1KB9K

Yeast cytochrome bc1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
107
structure length
107
Chain Sequence
DIELTQTPVSLAASLGDRVTISCRASQDINNFLNWYQQKPDGTIKLLIYYTSRLHAGVPSRFSGSGSGTDYSLTISNLEPEDIATYFCQHHIKFPWTFGAGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 17
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2001-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kb9K00
1HKLH 1YY8A 3FRUA 5D70L 2F5AL 5FGBC 1RZGB 1N8ZA 4Q2ZA 4R4NC 2IPKA 4F7EA 2RCSH 2X4SA 5DMGD 5CP3A 1BQHG 2DF3A 1KCSH 3VFRB 4HIEB 3EOBB 4S1SH 1KC5L 1PYWA 4PREA 4Y88A 3UBXG 4CVZB 2ZSWB 3G5VA 5HHOA 2QEJA 1LO4H 5F89A 3MRFA 4ZFOA 3S8WA 4PV9A 3QUYA 4LKCB 3U7WH 2GJJA 4NQDA 3HAEA 1NCAH 5J89A 4YHOL 1OAXH 4X98A 1AGCB 1JK8B 3RVUC 1NMBL 3ARFD 4PY8I 4EIGB 3WIHA 2JIXB 1U8IB 3DI2B 2AXFB 3U0PB 5E2VH 4L29A 2F58H 3BSZL 4GW5A 2P5WE 1LEIA 2P7TA 5CKGA 5L9DL 5IB5B 1JF1B 3K8MA 5HHMB 4XCFH 3OKEA 2YD7A 1OAKH 5E00A 2COQA 3O2DH 1OGTB 3CX2A 5IK3B 4BSVA 5DJ0A 3FT4A 4NYLB 3PGDA 4MDIB 2H1PH 3CCHA 4O2CB 5CILL 3TV3H 4L8BB 2AXGA 3D3VB 5D2LE 3RGVC 4LAQL 3CH1B 4NCC2 1Y0LA 3B5GA 4DKEH 1ULVA 2X4NA 3D25B 2P8PB 2PYEA 3OXRA 2HMIC 4ELMB 2VLRA 1Q9KB 5E8DL 1HSAA 2KUTA 4EBQL 3FAXA 5D5ME 3RGVB 3A6OA 2Q6WB 4EUPH 2DKSA 3GBMH 5DHVA 4EOWH 2MKLC 3F58L 4WI6A 4YPGB 4MGXA 3RA7H 1HCVA 4M00A 4NOFA 5FO7A 3E6FB 1YEGL 3DECA 4XP9L 5EU6B 1KACB 1WBZA 4P2RA 32C2A 3QRFM 4XCEB 4FZEL 5HGDA 3MJ8B 5I66A 3FKUS 2VYRE 3LS5L 4XPGL 5DWUH 5E95B 2UWEF 3LSOA 4HKZB 4ZS7L 1WT5C 2XA3A 3IDGB 1OAQH 3LH2L 1U3JA 5JUEL 1WTGT 4J3XA 3WFHB 1E4XI 1PW3A 1NGWB 3MPCA 4MX7B 3UTQA 4PBXA 1J8HE 2V7HB 4ISVB 5DD0H 4WHYH 1BREA 1QFOA 1UH2A 1KBGH 1VFAA 2G2RA 2HRPH 2NY5L 4FZ8L 2AK1H 2BVQB 5T5NG 4AM0A 5CFHA 5GXBB 4QWWC 4JRXB 3OKMB 4JFDE 5EO0B 2MQ0A 2A73A 3MRDA 2CO6B 2Z4QB 1FNLA 4GLRI 2ZWLT 2HKHH 1EAPB 4LSPH 2W9DH 5T3ZE 3TYGH 5BCAA 1CI5A 4G6ML 4HMCA 3DYPA 1EUUA 3L5JA 3SDDC 3SDCB 1JNJA 4R3SB 1LO3L 4LCWA 3VCLB 3UJJL 3CJJA 5CLWA 1WAAF 4WU5B 4KVCH 5CBEA 4EDWL 3MMEB 3DPBA 2WQ8A 1KTLA 1AGDA 4I48B 1I1AD 1ZLWK 2Z8WC 4LCWD 3SDDB 3ROLB 5BS0D 1K3ZA 3P77B 1RJYB 1BFVL 4ZXBD 5E2TH 3ORJA 3SKUD 2A77H 3PXHA 4OSUH 2AQ2A 1GH7A 2XICA 4H25A 4ZFGL 1T21B 4X80L 4U1NA 4AL8H 5D2NA 5IFHL 1RIVL 1LDSA 4P59L 3BZFB 3MYZA 3BN3B 4PJEF 4R7NB 1Q72H 1SYSA 4PJHF 2NXYD 1IM9B 1KT2A 4M8QB 4GSDH 1H3UA 1DBJL 1I7UA 2WWMD 1TJIH 3VXSB 2IEPA 1OGAA 1HIMH 3HC0B 4KROD 1M7XA 1BQHA 3THMH 3D2UD 1Z3GL 2NX5D 4X7SL 1MCCA 4IS6A 3MQIA 4LVEA 5DMGC 3LRSB 3OXSB 1OP3K 2CPCA 4YHYC 2VDLH 4YDVA 3EFFA 3B5TA 5DHXB 5FUZL 2BRQA 4R96B 5EOCJ 2JB6B 2VLJA 1SQ2N 2AJYL 5LXGL 3C5ZA 2C5DC 5I1JH 2IPKB 1XH3A 1DBAH 4WHTA 4ETYA 3PIQA 5DC4B 2X4SB 1IGIL 2JCCE 3EO0B 4IRSA 2CLZA 4LLMB 4WWKA 3FMGL 4N5UA 4G3YH 3QYCA 1DJSA 1DBBL 5KG9A 1K3IA 4PJ9D 4KI5F 5H35B 3TPKA 1O5DT 1MREL 3LV3A 5MERB 5D7SH 3S9DB 3DV6A 3MRQB 5C70A 2M26A 3ARFB 4IHOA 4PV9B 5IHLB 2LVCA 3EYSH 1UQSA 1XGQA 3P4NB 4MXWL 3LZFH 2Z91B 5BZDA 1FNFA 1SBBA 4WEUD 4OFIA 4X4ZA 5DK0A 3CLFL 3ZKNC 4CU7A 1GC1C 2AABL 3RX8A 1GGBL 4PJFF 1IAIH 4HHAB 2JJUA 1J18A 4HT1L 1MFBL 5TPWL 2VL5B 3BEVB 3OKEB 1N64L 5ID0B 4LLWB 4UINH 4MB4A 1A6PA 1NCUA 4JZOA 5J6HA 5HHQA 1KB5A 3L7EA 4XAWL 3IU3B 4OQ1A 4OJFL 3CCHB 1HYRC 3HNVH 5JW3L 4NN6C 5GSVA 4JVPA 4QHLB 1VESA 2IG2L 1FFOA 5HPMA 2P5WA 5HHXL 3BH8A 3HC4H 3AM8C 1AE6H 2WANA 1BIIB 4FQ1H 3C2SA 3KLHC 2PYEB 3OXRB 3MRRB 4NN6B 2HG5B 2MPAL 1A7QL 1C7SA 2VLRB 2P5WD 4MNGB 1RJZA 3QFJE 4Z7VB 3UC0H 1A14H 5F7NC 4Z7UE 43C9A 3MRLA 5DHVB 5C6TL 5GRJH 4XBEH 4CADA 5GGVY 3U46B 1MCNA 1F90H 5MP6L 2W0KA 5FKAA 5D2LA 1WBZB 4L4TD 5DYOB 3CZJA 4P2RB 32C2B 1BFOB 2X4RB 3MTRA 1Q94B 4JFEE 3RQ3A 1ZANL 5FB8B 1C08A 3GFUA 4P4KA 2YBRA 1SHMA 5D5MA 3NGBC 4P2OD 4KUCF 3AROA 3LEXB 5F21B 2P45B 2PNDA 2H8PA 4RGOL 3BT2L 5E8NB 1FNHA 3X3FL 4FFVC 5IFAL 4GG6B 2ZNWA 3LCYA 3NGBB 2BCKB 5B21A 4XC1L 1LE5A 3U83A 4ZG1A 3JV4B 1RIUH 1I1AC 2IH3A 3H7LA 3WNOA 4B50A 1E4KC 4ZXBC 1ODAA 2WWKO 2HH0L 4HWBL 5JXAL 3PQYD 2OM5A 1XGRA 4DQOH 1OWRM 1FC1A 5D96C 2DIAA 3ZE0E 5KJRL 2LU3A 4ZUVA 1J8HA 3OAUL 3K4ZA 1I1AB 4HAGA 4LCWB 5BS0B 4ZXBB 3DX7B 4DOHB 5KTEH 5DLMH 3FN0H 4M7KH 4AEIL 2D4DA 2EECA 3BZDA 3MACH 3V0VB 1U8LB 4LFHD 2NXYC 5D96B 3O0RL 3GMPB 1BEYL 2WWMC 3MRHA 4JFDA 4NKIL 3ULUE 1FFNA 3CFBB 1RUAH 4K3HA 3G6JF 4KROC 1MRFL 4JFHD 1CFNB 2X89D 1Z5LB 3RIAF 2VDKL 4H25B 4XTRC 1ZSDB 3Q2CA 2NXYB 3GO1L 4X5WB 1HEZA 2R9HD 1X5ZA 4GLRH 4PGCB 4KROB 5CBAB 1HH6A 5DUPH 4Q9BA 3ZYOA 2NX5B 2P49B 4Y16D 3DYOA 3IXTA 1OAYL 5C0RH 1BQHB 2EDQA 4IM8A 2DQJL 4PJAE 4GJTB 2FGZA 4IS6B 5I76A 3UBXB 3OL2A 2OK0L 2V17L 1X7QA 4XMLL 5FUCE 5EOCL 1T0MB 1J88A 4BKLB 2F19H 3UJIL 1BAFH 2CLVB 4XI5D 3N85L 4YAQA 4WWKC 4Y5YA 1OOAA 4WI2A 3SKJH 1TVHA 1F3JB 1T0NB 1XH3B 1ZMYA 1T1XB 5IKCB 3MJ9H 3TVMA 3BPNB 3PIQB 1N59A 4AYFA 4O00A 1KB9K 2OLDA 2EDBA 2V9TA 5IVXF 3H2WA 4Y4KA 5IF0A 5EIIA 1IEBA 4WWKB 3RDTA 4F2MA 3WXVL 4YE4H 1YC7A 1MCQA 4AT6B 3FOLA 5KG9B 3JV0A 3I6LE 4JRYD 4S1DD 2KDGA 3LS4H 4QXTB 3LV3B 3C2AL 4M9OA 1NGQL 3RKDD 4JAMB 1EAJA 4UT7L 3QWOA 4IHOB 3HTLX 4YX2H 3MREB 1A6TB 1B6UA 2Y6SD 3F7YA 4LRIC 2JCCA 1E6OH 1CD1A 4OFDA 3MNWA 4HULB 4OLVL 4HIIB 5LGHL 3KG5A 4QGYA 3Q5TA 1G7IA 