE 2E7LC 1OWRM 4J12A 3SKOA 1FNHA 3AREA 2FX9L 1BZQK 1TJIL 4HUXB 1YZZA 5ACMA 2W91A 1UWEL 3K80A 3CU1A 5F7MC 1BD2D 3BH8A 4P9HH 2NW2B 4NQEB 4XB8A 5ECJE 3HI1A 4XTRD 5JR1H 5A1AA 4Z5RA 1BOYA 1GIGL 4PRDA 1BAFL 1CBVH 1RZKC 5AAMA 1PW3A 5CGTA 2NZ9D 3LCYA 2Z4QB 3BD3A 3SE4A 1G7MA 5C92A 1EHLH 4QRQA 3M17A 1YEIL 2VABA 5EZJA 4YXKH 4OLZH 4PS4H 3FQUB 3BPOB 4XAKE 5I1KL 1ERNA 5TH2A 4YAQA 4PBVC 4Q9CA 1BVKA 1J1XL 4X9IA 2WWKO 3CXDH 4J8RB 3EOTL 1KGCD 2YD1A 4R4BA 1SYVB 3FAXA 5DJCB 1IZJA 2LQRA 1RJLA 1MFEH 3M1BB 5D2LB 3T1WA 1WQVT 5EC2B 3REVB 4S1RH 1UM6H 5GGQH 3VFSA 4FXGB 5HHXL 4MA1C 2N4IA 4NC2B 3NTCH 1HKLL 2BNQA 5DFVD 5H35A 5I18L 1CI5A 5F3BA 4NRYB 4PRHB 1NMAL 4X99B 2WBJD 1ODAA 4HWBA 2MKLC 2JJTA 3VFVB 2ZKHH 1LO2L 1MQKL 2OTWA 3TN0A 2Q6WA 4D8PB 5C8JB 2VQ1A 1CVRA 3MV9E 2HVJB 5FV2A 5F6IB 1KIQB 1WCBB 1XFPA 4OD3H 5TF1L 2AEIT 4OCSL 2W59A 3HCVB 1QFUL 4P57A 2YPVL 3VFPA 4LGSB 5JOFB 4K94L 3O9WA 4MMZC 2PUQT 5HBBA 1FJ1B 2VXQL 3C5SB 4WTZG 3GBNL 3CC5A 1ZSDB 4PJBE 4XP4L 4ZUVA 5BOZG 2HFFA 4YHMH 4F2MB 2X4UB 5H2BA 1V7NH 4MDJA 4FZEH 3KPRE 1EX0A 3BT2L 5FGCB 4P48A 4JZNB 1TCRB 5HY9A 4P3DB 3IRZA 2NY4C 2BC4A 3GDBA 1EUTA 5C0FB 1F2QA 1E4XI 1H0DB 3BP7B 1HH6B 1IGCL 4PGDA 3G08B 1WISA 3MYZA 3O2WL 3MLUL 3IS0X 4PREB 2GTWB 3NCCB 4JRXA 4MD0B 4IHOB 1FYTA 3DUSA 3S5LB 5HGBA 3O6FA 2AP2A 2B2XL 3KPSB 1KJ3L 3OB0K 3BN9D 3DRTA 2Z8SA 2O5XL 3B6SA 3RWCA 4ZUTA 4XVJL 4AIXA 3OAYK 3CDYA 3TYGH 1T2QL 4YBLB 4O5LL 2NXYB 1FL3A 5FA3A 5JPNB 1JMXA 4MCZB 4IMKC 4XXDB 2IANE 4JHAL 2E7MA 3JZ7A 3H3PH 3VFRB 1AR1C 3LEXB 4HH9B 1EHAA 4J3SA 4KJPD 3LOWA 3NIDE 2ZUVA 4IIQB 3TA3A 3THML 1U91A 2BNRD 4M1DH 5B4MD 1I3RB 3SKNB 1KXTB 3NCYP 3ZT5A 4JN1L 2MJWA 5CUSL 4X6EB 3QUMH 4Y4FA 1ADQL 1E0OB 1FLRL 2F5AL 3FT3A 4N1CA 4WNQB 1G1YA 5C0BD 4PRAA 1JYWA 4U49A 3OR6B 2A6DA 5HDBF 5MP6H 2J12B 1EGJH 5E9DB 3ARPA 4P2RD 5EN2B 1DZBA 3RKDC 1MCKA 5ACZB 3WS6C 5DA0B 2NYYD 4G7YH 3P0YL 1KCVL 4UDUB 1WK0A 4E41B 1K4CB 3ROLA 5FECA 3MLPA 2AS5M 3MC0A 4EKXA 1QLFB 1R5WB 1D6VH 2W07A 4XNZB 3L3DA 1JL8A 1X4XA 4ZPVB 3R4DA 1MFDL 1MVFA 2ADFH 2YUZA 1XGYH 1UJTA 4JG1H 4GAYB 4K8RH 3OJ2C 3P3YA 4XT1C 3NGBB 3IT8D 2R4RL 3WHE1 5D70L 2ZP0T 3BYYA 3WN5B 1HINH 1E6OL 3A0OA 3GMNA 2IH1A 3P9WB 3VCLB 3JV6A 4X98B 3V6OC 4X9BA 2H9GA 1AGDA 4HS8H 4OCLC 2AJ3B 1AE6L 4MNQB 3V5DB 2DLTA 3TO4A 1ZS8B 3MV8A 4GMSL 3PWUA 2RBLA 4QRRE 3DPBA 5B8CC 4WUUB 2ICCA 4J3XA 1N5AA 1XH3A 5D1QD 1ZANL 2DWDB 3KNBB 1OD9A 5DVOA 5D1XB 1K6QL 4P2CG 3MXVH 1I9JH 1NFIA 4Z7WF 5IW1A 5FM5O 4UDTB 2YK1H 1LGVA 2FSEA 1KG0B 5IMLB 3ALPA 2X5PA 2EDQA 5MERA 3S7GA 5DD5L 1JI1A 2P8PB 1A7QH 1A47A 3ZKMC 4K7PL 3DMMA 4LCWB 3U4BL 1FO0L 3T8XB 1JN6B 3FT2A 4G6KH 5E6ZA 3MACL 3J8F7 