1KB9K

Yeast cytochrome bc1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
107
structure length
107
Chain Sequence
DIELTQTPVSLAASLGDRVTISCRASQDINNFLNWYQQKPDGTIKLLIYYTSRLHAGVPSRFSGSGSGTDYSLTISNLEPEDIATYFCQHHIKFPWTFGAGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 17
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2001-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kb9K00
2BVUA 3FB6A 1WWCA 4LHUD 3AMLA 5L7XL 2OQJB 2APBA 2C5DC 4XP4H 4X7SL 3CK0H 3DSNA 3IF1A 5JA8B 3K81A 4LKXA 1QYGL 2BVQB 4OQTL 4YHOH 3SGDH 1S7TA 1MPAH 1WBYB 4FFWD 1EEYA 4P23D 4PB0H 3BGMB 5KS9A 4MQ7B 1Q9OB 4S1QH 5HY9B 2MPAH 4PJDB 3BP7A 2V7HB 5GISL 3PL6D 3AY4A 3V4PL 3WFBH 1KJ2B 4AL8L 4HUVA 3PHQB 3RWCB 3H7LA 3QQ3B 1AKJD 2RCSH 3BX7C 3E0GA 2NXYC 3V0VB 1DQLL 2X42A 5F1NA 2ZG1A 1FO0L 2XA3A 1JMZA 4JRYB 5BV7C 4JGJA 2VKXA 1NKOA 2F74A 3MRQA 5AZEH 4PRAA 3MJ8B 4TRPL 3SKMA 3TJHD 2Y5EA 2KZ1B 3T65A 5E2WL 4WTZA 1WQVT 2X89A 3BDYH 5DMJB 2Y36L 1T1ZA 1QBAA 4EI5B 2GITB 2CUIA 2HKHL 1TTGA 3LQAH 4OV5A 1G7HA 3L5WB 3I75A 1PKOA 1R3LB 2R56H 3QUZD 3T0DA 5FA4B 2J1KA 4XMLH 1YEGH 3QNZB 4LSQH 1FZKA 1YPZE 1NAML 3EOTH 5ACZA 3CFDB 4F8QA 5JQ6H 2VN4A 4YHPA 2ZSWB 4P2OA 1CDJA 4GAYB 3MRPA 4L3EE 2ARJA 1PYWB 2YPLD 2H8PA 2X4TB 3T2OA 1QR4A 3PP4H 1W0VB 2G5BA 4OAWA 4MB4A 2NMSA 1MIEL 4PYHA 4GG6B 4OQ1A 5D7LA 1JPFA 2ENYA 1TQBB 3P4OA 4JFDB 5HI4D 4LLMB 1HSBA 1G7IA 1T2XA 4NKOB 5B39G 1D5XB 1RU9H 3SO3C 3DX7A 3ULUC 1OPGH 4GRLA 4RMTA 1A7PH 3BWAB 2V2XA 3OF6A 3UTTA 5FB8B 4Z95H 3QFJA 2QQLL 2A83A 1T83A 2WZPD 2DBLL 2GT9A 3ZL4H 3AB0C 4KKBD 4LHUB 4OCWL 3OAUH 3HR6A 1GOFA 3DUSB 2DQFB 2ZKHL 1J9CT 5IB3B 5GS1C 1T5WB 4HPOL 4KKCC 1FORH 1RUPH 3VW3H 2EE6A 1L6XA 5E5MA 3VDAA 5ID0B 5IB4A 4W6XB 4Z0BL 3TNMA 4CADA 1FCGA 1ZK9A 3FTGB 3OXRB 4PV8B 2Z31D 4JO3L 1F58L 4QYOB 4AG4L 2JCCF 2BVEA 2G75B 4WEUD 3EGSA 3LD8C 4PJXB 3ROLB 1UEMA 2PW1B 3PL6B 2BNUA 1IT9L 4Y4KD 3VFSA 5BZDB 5KSBA 5ADPL 2W0LA 4HC1L 1AKJB 3DLQR 1I9IL 5AYUH 3TEUA 4FQLH 2BVPA 1MWAL 4JFYA 5ERWA 1Z9MA 5CLWA 3PV6B 5HGBB 3C09C 4O02H 5DQ9B 1FE8L 2JJTA 4OM0H 5DJ6B 5HPMB 4LFHD 4Z7WF 3DHMA 5T3ZE 1UYWH 5L0QC 2A2QT 1KJ2H 1CU4H 1G7PA 3U9PH 2X9WA 1NC4D 1RQ5A 1IM3B 5HD8D 8FABA 4NQDA 5DD3L 2AV1B 3T8XA 3PHOA 1VACB 5EBLB 4XMPL 2ZCLH 3BN9C 3PDGA 5IBUG 4JQXA 2XTLA 3L9RA 3SKJH 1KIPA 3L7EB 3QUZB 3K2UH 3LEYH 2HLFC 4OZIF 4ZUWB 1WC7A 4AZ8A 3E6HA 5GHWH 1GL4B 4Y1AD 3BE1H 2DI9A 3T4YB 3TFKC 4XCFL 2EICA 5BZWB 5C08D 1MUJB 2DI8A 1KTDB 2F54D 4LSSL 1A8JH 1JPSL 1VDGA 1KPVA 4OCXH 2QADD 5J1SC 3M17A 4I2XA 4XPTH 2YMXH 4QXGH 4P46C 3GFUA 4MNHA 2IALB 1MCCA 5T3XD 4MD4B 5DZNA 1CR9L 3EZ8A 5JUEH 1BF2A 4GW5A 5CIPH 3D0VB 5IESL 1HILB 1S9WB 5C86A 2DLTA 1LO3L 2YEZB 3OBAA 4NWUH 4KUCD 1VADB 4QHMB 3UTSD 4RFNC 2YZ1A 3UJTL 3C6LC 1NGWA 4UUJB 2DQJL 3C5ZD 2X4RB 1QBBA 1DQDL 2DWDA 3LQZB 4IRSD 4Z76A 3HPJB 4YK4C 4NQCD 4KJWD 3LKNA 5DHVA 4C54A 1JWMB 2HG5B 2R2EB 3QDJD 3HZKB 2V5TA 3QRGL 2X7LA 4GQ9L 1WCBB 4JFEB 4BSWB 4DCQA 4MWFB 4U1NB 1G7LA 1FZJA 1IKNA 3EFFA 1CQYA 2GTZA 1GZPB 2IANA 5TQ2H 2Y5TA 4TNWF 5L2JB 5GGRA 3PWLB 1GZQB 1IL1A 3WUWB 1FFQA 1NCCL 1IC4H 2X4NB 3EJZC 4X6FB 5E4IA 5HHMD 4PJDE 1HDMB 1RIUH 5CINL 2R0ZH 1MCNA 3GZKA 2WIIA 1VENA 2VZ3A 3OWEA 5ETUA 2JELH 5AAMA 3S7GA 1BJMA 1XF2A 1WISA 4ZO6A 1JL8A 4DZ8A 1A3LH 4WW2C 2CDFB 3IFLH 5AUMA 3RI5F 1YY9C 1DBBL 2Z91B 3GKZA 1ZLVH 1AGEB 5D9SA 4JRYE 3O6KL 4P2QB 4F7EB 5D2NC 5B38B 4AM0A 3M07A 4HFUH 3TBSB 3ARED 2KQMA 4ZYKB 1NEZB 4HX1A 5FV2A 1FNSL 5EUOB 4ODXA 5I8OL 1EX0A 3WCYA 4IRJC 1UM5H 5I1LB 3O6LH 3CC5B 4L4VA 3SN6N 3K7UA 4KGJA 4K7FA 2CIIB 3RY6C 3WDJA 1PAMA 5E2UH 1MJJB 1HHJB 1U3HC 1V3KA 1Q94B 1RUQL 4LOUD 1NFDF 4JY4B 3WO3B 4E5XA 1HXMA 3GMMB 4GRMB 4MJ2A 4CDGC 3GEWB 4HGWA 3X13B 5M94B 4LRNL 1QFUH 3FB8A 1YYLH 1N59A 1PZ5A 3HMXH 4NOFA 1YNLH 4G6KH 5D2LB 1FNGB 5E1AA 2H2PD 2XRAH 4ISVB 2IQAA 1LK3H 4JLRA 4N1HB 1JYNA 4XVSH 1JHLL 3O4LE 1EVTC 2RGSA 5I1CH 3SE3A 2ZZUT 3MLZL 3NCMA 5FKPB 4PY7B 4BZYA 5LWYH 2GSGB 4LSUH 4X6EA 3CSYA 4GG6E 4RAHA 1DUZA 3RA7L 1CDCA 3RBSA 3UTSB 4U1SB 1EHNA 2GEEA 3AY4C 3QIBC 2H1PL 2KZWA 5IHBA 5C0BD 1F2QA 1RJZA 4UIKH 5ALBH 4JQVA 4IRSB 3CPLB 3GB7A 4LCWA 5KSBF 4GBXA 1TQCC 1ZTXL 1KCSH 4ZXBD 1GXEA 2PO6C 3QDJB 1M6OA 3F6IA 4JDVA 4TQEL 5EZOL 1KENH 5T5NG 4IDJH 3DXAB 2AABH 5E8NA 1JWSA 3ULVD 3CCHA 1CDIA 1LEGB 1ZHKB 1JRHH 5EA0L 4G8IB 3WHE1 4LMQI 3IJHA 3PJSB 3QUXA 3CK0L 1I1YB 1C12A 2R1YB 1CGYA 5E94A 5CEXB 4NZRL 5F9JA 2AEQH 4L8DB 1AD0B 4MVBC 4OFIA 3BP5B 1UM4L 4DUXA 4PB0L 4GW4A 2HFEA 2ZUSA 1ZHBA 4JFFB 4S1QL 3WS6A 1KT2B 4PJXE 2EE3A 2EXWC 1UZ6E 3KDMB 4ODSL 1S5HB 1NFIB 4RWYL 1WBXA 1I1RA 2FGZA 2XKNB 3LV3B 4NZTH 1U3JA 1ED3B 2ICWI 4YHZH 1K4CB 3LKOB 3KYOB 4LF3B 3VFWB 1VFMA 4E41B 5IBLD 2VLKD 1KIRA 5C71A 4RSVA 3S34H 3CLFL 2C1PA 4HK0A 5JMOC 1BVZA 2PKDA 4OF8A 2IBGA 5HPOA 3R06B 3OTTA 5GGSA 5TF0A 3W9EB 4JDZA 3HNSH 3REWB 3QWRA 4YQXH 3SE8L 3IKCA 3FN3A 4RDQG 4C56B 1QA9B 5SV3A 3I84A 4K7PL 1T20A 5AZEL 1JF6A 3CNKA 1U93B 4XCYB 1A9BB 1J0KA 1JGLL 3I85A 3RJDA 1JYXA 2XWBB 3J7HA 4BH7A 4YDJA 5T3ZL 4U0RB 1RZ7H 1V3JA 1SJVA 1HZHH 2P8LA 3BUTA 4N0CC 3VFPA 1F4WH 4XBPA 5HHNB 1BFOA 1T83C 4UBDC 1BOYA 4F7PB 5DS8A 4OZHB 4HWEL 