2D0GA 2YN5A 4N90D 4MD5A 1LE9B 2VLMD 4R97C 1S7WA 5F7DB 1D5ZA 1T0PB 5I1AB 5C0GB 1F4YH 4J12A 3FB6B 2Q8AL 4BK5A 4R97B 1RUPL 1RZJH 2HT4C 4W4OC 1IQDB 1N6QH 2ESVD 3CSYA 2GTWB 3PHQA 4LGPB 3E3QE 3NH7H 3CDGA 1F11A 3VXTA 4NM4L 1IC4L 2VWEE 5JTWA 2D0FA 3ZKSD 2P5WB 1KIUA 3BH8B 1QSFD 5C0BE 3GM8A 4P49A 3H3KA 4NZJA 1B9ZA 5I19L 1G9MC 3DIFA 4LSUL 2QJDA 4ODHH 43C9B 1F4XL 4P2OC 4TRPL 3QJHA 1KELH 4L4TB 4OGZA 1LNUA 5J6GA 1S7RB 1RJLB 1BQSA 5IR1A 4OM1L 4HG4J 1OTUD 3T4YA 1WV7T 1UB6A 2EDLA 4KK9D 4YK4C 1T03L 4P2OB 4PRBA 4F58L 4EVNA 1A6AA 1CR9L 2QQLH 3BD3A 3KR3H 3RHWF 1OPGH 4JANB 2YBRB 4Z7UA 4XP4L 5B8CA 2DL9A 4YK4B 4YZFE 2ZCHL 2VABA 1L7TL 4QTIH 4H8WC 3QFJD 3MLTA 3ARED 5DJZB 1BVLA 4U1SA 1NEZB 3VXMD 3NPSC 3HG1D 2YD8A 4PTUA 2P44B 4YWGH 2B5IC 2Q8BH 4JFEA 5ANME 2DM2A 4OAWA 2DQCH 5ACZB 1YECH 2WP3T 1HILA 5DI8A 3KLDA 5IMKA 2KL6A 3NPSB 5F1OB 3WV0A 1FRGH 4B53A 2O5YL 1FIEA 2X6MA 4QCIA 1CL7H 1AC6A 3MR9A 1KEGL 2DLFL 1ED3B 2B5IB 2ITCB 1ZGLB 4UB0H 3P40A 3SO3B 4NBXB 1R24A 1NGPL 5FYLE 5JO5A 1QFUL 4IDLA 1R0AH 5B3JE 1P2CB 3V6BR 3FO0H 3QHZH 1ETZB 3MLPA 3QIUD 1AP2A 4JFDB 3MRHB 4HQQH 3PG2A 2ADJB 4KY1L 1FFNB 4AH2A 4Y16C 4NFBA 4D2NA 3S34L 3VW3L 2B7DT 2B1AH 5DRZA 3GSQB 4KU1A 3A6CH 3PWVA 3W39B 3IDUA 2VZTA 1HEZB 2NTSP 1AKJA 2VERN 4EIZC 4Y16B 5ICYB 3UJTH 3MRNA 2N7AA 3GMNA 1QACA 1YYLH 2ZUQC 3WFBH 2CRMA 3VD7A 4HXBL 2XZZA 2BNRD 4AK1A 4HBCH 3MRCB 3V7MA 3OWEA 1FORL 3X3GH 2ZUQB 4Z78A 5I76B 3L3GA 5AG9A 3FQRB 4E5XA 5HYFA 1TITA 4WI8A 3KS0J 1X7QB 2NW2B 3QXTA 3K8KA 4HLZG 1JGVH 5LBSL 4GAGH 1S5IH 2F53D 3NPZB 4Y5XB 5GHWH 2YPKA 3QG7H 4KXZI 1R3LA 3BXNA 4MQTB 1VEPA 1JN6B 3B2VL 3DX8B 2A9NH 4KFZC 4N8CL 4AIXA 5EBWA 3RKDC 5D4QA 4ZTPH 2VAAA 5IMMA 3O6FA 3N50A 3O2VL 3K74B 5E94B 3CVHA 3QI9D 4WCYH 2ZJSL 5EIIB 2V9QA 6FABH 3D39E 5EO1B 3B2UD 5J57B 4U3CA 3LY6A 3QCTL 3IRZA 3O6FD 1XIWA 1CTNA 1PKQE 4M7LL 4NJAH 1HZHH 2XKUA 4HC1L 3TEUA 3W9DB 4UIKH 3ULVL 3TA3A 1HHHB 4QGTA 4Q9QL 1QSED 5CJXA 2KH2B 5ILTL 5ERWB 3V4VL 1F3RB 1OTTD 1EO8L 3RY6C 5ACMA 3P4MA 4JM2A 3O6ML 3ROOA 3H9SD 3MNWB 3QIBA 4ZPTA 1S9XA 3FQTA 1FAIH 2VJXA 3MGTB 1U8HA 4XBPA 1JZ7A 1JPTL 4RGMC 5FF6B 1T4KB 1JGLL 3MLSH 5SX5K 1D5ZB 1K4DA 1U93A 1JYNA 1FNSL 5I1HH 2ESVB 3QDHA 4R4BA 4YHZH 1DQQA 2PW1B 4YFLI 4TVPL 3GSWA 1UFUA 2GSGA 5CGMA 5E5MB 1YPZF 2YD3A 4FXGA 2DBLH 4L8DA 4ONFL 2FO4A 1E6JL 1I9JL 3PUCA 3MLUH 4EI5D 4PJCF 4XVJH 2IMMA 2R39A 3U7AA 3RWFB 2ARJA 4J2XA 1OTUC 3DMMA 3OF6D 4JPVH 4HD9A 4KK9C 3CIQA 5F1NA 4K9EC 3T3PF 4F57H 4UDUB 5EBMA 4ZFFB 1MWAA 1NJ9B 4TSBH 1U58A 2YA1A 3RWCA 4HGMA 5I75C 3RZCA 1MRDH 3QJHB 3SDAA 1K85A 3BD5A 3MO1A 4QRQA 2V2TA 4P57A 3AREC 1J12A 5I75B 1UB6B 1XZ0B 5C0BA 1C5CL 1WCBB 3S36L 3P0YL 3R8BB 1ZTXL 2AGJH 4EVNB 4RAHA 5JOFA 4JO4H 3QFJB 4H88H 3AREB 3VXMB 4Z7UB 2A74A 3HG1B 4KC3B 3PP3K 5DDHB 1T1WB 1DQLL 3PL6D 4BELD 2EC9U 3HPJB 3NCCB 4U1SB 1CGSL 5C9JA 2GY5A 3IVKB 3SOBH 2OL3B 3RVVD 3I3DA 4U7MA 3V5KA 4JFEB 5EDXA 1DSFL 5HVFB 4KHXL 3WE6B 4U1IB 2D7PA 5CJBA 5DI8B 1EEUA 1F3DH 3JV6B 1I75A 3IJSB 1LGVA 4PJXE 1FVEA 1BOGA 2EC8A 3GJEA 3KDMB 1XF5A 3G04A 3RWGA 2BHUA 1KPVA 4EQ2A 4N0UB 2FEEI 1II4E 4ODVL 2GT9B 3LN4A 5HI4D 5ANMA 4ZO7A 4OKDA 1H3XA 2NNAB 5TGBB 3QXDA 1QOKA 2DWEA 1JF6A 5C0JA 3P0GB 4GRWF 4ZAKA 4CU6A 2ZOKB 2YN3A 3QEQE 3RL1A 5I2IA 4R4FH 3IFOB 3Q6GL 5DRZB 3QEHA 3PWVB 3JV5A 4Y4HD 2BNRB 3JVGA 4FN0A 4WUUE 1INDL 3SGJA 1YMME 4MAYD 4L4VD 3L3KB 2J88L 3ARWA 3VI4E 3TJEH 1CXEA 2B4CL 1A3LL 4RA3A 2A83B 4Y89A 4PLJD 5IW1A 1UVQA 3FN9A 4HF5L 4ODUA 3ZTJH 4ZQKA 3LPFA 3H9YA 2F53B 4L8CB 5SWQB 1P7QA 3QI9C 1A8JH 1CBVH 4N0FB 4X4YB 2EH7H 3T3MF 4O02H 2AV7A 3OGCB 3B2UC 5CSZB 1MHPH 3SQOH 3O6FC 2JF1A 5DQDL 1NEUA 3N06B 2ZSVB 5F6HI 3QI9B 4U3XA 3TNNA 5JQHC 1GL4B 1I8MB 4PJAB 3TWCH 1YNLH 1VFOA 3PWLA 1KJMA 3O6FB 3IU4H 4JQXA 2WBJA 2DYPD 1A7OL 1UC6A 1XCTA 3TA3C 4FQLL 1FDLL 1P84K 5HBBA 3LAFA 2EDJA 4HK0A 4BSWB 1QSEB 3K2MC 3RPKA 4H1LG 4HFUL 4HUMB 4K8RL 3HA0A 5HI5D 4JM2C 1NC2A 1UT9A 1PD6A 4XNZC 3QIBC 4ZPVA 3L5WA 1CS6A 5I16A 4JY6B 3R8QA 4PY7A 4H20L 4UIMA 4ZODA 3TA3B 1S9WA 3P9LA 4Z77B 3H9SB 1T6VN 3HI6L 4KXZH 1J9CT 3SDYH 1J1PL 5TF0A 4MJ2A 3O8XA 4G7YH 1I9RH 3BGAA 3P4MB 4HIJA 4LRNH 4JM2B 5CJQH 3D39A 2CLRB 4XNZB 3HNSL 3QIBB 5C9KA 1WUNT 2HJLB 15C8H 2FB4H 3O3AB 4JG1L 4NJ9H 5DMIL 1EEYA 1SY6L 3MRPB 4G5ZH 1L0QA 4XBPB 4EI5C 1PKQA 2IBZY 5C2BH 3FZUD 3QNZA 3HPLA 1Y18A 3AFLA 4NO3B 5JLZB 4JQIH 1C12A 4JVWA 1K4DB 2C26A 4QKXB 1QLEL 2BXYA 5KVGL 4MS8D 1DQQB 2NY7H 1NDMA 1PLGL 3D0LA 2GSGB 4EI5B 5I6XC 4FXGB 2EH8L 3QO1B 4L8DB 1CTOA 3BP4A 1MJ8L 3MCKA 3KLAA 5KVEH 5ID1A 2VIRB 1NAKL 4JDTL 1UB5A 5I6XB 5CIPA 3SDAC 2X5PA 4PRDA 4JR9H 4M1CD 1MWAB 2W60B 2WBWB 4OD1L 5IGXH 1FZOA 4FS0A 1X9QA 1AFVL 2NY4D 1C5BL 4HJ0D 1RZIB 3UYOD 3O45B 1ONQA 2R29L 3AS0A 3HZVB 4O51A 5JZ7D 5A43C 2VSCA 1NFDE 3SDAB 3VJ6B 3UTSD 3PL6C 1OY3B 3MJ7A 5DC9B 3UZQA 3U9UB 3MLYL 4M6AA 3BOVA 1MH5B 3LVEA 1MFAL 2M8XA 1PBYA 4BQCA 4J6RH 3B9AA 1F42A 2I25N 5JIIA 4M9PA 3V6ZB 1XGPA 1VGKA 3B8YA 3RVVC 1FO0A 3DVGA 3MV9D 4DWHA 3PL6B 5JOFB 5HGAB 3P4OA 3CXDL 5F7WC 1LD9A 3RX5A 5FYJE 2A74B 5B4MD 2E27H 3Q5YA 2Z8VC 1OB1B 5IG7B 4NO5A 3LEVL 1HOCA 2ATKA 4G43A 3QIWD 1NGZA 4S1RL 3MODH 