3GI9L

Crystal structure of apct transporter bound to 7f11 monoclonal fab fragment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPSSLAMSVGQKVTLSCKSSQSLLNTSNQKNYLAWYQQKPGQSPKLLVYFASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLSDFFCQQHYSTPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7F11 Anti-ApcT Monoclonal Fab Light Chain
publication title Structure and mechanism of a na+-independent amino Acid transporter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 48
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2009-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gi9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gi9L01
1NCCH 1NCAH 2DWDA 4OZFB 2HTLC 4W6YB 3HMXH 2OJEB 5CSZB 3H3PH 2E7HA 2QHLA 4YJZL 1ZXQA 3HR5B 5GZND 4XZUB 1CR9H 4TULH 1UZ8A 3B2VH 1AY1L 3EZ8A 4KKNA 5CUSL 1HINH 4QXGL 4PRPA 2D7MA 4WI8A 1NDGB 3VXOA 5BV7B 3T1WA 2ORBH 4GG8B 1AI1H 4PJDE 1FCCA 4RWHA 1C12A 4NKMA 2E7CA 1U92A 4M3KB 4ZDHA 3WJLA 4JRYE 4L4TB 1ZHBB 1OGAE 4JHWL 4F37F 4KHXH 5I8CA 5JNYB 3W11C 5MEQB 1CXIA 1FN4B 5C0CA 3TO2A 2VJXA 4JFYA 1FLRH 1HSAA 3MLTA 3MUHL 5F97E 3DV4B 2XT1B 1T20A 4XTRC 3RUGE 1HHJA 3EJZC 4D0CA 1BOGB 2Y7QB 3SGDH 2MHAA 3PP3H 2OTWB 1A7RL 4P9HH 5BZWB 2HA1A 1INEH 4H20H 2BMKA 4PLJC 3SGJC 5CS7A 4KTDL 4F3FB 1H5BB 1J8HD 1QLFB 4LEOA 2I27N 1YY9C 4XBEL 1T1XA 1Z0NA 5C07B 2APBA 4RIRB 1FCGA 4GJTB 4PJEB 3TO4A 3V6OC 1F11B 1NEZA 2P44B 1KN2L 3G5YB 4QRRB 4JHAH 2EXWD 3L9RA 2UVFA 4PYGA 5C0EB 2GTZB 5FHAL 1CGSH 1ZWIA 1KPRB 3SDXE 5IG7A 4WI5A 1J1OL 5IHBA 4PJ7B 1I7ZA 2WUBH 4LSTH 4BQ9A 3QEGL 2W9DL 4OAWA 3C5ZB 5GISH 4ZAKC 4C59B 3L3OA 4UT9L 3MBED 4RGNB 2Z91A 3O6KH 1G6VK 3MRLA 1KLFA 2GY7B 3LKPA 5I8EB 4LOUD 2C4XA 4FN0A 3LQAH 3L5XH 3D0LB 4P4KC 3QDJE 1JVKA 1UYWL 2MTPA 3RKDD 4P2QD 1S7RB 1C08B 3FKUS 3WYRA 4OLXL 4F7PB 2WBWB 1YECH 2ED8A 1X5GA 5FGCB 5IBTH 1RIUL 4NQCA 5GGVH 3V6OE 3MNWA 1RMFL 4R7NA 3PIQB 4WNQB 4YHMH 2GT9B 1EHLL 2FH8A 1KTKE 5DR5L 4G6AD 4LCCC 3BQUB 4EXKA 4Q58C 4NGHH 2EE3A 1F4HA 4PGEA 2F15A 2F53E 4WHDA 4OZFA 4YHIB 2OJEA 5DT1L 2Z4QA 3KHOA 3HHRB 4CU6A 3BPLB 2IPUK 4Y2DB 3WFDH 1EH9A 3UJJL 1JYVA 5DVOA 5TF1H 2PYEB 4NO3A 3BPNB 4M5ZH 1G7PB 5DEFB 2RQ8A 1VGKB 1YNLH 3DHJA 1G7HA 1RK0A 3MOAH 5EC2B 4QLRA 1QSFA 3QUYC 4LCUA 2BSTB 1FP5A 1CL7I 