2XQYK 2R56L 3MXWH 5BVPH 5HYFA 1PD6A 4XMLL 4F15B 12E8H 2X4OA 1NUNB 5D6DC 1WVZA 1S7VA 4X4MA 32C2A 5JQ6L 5D72L 4WVRA 3F7PC 4IRZL 3K80A 3V0WL 4DFIA 1YMMA 2L7JA 1M05A 4X6DB 3RQ3A 3MJ7A 4NQEA 3SQOH 5TDNB 3FQUA 3B9EA 4H8WC 1D3CA 5DR5L 1QVOA 4F2MA 1S7RA 2NTSP 2CLVB 4UIMB 4JANB 2NY2C 4HAGA 5C0BB 1BREA 2NXYD 1AI1L 5T3XH 3OJMB 3WFZA 5DMIH 3O2WH 4N0YH 3TESA 5KSUB 4QRPE 4ZXBB 1OAYH 4LPTA 1UB6A 5DHYA 4Z95L 3SDDB 3MACH 3Q6GH 4MDIB 3EDDA 3ZL4L 4LLDB 2HFFA 2UVEA 1L4IA 5EG6C 2W9LA 2XG4A 4PP2B 4Z7VA 2PYFB 5J1AA 3FL7A 3KPLA 3IAGC 4X6CA 4U49A 5DRXB 1FORL 4ODHL 3D69A 1LVEA 3BDBA 3E8UL 3VD3A 4WW1B 4JFEE 2G2RB 2GCYA 3ZKND 1JE6A 1NBZB 1UJ3A 3FB5B 4OZGA 2E7BA 3IFNL 3T0EE 3PGCA 4WU5A 1QRKA 1YUHB 1GIGL 3VRIB 1CS6A 4NPYA 2H41A 3SPVA 2VJXA 4F7CA 1C7TA 5I74B 4KKLC 4ZFOA 3EDJA 3NMEA 1DJSA 2LV4A 4FQLL 3NCBB 1MI5E 3TIDA 1JZ2A 3NCCB 1OP3K 1AFVL 1MCPL 1A6TB 1OSZB 3WSQL 4HUKB 3O41A 4JRXE 4ACPA 1BD2E 1C5BL 1IKFH 1FZMB 1UYWL 4IIQA 4GKNA 3UPCA 1T5XB 2Q8AH 2XG5A 2FX8H 1FNEB 5TDPA 1ES0B 4BSVA 3WLWC 3O11A 3ULUD 2B2XL 4P2QE 3NCJH 3D0LB 1G7QA 1TZGL 1S8DA 4FZEL 3MNZA 4XVUD 5IB1A 2BY2A 1JPGA 1I7TB 4UILH 1X5LA 5TE4H 3SKJL 1DP0A 5E9DD 2VWEE 5EUOE 5C07A 1GOHA 5LCVH 4PJAB 3C9NB 1HYSC 5LGHH 3UBXA 2ITDA 5DMKB 2UYLB 3DBXB 4CN6A 1F00I 3BP4B 5DI8A 3NIFF 1BVLA 4I13B 4M7KL 3SDAA 4JM2F 1J8HA 3O8XC 1R0AH 5IMMB 3H42L 5JHLL 4BQBA 2ZOLB 2ICWA 2YMXL 4LCCC 4LCUB 1CVSC 5IROA 4B50A 5FXCH 5D2LE 1EZVX 4JDTH 2NY6C 1A6ZA 1VKXB 2R15A 2JF1A 3M8OH 4CDHA 1OD9A 2NXYB 1TENA 1EMTH 3G08B 4NHUA 3DYPA 4GAJH 4IS6A 1A6AB 5CD5C 1D5MA 3ZDZF 3UTSE 1H3GA 5C2BH 2FJFB 5GRXG 5BV7B 3MROB 1P1ZB 3HHRB 5IQ7H 3GSUB 2DD8H 4HS8H 4XNYL 5CEYA 5ITFA 4K3JL 1NC2A 1UQSA 4YNYB 4Z6AT 1F13A 3IYLW 3U2SA 3QDJE 4G6JL 3DXAE 1VSCA 4WGWB 3BN9D 3DUUB 3LKPB 3CU7A 3S5LB 1Y0LB 4ETYA 2HJFB 43C9A 3ULVH 2HLFD 2X1QA 4XNMB 2OR8A 2AAVA 4MLSA 4L8BA 3QO1B 4LRIC 3I02B 3KR3H 3Q2CA 1GC1H 4XB7A 3IDIA 4JFFE 3RIFK 3RVWC 3QJFB 2ZSVB 1K6QL 3L3OA 3GRWH 1RIUL 1CICD 1J18A 4Y4FC 3PABB 1HNGA 2R0ZL 1KCUH 4DQOL 1M71A 4TYUA 2D4FA 5C0CB 4J1UA 3VDBA 4P46D 3EOYG 5FHAL 3RNQA 3UXFA 2D2OA 4E41E 4U6VH 3ULSB 2I5YL 3SO3B 3CFEB 4OTXL 3RL2A 2VXVL 5F9DC 1KG0B 3JWDL 4C56E 3L5XL 4NO5B 3GBLA 3AB0B 3MRNA 3MBEC 1XGYH 4EKXA 4RGND 5DT1L 2FIRT 3OGOE 4JZNA 5EU7E 5C0GB 5GS1B 2GSIB 2OM5A 1DR9A 4DN4H 1IQDB 3D9AH 1OTTC 4H20L 2P5WB 3VWKA 5EZLB 4OZHE 4FQQA 5DSCA 1MFAL 2D31A 4PG2C 5E6IC 4MJIA 1W72B 3LD8B 1U58A 4L8SA 4YJZL 1HH6A 3QEGL 2A6IB 1U8IB 2OLDA 4U6YA 4P3CH 1QFUL 2X70B 2R4SH 4GAFB 3KYKL 4OF3A 3TCLB 2GTWA 3HMXL 3UTQB 1CIDA 4L4TA 5C09A 3EJZD 3TBTB 4JFZL 3GSRA 1XGQB 2BHUA 4X6DE 4YXKH 1V7MH 3U30C 1LEKB 4HLZH 1IC7H 4ONGH 2YWYA 3GBNH 1YEHL 3HZYA 3CDGB 3WS6C 3C09B 2CK0H 1GJIA 1DZBA 4OZGF 4LSUL 4OM1H 4ZOAA 4MHHI 1OW0A 1RIVH 2IADA 4EI6B 5L0QB 4NKQB 1MRCH 1OGAE 1QUNA 3DO3A 1DSFL 1YY9D 3ARYA 1EH9A 1KEGL 2BDNH 3ULVE 1ETZB 1A14H 4WO4A 1KENL 3VWJC 5D5MF 2AABL 3GMQA 3WUZA 5AG9A 4XRCB 3D39A 1TIUA 3MODH 4UQ3B 1JNNL 1JRHL 3TF7C 5BV7H 4FQIL 3W9DB 3GMNA 3V6FA 4NNPL 3QXDB 5MI0C 4MAUH 3ZHDA 1HINH 1XH3A 4JY6B 3ZSTA 3T3PF 3MZGB 1E6JH 2VKWA 4IRJD 2AEQL 1Q1JH 3T1FB 1JPTL 3IDGB 1F11B 1P6FA 5MERB 3BI9X 1BZ7A 5I30L 1U3HD 3EYOA 2VQ1A 3P4LA 4NRXB 3MLTA 5TDOB 4ZO8A 3TVMA 1OGTA 1A4JB 2VLMD 3DX9A 1CBVL 5IIEB 1OAZH 2GFBA 3DI3B 2EIZB 3A6CL 4LLVA 4NZTL 4GSDH 4I4WB 2VLRB 3L95B 5KG9B 4WUKL 4I18A 5KANG 2OTUB 4FXGB 4CAGA 1DEDA 2P8PB 1KN4H 1D6EA 5HHPA 4PGCA 1HQ4B 4OGYH 2APXA 2FECI 2E5EA 1JNJA 1HKLH 5MEQB 2GKIA 3SGEI 1DUYA 2BXYA 5AG8A 2YBRA 4FS0A 4U6TA 2PYED 4L1HA 4RFNB 5IF0A 4X5LA 3C6LB 3QIBD 4NSKA 4YHLL 3O2DH 2W0KA 4NOBA 3O45A 5F6IC 5LXGH 4YK4B 3LCYA 3KYMA 2P46B 2PO6D 1HZHL 1LP9A 4X4ZA 4X8JA 5FUZL 3WBDA 3ULUH 4OLWH 1T1WA 4OZFB 5J89A 4EUPA 1QSZA 1MCQA 2Z4QA 4KXZH 5T1KA 1FL3A 3DYMA 1I4FA 3MXWL 3X17A 2IPUK 2BSTB 4RAVA 2VXTH 2R2BB 1HEZA 3X14B 4C83B 2R39A 4AQ1B 4L9DA 1ZS8B 3HE6A 4KI1A 5EFIA 3EFDH 4ZFZB 3H6JA 4MVBD 4HMEA 3FQXA 3LPWA 2X89D 2YWZA 2DTMH 4U6XA 5E2TH 1S7QA 4HS6A 3VFVA 3MRLA 3LS4L 1UJ3C 1DFBH 4M1DH 5FA3A 2EXWD 4XP5H 3X3FH 1FV1A 2IG2L 1VFBA 4NKMA 4OGAC 1W72H 1OB1B 3G9AB 1IE5A 2OS7A 1MQ8A 3IDUA 5DGRA 1OAXH 4DK3A 4WW2B 5F3BA 3D5OF 3GSOA 4BM7A 1FJ1B 3CUPB 3O2WL 5E8DH 4JKKA 3IJYA 1LHZA 25C8L 3P4NB 3U79A 3MACL 1BEYH 2FJHA 3WFHA 5D2NB 5DQDL 3VA6A 1VESA 4NCDA 3QRFM 3PQYA 1OCWL 1BFVH 5DURB 4IRJB 4LEOA 4PJ9A 5DJDB 3L1OL 3PNWA 4NQSB 1JZ8A 1JWUB 4NWTH 5DD1H 1CXLA 3LKSB 4UBDD 3FB6B 1WFOA 1CGSH 2OTWA 4Z0XA 5E99L 3RY4A 3V4VL 5HYQA 1VFAB 2LQRA 2D4DA 5GQBA 1ZLSL 3IF1B 1IBGH 5AAWA 4LKXB 3OKKA 2UWEB 4FNLL 4BFEA 3FFDB 4FG6D 1S7TB 5GGVL 1MQKH 1EEYB 1FPTH 5C0CE 2B39A 5KS9B 1BMGA 4MXWL 2FHBA 4FQCL 3HNVL 3BP7B 3HC0A 4OBRA 2PYEB 1NCTA 4OCYH 4LLUA 3DV6B 4Y8DC 2Z8WC 4LSPH 3QIBB 2NY2D 5GRVL 3ARQA 3IXTB 4JHWL 2FX8L 3O3DA 4I5BA 1YEDA 1AXIB 5F1NB 4IOSD 1TQCB 3NCJL 2HWZH 2PO6B 5IV2B 4GMSL 3V5KA 2IPTL 4KRPC 3V6ZA 3KPSE 1YN6A 2ZPKH 1MCJA 4M1GH 1D5IL 2HMIC 2WWMC 1DEEB 3UC0H 4NM8H 4ZFGH 3MRQB 4HH9B 5C3TA 3PWUA 4PRAB 2FB4H 2P5WE 2JB6A 5JLZB 3GM8A 4LQ1A 1QHPA 2BZDA 2DMCA 5I1IH 4X8XA 3RZCC 1T1ZB 4Y16C 4HWBL 4NBYB 3TBWB 2BSSA 4YC2C 3EO0A 4OZFH 