1NCWL 1OD9A 3FCTB 3V5KB 5DMKA 3MRGA 1EVUA 1JBJA 4K94L 3RNKA 1S5HB 1IAOB 4OZFB 2BHZA 1XEDA 2EIEA 2VUYA 5I17B 1FPTH 4O4YL 5J56B 2CUIA 3CD4A 3CMOL 3GBLA 5FA3B 1FVEB 4NKMA 3KPRE 4UT6L 3U2SA 3B3IA 2GTZB 1K5NB 2Y7QA 5JIKA 4ZAKC 4RAUA 4YFEA 3JTTA 4MAYC 1FV1A 2E8ZA 3QXAA 2WM0A 2DQIH 2ICES 5FDWA 2DWEB 3ARGA 4JCLA 2Y5EA 1I9IL 4HZLA 5JDJA 4JFFE 3AMKA 4ZAKB 2ADIA 4OLZL 5I2IB 3EDDA 3UZEA 4MAYB 4L4VB 4PJXA 4U6HB 5C07E 3HLAA 3U4EA 5EZJB 3N9GH 2HYMA 2YK1L 4DN4H 5ABDE 4L8SA 2OQJA 3ZTNH 3BP7A 4LEOA 4JKLA 2D7MA 4Y0GA 4TPRH 1A0QL 4LSSL 4DAGL 4KHTH 5DUMH 2YZ8A 5CEYB 1PEZA 1ZS8B 3T0XA 4UV7L 3HI5L 3S36X 2XA8L 5DEGA 3BKYH 3DLQR 4YDJB 2I9TB 3QEQA 4JPIB 1N6UA 3RY4A 1G9NL 5DJ2A 3GK8L 3ULVD 5CSBA 4YGAB 3P73A 1Q1JL 1KFAL 1JNHA 3PE9A 1U2CA 2Y36H 5GRYA 5GS0C 4WUUA 3U82B 2AV7B 1YMMA 5I1GH 2OI9B 1IBGL 3VU2A 3N1MC 2W0LA 3UXFA 3PABB 4Z0BH 5HI5C 2FJHA 4OZGF 2DYPB 4F8TA 4KQ3L 4POZD 2HFFA 4G6JL 1KENH 4N68A 5EA0L 3BW9A 1PY4A 1M6OA 2C7UB 3ZHKA 4TVPD 3OKDB 4NN5C 5HI3D 2QHRH 4HX1A 4EN3D 3WEXA 2VZSA 3OG6B 2JK5A 2R0KL 4G80B 3FZUC 5CKAA 3ZE1F 3HE6A 4ZPVB 4RZCA 4NN5B 1Q38A 4RQQA 4JDVA 5DHYA 4OZIF 1G7QA 4MS8C 5F44A 2UV3A 4G6AC 4QXGL 3VWJA 3LKRB 3FQUB 5BVPH 2UWEE 5IJKC 5D6DC 1I8KB 3T2PA 4HIJB 2B2XL 4UTBH 1N4XL 1CT8A 1IC5H 1I3VA 3QUML 4D9RE 2VC2L 4XNYH 3RX7A 1T7ZA 4IIQA 3LIZL 5C3TA 3QNZB 4OUOA 3RVTD 3HPLB 1Y18B 3S37L 1MPAL 4CGTA 4M1CC 4LVNC 3BYYA 5SWSE 4NZTH 2O61A 3D0LB 4YBHA 1UXSA 5JZ7C 4LLYA 4OLEA 5CUSL 3BP4B 2EDWA 3O3UN 1RURL 1WBXA 1Q9LB 1GRWA 2GY7B 1G6RL 4LVNB 5FKPA 2ZCLH 4CDHA 1XR8B 5IBTL 1QLFA 5ID1B 1HKLL 4KK8C 3S35H 4QXUL 3WIFB 1UB5B 4J23A 2L0DA 2HFTA 3BH9B 3GMLB 4X7TB 1A6WL 1WAAE 5T5FH 3BI9X 2J6EH 2EC9T 4YIQA 4OV6F 4XPFH 3WS3A 3KVQA 4ZO9A 2VDOH 1Z9LA 1KCSL 1KIRB 4S1SL 4JZJA 3RPIA 3SKOA 1HSBB 4FQQA 5B4MC 3JWOL 2JJSA 3MJ7B 4LDLB 1MJUH 3MV9B 5D71L 4MMXC 1DQJB 3FB7A 3C8DA 4HS6A 1JHKH 3HZYA 2UYLB 4TSAL 3IDJA 2LV4A 2HKFH 4PJEE 5CMAB 4YQXH 2H32B 4PBWD 3U7WL 1FO0B 3DVGB 4PJHE 4KMTH 2VH5L 2NLJB 2PN5A 1EHLH 1CU4H 5HYQB 1QPPA 2H41A 1NFDA 3GRWH 3OKLA 5DVKA 5E2VL 5E1AA 1WVZA 4E41E 3MRKA 2LVEA 4XMPH 3HUJF 4TOYL 4JKPH 4HWEL 1OT1A 3VI3E 1U8OB 3PWJB 4LNVA 3AGVA 1IEHA 2PCPA 5E4EC 3O2DL 4XP6H 1D5XA 2ADGA 4J4PA 3VFOB 5FGSA 1EJ6A 3WDJA 5DJ8B 4Z7QF 5E5RB 1I1FB 5INDB 2X4QA 4TNVK 4RMWA 4PTTB 1KCLA 5EN2A 5E4EB 5GSRB 3V79C 2Y7QB 3C60A 1G7LA 4ZSOB 1PG7L 2WUCH 4KI5E 1FV1B 3NVQA 4LVHC 1A9BB 2DM7A 2DWDA 5CINL 4KAQH 1IM3B 3DXAD 2DQHL 1AY1H 3GBML 2ADIB 4PV8A 4PRNB 3EO9L 2ORBH 5DJDA 3KPNB 3HMWL 5CZVL 4LVHB 3KPRA 1ZV5A 3HLAB 4XNQB 5L6YL 1P7KA 3CFCH 3ARPA 3CFKB 3BP7B 3EJJX 4LEOB 3BEWA 3VA6A 3RAJH 1WJ3A 2HVJA 5CLTA 5DWUL 1QEWA 4X8JB 1C16B 3GSOA 3HB3D 3QA3A 1RPQA 1OAQL 5EPMA 4JFFA 4K8RD 4C55A 4LLVA 2UVFA 1A7RH 4POZC 4PJ5E 4UOW0 3CC5A 5C07A 2DQFB 4BH8B 5KN5A 1RMFH 2PW2B 3EUUA 5BXFA 1UCBH 4H1LB 2HRPL 5HI3C 3VG0H 2EDKA 2BMKB 5IB1B 4EN3C 3SJVD 1CGTA 3WKMH 3KPPA 43CAB 2SEBB 5I1DB 1JGUH 3QNXA 3BUYA 2HKHL 4RFNC 3TM6A 3UO1H 4BQ6A 2W9DL 1MJJB 4BZ1H 5HHVL 2C1PB 1L6ZA 1F6FB 2AV1A 1EUTA 2C9AA 3IETA 3X11A 4EN3B 3W11C 4FFZH 1RUKL 2Z35A 3LKQA 3DETD 3KPMB 4KVCL 1NC4D 4RFNB 1HNFA 2Z31D 4PUBL 3VWJC 3D87B 5AEAA 1FP5A 4XNUH 3WEXB 1IAKA 4M6ML 1DQDH 3FRPG 1CGUA 3RVTC 5E2TL 5L8KB 4JHAL 3G6AA 1ZT7A 1ZWIB 3UAJC 1ADQA 2BK8A 5DHYB 2AJZA 4M61A 1C5DB 3DRTA 4FFYH 3Q3GA 1KNOA 1FNGA 4R0LA 1CXHA 2A6DA 4KGLA 1Q72L 3J8F7 1OSPH 3STZA 3GSXA 4JKWA 2EDRA 1H0DA 3EDJA 1TJIL 4MDJA 2YEZB 3QUXA 4ZUTB 5E70A 1HIML 3O2WH 1G9MH 5IM7A 1P6AB 1XAUA 4ZTOH 1JE6A 4UUJA 2UWEA 5IHZA 2LU4A 3PGFL 3NACH 5JNYA 2VDLL 2Y25A 2APFA 4LLYB 5E2WH 3VG9C 3RY5A 1WBXB 2I07B 2R1XB 3B6SB 1WIPA 5DFVD 1HDMB 1QLFB 1IKNC 1DLHB 5C0FB 2QBWA 1OP5H 4ZUUA 1XR9A 1OM3H 5I1JL 5LGJA 1KIQA 4QT5B 1A6UH 3VG9B 2X4UB 2G9HA 5SWSA 3P2TA 3WS3B 4YXLL 3QJFA 3VXQA 3PXJA 5EOQH 1HWHB 1ZLUK 5FO8A 3EOAA 2ZNXA 1A6ZB 3G6JE 3RPIB 3SKOB 4FQQB 1ZK9A 2GK0A 5ITBL 3OBAA 3N1PC 4JHBA 1G1YA 1VFUA 5D7SL 1R5IA 2P8MA 3HZYB 3CFEA 3L95B 1WAAA 1L7IL 3KPSE 3JWDL 3EYSL 3LZFL 1UZ8A 3ZDYF 5D1ZD 1ND0A 1T66D 2HLFD 5EIVA 1EHXA 3R06B 2NCMA 1JRHI 5D70H 3OKLB 2F5AH 4CU8A 4HIHA 3RWJA 1EBAA 1G0YR 1IAIL 5ESQB 5IFJB 3W5NA 2JLLA 1J10A 2VKWA 1A9EA 5D1QA 3KXFD 3RL2A 2XG5A 5L88L 3RWIA 2IALB 4LLAA 2KZ1B 4PJEA 4HUWB 2PYFA 2V5TA 4PFEA 3FOMA 4PJHA 3U4AA 1KC5H 1D5XB 1U3ZA 3SE9H 3O11B 3C60C 3S37X 2PTUA 3DHJA 4DUVA 3W82A 2BX5A 5IB4A 4U1LA 4UI2A 5KOVC 5EZIL 3V6FA 5IVNA 3HNVL 1QRNA 2X4QB 3VXOA 1DUZB 1ZT4A 5EN2B 4LKXA 5CAYB 4LF3A 4E41A 3TNMA 3C60B 2IJ0C 2J8UF 1G7LB 1FIGL 1AE6L 1JCKA 1TJHH 1OSZB 4K07A 3QT2A 4G9FD 4OCSL 1NMBH 1P1ZB 5ESVB 4YHIA 1UJ3A 3A6BL 1A14L 3AAZA 3ECBB 3U36A 3MJGX 3HB3C 5IUSA 3IF1B 4PLKD 1U91A 3O4LE 3AVEA 2EXYD 5GRJL 1LDPH 1CIUA 3D9AL 5K9QI 5E8PA 4J1UA 1IFHH 4N1CA 1P7KB 3UCRA 2X44D 2DJ4A 1S7VB 4X6CF 2CRYA 1QLRB 5IP4A 3BEWB 4PRAB 2GFBB 1X5XA 4EZMA 5MEND 2A9MH 4NRYA 1AGFB 1BHGA 5CILH 4X4XA 3BWAB 5EPMB 2VXTL 4LLVB 1ZLSL 4LAQH 3WNMA 1JTPA 4OUUA 5HY9A 3ZL4L 5F96H 3SJVB 2ZPKH 3QQ4A 5FGCE 5GRVL 4FRWA 2GKIA 5E8DH 5E8EB 3DETC 2FHFA 4N0YH 4RMTA 1CLOH 2Z31C 1R3KB 1VB9A 5H94B 1MCRA 4POUB 4NQED 4PJBF 3F58H 4M6NH 3KPPB 4FMKA 