1KB9K

Yeast cytochrome bc1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
107
structure length
107
Chain Sequence
b'DIELTQTPVSLAASLGDRVTISCRASQDINNFLNWYQQKPDGTIKLLIYYTSRLHAGVPSRFSGSGSGTDYSLTISNLEPEDIATYFCQHHIKFPWTFGAGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
molecule tags Oxidoreductase/electron transport
source organism Saccharomyces cerevisiae
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
total genus 17
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2001-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kb9K00
3F6IA 1U8NA 1WZLA 2AXGB 7FABH 4S1SH 2BK8A 2DBJA 1YQ2A 3JTTB 3VFWA 2VDOH 3L5IA 2XXMB 4RFOL 3SE8H 3S9DB 2ZNWA 2YPLB 1YNLH 1FPTH 1X6NA 1T04B 1KIUA 3PWUA 1OW0A 5I2IB 1PKQB 4ENED 3LN4B 3MNVB 4NOFA 4IMKC 1T4KB 1MHEA 1K6QL 4KUZH 3QPXL 2FBJH 1E6JL 1IEAB 2PTUA 4MJ5A 5D7SL 5JHDB 3RNQA 5BS0D 1GRWA 1T1YB 1Y6MR 4JFEA 5BZDA 3O45A 3FRPG 1WFOA 4M3KB 4BKLA 3RL2A 3WXVL 1RJZA 3NCCB 3MLPA 3HAEG 4QKXB 1G7JB 4JHAL 3WFHB 5ADOH 4X4XB 4MNHB 1U8KB 4HZAA 2V17L 4CVZB 3CPLA 3C8DA 3FQXB 4HUWB 3HRPA 1KEGL 2Z92A 1BX2A 2EDEA 4XBEH 4F33B 5IGXL 5IIEA 4QRSB 4RX4A 1SJEA 4QHKJ 4JFOB 4QHMB 1BJ1J 4YHYC 1VEPA 2VZ1A 5J9PA 2I9TB 2VE6A 2UZXB 1CK0L 5DHVH 4OV5B 4LMQE 3MLTB 1AGEB 3MLYH 4NKMB 1KJ2H 2Z35A 1MLCB 1KSRA 3SDXB 1RZ8B 3W81A 5GRUH 3MV11 3BKCH 4AM0B 3IJSB 1BVLB 3Q1SL 4ONGH 4P4KD 5MHSE 3GJFB 4Y4HA 4JFDD 3PNWB 1FAIH 3VXNB 2FIKA 5IVXB 5TDOA 1UB5B 5F96H 1BJMA 4N1CA 3RWHA 5IQ9A 5KJRL 5JIKA 3WN5A 1P2CA 3LKPA 1RULH 1JPFA 4GXUM 4OZIB 3ARUA 1JTTA 3ALWA 3WFEH 3WO4C 2IFGA 3HZVB 5DD3H 3EOAA 1R3KB 2VJXA 3FOMA 2JCCF 1JRHH 1F4YL 3O0RH 4PY8J 4I0CC 3WLBB 3O8XD 2EEBA 3DMMA 4X6CB 4NKOA 4M6AA 5D72H 3D39A 3MSPA 3DTXA 3FMGH 3FB6A 4MAUH 4MB3A 4PUBH 3WD5H 3P73A 3TIEB 3SDCB 1T0PB 2E6PA 1IM9D 2V5TA 1PG7L 5IMLA 5JZ7D 1JMZA 2DM3A 2WUBH 3Q5YA 3IB4A 4Z8FH 4N0RA 4M7JL 1TNNA 2P5WB 2PXYB 4LDLB 3IYLW 4W68A 5E8PA 4ZUUA 2IJ0C 4CDHA 1T3FB 3TPKA 1VSCA 3FO9B 1MPAH 5MHSD 1IQDA 2CK2A 1CDBA 1MNUH 4FNLL 2DQEH 4GAYB 1X5JA 4PGEA 5KZCB 5FM8A 3D85B 5EUOA 4ODSL 4LLAA 2C9AA 1RMFH 1HIML 4MS8C 4OLVL 4DEPC 5D6DC 1XGQA 4RSVA 1P7HL 4DZBA 4NSKB 4P23A 4NRXB 1IC5H 4XZUB 1N59B 3HPLB 5D1XD 3IDMA 2C1PB 1D6VL 2YBRA 1T1WB 1MCFA 2Q76B 2VDLH 1MCCA 3SDXE 3ELAT 1W0VB 3PV6A 2V5YA 2P24A 4CU6A 5I8CA 5TF1H 5EIIB 3PWVA 3AU1A 4JQIL 5C9JB 4OZHB 3GI9L 5EZLB 1G7HB 5DJCB 5F9OH 2ZSWB 4PRBB 1FZOA 3GZKA 5DF0A 3EDDA 4ZNEE 1DBMH 1YNLL 4KK6D 2JB5L 3BZFB 2CRIA 5ID0B 4P2YA 5KSAD 3MLUL 3L5JA 1UKQA 3O8XC 2WUCL 5CJOH 1VDGA 1T03L 2Z9TA 1BAFH 1KGCD 5DEGA 5KSBA 1JZ6A 1OLZA 2OMBA 3T2NH 5BO1H 3GUTA 5KVFH 5AUMB 5F3BA 1G7PA 3SO3C 4U7KA 3QR2A 4WWKC 4LKCB 3GMMB 5D6DA 5J11B 4LCYB 3VXUB 1VEMA 4NZUL 2CKBB 1NEZB 4WEMB 3QDGA 1T0MB 3VFRB 4XB8A 1ZANH 4UQ3B 3CFKA 3DX9A 2HVKB 5JHLH 4HH9A 4PBVC 5TPWH 3QXAB 5GS3A 3HE6A 5I1JH 1T22B 2GAZA 4Y2OA 4R2GB 1YUHA 3MACH 4WUUA 3OXSA 3BT2L 5FO8A 2D7OA 4CMMA 4JFQB 1UYWH 4NHCH 5HPMB 4RWYH 3O9WA 5E94A 1E4JA 4NO2B 4XCYB 35C8L 4DQOL 1E4KA 3LKNA 1UZ6F 4KWUA 3JWDL 3GMRA 3HPJA 3I02A 2B4CL 4PJXB 5T1MB 1LP9F 2H9GB 3HRZB 4M6NL 3GMLB 5H94B 1CICC 4G42B 5IMOB 3P0YH 3O3DB 1RJLA 4G8GA 2G9HB 2JJSA 2JJUA 4OT1L 2Y1VA 3O4LD 3RDTC 4YPJA 1AQKL 2X1PA 4BFEA 4R4FL 1XGYL 3RA7H 2J88H 3NIFE 2Y6SD 1IFHH 3HN3A 3FHQA 2ARJQ 5CBAB 5DR5H 2YHGA 2O5YL 5GS2D 1GGTA 4JGUA 1KB5L 4KJPD 4L3CB 3IDIA 4KTDH 5FO7A 4Z7OF 3V7MA 3OPZL 1KJ2B 3P9MB 1TFHA 2MKLC 3OAUL 5JLZA 2CLZA 1H15A 3F7YB 1MCLA 5DWUH 1RZJL 2OSLA 1DN0A 2VLJE 3MV8E 3Q6GL 1JVKA 1F00I 3KNBB 5L9DH 5ETUB 1UWGH 3VGAB 4YWGH 4UOJA 2FATH 4QRPD 3AM8A 1HI6B 5JXEA 5HSFA 1FG9C 4I18C 1FNHA 3CXDH 1C5CL 1RZ7H 1FRGL 4IDJL 1NGZA 1B0WA 4ODWB 2QL1A 1H3UA 1EJ6A 1CDGA 3LKOA 4JRYE 4P9HL 2DJ4A 4AEFA 2WUBL 4KK9D 3ZKXC 5FHAL 3DETC 5FYJD 4MQXD 1NCAH 1S7SB 2ERJC 1DJSA 3KYAA 4HWUA 4XNZC 1U8IB 3WDIA 1Q0YL 4KUCD 4Q6YA 3SPVB 4Y5YA 4NQSA 3FZUD 5JMRA 2Z93B 3DUSB 2YXFA 4EI5D 4TTDD 4HIXH 4Y4FD 4X5XB 1S78D 4X7FC 4X6FA 1AGBB 2HMID 4QHUA 4NZTL 1A3LH 4QOKD 4BZ2H 5LQBL 3HR5A 4MA7L 5CCKH 1X7QA 4QXUL 2F54A 2Z91A 3O3AA 3MLVL 1J18A 4V1DB 5DHYB 2YA1A 1J0IA 4UZGA 3KPOA 1C7SA 3KXFE 4OZFH 4OFIA 5F7DA 1SY6A 5HPOA 1EO8H 3AXLA 2BSTB 1RUKL 4L3EB 3H9SE 4XGZB 3LDBC 2XTJE 3W9EB 3CSBA 4J2XA 3ZYOA 2R1WA 4NRYA 3BPNC 4MJ6A 1B4JH 1T03H 4X6EB 1JRHL 3GNML 1KPUB 4MCYA 4ALAH 3VGEA 4K9EH 5F72S 1MJUH 3MRLB 2A74B 2HKHH 3D39E 2GHWB 4JG0H 4TVPL 3EYUH 2ATPA 5HHQB 2FHBA 1J8HB 3ALPA 4ONFH 3TIDA 4LGPB 2R23B 2NY3C 3R06A 3BHBB 1RJYA 2F15A 3EJZD 4MNQE 3VFNB 3BQUD 4ZXBA 5T3XE 5IB4B 3G6AA 4PRPD 3LZFH 3TA3D 1LO3H 1R5WA 3T4YA 2D31A 3RI5F 3F62A 2E9WA 1MH5A 3KYNA 1I1RA 5HHOA 4KDTA 4WHYG 5E2VH 2CQVA 2WIIA 2UVEA 1AD0B 2ED9A 4RWYL 3ZE1F 5AWNH 4P5MB 5IV2A 2DDQL 5KZCD 1VFAA 4G8EB 5DJDB 1JUFB 1WAAE 4WV1A 3GSNL 3RDTA 2OZ4A 5FYLH 4L9DA 2B4CH 3C5SB 2X6MA 1WBZB 1QEWA 1DL7H 1DBKH 1KBGL 43C9A 1MFDL 4HQQL 1FN4A 2XWJA 3IDYC 4OCSL 4TUKL 4NC1E 4M48L 5C2BH 1U8PA 1JNNH 5GS0L 4GUPA 4ODVH 1U3JA 5FM5M 4U1GB 4YDJA 1OT2A 4X8JB 1A7PH 1MJ8L 4HGKC 3HB3C 4WU7B 4L3EE 1FVCB 4TUJB 4YHNB 1A4JB 2GSGA 5EPMA 1E28A 4GQPH 1ZVSA 2GITB 3EYOB 1P4LB 3LN5B 4LHJB 2Z31A 3BKYL 2VXVL 4TNVF 2ILLA 2OR9H 