1FVCA 5T5FL 2JIXA 4LAQL 4OV5B 1G7HB 4O4YL 1AXTL 3I75B 2FYYA 1NCBH 2GIYA 1RY7B 2DQIH 5DZLA 3TT3H 3QDMD 4KKLD 3V5DA 4JDTL 1TDQA 3WMSA 5HDQL 1PDKA 4XAKE 5FGCB 2BY0A 2ADJA 4YHPB 1EMTL 4HSQA 5DVOA 3QWQB 5E5RB 2ARJB 1WZ1L 3U1SH 2H8PB 4WFED 4LARH 4BFBD 1D9KA 1F6AA 3E3QE 2K7QA 5DXWA 3PP3H 2G5BB 4OLXH 2MCG1 5IQ7L 2Z0BA 1HI6A 2ADFL 1NUDA 5F9WC 2FO4A 1ZLWH 4QRRD 4KTDL 3WIIH 2DQHH 4KMLB 1CTNA 4KY1L 4LSTL 4FFVC 5D7LB 5EWIH 1BLNA 3EJYC 5ACMA 1HSBB 4V1DD 3NFNA 1G7IB 4QNPF 3WLWD 5I8KH 4EN3A 3LKRA 2BK8A 1MAML 5GIRA 4S2SB 2AK1H 5TF1L 3IDMA 2P5EA 4WUUA 1IGIL 3G6DL 1ZAGA 2GT9B 3WXVH 1S7SB 2FEEL 4XNUH 1BWWA 5KTEL 4NCC1 2FX9L 1HYSD 1G0YR 1CD1A 5A3IC 3ZT6A 4PY8J 3U6RA 1M7DA 2XZCL 1J8KA 1LO5B 4QHNA 3GRWL 1W8OA 2OMNA 3VWKC 4PBWD 3O8XD 3TNMB 3GMPA 4NQVA 4OCSH 1XF3A 3NABL 2AKRA 1LP9F 3WJJC 1GAFL 1KC5L 1R6VA 4BJLA 2P45B 1EO5A 2IAND 3RWGA 3RVVC 3EGSB 2VLRE 1EJOH 1O7SA 4XVTH 3RY5A 2NY2B 4K94C 2R2HA 1Q72H 2C4FT 1T0NB 2DL2A 1MJ8H 5JPNA 1A7QH 4YDKH 5E0QA 2R8SL 2FX7H 5C0RL 1B0RA 4JFYB 1ZA3A 5KOVC 4JVUA 4S0SD 4J3UA 3OZ9L 1S9XA 3OR6B 1XF1A 1BIHA 2XN9D 1F90H 1JZ4A 1ZKAA 5J13C 1YEEH 3AAZA 1G7MA 4XWGH 4BQ8A 5GRVK 4LLQB 5T1DH 4DUVA 4PLNC 1D6VH 5HYJA 1OAUH 3G6AA 4GW1B 2K1MA 3N9GH 4UTAL 3ECBB 2F15A 4IMLB 3Q6FA 3OKEA 4QY8A 3OXSA 3JV6A 5J9PA 1WC7B 2IGFH 3NZ8A 4M43L 3Q48A 3C5JB 3F5WA 3CH1A 5K9JH 3RVWD 1FIGH 4ZSOE 5LAXA 3A6BH 4Y4FD 4WI2A 4Z7WE 2WBJC 4ONOA 4P0DA 3TZVA 1ORSA 1A1MA 1KPVB 3TVMC 2BHZA 1UVQA 3M17B 1J0IA 4K23L 4ZUVA 4MNHB 1YQ2A 2NY7L 1JGUH 3HAEB 5JOFA 5F7UA 4Z78B 1JHTA 1H8OA 4PGDA 2NY4B 4DJMA 1S7XA 4XVJH 1MIMH 2VDRH 5D2NE 5J11C 5MEPA 2HH0L 2CKBA 3U7YL 4E42A 3MODL 2P43B 1KN2H 5CJOH 2NCMA 3MBED 1F3JB 3ROOA 4KUZH 4PRBB 1MCKA 4PGBA 1ZGLP 4Y8AA 2BY1A 5FYKE 4XXDA 1OTTD 3L3GA 3WO4C 3LKNB 1DN0A 4AY0A 5D1ZC 5DO2C 2MOVA 1G1YA 5JW3H 4NDMB 3I6GA 4YEEA 2X7LB 3VI4F 3CFBB 3OR7A 1L9NA 4TULL 2VLME 3ARDC 5E6ID 3AC0A 3EFFB 2MWCA 1K3ZA 2GTZB 3ARWA 3HRZA 4LCCB 5F93C 2IANB 1J5OH 1J0JA 1ZHNA 2UWEE 3DX6A 2YXFA 2YD9A 4ZUUA 3ARGA 2NY6B 3MUGA 4XHJC 5FV1L 5GGRB 3HE6C 2EO1A 2YZ8A 4JJHA 3DURA 1FC2D 4G3YL 3CMOH 3QCTL 5KS9E 3QPQC 5DQJA 1REIA 1WWAX 1ZVSB 4TSBL 4JPWH 1E4XH 3O0RL 2XY1A 3SCMD 4YPGA 3ARSA 2WIIB 4XPHH 4X5WA 1S9KC 2XN9B 2E6QA 4H8WH 4P9HC 3O2DL 4ZUTA 1XF2B 1FLRL 3MLUH 3ARRA 1A1NA 4DZ8B 3MFFB 1BM3H 1BVKB 1S5IH 1II4E 5D1XA 3VWJD 1RIHH 3DRQA 2WWKO 2CDEB 3THML 4FTVD 2AK4D 4M61B 4HX1B 3DX8A 3FN9A 4NFCA 2DLHA 2V5SA 3D2UD 4OLUL 4P4RA 2Z8SA 3WUWG 4ODXB 3O4OB 2HVJB 5LGKA 2C4FU 3QB7C 1SM3L 5TH2A 3V0AC 5D7SL 3PDOB 2ED7A 1ZT7A 4G43A 1DFBL 3LN9A 4Y4FB 4M1DL 4TTGA 2YN3A 2X1WL 4XP5L 1YNTA 2XKSA 2K7PA 3OAYH 1NBVL 2YD8A 3QAZC 3N85L 4N0RA 1IGCH 4S1RL 4E5XB 4X7TB 1HXMB 1QACA 2XXMB 3FOMA 4IEFB 5FHBH 4HGWB 5FGCE 1VGEH 4PJBA 5F7DA 1CFTB 3FB8B 4R90H 3BRFA 1N59B 3O3BB 5C7XH 4G7VH 4AMKH 1S78C 4XC3L 2DS4A 4JLRB 5E8DL 5C0JA 5EC1A 2V17H 4NQED 1DBML 2VLJA 5B38G 3CSYB 4Q2ZA 4NUGL 5D7LE 2I9LA 1DUZB 3MBEB 4NNXB 4FOMA 1A4KA 5CEZD 2WMPA 5I71C 1KACB 2R4RH 5HYIA 3ZTJG 3T0BA 4PJGA 1U92A 3HAEH 1GGUA 1MCOH 4M5YH 4DTGH 3MRKA 4RFOH 4LCWB 3VG9B 2AGJH 1JF5A 3MFGB 3UTTE 1FZOA 1X5IA 3UP1A 4KHTH 1M6OB 4QOKD 5D8JH 5E8NB 1JWSB 1DQJA 8CGTA 3WKMH 3DETC 3OKLA 5E6IB 3ZE0F 5DJAA 1N6QH 3IJHB 4RA0C 3QUMB 4J23A 5E94B 1C12B 5IW6B 2D0GA 1X5JA 1VEMA 5F9JB 1HXYA 4R8WL 1TETL 4ODUB 1RJCA 4OB5H 4WENB 4GW4B 3MJ9L 1FIEA 3IB4A 2HFEB 3LMJH 4WU7A 2NXZC 35C8L 3RWHA 1P7QD 2DDQH 4FQJL 5JW4M 4OGAD 5A2JH 2J8UB 3LEXB 4OI7A 5T5NF 1YEKH 4RMWA 2YPVL 2DQUH 4AIXA 5EZIL 1WBXB 3WIFA 4LCIL 4MYWB 4ONFH 1U8QA 5I1GH 2VQTA 4WFHD 2E27H 1KIRB 4NBZB 2C1PB 2HWZL 3OGCA 1LO0H 2AJZB 4HKZA 4I77H 5KANI 3C5SB 4HS3B 3VWJB 1KJ3H 3QXTA 3TPKA 1KJVA 5CILH 5GGSB 1D9KC 4JG0H 5I8CA 4KVCH 3TV3L 3JTSA 3HC4L 5J6GA 4FTVB 5DDHA 1SMAA 2NY5L 3DTXA 5MI0B 5ICYA 3EYFA 3D2UB 4RGOH 3HI6H 1N7MH 1T4KA 2A9NL 4BH7B 3BYYA 3FHAA 2DJUA 3SGDI 3VI3F 3SOBL 2GJZA 3MLWH 4U1IA 5JXAH 2P8LB 2QSCH 4RGMB 4WJ5A 4NCC2 2ZJSL 1BFOB 2MTPA 2AXFB 1OD7A 1NCDH 4X7DC 3D85A 1KB5H 3BHBA 5GSRA 3MYZA 3CVIL 3MGTB 4ZMAT 5EN2A 4DKFL 5HHOD 2X4OB 3SBWC 1WIUA 2AQ3A 4JPVL 1XIWA 3QULA 3KLHC 2BVOA 3TNNA 2ADGA 4IOIA 1P4LA 4UTBH 2YD6A 4FXKB 3VXTB 4WFEE 1MNUL 1YMMB 3FB7A 2YUWA 3WIHL 1ORQA 4I2XE 4AEIH 4NQEB 4OLXL 3FQUB 5EOQH 1CT8B 4HAFA 4FQXD 1K9TA 4GOSA 5JR1H 4R26H 5F70A 3QQ9C 1S7RB 2DQHL 3GSVA 5E2VH 1JI1A 2OZ4L 5F6IB 2I9TB 2W0PA 2CRMA 2WQRA 2FSEA 3F7YA 3DROA 3VG0H 4KRPD 1UB6B 3MQIA 3WS3A 2OP4H 2MSPA 3NIDE 3QBTB 2HMID 4XC1H 2WWMD 5KVEL 2ZNWA 2D3VA 3MJGX 4Y4HC 2YK1H 3MV01 5KSAA 4Z7VB 2HKFH 3SE4A 5I1EL 4G8GD 4PGJA 3KPLB 2FRGP 4F3FA 2UZXB 4X6CB 1CGTA 3OKYA 4NRYA 2DKUA 3D69B 1ZVYA 4QXTA 4GUPB 3RZCD 5TQ0L 4Y16D 4X5XA 4U0QB 2GCYB 1P4BH 1UJ3B 4OZGB 4KZEL 3O6FD 5FYKL 1BFSA 1IFHH 4UDUA 4ZO9A 2IANE 4XXCA 2O5XH 3PGCB 4WU5B 1WT5A 2VIRB 4FFYH 4D8PA 3SPVB 2BVYA 4R96A 4F7CB 3AVEA 4CJ0A 4NP4L 3QUMH 3ZTNL 4M1CC 4KJPC 3B5TA 4RRPA 1KUMA 2FWOB 4KTYA 5SWSD 4ZFOB 5IBTH 2GW5A 4F58L 5CBAA 4X0KA 2DJ4A 2FX7L 4OLYL 4J2XA 3MOBH 4KK6C 1NKRA 4XWOC 3EJJX 1A2YA 3TIDB 3TJEH 1U8KA 2BJMH 2XN9E 3TZVC 2VL5B 1AIFB 4MA1B 5JQHC 2J4WH 1IAIM 2W59A 3O41B 1RK1B 3EJYD 