1AR1C 5E6IB 4WI2A 2B2XH 4PJAF 1H3PH 3LIZL 2ZNWA 1JYXA 5IWLA 5FM8A 1B3JA 2VOTA 1ONQB 1IT9L 1FN4A 3D9AH 3L3HA 3NPZB 4KDWA 4MAUH 3B3IB 4NSKB 3HNVL 1TZHB 4FFVD 3SKNA 2D0GA 2P42B 3T09A 2NY1C 4D94A 3DV4A 1KCUH 3RGHA 1FSKB 2ERJB 2FX8L 1FZMB 5CCKL 4F2MB 3SDCC 1I1RA 3UC0L 1I1YB 4IS6B 4ZFFB 1R6VA 2ZSVB 1DTUA 3FHQA 2YPLB 1A64A 3WIIL 5IB4B 2J88L 1C8PA 2V9QA 4JAMB 1U93A 3Q5TA 5BVPL 2R69L 3O6LL 1UXWA 1RHHB 4KZEH 3N50A 3T65B 1QR4A 2GJ6D 1H15B 2L7UA 1D3CA 1INDH 1V3MA 5C0FA 3EOYG 1JN6B 4RIRA 1A3RH 1MSPA 1UM6H 1F11A 4N9GA 1BEYL 4BA8A 3QUZA 2QADC 4KGLA 2GTZA 3SE8L 1CBVH 4WY7H 4M62L 4PJ7A 1MCRA 4WJ5A 4QRPB 1IQDB 2BHUA 2IGFH 5AUMA 3C5ZA 5K9JL 2VABA 4WW1A 5KOMC 2NNAB 3H7BB 2COQA 1ORQB 3KPMB 1MRCL 1MNUH 3GSVB 3GSXB 1B0RB 5GHWH 4BUGA 4LCIL 3FQRA 5I8EA 1KYOJ 4OLWL 5F7MC 2XACC 3FO1A 3HAEH 4X99B 3D0LA 4CU7A 2VDMH 3CFKB 2FEDD 5I8OL 1S7RA 3DX8B 5TJWK 4LIQL 4F7PA 3EGSA 3IT8D 2XI9A 2D7NA 5D5MF 3BEVA 4HH8A 1D5ZA 3UP1A 4NCDA 4WCYL 4K94L 5L9DH 4PJ8B 2GT9A 4XC1H 4DKFH 1A9BA 2V17H 2AAVA 1FIEA 3P0GB 4V2BA 1AQDA 4OCWL 3BQUA 4OCSH 3F6IA 2ZUQB 4JFED 1XGRA 1D5XB 2ICWI 1U8HA 5T3ZD 2W60B 3OXSB 1L6XA 3WD5L 4YHIA 4TN9A 2JELL 1WT5A 4Z7UF 3IU4H 1NCCL 1BM3H 4I3SH 3WV0A 5IB2B 3T04D 5IHUL 2PYEA 2EO1A 5E1AB 3HMXL 1G7PA 5DEFA 1BQHG 1V05A 3H3PL 2V9TA 1F58H 3PGCA 2X4UA 4R4FH 5I30L 1CFQB 3WNPA 1CR9L 4TULL 3MR9A 1VGKA 5K9QI 1ZGLA 3H42L 5KANG 1MFDH 5EC2A 4ENED 4FFWD 1HINL 5IB5A 1CU4H 4X6CA 4KJWC 3DGGB 1S7XA 5E6IA 3TC9A 3R1GH 2VNCA 3SBWA 5IVXB 2ORBL 1XGTB 1SBSH 2QSTA 1AI1L 1LP9B 1ONQA 4PBXA 1XR9B 1OF2A 3TJHD 1YN6B 4NSKA 1MCKA 2QBWA 5C9JB 4QRUA 3SN6N 4KHXL 1IM3A 3WDHA 1CZ8L 4U0QB 1I7TB 3ZDZF 1EAPB 1G6RB 2IAND 1I9JH 1I1YA 2ZCKH 3K4DA 1A3QA 4E41D 2IF7A 3HB3C 3O8XC 1R5WA 1QBMH 4NQED 2YPLA 3STBA 2P5ED 2IJ0C 1QSEE 3SJVA 2AK4D 1Q9WB 2N7AA 1XR8B 5DJYB 1IEAB 4P9HL 1H15A 4JM4H 1MIML 2XOTA 5E9DB 2IH1B 3SDYH 1INEL 1YEEH 1U91B 1DBJH 2CLZA 2ZNXA 5CZXC 3LY6A 3VH8B 2A83B 4KJPD 2A6KA 1ZA6B 1KTDB 4H20L 1DVFC 5EBWB 4OI7A 3FOMB 5F9JB 3M8OH 4L3CB 3OJMB 3BGFB 1X4ZA 4G9DA 1I3RA 2E5EA 1INQA 1IQDA 4EI5C 4FABH 1FYTE 2L4OA 3MRKA 3HAEG 4JHAL 4LSQL 4MJ4A 3H7BA 3BRGC 3MV7D 5AYQA 3IS1X 4MHHG 2M26A 3CFEB 2GYSA 1NAKL 2WUBL 4LSTL 35C8H 3RWJA 5SX4H 1HCFX 1GZQA 1OAUH 1NFIB 3H0TA 2D31B 2FLBT 1XMWA 2R0ZH 5FYLE 