1ORSA

X-ray structure of the kvap potassium channel voltage sensor in complex with an fab
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
214
structure length
214
Chain Sequence
QIVLTQSPAIMSASLGDRVTMTCTASSSVSSSYLHWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQFHRSLTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 33H1 Fab light chain
publication title X-ray structure of a voltage-dependent K+ channel
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Membrane protein
total genus 54
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1orsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1orsA01
1CFBA 5GGSA 1PD6A 3RBSA 2DF3A 3E8UH 2DMBA 2CDGB 4I0CC 3C8KB 4PJFE 4PJ8D 1PYWB 3CC5A 3VWKC 4HZAA 4MNGB 5DT1L 4XNZB 2E27L 2PO6A 1RAMA 2V9TA 1HZHH 2R2BA 2Z91A 4UOJA 2X9WA 3F7RA 2DQCL 3MCLL 1HCFX 1Q1JL 4YHLH 5SWSB 4YZFF 5BO1L 2QR0B 1DFBH 1WBYA 5E5MA 2VAAA 1R5IA 3V4VH 1JN6A 4QHUB 4ZOAA 4MD4B 4KZEH 3NH7H 2HFGL 4HFUL 2HKHH 3NN8B 1UKSA 5F1NA 1T1XB 4XPTH 1MCQA 4QRQB 4C4KO 3LHPH 3SOBH 1CXLA 2B4CL 2Y5TB 3EUUA 4M8QA 3MRFB 3B4NA 4NWTL 3X3GH 4P2QB 2AJVH 3BT2H 2E6PA 1NGXB 2FRGP 2IJ0C 3STLB 4K3EL 5T3XE 5LWYL 1OTTC 5C2BH 5IQ7L 5DD1H 3I6LE 3VH8A 2ZSVB 3VFUB 5EIVA 5T1LA 5D7LB 5HVFB 5HHMD 3LRSB 3UTTB 3EO9H 4JFOA 1G7JB 5DK3A 5JIIA 4I4WB 3UTPE 1Z5LA 4XVUD 1P7KA 1K8IA 1OHQA 3CFDA 3F7QA 5I0ZA 4UT9L 1I7TA 2Y6SC 5HHNB 3WHE1 4JFPB 1R3KB 4EI5D 4UT7H 3S5LA 5HDLA 4OUOA 3RWCB 2X4QB 2BVYA 1NC4D 5EOQH 1ORSB 1J0IA 1KN2L 1DN2A 3PJSA 1HWHB 3DX9B 2AJZA 4LF3B 4MAYA 1S9VB 2AAVA 3SJVB 1FFNA 3D2UA 3WIHA 4G8GD 2P8PB 2R2HB 5DURB 1MCHA 5AUMB 1A0QL 4HKXB 5DRNA 1UXWB 2A77L 4X5WA 3AU1A 3VFOB 1DN0A 1KYOJ 5I1GL 5FXCH 2W0FA 4LNRB 5CWSB 3LCYA 1NAKH 4GAFB 4PJDB 5D1XC 4DK3A 3JWOC 1EO8H 2ZOLA 5D1XB 3RRQA 4LLAA 4KI1A 3F65A 1I8IA 1ETZB 1U8MB 1VGKB 3VA2C 3VXMD 3HZMB 1UEYA 3BD4A 2P42B 5KAQF 2BSTB 1H5BC 4FQXC 1MFDL 5GS0C 3VFWB 1H5BB 3DX8B 4FQXB 4OM0H 2OL3B 4LLWA 2XY1A 1BZ7A 5FA4A 4RX4D 2P5WD 3QJFB 3QXTA 2OMBA 5GS3A 1CFQA 5K9KB 4MB5A 5CJ8A 4XXCA 3Q1SH 4MX7B 2VDRL 1MVUA 4GG6B 1AXTL 3PHOA 2Z93A 2EIBA 1KJVA 3KPSE 4GBXD 5HPOA 4FZ8H 1ZSDB 4IRJA 1MHCB 5D2LF 5SWZD 5T5NG 3U2SA 2GW5A 3RTQC 1NGPL 1ZLWH 3NFNA 4LLQB 4N8VA 1HHHB 1AY1H 4WO4D 5FO9A 2I9LA 4PLNC 4Y16D 4MQ7B 5KANG 2DL2A 2NX5E 2C3GA 1T7XA 12E8L 1KLFA 1NCWL 3R06B 2KQMA 3M8OH 3TIEB 3B83A 3F7PC 5DJCB 1TVHB 3SDDA 2YA2A 1ACYL 1ZA6A 2BP3A 3TZVA 2Z0BA 4HUMB 2B0SL 1AD9A 4J23A 2X4PA 5HGBB 4AG4L 4X6DB 4M4RA 4X5XB 4NNYA 3WIIH 3MRMA 2GFBB 3UDWC 1U93B 1UH3A 4HMCA 4JZNB 5D7IA 3O2DL 4Y8DC 1NCTA 1A14L 5KSBB 4G8EA 3GJEA 4Y19E 1C16A 4OCRH 1DEEB 4S2SB 2W1NA 4L3AA 3K7UA 4LCYB 4XC3L 2OM5A 1OAXH 5DHVH 4JFEA 5K9QG 2CRYA 4XVJH 3OHXA 5FUZL 5F7HA 2Q7YB 4WV1C 4IMLA 3WFBH 5CZXD 4HC1L 4WV1B 1BD2B 1PX4A 1JHLL 1DBML 1DBBL 1A6VH 3Q6FB 3SE4A 1LK3H 5CGMA 4M5ZH 5GGSB 3WLBB 4PS4L 1F4YL 1FFRA 1OQXA 3UTQB 2HAZA 4WI8A 3QUXA 2OTWA 1HHIA 2PO6C 2VDPL 4V2CB 3TBWA 4N0FA 3MV9B 1IFHL 3NFPB 1CR9L 2HT2C 2OP4H 4U7SA 2Z91B 2R2BB 3JV4A 3ARYA 2VUOA 4EVNA 1FNFA 3L3OB 3RL1A 1N3NB 3EFDL 1MJJA 1A6WL 4X83A 3I85A 3K4ZA 3MV7B 4AMKH 3QP3A 5F7LB 3RDTD 4JM2D 2VLJD 1OD9A 5E5MB 2VAAB 1R5IB 3UTSE 1JN6B 7FABL 4JKKA 1CXHA 5D96B 2R9HC 1HOCA 4NOBA 3IF1A 2CK0L 5JUEL 5F1NB 2BVOB 3VXNB 4CADB 5I1AA 3UEZA 5D70L 1VSCA 4Q6YA 4NNPH 1BFVH 4M8QB 3A67L 4YWGL 4KUCD 3EYUL 4GRLB 2EDRA 3GRWL 2CMRL 5SX5K 4QXUL 2MCPL 1UH4A 3V5DA 4HIJA 1LE9A 5C3TA 1N4XL 4EUPH 3LH2H 5MEOA 3ARSA 1WFTA 1IM9A 3QQ3A 4OV6F 4ZYKA 2G5BA 1MI5E 4JFOB 5BXFA 2IANE 3RX5A 1INEL 2E9WA 3WFDL 5JW3L 3S37L 1RUML 2GY7B 3H7BA 3LD8C 2H2PD 3LD8B 1K8IB 3CFDB 3WE6A 1I7TB 1L0XA 2FX8L 5D8JH 4L8BA 1MQKH 1OY3B 5IGXL 4ZFOL 1RK1A 1CLZL 5J3HC 4R4NC 4PGDA 1J0ZA 4MGXA 5ADPL 4K9EH 2J88H 5C7XL 3LB6D 3SDXE 5TE7H 1A7QH 1JPTH 1LO4L 1SEBA 2YKLL 2QQLH 2DQGL 5IQ9A 2AJZB 2NYYC 4L4VD 3WN5B 1FFNB 2BX5A 3D2UB 2NZ9C 5AEAA 4JFFB 5F9JA 3QFJE 4PJBE 2YD8A 3KS0J 4LMQI 3QUMB 1QPXA 4JKPH 4KK8D 5DRNB 5L8JB 4X5WB 3AU1B 1QG3A 4CNIA 2HN7A 1BP3B 4QNPF 5DVLA 1KJ2A 1OPGL 3CJJA 4NQTA 1O5DT 4OGAC 2AJXL 1P2CA 1LGVA 3H9YA 2ZOLB 4YEEA 5IESL 5AYUL 2JJWA 3WXVL 1I8IB 1JPSH 4JN1H 3DYPA 1EEQA 4X4ME 4ZOBA 4L4TA 2MOVA 1GGCL 5CSGA 3B2UD 4CJ0A 5IV2A 5FA4B 2OR8A 4LLWB 3TVMD 5GISH 5GJTH 1A3LL 1CFQB 3CVHL 3ZE0E 4XXCC 4PG2A 1ND0B 3RNQA 4DVBA 3MBXH 3LQAH 2F15A 1VACA 43CAB 3PHOB 5CEXA 4XVTL 1DQQA 4AL8H 1GC1L 1C5CH 5HVHC 4HIEA 5C6TL 4IRJC 5HVHB 3BQUA 5DJXB 2YPLD 1UACH 3S37X 4H88H 4PP2A 2AQ3A 3L1OL 4R97C 3U2SB 3VFNA 2BVPA 3BUYA 4R97B 1XGYL 4U1JA 4OGYL 4RAVA 4N8VB 1XH3A 3FRUA 5FO9B 2I9LB 1VFUA 3D39A 5MENE 1CLYH 4APQD 1YUHA 1ZK9A 4JZJA 3B9KD 5SX4H 4TNWF 3VFRB 4JJHA 3SDDC 4F7TA 1OWWA 3TZVC 4YDLC 3SDDB 2JE8A 3QRFM 3TESA 1AD9B 2X4PB 2ZUTA 1WT5A 2BSSA 1DR9A 4FFWD 1D6EA 1OTUC 4XWOC 4NNYB 3X11A 3EO1A 3X3FL 3RVXC 4UNUA 5ADOH 2BNQE 5C6WH 4MS8C 4M4PA 3NPZB 5D7IB 3FFCA 3GMMB 3WUWG 1R3LA 1ITCA 4G8EB 3GJEB 5IHUL 4UMGA 5FAAA 1HNFA 4FQPA 3LKQA 1GHFH 4LCCA 1PDKA 4JFEB 2ZWLT 2CUIA 2NPLX 3OHXB 5D2NA 1CU4L 1Q1JH 3MC0A 4IMLB 1FORL 3QPXH 25C8H 1X5KA 4L8CA 5ITBH 3SPVA 3QIWA 5BO1H 1MRCL 5C08D 4HPYH 3SE4C 4JGJA 5GRUL 1H3XA 3AS1A 4OFKA 