3D1MC 3HZKA 4P23D 3VD3A 2HH0H 4X7CC 1CLOL 5C0RL 3D0LA 4MQTB 4XNMB 3INUH 3HG1A 4P9ML 4PJ8C 4CVUA 2HFTA 4ALAL 3L5XL 1FGNL 2WUCH 1AQDA 3L5WB 2VDOH 2ZCLL 3G6DH 1YEFL 1JK8B 1NAMA 4ZOEA 4Y16D 4LIQL 4ZQKB 2RCSL 5T3ZL 1U92A 5IIEA 4PRIB 3ARGA 3QPXL 2CQVA 3VXMA 3AS0A 3V5HA 1B4RA 4LBEA 3KVQA 5E00B 3CH1B 2XOTA 4XP1H 1IC5H 3OAZK 1A1OA 4ZSOE 3LN4A 4A2MA 5KW9L 4HWUA 5GISL 4MLSA 1NJ9B 5CEZL 1ZGLP 2W92A 4RGOH 3UZQA 1MHEA 4Q0XH 1TZGH 1D6EA 1RK0B 3ULSB 4F9LA 5JW3L 4LSPH 3VFNB 2VLRA 5IKCA 5EO1B 2C7UA 2DQCL 4BH7A 3HMXH 4UTBH 4JFFA 4LCIL 1BJ1H 1LDPH 4YR6B 5FOJA 2XTJC 3RA7H 4DEPB 1G6RB 2CDGB 1AKJA 1E6JL 1IFHH 1CL7H 5IG7B 1DR9A 2VITB 3WS3A 4PJ5A 5JUEH 3DX9A 3HNVH 3NFNA 4G43A 1LO3H 4BFIB 4MD5B 4XC3H 1YDPA 3B43A 4BFBD 3QQ9D 2GT9A 1AY1H 1KN2H 1QRND 3U7YH 4AIZA 2IQ9L 4ODUA 4D0BB 4YHPB 3OX8A 1QSFA 1Q9KB 1YY8B 2NTFA 1W72B 4DN4L 4A6YL 1FN4B 1T6WA 2PTTB 5GRVL 1NL0L 2AQ3A 5LGKA 3IXAA 1HWGB 3O3AA 3N06B 3CPLB 2DD8L 3F7QA 3ROOB 4JANB 4QHUB 5GRUH 4XC1H 2DQHH 2PXYA 4I2XE 4XTRC 3C8HA 3QEGL 5IUSA 1A0QH 1OB1B 4NO5A 2X4QB 4M9PA 4K3GA 2X41A 2BERA 3GBMH 1JUFA 3PWLB 4GH7B 4MAYA 1YEEL 3LD8B 3ZMRA 2GSGB 3D5OF 3O3BA 1VADA 2R56H 3X11A 3QHFL 2YPLD 2WBKA 1CDCA 2D4DA 3HE6A 4RMUA 4G6JH 3J7HA 5ISZA 2HFEA 2HRPH 4EBQL 1RMFH 2AJUL 4J3TA 3A67L 3BMWA 4M7KL 4S11A 4MWFB 1CDUA 3C08L 5DEGA 2DICA 1O7VA 3MRPB 5E8DH 4M02A 3ARRA 1OAYL 4NN5C 4U1LA 3KPTA 5BZWB 3RAJL 3WIFA 4X80L 4HSQA 4PGEB 3X13A 4PRPD 3QIWD 5EBMB 2CO6B 1RZFL 4JO3L 2I27N 4Y7MA 4RAUA 4JQVC 2H32A 4F57L 5E2JA 2DWEA 5DFVC 2HVKB 3C5ZB 4JRWA 4L29B 1ULVA 4LLMA 2EC8A 1D5BB 4LVNB 4PJAB 2OM5A 4NDMA 2XPGA 2WBJC 4JDZB 3L3GB 1T7YA 2Z92B 5IM7B 4XB7A 1ZLVK 4Z7VF 3VFTA 5BV7C 1F4HA 1YEJL 5HHME 1U3HD 2FWOB 4HIJB 4U0RB 1RAMA 3MOQA 3ILQD 3TIEA 3HAEA 3PQYB 4QO1A 3BW9A 1MCOH 2K7PA 4KDTC 4X6FA 5EZLB 2MPAL 5BV7L 3PWPB 5A16A 3O6LL 2A74A 1JMZA 3V4VH 5GS2D 4JY4A 5DVKA 1MJJA 4LOUD 3UTSE 3QDJD 3WJJC 1B90A 2NNAB 3GNMH 3ZSSA 1S7RB 3L6FA 4FQXC 5B39G 2VUYA 4MJ5A 4Z7UA 3PXHA 3MUGA 1A14H 4HFUH 1WUNT 2OTUA 5JO5B 3U9UB 4RMVA 2Q76A 2HP4A 5EO9A 3HKFA 4JRYD 3UYOD 4WCYL 3ULUE 4S0TD 1CR9L 1KFAL 4XNQA 4NO0A 1D5ZA 5D6CB 4YHLL 2H2PD 1PLGH 3P9MB 3BHBA 4JE4B 1EO8L 2XQYK 3MUHL 3EDJA 5FDWB 3BN9C 2ZOLA 3LN5A 3MODH 2J8OA 1INEL 3DIFA 4FFYH 3ZHKA 4YFDB 1J10A 4R9HA 1MHHB 3W9EA 3IU4L 4YFLI 3RTQD 2P43B 1D5IH 2J4WH 4PJ7F 4WI7A 3UYPA 4EVNA 2X4OA 5C0AB 3BWAB 1N3NA 3TNNA 4NQSA 2OSLA 4KTEL 4UAOB 3AS3A 1OHQA 4Z7VE 2W0PA 5D2LF 2X4PB 3RZCB 4PLJD 1H3PL 4HWEL 4KJPC 4EZMA 1RULH 4POZD 2X1WL 3GB7B 1CFBA 5DSCB 5B4MC 5FEBA 1WBZB 1OARH 1BEYH 1KIPA 1RJYA 2CLRA 5IMKA 1GGIH 1T6VN 3LSOA 3BKJH 5EC1B 1OGAB 3MUJA 4Y1AB 4OQTH 