3KPRD 5HHVL 4XWGL 4GKNB 4I3SH 3QWOA 4G80B 1NGZA 1SEBA 5T1DL 4PJBF 3N1GC 4Y2DA 3Q3GA 5ESQA 3QG6B 2LVEA 1D6VL 2GAZA 2DI7A 5I66B 2VITA 2EKJA 1I3VA 3TA3C 3PWVA 4F9LC 3C8KA 5DWUL 3P4MB 4IBLT 5IB1B 2A9MH 4ZNCD 3DVGA 5C07B 5J6HA 1JTPA 5A3ID 4TOYL 3BEWB 5HHOB 1MRDL 4BZ1H 3UBXB 2FH6A 5JDJA 1RK0A 4M8QA 4KDVA 3QEQD 4PJGF 2DQCH 3VWKD 5DI8B 3ZO0A 2EDOA 1A6PA 5D7KD 4RISH 1FCCA 4K3DL 5EO1B 2Q8BH 2CSPA 1UZ8B 3RVVD 2P49B 1WAAA 1A7RH 4PV9A 3ZT5A 2VN7A 3NZHH 1EGJA 7CGTA 4YZFF 1INEH 1QNZL 2VDLL 3U36B 1EERB 1A6ZB 2QHRL 1G7JA 1DBJH 2W1NA 2A0LC 2J8OA 3B4NA 4NT6A 3RVXC 4FQ2H 1G6RB 4NHUB 2HT4D 2VXUL 4IS6B 1AGDB 3MCKA 3FO2A 1D5MB 4KI5C 4WEMB 2VB5A 3QHFL 3PP3K 4F80A 5CJOL 4PJEA 4K07A 1I8IA 3MOAH 4JFHD 5DUPL 5H37G 1NGPL 4PB9H 3J8F7 5CEYB 2B1AL 4KUZL 1NC2B 1UQSB 4LKCA 2RB8A 5FOBA 5CEZH 4LCWE 4G8GB 3RGVA 2VH5L 3U2SB 5TGBA 4L8CA 1FDLL 3RZCB 4OI8A 1SY6A 2QHLA 4Y16B 5EIIB 3E1F1 3F58H 4XHQA 4KHXL 3QQ4B 4YC2B 4DGIH 2YA1A 1J5OL 5I1JH 1C5CH 4F9PA 3S3PA 5FYLH 5HJ3A 2VDQH 5INDB 4K3HA 4EVNA 3L3IB 1L0YA 3NIGE 3UAJC 5TE6H 3VFUB 1T0MA 3IDIB 1BPVA 2XWJA 4PJ7A 4OIIH 4HUXA 2WBJD 4G9DA 5DJ2B 1YEIL 2EO9A 4JPWL 1T21A 3HN3A 5JXEA 5D4QA 5FUCE 4XPHL 5DD6A 3VH8A 1B6UA 4H0GA 5EU3A 1NDMA 3EO1A 2O5ZL 5F9WB 3FJTA 5HYSA 1L7TL 1RZFL 2VYRE 1KLUA 2ESVD 1AH1A 1H5BA 1EHLL 3SHSA 1KV3A 4OT1L 1Q0XH 4MNGA 3VE0A 1JHKH 2X9XA 1U36A 3S5LG 4FTVE 2HJKA 2Q20A 4Z7QE 2FLRT 3B2VL 3GI9H 1EAPA 1FVDB 3BT2L 2LAGB 2A1WH 4JFPA 2EH8H 3DVFA 2HTLC 2ZCKH 4OJFL 4JZNB 3TP4A 3QZWG 3OQ3B 3VFNA 2KL6A 3U0WH 3NA9H 1NGXA 5D1ZD 5DO2D 3KXFD 3VWKB 2OX5A 2EYTB 1AO7D 3EZJB 1FG2A 2JJSC 3ARDD 3P2TA 1RAMA 3QEHA 1DN2A 3WDHA 4K9EC 2DM2A 2D31B 5DJ0B 4MJIB 3OKDA 4TNWK 1MHHA 2W60A 4XHJD 4PLOB 4X4ME 4U6YB 5HVWA 3SKNA 1NCAH 5DJZA 5DJYA 4X4XA 3VD7A 2GTWB 1YMME 5T1LA 4AMKL 5C09B 1U8HB 1ADQA 3GSRB 3CVHA 1CDGA 4NQEE 2V5MA 5A16A 3GGWA 5IQ9B 3EYSH 2IQ9H 5DK2A 5CEZE 1AE6L 2DQEL 4I3GA 5C0AD 5J13B 3WFCL 2ZUUA 1CZ8H 4FABL 4Y5XA 1CG9A 1R3JA 4PTUB 3WLBB 1QP1A 3VFGL 4YHYC 1G6RH 1FBIH 5D8JL 4XH2A 4ZAKC 1MH5A 5FYLE 3WKML 4M4PA 2H45A 3D39B 1G1CA 4OF5A 4JCMA 4U3HA 1C5DA 4Z7VE 1NUGA 1P53A 3C87A 1EHAA 1O7VA 3GMNB 4EBQL 1CFSA 3WHXB 4X6CE 4AT6B 1XH3B 1QSFA 3ZYZA 2BVQA 1JGDA 3A67L 3GNML 3IKKA 3AU1B 3D48R 2Q7NA 4OZGE 1ACYH 1WBYA 1OT1A 1SEQH 4OB5L 1VB9A 3HTLX 1YN7A 1JV5A 1N2RB 3I2CH 2WBJB 3LMJL 4M3KB 4MQ7A 1Q9OA 4PJDA 4KROC 2DQDL 4JPIA 1T1YA 3N1FC 3TVMB 4WNQB 5LVEA 3DX9B 4U2YA 3HG1A 4LLVB 1KJ2A 5IB5B 3QQ3A 4GKSB 4I18B 4YBQC 1XIWC 1D6EB 4ONFL 1RULH 5HHPB 2ESVB 4U3XA 4GH7B 4ETQA 4PGCB 1YPZF 1CQKA 3MC0A 4HXBL 2ILLA 4TVPE 3WE6A 2YBRB 4JRYA 1X7QB 4YHML 3UPAA 1VCAA 3LKQA 4NSKB 4LLYA 1JRHI 4JM2C 5E24E 2PXYA 3MJ8A 2XNAB 1H15A 5LG1A 3BGFC 3O45B 1N7ML 1EBAA 2ITCA 5KVFH 1NMAH 2HA1A 5D1ZB 4LMQE 2AJXH 3KXFB 3MLWL 4X8JB 4EUPB 1AO7B 2Q3ZA 3ARDB 4YDIL 1NCDL 1X5XA 5C07E 2VZVA 5T1KB 4CUCA 2IEPA 3MLVL 1R3LA 4RAVB 5HHOE 3OX8B 1Z6JT 4JHAH 5KSAC 1WLHA 5K59F 2D03H 2VXQH 3HE6B 5L2KA 5EFIB 3CFDA 4IDLA 4Z7UA 3SE4C 4CNIA 1YEJL 5GRJL 3VMPA 5MHSD 3FQXB 5CIPA 2ZSWA 4HLJA 5B3NA 1AGBA 4R6UA 1YEFH 1KXVC 4GAYA 3DMMA 3KJ4B 1A3RL 2NXZD 3P0VH 3TT1H 3VFVB 3MRLB 1EO8L 1L6ZA 1ODAA 5FA3B 5MEND 1NJ9A 1FV1B 3FO0L 5EOQL 1LE9B 5IP4A 5IR1B 3BUYA 2Q1EA 3FFCD 5A1AA 1RZKC 4M6OH 4GG6A 3LAFA 4HIXH 4H0IA 1QLRB 4JFDA 4HUWB 2V6HA 4ZQKA 4NKOA 1GRWA 3TH4T 3MLRL 1D5XA 3VJ6A 4JCLA 3EYUH 3ZT7A 5GS0C 2YS4A 1LWRA 3IJYB 1KCRH 3G5YB 1VPOL 2UVFA 3OV6A 5FB8A 1D9KD 1AQKH 4PRNA 5FGBC 4XC1L 3QPXH 5KZCD 1E4KA 4LHUA 4JJ5A 5IFHH 4DVBA 1JBJA 4G6MH 5DK0B 1ZV5A 3PQYB 2DYPD 3DUSA 2DQFA 5CUSH 1J87A 1FLTX 3QT2A 3PNWB 3VU2A 1JYVA 5FCUH 4P23A 3HZMA 1PSKL 1AQDA 3FTGA 4WI8A 5CP3H 4UDTB 4QYOA 3QAZB 2VDKL 1AGCA 3B6SB 4FRWA 3LN4A 3CDYA 4A2LA 1F8TH 3PL6A 2X40A 1MY5A 2D9QB 3JV0A 5BZDA 3MRMA 4ZTOL 1AKJA 1BECA 5IBTL 1MCBA 1DBAL 5LJYH 1FFOA 4N8CH 4D0DB 3TWCL 4JO2H 1Q9LB 4M6NL 3PV6A 3WN5C 3HC0B 3IRZA 2EH7L 5HPMA 3PDDA 5I71B 3BKJL 4P5KB 3ORJA 1TJIL 3NACL 2MHAA 1I8LA 4Z7NE 5DJCA 4PP1C 4RMRA 5HGDA 1K5NA 1IM3A 2AV1A 1WTGT 3FCTA 3MV7A 3V5KB 1OARH 2OL3L 1YN6B 3ZE1E 3R0NA 3S35L 1A6UH 3NVQA 1EPFA 4Y4HD 2G60L 5B4MC 4N8PA 4NO0D 2FH8A 3L7EA 3QUZA 5F89B 4XGZB 3L6FA 5J4MA 1T80A 3E6FA 3UJJL 4BZ1L 3RGVC 3NPSC 1BBDL 4D94A 4URTB 3LIZH 5D7KE 3RIFF 5DA0B 1MUJA 4FFZL 3JBG7 4QHUB 2NXZB 2YPLA 4MJIE 2YA2A 2BSSB 4W68A 1MHPL 3EO0B 1FVCB 4PJHA 4EUPH 2VZ1A 5FYJD 1A7RL 1B4JH 2VDPL 3ZKQD 3CSBA 5AWNL 2Y06H 4F9PC 3FFCB 1INEL 4M1CD 4KJPD 3V5DB 5C09E 4MD4A 1QZ1A 2IFGA 3K4AA 1J12A 2ADJB 3TO4C 3TBVA 4KK6D 4XWOD 1ZANL 2CLZA 3MLYH 2Y7QA 1INQA 3BRGC 4NJ9L 1D9KB 4JFHE 1L7IL 1VADA 1QBLH 4QHMA 1Z9SA 4PJDF 1HI6B 3MA7A 3QJHA 5KZCB 1K8IB 5FO7B 4UUJA 3P0YL 4P9HH 5CEZL 3KLAA 2X4RA 2DYPB 1DBKH 3LQZA 4NGHL 4WTZG 1UXSA 5D70L 1H5BC 3LKRB 2RHEA 1JWMA 2R2EA 3TA3D 3HZKA 3D39E 1WCBA 1MCLA 3H3PL 1NGQH 3T09A 2Z31A 1CD0A 5L8LB 4WV1C 4QWWD 2R0KL 3ARVA 3FAWA 1YYMH 5D71H 5FYLL 3T4AB 1RUKH 1KIUA 4NJAH 4EDXB 1GGBL 3B3IB 4Y4KA 5EC2B 3NH7L 3U46B 3PWLA 1M7DB 1LO2L 5EORH 3O2VH 4QHNB 4X6FA 3LRSA 1OWRM 3GMPB 4NQVB 1HE7A 1XF3B 2AKRB 4DKEH 1I7UB 4UB0H 3T2PA 4LGRB 3RWGB 1I9RH 2R0WL 5CJXA 3JZ7A 2IMNA 