2PETA 4J6RL 8FABA 5I15H 2BY0A 1IILE 4H8WL 5EC2B 5KVDL 3GBNL 2HFGH 2QBWA 3H0TA 1FZKA 4HFUH 3HUJB 5DDHB 3LS4H 1RJLA 3OF6D 1OAUH 2EDQA 1DBAL 3OKLB 2JB6A 3QUXC 3QUXB 3UAJC 2OTWB 1Q94A 4N0FB 2L7JA 4M7JH 3BPOC 3P9MA 5IW1A 3BPOB 2FECL 3JV4B 4QTHA 1GSMA 4CDGC 4NRXA 5HHOB 3WUZA 4EVNB 2OTUA 3RL1B 3MUGB 4ORGB 5IQ7H 3CAFA 4FMFA 4RGNC 4HUVA 2VKXA 4RGNB 2NQCA 2IH3A 3QR2A 5IB2A 3UZEA 3UCRA 1HOCB 5F7EH 1G1CA 3JV6A 4HUNB 4UT9H 5EC1A 4OTXL 2YUWA 4C58B 2WUBH 1JZ6A 4WI4A 5I73C 4R0LA 4ZTPL 1PY4A 3D87B 4UZGA 5D93C 1D9KD 3EJYD 1KN2H 4S1QL 2PR4L 4M1DH 1CQYA 5IB1A 3RZCA 4HIJB 4DGIH 1LE9B 4EJ1C 5E6IA 5MEOB 3LQZA 4LVOC 1U6AL 1ADQA 5E2TL 2OZ4L 3BEVA 1IM9B 5DO2D 3H9SA 1A0QH 4ZYKB 1S9YA 3Q5OA 5BXFB 1DBKH 4QCIB 4CN6A 5IT2H 4RFNC 3V0VB 4ZS7L 2FO4B 4YIQA 3ET9F 3H7BB 4RFNB 4W70A 3FN0L 3KXFE 4RMWA 3MRQB 5K59E 1ZLVK 4Z7UF 3C60D 4LAQH 5HGDB 1RK1B 2RB8A 4OLZH 1NGZA 5C0BE 1YEEL 4JRYD 4BUGA 1JGDB 2GJ6E 4MCYA 3MR9B 4K8RC 4N1CA 1SEBB 5TDPA 1YJDL 2DOCA 4BZ2H 1ZGLA 2ZOKA 5FYKL 1AC0A 4K3GA 4U0RC 3K8MA 3Q6GL 3QDGA 4NJAH 5K9JH 5F9JB 4TPRL 3VXPA 2O5XL 3HC0A 3GSUA 2GAZA 1PQZA 2HH0H 5CSBA 1JTTA 1ZANL 4WU5A 3E6FA 4JPKL 3VWKD 4CNIB 4QGYA 4XNXH 1P2CB 2ZKHL 2FLBT 2VLKE 5F97E 2ADJB 1NGPH 3BOVA 4HJGA 3WEXA 1P1ZA 5KS9A 4L4TB 2LU3A 4KDTA 3D48R 4KK9C 3WFHB 4NFCA 4DQOL 4QRUA 1EHAA 1RZKL 3IAGC 2VXUH 4YO0A 3HG1E 3V4UL 4PG2C 1P69B 1JGUL 2W91A 3OPZL 2NW3A 4Z7VE 1ACYH 2B0SH 1GGUA 4QHNA 5EA0L 1Q72H 4LVEA 1JZ2A 3HC4H 4MJIE 4DUXA 5CEXB 3W5NA 2ZG3A 3ULVE 3EBAA 3BQUC 3H2WA 1OP5H 3PGDB 5L6YH 2DQFA 4YBQC 3BDYH 4Z7WA 3VFNB 2BVPB 1T03L 3O2DH 2P5ED 4OF5A 5IFJB 4U1JB 3IFLL 4UAOC 5MHSE 4NO0D 4OFYA 4RAVB 3FZUC 4M7ZC 1XH3B 3FRUB 4M7ZB 1OTTD 2A6JA 3D39B 1GGIL 2FBOJ 2OK0H 4JZJC 1YUHB 5D7LD 1IAIL 3MRGB 4JZJB 5FUZH 1UENA 3TWCL 5I1CL 1SJEB 1C7SA 4F7TB 2BDNL 3HI6L 1WT5C 1DBMH 1I9JL 1MSPA 2AJUH 1ZWIA 2BSSB 4XPHH 4JFHE 3I75A 3EO1B 1LWRA 4NQXB 5MERA 3D85A 1JZ8A 2ZSWA 3LKPA 4DEPB 1RZ7H 2VZVA 2DQEH 3F58H 3U4EA 3P0YH 3ROOA 3ILQD 3F6IA 3HS0A 3SBWA 2RIKA 1T3FA 5T3XL 1R3LB 4MA8L 5CEYA 4V1DE 2UZIL 2AJSL 4AEHL 3GKZA 1IFHH 1CR9H 4LKXA 1CLOL 5FYJD 5JOFA 3QG6A 4LCCC 2HT3D 2FJFA 1UT9A 5D2NC 4LCCB 2C3VA 4CKVX 5D2NB 4TNVF 5CBEB 4L8CB 3QIWC 3AGVA 3UPAA 3SPVB 1YNKH 3QIWB 3AS3A 4PJFF 3CFKA 1V3MA 1L0YA 2UV3A 8FABB 7FABH 1V3JA 4NO5A 4Z76A 3H0TB 1FZKB 1RU9H 1YYML 4M5YH 4H25A 1L4IA 3IJYA 2CK0H 1RJLB 3QWRA 3NAAH 2J7LA 4QLRA 1JPST 1Z3GL 2JB6B 3S36L 5ESAA 5GS0D 1SM3H 3TT1L 4KGLA 3RVVD 1Q94B 2CSPA 4OCMC 4ZQKA 3LAFA 3P9MB 2HYMA 1EEUA 1MLBA 2CMRH 4ONFL 4QTHB 2MCPH 4NRXB 3EOTL 4RA3A 2FIRT 1LE5A 4JO3L 1N4XH 4TVPE 4KHTL 2DYPB 2O93L 4WUKH 3GNMH 4NNXA 1XGUA 2Q86A 1RIHL 2IH3B 5DHYA 3DVNB 1EFQA 2KBGA 2VMFA 4BZ1H 4UDTB 5IB2B 4JVUA 3RTQD 2A6KA 3FTGB 5EZLA 3TF7C 4GJTB 3UJTL 4U1MB 1VFBA 4R0LC 1CLZH 1LILA 4JG1L 4R0LB 3MRPA 1KSRA 1DLFL 5ADPH 1BIIB 1KOAA 4BZYA 3V8CA 1MRFL 4RMTA 3RZCC 4RSVA 3SGKA 2HTKC 1E4XH 3RZCB 5IB1B 2DQGH 5E6IC 3QXAA 4OV5A 5EZIH 3LQZB 3O11A 1MY7A 3BEVB 3T77A 3X17A 3H9SB 4PJ7A 4LCWE 1U9KA 5B3JE 4DCQA 4WGVB 4MZ2A 3STZA 4E42B 2YOCA 4YXLL 5FOBB 3GEWB 1KXQE 1INDL 4PGEB 4HHAA 1OPGH 3MRLA 2EYRA 3W9DA 1T6WA 4LCIH 4I0KA 1NGZB 6CGTA 3MOAL 3P4OB 4ISVA 3PHSA 5E8NA 3IRPX 3OAUH 4G8IA 5DC4B 4MCYB 1GGCH 4FNLL 5EPMA 3S36X 5EBWA 2D7TL 5TDPB 2IGFL 5DSCA 3OB0K 4P5MA 4CAGA 3VH8G 1G9ML 2E9JA 2IF7A 1D3CA 4TVSa 3ZKND 4F9LA 1A64A 5CCKL 4K94L 4BK4A 2FBJL 3MFFA 4S11A 1OGAE 3KPNA 3FB6A 3VXPB 1YNLL 2GAZB 1PQZB 3Q2CA 3GJFH 4WU5B 4XHQA 3EYVA 1A7NL 2F53B 3UZVB 3NZHH 1SBSH 2PO6D 4U1HB 3S5LG 3GMNA 1VENA 2HT2D 3ESVF 1XGYH 3WMSA 3WEXB 3HC3H 4KDTC 4J3WA 4HGMA 1B0GA 2XG5A 1W8NA 2OSLA 4U49A 4F7CB 5DHVA 5IVXA 2ATKA 2I27N 2HT4C 4QRUB 5CZKA 5HI5D 3MROB 3FB7B 2RFXA 3OKEB 2NW3B 1XGPA 3HFMH 3NFSL 4NSKA 2NXYD 2R9HD 3QZWB 2BK8A 4PJHA 3VA6A 2ZPKL 5IB5A 2PW1B 4ONOA 5JOPD 4PJIA 4DN3H 2YWYA 2VE6A 3ZTNL 3FQWA 2AGJL 2DQFB 4LEXH 5SX4I 1TLKA 1KG0A 3D3VE 3GSVA 3CFCL 1B6DA 5FEBA 3ES6A 4NKDA 5T1LD 1P4IH 2BOBA 4IS6B 5KSAB 1CU4H 2OQJA 3OJ2C 5I17A 2IAMB 5E1AA 4FXKA 4G7VL 4KHXH 3WS3A 5ELIA 1DE4A 2BJMH 3BFOA 4O2FB 4J6RH 5KVDH 3V7AE 3GBNH 4EDWH 4R7NB 3ZKXC 5J3HD 1UM6L 3D85B 4R4ND 3ZKXB 2ZSWB 2NTFA 3LKPB 1BQSA 4L3EE 4ZXBA 1DBAH 3SBWC 3ROOB 4RIRA 4PJ5A 4N8VG 3HS0B 1CQKA 1F4XH 1T3FB 4JRXD 1UJ3A 2AERT 5CEYB 1T0MB 3OL2A 4MAYD 3G6JA 3VJ6A 3O0RH 5JOFB 3QG6B 5E9DA 2BY3A 4M3JA 4EUPA 2FJFB 2VZTA 4FRWA 2PN5A 2XKSA 2AQ2A 2Z8VC 3R8BB 3HPLB 2B1HL 2HFFA 1QBAA 4KVNH 1T1WA 2R69L 4S0TD 4MWFA 1DL7L 3QNZA 2FZ3B 1EXUB 3M07A 1FL6A 4Z76B 3ARFD 2HWZL 2XTJE 3WL9A 1RUKL 2AP2A 2YPKA 4H25B 3IJYB 5FV2A 4M03A 3MV01 2WUCH 3MFGB 5ESAB 3HRZA 5GGTL 4PRIA 4JY4B 4X9GA 5F89A 1FH5H 4ZQKB 1XIWA 3QUKB 4WI3A 3MLZL 3VXRD 4QY8A 3NCJH 5KTEH 4I18A 1N6VA 5CSZA 3O4LA 4Y2DD 4OF6A 1U6AH 5HGAA 1AP2B 1MNUH 3ABZA 2R29L 3OAZK 4NNXB 4WI2A 4IRJD 1YY8A 4YDIH 4HK3J 3RIFK 1VEOA 3VGGA 5GJSL 2PYEA 5ICYB 1M7DB 3C2SA 4ODVL 2FEEL 2A6KB 5EZLB 1AGCB 2W9EL 3DJ9A 2VKWA 2NY2B 4YHPA 4UIKL 1TCMA 1DEDA 4OCNC 3VXTA 1VFBB 1DQLH 4NZRL 5DD5H 3BWAA 2NY4C 3SGKC 3WKML 1G0XA 3SDDD 2NY4B 3O3BA 1EUTA 1YJDH 2NY6D 4L8SB 3RWIA 3TZVD 1OF2A 1KCSL 1NKOA 1UM4H 2F58H 3ZKMD 3QXAB 1RMFH 3GI9H 