4HK3N 3LKSB 5EBGA 1YEGH 3INUL 5E03A 4ELKA 5K33A 4A6YB 4DQOL 4PJ5A 1NC4B 2FX7H 4YHNA 4F3FA 2Z31B 1OCWL 3IETB 4HPYL 3X11B 2FIRT 5E7BA 4NNXA 2NW3B 2ICCA 1FCGA 2WINB 2BSRB 1YA5A 3LS5H 4G9DB 4XPGH 1MCWM 2FYYA 4ZS7H 5KTEL 4KKLC 5DLML 2XWBB 2JB5L 3FN0L 5ICZA 4UQ3A 4HMEA 5JUEH 1XF4B 3GMMA 1JHTA 2FHBA 3K2UL 4R0LC 2IQAB 1VACA 5EU4A 2QHLA 4Z9KB 3WJJA 3QQ3A 2XFXA 4QRRD 2E5EA 4MXVE 3WD5H 4FZ8H 5FYKL 5CJ5A 3WL9A 2YC1B 2WV3A 2ID5A 4GOSA 1FNGB 3LPWA 35C8H 2R56L 4QRUA 5E24E 4R0LB 3CPLB 5F1KC 2A6DB 2MHAA 4OLYL 2D03H 2MWCA 4IMKA 5DUPL 4G6MH 1JVKA 1KJ3L 3QEUA 3JXAA 3B43A 3QZWG 4LBEA 5C0RL 4QYOA 5IM7B 1LO3H 4HMDA 3BZEB 3MFGB 3MRBA 2DLHA 1DUYA 4EDWH 5C0AD 2V5MA 5DEZA 5IHZB 3AUVA 2HVKB 1LO2H 1M71A 3UP1A 4RIRA 3GMQA 3TJHC 1BAFL 2EDOA 4Y1AD 1K8IA 4ERSL 1KF9B 4ONOA 3OKKB 1UYWH 3FFDA 2FR4A 5FA4B 4X80H 1XR9B 4D0CB 3WDHA 2BHYA 4CW1B 2G9HB 1LVEA 2WSKA 1U95B 3SKMA 5CEXB 2CDEA 1CICD 5A2LH 1WFUA 2OZ4H 5D1ZC 3TZVD 2XWJB 4FTVD 3ZMRA 1T66C 4I0PA 2HLFC 5HPOA 4PJDE 1MI5D 2GK0B 4NUJB 5MEQB 3LS4L 2CSPA 3N1FC 3VFMA 4HGWB 1A1NA 4X7SH 4ODXA 5D1ZB 2P8MB 4YLQT 3DRQA 3FHQA 4BK4A 5GS2D 4GXVL 5T33H 2BRRL 5FUZH 5D1QC 4O5LL 1OLZA 1EERB 4O58L 1G7JB 5IROC 1MIML 3G6JA 5LXGH 3KXFB 4S1QH 1A22B 4S2SB 2Q7YA 1VADA 3RWJB 1VERA 2Z92B 1EPFA 3WHXA 3VMNA 4WGWB 1F4YL 5D2LF 3RWIB 5BJTA 1CG9A 3KPSA 1MAML 2CJUL 5D6CB 5E56A 5FCSH 2EIDA 4PJHB 1U9KA 1KULA 5DD3H 1DBBH 5K9OA 2OTWB 3FO2B 4WFFE 1N6QL 2Y9RT 3OHXA 1MREH 4XP1L 3TIDA 2EXYC 4G9FB 5SX4H 1UJ3C 1S7QB 3REWA 2EE9A 4LF3B 4MQSB 3OR7A 4P3CH 5J13B 4PGEA 3FB5B 1TZIA 1BJ1H 3ETBF 2E9WA 3DV4A 3MOBH 1BM3H 3QWQB 5F1SA 3EYOB 3CLFH 1WZKA 5D7IB 3KJ4C 5JMOC 1CDBA 4YHIB 1UJ3B 3C6LA 4ODHL 1U8QA 2AABH 2DL2A 3AAZB 3U36B 1CFQB 3RWDA 2C3VA 4HT1H 1MFBH 4R26L 5TPWH 4KI5C 3PV6A 1GOFA 2UZIH 4I3GA 3KJ4B 1UM4L 2XT1B 5C0EB 1MCOH 1ZGLP 5KSUB 2XNAA 1NSNL 4OB5H 4XAWH 4NHUA 1S7TB 2QSVA 2QQLL 4GUPA 4OJFH 1VFBA 4X99A 1YJDL 2YRLA 2B8OT 2E6QA 3F5WB 5DVNA 2FGWH 4NFDA 3O4LA 4P5MB 2J1KA 3NN8B 1A7BA 5J11C 5F9JA 5HY9B 1YPZE 4HV8A 4NQEB 1A7QH 3U0TA 2P4AB 3QUMB 4I9WD 2Q8BL 1CDUA 3VDCA 4J3VA 4RRPA 4F33B 3QDGE 4PJFB 1YECL 5C6TH 5J11B 3HZKA 1FRGL 3MROA 5DJCB 5MP6H 4P23A 1U8JB 1IVLA 3T3PE 4GG8B 4D0DB 1AXTH 3VFNA 5AD0A 1F3DJ 3ZT6A 3GUTB 2P42B 1N26A 3BE1L 4H0HB 1ZANH 3TC9A 4PJIF 3OX8B 1R0AL 5DQJA 2HP4A 1NDGA 4V2CB 5AAWA 2BVPA 3FO0L 3QZWA 4QRRB 4NN7C 3S3PA 3BT2H 2AEPH 1JHTB 2DJUA 1H5BA 3MGAA 1JWSA 3X3FH 1Y6KR 1P9MA 5EU4B 5F70A 3T77A 2XFXB 4M3KB 3NIFF 5SWZD 3EYFB 1FHGA 1IE5A 1DANT 4XB8A 4NN7B 1LEGA 4QRUB 3SKNB 4R7DB 3UJTL 1E4JA 2YR3A 2MHAB 4TNWK 1YYLL 2FJFB 3WFBL 4QRPE 4HWBH 4QHNB 2P8LA 3EDKA 5EUOE 5ISZE 1T80A 5FAAA 5FM4A 4IOFC 4J3WA 1OQOA 3QEUB 5KJRH 1A5FL 4HBCL 1X5HA 5B3NA 1KPRB 4CMMA 3G9VA 5IEHA 4FA8A 3MRBB 1Z9MA 3DHMA 4Y1AB 1CICC 4AEIH 2MQCA 3PDOB 5JDSB 1JGVL 1M71B 3DX6A 1GIGL 4GAGL 3O0RH 2EEAA 3TZVC 1BEYH 3DI3B 4NKIH 1S5IL 5GHWL 2IPUG 3PNWA 3KNBB 2XTJD 1MRFH 1K8DA 5EU3A 3WLBA 2A9NL 2VDKH 4NNPH 2N56A 3DVNB 1CICB 2FR4B 4I0PC 4RFEB 3TZVB 3GO1H 4FTVB 3CX5K 2CIKA 1NBZA 3GSNB 4KK6C 1MI5B 4X7FC 2WIIB 5GIRB 1ZLUH 1B4RA 2BNQE 4GRWE 4WCYL 3V5DB 1T5WA 1EZVY 3CDYA 5CEZD 3GSRB 4I0PB 5DEFB 1WEJH 4G8GD 4OZFH 1OAYH 5A2KH 4NJAL 1HZHL 2ITDA 5L0QC 3GDBA 1A1NB 1PFCA 4HJGB 2R2BB 3K7UA 4EI6B 4NPYB 1CCZA 2OK0H 4OLWL 4JPWL 3VXNA 3UJIH 2VXVH 4WFHE 5F7LB 5CSGA 3FTGA 5L0QB 3UYRL 4LPWA 3G6JB 3CNKA 3N85H 2DICA 4I0KA 4PJDA 2Q7YB 3QQNA 3MV8D 1I8IA 2X05A 1VADB 2O5XH 3O6LL 4X6EB 3VRLF 4D9QD 1QFHA 5DT1H 3MLSL 2AI0H 3HZMA 1BZ9A 3T3ME 1ZHKB 5BQ7A 3G08B 4HLZH 4M1DL 2B39A 3FO1A 4YHZL 2QR0A 1T3FA 3BJ91 2E7BA 5K9OB 2KQNA 2DBLL 5EO9B 3QPQD 1BD2E 5H37H 1GYAA 1L0YA 3C2AH 4YXKH 3TCLA 3T08A 3MLUL 4HAFA 4XVJL 2XZQH 5T1MB 3REWB 2BVOA 4JFZH 4PP2A 1CDJA 4QHMB 4QRSA 3NFSH 5ADPH 3NCEB 3ARUA 3CFJB 3S4SB 4NQSA 1RI8A 4HS3A 5LGHH 3OR6A 1L9MA 1MRDL 1KPUA 4U6YA 1CFVL 4XPTL 1PG7W 4TVSa 1A47A 4U3HA 5EU5A 4PR5B 3OV6A 3J7HA 5IVXB 4LOUD 4YHPB 2P5ED 1RHFA 1U3YA 4NNYA 2Q8AH 1QVOA 3VXRA 4F7CA 4NHUB 1ES0A 1RUPH 1UACL 5KS9B 4Y19D 2OCFD 1VFBB 1B3JA 4OM0H 3DJ9A 4NM4H 3WNLA 1FCCA 2BY3A 4MNQD 1A4KA 2MKWA 5E6IA 2CGRL 4JVUA 1EVTC 4NIKB 5I19H 2C3HA 1I3GH 3D18A 3S3JA 3NIDF 2EYRB 4AY0A 4LSUH 5FYKD 2NTFA 2IADB 3F12B 4JFXA 2MCG1 4HUKB 4HWNA 4KJWC 1F4XH 1FSKC 4TRPH 4TUJB 4NP4H 1T5XB 4HWZB 1B90A 3IS0X 3MROB 2JJTA 4UBDD 4WIQA 4X0KA 5DRNB 4Y5VC 4TSCH 1WICA 1MCFA 4YR6B 5HXMA 1FSKB 3FQWA 4P46D 4F58H 1YPZA 5EBLA 4Q74A 1E27B 5FGCB 1P9MC 3DROB 2VXUL 5DGQA 1D7FA 5IV2A 1MCPH 4Y5VB 4J3UA 3O3DA 1NDGB 1MLBB 2BVPB 1S9YA 5K93A 2ZCHH 1AD0A 3QDGA 5E6ZA 3OB0K 1L7TH 2E8YA 5D7JD 3FFCE 1RHHA 1V3MA 2ZG1A 5SWZB 4E0RA 1UM5H 1JWSB 3REVA 1S9VA 1N2RA 2FL5A 3MUZ1 4OQTH 3MLVH 1G84A 2CKBB 3LN5B 2YUVA 4GBXA 4L1HA 1AH1A 4GRLA 1VGEL 1RUQH 1G7HB 1GPOH 2QSCL 3RUGE 2NY3D 4MCYA 1RUMH 5JPMB 2G5RA 3KWWB 1C7TA 4XXCA 1X5GA 1Z2KA 3S5LG 4Z5RB 5CCKL 3DO7B 3RWHB 3QDJE 4PRHD 3TLRA 2P8LB 4Y4FD 2XTJC 4XCNA 4M8VA 4MQ7A 1BF8A 3T2NL 2ICEA 1MCDA 1NGPH 3SDXE 3MFFA 1T20B 1QFUH 4KI1A 5GGVL 4ODWB 5HDQL 1EXUA 2AKRA 2FDBP 2RGSA 1I8LC 5TDPA 3D85A 4CAGA 2XTJB 4Z6AT 2UZYB 1FL5B 3BDBA 3QXVA 2H32H 1F45A 2YPLE 