1PFCA 3MRGB 4R4NC 5B38G 3NA9H 3LQAL 3L5XL 1BVLA 1RZ8A 3QWRD 1FFQA 5I71C 1ITBB 4PFEA 5E2JA 4PJ8A 1YECL 2OP4H 5IBTL 2NW3A 4JVWA 4DAGH 1EJOL 1ETZA 3QI9D 4KTEH 5FV2A 4OZIA 5T1KB 3UXFA 1D5XA 3WNLA 1BREA 5IMOB 4H26B 2W60A 4QOKE 5I9QB 2XZQH 1H0DB 1NH6A 3HMXA 3TH4T 3ZLQC 1PEZA 5I73B 3OB8A 2APXA 5IB2A 1PAMA 2VQ1A 3D18B 3UPCA 3TVMC 2FWOB 2Z93A 3CU1A 5C0AD 3TLRA 2RB8A 3ROOA 2OR9H 4KXZH 4M93C 3WFDL 9CGTA 3PV7A 1RZJC 1EUTA 1KIUA 3O2WH 3BP4B 5IK3A 1P7QB 3MMEB 5TF1L 1JUFB 5KSBB 3DI2B 4M5ZL 3K3QA 4O58H 4GAFB 1YEJH 3B5GA 1S7SB 2HH0H 2ATPB 1YNLL 2V5RA 1MLCA 2DQCH 1XR9A 3MOAL 1HWHB 3RVTC 3LRGA 3IU3A 2HFEB 3HZYA 3MLVH 1H3PL 3SGEH 1I7TA 5JW4N 3D9AL 4PUBH 5A43C 1TFHA 4ISVB 3RX7A 2WV3A 3QSKB 1TZIB 1DEEA 1BWWA 2DD8H 1A8JH 3V2AR 1QQDA 4KK6D 1B6DA 4OCMC 3WFEH 1KCUL 1Q9WA 3ARGB 5DRZB 1CGTA 4IIQA 3B9KC 4JN2B 3TIDB 1XR8A 4MX7B 3VG9B 1T2XA 1YEKH 1MLBB 2YWZA 4MNHB 2GY5A 3HUJE 1BMGA 1U91A 1FE8H 1ZHKB 1XZ0B 2X89D 5F71A 3ULVC 3LD8B 1T2QH 5JORB 5EBWA 3FOMA 5F9JA 4OLVH 4L3CA 1ZGLM 1DE4B 5C2UB 1TENA 3OX8B 3ET9F 1JZ5A 3V79C 1H9VA 1INDL 5J1AB 5IJKC 4M6MH 3UMTA 2QKIA 3RWEB 5ESAA 1YMME 3ZYJA 1E27A 5IQ9B 1A3RL 2FNBA 1UM6L 5TE6H 3EO0A 2DMBA 3D85A 3FQUA 5HHNB 4LVOC 3DMMA 2O61A 4ZNCD 5DZLA 5FCUH 4N90D 4WY7L 3SDAC 1A6AB 4NKIH 2R1WB 3X12A 4P5MB 4X6BB 5DA0B 2ITDA 1LO0H 1C5BH 2WLYA 1KCLA 2IGFL 5C6TH 1AFVH 2FHBA 1LEGA 1A1OB 1GZPB 4N1CA 3QG6B 5IQ7H 5J13B 1NCWH 2H9GA 4M03A 2IPKA 3NABH 5GHWL 3VI3E 1G9NH 1MCWM 4MA1C 4X4ME 3MNZB 5KW9H 3ULVE 2VDML 2YD5A 2P5WD 3WSQH 3DOSA 2EIZB 2JF1A 2UYLA 2EKSB 4MQTB 5HSFA 3PGFH 5B38B 3C6SB 2M2DA 2OQJA 5DC4B 1UJ3C 4NC0B 3Q6GH 4PRIE 2IH3B 4HMEA 1QFWI 2XXMB 2IG2H 4R97C 4YBQD 5IMOA 2A6IB 3UJTH 5L9DL 4XC1L 3VRIB 4ELMF 3GSQB 3CPLA 2V17L 3W39B 2DL9A 5F7DB 4NRYB 3KWWA 1G7IA 3IDYC 1G84A 4U1GB 4Y5YC 2NY0D 3S98A 4XCEB 1QHOA 5EUKB 6FABH 2FWOA 2EKJA 1EX0A 4GKZA 4NNYB 3E1F1 4JO2H 1BM3L 4I3SL 4XVJH 3DUUB 4R0LB 1JF6A 4TNVF 5SV3A 2YMXL 2W38A 4R2GD 4AENA 3U30C 5EC1B 1CWVA 3MMEA 4EJ1C 1JUFA 3DUSA 4WFHD 5KSBA 1BQHA 4GH7B 1F58L 2NYYC 4R4FL 4LVNB 1S7SA 1WWCA 4FTVE 3VWKB 5I15H 5D2NA 2B39A 3QPQC 4GRLA 4N0UE 4OZGE 3CXDL 2AV7B 1MFDL 2QR0B 3GIVA 3N9GH 4KKCD 4MNGB 3OF6A 1MCBA 3L7FB 1CU4L 3QRGH 2BNRD 5C08D 2ADIB 5GS0D 1SBSL 4WW2F 1MVUB 1BBDH 1CICD 3VXSD 1H3WM 3D39D 