1NFDE 2IGFL 3KPPB 4G8IA 2HT3D 4Y2DA 2F19L 2WNGA 4R2GD 3SN6N 2D03L 4Z7QF 3VWKA 1TJIH 4JPWH 1HSBB 2Q3ZA 3O2WH 5GGTA 4F7TA 4HWZB 3QPXH 3MYZA 1U92A 1XGPA 1BZ7A 5DJZA 5HVWA 3KPNA 4D94A 2NY4D 2APTA 3ZKQD 2XTJB 5JMOC 5IW6B 5MERA 4KKLD 1AGFB 4L1HA 4TSAL 2XY1A 3GHBL 5J3HD 1CLCA 2IPKB 4W81A 5IVXF 1TVHA 2EYRA 3BWUC 3BUYB 1ED3B 2OI9B 2J7LA 2VLMD 5IW1B 5IFAL 4P2CG 3MUGB 1ZEAH 2UYLA 2V2WA 1WSST 2VXSH 3RNKB 3OJVC 1S9XB 1TIUA 5I1JL 3KPLA 2IAMA 3MLWH 3VW3L 1OB1A 3MROA 3LB6D 2APWA 2BDNH 3FO0H 4DAGL 2GT9B 1T80A 1Z9OA 4Z76A 5IROA 1UYWL 2IPUG 1FNEA 1KJVA 2V7NA 3QCUL 5BVPL 5IB3A 3KPQA 2NY7L 4O4YL 5JIHA 3M1BB 2CIKA 2F5AH 4HS3B 1CZ8L 3MRKA 4LCWE 1JV5B 1PBYA 1N2RB 3VXMA 1P1ZB 4G9FD 1HH9A 4PJIE 2DMBA 3UZEA 3MV8B 3P77B 4G7VL 2EDWA 4EDWH 2EKJA 2QLVB 3BESR 4LPXA 3OHXA 5JOFA 1FIGL 3P77A 1I7ZB 5B8CC 5HI4C 1XR8B 1BD2D 3RKDD 2UWEB 3UO1H 1JV5A 1INDH 2DQIH 3GK8H 4O9HL 3STBA 4BUHA 1OAQH 3CH1B 1DE4A 4ISVA 4OZIE 4HS3A 2HVJA 1T7WA 1KEML 4LPUA 4PTUA 4U1JA 5BRZE 3QHZL 1JF5A 4Z76B 3KHOA 5C3LD 1KENL 2XKNB 2IAMB 3FRPA 4QT5A 5FGBC 3T2QA 3MNZB 2VAAB 1Q1JL 1A6VH 1DQTA 3GJEA 2PN5A 2VLJB 5KANI 1XF1A 3FQWB 4QF1B 4LLQA 2D0FA 5INCA 4RGMC 3T3PF 4PJ9A 5J12C 4N0YL 1JWUA 4ZFFB 5I1GL 1UA6H 4KK5D 2YN5A 1AGFA 4Y8DC 4TULH 3LHPL 2M26A 3O9WD 2GY5A 4A2MA 1U6AL 4YDKH 2OJZH 5EU6B 3FO2A 5I1IL 5DTFB 5E08L 2X09A 1RQ5A 3BDYH 4HS6B 4OGXH 3U48A 1ZTXH 1D5IH 5DI8B 3BPLC 1AR1D 1QSFA 1LK2B 5EPMB 1Q9OB 3BD5A 3QUZA 1QLRA 4WY7H 5C0IB 5FYKL 3RAJH 4LLYA 2BP3A 1ZMYA 3JWNC 4WU7A 1BFOB 4Q9BA 4HSQA 4GRLC 3D2UB 2E27L 3RGVD 2ITCB 1H0DA 1JGEB 2KQMA 1SY6L 4XP5H 5I0ZA 1AGCA 4YQXL 1I1YB 3JVGC 3QIBC 4RGNC 4PJ9C 5ISZD 4X9FA 3ARXA 4UIKH 1PZ5A 5DC0A 1CVSC 3RDTB 1F6AA 1LO0H 1Z9LA 4AT6B 4LEOB 1QACA 1JUFA 5CP7A 1I1FB 2EEAA 3EYVA 4XXDA 5GGRY 4P5MA 2H3NB 4MNQB 4EUPA 5BV7H 4JHBA 1J11A 5D1ZC 4HF5L 3EO9H 4LLDA 3P4MB 5E2WL 4GS7B 4HUUB 3MV7A 1G6VK 4ALAL 3E2HC 2EIZA 3LVEA 2HLFC 5K9JL 4NZDA 4ZXBB 4PGBB 2HKHL 4XBPB 5AZEH 5C0JB 3BHBA 1JK8A 3IRPX 1F11B 3TIDB 3ZT6A 5FK9A 1VGKB 4H0IA 1S7QB 3MA7A 4KHTL 3QEQE 2A73B 3PGDB 2YA0A 4LVHC 3SCMB 3QG7L 4PJDE 5DSCA 4I3RL 3LMJL 5CGTA 3ZYJA 4XNXH 5JHLL 3JXAA 3VCLB 3O6FD 4E0RB 1KPRA 4MCYB 3PWPD 1TZGH 4OZGE 4BQ6A 2V17H 2O61A 4Q9QH 3DURA 1FJ1B 4FZEL 3VI3F 1DQDL 1D3CA 1OWWA 5DZLA 3VW3H 5E5RB 2R0WL 1P9MA 5HGDB 3QDAA 1RHHB 4TOYH 5L7XH 3P11H 3HNSH 4FRWA 2A1WH 2WBJB 5H37H 3SY0A 2A9MH 2HFTA 1NAMH 3UEZA 3NABL 1P69B 1ZSDB 3KPOB 2XA8H 4OCXH 3X3GH 2DLTA 1Q38A 3B2UD 1TNMA 5A2LH 2HKFL 2BNUB 3L3DB 4XPGL 3VFMB 3WEXA 1KCSL 3U0TA 3GSVA 4XPBL 5T3ZL 2AXHA 5DUPH 3Q1SH 1BREA 1LNUA 1DQJB 4Y2DC 4FTVB 1XIWD 4JO2L 1INDL 2DQIL 5CKGA 3QCVL 5FECB 3OXRB 2MPAL 3C6LC 2YKLL 4X6FB 4GRLD 1G1YA 5IF0A 4LEXL 5ACLA 3LDBB 3UXFA 3D5OF 4ZUWB 1GC1C 2GCYB 3MNWA 4NQSB 4J23A 1TXKA 5L0QB 4E41E 4QWWD 1VACA 3L5HA 3V6BR 3PXJA 4F37K 3DVNB 4MA3B 2IGFH 4PY7B 4ZXBD 5SWQA 5E4IA 3RVTD 5IB2B 2R2HA 1TJIL 4XCFL 3JUZA 1J1OH 3MXWH 4KI5E 3OAZK 1N64H 4QGTA 5DS8A 1EJOL 2X7LA 3FMGL 5ICXA 3CCHA 3CFBB 5BRZD 3MUZ1 4QNPE 32C2A 2AKRA 3K0WA 4Q9CA 5F7HA 1J0HA 1MHCA 5CILH 4NCC2 3H42H 5ETUA 3QXTA 5JOPE 1QP1A 1H15B 4FG6C 1OTTD 3OSKA 4FQXD 4HEPG 5C0AB 5KS9B 1MWAA 4WCYH 3FFDB 3HZKB 5KOVC 4PG2A 4UV7L 3U0TB 2IALB 4F8QA 2DYPB 1S8DB 3HMXL 3L3DA 1OAUL 4MSWA 5CLTA 1YPZF 1H5BA 2AP2A 2R29L 1CK0H 4NZTH 4ZPTB 2KBGA 4U1IA 5FA3B 1VFBA 1KJ2L 3LS5L 1Q9WB 2NPLX 5GGRB 3GMLA 1ONQB 1FIGH 1NGXB 4ZUVA 5C0BA 4XPTH 3O4OB 4MQ7A 2X42A 4UT7H 4YPGA 1X4ZA 3QG6A 4PREB 2BOBA 1N8ZB 4WWKB 2VZVA 5J11C 4JFEE 3FN3A 1DBBH 1ZS8B 2UY7A 1CQKA 1F90L 1FSKC 4PLJC 5ILTH 4HIIA 5EOCH 3PGDA 5E0QA 3LRHA 4IRJB 3G5VB 2ZUUA 2I07B 2UWEF 2H6PA 3DSNA 1JZ8A 1F45A 3FZUC 2F53E 2R0KH 1JK8B 1T22A 3B9KB 4PLOB 5JOPD 4JKWA 1CWVA 4N8CL 5DURB 1JYXA 1G6RH 5EC1B 3P4MA 3LY6A 4KKLC 4LLDB 2FD6L 3PGFL 1KB9K 3INUL 2X9YA 4Z7NE 3QXVA 2FYYB 1YZZA 1N3NB 1W72H 5AUMA 5M7QA 4FQCH 4ELMB 3K74B 4S0TD 5EBMB 2P5EE 3OAYK 1IM3A 5CP7B 5I1HH 4DW2H 1LO3L 2BCKB 2ZJSH 4XMLL 5E9DD 4P4KA 4P46D 4LU5L 5TDPB 1AGCB 3V6OE 3T1WA 3HI1A 1A4KB 3VGHA 3P11L 3AB0C 3HUJB 4F3FB 3MRHB 3MUY1 4MQSB 4OCXL 4RZCB 3X3GL 3QQ9C 3PV6B 4I3GA 1M71B 3QIWB 3U4EB 1T1WA 4C58B 1HYSC 1KTLA 4M6NH 3GDBA 3IF1B 4GG6B 3HPLA 2OL3H 5L2JB 5EU5A 4OT1H 4JO3H 1LP9E 4HS6A 1HH6B 1A9EA 3U4EA 4PJEA 3WSQH 5E4EC 1GSMA 3D85A 5EUOB 3BW9B 4HDIB 3C2SA 4Z7QE 2J5LB 1N0XH 2AQ1A 1XF5B 2JB5H 3MRHA 4F3FA 2VABA 1JWUB 2VXVH 3HUJA 4ZFFA 2VMFA 4PRHE 2FLBT 1B2WL 4D3CH 3QB7C 1X5GA 1JP5A 3DSFH 3I2CL 4RGOH 5D7KD 4ODHH 1CGUA 2N7BA 1K4DA 1KACB 2VDKH 4KJQD 4B7IA 4LVOC 1AHWC 3FB5A 3MXWL 2VLJA 2BCKA 3DJ9A 4KKCC 4LSVH 5IMLB 4LASH 2Q1EA 2VAAA 4O5LL 3WHE1 5F96L 1QSFD 4GJTB 3SDCA 4KKAD 2FB4L 5INDA 5EH1A 3SEPA 1N3NA 5IBUG 3D2UD 2FYYA 3DTXB 4Q6IB 1K85A 1U8HB 5C07D 2XZQH 5FYKE 4GAJL 3WLBA 5I19H 3LMJH 2JKXA 2JLLA 3SE3A 4ZQKB 5DO2D 2XZAH 3CH1A 1UH3A 1U3HA 3FONA 3HAEH 1NDMA 1H3GA 1XZ0A 4OZIF 5JOFB 4WGWB 4PRIA 1MI5E 1TITA 4NIKB 1Q0YH 1CLYH 4H8WH 4UV7H 5C7XH 5D72L 5T1LD 4ZOBA 1K2DB 2V2TB 4IRJA 2DQCL 4ZTPH 5I74B 3NCMA 2CIKB 3H3KA 5IVZB 4HIIB 1FCGA 5IB3B 3T4AB 3CD4A 2D0HA 3GJFA 3LKRB 1REIA 1FGVH 3MRRB 1LDPL 1B4RA 4MD0B 3KPRE 1HYSD 3WNNA 4QRRB 1MLCA 