5IMOB 4KY1H 4X9IA 3GSUB 4XGZB 1MHPL 3MSPA 2X41A 4QRPA 2B0SL 5EUOA 2H2PD 5ISZA 3WLWD 4EJ1C 4PLOB 1WK0A 4FG6D 4JGMA 5C0CD 4MJID 5FYKU 4F7PA 2I27N 1I7RA 1JTTA 3B9KA 4KGJA 4PJ8A 3VMOA 4G8GB 3IU4L 2FRGP 1T5WB 1CE6B 3ARBD 4FQCH 4HXBH 3NAAH 3IDNA 1OAZL 5HD8C 5IW3A 3CFIC 1JHLH 4OLXL 2ITDB 5JHDD 1FORH 5T3XD 2WW8A 4UZGA 2DKUA 3VXPA 4JEGB 3ULSB 4KK5D 1T22B 5LBSH 3MV8B 4ZD3L 2BNQA 2BZDA 3QPQC 3C5SA 2R23B 1W0WB 3EHBC 3DURB 4U05A 2C4FU 15C8L 1QNZH 2FB4L 4C56D 5DJ6B 2VZ3A 4G5ZL 5C2BL 1F02I 3FB8A 5IIEB 2BFVL 4JQIL 1X6LA 1WZLA 3WO4B 2I60H 5HVWA 4JGJA 3FO1B 1WZMA 1W0YT 5GJSH 1T3FB 3QCTH 1EA9C 1FZMB 1V8HA 1NGYA 4NWUH 4OCLC 4OZGE 2CDFA 3IKKA 4WO4D 4M7LH 4APQA 5MHSD 1WLHA 4HC1H 1GZPA 1T89A 2D31B 5JW4M 5GGSB 5I8CB 5KANI 3ULVH 1AGEA 5I73C 4FQXA 1K6QH 2IF7A 4Q9QH 2Z93A 4PP2B 3GNML 4QRSB 1NFIA 2VQUA 1JUFA 1EO8H 3NZ8B 1E28A 2NY2D 5IGXL 4V1DD 5I73B 4GMSL 3OR6B 4H1LH 1BD2A 3U9PH 1CVSC 1KPUB 4U6YB 2P5EB 3O3EA 3A67L 1JGLH 1SYVA 5E9DE 4D9LL 1U41A 1RZ7L 3BGMA 4I5BA 4YEEA 2W9EH 4WRLA 2H3NB 4Y19B 3SGEI 3L3DB 3QUZA 3TO2A 4M6OH 4J6RL 3S96B 4TVPH 3ESVF 5D8JH 3LMJL 1OP9A 4O2FB 4NUGH 1ES0B 4JGUA 3GHEL 3ARXA 4MNQB 2G5BA 2BOCA 3TYFB 1E6JH 1HH9B 1I9JH 3MBED 5KANG 1JYXA 4PRIE 5HDOA 3SGKA 2E27L 1KIPA 4P2YA 3RI5F 1HE7A 3BHBA 1XF2A 4P5KA 4XC3L 3VRIA 2XV6B 1UWXK 2XN9D 5KBNC 3D18B 3V4PH 2JJTC 1FFQA 1DN2A 5DK2B 3MODL 2LTQC 4NO2A 4U6XA 4KTEL 4R6UA 4U4BA 1MQ8A 4K7PL 4NRZA 4ODSH 1IT9L 5B3JF 2FLRT 4OGYL 4NM8L 5D7JC 1FPTL 1AQDB 3GJFA 3LKNB 2YD9A 3QFDA 4M43H 2R0WH 1NBYB 2LTQB 1YNTA 1C5CH 2VN7A 1W0VA 3P0YH 5DRXA 5DQ9A 2F54D 3S5LA 5EBLB 4FOMA 1O0VA 2NY3C 2FZ3B 1JWUB 5D7JB 4EEEA 1FL6A 1QFWH 2APVA 2GK2A 4B41A 4HUXB 2OR7A 3MJ6A 3O3DB 4GRLC 2WLZA 5DFWH 4PJCB 2PO6D 1AD0B 3QDGB 2QQKL 1DQLH 3T0ED 1U8PB 2X7LB 4IRJD 1UKTA 4E0RB 2NY3B 3REVB 1TZHB 1VENA 4NQCD 3KYMA 3WN5A 1TPXC 3BFOA 4GRLB 2YWZA 4WY7H 2PXYA 5CP7B 2NY1D 3L1OH 3N9GL 4UILL 4Y4FB 4MCYB 2JJVA 4KHXH 5D9SA 2A6JA 1F4HA 1R3JB 3FQNA 3ZTNL 4E42B 3UPRA 2QTEA 3P9MA 1UZ6E 1C1EL 1LEKA 3DGGA 4XCNB 2H2PC 3HUJE 5DD6B 3FFCA 4MQ7B 1D6EB 4FG6C 2YD4A 3GGWA 3U0WL 1CK0H 2VLLA 4XHJC 1CF8H 4RNRA 2X4OA 4Z18A 2GITA 2N7BA 4ODVH 3RUGA 4YNYA 4XP5H 4ZFOL 5JOPD 4Z7QE 3QBTB 5I1GL 3BKJL 5C0CB 4MJIB 4JJ5B 4KUZL 1BLNB 3MRMA 3QDJA 2A6IB 4OF7A 3ME0A 5A3ID 3WIHL 1QSVA 1HWGB 2CRIA 3RIAK 4MWFA 5KSAA 3SDXA 5AUMA 5HYJE 3STLA 1INQA 1INDH 2D7TH 1UXWB 4JKMA 1PGRB 2J88H 4N0CC 3WNNA 1Q9WB 3ZKQD 5JHDB 2F15A 2YPLA 1XGUB 2EYSA 2QHRL 5DTFA 1GC1L 2B1HH 4RGNE 1P84J 4HF5H 4ZOBA 3LEYH 4LHUG 4AZ8A 2VLKD 3HI1B 5I1KL 4RBPK 5T1DL 5J3HD 4JO2L 4C56B 1PQZB 4I18B 2AERT 3IDXL 2BNQB 4GRWB 1A1OA 4JY4B 3SHSA 4OI8A 1QRKA 5D1XD 3QRGL 2R2HB 5AWNL 2G75A 3TO4D 1NCTA 5I8OH 4P2QD 1KLGA 2R4SH 4XNYL 4XPAL 4XPBL 5TDOA 4X6BA 5C08D 5BRZD 1MEXH 3VFWB 4BH7A 2NY2C 4FQLH 1FDLH 4FQXC 3VXUE 1NKOA 1DDHA 1SY6A 3E8UL 1MUJA 5GZND 1CFSA 2FBJH 4HFUH 4K8RH 5F9WC 4KQ4H 2WNGA 1NCBH 3GIVA 4G42B 4UU9B 2NY2B 4H20H 4I2XE 4FQXB 1HINL 1BQLL 2Z93B 3QCVL 5GGTL 2EDXA 2VOTA 3HI6H 1NFIB 4V1DB 1J1PH 2CQVA 3R4DA 4XPFL 1E28B 2GUOA 2VZOA 3HNSH 3QUZC 5F3HA 1WWAX 4JG1H 3MBEC 5DMIH 2NQCA 1Z0MA 4OZGA 5KSVB 1CLZL 4P5TA 3EYVA 1Z9OA 4L3ED 4QOKD 4XBGB 2YHGA 5ALCL 1MJUL 5GGQH 2BSTB 1B0GB 4U33A 5KVGH 3RZWA 5ECJE 1JHKL 2E3VA 3MBEB 3SGKC 4A6YH 4YQXL 1EV2E 1IRAY 1KTDA 3BQUD 2BOCB 3GMOA 3LKPB 5B38G 3L6FA 2VITA 2XN9B 1MJ8H 4WFEE 5DJXA 1BZ7A 1EHLL 5EC2B 1IKFL 3O41A 5DFTA 2R2EB 2D9CA 3BPCB 1LO0H 4GQ9L 1ZE3C 4JDTH 1JIBA 1MCEA 1XF2B 3ZE2F 5E9DA 4AQ1B 2F74B 3VFSB 1M1SA 4LNRB 4M4RA 1IMHC 1HQ4B 2BDNL 4PJXF 1J0KA 4XMPL 4JKPL 1IGCH 3T2OA 2F8VA 4FQIH 4Q6IC 3MYJB 1ZT1B 4NO2B 2LE9A 1BVKB 3UZVB 4OCYL 1YEDB 5GJTL 3ARSA 3K80A 3RTQA 3P3YA 3SE3C 4L4JA 4UOW1 1PSKL 1XMWA 2F54B 4IRJC 4PRIA 4MSWA 2Q1EA 1MFAH 4Q6IB 3MNVA 2RFXA 3B8SA 2NY1C 4AJ0A 3S5LB 4HKJB 3O3BB 1FQ9C 3T0EB 1JPFB 2ZZUT 4IRJB 2WUCL 4JE4B 2HJFB 3WN5C 2VAJA 3NIGF 4DK6A 1LO5A 2CDGA 4NQCB 4N1HB 2MCPH 4JN2B 3TBWB 3OB0H 2C1OA 2EIZA 1KN4H 4YHKL 4BZYA 2NY1B 4Z76A 3PP4H 3H7BA 3D0VA 3JWNC 1A7PH 2CIIB 2ORBL 3LEVH 4GKSB 5IQ9B 3WN5B 3QULA 3DUUB 1NCWH 5HVHC 1T1YB 1URLA 3BWUC 4AENB 4FNLH 2J3SA 3UTTE 3CFCL 2A6JB 3BYTA 4NQUA 3BPOC 5JPNA 4MJ5B 1NAMB 3KYOA 4LIQH 1FZJA 4N5ED 2DKMA 3L3OA 5DD5H 3HAEG 1AHWC 3ARVA 4PRPD 4BFEA 1KOAA 5FHAH 4JO1H 2OTUB 3FFCB 4UT6H 5A3IC 3GGWB 3ARDD 4PBVC 1MHHA 3NCMA 3BPOB 1RK0A 1W72B 4YEFA 1U2HA 5JW5B 1F4WL 1I3UA 1YUHB 4W68A 5DSCA 1AHWB 1QTYT 5IB2B 1I1YB 2R69L 4X6DF 4ZFZA 1SJEA 1Q9OB 4LHUA 3CGTA 3TBTB 3QWRA 2QKIB 4FQJH 4JFYB 3MRMB 3WKML 1S7XB 4MD0B 2D0HA 4LHUD 3HUJA 2J8UE 5LQBH 1NCNA 3RGVD 2APXA 1REIA 3BIKB 3UO1L 4DK3A 2C4FT 2YK1H 2ED8A 5GGRY 4LSSH 2IPTL 3Q6FB 2VLKB 3HI5H 4KWUA 5J0BA 3G9AB 2XA8H 5J8OA 1EO5A 4U1KA 3VE0B 2X4TA 1RZKC 5IVZA 3E6HA 1X5JA 5CGYD 4X6CE 1Q1JH 3G5YB 5D1XB 2E6JA 1KFAH 1NH6A 3C6SA 3LQAC 5T1KA 4BUGA 2Y5TA 5HYJA 1UM6H 3PF2A 3V6OE 4MHHI 2XXCB 1CD9B 5HTSA 1XGTB 5L2KE 4LARH 3QNYB 4PGBB 3BMWA 1MHEA 5ELIA 4X5XA 5C08B 3IGAA 1OSPL 2ARWA 2G75B 4OF0A 5BRZB 4LDOB 1PX4A 4KQ3H 5FOBA 2QSQA 2CMRH 3BP6A 1TNMA 5D7LD 4QF1B 1BVZA 4HCRA 4J8RA 3O2WL 1G9ML 1WQVT 1FN4B 1YYML 3RRQA 5LAXB 