2UY7A 3O4LB 3QIWB 2EEDA 5C0DB 1G1CA 5IKCA 4M7JL 3FFDA 12E8H 1QLEH 3U1SH 2JCCB 5CGMA 1RJYB 4JN2A 4G6KL 3TIDA 1VEMA 4MX7A 4C55A 5J89A 1MLBA 1I9JL 2ZCKL 3LS5L 3V4UH 3P9LB 1ZTXH 3HMWH 3MACH 1QBML 5A1AA 2F8VA 1ZHKA 3VMOA 3RIFF 4WWKC 1EBAA 5JORA 1T1YB 4I0CC 3V5DB 3MJ9H 2VXUH 5DUPH 3QG7L 5KS9F 3O4OC 3ZHDA 3SDYL 4JM4L 4JLRA 5D9SA 3BO8B 4D9RD 1YEEL 5J1AA 1DBJL 3NIGF 4L9LB 5FKAA 1GGIH 3IJYB 5GZOC 4JCLA 3U9UA 4MD0B 2DI7A 4EEEA 3M8OL 5HHNA 3ZSSA 4BK5A 3O6FC 5EA0H 4CKVX 1RUKL 4M1GH 2B8OT 3MZTA 3PL6D 3WCYA 2ADJA 2XA3A 5DI8A 5B3NA 4X6BA 1B2WH 3QQ3A 4FABL 3HAEA 1FL3A 3AFLA 4U1MB 1A1OA 5ICYA 6CGTA 1PGRB 1CIDA 3W9DB 2C3XA 1XF3B 5CJXC 4NT6A 5DUBB 4C4KO 5TH2B 3B4NA 1A6VH 1KJMB 5JZ7C 1N8ZB 3AUVA 5GS1C 3KYAA 4MNQB 2KDGA 2XTJE 3H9SD 1E4KC 3T0EA 1KIPB 1OB1A 2GKIA 1UVQB 4P46D 1V3KA 2NLJB 4PJFE 4QHUB 3T4AA 3ULUC 2R0ZL 2WP3T 5B38A 1G0YR 2MKLC 3L5JA 4PRHE 2PXYB 5GRUH 5E03A 1K4CA 5E5RB 5DWUH 3OKDB 3KLAA 1T5XA 4LP5A 3VFVB 5SWZE 3VRIA 1NC4D 3GSQA 4AMKH 5D70H 4DZBB 4FG6D 3QUXD 2HJKB 4DAGL 1WC7B 4G9FB 4KTEL 5KSAB 4OFYA 4XCEA 25C8L 1FNFA 1LE5B 4JFDA 2XZQL 2OMBA 4J3VA 4LSVL 1OQOA 4JM2D 2BCKB 1GAFL 3VFRB 1X5AA 5A16A 4BZYA 3S34L 1M7DB 5C8JA 4K23H 1E4XL 1F3DH 1XCTB 5E8OA 1ACYH 3ULUF 5DURB 3GBLA 1ZHNA 1BAFH 4Q6IB 1MFBH 1OAYH 4OZ4A 3W0WA 2OR9L 1P7KB 4MJ6B 5SX5H 1BWMA 2WBJC 3VRJB 3O2WL 4RFOL 3L3IB 1FL6B 2OI9C 1MHEB 4O58L 2Q7YB 1JPTL 3KLHD 1YEJL 3AAZB 2ADIA 3OKMA 1A9EB 3WHXA 2HH0L 3DX6B 4PJCE 1MVUA 2DQCL 4H88H 3QDAA 4A2LA 2XFXB 1IM9D 5C0DA 2VZOA 2HAZA 4DVBB 3O41B 4U1KB 1EIBA 3MLVL 3MLXL 4NWTH 5B21A 4P2OA 2JTDA 4B53A 4TTGA 4PUBL 4HIEB 3DV6B 5HHOE 4AJ0A 4S2SB 3NGBC 2VC2H 3D25B 3I02B 3WFEL 1AO7A 5IEKA 4PJ5A 1T1YA 5AD0B 5DS8B 2EDNA 1M05B 1YEKL 1H3TA 1VFBB 1WCQA 4KUZH 3LN9A 1TNMA 1YDPB 5KVEH 5GRVK 5J11B 1Y0LB 1OTSD 1NBQA 1FE8L 4XXDB 1K9TA 4LHUB 1AHWC 1IGMH 1JTTA 3IJYA 5A40E 4APQD 3V4PL 3WIHH 4MD0A 1T2QL 3T3PE 5EUOE 2R0LH 4HC1H 1WZKA 4OLVL 3UTTA 3HE6D 5F9WB 3AY4C 3IB4A 4M6ML 1S7UA 5MP6H 1RSFA 1HDMB 43C9A 5SWSD 5FCUL 1NCBL 1NMAH 5D5MA 5I1GH 2X41A 1BD2D 3T2PA 2FYYA 4JFFD 1XF3A 4NKIL 2BNQD 5DUBA 4HPYH 4XT1C 1J88A 1A7QH 1LO0L 1C5BL 1N8ZA 5I66B 1AFVL 1ZS8A 1NFDF 2YUXA 4ZPTB 5JO5B 1M1SA 1NCUA 2F54E 3NABL 1G9NL 3ES6A 3C60B 1F3DJ 3U9PH 3HLAB 2I07A 5KW9L 1K8DB 1AXTH 