4OZGB 2F8OA 2X09A 4GSDL 5C07E 4LSTH 1I3GH 4WEMB 3QHFL 4FTVA 3O11B 1OTUD 3T77B 5D7JD 3RVXD 3TN0A 3BAEH 2FD6H 1N0LA 2DM7A 1JYNA 4DCQB 3MYZA 5LCVH 3TJHD 4MS8D 1JYWA 1I9IL 4IMKA 3SDXF 3ULUH 4HHAB 5J12C 3MRLB 2MQ0A 3NIFE 2ITDA 2VN7A 5J12B 3QQ9C 4NZUL 2ZG2A 3C09C 2FH6A 4NN5C 1KLGA 4ISVB 5FDWA 4NN5B 1WIPA 4JJ5A 1IL1B 2X1OA 1AXIB 3LDBC 1CF8L 1QBML 4DQOH 5DSCB 5HI3D 4P5MB 4F9LC 5A2FA 4Z5RA 4PJAE 3OPZH 3DLQR 3EYSL 3MFFB 1MJ7L 4MZ3A 3KPNB 5EORL 4B7LA 3HCVA 1YA5A 4Y1AA 3FB8A 3CVIH 4FOMA 4XMLL 3WIFB 4F8TA 1T21A 3QUXD 1NL0H 1IGFL 5F7FA 4I2XE 3UAJD 2R23B 3GMNB 3W11C 1T03H 1T7VA 1J1PL 4L5FL 1KPVB 3ZE0F 4LFHG 5J89A 3B2VL 2FH8A 3WFEL 1B0GB 2OSLB 4UT6L 5DHVB 5IVXB 1GGIH 5ILTH 1UQSA 3IDJA 4RGND 1FYTA 3I3BA 3L5WB 4ZPVA 4TULL 4DTGL 4DOHB 3DETC 4G42A 1XGPB 4NSKB 2QSTA 4BQ8A 5BV7L 4FQ2L 3RA7H 4KDVA 4LHUB 5T33H 1P5UA 5L2JB 4PJIB 2IBGA 4U1LA 1ITBB 2VE6B 4MMZC 4ONGL 3C2AL 4IBLT 4ORZC 5HYSG 1QNZH 3QULA 3TFKC 1T2JA 3L95A 1A02N 3GSVB 4KUZH 2BOCA 4X7SL 4OLVL 4AEHH 4CUCA 5CLWA 2XICA 4M6OL 1CBVL 3ES6B 4NM8L 3VMPA 2BOBB 4P3DB 4YHNA 3O4OC 1U91A 4TUKH 1EIBA 3O4OB 2IMMA 4V2BA 1PZ5A 4TTGA 1DE4B 1YMHA 2B7DT 4KRLB 5FUCE 2QSCL 2EDXA 3IDUA 4Z77A 1YYMH 3DGGA 4JAMB 3V0WH 2YR3A 4P5TA 1UGNA 4ZXBC 4LFHD 4ZXBB 1Z3GH 4RIRB 4K8RD 1UJ3C 4PJ5B 1UJ3B 5JPNA 2P43B 4X6BA 3PWPA 4OCSH 3VJ6B 1YEFH 5E9DB 4LK4A 3C6SA 3EOTH 4PR5B 5F1IA 4F58L 1EK3A 1YEJH 2J8OA 4M3KB 2A1WL 1U3YA 4F37F 3OKNA 3OB8A 5BZDA 2F74A 4KKCC 3QXWA 4HK0B 1KBGL 2E9IA 2UUDH 4MNHB 3QNZB 2YS4A 4Y7MA 1FL6B 4F80A 2ITCB 2YPKB 1J5OL 5EU7C 2ICCA 4HWEH 5KVFH 4EXKA 3C9NA 3V6OE 3QUYA 4K9EC 3UJTH 4WHCA 4F9PA 1I3UA 1P5VA 3HRZB 4JCMA 4PRIB 2YBRB 3FQXA 5D7KD 5F89B 1XIWC 4JFZL 1WFNA 3DRQB 3SO3C 1XIWB 4I18C 3SO3B 4QY8B 4I18B 4GMSH 3KR3L 1J1XH 1QSZA 3LEYL 5CSZB 3O4LB 3OQ3B 1HQ4A 4P23A 4JPWH 3S4SA 4ETQB 5HGAB 4Q0XL 1MUJA 4HQQL 1UH2A 3BQUD 1S7UA 5BS0E 3BGFC 4GKSB 4OD3L 4YBQD 5KW9L 3BGFB 5I1DB 1LK2A 4YHPB 2EXWD 1E4XI 3AFLA 1BPVA 3FZUD 4KKBC 2CDEA 2WBJA 2EEDA 3MREA 3MOAH 3VCLB 2IADA 4XWGL 2XZZA 3BWAB 1DVFD 3ALXA 1A21A 5DRXA 4A2LA 2F5AH 1T1ZA 3V6FA 3EDEA 1G9MH 5HDBE 1P6AB 3LQAC 4FTVB 5K59F 3TN0C 3TN0B 1ZHNA 1P7HL 1JIBA 3TA3A 3FFCD 2FJGA 3QSKB 1DZBA 4IMKC 2GTZA 3K3QA 4GRWH 2FHBA 1JZ4A 1H3TA 2AI0H 3VFSA 3O2DA 2EKSA 5CILL 4TNWK 1N2RA 3ZKQD 2ITDB 1QSEE 2C9AA 2XWTA 3C08L 4QO1A 4LRNL 3ZL4H 1QEWA 1KLGB 5FDWB 5DVMA 1ZGLP 3EJZC 2BXYA 4MXVE 3UYOD 4KMTL 2VTFA 5C2UB 3EW3B 4OQTL 3RIAK 4QTIL 4M62H 4U7KA 5AD0B 5I2IA 4JB9H 1T66C 1K85A 5JIPA 2OR9L 5C0AA 3HCVB 3FB8B 4W81A 1B3JA 1T21B 5JOEA 4XPGL 3GHBH 3ZTNH 1NDMA 2AGJH 1LEKA 3DURA 4D3CH 2Z4QA 1GZPA 5F7DB 3BN9C 1ZLUK 4IIQA 3IJSA 3WO3B 3V6ZA 5I30H 5HDOA 5E8EB 1X5FA 4N0UE 3UYPA 3IDJB 3NBNA 1FYTB 1CIUA 5LXGL 5F7MC 4NZDA 3ULVF 3GHEL 4XNUH 5IBTH 2X4RA 4G42B 1RVFL 4JM4L 4ODTH 1KYOK 3NTCL 4ESKA 2L4OA 5DD0H 2F54A 5DWUH 2P48B 1UG9A 4RFEB 3TYGL 4U1LB 3TO2A 1JWSB 5DLMH 5I74C 5IBUG 1FG9C 1IQDB 5I74B 1T20B 2I26N 3TH2T 4M1GL 5DK0B 3QULB 3L95B 1FV1B 4TVPL 4I3GA 3GRWA 1HIMH 1BAFH 5E6ID 2BOCB 1F6FB 3TBTB 1KEGH 15C8L 4MCZA 4MNQE 3MNVA 3B3IA 1U91B 1BJ8A 3UJJL 4M7LL 1EERB 1AD0B 2B1HH 3LIZL 4HK3N 3B9EA 3GBLA 3P30H 1PZ5B 1NMCC 2R69H 5TH2A 4M6MH 2A9NH 4W4OA 5FCUL 1RJZB 1NMCB 2FB4L 4YDVB 1Q0YL 4P2RA 1DL7H 4XCYA 4XMPH 1NBZB 4Z77B 2HWZH 1TMCB 3W5MA 3D18A 3DGGB 4P5TC 1CGTA 2FECI 4P5TB 4ZFOA 2I9TA 2GHWB 1CG9B 4YR6B 1KN4H 1FIGH 4DKAA 1UADC 3ULSB 5GGTH 2V17L 3DVFA 4X6BB 3PWPB 4C59B 5F6IC 4BQ9A 3QDGD 5JQ6H 1J7VR 5F1IB 4S1DD 1BWMA 4DKFH 1CE1L 3MLTB 1TJHH 3AREA 1ROWA 3KVQA 3OKNB 4X0KB 1KC5H 3WBDA 1JNHB 1MCOL 1LO0L 1XCQB 2V5SA 1UVQA 1JGVL 1CGSL 4F7PB 3ZMRA 1QQDA 1U42A 4XI5C 3BRGC 3QUYC 4K3JL 1FAIL 4H0GA 2K7PA 2IBZX 1UB5A 4F9PC 3MLXH 1BIHA 5BOZG 2VL5A 3U79A 4OCYL 2HT4D 3NCYS 1MFEH 4PRNB 4X9BA 3FQXB 3IYLW 3WKMH 3WSQL 5DD6A 3KPRA 4PJEE 4U31A 1NSNL 4JLRA 2EDKA 1FO0L 1KCSH 2X4NA 3CVHA 1OP3H 3ZE1E 2EEBA 4GSDH 4P23C 4XNYL 2Y7QA 1HQ4B 4P23B 1A7PH 5HHME 1MUJB 2HRPL 2J3SA 3RJDA 5IUSA 1S7UB 2HJFB 3GJFA 4RISL 1WCBA 4XZUA 4ENED 1YPZA 1U95A 3LEVH 1A7OL 1KB5L 3AY4A 5C9JA 3WD5H 4LVHB 2CDEB 1EGJH 1OAYH 4TOYL 1XGTB 1QRNA 4EIGB 2P49B 3MRKB 4YK4C 3VGEA 3B43A 4YK4B 3WO4C 1IEBA 3WO4B 2MNUA 1D5BA 2E7MA 5DRXB 5B3JF 1T1ZB 4GKZA 4NIKB 2XNAA 4GAYA 3V6FB 4OSUH 4R8WL 5J11C 4G8GE 5GGQH 4FS0A 5JDSA 1QFPA 3VFVA 1MJ7H 4XP5L 5EORH 3IXAA 3SEPA 5IVZA 3TA3C 2AJ3A 4HG4J 1M71A 2GTZB 5EU6A 4JR9L 3REWA 2X2YA 1IGFH 5EUKA 4NQEA 5FUOH 2EKSB 1RIVH 1N2RB 3CFIC 2XWTB 4L5FH 1J1PH 2P7TA 4OZHE 3VXME 2W07A 3NZ8A 4E41A 5CEZH 4R9HA 3B2VH 3HNSH 5DVNA 4UT6H 2ICWI 5D1ZD 5I1JL 2P5WE 3BHBA 4PV8B 3UBXI 5C9KA 3IDIA 2HLAA 1OSPL 1PLGH 4JKWA 1U2CA 1MCCA 3ARGA 4F8QA 1S8DB 5I2IB 4DTGH 4HWZA 5DS8A 5DR5L 1E28B 2DBLH 2PW2B 3MRRB 2ZCKL 2KKQA 4M6NL 4G6JL 3DXAA 4PRHA 5C0AB 1LO3L 2X4UA 4ZTOH 4LSUL 4QRPD 1JTPA 3VFTA 4HSQA 5SWZE 2VLRD 1NDMB 4Y0GA 3C2AH 5E8OA 1E4KA 1LEKB 1FBIH 2LV4A 1IAII 4UBDC 1V3KA 5J9PA 2HVJB 2IPUG 1RIUL 2Z4QB 1GZPB 3NA9H 2DKMA 5CD3A 5CJQL 4AH2A 4XAWH 3Q5TA 4IIQC 4AT6B 5ICXB 2XQBL 3V6ZB 2AXGA 5HHQA 2HMIC 4NFDA 4KMLB 4M6OH 2AV1B 3HZYB 4IDJH 2AW2A 3RI5F 3BH8B 5JNYA 5HGGS 2NR6C 5FM5M 1MPAH 3PWVB 3VXUA 