5MENB 1JGLH 4PTTB 2NX5E 2YN3A 4FN0A 3OJDA 5I16B 2UYLB 4J8RB 5CBEA 3RY6A 1GAFH 4OLZH 2XACC 1K9TA 1V3JA 3BUYA 2DOCA 3S5LB 5J0BA 4M43H 4K94L 5F6HJ 3WNLA 1OAYL 1A3RH 3KLDA 4CL7A 1KB5H 5IIEB 1OF2B 4MSWB 3WFEL 5IVXE 2VQ1B 4K3DH 2X4UB 4KQ3L 3DYPA 4CVZA 1U92B 4U2YA 3ZL4L 4XMPH 2FX7H 1LK3H 4X4XA 5GIRA 1MWAB 1BZQK 5C08A 3HNVH 4N8CH 4XWOD 4LCWB 4G8IB 3LN5A 1JIBA 2WBWB 4HC1L 4MJ5B 1A7NH 5JHDA 3LHPH 4MA1C 3VG0H 3FT3B 2ADGA 1TQCB 3GGWA 5CUSL 3VGBA 2BVPB 3SGDI 2ZSVB 4L5FH 4X83A 5EOCJ 1NCAL 4NCDA 5DS8B 4YDJB 1NANH 2ZUQB 3FFCD 2XWJB 3EAKA 3PWUB 1PVHA 2R2HB 4Y8AA 1GGIH 3UDWC 1CFNB 2IG2H 4YLQT 5FYKH 3JTTA 1GHFH 1QR4A 5DJDA 2DQTL 4HIJB 2JJWA 1WIPA 3U1SL 5DQ9B 4C54A 3KJ4C 2DDQH 2VRAA 4DJMA 3BZ4A 1DDHA 1J12A 2A2QT 1V3MA 5FECA 3T09A 8CGTA 3K8KA 1ZVYA 3RHWF 4LARH 4X0KB 1LNUB 3PWPE 5E1HB 5I9QC 3MACL 3ZTNL 1G7LA 1I7UB 5AG8A 5KSAC 2W91A 3LRSB 3WEXB 3T3PE 3BJLA 3QFDB 2FR4A 5TH2A 1MHPL 4L3ED 1TVBB 4HWBA 4N1HB 5HHQA 1NLBH 4LQFH 4PRHD 3G08A 4K7PX 4LQ1A 3E8UL 5EZJB 1ZLWK 3S4SB 3UC0H 4LFHG 1HE7A 3ZLQC 4OLUH 1KGCE 3DURB 4LLMB 3BH8B 5L2KA 1YDPA 3HR6A 5KVFL 1YNTB 5GSRA 4NRYB 5H2BA 5IEKA 3QXDA 2BJMH 1OTSC 3VA6A 4LCCC 2VXQH 5I15L 4Z5RB 5DSCB 3IVKA 2A73A 4WWKD 3AXLB 3TN0B 5F7DB 4U0QB 2VTFA 5I18H 3G04B 4OGAD 3WL9A 1CG9B 1D9KC 1S5HB 1F11A 2P43B 2X5PA 3N1FC 5DHXB 4U05A 1AY1L 5D7JB 2J12B 1I9EA 5LBSL 3IJYA 4POZD 1GXEA 3THML 5T5FH 3GSUA 4HUUA 2FATL 1BBJA 1X7QB 4TOYL 5L7XL 3QCUH 4YK4B 3RQ3A 5HHMB 3K2MC 3SJVE 3Q2CA 4Z6AT 4X5XA 1AKJD 1KIPB 2Y23A 4I0PA 4JPKH 5D71L 3TNMA 4EUPB 1T89A 2C4FT 2E7CA 4KTEH 5IK3A 3HI5L 3W11D 4HUMB 2E7HA 4XPBH 2P8PB 3FQNB 3HE7B 4NQCD 1U8IA 4RFEB 4TUKH 1QBML 4NBYB 2Q7YA 1FHGA 5D1ZD 4IRZL 1S9KC 4G6KL 1IFHL 3WS6A 2VWEE 3BQUC 3A6CH 4WTZA 1IQWH 3MUHL 1CDHA 5D7LE 1DBJH 2DI9A 4CN4A 5CD5D 1F97A 1Z2KA 4D3CL 3LEYH 2BNQD 3LV3B 5FF6A 3QWOA 2VDKL 1SVCP 1DN0B 3P3YA 3KLHD 4PS4L 4F2MA 1RVFH 4AK1A 5ALCL 1U3HC 2CLZB 3RTQA 3LN9A 5JLZB 3VDBA 1KCRL 4N0YH 3IDIB 4H26B 4GH7B 5JO5B 4BFGA 1AE6H 2OQJB 2RB8A 4KY1L 1I9JH 5JPNB 3D25B 2CO6B 2D4DA 2VAJA 3IKCA 5HDQH 3RVXD 1Y18A 1ZLSH 1IL1A 4JRXA 2QJDA 1URLA 3GHEL 3Q3GA 3V5DA 3BJ91 5FHAH 3WNKA 4M00A 1SEQL 1GZQB 4FQJL 4NPYB 3MR9B 5F9JA 3O3DA 1CR9H 5J12B 5CHNA 5DK3A 3HRZA 4OI8A 2YWZA 4PJIB 2GYSA 2H9GA 4IOSD 4ORGB 5IG7A 3PG2A 5GSVB 5TE7H 3MRQA 4XH2B 1CZ8H 4JKPL 2NZ9D 3EO0A 1G9MH 5F7WC 4MCZB 2WWKO 1BPVA 1FE8L 3MV9E 1G7IA 2KPNA 4A6YA 3CJJA 6CGTA 3OKOA 2HVJB 1XT5A 3RHWK 4I9WE 1NANI 5I1DB 1L9MA 3RTQC 4CGTA 3OXSB 2BVUA 1X5IA 4E9LA 3DLQR 3MLXH 3CFEA 1BFVL 1JGLL 2XRAH 1HNFA 4F7MB 3RWCA 1A5FH 4X98A 3MV8A 5FOJA 4HH9B 2X05A 4ZXBC 3DX9B 1EA9C 3MO1A 4WO4A 3T2PA 3ULVL 4XI5C 3SO3B 2AVGA 3F7RA 2D7NA 3PQYD 5I74C 1QUNA 4W6YB 5IHZB 4LCYA 2NW2B 3ARGC 1G9NC 3GMMA 1GIGH 4LKCA 1CDCA 1G7PB 3DGGB 5F3BB 4M1CC 3ZL4H 5ABDE 3U9PH 2CJUL 4KKBC 1WWBX 2B5IB 4PJBE 1P4IL 3CLEH 3RNKA 4APQC 2YUVA 1F58L 4M6OH 1A7PL 1MJ8H 3HZYB 1AC6A 4NJ9H 4DWHA 1ED3A 1MCOH 2BFVH 2YA2A 4FFWC 2ZSWA 4PRBA 1WITA 4PJHE 2PKDA 4G6AD 5D2LA 2JELH 1KELL 2XN9B 1HQRA 2B4CC 3GSOA 2VZ3A 3BPOB 5E2TH 1RUAL 3X11B 1BQHA 2J6EH 2VL4A 4HWZA 4JPWL 4UV4H 3MBXH 3D0VB 5DJ8A 2QQKL 1A1OA 1N59A 5C6TL 3C87A 5FM5O 5CEYB 1P7QA 1MFEL 3FCTA 5D7SH 4DGVL 1DQLL 3V52H 3EYOA 3IGAA 4OLYH 2OS7A 2YRLA 3ES6A 5HHME 3NFPB 2QHLA 4NQEA 4RRPG 3SBWA 5EN2B 2EECA 4RMUA 1ND0B 3VRJA 1FNFA 1YNKL 4LFHD 1Q72H 4X8JA 1A0QL 3NPSC 2FJHB 1TQBB 1T66C 1BOYA 1MCDA 4Z0BL 2BVYA 4ZUUB 1MVUB 1YQVH 1WWCA 2AK4D 2G2RA 5IGXH 2Y5EA 4BSWA 4YAQB 3C60A 1QEWB 4ELME 1P6FA 4DKFH 3C5SA 4GRWH 4M61A 4DFIA 4H8WC 3GEWB 3VGAC 3G6DL 4J3VA 3ARED 3ROOA 5AAWA 5JHDD 1KG0B 2NY4B 1EHAA 3DRQB 5B39B 3D39B 2R1XB 2ICWJ 4PJHF 2WIIB 4X6CA 5D70H 4KI5C 4OLEA 5HHOB 3HC0A 1KTDB 3KYNB 2XIDA 4XNZB 3WDHA 3U4BL 2PNDA 1VKXA 2K9UA 2AJVH 1N0LA 3ZDYE 1WK0A 2X9XA 3G6JA 4XI5D 1U8MA 1MJJA 4OZIA 4KAQH 3L7FB 3ARQA 1L0XA 4JM4L 3WN5B 1C16B 2XZQL 5DDHA 3NGBC 1NMAL 2Y4SA 1EVTC 4I5BB 1MCSA 4BZYA 3MJ8A 5FKPA 3IJSA 4LHUB 1WTLA 1NQBA 2E7BA 1CLYL 1MOEA 1E4KC 2NXYB 1GPOH 3MLTA 4Y4FC 4J3SA 5I8OL 2XA8L 4HUXB 1Z5LA 4KROC 4OV5A 3KJ4B 5IP4A 4JFPB 1G9ML 2VE6B 2I9TA 2PO6D 4L3EA 2Q8AH 5D71H 2QADD 5J1TC 4IDLA 4HKZB 1T1ZB 1D9KB 5IKCB 2FH6A 4FFZH 3QRFM 1GCFA 4RIRB 4S10A 3LQAC 3OGOE 5EA0L 3IDXL 5DHYA 2Z92B 3AMLA 1MCRA 1D5MB 2EDLA 4JFDE 1BD2E 4W4OC 1A14H 2NLJA 3O3AB 4AL8L 4K71B 3EW3B 3MUJA 3TPUB 5BZDB 1YN6A 2R1YB 3MLRL 3EOTL 5B38B 1MWAL 3NZHL 4G6FB 2BERA 4LCCA 1Z6JT 3LSOA 1SBSL 3Q48A 1NH6A 2YMXL 4WENB 2O5XL 3KWWB 4YE4H 4JPIA 2QSTA 5B4MC 5C08E 5I2IA 3TC9A 4P2RE 2BY0A 1BZ9A 4MMZC 5GZNC 3QDMB 3X3FL 4KRNA 4UU9B 5T5NG 1MJ7L 1H5BC 3INUH 4U3HA 3VFWB 3VXRE 4WGVB 5C0FB 4PRPE 4JFFE 1IGMH 3DV4B 3EO9L 3EHBD 4XNYL 4Q9RL 4PJ5E 4Y1AE 3CIQA 3PV7A 4K3JH 4ERSH 1RV6X 1ZT4A 3STZA 3KNBA 3W11C 3OMZA 3TYFA 2H2SC 1NCTA 3V0VB 4LOUD 1A47A 3P9MA 1UCBH 3HMXH 5EWIL 2R39A 4QXTB 5FO7B 5D1ZA 5GPRA 4AQ1B 5F7NC 4DZ8B 4Q2ZA 1QSEE 4Y4FB 3LKSB 3S34H 1Q9LA 4OAWB 4OIIH 3QPQC 2R2CA 2BVOB 1IGTA 1V05A 2VLME 1QBLL 3CSPA 1S7RA 2DWEA 1I85A 2WP3T 3REWA 3D0LB 1WTGT 2IBBA 1TCMA 4OTXL 4N68A 2EDOA 1VGEL 3FTGA 4LSRL 3QIBA 4UIKL 5MEPA 4L4TE 5IMOA 1NKRA 4HKJB 5SV4A 2DIBA 3IJHB 