1X44A 4PJBE 2ZOLA 1M7IA 4LCYA 1FNEA 4C83B 1D6VL 4QWWD 1J05B 1MUJB 1X3DA 3NACL 2XKNA 4LU5L 4AEEA 3QUKA 1CFSB 3UDWA 1DN0A 2RQ8A 1A1MB 3M45A 2GJ6D 1M7DB 1NFDF 1NUNB 4OCNC 2AK4E 3CUPA 4QXGH 4MHHG 3K4DA 4FXLA 3MUGA 1A6UL 5KSBF 2B2XH 3BQUC 4MMZC 4L3EB 4QOKB 3VXUA 4XH2A 1G6RA 5F3HB 1ORSB 3QUMH 5F8QC 1XF3A 1GHFH 4OZGB 4LHQB 2ILLA 3LIZH 4H8WL 3EYVB 1MPAH 3UROR 4X9FA 3BQUB 4I2XA 1HHJA 3BJLA 1BFSA 4CNIA 4I13B 5T1LD 4FABH 1DLFL 3SO5A 2IQ9L 4JFPA 2DM3A 2H26B 1Z0NA 1JPGA 1RZFL 2JTDA 5CUSH 5FHBH 1RURH 3CLEH 3O41B 4ONGL 2YD5A 4QXUH 3BKML 4DGIL 4F7MB 4OZHE 1A6WH 3RVWD 4OZIB 2AEIT 5F93C 2GCYB 5IJVB 1KN2H 3S88L 1QQDA 1INEH 1IAII 5IW6A 1VFMA 5T3ZL 1MY5A 1U92A 3IS1X 1X6NA 1KJ2B 3TIEB 4NKDA 2AVGA 3OKOA 3PJSA 3JWOH 5CS7A 1YQ2A 3H9HA 2IPUK 5F71A 3SE9L 3X14A 2RIKA 1IZKA 4WENB 3DTXA 3VWKA 5D71H 4LPYA 4P9ML 5BV7C 3IRPX 1XCQB 4PGDA 2RFXB 5DC0A 1S8DA 4TSAH 1YY9D 3MA7A 2VQ1B 5DO2D 3N1GC 1CGVA 4DVRL 1TQBC 3O2DA 5I74C 4IMLA 3IKCA 5HHOD 1TJHL 2VH5H 4KDWA 5BW7A 1ZVSB 3CDCA 1KCVL 3PWPE 1FLTX 4XAKD 5FIEA 8FABA 3RWEA 4RAVB 5BV7B 4N5EC 3QUYD 4KKBC 3S35X 1BJ1J 1YDPA 3I6KA 3QO0B 4FQ2L 1YEHL 2VNCA 4NQDD 4MA3B 4PJ7B 1ZXQA 1TQBB 4ZNEE 5I74B 3F8UB 3ALPA 3ARDC 1K4CA 3HCVB 4TOYH 1LDPL 1DZBA 3S98A 5DF0A 1FVDB 4HWEH 2DIJA 1IFHL 4LCUA 4PRPB 3TH2T 1QSZA 3MV7E 4DCQA 4LCIL 3ARDB 5DMJB 4EUPA 3GSNH 1MQKH 2I9LB 3ZKND 5DVOA 2A9ML 2R15A 5B39B 1FZKA 2Q76A 2AJSL 4TUOA 4YPJA 1MHHB 4JZNA 4P99A 5GS2H 5C8JA 4AEFA 1RK0B 3I75B 1PG7H 2ICWI 4I3RH 3PWNA 5EZLA 5F96L 3TBVA 2ZPKL 4AG4L 5INCA 5CINH 3UTTA 1HKFA 4LHUB 4N0YL 3TN0A 2DQHH 1GGCH 1CLOL 1FVCA 2PYED 3L3IA 3EO9H 2VLRD 3MRIA 4M6NL 2Q20A 3HMWH 5CZVH 1FG2A 5CGYC 4OFVA 5BOZG 1QBLL 5EG6C 3L3HB 4MNHA 5L6YH 1DQTA 2FX7L 3QH3A 4NDMB 2VDPH 4M62L 3OKNA 3KLHD 4MLSA 3VRJA 5JW4R 2FWOB 4P2RD 3HE7A 1NUDA 4HKXA 3HC3L 4KTDH 3PWUA 3WHE0 1Q0YH 5D7KE 5K9JH 5GZOD 2X4TB 3T1FA 1O7VA 5IVZB 2V7NB 2J8UA 3GIZH 3SCMA 3QDME 3HKFA 3D69B 3C6SB 1YEFH 2Y5TB 3NABL 5CD3B 3WD5L 1WFTA 3GSVA 2MTPA 1CGXA 3O9WA 3KLSA 1UWGL 3SEPA 3X12B 35C8L 5D7LB 1T7VA 4MA1C 2KQMA 4YDIL 4X5XB 2D03L 2DLEA 4H5SB 4L9LC 4GMTL 1I3RB 4DFIA 2ATPA 5HHVH 4FFVD 1MJ7H 4DZBB 4OD2A 4X6CA 3UDWC 4K9EL 3V0WH 1N5AB 4MA1B 3PHOA 1RUKH 1N3NA 1KJVB 4IJ3C 3V6OA 4L9LB 1DE4B 3H3PL 2GJ6B 5F6IC 1FNEB 1AQKH 4PUBH 4OZ4B 3BVNB 1LO2L 5L2KA 4MZ3A 4M6MH 4B7IA 4MCZB 2RHEA 1OHQA 4JHAH 4XCYA 2GJZB 4HG4K 4IJ3B 5FK9B 2VO5A 4RSVA 5IB3A 1UYWL 1H8SA 4PJIE 2BC4B 5F6IB 5B38B 1GZQA 3WFCH 3QHFL 2IAMA 4D8PB 5DRWA 4OKVA 1SEBA 4PJBA 4XH2B 2G60H 3DSNA 3AU1B 2OZ4L 2OL3L 2FJGB 3VGBA 5T1LB 5C0IA 5H8DA 1IEAA 1ZA3A 3NIFE 1V3JA 4HDIA 3DBXA 3QG6A 3RIFK 1A4JA 3RVWC 4XZUA 4XTRD 4M48H 3ARZA 2AK4A 1OGAD 1R5WA 2DMBA 3TFKD 5T33L 3PGFH 4NO0A 5CWSA 2Y72A 3GB7A 1QA9A 3VI3F 4QRTA 3WUZA 4LCCA 4OTXH 4IOSD 4S1QL 1YY8B 3FRUB 4ETQA 1N8ZB 4JDZA 5FUOL 4Q2ZB 1KTKE 4ORGA 4YHYB 1YY9C 4F7EB 5DO2C 2HLAA 4O2EA 2VLJD 1WWWX 3VWKC 4YXLH 3C5ZD 1EZVX 3IAGC 3ABZA 1H15A 3MC0A 1TVBA 3ZSTA 4DZ8A 5C09E 2VXQH 5DD3L 1EHNA 1PYWB 3QUYC 3VDBA 4PREB 1F2XK 4D3CH 4YHLL 5ITBH 3X14B 5IMLA 4IRSD 3G5VB 4WWKD 3VWKB 5HHOB 3GMRA 5F89B 2AEWA 4LLQA 1RVFL 2QADC 4OZHA 3MRFB 4ZFOB 4Z0XA 5FEBA 1L7IH 3ULUL 3QUYB 3JWDH 1UCTA 3ZHDA 4P3CL 3O4OC 1ZHBA 3DYMA 4IMLB 4NQDB 3HAEB 4X98B 1JV5A 5JW4N 3MOBL 1FYTE 1BM3L 2WUBH 2QADB 4WV1A 2BNUA 4L29B 1KCRH 3O4OB 1DBKL 4GW5B 1LEIB 2P7TB 2IANE 4NBZB 2OXHA 1J8KA 3ELAT 5L88H 5E00B 2UZIL 1FFRA 5LWYL 2IH1A 1MCOL 4DGVH 4W6XB 1ZHNA 5CEZH 4OB5L 3PWPA 4AIOA 4BSVB 1RULH 4QO1A 5DJ0B 3FT4B 5TH2A 5ITFA 3CVIH 3PGDB 3VRLE 5EZIH 4D0BA 4LSTH 1FZKB 4JHWL 4M5ZL 3O6KL 1BF2A 1TETL 4K3JL 4ZNEA 4GW4A 2AXGB 2FGWL 4KJYA 4IRZL 3M07A 1Y0LB 1FIGH 2RR3A 4ZO8A 2X4NB 3TBVB 4OCSH 5INCB 1HSAB 4DN3L 4OF8A 3A6BH 3MV7A 5JXEA 2HT4D 1QR4A 2ICWA 1F58L 3CZFA 5GZOC 1WIUA 1OF2A 5HGHA 3D9AH 3OQ3B 5EC1A 5FO7B 1FG2B 4DGYH 1D5BA 1AXTL 1P6FA 3U7YH 2DTMH 4MNHB 1CL7I 2FIKA 5HGDB 4RISL 5I66B 4YHML 1AO7E 3V4UH 3SCMC 1MCKA 1CFTA 3LSOB 4JY5H 3DGCR 4GT7A 1AR1D 2VDMH 2VXTH 1R3HA 5IOPA 4IOIA 1ZLSH 2AEPL 3T1FB 4C57C 4P4KD 3UTQB 3IDMA 2J8UB 2X9WA 1BMGA 3G5XA 3SCMB 3ZL4H 3QHTC 4KJQD 2G2RB 1VFAB 5MI0C 3KJ6L 1PZ5A 2V9RA 4PGZA 4AM0B 2NY6D 4NCC1 1JZ8A 1MWAL 2A73B 3MRDB 2LU7A 3INUH 3V6OC 2ATPB 3NIDE 5MI0B 1CN4A 3VFPA 1AGBA 1OCWH 4OD2B 3H9ZA 4HPYH 3UTPE 4KZEL 3QDMA 1MVUA 2MQ3A 1N3NB 2K1MA 5CBEB 1D9KA 3I9GL 2JB5H 1KTLB 3C8KA 1AGDB 1ZA6A 4ZUWA 1J8HD 5D2NC 3K2UH 3LKOA 2ARJQ 2YMXL 4KTYA 2KBGA 3IDIA 4LVOC 5EORH 4NNPL 4JFDD 4WUKL 5FYKH 4U1NB 3TFKC 5D2NB 4X9HA 5D72L 2R56H 5T3ZD 2YUZA 1WC7A 4PJBB 4OLYH 1SYSB 4I77L 4LVOB 1TCMA 5DJAA 5DUBA 1KT2B 5GGUA 1I7UB 1KJ3H 1OGAB 3G6DL 3E0GA 1WEJL 5I30H 3JUYA 3VGDA 1GXEA 1DEDA 3MJ9A 3T0AA 3C9NA 4PJIA 5CHNA 4LLUA 3C5ZC 1QKZH 1DL7L 3EDFA 5CWSB 4YDVB 3EFFB 1K9TA 5CJ8A 1S78C 5EULV 2VXVL 3T65A 1U6AL 3ALWA 2VLJB 4IRSC 4JQVA 4ERSH 2UY7A 3C5ZB 2OMBA 5HYSG 2GAZA 3WUWA 4JDZB 2O5XL 4Q9CA 4ORGB 5DT1L 2HLAB 4L5FL 2AI0L 1RIHH 4WHTB 1VEMA 4IRSB 2CLZB 1MFDL 4YBQD 4YDLC 1PAMA 4DZ8B 5ESAA 2P1YA 3NMEA 2D3VA 3TVMD 2K9UA 1BX2A 4Y4KD 3RDTD 4YXKL 3IFPA 4YDLB 1U8NA 1KSRA 3DV6B 2XZQL 3MLRL 5FM5M 4GXVH 4JFZL 4CJ0A 