4FQ1H 5TQ2L 2VR9A 1PG7L 3ARBB 5F88B 1OAKL 2QSCH 2H3NB 2PXYA 3QNYA 4Y4FA 4QOKA 1ZE3C 3WNOA 2V2TA 4UINL 3HRPA 3TO2B 4UTBH 5KSUA 2F19H 2NY4D 2ARJA 3HTLX 4KQ4L 3KJ4B 1JVKA 5FF6B 3T2NL 4BM7A 4OLUH 4ETYA 1QLEL 3GMRA 5GHWL 3CX2A 2DLFL 3GMQB 3ME0A 1WSST 3MJ7A 3T0WA 1NGWB 1QKZH 4MCZB 2H6PA 3MNVB 3B3IB 3H9HA 2A1WH 4OZIE 2K1MA 1JNNL 3R0MA 4W4OC 2AK4A 1I8KB 5F7NC 4IOSD 5LVEA 5AAMA 2IG2L 2BVQB 4XCYB 3TV3L 3DI3B 3D18B 4KJQC 1HINL 4KJWC 5BRZE 4N0RA 4ZFOB 1QYGH 3WLWC 4G43A 1OQOA 2DQHH 2ZCHL 2GI7A 4NGHL 1MCPH 5CZVL 4OUUA 2R0KL 1A8JH 3QI9D 1PG7W 1OAQL 4JO2H 5I1HL 3KR3H 3MUY1 5ALBH 3LEYH 4MD5A 3TBSB 1KELH 3X14A 1RQ5A 1BQHG 4G6AC 5FM5O 3AREC 2W65A 1OAZL 2VLJE 3N1FC 1GL4B 1ZEAL 1HHJB 1N6UA 3QCTH 1B9ZA 3HMWL 5CJOL 2YPVH 4MJ5B 1QVOB 1N5AA 2CIKA 4OD3H 2Q6WA 1QQDB 1PG7X 1B0WA 1K5NA 5DGRA 3VFPA 2LU7A 2AKRB 1H3GA 2F9BT 4BFIB 2APXA 4GQPH 4GS7B 1UB5B 4N0YH 2OS7A 2VL5B 1Q9LA 4RDQG 3BPNC 3T3ME 4XWGH 1CTOA 3BPNB 4AENA 4XAKD 1CVRA 4EUPG 3QPQC 3BMWA 4YDKH 4FZEL 3W0WA 3WNPA 3DETD 2A6IB 3CVHB 4PV9B 3O2WH 5DRWA 4YPGA 2X7LA 4HBQA 3GIZL 2Y7QB 1XZ0B 1J11A 3E0GA 2ICWA 1F4HA 3O3AA 1CDCA 4H1LH 3ZHDA 3MBEB 4ZO7A 5J8OA 1G7HA 3UBXA 1GC1C 5H94A 4WWKA 2L0DA 2BHYA 3L3HA 1H3UA 4UIMA 3NCEB 5DEFA 4YE4H 4XZUB 1HH6A 1WAAA 4YX2H 3PQYD 3AY4C 5C0CB 2FL5A 1AXSA 2C1PA 5C9JB 1IMHC 3C08H 4D9LH 4O58H 4W6WB 5C70A 4XHJC 3L7FA 3BJLA 3KYMA 1YEHH 4OT1L 4OQTH 5T1KA 4L4VE 1JJUA 4GKZB 4QTIH 1UA6L 2XNAB 4GAYB 3C5ZA 5IROA 3ESUF 3ARVA 1J0KA 2D9QB 4TTDC 1FC1A 2EDDA 2NZIA 3NIFF 4XC1L 2OR9H 4M48H 2VITA 5IVZB 4ZXBD 2AJ3B 2RAMA 1M71B 3REWB 5DRZB 2CD0A 5I8EB 2BHZA 4WCYH 2XV6B 5JHDB 1NEZA 4I77H 5GZNC 1U8JB 4G9FD 5E9DD 1RUAL 3G5XA 4NQSA 4LSQL 3NZ8B 4FFVC 5LJYH 4PJAF 5TFSH 4O2EA 3PWNB 5E8PA 1W0YT 3BHBB 4KKCD 1ZLWK 4F2MB 5GRJL 2EKJA 3ARGC 3AS2A 1JGLL 3G6AA 3GHEH 4KROD 4HIIA 4BH7B 2IPUK 4HGKC 3VXOA 4HWZB 5DS8B 3VRIA 4JM4H 1K4CA 4H8WC 3VG9C 3NTCH 3MJ9H 4AQ1B 2CLRA 3DXAB 4PRHB 3VG9B 1BVLA 5F21B 3BP4B 3NCCB 5J6HA 1YMMD 2X4UB 2Q20A 1EX0A 2YPLE 3VFTB 3O9WB 3RGVB 4Z7UB 1E4KC 1V5JA 3CMOL 5E8OB 4NC1E 1XIWD 3E6HA 4UNTA 3S34H 5J9PB 2D03L 2WW8A 4X4XA 4TVPH 4AH2B 5JO5A 3A6CL 4IOIB 3SGDI 1BEYL 1P4BH 4NUGL 1A7BA 4PRDA 15C8H 1ZXQA 3BH9A 5JNYB 5DQDL 2PYED 3UJJH 4PRPB 4J1UB 3I50L 3VXUB 4OFPA 4DW2L 1MHPH 5B22A 2FX9L 5FCUH 2PXYC 3LEXA 4Y4FC 5IVOA 4H5SA 1F90L 3UJIH 3WV0A 2PXYB 3QNYB 4Y4FB 1F2QA 4QOKB 4KKBD 3NGBB 2ESVB 1WZ1L 1ZHLA 4GMTH 5KSUB 3MCKA 1L6XA 4YEFA 3QIBA 5CKAA 5B4MC 4GT7A 5IBLC 3MSPA 4IJ3C 4MDJA 3CZJA 3GMRB 1BJ1H 5ACZA 4K2UH 4O5LL 1IT9L 3DOSA 4FTVD 2W9DH 4DVRL 1ZHBA 3MJ7B 1FNGA 3TN0D 3KPSA 3QWOA 3H9HB 1OL0A 2VAJA 2LVEA 3DYOA 3MGOA 1G7IA 1NFDE 5E1HB 2AK4B 4F3FA 2BNRA 4LPWA 4YHZL 3T0VA 1JGVH 3PXHA 3TJEL 4NOFA 5DFVC 1Q8MA 1FLRH 4LBEA 3RP1A 4Z6AT 2NX5A 1WIUA 5C3LD 2Z92A 2B1AH 3DX6A 3OR6A 5TPWL 5IFAH 5L9DL 3O6FA 3WJJA 4U6XA 4U6HA 2DN7A 1RK0A 1YJDC 2D31B 2FWOA 3VMNA 1D5IL 2XFXB 3KLSA 1F11B 3MRNA 4OUUB 2N7BA 1WZLA 1JHTB 2AJYL 4D0BA 1FO0H 4F7EA 3X14B 4Y1AD 2O26U 1JUFA 2B2XL 4HUKB 1QLRB 4CN1A 3M1BA 3T65A 2WLZA 3RL2A 2HRPH 5E08H 5GZOD 5CAYB 5GSVB 3ULUC 4Y19A 1YEKH 1N5AB 2CIKB 2QTEA 2Q6WB 3U46A 3NPSC 1K5NB 5D6CA 3VFPB 3NPSB 5FYLH 2EDFA 1PGRB 1KENH 1WJ3A 1HKLL 1LDPH 4NUJA 1A7OH 3UPRA 4NCC2 4M00A 1I4FA 1QHOA 4PJ9B 5CS7A 3MGTA 4AM0A 3P0VL 3S88H 4AENB 4JDVB 3RWJB 1BF8A 4B5EA 5C0RH 2DICA 1FPTL 5DRWB 4R8WH 1S5IH 4EN3A 5HHXL 4ZUSA 1S7VA 2ICWB 4ODSL 2D7MA 4WWKC 3UBXB 1CFNA 5H94B 3L3HB 5I1KL 4UIMB 3SDAB 3C5SB 4QEGA 3RWDA 1HH6B 3ZYIA 3RKDC 1UWXK 1GGYA 4LDLB 4JRYE 5T3ZH 4ALAH 3L3GA 3NIGF 3L7FB 3KWWA 2DKUA 1G6VK 2GSIB 2Y9RT 5A2LH 5T1KB 2D9CA 3ZSTA 3C5ZC 1KXTB 3MJ6A 3S4SG 3RX8A 1EMTL 3D6GA 3C5ZB 3L3KB 3KPOA 4RZCB 2VDNL 4WHYH 2DQUH 5DR5H 4M6NH 2GJZA 2OR7A 3OXSA 2VITB 1I3RA 1Z0MA 4OZFB 5MI0C 2AVGA 4LSUH 3MYJA 1K6QL 2DTMH 4HLZH 5TE4L 5MI0B 4AEIL 4X9HA 2FEDD 4MXVF 2JELL 1A3RL 1NCCH 5E7BA 4TSCL 2EC9T 5CJQH 5CP3H 1HYSC 4HJ0C 1BWWA 4JPVL 3CDYA 1C1EL 5E8PB 4K71B 5MP6L 4LU5H 2MMXA 1J1OH 1JWUB 3G6AB 2O5YL 3VXOB 3QUZD 3VRIB 1K4CB 1T83A 4WFGD 2K9UA 4LPYA 2QHRL 1OAKH 3BPCA 2CLRB 4OKVA 1BVLB 4XI5D 2X05A 3QUYD 5DD3L 5J6HB 1JPFA 2UY6A 1YC8A 1A5FL 2ORBL 4UINH 2CLVB 1TVBA 5DMIL 4JY5L 2EH8H 2P5EE 5GGTA 4FFYL 4KQ4H 1ZT4B 4AYFA 3ZT5A 3SCMA 2PTTA 2NCMA 3JUYA 4YPJA 5JO5B 1F3DH 3QFJA 4OD1H 4PJBA 5GHWH 3MRIA 2YZ8A 4P99A 4R96A 5I19H 2Y72A 3F6LA 1CFVL 2VN4A 2C3HA 1U8QB 4X6CF 4ZAKA 1MWAL 3UO1L 5D71L 1JNNH 4U1NB 4YHKL 1ZT7A 2RBLA 4QHKJ 1QBBA 1RJCA 3RWGA 5GRYA 4H20L 4JZOA 4H5SB 3MLWL 1CGXA 4WI9A 2WBJD 1HINH 1ZHLB 4GOSA 4HIHB 3MCKB 1FRGL 3TO4D 4HXBL 3QIBC 4DN4H 2C3XA 3D9AH 1K8DB 2V9RA 5FYJE 2VRAA 1WF5A 4MDJB 1LP9F 2R0KH 1DLHA 5F9OL 1QZ1A 5DUPL 1ZHBB 1WQVT 1FNGB 2J8UF 3QA3A 2G75B 3KPSB 3QWOB 1OAZH 5JR1L 3TA3D 4NQUA 2FGWL 1ZEAH 3MGOB 1G7IB 5JLZB 2UWEA 3IJHA 4F3FB 2FIKA 2AEIT 2BNRB 5ANME 3SQOH 3HR6A 3HMWH 1FG2A 3HR5A 2DQIL 2NY1B 4LLYA 2HJLA 4LBEB 5MENA 5F9AC 2NX5B 1EGJA 1I7RA 1N59A 4PGBA 3O6FC 3JTTA 3WJJC 4PLOB 1FDLH 3O6FB 4YAQA 2FJHA 2W60A 4U6XB 2WP3T 4L29B 4HXAH 1EJ6A 2FWOB 3P73A 4DGVH 3C6LC 1G9MC 4D0BB 3C6LB 4K94C 5C0AD 4YFLF 1TQCC 5CP7B 1CI5A 3KAAA 2BNQA 2VXSH 3M1BB 2J5LC 3CDCA 