3W81A 3D3VD 5LGJA 1OGTA 1M6OB 4WHYG 2OXHA 4NUGL 2QADC 1ACYH 2W60B 3RPIA 2ARJB 4LSUH 4NN6C 4JO4H 1HHGA 2NYYC 2ITCB 4M8QA 2X4RB 1JHLH 2PW1B 4YXHL 2EYRB 4LDLB 4LLUB 4NQEE 4KZDL 3IF1B 4JO2L 5JDSB 5EZOL 3OJDB 1EEYB 1WWAX 3OTTA 3RFZC 5BZDA 5C6TH 1G0DA 1GOFA 1J0IA 1S7SB 5E2VH 4LLQA 3MLXH 5DJ8A 3MMEB 3LN9A 2C4XA 3GMQA 4P5KA 1LNUA 5BXFA 2UVEA 1AXSB 4QHKI 5E6IA 5H37G 1RV6X 4PV9A 5C09B 1K3IA 4DK3A 1QYGL 1S7UA 1NDMA 2W9EL 4RRPA 1JIBA 2Z31A 4CN4A 5IWLA 2F8OA 4KXZH 3KYNB 4U6HA 1YNLH 4XNYH 4QYOA 5BW7A 3L9RA 2YXFA 5DJDA 5L2JA 2GYSA 2HJFA 4N0CD 1G6RH 5JXED 3KPOA 2EC9T 4GKOA 1A7OL 4L3AA 3STZA 4YH6A 1A3LH 1DQQB 3AM8A 4MJ6A 3EO1A 5FYKL 3BDYL 3KXFE 5FOBB 2DL2A 2HJLB 1I8LC 2VXSH 5D1QC 5DJ0B 2YHGA 1A6UH 4FP8H 1CLYL 3ABZA 4WW2B 1HQ4B 3F6IA 1TQBB 2X1PA 4ONHB 3U6RA 1IC4L 1MCWW 4DZ8B 2ZSWA 5L8LB 1UB5B 3EYVA 5JW4M 1BLNA 5DRXA 2H1PL 1DN0A 4HKBB 3FTGA 3QG6B 3IETA 1W72H 4HIIB 5DURD 3FZUD 3WIHH 1RZJH 5DK0A 3QI9B 1KPRB 4RISH 5GJSH 5C0DB 2Y9RT 4XWOD 2APWA 5E2UL 3DVGA 5JOEA 3W5MA 1T1XA 3A6CL 3K46A 43CAA 4IDJL 3MRLB 4HC1H 3I3DA 4GAGH 5GGSB 1GZQA 5HXMA 3UXFA 1HZHH 1PX3A 2XN9D 1IQWH 2YBRA 2APVA 4P23C 4HK3N 1ETZA 3O4OC 1IQDA 4F7PA 1A1MA 4L8DA 3S3SA 1PX4A 5ETUA 2JK5A 2ZZUT 3MZGB 5K9JH 4X7SH 1YNTB 3VGFA 3SGKC 32C2B 2PO6D 4YUEL 5D7LD 4EDXA 5FGCE 3U79A 5DJ2B 2FX8H 4R96A 4NQVB 1OP9A 4ZPTA 2IBZY 4BZ1H 3S35H 4O51A 4G9FA 4KK5D 4TVPH 5CP7B 5LKNA 3I6KA 1UCBL 2DF3A 4HS6B 2DQFB 1SQ2N 2VQTA 5LJYH 1JRHI 3HR5B 1LK2B 4JJ5A 2P5WB 3SOBL 3QXDA 2AV1B 1SYSA 2KBGA 4KDWA 4D94A 5EU6B 5F7DA 3UMTA 2V5RA 5IV2A 1RI8A 2AXFA 1X4ZA 5FF6B 3ARQA 3T65A 3DGGB 4Q2ZB 5I1LB 4BK4A 1HN1A 3X12B 3IFPA 2BSED 2B1AH 3FFCB 3KHOA 4D0CB 3ARBD 3DWTA 4UIMB 1XIWA 4PJDB 3G5VB 4DKAA 3DVNA 2WUBH 3O4LB 2ZG3A 1T1ZB 2VDLH 4GMTL 4LF3A 5KVDL 3PNWA 4IOIA 1QEWA 2M1KA 4KHTL 2GFBB 1Z0NA 3UYRH 1AD9B 4M8VA 5TE7H 1S5IH 5MEQB 3AU1A 4NYLA 3DV6B 2FEDC 1D3CA 3RX7A 4KI1A 3VXUB 5IR1B 5GPRA 4OLXL 2DTML 3G5YA 3QEHB 1FAKT 3T2OA 3UROR 2Z8VC 4E41E 1YY9D 3VA2C 5KVEH 1RJCA 3FHAA 3TH2T 2P5EA 2BRRL 1A6PA 5D7IA 1KB5A 1FL6B 5DWUL 5EZIH 5F9JA 5C2BH 3EYQD 4DUWA 4PG9B 2VE6A 1U8HB 1HCVA 3EJYD 5SWZB 4M7ZC 2BVQA 4WU7A 4YHIA 3KPPA 2OZ4L 2OXGA 3MLZH 4MA1B 3RWDA 1KYOK 2AXHA 4R6UA 4FQLH 3VE0A 2BNRE 4LNVA 3FN3A 4ODXB 2VLKD 4L4TA 1Z6JT 5GHWL 3FCTA 4HV8A 5F6HJ 4P5MA 5I30H 4ZODA 4ZUWB 4K3HA 1N2RA 4OSUH 3NABH 3MLRL 4LMQI 4O4YL 5HGAB 1HHIA 5INCB 3FO1B 4LLAA 3LZFL 4NZUH 1JI2A 3PHOB 1U8PB 5SX4H 5B38G 1ZGLB 4WUUE 2X9WA 1EMTH 1HDMA 4GAJH 1BBDL 1TQCC 3V4UH 2XZCL 3QFJB 4QRPA 3TF7C 3QIWC 4RFOH 5E2TH 5J56B 2ICWJ 2IPUG 4TN9A 3ARED 3VMOA 1LEKA 1ES0B 4OI8A 5KBNC 4RWYH 4N0UA 4NGHL 3LIZH 1I7TA 1S9YA 