3CFCH 3SDXB 3W5MA 5FDWA 4GXVH 4XNZC 4QRQB 2ESVE 2FDBP 5DUBA 2VTFA 2VXSL 2CDFA 3RVXD 5JPNB 1EUTA 4ALAH 4ZFOL 1NC4A 5I19H 2Z91A 2F9BT 1AGEA 1B0RB 5IM7B 1ZA3B 4C55A 1NL0L 3UYRL 4KI5D 4OD2B 1O0VA 5DFWH 2OR7A 4DW2H 1JFQL 2CUMA 1XF4A 4NO0B 3TBSA 4ZYKA 2ZG3A 4TVPL 1ONQA 2EH8L 2O61B 2WAHA 4F7TA 3AAZB 4CBPA 1CFNB 4LGSB 4PS4L 4GG6F 4HT1H 2JJVA 4Y1AA 3U0WL 3F7VA 1FGNL 3FQWB 4QO1A 1JF1A 1LO4L 4R4FH 5HYJB 5C08A 2CIIA 1CGWA 4LQFH 2UZYB 5KAQF 2F54A 3G6AB 1MFDH 3CD4A 4GRMA 3P30L 4DAGL 3JV6B 5J9PB 1P84K 3BDXA 4UV4H 2VQUA 2VZTA 3GIZH 3NZ8B 3UAJD 4M7JL 1T89A 1EFQA 3F5WB 2J8HA 5L88L 2CQVA 5LAXB 4G7YH 2OJZL 5K9OA 3TZVB 1ORSB 2CMRH 1IGJB 2IF7A 1MFCH 1LDPH 3MLSL 4PY7A 4HV8A 5SX4I 3G6JA 2XICA 3UTSA 4U1SA 1U95B 1Y18B 4ZUVB 3UZQA 3RWIA 4KRLB 1NGYA 4PJXF 4KKAC 3C5ZA 3C2SA 1LGVA 4IRSA 5IVZA 5FKAB 1JHTB 2BY3A 4PGDB 2DB8A 4NQCA 3NAAH 1S7XB 3TA3B 3QDJA 3QXUA 4JO4L 4DVRL 1FN4B 3H0TA 2J88L 2QBWA 4E42B 1A6VL 3NFSH 4G8IA 3V79C 3PQYE 4HUUA 2HTLD 3ROOB 3TYGH 1LEIA 4M02A 3MRDB 4PGBB 5CEXA 1N64L 2PXYC 4K71C 5J1TC 4KVNH 3RU8L 4XXDB 3L3GB 2OK0H 3CAFA 2D7NA 3GJFH 3I6GB 1DQML 3OR7B 1KT2A 1SYSB 3BKML 2GJ6D 3KDMA 1DL7H 1H8SA 4NC1C 1ZHNB 3GO1H 3DX6B 1NFIA 2XKNA 1ED3A 3MUGB 2B8OT 1R3IL 3RWDA 1TXKA 3W39A 3DURB 3KYOA 3OKMA 3VFWA 5DQJB 2I24N 4M5ZH 4U1MB 5JNYB 3DMMC 5DTFA 3U9UB 4H26B 1RURL 3W9EA 4NN6C 4AEEA 4X5WB 3MPCA 4PJHF 1QA9A 4BELD 3AREA 1KXTB 4F8TA 1U93A 5F1OB 3VI4E 4WI4A 2NR6C 5INCA 1ZSDB 4XZUA 2AJXL 3QFDA 4RX4D 4UINH 4ZAKD 1FYTD 1D7FA 5HHNA 3DRQB 3GHBL 4F7PA 2IH1B 1FNFA 2RJMA 4JR9L 4DOHB 1E4KC 1URLA 3V95A 4JHAL 3FQTB 3ILQC 5AEAA 2VXQL 1S9YA 4XAWH 5MHSE 3RPKA 4KPHL 3MRGB 1IGMH 5TH2B 4JKPL 1ZT7B 4MSWA 4FFWC 4F37K 4P23C 4G43B 1EJ6A 4KROD 5EOCL 4F33A 1J1PL 1YNTB 3GK8L 3FFCE 4PJFB 3U7WH 2O93L 4YXLH 4Q9RH 5FYJH 4C57C 5E8OA 2CLVA 5GGQH 1FH5H 1L9MA 3BJLA 4YBLC 4YBQD 5GJSH 2WBWB 4JANA 1AR2A 1ZMYA 5C0BA 3HPLA 5DD0L 4K94L 5JIIA 4XP9H 3KS0H 3SDCC 5KOMC 1I1CA 3PWNB 3U7AA 5K9QG 2CGRL 3BAEH 4GKOA 4ZXBA 5J0BA 3D6GA 1IAIL 1BQHB 2ORBL 4MDIA 2VLJB 4PY8I 5KVGH 4Q2ZB 2W9EH 3QPXL 5C6TH 1U3ZA 4KXZI 4JM2D 4LPCA 4G6ML 4MDJB 5DUML 1CLZL 4KQ4H 5CUSL 1U92B 3IETB 4TSAH 4PGZA 3T2NL 3MRKB 1FRGL 3PV7A 2IPKA 5C92A 2Z8RA 4ODWB 1BQLL 1MCFA 3FB5A 1YC7A 3OAZH 2XQBH 4GRWB 1YUHA 5CGMA 3OKLB 3VRIA 1ND0A 3MV9D 5ABDE 4EOWL 1I85C 4LK4A 3HRPA 4PJ5D 4JN1H 5EPMA 1FO0A 1F8TL 5DJXB 1WWWX 1QRND 2Y72A 4HIJB 4X98B 2XT1B 2EDWA 4KAQL 1PG7H 2VLKA 3IFPA 1T66D 4N9OB 4JFXA 3CXDL 5BO1H 1J1OL 4XTRD 5K9KB 4TPRH 1A6TA 3MOQA 1KCVH 4Z8FH 5KVDH 3GDBA 2KQNA 1FZMA 2E9WA 1X5GA 1H3PH 1SYVA 5I1KL 1T5XA 2R0LH 2JB5L 1A7NL 3VXRD 3MLXH 1U8QB 3GSNB 4PRHD 3UZEA 1ES0A 5IKCB 1PEZA 4YHYB 2XZAH 4HKZB 5D2LF 4XNXH 3N50A 2Y23A 5CJQL 4ZAKB 5E00A 3L3DB 1KJVB 1I7TA 3JTSB 1UJTA 5DDHB 5IG7B 4UOW0 2CKNA 4KUCF 1PG7X 3EYFB 4EDWH 4PJAA 3MTRA 3V52H 1OWWA 2F5AL 5BMFH 2DN7A 4TUKH 1XZ0A 1T4KB 4FZ8L 3WNNA 5HYJE 3PXHA 2AJSL 2UYLA 3DBXA 5IB2A 1AJ7H 1A5FL 3H7BA 4RBPH 2GJZB 4ELMB 4LIQH 1MVFA 3QCUH 2PTVA 5FYJE 4WJ5B 4KROB 4P3DA 4RMQA 2ZOLA 1B4JL 4QGTA 4GG8A 3D85B 5GSRB 3N1PC 4YR6A 2LVCA 1IEBB 3CLEL 3CDCA 3I3EA 1VKXA 1XIWB 1HH9A 5D96C 2ADGB 2E9JA 2UV3A 1P4LB 3G08A 1YJDH 3FB7B 5FUOH 3H3BC 1A6AA 4L4JA 1JJUA 3KHQA 1ORQB 5EU5B 2WP3T 3MROA 1P1ZA 4M6MH 3QHZL 3PIQA 5CZVH 4DGYL 5E95B 4O5LH 2PN5A 4P9HL 1KEMH 3BGFB 2HT3C 3GSVB 1CFVL 4PP1D 3U0PA 1S7WA 2CXKA 3PF2A 1I1FA 1M7XA 5F7HA 5HYEA 4HDIB 1YQVH 2OR9L 4LVOC 4Q9QH 3SKUD 5J12C 3DECA 5J3HD 2FSEB 3F7YB 4MGXA 4XB8A 5HD8C 4R3SB 2R69L 3WL9A 3IT8D 3CMGA 2N7BA 1HHIB 3IU3A 3BD3A 1T03L 3EHBC 1AY1H 2ZP0T 5B22A 4XNMA 5KSAB 3KPOB 1E4WL 4JQIH 3QO1A 4OD3H 3I02A 4XMKH 5C0NC 4QXTB 4C58B 1A0QH 2ZOKA 3QJFA 2FHFA 4UOJA 4WFFD 2JJWA 4O2FA 4OLEA 3PABA 4X7FC 4DKEL 1X5AA 4GRWH 4K9EH 3G9VA 1MRFL 1KELH 4D8PB 4R96B 3MRRB 2B4CL 4OZHF 4GXVL 1Q9KA 2QQNL 2FHCA 1OOAA 1CK0H 4TSCH 3S4SB 1T89C 3O3AB 3TO4D 3ULSA 3VXRB 5CBAB 4PRHB 4QRTA 4UQ2A 3CFEA 2RR3A 2AV7B 5I18L 4WWKC 3QHTC 2VLLB 5BW7C 4U6HB 3ZDYE 1U8KB 3L5IA 1HSAA 1IC5L 4NO5A 4X6DF 4Y19A 5F7NC 3KS0J 3KGRA 4X99A 5E9DA 1VGKA 2MCPL 1WIOA 1C1EH 4WFGD 1V5JA 3QWOB 5ESVB 3HR5A 3QDHA 5GS1A 6FABL 2GSIA 1SEBB 4LIQE 3DSFL 5CZKA 5AYQA 2H26A 1IQDA 4HKXB 4PBVC 5ESQB 3GSNH 2GAZB 4KTEL 4KJWC 3VFOA 2VITB 4ZD3L 3S88H 2AI0H 5EZLA 1MLCA 3BQUD 5GRWA 5FGSA 5EO0A 3W11D 4GKZA 1UWGL 4WI9A 3L5JA 3PWVB 4N8VA 1ZA6A 5IHUH 1MFDL 2C7UB 5MP6H 1TTFA 3IJSA 3VXSD 5IEKB 1W72A 3JWOC 3U83A 1H8NA 3ULVF 5BXFB 2BNRD 4NQTA 1T2JA 3QUYA 3T2QA 3GIZL 3ZE2E 1NMCC 4ZDHB 3TCLA 1MVUB 2YUXA 3UTQA 1KCLA 1P4IL 4YHIA 1OAQH 1BJ8A 5C3LD 2N4IA 5HGAB 4OUUB 1LEKA 3CDGA 2FIKB 4XBEH 4JB9H 3WN5B 4LLWA 1CE1H 2AJUH 4PLKC 4PJBE 3VXPA 3H9HB 2A38A 5TE7L 3BZFB 5DC4B 4EI6A 2CUHA 3P77A 3KPPA 1G7JB 4NT6B 2J2ZA 4H1LH 2FECL 1A9EB 2D0FA 2P48B 2VLJE 1WBZA 1XGTA 3MCKB 5L9DL 4XRCA 1QLFA 4XX1E 4PIRF 3FMGL 4PJEB 1BQSA 3W9DA 2J7LA 2R29L 4OLVH 3AREC 1PX4A 3I9GH 2D7QA 4LKCB 5FOBB 1AC6A 3UBXG 4AIZA 3RGVB 1AC0A 3NPSB 4L8CB 1F11A 5BVJB 4Z7OE 2BHYA 4GRWE 2YC1B 5DHXB 5I75B 4UV7H 2OCFD 1CICA 1JGVH 2YN5A 1A6WL 5TDOA 4NZDA 3MNVA 1ZLUH 1JNLL 2FLBT 4G5ZH 1U8PB 4P46A 2E3VA 3K0WA 2EIZA 