3T65B 1LEIA 4M02A 2J5LB 2J12B 3RL2B 1NC2A 1A9BB 1FN4A 4ZODA 4XTRC 3QXDA 2EDLA 4Y19B 4GRWB 5E70A 3U46B 2CIIB 4UBDD 1TQBC 4Y5XA 1BM3L 2BY1A 4PJEF 4NUJB 4POZC 3UPRB 3QQNA 2VNCA 1FYHB 3ZE1F 2HMID 3GMLA 1FZOA 1QR1A 1IKFL 4DKDC 1BFSA 3NACL 3MGTB 1XF5A 1MEXH 3LMJL 3ARDA 3MLRH 1VEMA 3P11L 5T1MA 2NR6D 2EICA 5JXAL 3K8KA 3SE9L 2BC4A 3CUPA 4KRPC 4OT1H 4KRPB 4M7LT 1H0DA 5ID0A 1IGIH 4EN3C 4G3YL 1G0YR 3LZFH 4EN3B 2F54D 1MHHA 4JGMA 1X5YA 2ADFL 4ZD3L 3O3EA 1QSVA 3U0WL 1H15B 3L6FA 1TETH 4HX1B 4Q9CA 5KSBE 5DJZA 4U6YA 3PG2A 3RWDB 4ZG1A 1L7TH 2XKUA 4PUBH 3GMOB 4Q2ZA 1RUAH 3VD7A 3L3GB 3RUGE 1E6JH 1MOEA 3EYQC 2R4RH 2YA1A 3UTSB 2YA0A 4R4FL 1JCKA 4NN7C 1TITA 4P2RD 1JGLH 3FO1A 4NN7B 2CXGA 5DJYB 3KPOB 1DANT 1RFDH 2GJZB 1MFCL 4KJQD 3OXSB 1I3RB 4OZHF 5A16B 1BJ1J 1NBVH 2F5BL 3FQUA 1C5DA 5LGHH 3GSWA 1XF1A 3MOBH 2JK5B 3T0DA 1TNNA 1MCEA 5KJRH 2OLDA 1NMBL 3RAJH 3DGCR 5B39B 1NGYB 3MV11 3LKSA 4G6AD 1MI5B 2A0LC 3ARED 4FXLA 2VQ1A 2DQTH 2IANB 4NUGH 4ZNCD 3T04D 3HMXL 4TSBL 4WDIA 3IRZA 4LHQB 4Z9KB 2XA8L 4I9WD 1CD8A 1PKQA 1T83C 4DW2H 1EFXA 3BPCB 5IEKA 5JOPE 1T7YA 5EN2B 1JPFB 2CLZB 3SDXB 3MXWH 2VC2L 4HS8L 1TVBB 3C5JA 1JZ5A 1P84J 3MRJA 1LD9A 3GSXA 5CINH 3KPRD 3SCMC 3QPQD 4PBXA 3SCMB 2PTTB 3DBXB 4Z7QE 1F5WA 2I5YH 5IG7A 2DL9A 3QFJB 3FT4A 4PJBB 1ZLSL 3CD4A 3BE1H 1A4KA 3QUMH 1F3JA 4S10A 5I76B 2WQ8A 2ZUYA 3BJ91 1FE8L 4R96B 1K3ZA 4ZAKC 4JDZA 4YHIA 5IF0A 3D5OF 4S1SH 1NJ9A 1ZT7B 1OT1A 4YHZH 1II4E 1KPRB 1I85A 1CICA 3TJEH 4EBQL 1QRND 4HAGA 5ALCL 4P57A 1G0DA 5IKCB 1KTKE 5MEPA 4XHJD 5TPWH 4KKLC 1JF5A 1RUQL 4LLMB 1MCLA 5L9DH 4JRXE 1T1YA 4DZ8B 4N9GA 4P3CL 5HJ3A 4Z7VA 3NCYP 4OZIF 5IMKA 3WDIA 5IIEB 1QSFA 1DLHB 1D5MA 4WJ5A 5I8CB 4MJIA 5JORA 2GTWB 3JVGA 5T5NF 2A83B 4N90D 1EUUA 5LG1A 3IETB 3HE6D 4Z7NE 5CHNA 1U2HA 3FOLB 1N8ZA 5J1AB 5E7FA 5E24E 1IAMA 4HCRL 5EU6D 1V7NL 1B2WL 4NQED 1H9VA 4TUOA 4MAUL 2X41A 3HR5B 1IAKA 5KZCD 1MREH 4KVCH 1I3VA 4BKLA 3OAYK 4LLYB 1BLNB 2HJLB 5MENB 4E41D 4MDIA 1AKJA 4FFVD 2R2EA 2ZUQC 1I7RB 1N59B 3JTTB 1NLDL 4JQIH 2FJHB 1T04B 2MFNA 1AQKL 3PDOA 4AZ8A 3VXRE 1X5ZA 2R0LL 3ARGD 3P73B 1YY9C 4ERSL 4OQTA 5KN5B 4MA1C 4KTDL 5TDNA 1T80A 4MA1B 4X80H 1GGTA 2DLHA 4PRHD 4M43L 5EOCH 5DMKB 5HYJD 2BNQB 5T5FH 5I1LA 3X13A 1LEIB 2HG5A 1QO3A 2EZ0C 5JPMA 2XYCA 3VGBA 1J10A 3QXDB 4Y5XC 4FQCH 4KUCF 4UI2A 3T3MF 3H42L 3BZDA 4Y5XB 3ILPB 4HJJH 3CLEH 3FO9B 1C8PA 4I0PA 2E6JA 3BZ4B 2Q1EA 5GGUA 3ARDC 3S6CA 1XF5B 4N5UA 3ARDB 4PJCA 1JE6A 3ARTA 5T1MB 1I8MA 5ISZD 4IRSA 3CUPB 4OAWA 1EEZA 1H0DB 5ID0B 3VWJB 2ZCLH 4OD2A 2CR6A 5BV7B 3MJ9A 5BVPH 1MHHB 3MZTA 3MCG1 5D4QA 1F3DJ 3VDCA 3CSGA 1J88A 1LO5A 2R1XA 3L6FB 3TBYA 2VUYA 1QUNA 5DJZB 2EXYC 4KKAC 2JELH 4UV4L 5B4MD 2CGRH 2X4TA 1A3RH 3AC0A 5IBLD 1I1AA 1XR9A 4Q2ZB 1WCQA 4CN4A 1VDGA 3L5JA 3LPGA 1Y18A 5L88H 1J8KA 2AK4D 2WBKA 3SDCA 2FR4A 3FO1B 4Q9RL 4E0RA 5EUOE 3FO2A 4JY6A 1Y6KR 3UBXG 5D1QD 2GK0B 3MPCA 3IS0X 5HI4C 2VXTL 2QHRH 3KYKL 4R7DA 3QFDA 5DD3H 4KZDL 3FQUB 1A5FH 1C5DB 3JTSA 4PYHA 2CRZA 2ORBH 2VDQH 1CGVA 5DMIH 3DMMA 3GSWB 3KNBB 2Y06L 6FABH 4JY5H 4RRPA 3BKML 1OTSC 2D4FA 1A6TB 1YEGL 2OJEA 3BKYL 4YXHL 2FX7L 2EDEA 1G7PA 2EE9A 4NBZB 3RVTC 3NABL 3H3BC 2OMNA 4QRRA 4LCWA 4MVBC 4KAQL 4RGNE 1I1RA 4RMSA 4OLWL 4WDIB 3KXFB 3UO1H 4FG6C 5D71H 3F7YA 3ULUD 5EDXA 1SEQL 1U3HA 4I3SH 4JQVA 4RQQB 1JNJA 3BN3B 3I9GH 5IEKB 5C09A 4FQIH 4P49A 3VDAA 3GI8L 2VSDA 1CVSC 2PTVA 4P0DA 1NEZG 5T1DL 2V2XB 4LCUA 1G7LA 4XPAH 4U1KA 5JXEA 3W0WD 1EAPB 5AZEH 5E6ZA 2APFA 5IG7B 5C71A 4MA7H 2BY2A 3FT4B 1FO0A 5GPRA 1DQMH 1F3JB 1KCUL 2PUQT 5DUPH 1A6ZA 1NFKA 2VH5L 4WWKD 1GCFA 1TZGH 4DGYH 3FL7A 5SWQA 2FGWH 4HKBA 1NJ9B 3UYRH 4I5BA 1LO2L 2VLKB 1IRAY 1X5JA 4LSPH 3DVGA 3REVB 2CR3A 4EOWL 1IARB 5FCSH 1I85C 1CICC 4U33A 4GG8B 4QWWC 4KTEL 3M45A 4K3DL 5MEPB 4ZS6C 5B8CA 3TCLB 1T1YB 3HG1B 2XOTA 4N9GB 5T1KD 1CIDA 4Z7VB 1DSFL 1GJIA 4AIZA 3E3QC 1NFDF 1IAIM 3JVGC 5DA0B 1D5MB 4P2OA 4WJ5B 4MJIB 4NHCL 2MPAL 2VISA 2ID5A 4U1SA 5CHNB 1UCTA 4AK1A 4MNGA 3D3VA 3B9VA 5J57B 1R3IL 4TUOB 1IAKB 3MXVH 4MMXC 3U9PL 4UQ3A 5GQBA 4BKLB 1Y0LA 2QSVA 5FYKU 4C56A 1AKJB 2R2EB 3RWHB 5FK9A 2VSCA 5J56B 4F57L 2I24N 3UC0L 5D7KE 1IKFH 3PDOB 3NACH 1KCRL 2Z31B 3LMJH 4UU9B 2D7NA 3DVIA 1F4AA 4P3WA 5SX5H 2VDOH 3P11H 1H3PL 2ED9A 5JXAH 3BZEA 1U8HA 3PWUB 4M93C 2B5IC 5EBLB 4QRQA 3JZ7A 4M93B 2ENYA 2B5IB 3EHBC 5I6XC 2Y5TA 5I6XB 2AK1H 3X13B 43C9B 4P4KB 3FO0H 3RVWC 4P2QA 5JPMB 4GH7B 5CIPA 5ESVA 4V1DB 1H3VA 2DB8A 4I0PC 3BIKB 4I0PB 1YN7A 2P47B 4LARL 5CP3A 4G6ML 4BFGA 2QADC 5GGUB 2R0WH 1G7JA 1NUGA 1S9XA 1IGCL 2EECA 3PWJA 4YNYB 5IHZA 4HUUA 4IRSC 3GDBA 5AAWA 1I8MB 4R4FH 1Y6MR 2DWDB 4TQEL 1BF2A 4OAWB 4QF1B 2I60L 3DUSB 4JFPA 4ZFGL 1FL5B 4BH8A 5FHBH 5DVOA 1FGNL 3QT2A 1RHHA 1OD7A 1S7TA 4NBYB 1WC7A 1CN4A 4XH2A 3FFCE 3D0VB 3C8DA 3J7HA 4OM1L 3TBYB 1AFVL 3DX9A 3QIBD 2A73A 3U7AA 4R4BA 4X9IA 5CJXA 1MRDL 1I1AC 2MQCA 2V7HB 2X4TB 1I1AB 1XR9B 4YHYC 2FDBP 4YHYB 5D2NE 5AUMA 1NMBH 2D3VA 4Y4HB 3KPSD 3ZZ1A 1JFQL 5I18H 4FP8L 4X99B 1Y18B 3VFOA 1ACZA 1HHGA 3SDCC 2FSEB 3HMXH 5DQJB 3KLAB 2BNRD 1O7VA 4HWBL 4GKNA 4E0RB 2XA8H 3D0LA 3FO2B 5F1OB 1RPQA 1T22A 4GAGL 4JY6B 1QBLH 3VG0H 1ETZA 1U8MA 2GQHA 2R0ZH 1GIGL 