4UQ3B 2C1OB 2NY4B 3SDCA 5DQ9A 1N4XH 2VXVL 2EYTA 1KTLA 4EI6B 1S3KH 3IFNH 2JJSC 4G8GA 3T1FA 2YA2A 4DTGH 5I16A 4JFEA 1TJHH 1P9MA 3OWEA 1ZHBA 1E27A 2D3VA 2QEJA 3MLVH 4NQDE 3JV0A 4F9PA 4G8IB 2ZSVB 3ZE1F 1TFHA 2VB5A 2XG4A 3ILQC 4F58L 1WEJL 1HHJA 4JEGB 1V3LA 1MREH 2A1WH 1U3YA 2ZUUA 5DRWB 4DN3H 4JPKH 4KAQL 1SEQL 1KPVB 4U1NB 3CFKA 3RU8L 2W1NA 3VFOB 4MB3A 2JB6B 2J88L 1GAFL 3MRQB 3OKDB 4LOUC 3KJ6L 1YEKH 3HRPA 4V2CB 3VD5A 2VO5A 1X5LA 3VXPB 4H88L 1QLRB 3X14B 3FO9B 4PRIE 4KMTH 2KQMA 3NIGF 4HUUA 3MFGB 3P40A 2DAVA 4RAVA 2AEQH 2V9RA 4ZOAA 1HSBB 5HD8C 2H2PC 1F8TH 1TVDA 5FYJE 5JNYA 5HYJB 5JXAL 3VG0L 2XG5A 1B0RB 3UCRA 1AD0B 3TN0D 1T2JA 5CD3A 4J7RA 5CMAB 4C4KO 5I8CA 1MUJA 4XVSL 2P42B 4YIQA 4LU5L 1J8HA 2DI8A 4GXUN 5ALCH 2CGRL 5HSFA 1Z9SA 5J9PB 3UBXA 4ESKA 4EIGB 1A7RL 5C7XH 2F74B 4V1DA 5E94B 1P7HL 1F11A 3O9WD 4FG6C 3RTQC 2DDQH 1RJZB 2BY2A 2D7PA 2WLYA 3DJ9A 1QBML 3QDMB 1NBVL 4JN2A 4EN3C 2XT1B 3VDCA 3O6KL 5GGRA 3D2UA 3G5ZA 4PLJC 3O0RL 3QNXB 1DBAH 4POZC 4JQXC 3ZE1E 4XBPB 1DBMH 5JW5B 3LKPB 4PJAF 4MZ2A 3MCLL 3GMPA 1TITA 3F5WB 4XCCH 1VGKA 4ACPA 4ZO7A 2Z8RA 1XF5B 3O45A 4JRXD 1FYTD 1AJ7L 5KAQG 1A7BA 4Y19A 2V9TA 1T21A 2J6EH 4I48B 5L0QC 3ARDA 3HHRB 5EU7E 1Y18B 5FUOL 2WSKA 4QTHB 2Y72A 5HHQB 5K9OA 3NIGE 5JIIA 2BVUA 4XP9L 4MSWA 2VTFA 4CVZB 3EYUH 1P7QB 1AI1L 3CLFH 1FGVL 1MFNA 1WBXA 3WD5L 4UUJB 1U93B 2C3GA 5F44A 5F93C 1WZ1L 3T0EA 4QHLB 5KVGH 1MAJA 1DDHB 3LKOA 3EOBA 3DURB 3QH3B 4NT6B 3S4SB 1OTUD 2FX9H 2GKIA 2BSSA 1TJIH 1CDBA 4KY1H 2FIRT 3GIVA 1N59A 1M71A 1UWEH 3MCKA 1A64A 4UNTA 5J6HA 2EDFA 1FO0B 1MHCB 5EIIA 3TA3D 5DVMA 5T3XD 4AH2B 2X4TA 2GUOB 3PWNB 1IL1B 1BAFH 1TLKA 4Q6IC 3MV7D 4XCEB 4N0CC 4L8CB 5JXEC 2V5YA 3BE1L 4Y4FD 1YPZE 2X70B 2AV7B 1NAKL 5KSBA 3LY6A 1X5HA 4ZNEE 5LXGL 1N6QH 3VWKA 3GUTA 3HR6A 4CMMB 5IB5A 4WUKL 3WEXA 2W38A 2FGZA 3SBWA 4OM1L 2Y6SD 3WFCL 5CCKL 1LE9B 4ZFOA 2NX5A 3KLSA 1ZMYA 1RIHL 2VZUA 3FZUC 2B4CC 4OGYL 5DEZA 2Q8AL 1M7XA 3U82B 1T89C 4XWOC 1UB6B 5DQJA 4JFQB 5HHXH 4PJ9A 9CGTA 1HKLH 3DETD 2XWBB 5I18H 1ZWIB 4JFXB 3NPSB 4NM4L 4X9GA 1PG7W 1YYLL 2B4CL 2ICEB 1NMAH 2FZ3A 3RUGB 1NGZA 4FTVA 3PWPE 4X6CA 2AVGA 4EUPB 1LO2H 1MQKH 3TZVA 5BS0E 1IAOB 5TF1H 1GC1L 1CF8L 1YEHH 2D31A 2PO6C 4H8WC 5E1AB 2GJ6B 5GRZA 4O2FB 1CD1B 4MXVE 3GZKA 4OCSH 4KROD 3TO4D 4B5EA 5ILTL 5I1IH 2YPVH 1U8MA 1L4IA 5DTFB 4WWKA 3W39B 5F8QC 4HUKB 2MTPA 3GBNH 5J1AA 4H8WL 5LCVH 4P49A 5I8EB 1JHTA 4XP4H 4JPVL 4ZAKA 4Y4KB 4QRSA 4PJFE 4RQQB 3BT2H 3BJ91 5HGHB 2F54D 4PRNA 1HSAB 1DTUA 2EO1A 2FL5B 2R8SH 1RUQL 3V7AE 1KPUA 1LK3H 5CJOH 3C2SA 2W65A 1WFUA 3DMMD 3HMWH 3FFDA 5JOPD 1IGCH 2WP3T 4A6YB 5DD6B 1F13A 3G04A 3O2WH 3MLUH 1LD9A 5F97E 