4P57B 2J12B 3WSQL 2YEZA 3OKDA 2PTUA 3BZEB 4J4PD 4OIIL 3C6LA 3QULB 4OIBA 3Q6GL 5KSAA 4HXAH 3MRNA 5FK9B 2IG2L 4LNRB 3UJTL 1JPFA 1MFCH 3M45A 1FL5B 4W4NA 3QDMD 2BCKA 1ORSA 3SGKA 3JUYA 1MAKA 1QO3B 3B2UD 4OZHB 2BVEA 2DQJH 3A6CL 4HLZH 2B5IC 4Q6IA 4UIKH 2DLTA 6FABL 3VXRD 3RDTB 3HC3H 4JO2L 4P3WA 3WNMA 4XVJL 3SCMD 4RX4A 1KC5L 4NKOB 3PUCA 4POUB 4OLYL 4PGZA 3PHOB 2Q7YA 3KPSA 4I3GA 1E6OH 3AAZA 2KZWA 3G08B 1MHHB 2XKUA 2Q6WB 3N9GL 3RZCC 2R2EB 3QRGL 1NDMB 3O41A 1T89A 5CKGA 4U1KA 1ZA3A 1HSBA 2APWA 2IFFL 1BBDL 4HIEA 5HHME 3QJHB 4M8QA 3D48R 1YC8A 5TDPB 5DO2D 3FT2A 1PX4A 2MMXA 1WAAE 3DTXA 2OXGA 2FJHB 3U1SL 3BAEL 4OLUH 2DBJA 3ARBB 5AD0A 5DS8A 2DLGA 1VFBA 2HJLB 3C8HA 1QUNA 3V4UL 3HMWL 1Y0LA 4JGJA 3N1MC 2BVQB 4DEPB 1ZMYA 2R2CA 4DWHA 3GIZH 3MJ9L 2VXUL 4FQQB 5DUPL 5EIIB 5TE7L 5EG6C 4U2ZA 1RZIA 5C09A 1HHIB 1GGIL 4QXTB 4JFOB 4XNZB 4YFLI 2B4CC 5ACZB 3P77A 2F58H 2CIIB 3K80A 3DRTA 2XXCB 1MCNA 4XBGB 3MROA 1B2WL 4JFPB 5ERWA 4L8CA 4LMQE 4X98B 4WUUB 2EYSB 5JO5A 4XI5D 2PNDA 4HGWB 5LQBH 3B8SA 2FIRT 1YJDC 3GO1H 3TZVA 1A6VL 1L0QA 5F7LB 3UTSE 5HYJB 4F15B 1XF5A 1YA5A 5DSCB 1EJ6A 3TBTA 4ZO8A 1QD0A 5MEOB 3MODH 2X4QB 1O0VA 5GSVB 3QDGB 1NFKA 1JHTB 4Z5RB 4P23D 2GQHA 1G7QB 3QEQE 1MWAL 3VD9A 1WZLA 1K6QH 3BUYB 4NHUB 3BZEA 1Q9OB 5DD1H 4XVTH 5GRUL 3GSUA 1B4JH 5TQ2H 1PLGH 3FB7B 3Q5YA 4IRJD 4HLZG 3IS0X 4AMKL 1FL5A 5D70L 1YNTB 2UZYB 3SDDB 2GTWB 1FGNH 5FGSA 2Z8VC 1NL0H 1J18A 2PETA 1UWXK 5D1ZA 1Y6MR 1DL7H 2H45A 1L7IH 5EOTA 4FQPA 1Q1JH 3RDTA 5C3LD 2X4NB 3DVNB 3MLSH 3VWJA 1CIUA 4NKOA 1DQJA 1LO3H 1BAFL 1MFBL 1OAYL 1FFNA 5I8KH 4S1QH 5GJTH 3TA3B 1RUPH 2Y5TA 5EOCH 4N1EA 1WFUA 4KDTC 5IHZB 3G08A 1MHHA 1FAKT 2VLKA 4ONFH 4AH2B 2EXWC 4JPKH 4AM0B 4I4WA 4P2RB 1S9KC 4Z7NE 3GRWH 4PRPD 4MQXD 2UVEA 1NGXA 2OZ4H 4H88L 3QJHA 2OS7A 4JKKA 3ZYZA 4YUEH 2CLRA 4LLMA 3RQ3A 1TQBB 4PBWD 4NWTL 2Y4SA 3VCLA 3UBXG 3ESUF 4JPIB 2R1XA 4LOUC 3MJ9A 1OAQL 5IW1B 2K1MA 3KPLA 2NTFB 3RKDC 2VC2L 5FUCC 4DTGH 4MXWH 3MV8B 2P8MA 4ONGH 4AYFA 4KJYB 1OW0A 3MRMA 1GVIA 4DW2H 4KUZL 3KR3H 5D1QB 2AJUL 1UZ6E 1FYHB 5KVEL 3QIUC 1PKQB 3S8WA 5TQ0H 1P9MC 5BRZA 1IGML 2DIBA 2R4SL 3WIHL 1MI5E 2C9AA 3DGCR 5HVFB 5ENWB 4XHQA 2R0LL 4HGKC 3BW9A 4HC1L 1S3KH 3WJJC 4BH7A 4S0SD 3VGAB 4YHPA 2MSPA 3QNZA 1U6AL 3C9NB 4O2CB 5MP6L 4OKDA 4AIXA 1AGEB 