1CXEA 5T1MA 4O58L 4UB0L 1PSKH 5EOQH 3RPIA 1CE1H 3Q0HA 5F3HA 3GMRB 5GGSA 5DMGC 4CN6A 1BM3H 3LKNB 4KPHH 4EDXA 4HS8H 3EFFA 4NO2A 2ATKA 4IHOB 3VDAA 5IBUB 2YSSA 4P3DA 5ICZB 5LGHH 4CMMB 3ARDA 5IOPB 1CFVL 1H3XA 2X4RB 5J1AA 1CBVL 1YUHB 1I9RL 1KIRB 3IT8D 4N8VA 3I3DA 4K7PL 4NNPL 1W72A 3HE6B 1EFXD 3EYSH 3VFSB 1DUYA 1Y0LB 3CXHK 3QFJD 1NFDB 1LE5A 4KK8D 3VFTB 3G5XB 3L9RB 5C2UB 1VERA 2FSEA 1JGVL 3KPTA 3V9FA 4NNXB 3ZKSD 4ZAKB 1WC7B 2EDTA 2CKBA 5I18L 2WMPA 5L8LB 1M7IA 4OZFB 2JIXD 1U42A 2W59A 3QQNA 1LP9B 4NWTL 2P5ED 3OAUH 3ULUF 1CD1A 3ULVC 3WHXB 2HRLA 5HY9B 4OZGA 1EO7A 2XWBB 1PFCA 2QQKH 4P5TD 2OTWB 4XP9H 5E6IC 1AO7E 5KSBB 3FB7B 3HNSL 3V52L 1S7VB 5K9KB 4X80H 4FQIL 2IH3A 3HNTL 4ZODA 3CMOL 4ZFGL 4GKOA 3SGEI 2DD8L 4KH2A 5EZLA 2DYPD 3H9SA 5CILL 4Y1AA 3QJHB 4FXKB 2P24B 4JN1H 4WW2F 5C8JA 5FKAB 1DLHB 2C3WA 4N0UA 1PEWA 1U8QB 3L3KB 3UPRA 4I48B 1HZHH 3KJ6H 1S5IL 1UEMA 4JO2H 1NCDL 4MAYD 3LEVL 4PG9A 1IVLA 4Z18A 1F4XL 1IZKA 4YHLL 2DF3A 1KN4L 2FZ3A 4DZBB 5EC2A 4Z7VE 1HQ4B 3SGKC 2C3VA 4KJYB 5DR5L 4DGYL 3JUYA 5F44A 2I25N 4JY6A 1CIDA 2D2OA 4NQTA 5CEZE 4WI2A 3OR6A 2X41A 4V1DD 1BGXL 5JORA 4C83B 5E9DA 3GSXB 3Q6GH 4U6VL 2XG5A 5GHWH 1OPGL 4CADB 2F53B 2W1NA 2WANA 4UDUA 3TZVA 3F6LA 3HAEA 2NXZC 1C12A 1N6VA 4OIBA 4OCYH 4JCMA 3P0GB 4GRLB 1KIQB 3FT2A 3TYGL 4TVPD 1EO5A 1ZLSL 4TNVK 1NMAH 2WM0A 4I8DA 4OZ4B 2VC2H 1NAKH 3C8HA 4MDJB 3W5NA 2MHAB 2GIYA 3RY5A 4X6DA 3F12A 1UXSA 1ZWIB 2JF1A 5D2NB 4ZS7L 4AG4H 4TVPH 3QDJE 2E8YA 5TE7L 4JB9L 1GHFL 1PYWB 2DQDH 4HIXL 2DQTH 5DJ2B 3PGFH 3QDJD 1QR1B 3UJTL 2Q8AL 5CFHA 4KDTC 4QXUH 1JF6A 4WI8A 2BNQE 5BV7C 4BK5A 2VQTA 1UB5A 5TDOB 3IFOB 3MJ7A 3PNWA 5EUKB 4DW2L 5HHXH 1RK0A 4LSRH 3SDYH 4XRCA 2ICEA 1ZHNA 4X7TA 5MP6H 1GAFL 4LIQE 1IM9B 4YXLH 4UINL 5DJ2A 2OZ4L 1QVOA 2VNCA 4XVTL 5CEXB 4HG4K 3MLRH 3UBXI 1EGJL 3S37L 4GO6B 4QHLA 3H3PL 1EAPA 3TWCH 5J9PB 4POYA 5DZNA 2FRGP 2Y07L 3VU2A 3I3EA 1EEZA 3E8UH 2IPTL 4F7CA 1ES0B 3UC0L 1Q9KA 4UTAH 3GNMH 3WE6A 1MCEA 2AK1H 5CJQL 3VGFA 1D6EB 2VDQH 2XTJC 3OAZH 1WBXA 4M6OL 3TP4A 1G7JA 1GGBH 5KTEH 5T1LA 3O6LH 4XP6H 3HAEB 5ITFB 3TZVB 1HN1A 4JM2A 3S6CA 1EEQA 4LLWB 3ZMRA 1W72L 3RNQB 2X1XR 4WI4A 3GSXA 5E6IA 3UTQA 2VZSA 1JWMA 5EULV 2O5ZH 4M7ZC 4K3JL 1NGWA 2EYTA 3GIZL 2VSDA 2Z8SA 1NLDL 4WFGE 5D1XB 1IAIH 3L3IA 3ILQC 2NX5D 4GKSA 3TA3C 3MNVA 3DXAB 2GTWA 2IG2L 3PL6B 2LU4A 1PKQA 1XGTB 2M1KA 5F1IA 4ZNEA 4K7PY 3GIVB 3LRGA 2B1HL 4PG9B 3A6OA 4LSQL 3SDAC 1RZKH 2BRRL 5I19L 1OGAB 3TBWA 3UPRB 2APVA 4HIEA 5C0CB 4N0UB 2Y72A 3H9HA 2E9JA 1DL7L 3ILPB 4IMLA 4F7EA 1JTOA 1VGEH 4LVEA 5D4QA 1R5IA 2V5MA 5JIIA 5DD1L 4M48H 2ARJA 1BOGB 1DFBL 1JNNL 5EU7C 3GMOA 3N85H 1PW3A 4FABH 3ZTJH 2Y5TB 1WAAF 5EU6D 4G6FD 4PV9B 4W6XB 2SEBA 4OZHE 3SKMA 4GW5A 5HI5D 5K9KA 2DQFB 4KVCL 4DVBA 5BW7A 4JFFA 1SMAA 4X7DC 3FB7A 4UT6H 5JXEC 1NLBL 5DXWA 3C6LD 2KDGA 1QBAA 1DP0A 5HY9A 1HILB 1J5OL 3DSFL 2D03H 3I2CH 4AENA 1A9BA 3KPRA 4OZFA 5CZVH 1EHXA 1U8OB 2H2SD 3UO1L 1FG2B 3C6LB 5GS1A 3KLAB 2VXQL 2ZCHL 3T0EC 1T1XB 3GHBH 5TDNA 5F6HI 5EOTA 3VFGL 3MCKA 2ESVB 3QQ3A 4GAJH 4H25B 3DUUA 3ILQD 1YMHA 2WQRA 4M1GL 3VXSD 1J8KA 1FL6A 4XMPL 1NCCL 2EE2A 4P3DB 5HHPA 1I85C 1KB5A 4JJ5A 4ZPVA 4IHOA 1R0AH 3MJ9H 1R3JA 4NCC1 3U9UB 4XP9L 3GM0A 2BDNL 3FO0L 4H8WL 4HW6A 2PW2B 4XWGL 3L95A 3B2VH 2FL5A 1PY9A 4NO5B 4RDQG 5GGSB 4WI5A 1P4BH 2DS4A 3SJVA 1QRKA 5SWZD 5J4MA 2FIRT 4HKJA 1GGCH 1KOAA 3V79C 3UJTH 3KYOA 4JZJB 4UOW1 3MCLL 4HBQA 3MLYL 2X4TB 2ICWI 3BH9B 3STLA 1S7RB 3B9KC 4WW2A 1ZTXL 3IU3B 1AFVH 4FQPA 4KRLB 2BVOA 4M6ML 4Y4KA 4NBXB 3PWNA 1EFXA 4OM1L 2B0SL 3M17A 1IJ9A 3DX6A 3OKKA 4JFFB 2J8OA 2OZ4H 4GW5B 4MS8D 5FHBL 3WIHL 3RX7A 1CYGA 3AREB 3TZVC 2W60A 4PYGA 1EMTH 1I3RA 2R4SH 4F9LC 3GMOB 4OKVA 5IQ7L 1ZXQA 3V0VA 4YHPB 4Z77A 5CJ5A 4L8SC 3WFBL 5KW9H 1D6VH 1BJ8A 4L8BB 5EU7E 5C0CA 4GRWE 1A7RH 1O5DT 4U6VH 1EUTA 3E6FB 3OB8A 3W2DH 4LSSH 5E00B 1U9KA 2IC2A 2Y36H 3WLWC 3QDMA 1U8LB 2DKUA 4WDIA 3MOAL 1U95B 5CP3H 2CRMA 4OD3H 2HJLA 4PJFB 5KSVA 4WRLA 3PL6A 1DBML 1UXWB 2IBZY 1B9ZA 1NC2A 5I8EB 3CX5J 2RR3A 1K4CA 5CJBA 1UB6B 2A6DB 1M4KA 3UTPD 2ICWA 5E6IB 5E8DH 5T3ZE 1EIBA 2FJFA 4LLWA 2OTPA 4JM2B 1HHKB 4HUKB 2X1QA 5IUSA 2QSCH 3T2OA 3QWRD 3EYFA 3TPUA 1ZA6A 4XTRC 1JHLH 1SM3H 5D7LD 3QUKB 4R7DB 2UZIH 1SY6H 5D7IB 5TPWL 1EDQA 1MHHB 1QFWL 4F7CB 1AHWB 5E7BA 5J13B 3MODH 2EE6A 1I4FB 1F8TH 5LBSH 5KBNC 4QHLB 2CK0L 4LF3A 1CU4H 1KPVB 2BNRE 4NHCL 5DVLA 4EI6A 2P8MA 3H8NA 2OJEB 1T7YA 2C26A 1WZ1H 2VDMH 1FDLL 4QHNB 4XPGH 2GK0A 1G7QA 2NY6C 4UNTA 4S2SA 3GSNB 1KN2H 2XA3A 4PGDB 3EJJX 3IU4H 5EUKA 1BAFL 2XY2A 4PFEA 4XBGB 4HWNA 4U1HA 3L5XL 3R1GL 1QBMH 4YR6A 2KZWA 1N5YL 5HGGS 1DBAH 3IKKA 4ODXB 2IH1B 4K3EL 3B8YA 5DQDL 1EZVY 2WAHA 4O00A 3RA7L 2BXZA 5GRYA 3MRGB 4XPHH 2YPLE 3MRMB 3QUMB 3U36A 4PJ7A 2BFVL 5GS0C 2E9BA 4FXLA 5C3TA 2XQYG 1IQWL 1CT8B 1ZANL 4P2QA 5D2NA 1TZHA 4JZJC 5TGBB 2HP4A 4JY4B 4JCLA 2DJUA 2MHAA 1FFOB 5CEZD 2HA1A 4RNRA 1J0YA 2XOTA 4OZ4A 5E6ZA 2A6IB 2FJGB 4NYLA 2BC4A 4Z7OE 1NJ9B 3MJGX 5EZOL 4L8CB 4R26H 4X4ME 1LO4L 2JTDA 1KG0A 4JDTH 1MFEH 4MD5A 3RFZC 3FT2B 4L4JA 2LABA 3VFOB 4DCQB 2A9ML 1T5XA 4MNGA 4MXVF 4R4NC 4QCIA 2B1AH 3MRNA 3W39B 1INEH 4BSWB 4XNUH 2F53A 3E3QE 3TH3T 