3S96B 4HPYH 4I4WA 5KG9A 4XT1C 4QHLA 2OTUA 4FXGA 4I0PC 3C6SA 3WD5H 1T6WA 2IFFH 4PJAF 2VRAA 3BZDA 4R2GC 4PJ7B 4YWGH 1JVKA 2H2PC 1MFEL 4HUXB 2WUBH 1N0LA 5MEQA 1OM3H 2QEJA 3C60C 3HFML 3FAXA 3VH8B 4N90D 4P59L 5DD6B 1IAKB 3AUVA 3KHOA 5EU3B 1NDMB 3EO1B 3RTQC 3HG1D 3K8LA 5HYSB 1TTUA 4CU7A 2YD1A 4XPBH 1RZKH 2X05A 2WLYA 3BMWA 1KLUB 1CDYA 4CMMB 4LCYA 1H5BB 1G9MC 1OTSC 2OXHA 4MNGB 3HNTL 3DYOA 4RCAA 2XFXB 2HJKB 3P9LB 1GCFA 3ARFD 4MJ6B 3RBGA 3VXSB 1EAPB 2EEDA 2BSTA 1EEUA 3DO7B 2R2BA 1TVBA 3LN5A 3X14A 4C83A 2BNRB 4N0FB 1ZOXA 2YKLH 3ZKSD 4P5TD 5E2JA 1GC1C 4LSVH 3VFNB 1QLEH 4ELME 1IILE 3KNBB 5ELIA 1NGXB 4CU6A 2GY7B 2F19L 1NLDH 2VZOA 1FFPA 2EIDA 4J3WA 1FG2B 3QEHB 1UKSA 2QLVB 2E7LC 1EEQA 1GPOL 2VL4A 2X1OA 3IS1X 1XGUA 3OKDB 4NO2A 3SJVD 4PRDB 2W60B 5GGQL 4XNZB 3SKNB 2B1HL 5DJZB 2A77L 3QCVL 5DJYB 4X4XB 5CBEA 4WW2A 3OSKA 4Z77A 2D7PA 3CVHB 4XCNB 2C3XA 2W91A 2Y07L 3BESR 5A16B 3GGWB 1JCKA 3BKCH 5DK2B 3HC3H 3RIAK 4QEGA 4HKBA 4MCZA 3O6MH 3KG5A 2DM4A 4OGXH 1KFAH 1T2QL 4LPVA 5ISZD 1RZIA 3I50L 3NOIA 2NR6D 3EAKA 4IRJA 1RI8A 2CRIA 3S36L 4PJ8D 3K8MA 2APWA 3BH8A 4NQSA 4OFYD 2FL5A 3RY6A 4HWZB 2XQBL 4DKAA 4Q74A 3ULUF 5IJVB 3LKSA 5IGXH 1U3HA 1MH5B 4G6AC 2DQTH 4M93C 4OF7A 3CXHK 2OI9C 1C5DB 1FVEB 2CKBL 2COQA 3ILQD 4JY5H 1VFAA 1CFSB 1B4RA 2LU7A 2BFVH 3BSZH 3MUHL 1NCWL 1QSFB 4P2RD 1JGDB 2UWEA 1H3VA 1KF9B 2HFGH 3FFDA 4EEEA 1CI5A 4LU5H 3BP6B 3FRPA 3VGDA 1TZIB 1YN7B 1Y6NR 1JV5B 2VDML 3LS5H 1SY6H 4U1HA 2I25N 2HN7A 4JPIB 3VFMA 1T1YB 2XA8L 1KPRA 3FQRB 2AEPH 4MA8L 2ZCHH 1UACL 3F7QA 2PYEA 1KCVL 5JOPD 4OFDA 5DJ8B 3DV6A 1CXFA 3HG1B 3GBML 3QIBA 3VA2C 3VXRE 4PRHE 3IXTA 2R0LL 3SDCD 1EIBA 1B6DA 5DEZA 4ETQB 1FNHA 2PO6A 3GMLB 4PJIA 4XNXL 5IV2A 4WHYH 5GS2H 1GGCL 5I6XC 3WE6B 3D3VA 2RBLA 3RNKB 3P11L 2X4QA 1DEEA 2H2SC 3LKQB 4LLYB 4HH9A 1N0XH 2PXYB 4K71B 1H15B 4HQQH 1FSKB 4N0UB 1FNAA 1TNNA 5AD0B 3GHEL 5JLZA 2ITCB 4DGVL 1NLBH 4OF6A 4UT9H 3VFTA 4BQ9A 5EZJB 3MV7D 3CSGA 3U0TB 1RHHB 1MCSA 2VERN 3ZKNC 3TBWA 5J56B 1AGFB 1MJUH 1FAIH 4WY7L 4KMTH 2XI9A 2ICEB 3HI5L 4J6RH 3KWWB 3N06B 4K2UL 5L2KB 5JO5B 4Z7UB 4CNIB 1Z3GH 5CIPB 1WITA 3S37H 1AGBB 5H35B 5CCKL 3DMMB 3T77A 1WAAE 3QIWA 1CVRA 3NTCH 1NJ9B 4OLZL 4M6ML 1MFBH 3BUYB 5A43C 5CZVL 4HEPG 4D3CL 4O5LL 1INDL 2APTA 5DFVD 5TPWH 4ZQKB 5CLTA 3VJ6B 5GRUH 4FQ1L 4Q9QL 4JM4L 4S2SA 1ADQH 3CVHH 2HRPL 4PJEE 5K59E 4PRNB 1G9NH 4K7PY 3MGOA 4XVUC 1S7SA 1ZHLA 5K9QI 4NZUL 4JJ5B 4ZOBA 4MD0B 4DVBB 5C9KA 3S37X 5D6DA 4E9LA 1A02N 1U8NA 3DPBA 3EDFA 1LO5A 4OD1L 2I60H 3MMEB 5HHXH 4P23B 4TUOB 4WEBH 3HZMB 1AQDB 2VE6B 5I1AA 5JIPA 4PR5A 3S3JA 4MZ3A 4X80H 3JV4A 1AGCB 1IGFH 4K9EL 3SGKC 3LN4B 1NH6A 3EOAA 4XPFH 5ADOH 3RL1A 1F3RB 4YBLB 2ARWA 3QUYC 4PJ7E 2FBJH 1CK0L 1R3KA 4O51A 1N6VA 3MRMB 3U4BH 1T0NA 4HBCL 3SDCB 1FFOB 3WFDH 5D1QC 1EFXD 1KLFA 4LSRL 3ARZA 1HHGA 3OR6A 2DAVA 2BSRA 4YDLC 3H9SD 4ZS6D 1BAFL 4I3RH 5GJTL 1G0XA 2HT3D 4HFWA 1JP5A 1WGOA 1V05A 4LLQA 2MHAB 1OLLA 5FAAA 4CMHC 5DJCB 3DGCR 4MNGE 4RNRA 5E08L 2B0SL 5HGDB 1K5NB 4WW2F 4RAUA 2DLEA 3OJDB 1IQWL 3S88L 5JW5A 2IH3A 3FCTB 3MV7B 4YH6A 2EXYC 3VXSE 3BD4A 2WINA 4GW1A 2BNRE 3C2AH 3EHBD 3VMOA 3ECBA 4IMLA 3SE9L 1UCBL 4ZOEA 2J6EH 3L6FB 3I3BA 3V7AE 3QDMA 4NM4L 3E6FB 3HMWL 1F3DH 1RVFL 3C5JA 5C0ND 3QI9D 3TPUB 3B2UC 4I48A 4L5FH 1BGXL 3MXVH 4RFEA 3UPRB 3GIVB 5F7WC 3JWNC 4XCCL 4MHHG 1KOAA 2EDHA 2OTPA 2YPLB 1CICC 1UM6H 5E8EB 4PJHB 2AJUL 4QRUB 4KKNA 4KJYA 4OZ4B 2H32B 2ZUQC 1QG3A 4QRRA 5CMAB 3HAEA 4V1DA 4Z78A 2UWEF 3OHXB 3TBVB 1GH7A 4WWKD 2CO7B 4QTIH 2CLZB 4QCIB 1MHEA 1UKQA 2Y7QB 1INQB 2R9HD 4HD9A 5I73C 2EDYA 5KS9F 4WTWA 3TLRA 1RD6A 5DGQA 1WEJL 5CJ5A 4LBEA 1FFNB 1F3JA 3MA7B 1B3JA 3QJHB 5TFSL 4GXUM 4PRBA 3I9GL 2X1PA 4RGNC 3DRTA 3KLAB 3VXUD 1KIQA 1A1OB 3INUH 1J05A 1MF2L 4P9ML 1UXSB 4RMVA 3BFOA 4O2EA 2MQ3A 3HUJB 4HF5H 1QKZL 3SDYH 4NDMA 4UV7L 3O8XA 3CFBA 2XKUA 4OFPA 2Z31B 1OAKH 3V4UL 5ESAA 4LCCA 1QSFE 5E70A 5C9JA 4YHNB 4ERSH 5DVLA 1CF8H 5IVOA 4ZNEA 2FEDC 4ODVL 4Y4KB 1YECL 3WD5L 3REVB 1ITCA 5D96B 2CJUL 1F45A 3LRSB 4R0LA 4BKLA 4LVEA 3R1GH 1ZVSA 5DEGB 3VMNA 1I7ZA 3BKYH 1ZGLA 1OQOA 1RMFL 4PLKD 3HG1E 1AP2B 4K3EL 3Q1SL 2XN9A 3H9SB 4UT6L 4BZ2L 1ZEAH 5FDWB 5DUBB 4MA7L 4JZJA 2P24A 3MFFA 3QXAA 1BVKA 1NC4B 4LVOB 3QDAA 2VOTA 5J12B 4LEXH 4MXVE 1QD0A 5GS0L 3H9ZA 4YDVB 1EK3A 5T33L 2NX5D 4D9QE 2CDEA 1KB5A 4GAGL 1XF4B 5L6YH 3LHPL 1AD9B 3ESUF 1ONQB 4M61A 4F7TB 5DLMH 2ADIA 5KJRL 4LRIA 1U2HA 2HVJA 3PGFH 4Y1AB 3F7VB 3IU4H 4OCRL 1RFDH 2FD6L 3PDOA 4NUJB 4AEHL 2H3NB 1JF1B 4KZDH 5C08B 4Y4FA 4NC1E 2F54B 2BVTA 5IMKA 4D9RE 5I1DA 2QADB 1ZWIA 4X7TA 3R4DA 5L2KE 3P9WB 4Z7UE 4I0PD 3W2DH 1CFTA 4PRID 3PUCA 4GT7A 3O3BA 2BRRL 4R2GD 1KNOA 3HZVB 1F4XL 4WWKB 3C60D 5K9OB 3NA4A 3D18B 4OCNC 1OP5K 5IOPA 1TJGH 2F58L 4HV8B 3G6JB 3WFEH 3RTQD 3X3GH 3QP3A 4JFDE 3MBEA 1MEXL 4NNXA 4OGXL 4XPGH 3RWIB 2H32H 3QO0B 1NGYB 1EGJL 2EIEA 3C5ZB 3JVGA 1H0DB 5IT2H 3VXUB 3LZFL 1UA6H 5IVZB 3U4AA 4EJ1C 1OTSD 4XP6H 4NQCB 4FMFA 1E28A 4Q97A 4O9HH 1IAOA 3C8DA 3H0TB 1UKTA 2EDEA 4PG2A 5E6IA 1PGRB 1MREH 4HUUB 5IMOA 3QUMA 4XP4L 1LEIB 5IW6A 2CIKA 1NMCB 5GPRA 1EV2E 4YHOL 1RZJH 1QFWM 2OSLB 1MPAL 4LU5L 3UDWA 4ODUA 