4HUUA 4F8QA 4X8XA 4N9OB 4WUUA 1IGJA 2EYSA 4JJHA 5FXCH 4HGWA 4G5ZL 2A9NH 5DYOA 5FUCE 4HPYL 2NY2D 4U6HA 4PRNB 4EN3B 5HYQA 4K2UH 1A7QL 3ORJA 4OJFL 5DJZA 4ELMA 4XVSH 4ZOAA 5F70A 4Y4KB 2X4QA 2VLLB 1TETL 2CDFB 3I3EA 3PQYA 3TESA 1OCWH 4L8SB 4JZJB 3VXUE 3GEWB 3QPXH 5LG1A 4PJ9A 3U9PL 2IQAA 1UWEL 3LRHA 2XRAH 3DVGB 5CD3B 1QR1A 3IKCB 1ADQH 2XNAB 2V2TB 5EOCJ 2IAMA 4UDTB 4NRZB 4FFVC 2P7TB 4Y1AA 1U9KA 4I2XB 4NQCD 3EBAA 5D1XA 4K55A 3IDGB 4WV1B 2EDDA 1KLGB 3ULUL 1A0QH 2NZ9D 2X4NA 3DVNA 3ULSA 2IFGA 4LVEA 2AABH 2E8YA 2W0FB 2CRMA 1YQVH 2I9TA 1FLTX 2DQJL 4UIKL 4WW2A 2BOCA 3SGDI 1CVSC 3GJFK 4JFHE 4RFNC 3KXFB 4JDVA 1WISA 2HJFA 3U83A 3U7WL 2WLZA 1OP5K 2E8ZA 2LTQC 4AH2A 4AM0A 3PWJA 4KC3B 3CC5B 3GSWA 1VEOA 3BYTA 1KB9J 5DFVC 4P2RA 1E6OL 5J57B 3BH8B 2OR7A 3FJTA 3WO4B 3LQZB 3OKKB 1GJIA 3QUKA 4NQVA 5KS9A 3V6ZB 1QSFD 3S35X 4L4TD 5ID1A 3CFIC 2FEDC 2DQDL 5F1OB 5TDNA 4XB8A 1MCOH 3MV8A 2GJ6E 3KPQA 4K9EH 4XXCC 1WK0A 3GJFB 1A7NH 2A2QT 4K7PY 2KQMA 4KJYA 3WIHA 2B0SH 2A6DA 1WICA 5D7IE 1V5JA 3GSNL 3HRZB 3BEWB 1W8OA 4HC1A 2Z31C 5IVZB 2ZPKL 3RI5F 4QEGA 3P9WB 4BFIB 3QJFB 4CDGC 5L0QC 3GIZL 3NFNB 2JJSA 1JWSA 1RZGA 4ZNEA 3S5LB 1CE1H 3BRFA 4YHZH 2Y07H 4DUVA 4FQXC 4ZFZB 1WCBB 1M4KA 2EICA 4LLQA 3T0DA 4PG9A 1AGEA 4U6XA 4N0YL 2CDGB 2JIXB 4I18B 3GJEB 1FNSH 3OAYK 2F58L 1ZLWK 2ZG2A 3QUZD 4QGYA 2Q87A 2CK0H 1IGIH 1EDQA 1JFQH 1WITA 4HJGB 1T7ZA 1D5MB 1YMHB 2X5PA 3HC4H 4JN1H 2ZOKB 5ISZB 5I1KH 3C5ZD 4GRWE 3U46B 4RBPK 5LQBL 2VERN 5DGQA 4FFWC 5SWQA 3GO1L 4ZO9A 2AJVL 3LEXA 1EHAA 1U8PA 1MQKL 1HILB 4G8EB 4DN4H 3U82B 1QRNE 4F9LC 4GUPA 3IKCA 4GOSA 3ESVF 3TJHC 3WKML 4JFEE 4YO0A 4Y4HB 1U8QB 2DQEL 5T3ZE 1LNUA 3MLYH 3FB5B 2P7TA 4HKZB 1QEWB 1S7WB 2J6EH 4XVTL 1B4JL 5TQ2L 1PLGL 2E7LA 3PV6B 4YX2H 5EOQH 3BD4A 4WV1A 1DLHB 5KANI 2VLRB 1TLKA 3RA7H 4AIZB 3JTTB 4U0RB 1P84J 1FGNL 2KBGA 2I25N 3EYOB 1RUAH 3BQUD 1DBKH 3QWQB 5J0BA 2Q3AA 4HS8H 3ARYA 4ZYKA 1QNZH 1Q1JL 2XG5A 2YSSA 1V7NH 4KJPC 2ZOLB 4H1LB 3TT3H 3MLSL 4WGWB 2X7LB 4GKSB 2OLDA 1LO3L 3VD3A 1QFUL 3BZFA 2BVOB 5FDYA 3MV9B 1F13A 2JB5L 2PYED 5I8KL 3KJ4B 4XWOD 2FO4B 3BH8A 1YPZB 5EOCL 3F7QA 4ZXBC 3HRPA 4K8RH 5JXEC 4ONFL 5BS0B 3MSPA 4Z78A 4J2XA 3T2NH 4JDZA 1ZT1B 1R24B 4KQ4H 4E0RA 1MY5A 3HZMA 3P73B 5D6DA 4J1UB 5E8NB 3LMJH 3U4AA 4NQEE 3IVKB 5E6ID 3VI4E 