3BIKA 4M61B 5I76B 5EBLA 1ZOXA 5DK3A 4P2YA 1YMMA 2B2XH 3MROB 5TF0A 5IFHH 4U1MA 3VGBA 2A38A 3HG1D 1LHZA 4UU9B 4XVJH 1QVOA 4BH8A 1JHKH 1H9VA 4O5LH 4WW2F 4ZOBA 2M2DA 2OCFD 1T0NA 4KRLB 3WNMA 5ANMA 3SDDC 3TLRA 3CJJA 3WJLC 4JHAH 3MYJA 5DD0L 2W0FB 3QPQC 5FK9A 3QB7C 3SJVB 1OCWL 1EJOL 3WKNA 3ARGD 3T2NL 3E3QC 4OLVL 3VXMD 5IFAL 4BSWB 5L8JB 3THMH 4KI5E 3VRLE 1V3MA 3H9YA 3C09C 1YY9C 1Q1JL 4JN1H 5CUSH 1YN7A 2OR9L 1BOGA 3BUYA 5DMIL 3UJJH 1ADQH 1FLRH 2F5AH 2FO4A 3EYQC 3MGTB 2GSIB 4Z18A 4YDJB 4YHYC 2EECA 4NQCA 3MZTA 3SEPA 4EIZC 5AD0B 3FOLA 2V7HA 2XACC 4NN5B 4QHMA 5I1DB 1ZLWH 4S1QL 2UYLA 1CFTB 1JTOA 1CU4L 2BVEA 2VLRD 4HGWB 3WUZA 5TDNB 5KZCB 1WC7B 2FECL 4QOKE 1XF2A 4JFDA 3VDBA 4RMTA 5J12C 1OAKL 1JYXA 1CT8B 1AKJD 4XRCA 1ZT1A 1DVFB 1I3VA 3I6GA 4HZLB 2WBJB 4HHAA 1NC2A 4HPYL 1ZHKA 1MJUL 3OGOE 4NKIL 1TVBA 3WHXB 3SGDH 2DIJA 1P84J 4ZUUA 5BV7B 2AK4A 1E28B 2R4RH 2CKBA 5D70H 5IEKB 1LP9A 4OTXL 4U1SB 5EU3A 4HW6A 1QSFD 1UEYA 3AREC 2NY5C 4MXQD 3MFFB 1F5WA 3OXRB 4WV1A 4DUXA 5EFIA 4H25B 5HHPB 4OZFA 3VXSA 3F8UB 5GXBB 4JFYB 3MBEA 4GMSH 5HI5D 4ODHL 1ZLSL 1YUHA 2PXYD 4PJDF 3WFHB 1VFBB 4X5WA 1U3JA 2NY5L 4NJAL 4WW1A 1ZANH 3CFEA 4FQXB 4NP4L 3GSVB 5HGDB 1K6QH 3P11L 1YC7A 3V5KA 5K93A 4K71C 4MAYD 3SE4C 1FSKB 5F1SA 2Q7YB 1FZKB 2IADA 1FNSL 1FZMB 3ARFA 5GSVB 4DCQA 3DOSA 5J1SC 3DROB 5DD5H 2EDBA 3TBVB 2QKIA 4M3JA 4PGJA 3RGVB 4N9OB 3VRIB 3EFFA 3PE9A 3TT1L 4X4YB 4WHTA 4NBZB 4KGJA 4L4VB 3U4BH 2JKXA 5F7EL 5ISZD 2CRIA 2EIZA 3MRCB 1FO0H 4NNPL 5I9QB 1N64L 4HFWB 3GM8A 4YDIH 2HFGL 5D2NE 3MACH 3LB6D 3EYOB 4XPTL 2NY2C 4TQEL 4PJIE 4EXPX 2PW2B 5JTWA 1MIML 5GGVL 4HWZB 5J6GB 2I26N 1JGDB 3RVUC 3HZVB 1V3JA 1S7XA 4PRBB 4ALAH 3L5XH 3VXRB 3TV3L 1FGNH 1QG3A 2ATKA 2H8PA 1I1AA 2YKLL 1DLHA 5EU6E 3RIFF 2ZCLH 4BKLA 43C9A 1YEFH 1P1ZA 3T77B 2JJTC 4KFZC 5C0CD 1R3KA 3WV0A 2RCSH 1RZIB 1IAKA 4R4FH 2QQLH 5T3ZH 1D7FA 3TN0C 3UBXI 1MJ8L 4LSSL 1MLCA 5D71L 5IHUH 2M8XA 3C2AL 2JIXA 1HEZB 3GSQA 3QPXH 1DBKL 5C0BB 3O11A 3B9KA 3MV9A 5EDXA 4H0IA 4U1JA 5BCAA 4NWUL 4WIQA 4HWBL 5HI3C 4F7MB 4TTGA 3ECBB 2GTZB 2QADB 1A5FL 3O9WC 1C7SA 4KH2A 4PJDE 4JAMA 1ZHLB 1BIHA 3LPWA 3O4LE 1SBBA 2Y07L 2WINB 5GISH 4MNHB 5I75C 5CEZH 3ZKND 3CSYB 3FJTA 4OLYH 5IJVA 4KJYA 4LVHC 4BSVA 5B3JE 4J3VA 4ZD3L 4PJBA 5TJWK 4EUPH 2OMNA 4N9GB 1AP2B 2IMNA 3RIAF 3B2UD 2F53E 3KPRA 2DQCH 4LCIH 4OCRL 5FM5M 3ALXA 4Z8FL 3TBTA 4GKSA 1A3QA 3WNPA 4FQIL 3VXUE 4LCUB 1FQ9C 3MRNA 1KJ2A 3OXSA 4NO0D 4NNXA 1E6JH 1LO0L 2HT4D 3O6FC 5SWQA 1MVUB 4TNWK 2BVOA 3TP4A 4G6FD 1ND0B 1I4FB 3GI8L 3MRGB 1T0MB 1XR9A 3MREA 3RX5A 1MPAL 5F3HA 1AGCA 1MF2H 2YD8A 5F7FA 4G9DA 2VAAA 5SWZE 5AUMB 4OLEA 3HFMH 3KDMB 2VDNH 4HIHB 