5HHMB 3UBXI 1LNUA 2EDDA 2MPAL 4WI6A 3SCMA 2J8UA 3LEXA 7FABH 3WFBL 2NQCA 3RWDB 3ARBC 3W39B 3ZDXE 2RCSL 4A2MA 4UNTA 1EXUA 3OKMB 2A73B 4JPKH 3DV4A 2AJZA 3C5SA 4HS3A 3VWJA 4YUEH 5DTFB 3QIWC 5KW9H 4JG1H 4FTVA 1GGTA 2DLFH 2AK4A 3AREB 1RUAH 3D2UA 1V7NH 1OF2A 5INCB 3MV7E 1Q0YH 3BDYL 2M2DA 4OFKA 4XZUB 3QFDB 3TC9A 1HCFX 4G6AD 3QH3B 2AXFA 5F9OH 3LQAL 1U8MA 1AR1C 3PWJB 4G9FD 4EXPX 1DE4B 5I17A 5ANMA 2WW8A 1FAIL 4UI2A 1LMKA 1YEGL 3MGTA 4PG9B 4LSQL 1S9YB 3MA9H 2EDXA 4I0PB 3NIDF 3EOTL 4PRIB 3WEXB 2DKMA 4FG6C 3VXTA 3DWTA 4FXKA 2YPLE 4JFQA 4JKWA 5FOJA 1C8PA 4MSWB 4PJHE 3C60B 2OXGA 4O58H 4F33B 3PP4L 3ZLQC 1CT8A 3GKWH 3RTQB 1MFBL 4P2YA 4HWUA 3AS2A 5E8OB 3JTTB 4Z9KB 2NW2A 4QHKJ 3HPLB 4MD5A 2I9TA 1RU9L 4MX7B 1CLYH 1OPGL 1ADQL 1A7PL 3CVHL 2LAAA 1WTLA 4QOKA 4APQD 3MGAA 1U3YA 2H2SD 3KJ6H 3V6OC 4GLRH 3TN0C 3OAUL 3PGDB 3AXLA 4EI5C 2CDGB 5BS0D 1I8MB 1F02I 1DVFA 1RUPL 3VW3L 2I60L 4GUPA 2IPKB 4X7EC 1IARB 1YDPB 3V8CA 1HYRC 2B7DT 2WM0A 4X80L 1P7QA 3FO1B 4XCEA 1ND0B 2VIRA 5CZXC 3HS0B 5E6YA 2A6DA 5EPMB 1WCQA 1FO0B 3JWOH 4ZG1A 1BBJA 1NMBH 4H25B 5ITBH 4HH8A 1QEWB 2JLLA 1RJYA 2FBJL 2FWOA 3M1BA 4I8DA 5AYUL 2VLKB 3IFPB 4QXUH 3RGHA 4YXHH 5IJKC 3HCVA 4JFXB 3LRHA 5E1HB 2VL5A 3H9SE 1AIFA 2W9DH 1IAII 4O02L 4OM0L 4XX1G 1MHCA 2DJSA 1B2WH 4XI5D 3G5XA 2EZ0D 1ROWA 1RK1A 2F5BH 4X9HA 1RUMH 1SYVB 1KJ2L 4G80A 3BZEA 1CU4L 3GMRA 3NCFB 4KQ3H 4MCYA 5GRZA 3SY0A 3U9PL 1K8DB 1P9MC 3QG6A 5F1IB 1I3UA 2V2TA 5I66A 4L29A 1OHQA 2XYCA 2ZCLL 5E00B 1E6OH 5JHDD 3P4MA 4Y19D 2KUTA 1WK0A 3K2UL 3LEYL 3QIUC 3BEWA 3DVIA 4Y1AE 5HHOA 1D5ZA 3RAJH 2PUQT 3SEPA 5GHWL 2NY1C 3BE1L 2VC2H 1XZ0B 5C08E 5IB2B 4YBHA 3MXVL 3V8OA 3H7BB 3OB0H 2F54E 3AM8A 3QXVA 3VGAC 4L9LA 1ZT1A 2NW3A 5EO1A 4A6YH 1UWEH 2C3VB 4P3DB 1UZ8A 4OCXL 4XPTL 4GG8B 4FQXA 4QXGL 4CU8A 5T3XE 3P9MB 4YR6B 3MCLH 4HXAH 3QUYD 5IW1A 4RWHA 5GGVY 3JWDC 4N5EC 3STLB 3U36A 2QSVA 1R3HB 5IVXA 1JZ7A 5JUEL 1HH9B 4FQHB 4JRWA 2XXCB 2HAZA 1BOGB 3RUGA 5D1QD 1G6RA 1F6LL 3NIGF 5F8RC 1AGDA 4R0LC 3G6JE 5LGJB 5I6XB 4IJ3C 5HHQA 1TMCB 4NWUL 5GGTH 1SBSH 3MNWA 1U41A 3PIQB 5F1KC 3W0WD 1NBYA 3VXUE 2J8UF 2XIDA 3WV0A 5EBWA 4NQCE 4G8GA 4ZUSA 3INUL 3U0PB 1S7WB 4JZJC 1I1FB 3N1QC 5H94A 4LPYA 1G9MH 3RZCA 5L7XH 4Y16A 5EIIA 2EXYD 4X7SH 4ENEC 1MCWM 3QQ4A 3WL9B 2NZIA 3O6FA 1QYGH 4OQTH 5F96H 3IU3B 3AMKA 5TQ2L 1C7SA 1CF8L 2QL1A 1X9QA 3S8WA 5INDA 3ALWA 5J7CC 2CD0A 3L3IA 4Z7QF 4LP5A 3B2UD 4PFEA 5SWSA 5HHME 3VFUA 5GISH 1IC4L 2ZOKB 1TVHB 5IFJB 5DJ2A 1D5BB 3HB3C 4O2FB 4AL8H 4MA3B 1PKQB 2JELL 2Y25A 3VXOA 1DQLH 3GSXA 1EBPA 1Q9KB 4GO6B 1FO0H 2BCKB 3KPRA 3ZYOA 1A3LL 1UCTA 2QQQA 3IFLL 4X83A 4NKIH 4QRTB 1JZ5A 4UQ2B 4I0KA 4TRPH 1HSAB 3NCYS 5SX5H 1S9VB 1FVDA 4Y19B 4HFUL 4AH2A 1X44A 4X99B 4U1LA 1VGKB 2Y36H 5E9DB 1UXWA 3HR5B 1IAMA 3JVGC 2HKHH 3PG2A 1A7OH 1UM5L 2H26B 2EKSB 3O6LL 2AEIT 2NTFB 3QEQA 3T0EC 3IDXH 3VFOB 2VUOA 1MLCB 2EYTA 2DM7A 5EO0B 4GKZB 5E2UL 2BNQD 3WJJA 1NAMH 2G5RA 1JNHB 4N8VB 1ZA6B 3IJSB 3CFKA 4UOW1 5DJ0A 1P2CA 3ZYIA 4H88H 1QFWH 5EU4B 4PRIE 2FEDD 4RRPG 3E2HC 3QUYB 3W2DL 1YYLL 4L3ED 3VCLA 1CXIA 1XT5A 2XZZA 4Z7VF 1YNLL 4G6KL 4YHIB 4RQQA 3RRQA 1UEYA 1U8HA 2XRAL 2V9QA 1LK3L 3UDWC 4X6CF 5D1QB 4XVSL 1MIEH 1DCLA 3B9KC 4B7IA 5I1CL 2XQYG 5IQ9A 3FZUD 4LLWB 5LWYL 3SCMC 3BRDA 3VXPB 3W0WB 5C0BE 4XPGL 4OFVA 2EDKA 2QQLH 4CMHB 3P77B 4UIKL 2DBLH 3KPPB 5ALBL 2YPKB 2XOTA 4PTUA 3WLBA 1K4DA 5JIHA 1KCSL 4OCWH 3U82B 4CVXA 3B5HA 2ATKA 5CP3A 1WBZB 1XGTB 4IDJL 4NFBA 1C16B 1QLFB 2ZKHH 3ZSSA 4HPOH 3QZWA 2H9GA 1H3WM 4LSDA 2J12B 4M7LH 3WHXA 4AT6A 4Z0BH 4AIZB 1CDHA 1F58H 3AU1A 5EH1A 4OSUH 4AG4H 5IHLB 1I9JH 4K3GA 1N2RA 2WBJA 4CW1B 5KN5B 3NCEB 4F37F 1CICB 5F97E 5ADPH 1X5HA 4WNQA 3MNVB 1I9IH 4MMZC 4PGEA 4P46B 7FABL 2ZUQB 4V2BA 4M9PA 4YHZL 5IB5A 3FONA 3DGGA 2GK2A 4GKSA 4QHLB 3C6SB 4N1EA 2VLKE 1SVCP 1FE8H 2ESVA 1JUFB 5F7LB 3FT3B 3S34L 5F1SA 5I73B 1JK8A 5T3ZD 3HNSL 4YQXL 1X7QA 3MRBA 1VA9A 2Q7YA 3Q0HA 3L7FB 3CDFA 5B8CC 5D7IB 5D6CA 4RGNB 3TYFA 4Q58C 2XNAA 4XMPH 4LCYB 4WHCA 2V9RA 2BMKA 5D1ZA 1W2KT 1RZ7L 4PRPD 3C08H 3KXFA 3VDCA 1ZLVK 4LNRB 1AO7A 1F4WL 3D3VD 3RJQB 3ARDA 2BNQB 3O9WD 5JDSA 5A2FA 2LU4A 2C3WA 3FQNA 5BVPL 3OX8A 4PJAE 3ARUA 1TVBB 3LN5B 4XCFH 12E8L 1XF5A 3TGXA 3NCYP 5EU6D 4HMCA 4LSSH 1CXKA 1JPSH 2EDJA 1DVFC 2RAMA 1A64A 2FBOJ 4H5SA 4YIQB 3LH2H 1TLKA 1FFPB 3WNPA 3VH8G 2AVGA 3QNXA 3SQOL 1CR9H 3RDTD 1T3FB 1LE9A 5HYSG 5IR1A 1XGUB 1WFTA 4NO2B 5C0AA 3K4ZA 3DHJA 4KGLA 5IESH 3ARBD 1QLRA 4HUWA 1XR8A 5EOTA 5CBEB 1Q9WA 2MQ0A 4P4KD 5T3XL 4Z77B 5DMIL 2OJEA 2BRQA 3RHWK 4N0YL 2ERJC 2E7MA 5HSFA 3UJTH 1OAYL 4J3TA 4NYLA 3G5YA 3QIWD 5DEFA 3BGAA 2DQJH 3Q6GL 4N9GB 1DQDH 2PTUA 4HKBB 4UMGA 3OG4B 4MCZB 3KJ6L 4YFLI 1DDHA 5EU7C 3KLDA 4U0RC 5DA4A 1OVZA 2Z92B 1RZIB 5DK0A 3QRGH 4GQ9H 2X2YA 3RX5A 3V7AG 4BQ6A 1FP5A 4BA8A 3BH8B 3JUZA 2E6JA 2FL5B 2IBBA 2V7NA 4Z7NF 1O5DT 1U3HB 3MSPA 4UDTA 1AR1D 1HQRB 4YFDB 3B6SA 4NRZB 2HVKB 5IVNA 1NCCH 4Q0XH 2VSCA 2Q3AA 1NMBL 3ZE1F 5ITBL 5CINH 1OSPH 2W0FA 5JA9A 4QXUL 5DVKA 4D0DA 4YXHL 4IOFD 1Q9LA 3AM8C 1PKQE 1N4XH 1CXEA 4L9LC 4U1HB 2HN7B 3VFMB 2W9DL 1KPRB 1RHFA 2V5YA 3P73A 5AZ2H 4FQXC 1DBBH 4P5KA 2GUOB 1B88A 