3GRWL 2P5EE 3GMRA 4G7VL 4PJIF 2AK4E 2OZ4L 5JHDB 5DRXB 1MQ8A 3EYQD 3OXRB 43CAB 1TJHH 1EBPA 5JPNB 1BJ1J 3O9WC 1J7VR 2X70A 1T1ZB 4YUEL 1GOHA 5LGKA 1IE5A 1TVBB 4U1SB 3HRZA 1SMOA 5A2LH 5H35A 4HWEH 5GIRB 3QNXA 4O51A 3SO3B 4DTGL 3LPFA 4MXWL 3DROB 4ONGL 5ELIA 4Z7WE 1PG7X 1MF2H 4PJGF 5F89B 4BFIA 3QJFA 2YPLD 4MHHI 4NNXB 1IC5H 3SJVD 3NFNA 3QI9C 3KR3L 3QA3A 4U1IB 1OP3H 3S96B 1AE6H 3G6JF 3OKYA 5E8PA 5TQ0L 3M17B 3TV3H 3DJ9A 4BZ2H 3B9EA 3MV7E 4NKQB 2NZIA 3UCRA 5MENB 1IGYA 1Q9LB 1TCRB 3CIQA 4QHLA 4ZODA 4MJ2A 3CFDB 1ODAA 3MFFA 3LKNB 4WUKH 2EDFA 5TDOB 4TNWK 4QWWD 1CDJA 1OSZB 1J9CT 4HJGA 5ISZA 1RULH 3KPRB 3S4SG 3K2UH 1AD9B 2A9NL 3VFUA 2ICCA 2Q8BL 1KLUB 1EXUB 3C09C 3V4VH 4FXLA 3BMWA 5C0NC 2E7BA 4RAUB 1HILA 3KYOA 2Q86B 4XPAH 3S9DB 5DHYA 4QHNA 2BFVH 1G7MA 4HEPG 4NO5A 5DQDH 5EFIB 4Y4HA 5C7XL 1Q38A 4D0BA 5BO1H 3FB5A 1BPVA 3DIFA 1CLYH 2XRAL 4HKZA 1QEWA 1ZSDB 1S7WA 3UTPD 1ZLVH 5E94B 3H2WA 1P84K 3LKRB 3CSBA 1ADQL 3K2MC 3MRBB 3PV6A 2VXSH 2IALB 4ODHH 1JK8B 2YRZA 3AC0A 4NZUH 2NXZB 5D2LF 4KK6C 4PJ8D 4AIZA 4NN6C 3JTTA 3FN0L 3IFPB 5C0AE 3LN5A 4LVHB 1F00I 1F2XK 1JGEB 4PJDB 1F4XH 2NX5E 4I77L 4YDIL 2RJMA 2DS4A 3B8YA 4YIQA 5F96H 3BHBB 5KZCB 2AJZB 5JIIA 4OSUH 1A0QL 4JRYB 1QHPA 1OGAB 1TITA 2ZOLA 3G9VA 2AABL 4ONHB 3FB6A 1YQVL 2FSEB 5MERB 4I8DA 5IIEB 4GKNB 3MV9A 4EVNB 4WI6A 3L6FB 3T2OA 3RUGB 1YEDA 1IGTA 3GRWA 3K1DA 5GPRA 5BS0A 1RVFH 2OZ4A 2DLIA 1AP2B 2D03H 2DM4A 1MAMH 4PLKD 4G8FB 5DTFB 1EPFA 4ZUVB 5E8NA 4FA8A 4H8WC 4JB9L 1BQUA 3JUZA 3CLEH 2OBGA 5DRXA 3ALWA 4E5XB 5IFJB 3JVGA 43CAA 4DN3H 1UKQA 2R4RL 3D5OF 3MJ6A 4KROD 1U95B 5E99H 3KGRA 4YBHA 1BBJA 2IPTH 5GIRA 3ILQD 5DMYA 1MCOL 2CO6B 3DROA 4RISL 5SX4I 2D0HA 3SDXB 3BIKB 4K9EL 5E9DE 5HXMA 1A7NL 5F89A 3O11A 5FUOH 2B0SL 1BX2B 5C1MB 1TJIH 5JPMA 2YK1H 4M7LT 5D7LA 4U1IA 1NAMH 4LP4A 4YBQC 3M17A 4YHYC 2J8UE 3QEUB 1CK0L 3QDJB 3PWVA 4WTXA 1Q9LA 2Y07L 4CL7A 3TNMB 3CFDA 1X5HA 3TBSB 4AIOA 1TVHB 5E56A 4MXVE 3ARWA 3MREA 1R3HB 3BKJH 1S7VB 1XGYH 5I6XC 2VDOL 1ED3B 4O00A 3V5KB 3DWTA 3D85D 3T77B 3U36B 4IHOB 3DMMD 1MAJA 2P5WE 5I75C 3HA0A 4LCWE 5TGBB 1KLUA 1EXUA 4CVXB 2CK0L 1IGIL 3TYFB 3GGWB 4RAUA 3VFTB 4LEXH 4Q9RH 4PB0L 3VD4A 1ACZA 2YD9A 4JN1L 3CX5K 3HC4L 3KAAA 1SYVB 5I1KL 1SJEB 1ADQA 4ZAKB 5FYKH 1PYWB 4KKCC 2E9JA 4KVCH 3F12B 