1OTUC 3V0AC 1KTDA 4DN4H 1WAAF 3CX2A 1Z5LA 2CMRL 3O2DA 5F1NB 4WWID 3SDAB 5GS1B 2IANA 5I19L 2DD8H 5GGUB 2BVPA 3QEGH 3TA3C 4PYHA 2IBZX 4YHNA 4YC2C 2VXTH 2FEEI 1Y0LA 3CUPA 3V52L 1AC6A 1Q9OA 2VKXA 2BVYA 1S8DA 4WGWB 1W0WA 5MENB 2ZG1A 5TQ2H 3TBWB 3C60A 4P23B 1IGTB 1CCZA 5CIPH 4RA3A 3O4OB 5JDJA 4UILL 1M05B 1KF9B 4XPAH 1ZA6B 4TNVK 1S5HA 2Y6SC 3A67H 1W0VB 4M7KH 1I1FB 3CLEL 4N8PA 5AG9A 1OAYH 5ESVA 1MSPA 2BOBA 4X8XA 4X80H 4X5LA 4O02L 1RZFH 2A77L 4JO3H 5FCUL 3MGOA 1G1CA 4EOWL 4ZYKB 1L0YA 3AMKA 3FONA 1NGQL 5DJXB 3DETC 4QY8A 5D6DA 3ORJA 4X7FC 4IRJA 1B6UA 3I9GL 4BELD 3DSFH 2WWKT 4HUNB 3PGDB 1VACB 1SMOA 1P4LB 2C3VA 4J1UA 1YEJH 3LS5L 4X8JA 2ZUWA 2HN7B 1YMHB 4KROC 3TO4C 5IMOB 3FRPA 4NQUA 5H94A 4GRMB 4YX2L 5IESH 4NFDA 4XAWH 3Q3GB 4PY7A 2V2WB 4QRRA 2G2RB 5BV7H 1NFDB 1Q0YL 3STLA 1FV1B 3O6LH 4YHKL 2RIKA 2VIRB 4QRTB 2OTPA 4X6DB 3QULA 1S7TA 1ZVYA 2B20A 2BMKA 1IGYB 2G75B 3BP5A 1K8DA 5A2FA 2GJZB 5I1JH 3DMMC 5ENWA 1J5OH 3R06B 1IGFL 3MNZA 5FYLL 4JFZL 2JCCA 2R1YB 4YJZL 2IGFL 2CO7B 3QWOA 1PVHA 5C07E 1CR9H 4ZFFB 3S37H 4LSQL 4QHNB 2A83B 4R97C 1EO8H 2F8VA 3QDME 3P9LB 1Q9WB 3PDGA 2WLZA 4RSVA 4PTUA 4ZG1A 5EO0B 4XWGH 3GHEL 1INEH 3QCUL 5CJ8A 1ZLUK 1KCUH 3QDGB 1IM3B 4PP2B 5ERWA 4ERSL 5FA4B 4IS6B 4PGZA 4UQ2A 3C8KA 4I0PD 2Q1EA 5JZ7D 4M7ZB 3P4NA 2R2HA 1JGUL 2PCPA 3TPUB 3VD7A 2X1XR 1URLA 3E8UL 1F90L 4G9FD 3ARGC 1MLBA 2GY7B 3JUYA 4KTEH 4KTDL 5DFTA 4Z95H 4HWEH 1IBGL 1BQHA 1NAML 2CKNA 5H37H 2N1KA 1MRFL 2YPLB 3K2UL 5BRZE 4HX1A 2XWTB 2CSPA 4NWTL 3TVMA 4YO0B 1UKTA 4UTAL 4WO4A 1PD6A 5SX5H 3DARA 2O5YL 4ZSOA 4LPTA 2VDQH 4G5ZL 3RUGF 5C0EB 5T1KD 2Q7NA 2X40A 4F9LC 1KUMA 3L3OB 1TQCB 2EZ0D 3HI6H 1SJEA 2XKUA 3QIWB 4PP1D 4ELMB 1VFOA 4YXHH 1XIWD 4S1SL 3PABB 1UEMA 1RZ8B 4I5BB 2BXYA 4JO2H 5EZOH 3VGDA 5FKAB 2BCKA 1NGXB 4NKMA 4ELKA 5JLZB 5HHOB 3ESUF 5CZKA 5I8KH 2NXZD 1ZT4A 1OQXA 2AI0L 3V0VA 4WTWA 1P7KB 2VNCA 4XCFL 1T5WA 2W9EH 2H3NB 1EAPA 1RK1A 3EYFB 1BZ7B 3BPNC 2BDNL 4LIQE 1IE5A 4MXQC 1DL7L 2WV3A 2OMBA 1J1OH 1J9CT 3CFCH 1HNFA 1OT1A 3MRKA 3QCTH 2A6JA 1WITA 3GMOA 1RZGA 2EDTA 1A7OH 5HI5C 3U0PA 1UH4A 2PXYC 3BDYH 3RWIA 2VQUA 2QSVA 5ICZB 3CMOL 4R7DB 1CLYH 3CXHJ 1VFUA 1AGEB 4I2XA 4OJFL 5F1KC 4WFED 4OT1L 1IC4H 4U33A 4MAYC 2H6PB 1NLDL 4YHZH 1VB9A 3OKNB 1K4DA 2AK1L 4L4TD 5DDHB 1I7ZA 3HE6C 1JF1B 1UVQA 5D5MB 1FFPA 3MV7E 3RWJB 5E2UH 4H1LA 3B8YA 3A6CH 5CILL 4IDJH 2D03L 4M6AA 3MA9H 2HG5B 2O5ZH 4HDIB 4JM2B 1FPTL 1I3GL 3MRHB 5KOVC 5I1AA 3DVIA 1RURL 4XP5L 3LB6C 4NHCL 5DI8A 1HI6B 1XGRA 5F9DC 3ETBF 4QRPD 2MMXA 3RTQB 4MVBD 5T1LB 1C12A 1DFBL 5KJRL 4EN3B 1IVLA 4YUEH 3DTXB 2GIYA 4G42B 4U7KA 1A9EA 1IGJB 5IVZB 5E24E 3UPCA 5LBSL 1QKZL 3GI9L 