4LGSB 4ELKA 2FHFA 1L4IA 2W9LA 4ZOEA 12E8H 2XWTB 2X4QA 3KPSA 1UZ8B 5DUPL 3IDXH 4Z0BH 2OXHA 2AI0L 3DV6B 3CFJB 3QUYD 4Y5VB 5L8KB 4JDZA 3VD5A 4JY6B 4NQEB 3S3JA 2YK1H 3V4VL 2JCCB 3IDNA 4KJYA 4XTRD 4KROB 4ELKB 2HH0L 1BQHG 3V8OA 3EJZC 1WAAA 2EC8A 3LD8C 3CZJA 3MRNB 4JLRB 4KK5C 4OIAA 5E5MB 1D7FA 4P5TC 1T5XB 5DJ8B 5FEBA 3WIIH 1V3LA 4NN6B 3PDOB 5I6XC 4OB5L 3B5HA 5GRUL 4L8CA 4HPOH 4YBHA 3VWJA 4XCFH 1FFNA 2BC4B 3GSOB 2A6IA 3QUXD 2ZUSA 5K59E 3QSKB 4FXKA 4HPYL 1JPGB 2DTSA 1JPSH 5EZIH 3CSYA 4Y1AB 1NGYA 5HYJB 1FFOA 4D2NA 3RIAF 5ESQB 4KHXL 4X9GA 1TMCB 2L4OA 5CSBA 3MOAH 1TZHB 2IH3B 4KY1H 2CPCA 5LXGL 1T5WB 3PGCB 5HDQL 5IBLC 4K3GA 3C6SB 4ODTL 2ADFH 4PJ7B 2HT2D 2H26B 3F5WB 1SQ2N 4P5KA 3REVA 3RVUD 3S5LG 4JQVA 5EO9A 5IB1A 1CD1B 4K3HA 4FXGA 4YR6B 4JKLA 3DGGA 3RX5A 4Y16D 1E4XI 1GC1H 2IFFH 5LVEA 3BYTA 1LMKA 5GQBA 1HCVA 2FSEB 2Q20A 2DWDB 3H7BB 4L9LA 1BP3B 2Q6WB 1A3LL 4WU5B 2P8MB 1IC1A 4X6CE 2GTZB 4NO0A 2JELL 4AIOA 2GEEA 2PXYC 5I1AB 5HDBE 4CW1A 5D96C 3OKNB 4IM8A 2UZIL 3LB6C 4Z8FL 1SYSA 4XNMA 4N90D 1ZKAA 1I7RA 4HLJA 3TBSB 3MLXL 1J88A 3I75A 4KJWD 3MV7E 1AFVL 3CZFB 3S96A 1I1AB 4UNVA 4MMXC 1TTFA 3TV3L 2LAAA 3EO0B 1PSKL 5CS7A 1CE1L 1FFRA 3UP1A 2GI7A 1DQLH 5FHBH 3WIHH 1XF3A 5F3HB 1ZA6B 4DKDC 3MRCA 2BOCB 1CDUA 3SOBL 4PV8B 4PR5B 1M1SA 4LSPL 4N0FA 2CLVA 2ICWB 4HQQH 2Y7QB 3TNNB 1UGNA 3TF7C 5KSAB 5ERWB 1NMBH 4XX1G 2D7MA 1CF8H 5I9QB 1NC2B 4KJPC 3WFCH 4PJDF 5I30H 2AV1B 1LE9B 1OGTB 1IKNA 1BIHA 4X4YA 4PLKD 5SWSA 3SJVD 2VXUL 4LCIH 3VXTB 4CRPA 4JVWA 4AEIL 5JDSB 4X5WA 2OX5A 2WUCH 5CJOL 4YFDB 5DJAA 3FN0H 4CU8A 2J6EL 2GUOB 1Z9MA 3LV3A 4EQ2A 2WWKT 4LPYA 5FGCB 3UYPA 1IGYA 1M7DB 4MLIA 2RQ8A 5C0FA 2YPKB 1FYTD 3BZEB 3DIFA 4FQ2L 5CWSB 2RGSA 4QWWC 5KVEH 4BSJA 3L1OL 3QIUD 4WI7A 2DKMA 1FO0B 5BS0A 1INEL 4WFHE 3IDGB 2YD9A 5I1LB 3GSNH 2VN4A 3U4AA 1IBGL 2XZAL 3LPGA 1D5ZB 5SX5H 1EFXB 3S97C 2WSKA 1DEDA 4Y4KB 4R2GC 1W0WB 2EDDA 3IU3A 2QQLH 5IK3B 3STLB 2XPGA 3QNXA 4Y88A 1HZHL 3KJ6L 3BH9A 3KLHC 4KI1A 1ZK9A 4BZ1H 2YK1L 1JPST 3TO4A 2GJJA 2IEPA 5B38A 2NXZB 2X4TA 3WSQL 1GPOL 3HG1A 1S78C 3KYOB 2HH0H 2WBJC 4WO4C 5K93A 3DROB 4NBZB 4DTGL 4KKCD 3ARBD 3DHJA 4NQXA 2FL5B 4NO5A 5D7JA 1EEYB 4O51B 1KFAL 3T77A 1FL3B 2CMRL 4FQLL 3UAJD 1LDPH 3N0PB 1C08B 3R1GH 3NCFB 3EYSL 5IKCA 2R2BB 4E42A 2CIIA 1FAIL 2YUWA 5DQDH 2ZUVA 1R5VB 4W6WB 1GGUA 3IVKB 1IGCL 2AGJL 1XR9B 2NY0B 1NGPL 3QWRA 3B43A 4F58H 3QXDB 3W9DA 3EOTH 4N9GB 5L6YL 1YEJL 5L2KB 3GBLA 4ODUB 2P8LB 2HAZA 3AS3A 3MJ8B 4HZLB 5ISZE 2AJYL 1FORL 2DTMH 4QTHB 3V6ZA 2GJ6E 2VXTH 3BIAX 2IFFL 2WBKA 2ENSA 2RHEA 5IT2H 4NO3A 4A6YL 2N1KA 4NT6A 2W0PA 4YNYA 2F5AL 1MJJB 3QNZA 4IDJH 5IR1B 1U8MB 3DI2B 5JOEA 4TRPL 3ZKXB 1Q0XH 1DR9A 3SKMB 1T2QH 2VISB 2HFEA 2NNAA 4B53A 4L5FL 4LCWD 3SQOH 3ZSTA 4PJ8A 3C09C 4YGAB 5J13C 3HC0B 5KG9B 2NY1C 3SDYL 4E5XA 4O9HH 4IOIA 4HIEB 4OF5A 2NY2C 4WHYH 5IHUL 4U1KB 2PUQT 4RMRA 3ARBB 4DVRL 3RAJL 2YEZB 5DZOA 3WFZA 5F8QC 1XCQB 3NFSL 2V7HB 4M61B 5I73C 3D3VB 3GMPB 5DURD 5CCKL 1P9MC 4C57C 1MLBA 3FB8B 4OB5H 2OI9C 1X5ZA 2P5EA 2FX7L 3L3IB 5D1XA 2BVPA 4EUPH 3B5GA 4WFFD 4YZFE 3ZTNH 1AO7D 3EHBC 2VLKE 1NDGA 3GBNH 4KQ4H 3UTQB 5C09E 1AR2A 1INQB 3SDXF 1EO8L 4YH6A 2PF6A 4XP6L 3RIAK 5MEOA 4APQD 4KPHL 3SGKA 4JZOA 5CEYA 2D7TL 3SDAB 5EU4A 1ZLUH 4JVPA 1A1OB 2ZNXA 1MAMH 5GZND 2NXYD 5T1LB 3U0WL 5CINH 1WBXB 3MLUH 1B6DA 4Q9RH 4EBQL 1MCPL 1FZKB 3KPSD 2VL5B 4CVWA 3MBEB 2X4UA 1I9RH 4RBPK 1OT1A 2NTFA 4PYHA 1HQRB 5E1AB 1MJUL 1DVFD 3BXNA 4LKXB 1A2YB 1ES0A 2G5BA 3DX7A 4PRPB 1MUJA 1UCBL 5HBBA 1HOCA 3AAZA 4OLXH 3U0PB 4G8FB 4KHTH 4R4ND 2NYYD 2R2EB 5F1NA 4JQXC 3HZYA 3BPOC 1W8NA 2P46B 4LOUC 4WI3A 1QBLH 3QUYB 4GRWB 3LZFL 1YMMB 2L7UA 4MD0A 1ZHNB 1ADQH 3LKRA 4JFYA 2PYEE 2NY1D 1WIUA 2Y9RT 2ADJA 3JVGA 3KYMA 2DL2A 1CFQA 1CGYA 1F8TL 3LQZB 3HCVB 3AUVA 1S7WB 4OJFH 4UAOC 3NCJL 1JTPA 3K46A 5E8EA 5TF0A 4I1NB 4K2UL 5BRZB 3AB0B 1QR1A 4NQDD 3PIQB 1FZMA 3VXRD 2K7QA 1R3IH 4MGXA 5TE4L 3UTSE 4F9PA 3HI5H 1KN2L 1ZWIA 1G84A 1RI8A 3F12B 5IHBA 4M4PA 1U3HB 3FONB 5I1DA 1P7KB 5DK0A 2X4SB 4YC2C 1QO3B 1FGNL 4MDJA 5DYOA 1KYOJ 3SDDA 1KLGA 4A6YB 5C71A 1U8HA 3O4LE 3WFCL 2IADA 3QDGD 4YXHL 2MPAH 3JZ7A 2ZOKB 4EI5A 4JJHA 4ZSOA 4BM7A 2IQAA 5DVMA 4OQTH 2C5DC 4DN4L 2VDOL 5GSVA 4OI7A 4GRLA 4NWUH 4KMTL 5AG9A 1KLUB 3JWDC 5K9OA 4OZHF 3QEUA 3KYKL 5J6GA 1GZPA 1TDQA 4UDUB 1K4DB 3NCEB 5F9JB 2HN7A 3LEYL 4NPYA 5E9DB 4JFZL 4ZS6D 1BVKA 4WI9A 1WBYA 1N64L 3F58L 4ZG1A 3ARFA 4YDVB 5E8OA 4HDIA 3BW9A 1AE6L 5AD0A 3OGCA 3O9WC 3TJHC 4H26A 2B1HH 1UJ3A 1HH6A 1RFDL 5EU5B 3RTQB 5L2JA 2EO9A 1UFUA 5KSBE 12E8L 1RZFH 3MLSH 1KTLB 3RP1A 4KRPB 5FF6B 4K23H 4I48A 3ROLA 3V6OA 1U8QA 3L3KA 4WCYL 3MLWL 5HXMA 4FQXA 2ZG2A 2XZZA 1WV7T 4XBEL 1YN7A 4G7YH 4BZ1L 3QCVH 3TCLB 3CC5B 1F4XH 4Z7UF 1A1NA 1HINH 2NYYC 2YKLH 5D1QA 2J5LC 1MFCH 2HJKB 3MLZL 3PP3K 3NFSH 3MRFA 1A4KA 1S9VB 2A6KA 4MJ4A 4E41A 4XPFH 4EVNB 5JW5B 1X5AA 3BO8A 3CDYA 3L3GB 2CO7B 3BP7B 1YJDH 3RY6C 2KL6A 1KXTB 1PLGH 3BMVA 5HGBB 1QBBA 5ECJE 4M4RA 2B7DT 4ELMA 4L8SA 2YPVL 4QRPA 5GRVL 2WINA 4LLVA 1KIPA 1CXFA 1BQLL 4Z7UB 3V6FA 1T21B 3IAPA 5IB5A 5KJRH 3M45A 4OF8A 1T0NA 1L6XA 1BBJB 3JV5A 5I8KH 5EC1A 4PJAE 4UDTB 1IC7H 3IJYB 3L9RA 