4UUJB 4K7PL 3IDNB 1UZ6F 2BSTA 3O6FD 1H5BA 2X42A 3DX8A 4WUUA 5EB9A 2VC2H 1TFHA 3DMMC 5FYJL 3QJFA 4S1RL 2X5PA 3CDFA 4NZTL 4KPHL 5K9KA 4EEEA 4PRAA 2XWJB 4XCEA 2KZWA 4LLDB 5C07A 3ZO0A 4MX7A 3FT3B 3QDHA 3KLHC 1HDMA 4JREB 1SYVA 4OKDA 3NOIA 1VFAA 3NIDF 4LCWB 1GH7A 4KY1H 2DM4A 3B9AA 4UB0H 5M95B 3BUTA 4ZUTA 3V95A 5I8OL 1BOGA 4XTRD 5HHVL 1U3HC 4HULB 1ED3B 4JQVC 5EU5A 3T09A 4LLQA 1U3HB 3T3PF 2AXFA 5F7WC 4ELME 5GS0L 4MQ7A 3ARRA 1M05B 3FT2A 3EYFA 5C0GA 4JGUA 3TGXA 3G08B 2J6EH 1RZ8B 3TIEA 5JXEC 4LCUB 5DJCA 4U1KB 5EOCJ 2VWEC 1YN6A 2NXZC 1IM3B 4U0QB 2C1OA 2BMKA 1GAFL 1DUYA 2NXZB 4DFHA 5IFHL 5HGBA 4NKMB 2XN9E 4KRPD 5A43C 4X6DA 1OGAB 2WWMC 4M7KH 1AGBB 1FO0B 3CPLA 2VYRE 5J6GA 2BFVL 5A40E 1U93A 1NCDL 4U6TA 3L5HA 1S7RA 3H6JA 4I2XA 4R26L 5SWQB 3WFZA 1NEUA 1R3JA 5GGRA 1CL7L 1ZTXL 4CMMA 5F7KC 4S2SA 2Q8BL 4LCYA 1D5ZA 4DFIA 2E7CA 3BVNB 1KB5B 1TTGA 3PIQB 4K7PX 5B8CC 2UUDK 3QIUD 5B8CB 3EYQD 2E9BA 4U3CA 1GPOH 3CK0H 4GQ9H 1NBYB 1ES0B 1FGVL 3QDGE 4P2OC 3U36A 3H3PH 3TNMA 2YK1H 3WLBA 2FHFA 4YUEH 4TRPH 3INUL 2VISB 4U1SB 1W72L 5AG8A 3HNTL 3UX9B 4UOW0 5CUSL 3UTQA 4XNZC 4LIQH 5A3IC 3PXJA 3D3VB 3MV9A 3NFPA 2A6DA 1MELA 1CFSB 5KS9E 4UQ3B 2HJKA 2ADIA 5FHAL 3L3OA 1A47A 1Y0LB 3GFUA 1B4JL 1N3NA 4KK5D 2NNAB 2V2WB 4C56B 3MV7A 1FNSH 1F6LL 1BBDH 3HE7A 5FK9B 5JMRA 5H37H 4AIXA 5HBBA 2A0LD 4QT5A 4OJFH 2DIAA 2GT9A 5B38G 4FQJL 3BZEB 1U8HB 5DHXB 1WZKA 2BVOA 4YQXL 5I1IL 3VXNA 4CADA 1PX3A 5ECJE 1KCVH 1Z6JT 4GW1A 4XP9L 4L3EB 5HYEA 2NY7L 4Z7WE 3W82A 5CIPB 3K2UL 4HH8A 4GRLA 4Y5YB 4AQOA 5ESVB 2D7OA 3SCMD 4D9RD 2BERA 1UWGL 4UV4H 1ZLVH 2H2SC 5FGRA 1YN7B 3R1GL 4NQCD 3QDJD 2X9XA 4ZAKD 1S9XB 1ZHKA 3PWJB 5IHZB 4HUUB 1GOFA 2RQ8A 2VDKH 4B7IA 1AO7D 1A6UH 5KSBF 2YD5A 3EZ8A 1N64L 4BH8B 5C0NC 1QFUL 5C6PB 3T1WA 2WLYA 4PGJA 5KVGL 1RHHB 1S7TB 4FA8A 1WC7B 4XH2B 4XVSH 5LGJB 3B9DA 4ODBD 1ONQB 4J4PD 2C4FU 4KZDH 5EZOH 5CJXC 3RUGF 2A73B 4R4BB 4JE4B 3WN5A 1YEGH 3AAZB 3BKYH 4I3RL 1XF3A 4LASL 4YXHH 4JFFA 4X7TB 1TIUA 3O8XB 5KG9A 3QUMA 1BBJA 4IEFB 2AABH 1WVZA 4KAQH 5BS0A 1MJ8L 1HHGB 2MKWA 1MCJA 1FNAA 1YYLH 4OLWH 1V05A 4YDJA 1XMWA 4LSSH 4DAGH 4HH9A 4GKNB 4FABL 2HA1A 3D0LB 3SKUD 2Q3AA 1T22B 1SEQH 4QXGL 1X4ZA 3RIFF 3LPWA 4QRPE 3CDGB 4FFZL 2VLRE 4WUUB 5EBMA 3GI8H 3T0AA 5DUBA 1R24A 2C26A 4PRAB 4XCEB 5L2KD 1YY9D 3AS0A 3OZ9L 5C07B 4ZPTA 4N0CC 1ND0A 4YFLI 1HDMB 1SYVB 3OGCB 3SE3A 1VFAB 3BRDA 43CAA 4KJPC 1P7QD 4CRPA 4F33B 1KTLA 3EOAA 4KXZI 4WNQA 3V6BR 4G8FA 4P9HL 1NC2D 1OARH 5DJXA 2VH5H 4BSJA 2DBJA 5DTFB 4ZUTB 1I1YB 1BOGB 3FQNA 5EU5B 2Z35A 1LO2H 4XMKL 1QD0A 1ZA3A 3RU8H 2DM3A 4O9HL 2ADGA 2AXFB 1PJ9A 4OIBA 5F1KC 3VFGL 2XQYG 3ROLA 4LOUC 4Z7QF 5CEZD 2R56H 4Z0BL 4Z8FH 3BP5A 3FT2B 3EYFB 5C0GB 3VFRA 5BMFL 2CXKA 1A1OA 1YN6B 1GGBH 4OCXL 4R90H 2C1OB 2BMKB 1DUYB 4PJAB 2H26A 5FGCE 1DSFH 4KWUA 4U1GC 3GSNL 4U1GB 3CPLB 4PJ7E 5J6GB 1E4WL 4NHCH 2MPAH 1EA9C 1ZVSA 2NY3D 3QB7C 3TYFB 1S7RB 4I2XB 3PNWB 1U0QA 3GMMA 3T0ED 1R3JB 5GGRB 5FGBA 1G1YA 4CMMB 1MIEL 1R3IH 1XF2B 4D9QD 1D5ZB 3DV6B 3IDGA 3U9PH 3LQMA 1NAML 2KL6A 5HTSA 3VW3L 2ZNWA 2CDFA 1KEML 1IC4H 1MFBL 5EIIB 3RWFB 4Z7NF 2X89D 4HD9A 5EH1A 3HB3D 5EC2A 1IBGL 1H3PH 1S7XB 1JF1B 3HUJA 3U36B 3TNMB 5DDHA 4U2ZA 1PKOA 5EZJB 3HLAB 5EG6C 3OKLA 1CZ8L 5E2JA 1ODAA 1G7MA 3ZYOA 3UMTA 5F7YC 1JYVA 5FO8B 1A2YB 2A6DB 4NP4H 3OKMA 4BQBA 1CDJA 1OTSD 2XT1B 4HGWA 5HHOA 2HJKB 2ADIB 3DSFH 3QEQD 3OJDA 3HE7C 5I1EH 3MUGA 2UYLA 4ORGA 3HE7B 3MOQA 4MVBD 4G6MH 4QT5B 3L9RA 1G84A 1IGCH 1CFTA 3G5VB 5D96C 1LNUB 2GT9B 4FG6D 4PJHE 4H1LG 1EFXD 3I3DA 4HT1L 4PJ8A 1F58H 3RY5A 2CRMA 3NVQA 4GW1B 4HS6A 1HK6A 1FGNH 1CXEA 1URLA 5AWNH 4GRLC 4RFOL 5IB4A 4ZO8A 5IMMB 3QCVL 3PQYE 2E3VA 1T2XA 5FM8A 1JNLL 1UM5L 4HPOL 1NUNB 1X6NA 5DUMH 3CSBA 3WXWH 5E0QA 2YC1B 3MACL 1OM3L 5LQBH 1N5YL 1U92A 1J8HA 2CJUH 2MJWA 3QRGH 4XPFH 1JFQH 4QCIA 3V0VA 2G5RA 3AMLA 1ZHKB 2FO4A 4EIZC 2FATL 5D7IF 4ODHL 4G6FB 1MWAA 1KFAL 3AVEA 3MRQA 2COQA 4GW5A 1ZMYA 3VXSD 2EYSB 3V6OC 5HGDA 1CICD 1RV6X 3BKJL 3PP4L 2CUMA 3MJ8B 4FMKA 1KUMA 1JGDA 1Q0XL 4DUVA 3W2DL 3MR9A 2JIXD 3N1GC 4PJEA 3G6JE 3WN5C 4S1RH 1E6OL 4KPHH 4G9FE 5E9DE 1CGWA 1QSFD 4OLYL 1XF3B 2W0PA 2AEPL 1SJHA 4PLKC 1PZUB 1JGEB 5EUOF 2IALB 5KG9B 1BBJB 2YMXH 4YHOH 4U6VL 4NYLA 5BS0B 5C92A 3B5GA 1TNMA 5KANI 4YDJB 1NPUA 5BCAA 4HH9B 1RUPH 2XRAH 4EI5A 5HHVH 2ADJA 1FNHA 4BUHA 3ARQA 3KLDA 4FN0A 5F71A 1T2QH 1AKJD 1FFOA 1JI1A 1YMME 1C7TA 2P1YA 3WFHA 1WLHA 2WV3A 5EBMB 1MJUL 5DUBB 1R24B 1HCVA 1I7UB 2XZCL 4NM4H 1W0WA 3CXDL 5IFHH 4ZPTB 3SE3C 3BYTA 3FAWA 3CFBB 1QFWL 2XQYK 1SJVA 1XT5A 3LS5L 1KJ2L 3BDXA 3EHBD 4GUPA 2BFVH 2VDLL 1KTLB 3EOAB 4WNQB 2ED7A 3PGDA 4G8FB 5DFTA 2PYEE 3BKCH 3FMGL 2FNBA 3KDMA 3RVWD 4NKIL 5DGQA 1A6PA 4N68A 4R26H 1T5XB 3ARWA 5IFJA 1OT2A 3FQNB 1DQJA 2Z35B 1QSEB 1ZA3B 3RVUC 2ADGB 3VXMA 1OW0A 4KRNA 4WGWB 4UNVA 3O2VL 1CCZA 2IPTH 4I0PD 3ROLB 2EC9U 3EDKA 4Z0XA 3BP5B 4RRPG 3MRGA 1SJEA 2P5WA 2QADD 3V52H 5AG9A 3MLYH 3LRHA 3BD5A 1A1OB 2X1QA 4XB7A 3KYOB 4IRSD 1MFAL 2H26B 2N7AA 4G6KL 4Z7OE 2R8SL 1FGVH 4FTVE 2ENSA 1UYWH 2IFFL 2KUTA 4LDEB 3U83A 3RIAF 4NQXA 3EFFB 5I9QC 1UWEL 5EWIL 1ZVSB 4YC2C 5SWZA 5I9QB 4YC2B 2NLJA 5CUSH 2WANA 5FGBC 5DT1H 