2BRRH 3NFSL 5ADPL 1UQSB 1XGQB 1ZHBB 5TDNA 5BZDB 2X70A 3IB4A 2DMCA 3BRFA 4O5LH 4O58H 5DK0B 5C09A 1MIMH 4PYGA 2Y06L 3FL7A 4AEHL 4GKNA 1B0RA 4I4WA 2VZVA 2BY2A 2I5YH 4XXDA 1AD9A 1YN7A 3DVIA 1PVHA 4ZOEA 1J11A 1MAMH 2CJUH 1IZJA 4JZOB 5GS0L 5HHQB 5J6HB 4HUVA 4GS7C 4OV5A 1ZKAA 1KB5B 3L7EB 1RZ8A 4XWOD 4J3SA 1FYTA 1GCFA 4S11A 1S7UA 4UNTA 4XP1H 3HMXH 5GSVB 4OM0L 5T3XH 4BYHA 2X09A 4GW4B 1FFOB 5HPMB 5HJ3A 5JXEC 4GS7B 4KJYB 2IANA 5JQ6L 1NLBH 3VFTA 3VD3A 1I3GL 1EMTL 1A02N 4JN1L 1NUFA 1RJZB 2QV2A 2EE2A 1AR1C 3MRLB 4NP4L 4HXAL 4R26H 3DARA 4CADB 1OF2B 2ZP0T 4GXUM 5HGHB 4PJGF 4P4KC 2J12B 1UM4H 4TSCL 1F2QA 5FKAB 5D2LB 5GQBA 1NSNH 4KJQC 5DK3A 4KV5E 4MA8H 4MJ6A 4MXVF 3SGDH 1C08B 2BY0A 2R8SL 1NCCH 1YJDH 5FECA 2NY6C 4LSVH 4P4KB 5L2JA 1MCPL 5D5MB 3O81A 3W0WE 1AIFA 3FQXA 1KYOJ 2H8PB 5L8LB 3W9EA 1UM5L 1YEJL 1T7XA 4OQTL 3MLVL 2NY6B 1ZLVK 1I7TA 1AI1H 5DMYA 3BN9D 3EAKA 5EFIA 1LE5B 1RUQL 1GPOL 1AO7A 4BFIA 1T04A 1RUML 2IH3B 1EFXA 2D2OA 3M1BA 4JFED 5HDBF 3VMPA 1XGRB 1TTFA 3VFPB 2V2WA 1B88A 2W38A 1KGCE 4ZUVB 4DW2L 1J8HB 3BE1H 5KW9L 1HYSD 4G7VH 1U36A 1NANH 1QO3A 1MRCL 2I26N 4U1JA 4F9PA 2OJEA 5IBLD 4KRMB 1ZLWH 2H9GA 1B0WA 1TDQA 1FO0L 4HUUA 3LKOB 3VH8G 2R1YA 2V2XA 4PJDF 2FO1A 3DUSA 3Q5OA 2EYTA 3H0TA 2AW2A 3MGOA 3IFLL 1VKXA 1WCQA 1HHGA 5EUKA 1KLUA 2VUOA 3CX5J 5HYSA 1NL0H 2HTKD 4NZUL 4FQCL 4KKAD 1HH6B 5IESL 1IGFL 1AKJD 3NAAL 1GJIA 3IXTB 1A5FH 4PS4L 1JHLL 1X5IA 3D3VE 5GRWA 4Z7WF 3T4AA 5CHNB 4Y5YC 3ZTJG 3ULUD 1BBDH 1OP3H 3VFVA 2CD0A 4YBQC 4U1HA 3B83A 4ELME 4U1GC 1GIGH 2R4RL 1MLCA 4U6VL 3TVMC 4HW6A 3C5JA 3L5HA 3FO9A 3T65B 5DZOA 4Y4KC 4YAQB 4Y5YB 3RDTC 1QNZL 1HHKA 1OW0A 1TVHB 2GAZB 3IJHA 4U1GB 4NRXA 4WI5A 5EU6E 4FQHA 4DUXA 3W2DL 2Y4SA 4G6KL 3TVMB 4MD4A 1WFNA 2I60L 1N59B 2JELH 5IF0B 1HHIA 4Y4KB 1IEBB 1CGWA 1LK2A 3RDTB 5C0DA 5GJSL 4F2MB 2YKLL 3EFDH 5F7HA 4UV4H 3VFGL 5DD1H 3FOLB 4NWUL 1KTRL 1TXKA 1NAMH 2R1WA 1RZJC 3EOYG 1U8NB 3R0NA 2R0LL 1PZUB 1J1XL 1K6QL 3QWOB 1XIWD 4WVRA 4OLWH 4JPWH 2CXKA 3F7YB 3Q1SH 2JCCB 5TDNB 5IEKA 1W72H 5TFSL 1CD1B 2FECL 3TA3D 4XWOC 3UYRH 1ITBB 4Y8AA 1JGEA 1XFPA 2DOCA 2H45A 1G7IB 3U9PL 3O6LH 4MD5B 2J7LA 4NQVA 4XT1C 1S7WB 5IWLA 1IGTA 3SE4A 4JM2D 2LAAA 3QIBD 4IDJH 5I8EA 1UA6L 2W9EL 2PTTA 4N8PA 4M1DH 3I6LD 4M6OL 1U3HA 4TQEL 4XPHH 2F9BT 5D8JL 1X4YA 4OV5B 4RGMB 4NUGL 3F7VA 4WFGE 1RZ8B 3CSYB 3T0WA 4KMLB 3PHQB 3CDGB 1KUMA 1F11B 3VXTB 1TCRA 4OIIL 3GI8H 3LQMA 4YH6A 1WZ1L 3K46A 2EDHA 1G6VK 3VFTB 1X5KA 2A38A 4WW2F 3ES6A 3V4PL 3DIFB 4RMQA 3DMMD 2RJMA 4WJ5A 4UNUA 5DJYA 5EB9A 1CFVH 3JUZA 2HT2D 4ODSL 4XPTH 3BAEL 1EDQA 3UX9B 1LNUB 5J6GB 1A64A 2XZCL 2GQHA 5AZEL 3MXWL 3I6GA 2X1XR 2Y23A 3I02A 5IR1B 3RZCD 4M43L 5B8CC 2R0WL 3T4YB 3SDAD 5MEOA 1G7PA 5EIQA 3BN9C 4U7SA 4PRBB 3UYPA 4V2BA 1HI6A 1A6AB 1UACH 4MJ6B 3I50H 4K3DL 5FECB 1QFWL 1P4BH 5C0BD 4CKVX 1RK1A 5B8CB 1WITA 1ZEAL 2YPVH 1AIFB 1T2QL 3FQXB 2D9QB 2VABB 4GKZA 2EKSA 4RWYH 1N0XL 2K3TA 3MLTB 2CGRH 3T8XA 2IFGA 1BVLB 5C6PB 5EUOF 4NFCA 3IXAA 4PTUB 5EU7E 1HQRA 1B2WH 1QR1A 1HYSC 4WY7L 2EEDA 3MNZA 3L1OL 4LPCA 3VH8A 1AO7B 4OAWB 5IBLC 1T04B 1HILB 5IMKB 3ZE2E 3WSQL 5IBUG 4QCIB 3W0WA 3MR9B 1LWRA 1X5AA 4I1NB 3C08H 2V2WB 1CK0L 1RZGA 1R24B 5JO5B 1CF8L 3SBWA 1NLDL 2VXUH 3K3QA 1QO3B 1EGJH 2EO1A 4W6WB 2BSSA 5TF1L 2HTKC 3VFRA 4XP5L 4HIEA 3EOBA 4KJPD 2H9GB 1PEWA 4KKAC 4P9HC 5FGBA 1AP2B 4HUUB 4RMUA 5I1CH 4AH2B 4HKBA 4CVZA 2OP4L 2ZSWA 2V2XB 2EDNA 3ULVF 1F00I 5C7XH 1VGEH 3MLWL 2XYCA 2N1KA 2QSCH 3ULUC 3NIGE 4ZAKD 1AKJB 5EUKB 2D7TL 3MRNB 3KGRA 3GMNB 5HYSB 1AGCA 5CCKH 1JK8A 5FYLD 1KJ2H 2B1HL 1U8IA 5FCUH 5K9KA 4XX1E 3T2NH 3IDYC 1JZ6A 1YEEL 2AXFA 5A40E 1BJMA 4W70A 4ZO6A 3LEYL 5DGRA 5JR1H 2P47B 5FYJL 5GGVH 5HDQH 1JF1A 1X5LA 5IB5A 4X5LA 4Z78B 4JO3L 3MV01 3L3GB 4E5XB 4Y2DA 4A2MA 3WMSA 3IDYB 4MNGE 4Z7VE 2EZ0C 4EKXA 1T1ZA 2YPKB 4K3GA 1R3LB 3BXNB 1UKQA 1P7QD 2XZAH 4NYLA 2B0SH 4Y2DD 4MDIA 3F6LA 4O2CA 1HHKB 5I8OL 1SM3L 3B9DA 5FUCC 5EBWB 1KEMH 2R4SL 5AYUL 4L8BA 1XIWC 2VAAB 3D3VA 4X6DE 3CH1A 5IMMB 3DSFH 3BDYH 1TNNA 1MEXL 3CVHB 1HHIB 1SBSL 3BX7C 5GS0D 3D25A 2P8PA 4OLUH 3VGHA 4ELMA 4YBLC 2ZUWA 4X9GA 5CJXC 4X7DC 1XIWB 1OAZH 2WBJD 2FBJL 2Q6WA 2OR8A 3EZJB 4KQ4L 4OLXH 4JG0L 3I85A 3NCBB 1NCBL 4YPGA 4MJ4A 4CMHC 4YBLB 3E6FA 4GG6E 5EU6A 5KAQF 1CQKA 2LABA 4XX1G 2X4PA 1T2JA 2O5ZH 1NC2D 4XCEA 1ACYL 4ZD3H 3ROOB 1JGEB 4ZPTB 1S9XB 4CMHB 3O8XD 3FQTB 5CGTA 2CK2A 1WIOA 4OFYA 1U8HB 3IDGA 3BPLC 1IGTB 2EXWC 3D39D 3RVXC 2YSSA 2BFVH 1NGWA 3DO3A 1U93B 3CFDA 4MX7A 4NC2B 1FBIL 5GGQL 4R4BB 2V7HA 4R90L 1TTUA 1FAKT 4G6AD 3GSWB 5BS0E 3ISWA 1H3VA 4HJJL 4A6YL 1PJ9A 4OCMC 3BPLB 4XHQA 3DMMC 4DOHE 1MCWW 2BVQA 5GRUH 2BJML 2FO4B 4TNWF 3QEGL 2HT2C 2EDYA 4JRXA 5EO0A 1R3IL 1LO0L 2Z4QA 3RZCC 2ARJB 5A2FA 3GNMH 1EAPA 1FGNH 3DMMB 1IC1A 2DQGL 5F1NB 1ZHLA 3E3QC 3SDCA 5EBMB 4PGJA 4R3SA 1N0LA 1U58B 2VWEC 3U4BH 1IGCL 2P43B 2GEEA 3VCLA 3RWCB 4FQIL 4WJ5B 4KZDL 4GMSH 3RZCB 3QR2A 1OQXA 3MMEA 4Z7NE 4Z95H 3GKWL 3MO1B 3A67H 1Z6JT 2NX5E 3SDDA 4D9LH 3ROLA 1RZ7H 3P77A 1RJYA 4QRQB 2V2TB 4P57B 4KK8D 3I02B 5F9AC 2AS5M 5KSBE 5C0BB 5MEOB 3LMJH 1D5MA 5GISL 5I15L 1T21A 2X2YA 5HYEA 3GHEH 1MY7A 5K59F 1CWVA 