3VI4F 1F3RB 1NUFA 3DRTA 2W0KA 1B4JL 1NKOA 1ZA3B 1DUYB 4IMKA 3ARSA 3HZMA 2H6PB 3IAQA 5JXAL 1YY9C 3BE1L 3QULB 3TN0A 3P2TA 4ZSOE 1MY7A 1OVZA 4KDWA 5EU6E 2YSSB 3TO4D 3EYUL 3KR3H 4QOKA 2ATKB 3WD5L 1ZS8A 4HX1B 4OGZA 4IJ3B 1N7MH 5MI0C 4NFBA 1N8ZA 4S1DD 4UQ2A 2XQBL 1YDPB 3RPIB 5TQ0H 2Z0BA 3IJHA 5CMAB 5E2TL 2UV3A 5C0BB 1UWEH 4Z7NF 3S4SA 3UTTA 3I50H 5DJYB 3HFML 1D5IL 2ZCLH 4U1IB 3KS0H 4XVUD 5FA3A 2DRUA 1WJ3A 3D0LA 3RKPA 3VD3A 4ZPTA 2M2DA 1TVBA 5IHUH 5IVNA 1OOAA 5F88A 4LP5A 4YHZL 3P4OA 2FR4B 4B41A 3PQYE 4XCNB 2GFBA 1OCWH 4OAWA 4OLYL 3VD9A 1ODAA 4BH7B 1P84J 1IKFH 3WS3A 4OKDA 5JW4R 5CJXA 2PYEB 2JK5A 4YQXH 1VCAA 1KBGH 4L4VD 4J3UA 3UJJH 3F7QA 1MFDH 3T3ME 1I3VA 4NQVB 1DDHB 4WHTB 5CJXC 1MI5D 4M1CD 1ZT4B 4WUUE 5GISH 3S35L 1CF8L 5BOPA 5C09A 3ZDZF 1HXYB 3DV4A 1TQCC 4HAFA 2VITA 3O6LL 4R0LB 3BP4A 2X7LB 3WN5C 4XVSL 4C55A 4WJ5B 1CFNA 3D85D 1YEEL 3FOLB 3MXVL 1VEOA 5H35B 5B38G 5EO0A 3S7GA 5I75B 1IAOB 5D70L 1L7TL 25C8H 3KLSA 3MBED 4JO4L 4NOBA 3AFLA 4FOMA 4Y19E 4MHHG 3E6HA 1MIML 3H3BC 2APBA 4XVJH 2R9HD 2R1YA 1YN6B 1LGVA 2BVTA 3ZE0E 3RUGE 5I1CL 1RUMH 2V5SA 4FFVD 5D93C 3TN0C 4ODBD 2YC1B 2GJ6B 4M02A 4MZ3A 4XVUC 4BYHA 3PWJA 4M1GH 3JV4A 1JNHA 2HT4C 1JNHB 5K9QI 4Z78B 4HUVA 2BNUA 5HJ3B 3DMMD 4PJ9D 1XH3B 5IMKB 3RIFK 4K2UH 4S11A 3QDMD 1KTRL 2RIKA 3KG5A 3MLZH 3ZTJG 2Z31D 1RHHA 4H5SA 4WNQA 3S3PA 5FCUH 1WWWX 1U91A 5I16A 5I1KH 4S0SD 1R3IL 4PJCB 4HXBH 4XB7A 2J8UB 2HRPH 5DMKB 5MENA 4FTVE 2CXKA 5DT1L 5F7EL 3RZCB 3VCLA 5FKPB 4U1MA 3GSRA 2MNUA 1WFTA 5EO0B 3SCMA 4J4PC 5LCVH 4J6RH 4LRIC 4AH2A 1JL8A 1IGCH 3FOLA 1LD9B 1VGKA 3K4ZA 5IWLC 4F58L 1B0RA 1QRNB 5C0JA 1HXYA 1NBQA 1C5BH 2CR6A 3JWOC 1MEXH 5D96B 4F8TA 3G6JB 2VH5L 1DVFB 3VA2C 3QEHA 5HTSA 4Z95L 5F9DC 3BVNA 4RMTA 4LBEB 3O6FC 1R0AL 3RVUC 2DQHH 5LWYH 5F1SA 1EGJA 1X5YA 2Z8RA 3IXAB 2ESVE 5C08D 4XWGH 2R1XA 1I1CA 4Q6IA 3DRQA 1IE5A 4BH7A 2CDFB 1FRGH 1MJ7H 4XCNA 2DQCH 4ZTPL 3ROOB 4G9FA 5D1QC 4HK3J 1RFDH 4CKVX 4YHOH 3WJJA 2YD5A 1EAJA 5F1KC 2MFNA 4ERSL 3MJ6A 1MVUA 3ET9F 4N90E 2ZCLL 5F6IB 4LVOB 2BVEA 3QQ9D 4R6UA 3O3UN 4OLZL 3TV3H 3CDCA 4NP4H 2P47B 3J8F7 4NFCA 2P48B 4YBLC 1IGJA 3ES6B 4HX1A 1LK2A 4UUJB 3NH7H 1QSFB 5E7FA 1J7VR 3UTOA 4OIIL 4LGRB 2AJSL 3KPMA 5EUOF 3O6FA 3RU8L 5HYSA 1OAXH 5BV7B 1CICA 3D0VA 2NMSA 5FYJL 4M03A 1GL4B 4WUUD 1NCUA 4I0PC 3DRTB 3PUCA 1BQHB 4KI5F 4ZD3H 4MJIB 3GMNB 2PTTA 3DARA 3TBTA 4KQ4L 2Y36L 4UDTA 4IS6A 4HEME 1JF1A 4HC1H 1LEGA 2CLRA 3EO1B 2OR8A 3QJFA 5LGJB 5I8KL 2VUYA 5LG1A 5FO9B 3HI1B 3OV6A 1YEEH 5CZXD 2J3SA 4JN2B 2YOCA 4TNWF 1S9WB 4K7FA 1E6OH 5CIPH 1CFVH 5BJTA 5JR1L 2HLFD 5L88L 2DQJH 3MNZA 3TBVB 1T20A 4K9EL 3OKLA 4G8GD 2EH8H 4XHJD 1C5DB 4K3EH 1SEBB 4Y5XB 3L3GA 4MVBC 1I8KB 3BO8B 1WISA 4E41B 2J1KA 4TVSa 2OYPA 3MRFB 4KXZH 4EIZC 1JHLL 1KYOK 1IGIL 3QG7H 1F4WH 3SGEH 4Y16C 1TJHL 3R8BB 4XXCA 1NCWH 1XR8A 1A6ZB 1H8NA 4UOW0 3GI8L 4ZFOL 3ZHKA 4FQXB 5CKAA 2DI7A 5CD3B 5JA8B 3B9KA 1P1ZA 3SE4C 3VXMB 1QHPA 3QUXA 2VIRB 3W0WD 3MRKB 2NY6D 5T5FL 5JQHC 3UCRA 1Z3GH 4NM8H 4YZFF 1BF2A 4Y7MA 1S7UB 2LV4A 1A6WH 4YO0B 3VMOA 1KJVB 1FNEB 5MI0B 4MD4B 3TCXA 4NJAH 2DD8H 3BPNB 4MCZA 4IRJC 4NC2B 1YEFL 5I0DA 4DTGH 2BOBB 2PW1B 2CXGA 3ARFB 4YDVA 5E8OB 3SOBH 3WDJA 2YUZA 4PJ5A 4HXBL 3KPLB 4M5YL 1WBYB 4I0PD 4ORGA 3WUWG 3C5JA 4L4VB 3BEVA 4O02L 1CBVH 3MUGA 4U4BA 4LP4A 5LAXA 4LNVA 2QHRL 4NN5B 4P48A 3PJSA 3HMWH 4YEEA 3TN0D 1NFIB 3PE9A 3QBTB 3Q3GB 4YHLH 3V5DB 3RIFF 1IL1B 4P2OD 5IW6A 1NGPH 5CZKA 5DLML 3D25A 2NY3B 3VFVA 5T33H 1DBJL 4PIRF 2F54D 3KYKH 1KLGB 1IAII 2BY3A 4MHHI 3RWEA 5KS9A 2FEDD 4HXAL 3BGFC 5D6CA 4YHMH 2AJYH 1CN4A 4OQTA 1NBYA 4M8QA 2P44B 4NKQB 43CAB 1ZVSB 4MJ2A 1MHCB 1AD9A 4YHNA 4M5ZL 2DN7A 4X80L 2F8OA 1RU9L 1KT2A 3L6FB 4K71C 4S1DC 1HSAA 2FLRT 1TJGL 4J4PA 1AR1C 1NUNB 1BJ1H 2ED8A 1I9IL 2BSRB 3QO0A 1PG7W 3PWPB 4RQQA 3U7YH 5I1EL 3BWAA 4K23L 1U58B 1FQ9C 2JJVA 1KEGH 1CFTA 4RFEA 3CLFL 1JJUA 1RURH 5I76B 1RUQL 3DVGA 2P8PA 3C5ZB 1NEZG 1J05A 3QXWA 4G7YL 4P2OC 4ZS7H 2IPUK 3VMPA 4UT9H 4NP4L 3TNMB 5KVMC 1CXHA 4G6AC 4O4YH 5IF0B 3DYMA 3A6CL 1ZLWH 3OXRA 3QO1A 4OBSA 4G8FA 3MRJA 1MH5B 2YD7A 4LIQL 4OFDA 2D31B 4FTVA 2G5BB 3D9AH 2AQ3A 1RZIB 3CFDB 3HS0A 5HHXL 4HK3N 3G6AB 4PJEE 3VFNA 4DFHA 1OAQL 2R23A 5CSGA 2PYFA 4JM2C 4ZYKB 1S5HA 3F7VA 2AGJH 1CG9A 1J8HA 1UEYA 5EU4B 5GGTL 3SDAA 3VXRB 5DJXB 3ULSA 2WBJA 1FLRH 2A6JA 5HGDA 2AEPL 1VESA 2ZUWA 3MRLA 2P45B 5KVGH 1GIGL 1XIWB 5GSRB 3B6SB 1SEQH 1YNTA 1E6OL 3RGHA 3B6SA 3BH8A 4JEGB 4LLMA 4E0RA 4HC1A 2NXYC 2J4WH 1GC1L 2LU7A 1MCWW 4P59H 5EZJA 2A6JB 4HJJH 4EXPX 2XQYK 3IFLL 3S8WA 3U7AA 5DJXA 4PJBF 2GJZA 1WZMA 4YDLC 1HIMH 2NY5C 5FK9B 4PJHA 1XCQA 1UJTA 5B22A 1MELA 4YHOL 3QFDA 3ARBA 4IBLT 5J89A 4XC3L 5D7JD 3P0VL 1I7TB 2EIZB 4M7JH 4PP1D 4ZTOL 5IMMA 2ZUQC 1I7UA 3ZSSA 1PG7X 3VGDA 5DFVD 3VWKC 5DRZA 3CFDA 3HS0B 1ADQL 2ZG3A 3LAFA 2Z91B 3HFMH 4X0KA 3MGTA 4DN3H 3SCMD 4QHUB 3QZWB 3RRQA 3MFFB 5CJ8A 2Z31C 2CD0A 5FDYA 5IR1A 3VDCA 5GGVL 4JRYA 4GMSL 4YNYB 3ZDXF 3ZE2F 3SPVA 3C5ZA 1KC5L 1VB9A 5I76A 1XMWA 1F6AB 1IARB 3V0AC 3X17A 4JRXE 3BWAB 4K8RC 3BUTA 3NCYS 3QUMH 2BHYA 3FRUA 4I4WA 5BO1L 2G60H 1YYLH 4OGYH 2KH2B 3IS1X 2FDBP 4QRTA 4FABL 4HJGA 4OCWL 3A6BH 4N9GA 