1IKFL 2JCCA 3O6KH 5JPMA 3ULUE 2DM3A 2Q8AL 5ICXA 1P6AB 5I0DA 3KAAA 4PRPB 4PJIB 4Y19E 3D3VB 1CGXA 5E9DE 4UILL 5I8OH 5TE4L 3TN0D 2X4QB 2GHWB 3AFLA 5F89A 5LCVL 4XGZA 4EI5D 2BSED 5LGHL 5EU6B 3WNLA 1RUQH 2VC2L 3IDNB 3VFTB 2L7UA 4BH8B 4QHUA 2NPLX 2GI7A 4LRNH 3QEUB 4HHAB 1R0AL 2LABA 3O6FC 3UCRA 5CZXD 5MENA 3OL2A 3KYNB 1EDQA 4CKVX 1PQZA 3KPQB 4M3JA 3MCLL 3FFCA 4QTHB 2AJ3A 5T1MB 4MAYC 3ARBB 2R2CA 3MLZH 3M8OL 3O4LD 3BPOC 2Q86B 4W6YB 4GAJL 3T77B 3QIWB 2H1PH 5C2BL 2DD8L 4HS8L 1K8IA 1ZTXH 2BOCA 4ZPTA 5FO7A 5EZOH 4TQEH 2DYPA 1ZGLM 1RZ8A 3SGJC 3GJFA 1JIBA 3FT2A 5EA0H 1G9ML 1GOGA 3BPCA 3VGEA 5C0DA 4NZRH 5F96L 3RX7A 1T1XA 4MXQC 3MGOB 5I0ZA 1ZHLB 1A22B 5LQBH 3ULVL 1UM4H 3CGTA 3QIUD 3TIEB 3T4AA 3SBWA 4EDXA 2NY1D 3VXMA 3B3IA 5EC2A 2MKWA 4CJ1A 1U8NB 3U46A 3KR3L 1OP3H 1GC1L 4YE4H 3OJVC 4ODSH 1G84A 3B8SA 4EZMA 4RWYH 5B3JE 5I1AB 1KCUL 1Y6MR 2APVA 5B21A 2ED9A 4PR5B 1I7UA 3JV4B 1R5VA 4PJCB 1JYWA 3EOAB 3CLFH 5DYOA 3RL1B 4N5ED 3SDXA 4QRQA 2RIKA 4AENA 1R3KB 4O51B 4W4OA 4U6VL 4KH2A 1DQQB 3SE8H 5KAQG 2APFA 4NKIL 4QRSA 3SQBA 3BMVA 5IM7A 4K7PH 2HT4C 1YY8B 4OD2A 3DUHA 1HHGB 1I3RB 1B0GB 1JGLH 1JGEB 3MO1A 4LHUG 5D7IE 2BSRB 1PLGH 1U8JA 4Y4HA 4RGNE 4NO0A 3TN0B 5T3ZH 2WANA 5J06A 1XGYL 2O61A 1JZ3A 1CFNA 4HFWB 3BW9B 5DRWB 1C08A 1A7OL 4G8FB 2C1OB 4RNRB 4DN4L 4HWEH 3D9AL 4RAUB 3IDXL 3FQWA 2BNQE 4ENED 5JW5B 2IH3B 5L8KB 2DF3A 2WINB 5D72H 1X4YA 4IRZH 4H88L 1QFWL 5FYKU 3V0WH 1EEZA 5ACLA 4P3CL 3QDMB 4J4PC 2R4SL 3T1WA 4X9GA 4U1KB 4K7PX 3O4LB 4HZLA 3LDBC 4I48B 5HDOA 5DR5H 4RFEB 4YXKL 2VDNH 3OB0K 1V7ML 3HB3D 1T04A 4MLIA 1IC7L 4ONGL 1P7KA 1P5VA 3GBNL 2IPUG 4Y5VA 1IGJA 2CK0L 4KK5C 1FQ9C 3CH8A 1AI1H 1JN6B 4OM1L 4KJYB 1TJHH 2XY2A 5HTSA 4M7ZC 2EYRA 1RIVL 1U95A 1Y18A 4R4NC 4QRRB 1MRCL 1NFDA 1NFKA 2ARJQ 4QRPD 4JVWA 2E9IA 4V1DB 5F88A 5JZ7C 3M45A 5FKAA 2XZQH 1T7XA 4YGVA 3CX5J 3MR9A 2BDNL 4UZGA 3TA3A 1MHEB 1A14L 1FN4A 3P0GB 4F9LA 4S10A 1NEUA 4ODHH 5BJTA 4LBEB 3E8UH 4M7LL 5BV7L 5CSBA 3QIUB 4MAUL 1UWXH 3MRDA 1HINL 3V5HA 4JFED 3DRTB 3IFNH 1E6JL 1KIQB 2NY1B 4MJ5B 1J05B 5E8PA 1Q1JL 4OSUL 1GIGH 1IGYB 3T0ED 1LE5A 1I9JL 2IC2A 4O2EB 3VGAB 4MS8D 3TH2T 3O8XB 1SYSA 3MUJA 3LSOB 5ESAB 5C9JB 1OAZL 2X9YA 3V6BR 3TM6A 4GSDL 4HG4J 4ODBD 2IBZY 2WNGA 5E6ZA 1MI5D 1KN4L 1BX2B 2DRUA 2YRZA 1AFVH 1MCPH 3WSQH 3Q5YA 4JFOA 4PUBH 5CP7A 4U1MA 5JNYA 3B9KD 4OGYL 3E3QC 4R0LB 4BKLB 2Y6SC 1C5BH 1HKLL 4KWUA 4JRXD 4IJ3B 3TBYA 3U9UA 2PYEE 4ZPVB 1I7ZB 4H26A 1BD2D 2E6PA 4WIQA 1ZGLB 1HHHA 3RIAF 5ID1B 3QNYB 2B2XH 1QO3B 1XR9A 2IAMC 1TZGH 4P2QD 5C2UB 5BRZD 4FZEH 4JZJB 2P24B 1YMHA 3QXAB 4PJIE 3HLAA 4PRPE 5I8EA 5LXGL 3BH9A 1ZSDA 3C08L 3D3VE 5ENWA 3ULUL 5HGHB 4OLWL 2D7TH 2IH1A 1KB5B 3QDGD 4I9WD 3BO8A 1J11A 5SX5K 3GSQB 2VXTL 1J7VR 4WHDA 5EU6E 3FQTA 3WYRA 3IDJA 2ADIB 4ELKB 4M7KH 2JKXA 3EFDL 5F6HJ 1FL6A 3H42H 3MRGA 5JHLH 5I1HH 2DTML 3LH2L 5E2TL 5FDYA 5IMKB 3X3FL 2Q76A 3HE7C 4LFHG 1U91A 1GVIA 5I1DB 4PJFA 4R4BB 1ZWIB 4JO1H 4IMKC 4U7SA 1W72L 3T04D 1OAXL 4N68A 3STZB 4QRPB 3H9YA 1KNOB 2NY5C 1OQXA 4RZCA 3PWNA 1R5WA 4XNYH 4K3JH 4U05A 1BQHA 5E7BA 3WKNA 4L3CB 1BEYL 5IOPB 4HCRA 1PW3A 1NEZG 1TFHA 4G6JH 3VD4A 1TPXC 4MDJA 3DXAD 2Z93A 1BFVL 5FECA 3B9AA 3IETA 3SDXF 2NZ9D 3T0EB 4NC2B 5D7JC 1E28B 4MB3A 4ODWA 2R23A 1IAOB 4NWTL 5DD1L 4QT5B 2JJSA 3TO2A 2GJ6A 1CGSL 4YFLF 1ZE3C 4Q0XL 5IMOB 5DJXA 1K6QH 4GXUN 3E2HB 4M48H 1IBGL 2CIKB 2WWKT 3KPMB 4JFFD 3MRCA 1OSPL 3RWJB 4DQOH 1MI5B 2XWTA 4PTTA 1DVFD 4HIJA 4X98A 3ZKMD 4CVWA 1WZLA 3S9DB 4AIOA 43CAA 1MQKL 5FHAH 3U30B 1UB5A 1FPTL 1LNUB 4JREC 5GZNC 3B9KB 4DEPC 3BD5A 4J8RB 1N4XL 3BPLC 1U0QA 4PJCE 4JRXB 5K9KA 1B0WA 1BD2B 3BEVA 3SCMB 2PNDA 4HIIB 4E41D 2I5YH 4WDIA 5AZ2L 4OCYL 1E27B 4HKJB 4OTXH 4Y0GA 2LU3A 4LSPL 3GSWB 2VXVH 4PD4J 1FAKT 2YD5A 3JWDH 4L1DA 5BRZB 3L5XH 3GSNA 1EXUB 4C56D 5IKCA 2VR5A 3NFPA 4FHBD 3DV4B 2X1XR 4RX4A 4ZAKA 1FYTA 1U8LB 5DT1H 3ALXA 4LDOB 3V6OE 3L3DA 1KXQE 2ZPKL 1XCTA 4M1GL 5A40E 3QDGB 5IG7A 1I8KB 2X4PA 3UC0L 2AK4B 4H20H 1HWHB 2X6MA 3I6KA 4L3AA 4NM8L 4ZFGL 2NY3C 3PHSA 3VXQA 2FB4L 2HT2C 4R7NB 5ILTH 1MFAH 1OF2B 3K1DA 4Y89A 4LVHC 5I1IL 4ELMA 3BPNC 3W82A 1AXSA 5DK3A 3QEGH 4DKDC 2MNUA 3VD5A 4YGAB 3KYKH 3MX0A 4HWNA 1U8MB 4BFIA 2YRPA 4KFZC 4JFZH 4MQTB 5ANMB 5I17B 3QDME 1NCBL 2JE8A 2DQIL 3TT3L 1IEBA 1IGTA 3BZ4A 1YEHH 5IFAH 4G8EA 4H1LA 4B41A 4WWID 4JFQB 1QPXA 3U1SL 4LARL 2L4OA 5EU5A 2EE2A 1OGAD 1XCQB 1DSFH 4QRRE 1MELA 5B8CB 5GGRY 1KEGH 3WIIL 4JM2A 5H2BB 4V1DE 3EYVB 5EWIL 3SDDD 3VGHA 2NW2B 5GXBB 2YR3A 2WIMA 4MD5B 4W4OC 5I8KL 3IDYC 4JN2B 4HDIA 1JNNH 4FP8H 1MLBA 4FQIH 4NNPH 4R3SA 2AK1L 2AQ2A 4QOKB 1GGIH 5H8DA 1HHIA 3WXVL 1JPTH 3MV9A 4XNUL 3R8BB 5LQBL 4KI5F 4PJ5A 3ZDYF 2CXGA 3KPOA 4OKDA 5I30H 3D87B 4D9LH 3ZMRA 4CVUA 2M1KA 1H3XA 1QRNA 1OL0A 4CGTA 3AXLB 2EDRA 4YE4L 1DVFB 3BIBX 1X4XA 2F8VA 1CBVH 1CLCA 5KSVB 1CWVA 3VFRB 2JJUA 3A6CH 4LVNC 5D93C 1KPUA 2G9HB 4OCSL 4WUKH 2FZ3A 5SWZA 1P7QB 4XCEB 4ZNEE 1EJOL 2A6DB 4P2OC 4XVTL 2X09A 3MRRA 1BBJB 4MAYD 5F72S 2OL3A 2X44D 1RJYB 1Q72L 3M1BB 3S4SA 3O3AA 3VXRA 3VGGA 1MJ8L 1A7QL 4PRHA 4YDKL 2DIBA 2ERJB 2AV7A 5FO8A 5HVHC 1A21A 3ZE2F 5A2KH 2VLLA 3HCVB 4YHLH 4U6HA 2Z35A