1NCBL 2E27H 3DARA 1Q9OA 4WO4A 1EDQA 4TVPD 3IDGB 3MCLH 2DQCH 4P4RA 4J3UA 4N0UB 1C5BL 2CDFB 5CBEA 2EDWA 2JTDA 4WRLA 4XP4L 2H1PL 3QJHB 3L5XL 5BQ7A 3SDCD 3EDDA 1VFOA 5D5ME 1QLFA 3BDBA 5FDYA 4OGXL 3O6ML 4Y1AE 4PLJC 4YQXH 5IK3A 4OLXL 5I66A 3PUCA 2B4CH 2EIDA 4HEME 4NWTH 3CGTA 4D8PA 1G7MB 1U8OB 3DMMD 4Q9QL 4O00A 3K2UH 3MUZ1 4JRWA 3OKMB 1XF4A 3K1KC 4HGWB 3HNVL 4K3EH 1QR4A 3OJDB 3KLHD 1PW3A 1UWGH 2DYPA 4QRRD 5LWYH 2AXJA 2UYLB 4LCWD 4MNQB 5ABDE 3R1GH 4IRZL 1U58B 3X12B 3QQ4B 2WP3O 4RMQA 4NKOB 5F72S 3L9RB 4OFDA 4NQDE 1MCNA 3DVNA 1CFTB 3HMXA 4UDTA 5C86A 1HNGA 2RCSL 3W81A 3FTGA 1RY7B 1U3HD 5D72L 4PJ8C 4JFDA 2B8OT 3OG6B 4PJ8B 4U1MA 5BRZA 5C09D 4WW2A 2KZ1B 4Q6IA 1N64H 4HS6B 4BQCA 2Y07L 4MD0B 4WENB 4NBXB 1BIIA 4OF3A 5JW4M 5IB4B 3TP4A 3UROR 2EH7L 5JXED 4G7YL 4CBPA 1L7IL 5F6HI 2X1WL 1C08A 5DA4A 3RDTA 4JM2A 3HPJA 2N1KA 2WK2A 3O3UN 1TJGL 1S3KL 1EBAA 1U92B 1J8HB 3DWTA 4E42A 5FOBA 2A77H 3V7AG 1JV5A 1SY6L 4CGTA 1V3LA 5I1GH 1OLLA 3EYOA 4PGEA 4WHYG 1MWAB 4GW5B 3ETBF 5FYLD 3P9WB 1KIUA 1NCAL 4QXGH 3P4OA 4HLZG 4FQQB 5KVEL 4WTXA 3QDME 1CDBA 1MFDH 1JHKL 2J6EA 2NY5L 4PJEB 1ADQL 1TJIL 2BNUA 2VXVL 3DHJA 2V5RA 5C0JA 4J3TA 4GXVL 5J06A 3OZ9H 4P2OD 1SJHB 4G5ZL 3FAXA 5HHMB 5DJ2A 1CXIA 2VDRH 1AXTH 4Y88A 4NYLB 2F53A 3HZVB 1G9NL 2OTPA 3OSKA 1D5XA 4EI5C 3EGSB 3LPFA 1T89A 4U1HA 4HCRA 4EI5B 1ZV5A 4WFGE 5E03A 4DJMA 2Q87A 4L3CA 1BFOB 2VXQL 4O9HH 4C56D 1FFOB 4UQ2A 3S35L 5T3ZD 1D6VL 4F7CA 5SWSD 1NC4B 4P2CG 5E2VL 2I25N 12E8H 4F15B 1NCWH 4WI6A 3MROA 4L4VA 4Y89A 1K2DB 3FB7A 2YN5A 3EOBA 1AI1L 5BMFH 5A2IH 3OKEA 4OCXH 1W0WB 4G8GB 5DZLA 3QZWA 2UZXB 3RNKB 4AG4H 2Y25A 1EVTC 3DUHA 4PBWD 5F7UA 2PW1A 1DANU 4ELMF 4GUPB 3ARPA 4P2QD 3JXAA 3B8SA 1Z9MA 2WWKT 3KDMB 1YNTA 3WFCL 4WTWA 5ID1B 4ZOCA 1A14H 1DQJB 1OW0C 4OZHB 4Z18A 3VXMB 3BO8A 5IW6A 2H2SD 4XC3H 1AJ7L 3I6KA 1VKXA 2YD7A 1KXVC 4Z0XB 1NAMH 3TVMA 3UTTD 4E9LA 2P5WB 4IS6A 5KSAA 3V9FA 1KEMH 4HC1H 1T4KB 2IAMA 1JHLH 1VCAA 2GKIA 1DBBH 3FQRA 3U7YL 3E8UL 4D0DA 4O2FA 2Y6SD 4PG9B 3QWQB 1MF2L 4R7NA 1HQRA 5F3HA 5HGHA 4DEPC 4GBXB 5C0ND 4PS4H 1F4YH 2YPLA 5SWZB 2NLJB 1CZ8H 2Q76A 1I7ZA 2GUOB 1HXMA 1T0MA 2VDPH 4WO4C 3ZHLA 1Q9OB 3SJVD 3C8HA 4WO4B 2LU4A 3I02A 1PEWA 4YHLL 5DURD 1NCNA 2PKDA 1WUNT 1MCWM 1DFBL 2G9HA 3EFDH 3S35X 1A6WH 4P4RB 5C0DA 1X5LA 3HPLA 4KZEL 3NH7L 4XCFL 5BQ7B 4H26A 4UILL 3KG5A 3HAEH 4XPTL 1QLFB 2FZ3A 5D1XD 3BEWA 1EXUA 3MQIA 4CVXB 5IVNA 3SOBL 5C0AE 4WWID 3X3GL 5JUEH 5KS9F 3JBG7 5IK3B 5D70H 1IC1A 5I66B 3BT2L 4WUUD 4FQXD 2YN3A 4D8PB 4JY4A 3A67H 2MWCA 4YWGH 3EYUH 3QUKA 1P6FA 5DD1L 3GRWH 4QXUH 5EFIB 1XF4B 3QCVH 2BVEA 2VZUA 3T8XB 3EO9L 4C55A 1OP9A 1AP2A 1VGEL 1IAOB 4KJPD 3MACH 4OZIB 1B88A 4HEPG 4J3SA 2C5DC 1NFDA 5JW3H 3WFDH 1INEH 4K7PY 3EO0B 3S37H 1RUMH 5ICYA 1M7DA 4Z7WF 2FATH 2JJUA 5I8KL 4ODHH 4JFYA 1AGCA 1KFAH 4LPTA 4IHOB 3P40A 2FX8H 2F54E 1UC6A 1HHKA 4JFDB 4WW2C 5E5RB 4Q6IC 5IGXH 5EOQL 5BRZB 4WW2B 2VOTA 4Q6IB 4LOUD 3CH8A 3BKJH 4GFTB 5C7XH 2KQNA 3Q3GA 4ZO6A 1LO4H 2YKLH 4L8SA 2BSED 2EDJA 4NC0B 3S3PA 4Q58C 4OZGA 1E6OH 5CFHA 3JV5A 3RDTC 3EJJX 1C08B 4JM2C 2ARWA 3RDTB 3QBTB 1CYGA 4JM2B 3HPJB 4OLYH 1J0HA 2AEPH 2VLJB 3SY0B 1NAKL 3F7VA 1FHGA 4KI5C 1JV5B 4PJGE 3VDBA 5ITFA 4JFXA 3EYOB 2DS4A 4P2RE 3NCFB 3WUWA 4ODWA 3QAZC 1R3HA 2AJXH 1S7SA 3BYYA 3QAZB 1FP5A 5IESH 1IGJB 5AYUH 4OM0L 3WXVH 1T7ZA 1FQ9C 5E5UB 2DLTA 5IOPA 1IL1A 1SVZA 1SMAA 4OB5L 1EBPA 2V5YA 4L4JA 1BD2D 2QKIB 4DK6A 1OB1B 2AV7A 2BNUB 1A3LH 3CVHH 1IZJA 5C0JB 1OOAA 3CXDH 5HYQA 4FZ8L 5DJ2B 3LS5H 4PP1C 4JVPA 4XVTH 2AXHA 4PY8I 1GC1H 3WIFA 5C6TH 3MLUL 1T89C 2MHAB 1D5XB 4I9WE 3MV9D 3L1OH 3HZKA 1I9RL 2R23A 4NKIH 3D1MC 3QO1B 3S8WA 1KPVA 4L3CB 3LB6C 4OGYH 3ZTJH 3MV7D 3M8OL 4UQ2B 3HE7D 1F2XK 1JBJA 2XPGB 5E95B 4HBCL 3OBAA 5FM4A 3BSZL 3KPRE 1HILA 3L5WA 4L4VB 4CVZB 3EOBB 5ACLA 2VABA 5LAXB 2VO5A 3WIIL 3SGEH 5FA3A 5GGVY 1CE6B 5FIEA 4OBSA 4KK8C 1IZKA 2E7LA 4LHUA 2R8SH 1CL7I 3EDJA 5L2JA 4B53A 3X3FH 4WFHD 2JJSA 1RZIA 1UWEH 4MLSA 5EWIH 5GSRA 2C7UA 4GRLD 1YNTB 4ONHB 1S9WA 1YPZE 2EDOA 4P46A 1OAXL 4ELKB 4CJ1A 1FFPA 5IHUH 3WFBL 3BO8B 3CZFB 5IW6B 5GGSY 1QRNE 3B2UC 1KTDA 3I6KB 1VKXB 1FCGA 4PREA 3TVMC 4P3DA 5KSAC 1A6VL 3TVMB 4K7FB 4PJ7F 2IAMC 1FORH 3KPTA 1LK3L 3IU3A 1VB9A 1MRCH 2A38A 4G6FD 4M5ZL 3P4NB 1PY9A 1J0YA 3FQRB 4D0DB 5FKAB 3MV8A 5GRUH 5EULV 5CJBA 5L8LB 3CFEB 3WHXA 4H8WH 3WDHA 1WIOA 3KYNA 1HQRB 4WU7A 5F3HB 3O6MH 4N90E 5DI8B 1EVUA 4JAMA 4MHHG 4ZO9A 5HGHB 5HYFA 1HYRC 1KJMA 5I16A 2YPLB 3MNZA 4OLXH 2VJXA 2OP4L 5EU6E 2E7HA 2Q76B 3TC9A 1I7ZB 1FNLA 1HXMB 4NQEE 3ZE2E 4U2YA 2ZUUA 2NYYD 4AMKL 3D2UD 1XCTA 3FRPA 4LNVA 3I02B 4ZDHA 4E41E 4PR5A 2NZ9D 1DQDL 4FXGB 4JFFD 1N0XL 4APQB 2G9HB 3B9KB 4RGOL 1MCKA 5C0DB 3W9EA 5BS0D 2W92A 4URTB 1CLCA 4H26B 4HK0A 2D0FA 4MNHA 5IJVA 4OGAD 3DECA 2EDYA 3BEWB 2H41A 2ITCA 4NNPL 2DQDL 4PRHE 5ERWB 4HKZA 5D72H 5HYJE 2D2OA 4OTXH 1MAJA 3N9GL 4ZTPH 2YBRA 3CCHA 3LH2L 1WFOA 3DRQA 3MNWA 4S1QH 2PR4H 3PL6A 3QHTC 2WIIA 1L7IH 4HWNA 2HLFC 4ETQA 4PJHF 5E2TH 1KIPA 2OZ4H 2JCCA 1S3KH 4QRTA 4BA8A 1NFDB 5D8JL 3LY6A 1MQKL 1NCUA 4GKSA 5ANMA 4ZS7H 5ISZE 5M94B 1SY6H 4LGPB 1X5HA 3WNNA 2NY2C 3FN0H 4JFYB 5I1DA 4U05A 3V5HA 3RVUD 2J2ZA 