2YD4A 4JFHE 2ADJA 4PJEB 4FFVD 4OKVB 4QTIH 4X0KB 3SDCD 4OKDA 4G8GD 2P47B 2ED8A 5C0NC 3RVVD 5EU4B 1UCBH 1UGNA 3D3VB 2GW5A 3EJZC 4LCYA 5GIRB 3SOBH 2YEZA 3UEZA 5FO9B 2I07A 4XGZB 3MRMA 4XPBL 5L0QB 1KACB 1T2XA 3DI2B 1LEGB 3ZKNC 4HUVA 2XWJB 3CFBA 4TSCL 2K3TA 1FNEB 4FRWA 1CFSB 4MHHI 5MEOA 4WU5A 3GJEB 2CIIA 1BJMA 4P9HL 3GSWB 3B2UC 3UTSA 4JLRB 3SJVE 5EG6C 3TJEL 5JR1L 1O0VA 4GBXB 3UTZB 2DQIL 1C08A 2AXGB 2NW3B 3OGCB 4PLKC 5EBGA 1IEBB 4MNGA 2OP4L 1NDGB 2E7HA 4ZO6A 3IJHB 4GMTH 4WENB 1EHLL 5KVDH 3BZFB 2HT4C 2CDEA 2H2SD 5KOMC 4LHUB 4KHTH 1NEZB 3I75A 5JW4Q 1NCNA 4PS4L 5CEXA 2VDMH 3D69A 4Q6IB 5C3TA 4N8VA 4DGVL 1YEDA 1BJ1J 5DMGC 1T66D 1QO3B 4OLXH 2DTMH 4AK1A 4V1DD 2HT3C 3LDBB 4IOSD 3QQNA 5DRZB 4QF1A 1GPOL 1MFEL 5DHYA 3LHPH 3SPVB 2XQBL 3PHQB 2BRRH 3U48A 5DWUH 3QUZA 1UM6L 2XXCB 3D2UD 5F1IA 3IVKA 3RWEA 2BK8A 2PYFA 4D3CL 3VH8B 4CL7A 1OF2A 2VL4A 3ZE2F 1K5NB 1SBSL 2QQKL 2VC2L 4OM0H 2EYSA 4GKNA 5EIQA 1XF3B 2OZ4H 5F7UA 3CVHA 3JSSA 3UTQB 2VDRL 2ZKHL 3ZDZF 3MBXH 2R0KL 1CICB 2YPKA 3IDYC 3QISA 2A73B 2XN9B 4DQOL 4HAFA 4NO2A 1U8NA 5GS3A 3N1MC 4N0FB 4E5XB 1BHGA 3RDTA 1BP3B 4HT1H 1S9XA 4MB5A 5KANG 3ARDD 4LARL 3EHBD 3MLRH 4O4YH 1RUML 3LZFH 4AT6A 4Y2OA 2PO6B 1NBYB 3P4OB 2J7LA 4G8FB 1BBDH 2IAMA 4NQEA 5CKAA 3T0ED 1A2YA 1Q9LB 4TSBH 3WNLA 5A2IH 5KG9B 2R2BB 4Q9BA 4FZEL 3VGEA 2N7AA 1UXWB 4F15C 1F6AB 2JB5L 5E6IC 4CNIB 5MEPB 3L3HB 2FGWL 3KPMB 1NC4A 2Z4QA 1AGBB 1QOKA 2CJUL 2GI7A 1OD7A 1CXEA 4Y5XA 4PJCE 4NGHH 2WNGA 2DYPA 2B0SH 1L9NA 2Z31C 5J06A 3VXQA 5IWLC 1X5KA 2VLMD 2EDJA 4L4VE 2VXVH 2COQA 2YWYA 3QQ3A 4H20L 4DVBA 5BW7C 4UT9L 3PWVB 4H5SB 2D7NA 1S78D 2O93L 2GCYA 4K9EC 3AM8C 3ULVD 1UXSB 5DJCA 4LLYA 1I9EA 2BOCB 1WEJH 4F58H 3V6ZA 1S7WA 3MJ8B 4U0QB 4CRPA 1F3JA 3M1BA 3VWKD 2WW8A 4IMLB 1QSZA 1SEQH 3KXFA 1FYHB 5EC2A 3RU8H 1EH9A 1XGQA 3VXRE 3HC0A 3BSZH 1CZ8H 4GRLD 2ICWB 1GAFH 3H3PL 3LEVH 1R5VA 1R3JA 2NX5D 4KPHH 4UNUA 1ED3B 5FAAA 4G6AD 1HNGA 1OW0A 4NRYA 3SDDB 5C3LD 5E5UB 1F3DH 4ISVB 2RR3A 3R1GH 3RWHA 4PJ9D 2BNUB 1UH3A 2OBGA 3RWGB 1KIQA 2H45A 4Z0XA 1KJVA 2D0FA 3HCVA 4M9OA 3G6JB 2A6KB 1HILA 3VG0H 4FTVD 3BKYL 3FOMB 2C3WA 3C09B 5GRJH 4GUPB 1WTLA 1FJ1A 4HUWB 1DE4A 3JTTA 4XVSH 4G7YL 1ZSDA 3S98A 3NZHL 2HKHL 4YHYB 5EUKA 2FB4L 1INDL 4LMQE 5IB2A 3BO8B 4MJID 1T03L 1A7RH 4WWKD 4BJLA 5JZ7C 1VSCA 4JZNA 1D6VL 4F7EB 4P3DA 5DD3L 1PAMA 2RFXB 2LV4A 3KG5A 1NBVH 5C0FA 3O6KH 3EOYG 3QUKB 1MCLA 2ADFL 3BP7A 4LPVA 1HOCB 4ZAKD 4OIIL 3U46B 5J12B 3G08A 5FYKE 2ZUXA 3TFKD 3SDYL 3BUTA 3H0TA 1U8OB 5C0CE 1B2WL 2UWEB 3T08A 1U0QA 1T1WA 3MCLH 1BFTA 3PIQB 1CFVL 4KRPB 3BVNB 1QTYT 1HXMB 3TO2B 2EZ0C 4RWHA 1NH6A 1EK3A 1CG9B 4JDVA 4WFFE 1AJ7H 3Q6FA 