3DUHA 5KVDL 4NC0B 3RUGF 3BZFA 4R7NA 2MCPL 4URTB 1IM9A 1KN4L 2EKSB 4M8QA 5F7YC 4XC3H 1FFPA 3VXSA 2NMSA 3PP4L 3UBXI 3HC0A 5C9JB 4U1MA 1A7PL 3IXAB 2M2DA 4Z7OE 4LPTA 3HR5A 5EWIL 3SDXF 4FNLL 4KTEH 4K7PH 1IT9H 4KJPC 1FLRL 4OGYH 3UTOA 4LIQL 4IBLT 4NM8H 2BVYA 3IFNH 3MOAH 3WFDL 4LPVA 4TN9A 3EGSA 5DD5L 3W0WB 4R96A 2APTA 2JB6A 1DTUA 2EDEA 3M17A 5FHAL 1BOGB 2ED9A 2PF6A 2XACC 4JO1L 3GJEB 1XF5B 3G04B 3RWGB 1KPVB 4KRPD 2FATH 2X42A 1TZGH 3EO0A 2IFFH 3LN4B 5ANMB 2BSSB 4LLMA 2QQKH 1BFTA 3QXDB 5C0JB 3JVGC 3SGJC 1QD0A 3I3BA 4FQJL 4HKBB 1J7VR 3RL1B 5H35A 4CJ1A 3ARGD 5LQBL 5MERA 3QEHB 3MRQA 4UILH 3ARFA 3WBDA 3P4NA 3T0DA 2Z91A 4BUHA 5CP3H 2KPNA 4NGHH 2LFGA 4LMQE 5IHUH 1OARL 1C1EH 4JJHA 4Y2DC 5K9KB 5IW1B 3U0WH 1UVQB 4ODUB 4DKAA 2DRUA 4HHAA 4ZQKB 4G6FD 1FGVL 2VL5A 2VTFA 3BP5A 3VFUA 2VKXA 3BEVA 1H3TA 1P7QB 4LLWA 5ID0A 4LMQI 4Y2DB 5I8KL 4LQ1A 1UM6L 3QEQD 2WZPD 5L7XH 3WFEL 3BKJH 3HAEH 1T1ZB 5M94B 2VRAA 3IU3A 4KUZH 4LARL 4JQXC 2WBJC 2YS4A 1I4FA 4L4TE 4WUUD 3MZGB 3WIHH 1YMMD 2DMKA 3TNNB 4QHLA 2CMRL 4U31A 5JA9A 4X7CC 3PWLB 1KJMB 1EH9A 2WBJB 1BIIA 1F97A 1XCTB 3MRRA 2HG5A 2E9IA 4MNGA 4Z7VA 1GC1H 4XVUD 4HK0B 4BJLA 1X4ZA 3O8XC 1FH5L 5E08H 3ZSSA 3AM8A 1P5VA 1NC2B 3L5WB 3U79A 4K2UL 5I16B 5I1KH 3OKYA 4OGXL 4PY7B 3HFML 4UIMB 3U46A 1S9WB 3P9LB 5T1DH 5LVEA 4JO2H 4X6DA 5DYOA 3O8XB 1UJTA 3UMTA 2X4PB 3W11D 1BFOA 1QYGL 2X4RA 1QHOA 1Q94A 3HE6D 1GGIH 1AR2A 3IDXH 3D39B 3QRGH 5FB8A 3PQYE 1IAIM 4POYA 5AWNH 3VWJD 3MOQA 1GHFL 1OD7A 2F5BL 1EEYB 4HS8H 1PKQB 4XPAH 4C58B 2BVUA 5GGTA 3LEXA 5SX5H 3TH3T 1FE8H 5DZLA 3GM0A 4XPBH 1WFOA 2YSSB 2CR3A 1C12B 2J5LC 5DHVH 3QSKB 3CFDB 5E8NA 2J6EA 4X4ME 5DVMA 3UAJD 4GG6A 4OBSA 1QG3A 4FABL 1NDMB 2BCKA 2OJZH 3E8UH 5IQ7L 1IARB 3JV4A 4ZOCA 4JFHE 2J5LB 5FHBL 3SDCC 3CLEL 3MCKB 3KLAB 2W59A 3I2CL 2W9LA 2H2SD 4Y8DC 2J4WH 3MLXL 1HINH 1BQLH 3P11H 3QCVH 5GGTH 5JORA 5CIPB 2DLIA 4PRDB 1ZHLB 4DUWA 5LCVH 1KN2L 1FZOB 1INEL 1I1AA 1TMCB 4ALAL 4YFDB 3VGAC 1X5YA 5BS0A 2DI7A 5CZXD 1ONQB 1E4KA 4ZXBA 3DX7A 1NEZG 3P9WB 4O51B 1HNGA 3GRWA 3V0VA 1U8LA 1CLZH 5CZKA 3NCJH 3NFNA 5I1LA 3GMPA 4PYHA 2FNBA 5ALCH 4ZYKA 2W65A 3OJMB 3CFBA 4LPUA 5CJOL 4AMKL 3VGAB 4FP8L 6CGTA 1CFNA 1Z5LA 4DVBA 1D5MB 1ZSDA 2XQBH 2X40A 1XGPB 1VGKB 2IGFL 4OFPA 3SQBA 5IBUB 4X5WA 3QXWA 3E2HC 3P4OB 4HUNB 1LD9B 4PG2A 1IKFH 4PGCA 3PP3H 4H0IA 4LFHG 4GQ9H 3W5MA 3D2UA 5CBAA 1QRNE 4KDVA 2NX5A 4M5YH 7CGTA 1FFPB 1NMCC 1TJGL 3KPTA 2HWZL 1MVFA 1KCUH 1UZ6F 3OGOE 4NO5B 2BDNH 3E2HB 1NPUA 4U1MB 5KSBA 1HOCB 2ATKB 4G43B 1IGYA 1RSFA 1NGZB 1H3GA 3C09C 3HR5B 2CR6A 4KRPC 4JRYE 4OCYH 5DMKB 3MRGB 1SJVA 5GJTH 3RNKB 3UBXA 1NMCB 1R5VA 2UY6A 3WHE1 2BERA 4MYWB 3GSNL 1MQKL 1PSKH 1T0MA 5EU7C 4BKLA 2Y07L 3EGSB 3C09B 1CIDA 3R0MA 5D7IF 2CLVA 5DZNA 3M17B 5KVMC 4KRPB 4NKMB 4J4PD 3ARGC 3U2SB 1MNUH 3B3IB 5FYJD 2P48B 1F3JA 1T0NA 4UNVA 4PD4J 4RAUB 2RBLA 4GFTB 4I3RL 1T1XA 5IKCA 3JTTB 2X1WL 1LMKA 4PJ9A 1CYGA 4N90E 3NCYS 3QXAB 2VLME 4NHCL 3H42H 3C60D 5FDWB 4YHKH 3ARGB 4LSDA 4AT6A 3ARFC 4HZLB 2ZG2A 4L8SC 1GGCL 4QHKJ 1YEKH 2VXSH 5DA4A 3F7PC 4HLJA 1QBML 3OPZH 3ZT5A 4PJXB 4QXTA 5BZWA 4JAMA 3U4EB 1QBAA 2ESVE 1A7NL 4L8SB 3I3EA 3MREA 1VA9A 2OQJB 1A6TA 2VDPL 4WNQA 3KPRD 4GXUN 1JRHL 1YN6A 4LSQL 4G6FB 2UUDK 1QSFE 1IQWL 2XXMB 3L7FA 4HIIA 4RMRA 4KTDL 5DEGB 3RU8L 1Q0YL 5HGBA 5K9JL 1LE9A 3QEQB 3H6JA 5DJ2B 4LRIA 5F7DA 3GIZL 2ICWJ 1F4WH 3BP5B 3VFUB 5I1AA 3P73B 4ZDHA 5C0GA 4JFFD 2R69H 1P53A 1JNHB 1YEFL 4WUUB 1YMMB 3FB6A 2DD8H 4XVUC 5C07D 3ZDZF 1IQDA 1I4FB 1TIUA 2AP2A 4XCCH 2GTWA 1AC0A 2FJHB 3SPVA 5F97E 2HFGH 2XY2A 3IJYA 2HFFB 1MJ7L 2FLBT 3BW9B 1SJHA 1CXLA 1M6OB 2R0ZL 3V0WL 4W4OA 2FX8H 2IPTH 3HE6C 4YC2C 4YO0A 1OLLA 1J0HA 4HX1B 1AQKL 3VXME 5E4IA 4I0CC 1KB5H 3HG1E 5M7QA 2JK5B 4L4TA 1RFDL 4UQ2A 4WGVB 5FYJU 4ORZC 3V52L 3HE6B 4L3CA 4RZCB 4YC2B 1S7RA 4RQQB 1FYHB 1RJLA 4JDVB 1G7QB 4X6DB 3VWJB 4IIQC 4AIZA 1E4WL 3WFCL 4P2OA 4XRCA 2BVTA 1CT8B 2VDQL 4KKLD 4PP1D 2G60L 2YRZA 4JANA 1TTGA 3HS0A 2H2SC 4IIQB 4HWUA 4BFBD 4NT6A 2PUQT 2OS7A 5DJZA 2DTSA 1NEZA 1YYMH 5A16A 4M48L 4TTDD 2O61B 3QUXD 1YC8A 4N0UE 5CZXC 1D6VH 1UXSB 2JKXA 4LU5H 2WBKA 2Y1VA 4KDTA 3PQYA 5ACZA 4S10A 5FKPB 4OTXL 4DKFH 1BJ8A 1MCJA 1DANU 4JZJC 3SN6N 5JORB 1ED3A 1WISA 2ITCA 2JJSC 1ZGLA 4X4MA 4D9RD 4YIQB 3MCLL 1GSMA 2BNRE 2CKBL 2AJ3A 1P2CA 1DQML 1C8PA 1E4XH 2VXQL 4JZJB 5D93C 1AXIB 5JMRA 2X89A 3T0VA 5SWSD 3TJHD 1ETZA 1JFQH 4H8WH 2OX5A 4P4RA 4D3CL 3NFNB 5I1LB 2CH8A 2ADJA 4ZYKB 2W65B 1P4IL 4PG2C 1TFHA 1JZ2A 3ILQD 3FB7B 4RA0C 2LAGB 4HS6B 4M93C 3QPXL 4DVBB 1DLFH 2F53E 3IDJB 5D93B 2HT3D 4CVUA 2IQ9H 3EYUH 3GSQA 3EJYD 3W39A 1RZFH 5SX4I 1OT2A 4Y16A 5ICYA 4ONGH 2WUBL 5L8JB 4M93B 1NFDB 3D2UB 4WEMB 1A3RL 4OCXL 5J1AA 3BKMH 3WCYA 4DGIH 1KCRL 5E1AB 4J4PC 3RI5K 1JNNL 3MRKB 5KSBB 3S88H 3MRCA 1IGYB 1UEMA 4XVSH 5T3ZH 1CFBA 4L1DA 2XPGA 3AS3A 4WDIA 3U1SL 4DGVL 3FQRA 4DJMA 4TULL 2PCPB 5CEZL 3LQZA 1R5VB 2ADGB 2NW2A 5D1QD 3VD9A 1RULL 4Y5XA 2J2ZA 3CVIL 1FNAA 3D48R 4K3EL 4PJ9C 3BPNC 1QSEE 3TP4A 4LSTL 4P9MH 1JN6A 1P7HL 3AY4A 3DX8A 4DVRH 5FM5O 2CO7B 3H9SE 4F80A 1GVIA 1QRND 2DAVA 1KCVH 2AJVH 3BESR 3X13A 4PJ9B 5E94A 4JRYA 2DWDB 4E41D