1GYAA 1OY3B 3GGWB 2ADGB 3BQUA 5JW4M 1HKLH 4JHZA 1QLRB 1Q9OA 1XR9A 2QSVA 5T33L 43CAA 5FUZH 4LQFL 2W07A 3K4DA 3VXMD 4GQ9H 4UTBH 4AIZA 3ZDXE 4LCWA 4E42B 1NLDH 5C0DB 4BFIB 4JFZH 3WHE0 1FL3A 1ZT7A 1JN6A 3O3BB 2VQ1A 3RUGF 3HHRB 1OF2A 1QSFE 1D5BB 3C5ZC 1X5KA 3SDCD 5HGHB 3LD8B 3RVXC 3P30L 1YPZA 3H9ZA 4PJ9B 4M7LL 5I1CH 1RZKC 8FABA 4G8GB 3FN9A 1QSZA 2Z8VC 4MB4A 4J8RA 2XPGB 3OJDB 3QNXB 2VUOA 1NCCH 1W0WA 3BRGC 3MRBB 1AY1H 1DQDH 4QRRA 5BCAA 2PW1A 3N85L 4WTZG 1HHIA 2OBGA 5I1LA 3O9WB 5E94B 5FUOL 4PTUB 4EEEA 3T4AA 5HPMA 1FO0A 5BS0B 1MFCL 5BMFL 5IVZA 2EKSB 3SHSA 4JFQA 3CUPB 5C0ND 4ISVB 2NY0D 4HCRA 3JWDH 2B20A 3MCLH 2GAZB 1R24A 3U2SA 2UWEA 1KCSH 5CD3A 4QRUB 3G5YB 4WFGD 1A6ZA 1XZ0B 2P1YA 4LHUG 5DMIL 1ZGLA 5FA4B 2YPVH 4Y19D 1AQKH 3MV01 2B0SH 4ZQKA 4LVHB 1T0MA 1V8HA 3I6KB 5IFHH 3CXDL 1V7ML 2ZCHH 4HBCH 1RZ7L 5D7LB 4OQTL 5JZ7C 1BIIA 3WCYA 2AV1A 1MWAH 2IMNA 5GZOD 1NCBL 4NN6C 1QKZL 1X44A 1YEJH 3N1PC 3TBVA 4NN7B 5ERWA 5BJTB 1LEKA 1XF4B 3NBNA 2NY5L 1J1OL 4K7FB 3PHOB 3RJDA 3ORJA 1U41A 5C0CE 5ID0A 3PF2A 5C0GB 1WF5A 3W82A 2BX5A 5DJCA 1G7HA 1M7XA 5F1OB 4OZHA 4UI2A 2IPKA 2HJFB 4KV5F 3LCYA 1JRHI 3BKMH 4D9LH 1PKOA 3ZT7A 5B39G 5SV3A 1XGPB 1H3VA 4KZEL 1MAML 3U0WH 1DTUA 4PJEB 1A9EB 2C1PA 4PP2A 3IDMB 3MV7D 2CUIA 1MCQA 4FQJH 2ZUXA 2EDHA 4Y2DB 1I7RB 2VLRE 1SYSB 1MFBL 1YC7A 5I71B 3MC0A 1P4LA 4OF0A 4I3SL 4UUJA 4CW1B 1E4WH 1TCRB 4DN3L 1IGJB 2CUHA 3V7AG 1M71A 4WU5A 3CNKA 1ZHKB 4P2OA 1J9CT 1HCFX 3H7BA 4RZCA 3X14B 1SBBA 4I13B 1EMTL 2K3TA 1J87A 1RIHL 1LILA 3HI6H 4OD1L 2H1PL 4NN5C 4P4KB 3QA3A 3EDFA 5FYJH 5JIPA 4KRMB 1FL5A 1CLOL 1VFAB 4G9FB 4Z0XA 5EBMA 2H26A 1BECA 4I18B 3NMEA 4OV6F 2D0GA 3DMMB 1AKJA 4M1DL 4LBEA 2R0KL 4OF7A 1R3KA 2R0LH 3EOAB 1V5JA 5DVNA 3ARVA 1KJMB 1FO0H 5IB4A 5IBLD 3PDOA 2XN9D 1RJYB 5D5MB 4JQXA 5E2JA 4PRAA 4XPHL 1F3DJ 1I8MA 5IQ9B 2ATPB 4HFUL 3S34L 4LRIA 4H1LA 1XGUA 4XHQA 2EXWC 2XQBH 4RMVA 1BWMA 4QYOB 4L3AA 3VXOB 2BY2A 4XC3H 3WFDL 4WWKA 3O4OC 1XIWC 4PJBB 3MJ9A 1EHLL 3RZCA 2DAVA 1X5HA 4R90H 3HA0A 4DUXA 2J8UA 4PJCA 1ONQA 3OQ3B 3RZCC 4LU5H 4WNQB 2HFFB 4HV8A 5T1KD 4P5TA 2MCPL 4D9RE 1CU4L 4M62H 5HHMD 1BM3L 2D7PA 3N1MC 5BMFH 1CD9B 4MDIA 6FABH 5KAQG 1WZ1L 1YEFH 3TESA 3U30B 3OTTA 2DYPA 1YNKH 5B4MD 3DX8B 1JBJA 1ITCA 4NN7C 4Y1AD 2C4XA 1KB9J 3BISA 3JV4B 1BBDH 2FJGA 3ZE0F 4MNHA 4DKEL 3VRIA 4OFYD 4YDIL 2VLRD 4RGND 2F54B 5C0AA 3ESVF 5TFSL 3RL2B 3C8KA 4U1LB 5TE6H 3HR5B 3ECBB 4JFHE 5TGBA 4J6RL 1T1YA 4G6KH 2QEJA 1CT8A 1JGVH 1MFAL 2R8SL 5F70A 2Z93A 1EUUA 3DUSA 1WCBA 4HGWB 1CI5A 4PJFF 5ICXB 1QSVA 1M05A 1X3DA 4ODXA 1MHEB 1T4KA 4J3XA 1J86A 4EN3B 1S7SA 4HXAH 4DUVA 4J12A 4HPYH 2HWZL 1BLNA 3T1FA 1OPGH 3CU1A 4CU7A 3PHSA 2NY2B 2GK0B 1BQLH 3VI3E 1VENA 4JO1L 1IAIM 2VITB 1I3GL 5C09B 5I73B 2AXGA 2DKSA 3ABZA 3B9DA 3PQYA 4KKAC 4Q6IC 4XNUL 3S4SG 2IANA 1ZHLB 4OQ1A 4NQVA 3F7YA 1I4FA 4GKZB 2NW3B 4TQEL 5ISZB 3UYRL 1AHWA 3FO1B 5EB9A 1WT5A 3D6GA 3WJJC 1MHHA 2AAVA 3LS4L 4Q58C 3QT2A 1HEZB 3RGVB 3F65A 3FT4B 4RISH 3O6MH 4PB0L 5F88B 1HDMB 3LQAH 5HYJD 2EDFA 2Q8BH 3BRFA 5FYKD 2NY2D 1ZSDA 4U6YB 5JW3L 2Y25A 4ACPA 5GS1C 2L7JA 4GRWF 3VXPA 3MMEB 1RJLB 3MOBL 4PBWD 5DT1H 5F7EH 1I1AD 3BKCL 3RKDC 2A6DA 1UB6A 4I2XE 1BFVH 3SO5A 1YEHL 1AJ7L 4G6JL 2XRAL 1J0ZA 3HPJB 5MP6L 4CMHB 3DO3A 5I8EA 1F13A 3ARBC 4LVNB 4UQ2B 3T0XA 2XN9E 2H41A 4D9RD 3BGAA 1JZ4A 1ORSA 4XCYA 4YHZH 1MVFA 5D9SA 4OCYL 5CIPB 3EUUA 4QOKB 1TPXC 4Y5XC 2BNRB 2DJSA 5LXGH 2OJZL 1U95A 3H3PH 3TWCL 4GG8B 4FS0A 4IRSA 3O4LB 1KENH 4WUUB 4NDMA 4NKDA 3GRWL 4Y16B 1ZA3A 2DQJL 4W4NA 4BH8B 5B3NA 4B50A 3E1F1 3OKMB 3O6KH 3IXTB 1IEBB 1NEZA 3MTRA 3BEWB 5IB5B 2OK0L 3DECA 3AREA 5F9WB 2X89A 1OARH 4M9PA 5C6PB 3AM8C 4Z7VA 2WINB 4YHIB 2H3NA 4MNQA 3KDMA 4JM2D 3JV0A 1YY9D 3EYVB 4XXDB 3PWNB 5MEND 1L7TH 25C8L 3PHQB 1QZ1A 4AT6A 1FFPB 5DEGB 1PZ5B 1IAIL 2FX8H 2PO6C 5C6TH 4M7LT 1H0DB 2ITCA 5AZ2H 4Q74A 4EJ1C 1DQQA 3PXHA 3L1OH 1FVEB 1EGJH 4NJAL 1BFOA 5MEQA 4ZUTA 2HMIC 3UTSD 3TVMB 1W2KT 3QUZB 3RVWC 4KTYA 4MAYB 2AABL 2DLGA 3BGMA 4ZPVB 2ERJB 1A22B 2QHRH 5DD1H 1QHOA 4NRXA 2DIAA 4NSKA 3HMWL 4WV1C 1NMBL 2VDQL 4LAQL 5GISL 3S35H 3AS0A 1U0QA 4OLWL 3QQ3B 4H25A 5DTFA 1N26A 5KTEL 5GGUB 4QXGL 3ZYZA 2VN7A 3I6GB 4HMEA 1R3HB 2G5RA 1XF2A 3K8LA 1K8DA 3FO9A 3O11A 2YD4A 5JR1H 2W0FB 4NZJA 3PP4H 2HN7B 2P5WA 2EH8L 3FQWA 4PGCA 4QF1A 1JPTL 2EH7L 4JO4H 4HK0A 4JDVB 5AZEL 2AJVL 2C7UA 4HCRH 5AAMA 5LCVL 3UROR 2HTLD 1NAML 2LVEA 2IQAB 3P4LA 3VXQA 3PDDA 3P73B 4D9QE 2QSQA 1FSKB 1IGIH 2DQFA 3UTZB 2CH8A 4PV9A 3SDDB 1TJGH 1RUML 4P57A 3QFJB 2FWOB 2X4NB 3BN9D 4RGNB 4G80B 4NGHL 1DUZB 1KLFA 1CICD 4WW1B 3WBDA 3ARGD 3EOYG 4OFKA 2VXTL 3OHXB 4ZO9A 1F3DH 3THMH 5IT2L 1Z3GL 4NM8L 5B3JE 4APQB 1HH9B 2XV6B 2ADIB 4LEXH 3GIVA 1UVQA 3RWHB 5LKNA 1ZT1A 3HCVA 5E95B 3VXNA 2PO6A 3OPZH 2GTWB 4JFYB 5A2JH 2E7LA 4R97C 4M7ZB 1AXSB 3WKNA 2V9RA 5DWUL 1WEJL 3UYOD 2Z35B 3R8QA 2V2WB 1D9KD 4OM1H 4Y5VC 1NBZB 5IHLB 4JAMB 3I9GL 1Q94A 5F1NB 2J88L 3P4NA 2DLFH 1UWXH 4NNYA 1SJEB 4X9BA 3V95A 4PJDA 3VRLE 1DQMH 5EBWA 1OTSD 4CVUA 3JWOL 1QYGL 5MERB 1MEXL 1BX2B 5IJVA 2NTFB 3L5WA 4LHUD 1NPUA 1BZ7B 5DJZB 3CPLB 2VL5A 4YE4L 4Z95H 4F7TB 3RZCD 3L5WB 4I2XB 1J0KA 3BDBA 1Q9KB 3WFHA 2J4WL 