4PP1C 3CFJA 4XVTL 4XXDA 5CBEA 2IH3A 1XIWC 3RP1A 4XP9H 3VFRA 3JWNC 1AI1H 1JPTL 1FGVH 2CIKB 3LEXA 3WD5H 1E4XH 1FCGA 3MXVL 1KT2A 5TDPA 3VGAC 1WZ1H 4E0RA 1NFDF 3W5NA 3FT4B 4GQ9L 1N8ZA 4OZHF 4Z5RB 4GLRH 5EOQL 4OGZA 3LRHA 1QR1A 4PRDB 5C08B 3IJSA 3WFDL 5IT2L 2NXZC 2XXMB 2MHAA 1VKXB 2NR6D 1G7MB 4Y5VA 2DLEA 1BF2A 2HTKD 3CCHB 3LPGA 1U8IB 5EZJB 5E03A 5EN2A 5ACZA 1DSFH 4YAQB 2ZNXA 4LAJH 4J4PA 2GITB 2IFFH 5C0GA 4DKFH 1JPGA 2HH0L 2JE8A 1ZVHA 4PGCA 1BVKB 4UDUA 3BE1H 5HYSG 2EDKA 2AABH 4E41A 4E42B 2I5YH 1K4CA 1NAKH 4NQCD 5DUPH 2WUCL 4MD4B 1RJLB 2NY2B 4DJMA 5MHSD 5T1DL 4LLDA 1PKQA 4WUKH 4ZS6C 1BWMA 1Q8MA 4XMKL 4GAYA 4OM1H 2BNQB 4JFDD 4KK6D 5CCKH 4AENB 8CGTA 2YUVA 4RGND 3FB7B 2IBGA 4OUUA 4Y0GA 5F3BB 1U2CA 4I0CC 4OGYH 2BNRA 1EZVY 4YZFE 1A21A 2Q8AH 5ID1A 1IC5L 2YRLA 3MLSL 5TQ0L 2Z0BA 5J11C 3EOAA 4PFEA 1UZ6F 2AJ3A 1B6DA 4NM4H 1TZIB 5INDA 3IFOB 1SJXA 3H3BC 2B4CH 5HDQL 4WUUA 3O9WB 1NFDE 1OP3H 4MVBC 3IDJB 4GFTB 5D1XA 2X7LA 4X6DE 1CF8H 1CQKA 3VXSD 5KS9E 1KLUA 3B5TA 2VL5A 2VN7A 2HFFB 4UDTA 5CAYB 5H2BB 1MI5E 3MBED 4ELMF 3HNTH 5AG8A 5ILTH 3MLTB 4DKEL 3RA7L 5HY9B 4FFVC 2NY6D 2PYEB 2P8PA 2BC4B 4Z77B 4H8WH 1CL7L 5ADOL 5ICXB 1GGYA 4M00A 5JUEL 1P9MC 3HNVL 4IJ3C 4JPVH 5GQBA 1LO3L 5CLTA 1VHPA 4F9PC 3ARFD 1WIUA 3T8XA 3BZDA 4JRXB 3T0XA 4NQDA 1AY1L 5HGBB 3O6FB 1RUQH 3U7YL 1IILE 4NKQB 3WXVH 4ORGA 4Y4HD 3DRTB 2AKRB 3MRFA 4XAKD 3B6SB 4ZUTB 4KKCD 4XHJC 1VCAA 3T4YA 4P2QB 1F3RB 3GSOA 3PV7A 4OF3A 1I75A 4OQTA 4XC1L 2DQHL 1A9BB 3CIQA 1T04B 4ZQKA 3SDXE 1IEHA 1CDHA 2WQ8A 3T0VA 2LFGA 3K81A 4PRIA 3V4PL 3IFLH 2UUDK 3KYKH 1U36A 1I1AD 3VA6A 2YXMA 1EEQA 2G9HB 1U91B 5J13C 1XCTA 5E00A 3ZDYE 4YC2B 3Q2CA 4UT6L 4PJGE 5K59F 15C8L 5KAQF 1PZUB 3ZE0F 1OTSD 5LWYL 5EUOE 1ZEAL 3F6LA 3FT3B 3T2NH 1BQLH 4OLVH 3WDJA 2XZQL 4PRAB 5IFAH 4I18A 3MV9D 2A6DB 1NUNB 5D5MF 3WSQL 4NZTL 5F9WC 3GJFB 1IC7L 4M48L 4GSDL 3VFNA 1C5DA 2BFVH 1Q1JH 4JM2F 5EO1A 2OS7A 4Q9QL 5TE4L 5E4EC 3S34L 3ROLB 3S5LG 5FECB 3G9AB 5HHOE 4K07A 4LQFH 1G6RA 5F21B 4R8WH 5F8RC 1XT5A 2KPNA 4S1QH 4N5EC 1CU4H 5IG7A 2V5MA 3SE8L 4FXLA 4ZXBD 3KPRD 3N9GH 4M7LT 4FFZL 4FABL 4YPJA 4BFIA 4F33B 4CDHA 5C9KA 3ARYA 1OAKH 4PJEF 4X7EC 1A4JB 5DXWA 2EDLA 1HHKA 1NCAL 3GMNB 2IH1B 4HPYH 3JV6B 4HF5H 4YHPA 2EIDA 4Y5YB 1MJUH 5JIKA 1YY8A 4F3FA 3ARDC 3EHBC 4NKIH 2H9GB 3M45A 1AGDB 3DNKA 3GSRB 2PTTA 5FDYA 5CGMA 3QR2A 5F96L 3FKUS 4KROB 3TO4B 2XA8L 3MV8B 4NJ9L 1I8MA 4HJ0D 4QHUA 1NKOA 4HAGA 3T0EC 1R3LA 3D18B 1XH3B 5EH1A 3IXTA 2YN5A 3GNML 5C70A 2X4QA 5J3HD 1CGUA 2F19L 1XF4B 4KRNA 5K59E 2L7JA 5KSUA 2EE2A 4JVUA 3JWDC 1JZ3A 3SCMD 4KQ3L 5MERB 1OSZA 3VXNB 3SO3C 2NY5H 4NJAH 4OFPA 4NP4H 3FQWB 4O00A 3F7YB