3QEGL 1HHKB 1A7QL 1JPTL 4BSVA 2ICEA 1YEEH 3VCLA 4YFEA 5J7CC 4L8SC 3Q3GB 1JHKH 4PRBA 3MRHA 5GS2D 5FYKH 2ARJQ 2BRRL 2VXVH 1LVEA 2DAVA 1JL8A 4J3XA 4JKPL 3Q6GH 4GXVH 3MUJA 4XBEL 4XWOD 4XT1C 4TPRH 3F7VB 1NFIA 2O5XH 3DUUB 4FQLL 3PE9A 1ZANH 3QH3A 4JPKH 5ITFB 4JFXB 4JANB 1G9NH 4JN1L 5DJ8B 2PCPA 3WYRA 4N9OB 3WUWB 3DI2B 4ODWB 1R3HB 1S7SB 2ZKHH 4PJXE 3G6JF 4RDQF 1X9QA 4LLUB 4JFED 4NFBA 5GISL 5GJTL 3FKUS 5IOPB 1LQSR 3EJYC 5E2VH 3OMZA 4JHWL 3MBXL 2AV7B 1RZKH 4GO6B 3V4UH 1AI1H 5AD0A 1JGUH 5DO2C 2PYFB 1YQVL 1JZ7A 1C5CL 4TYUA 3H3KA 3O3DB 5HYQB 2VR5A 3OV6A 5EA0H 1UJTA 4KKNA 1UACL 4RA0C 1U8NB 4GXUM 1M1SA 3ULUE 3HZKB 3C60B 4GLRH 2XTLA 5F7DA 5HHOD 5CD5C 3IFLH 2QEJA 1FVCA 3B6SB 1DP0A 1TXKA 3D69B 1J87A 4LQFL 1AJ7H 5E8EA 4PD4J 4AY0A 1IAIH 3TWCH 5I1CH 3CLFL 4OCLC 5TDOA 1HILB 3W0WE 2BDNH 4Y4KA 2W59A 2VABB 3HI6H 1JI2A 1JWMA 1I9JH 5FA3B 3U7YH 2E7LC 5ADOL 3VD5A 2XZAL 4X4YA 4HV8A 1MF2H 2JJSC 4RFEA 4OZFH 2GK2A 3VWKB 1RZIB 1JWSA 5DZOA 1S5HA 1J18A 1IQDA 5E6YA 5GSRB 1T20A 2C7UB 3VD3A 4P46C 2R15A 5DK0A 1S9WB 1WAAE 2FLRT 1FV1A 4P46B 5T3XH 1GHFL 4MA8H 5TF1L 4HAFA 4W6YB 1FFPB 2UZIH 2AJSH 2ED8A 3QPXL 25C8L 1CLOH 5ITBL 1KTDB 1WICA 3TBTA 1IM9D 4PREB 1TTUA 4Z7OF 1T0PB 4HPYL 1J8HD 1B90A 5CMAA 1B6UA 1OSZA 5I15L 3IU3B 2EDHA 1AD0A 4XCFH 5K33A 3P77A 1U8PA 4UILH 3LS4L 3WNMA 1RJZA 4YDVA 4LEOB 3F8UB 3MV8B 1OAUL 1UZ8A 3WHE0 3WHXB 1NBZA 3KYNB 4WU7B 1U36A 1K4DA 5D2LA 5I16B 1FFQA 1KJMB 1CG9A 4YR6A 4M7JL 3MNZB 1BJMA 2P5EB 5DK2A 3S36H 3ULSA 3TT1H 1PVHA 1NANH 4NO0B 2A9ML 1XCTB 4ZDHB 4ONFH 3FN3A 2D0HA 2JKXA 5D5MF 1FVEA 3L3JA 4U4BA 5HY9B 3K2MC 4JO3H 4KHTH 1M7XA 3MLTA 3W9EB 1VGEH 4X0KA 4YBLC 4JPIA 4YBLB 1F6AA 4XXDB 1RD6A 1FSKC 1JNHA 5F7EL 1XCQA 1FSKB 1RIHH 4F7PA 5IJVB 5K9OA 2WUBL 2D0GA 5I8KH 5TJWK 2VLLA 4HKZB 4L4TD 4HKJB 3ILQC 4JG1H 4M1DL 1TCRA 4KK9D 4JRXA 1DLFH 4DGIL 4PRNA 3CCHB 3U6RA 3VGFA 3MNWB 3PWLB 1MRFH 4NHUA 1WWWX 2HT3C 3PL6C 3LKNA 3PL6B 3TT3L 1I1CA 2WIIB 3GB7A 3SKNB 1DBKL 3DYMA 5IT2L 1KIPB 1R6VA 2JCCB 4QRTB 2HJFA 3RY6A 1YZZA 1IEAB 4LAQL 3RPIA 5ANMB 4YXLH 4OLZL 3ARFA 4Z78B 3QDAA 1INDH 2YUZA 1KIRB 3V5HB 5LGKA 1FJ1A 1MCSA 3D39D 1U8LB 5D7SL 3IB4A 1XGTA 4BSVB 4BZ2L 1GVIA 1X4XA 3RVVC 3MRKA 2ICEB 1MLCB 3DV4B 4EDXA 3B8YA 3ZYJA 1SJXA 4OB5H 4FNLH 3CH1A 4YGVA 3VXRA 2D7TH 4PRBB 5ETUA 2IGFH 2VLMD 3MRHB 4NJAL 5K9JL 3NIGE 4Y2DA 3ULVL 2HH0L 5CCKH 4K94H 2X4OA 2FBJH 3IFOB 2Z9TA 3GSNA 1O7SA 4XNXL 1NFIB 2MSPA 1YNLH 2CKBL 1A7RL 2J1KA 2BNRE 1Z0NA 3QH3B 3RTQB 1A7NH 3G5YB 4A2MA 3MLUH 1IE5A 3IVKB 2X10A 2PCPB 3BP6A 1I9RH 3T4YA 5GIRB 5EO9A 2R1YB 3VMOA 4R2GC 1K3IA 4R2GB 1SYSB 2VXUL 1NAMA 1V7ML 3QIWD 1QFWI 3P3YA 4PV8A 4HBCH 4HC1A 2GSGB 3BSZH 1Q72L 2XXCB 1S8DA 3HC4L 3NFSH 1E28A 4MB4A 2PW2A 4C83B 3MRRA 2W9LA 4LRIA 5D7JA 5L6YL 3GIVB 1N6QL 3BDYL 2ZPKH 4OQ1A 2D4DA 1DBJL 1W72B 1KB9J 4GRWE 3U0PB 3QNXB 2P46B 2HVJA 2OK0L 1FVCB 4AT6A 5ICXA 2DYPD 3CFCH 1HSBA 3SGEI 3RUGB 5F9WC 2AV1A 3HZYA 5F9WB 5H35B 4RBPH 2AJUL 2ZG1A 3BH8A 1OGTB 4XPHL 3ZKNC 4Y4KC 5TDOB 3RJQB 4Y4KB 4PY7A 3PWVA 3SGDH 3HI1A 3HAEA 4G7VH 5EUOA 1JWMB 3ARBA 5F88A 1CDHA 4LP5A 3HI5L 1RZ7L 2H3NA 4JFDD 2DQEL 3F58L 5BRZD 3P0YL 4X6CE 1F8TL 3CC5B 4HV8B 4X4YB 2P8MA 4WFED 1S5HB 1UM6H 3PABA 2B4CC 2PO6B 1IJ9A 3RZCD 1MVFA 5FF6A 2HTKD 3ORJA 4K55A 1HWGB 4ZNEA 2H9GA 3RHWF 5F3BA 3GMQA 1ZVYA 3OGOE 1YNKL 4YFDB 1DQDH 1ZS8A 3H9SD 1N0XH 1NGWA 5HI5C 4RGOH 1WBYB 4DWHA 3MLVL 3CNKA 5CMAB 3BGAA 3QZWG 1OSZB 4KI5D 2NXYC 1LP9E 1RU9L 1I8KA 4M5YL 3P77B 1U8PB 2NXYB 3NAAL 3RY4A 5DMGC 2BVQA 1UZ8B 2J8UE 4J8RA 2W0LA 1RUKH 2DQDH 1SM3L 2CUHA 3K0WA 1K4DB 5D2LB 3H7LA 3T0XA 4MLIA 4OI8A 3DRTA 3SHSA 4X7EC 1W8OA 4I48A 5DK2B 3N9GH 4BSWA 4WUKL 2UY7A 3MLZH 4HMDA 2C3WA 3VH8B 5H37G 1FVEB 3L3JB 5T1LB 3GNML 3TBSA 5J4MA 1EO7A 3U4AA 3NMEA 4BZ1L 4PP1D 1HHJA 1Z5LB 4JPIB 1F6AB 2F53D 2R29H 1P7KB 3ZLQC 1HH9A 4MJ5A 1QVOA 2NW2A 5GJSH 5K9OB 3C87A 4ODVH 4POUB 2AKRA 2VLLB 2VB5A 3S5LB 2W9EH 4BFIA 4UIKH 3QEGH 1P4LA 3FOMA 3PV6A 1E4XL 3PJSB 1TCRB 4MAYC 4NZRH 4JRXB 2ICWJ 4MAYB 3DROA 5I75C 3U6RB 5EZIL 1NUFA 5I75B 1DCLA 4NHUB 4ZUUA 4D9RE 3LKNB 3I84A 2A6IA 4PV9A 2BRRH 3GB7B 1UWXH 1XZ0A 3TH3T 4KGJA 4NQCE 3QDJE 3AB0C 3QHFH 1DN0B 2N56A 4XBEH 3AB0B 3MBEA 3RY6C 3DTXA 1FAKT 2W0FB 1IGML 2HTLC 4P9HC 3RPIB 3ARFC 4FQLH 4LCIL 1I9IH 3ARFB 1AO7E 1N7ML 3ZDZE 1ULVA 5DEGA 5HYSA 4OFYD 5C0CA 4XP6L 3OAUL 4LVHC 4NZUH 1FJ1B 3U9UA 1MCBA 5DMYA 9CGTA 1MAML 1BZ7B 4NJ9L 4EDXB 3RQ3A 5KSAD 4LPVA 4XX1G 1CF8H 2IAMD 3CH1B 4YGVB 3VXRB 1QBMH 5ETUB 4JHWH 4Y2DC 4PJGF 1MVUB 4Y2DB 2XIDA 2Z93B 1YQVH 2X4OB 3EYSH 1KJVB 2M26A 3PGFL 3V7MA 3D85D 3GSNB 3NZHL 4IRJB 1SBSL 2IC2A 1JYXA 2UWEE 3QO0A 4XMLH 3DX7A 3K1DA 4U3HA 3NFNB 5DRZA 5I8EA 3HC3L 3MRBA 3BP6B 5JHDA 4M61A 3O6LL 3MTRA 3T4YB 1U8JA 5EO9B 2DJSA 2Y4SA 2NTSP 3FFDA 3WFEH 3PWNA 1DVFA 2NY6C 4LQFH 1NAMB 5E99L 2DQJL 1ZA6B 2NY6B 3HFML 3TZVB 3ZKMC 4F2MA 4YDLB 3AXLA 1X5IA 3CLFH 4M1CC 5CGYC 5L2KE 4RMVA 1C12A 4TULH 3P4LA 4BH7A 4DN3L 4LRIC 1VHPA 3MRMB 3HA0A 5D7JC 5BV7H 3QWRD 4FQ2H 4HLJA 5D7JB 1EHLL 4GLRI 2EO1A 3BP4A 3P0GB 3TJHC 3VD9A 4LEXL 2XZAH 1R5WA 2HFEA 3O9WA 2YSSA 3RGVA 4Z7UA 1H8OA 4ONGH 2G60L 1C16B 2DJUA 3IU4L 5C8JA 2FHCA 4JHZA