2EDYA 3B9KD 3VWKB 3W5MA 2BSSA 1JHTA 3U83A 1KCRH 4KK6C 3O8XA 5HDOA 4L29B 1OAUH 1DLFL 3O45B 4IRJD 1T2XA 1EAPB 3P4NB 2Z31B 3GRWA 2GITA 2K1MA 3HUJE 4JAMA 5IVOA 1NDGB 1NBZA 4Z7UE 1IEHA 1CCZA 1FVCA 4TUJA 1Q0XL 3KAAA 2EDBA 5DMJB 4PJ5D 4FQXC 3MLVH 5DHVA 4H0GA 3N50A 1RK0B 1OQXA 4DK6A 1XGRB 1RURL 1MLBB 2BMKA 3FB8A 4HAGA 2BHZA 3OKDB 5GJTL 2IF7A 2YPLA 1CDIA 1JWSB 1WBZA 3D3VA 4R4BA 2V7HA 4TSCH 1RUKH 2YEZA 1DCLA 5HYFA 5IV2B 4BZ2L 2VOTA 3DUHA 4IJ3C 4WFEE 4IOIB 5FUCC 2ZP0T 1TJHH 5IQ7H 5HHVL 4E5XB 3ULUH 5LJYH 1UXSB 3MOBH 2A83B 5F7KC 1RK1B 4I9WD 1YEHH 5FAAA 4PY8I 4P57B 1I8LC 3T4YB 1DSFH 4U1GC 3R0MA 1YYLL 2J8UE 3CU7A 3R4DA 3NCJH 4YXLL 4U7SA 3QNZB 2FD6H 4OCMC 1NAMB 3RBSA 5IJKA 5DGRA 3G6JF 3KHQA 3R06B 2ZUYA 3MGOA 1C12B 4JY5L 5IJKC 3SDDC 4YFLF 1OLLA 4BUGA 3ISWA 3RL1A 5E56A 3N06B 3SE4A 2JJTC 1IGFL 1MQ8A 2ZCKL 5DJ6B 3I6LD 2C4FU 5J1SC 4W70A 5M95B 4DKAA 4ODUA 3OR6B 4X6EA 1AXIB 1R3HA 4FQQA 1XF2B 1J1XH 4MJ6B 1MRFH 2N56A 3IFLH 3QIUB 4D0BA 5GS0D 5GGUA 2Q7NA 3AVEA 4ZO6A 3SGDH 5IWLA 2I26N 4HFWA 3BN3B 2ZOLB 1FYTB 4QXWA 2FZ3B 1G6RA 2BSTA 3ZDZE 3DXAD 5FV2A 5J7CC 4XHJC 4JZNB 4Y19B 4G9DB 1C7TA 3BIKB 3FL7A 4U31A 4R97B 5KS9E 1QQDA 2VSCA 4V1DA 4WFFE 5KVDL 5CGYD 4ZUTB 3TGXA 4EOWL 4R26L 1XEDA 7FABL 4U1SB 2AK4E 3F58H 3H9SB 4NQUA 5FUOH 2I5YL 1FYTE 1KV3A 1VHPA 3FAWA 4LNRA 1CL7I 3HG1B 1HHHB 3NVQA 5GXBB 4GMSH 3TO4B 1AGBA 4ETYA 3OKEB 4JANB 5B3JF 3B4NA 5AYQA 5HDLA 1S7XA 5HYQB 3IFPB 5D7KE 4Y5YB 4FMKA 4GAGL 2OTWA 1DBKL 4FQHA 3LEXA 4YBQD 3A67L 4NKIL 1D5ZA 3O2WL 4OZGB 3NIFF 5DMIH 3CLFH 1LP9A 1RUQH 4LASL 4O5LH 5KN5A 1FBIH 4QNPF 5GGVY 4NRZA 1ADQA 1WZKA 2FB4H 3C2AH 2OP4H 3OF6D 3LKOB 2DLFL 3LKQB 3QI9A 1CGSL 3OKMA 5IROC 3GMQB 3QDJA 3WXVH 3BZEA 3MFGB 4NZRL 2X89D 2YPKA 4DGYH 3U79A 4HMCA 3HKFA 5T3XD 1NFDA 1LE5B 1KNOB 5K33A 4H1LG 2V6HA 1Y0LA 5DUBA 2CRZA 1IC4H 1MCJA 4TTGA 1S9YA 5JDSA 1T66D 2CSPA 5FFLA 5CZVL 2F58L 4PJ8C 4QTIL 4P2RA 4ZFOA 2GQHA 2OTUA 4LSVL 2BNRA 5D9SB 1LO5A 3EFFB 5SWZE 4MWFB 4TSAH 3H9SD 1MF2L 1I3GH 2XG4A 3WMSA 3P30H 2VB5A 5H8DA 4YJZL 5KSAA 3TNNA 3EDEA 1NFKA 2QKIA 1AI1H 4TQEH 4ONGL 3IDYB 3LH2H 3T0WA 3VFPB 1A7QH 1YEKH 3HLAB 4U6YA 5H94A 3T08A 5JQ6H 2DWEB 4GW4A 3MRCB 4N8VG 5LGKA 5FUCE 4P59L 3MPCA 1IGTB 1MAKA 3MQIA 3R0NA 1BHGA 3MA9L 4Y4FA 3MOQA 4U3XA 1MCKA 1J0JA 1HXMB 5TQ0L 1Q1JH 2HG5B 4OD1H 5ESVA 4ZFOB 3UBXG 1F6FB 5I17B 1LK3L 3FFCE 1AIFB 1G1CA 4XNMB 3H6JA 5F6IC 5TJWK 1ZHLA 1MREH 2IANB 3GBML 3OKNA 5F7UA 4FFYL 1HNGA 3GK8L 1JPSL 5EZIL 2GTZA 4MYWB 2DI8A 1KNOA 3DWTA 5I1GH 2YD2A 3L3HA 1GGYA 2YXMA 2DWDA 4L9LB 4KU1A 3CFKB 3TO2A 1OP3K 3NCYP 3BP5B 3WNMA 4WFHD 3NZHH 4QRQA 1WUNT 3T1FB 1LHZA 4ODTH 1AO7B 4X99B 2R4SL 3VXUA 5T1KB 3IAGC 4M1DH 4NRZB 3RX8A 5KN5B 1OP3H 2F74B 5GRJL 4RA0C 5EO9B 5EIQA 4UTAL 4GT7A 1M05B 4L4VE 5CJQH 4JPIB 2J8HA 3LEXB 3BP6A 4HGWA 3FQUA 1SHMA 1CDJA 1U93A 1WCBB 3W2DL 3AGVA 3WXWL 1OGAE 3IFPA 1DLFH 3BOVA 5IESL 3BZFA 4JKMA 4D9LL 3EGSA 1FZOB 4YDKL 4LNRB 5M94B 1PY4A 1JGDA 4P3CH 3DO7B 1QLEL 1X4XA 3AU1B 3LIZL 3PWVB 1IC5L 1N6QL 4KZDH 5I8CB 1VPOL 1L0YA 4XNYH 5F9AC 3P0VH 1JMXA 4AJ0A 4X7CC 3VWJB 4M9OA 4XCEB 4ZS6C 2JIXB 2Q76A 3BKJH 3MV8D 4WI6A 4RIRA 5DFTA 4CBPA 4Y19A 3KVQA 4JZNA 3E3QC 3U7WH 4XZUA 5JXED 5DRXB 2CKBL 4XP4L 5HHNA 2E9IA 4YK4C 3QISA 5KVEL 1NBVL 5AZ2L 1FYTA 4XX1E 1YEIL 4JFPA 2JCCA 4MXQD 4D0BB 4GG6F 4JDZB 4M7LH 4GAYA 4PGEB 1L9NA 2QQQA 4LHUA 4H88L 3VXSA 3T2NL 2ZWLT 1IQDB 1QFWH 3SQBA 3ZDYF 4FMFA 1LO0L 2OR7A 1T3FA 5DJ6A 3NN8B 1RD6A 3BZDA 3ZE2E 4D0DB 1UJ3C 3NZ8B 1YECL 3W39A 2EIBA 3BYYA 4UB0H 4DK3A 4BJLA 5I30L 3NTCL 4MNGB 5D5MA 3B2UC 4L9LC 4M7KH 1MFAH 3I84A 2R8SH 3CVHL 4MNGE 3ARFC 4KDVA 2VXUH 4PLJD 4NZRH 1NJ9A 3K4AA 5DMGD 1KJMA 5FUZL 3FB6B 4JG1H 3NIDF 1AP2B 3UJIL 2VKXA 1A7BA 2HRPL 1KFAH 4GQ9L 1F02I 4UTBL 1I75A 3OL2A 1J5OH 4EN3D 4RNRB 1KTDA 5FYKU 4MXVE 5DD0H 3MRDA 5FB8A 2MMXA 5HVFB 2CDEA 3JTSA 5EO1A 3U6RA 1AP2A 3L3OB 2JE8A 4ZAKD 4I18A 1RHFA 4ONOA 2DQGH 3MRMA 3U36B 1FL5B 1P2CB 4PRNA 4F57L 4R4BB 3NZ8A 3C60B 1OAZH 1IBGH 4TUOB 3QUXC 2AJUL 2G2RB 2VDPH 3TM6A 4U1HB 3OKDA 1BEYH 3NN8A 2EDXA 2BMKB 2ORBH 3UAJC 5IVXA 4F7PB 3GSNA 4AM0A 2GK2A 3MJ9L 3VXSB 2B5IC 4KGJA 2IAMD 1OL0A 4RRPA 2VLKD 3CH8A 4X4MA 1JE6A 1FNSL 2DLHA 2OJEA 4M62L 2X4PA 3HG1E 1AGEA 3HNTH 2XZCH 3BKML 1GOFA 1TCRA 6FABL 3IGAB 4U0RB 4LF3B 1G0DA 4X4ZA 2FCBA 4UBDC 5JHDE 4JFOA 4QHMA 1P7QB 1T2QL 5DRXA 2NY6B 1ZAGA 1JHTB 3IETA 5FYJE 3D69A 1UCTA 4PP2B 5GGQL 3BIBX 4L8DA 4Q97A 3ULVD 4AY0A 4HUWA 2AI0H 1E6JH 1NCDH 1EJOH 2XN9A 2B2XL 3LPFA 3PWLA 4Z9KB 5D2LB 3DO7A 4IIQA 1JGDB 4BKLB 5DD5L 4G5ZL 1HHKA 3M8OL 4NNYB 1U3YA 1YEDA 4D8PA 1NCBH 2ID5A 4JHAH 1IEAA 4I0KA 3F8UB 2VH5H 3GRWH 1U93B 3X13A 2RBLA 1NFDF 3FQUB 2FEEI 3NIGE 3FFCB 4FZ8L 1CR9L 2R0ZH 4Q0XH 2QADB 3LN4A 4KXZI 1T7VA 3K2UH 4DOHE 2PO6B 4ZD3L 4PJFA 5KSVB 5H37G 2NW2A 1T04A 1AO7A 3NA9L 3I6KA 4QRQB 5EIVA 3BP5A 1FE8H 2A0LC 4WO4B 3TO2B 5ANMB 2NXZD 4PJGF 2ADIA 4YIQB 5FA4A 5ITBL 4P3CL 4KZEH 4APQA 4X98B 3RWCB 4JFXA 3QYCA 3G5YA 2O26U 4Y4HD 5HI3D 1CGWA 4Y4KD 2ICES 1F6LL 1R24B 1SJXA 3U2SB 4OFYA 3CFEB 4YBQC 5A43C 2H32B 4GW1B 3UZQA 1ZHBB 2H45A 2FWOA 5ESVB 5GRXG 2L0DA 2V2XA 3QFJA 4OFPA 4RAVB 3KXFA 3U7WL 3O6ML