4KXZI 2ZUSA 2F53B 4K7FB 4OGZA 2WP3O 5GS0C 1PVHA 2XQBH 4DN4L 1ZSDA 5T5FL 1HWGB 1CICC 4FRWA 4P4KB 1UJTA 1G9MH 4NWUL 4R4BB 4X7TB 3KPOB 1DSFH 4NOBA 3WN5C 2J6EL 4HFWA 3X3GH 2R23A 2YD6A 3IFPA 2O26U 4PJBE 4PJDA 3QFJA 3BZDA 3SGEI 2OL3H 4ZSOE 5F21B 1M7IB 2HT4D 4YX2L 2VAAA 5KTEH 2GAZA 4LDLB 3RA7L 4JRYA 1LEKB 4L5FH 1OGAA 1UH2A 2EZ0C 2I5YH 3BWUC 3FTGB 2JJUA 5I76B 4ONHA 1RUAL 1JGUH 3CFJB 1DBKL 2VZVA 4LCCB 2FSEA 1TQCC 4HS8L 2PW1A 3FOLB 5IIEA 3QIBA 2CK2A 1QNZL 1I3UA 2V2XB 4EVNA 4XHJD 2FZ3A 3FFCA 3TT3L 4BKLB 1JHLH 4C56A 2BNRE 5C08E 4M61A 5ETUA 1MJ7H 2NY6D 2WIMA 1CG9A 1G7LB 4QGTA 5FO9A 3CFBA 3HI1B 4NN5C 3VXSE 4AEIH 5DTFA 3PL6C 4OFIA 3MRJA 4ZUVA 4OGAD 3RTQA 4JRWA 2Z35B 2HVKA 5DRWB 4JZOA 4V1DA 4GRLD 3T2NL 5ECJE 2PTVA 1FNHA 4KQ4L 1OWRM 1T80A 3SOBL 3OF6D 2NR6D 3U4EB 3LMJL 3QUYB 1U95A 2YD1A 1CXLA 1RUQH 1WIUA 4PV8B 5FECA 4Y0GA 3I6GB 1X9QA 3ARZA 1TJHL 4L1DA 3KYMA 2UWEE 3FL7A 1T21B 4P46C 2ITCB 3O3DB 4D9RE 3D2UB 5T1LA 1PSKH 2VKXA 2EE2A 2NY1B 1KF9B 1NCTA 1QOKA 2YHGA 4HKJB 4OLEA 1FG9C 1JGVH 3RVUC 3SDCB 1UGNA 4MQ7B 4X9BA 5CMAB 3P3YA 4FG6C 3QUXC 1IC5L 4PRAA 3KPNB 3T8XB 1RZKC 2JE8A 4H0IA 1AE6L 1KB5H 3TV3L 1CS6A 2R39A 3OKEA 3U7AA 4JM2C 1KIQB 3NTCL 4HKXB 1IC4H 3HTLX 1ZAGA 4PV9B 4D9QE 1X7QA 1S7VA 4YXLH 1ED3A 3V7AE 3NAAL 3T77A 3U36A 4IHOA 2QADB 4WUKL 5TGBA 1U58A 2HVJB 3VFTA 1G0DA 1U3HA 1FO0H 1J0KA 1RULL 2YD8A 3S4SA 1KJVA 1NANH 3K2UL 4TSAH 1T0NB 2FX9H 1D5IH 3JV5A 3NCEB 1PYWA 5DJ2A 1AJ7H 5J3HD 5CIPH 2VUOA 5DRNB 4U33A 3V4VL 2NMSA 3KLHC 1DUZA 5JOPD 2J6EA 3THMH 4ZUWA 1JZ8A 3T0ED 4YXHL 4JM2F 2WNGA 4G80A 5GJSH 3S37X 2DKUA 2D7TH 4R4BA 1KT2B 1HH9B 3BZ4A 3RWGB 3ZDYF 2XTLA 3DX7B 4NHCL 4DUXA 3QCTL 5IM7B 4ODHL 3ZE1F 1TTGA 2BHYA 5FO7B 3IXAA 1LEKA 4M6AA 5DD0H 3OJDA 3ARVA 5LGJA 1JRHH 5DQJA 4Z7VF 1F4XL 4OFYD 5EBLB 3TJEH 4HIIB 4NRXB 1OTSC 5F96L 1H3GA 4G8GE 5F7FA 4OSUL 4JFDD 1S78C 2XG4A 3TBYB 1HXYA 1X3DA 2I60H 3INUH 3IAQA 3HE6C 3ZDXF 4LRNH 3HI1A 2F5AL 2BSRB 3GUTB 5GGRA 1Y18A 1CI5A 1QSEB 1YEGH 3L3JA 3W0WD 5C0GA 3RRQA 1EHNA 3VWKD 5DRWA 1RVFL 4HX1B 1NUGA 5E08H 2D03L 1HHGB 4L29B 4U3CA 1MAML 5DJ6A 3BI9X 2QHRH 3RVXD 3O4LE 4M7ZC 1YQ2A 2HP4A 1ZLUK 3CLEL 3BT2H 5IFAH 4UNTA 5CILH 2E9IA 5IBUB 4DN3L 1IGFL 4U7SA 5E99L 4X7SH 5E5MA 2IBZX 2IPTL 2PR4H 2BVUA 4GO6B 1FYTB 4MLIA 4P2OD 5C0IA 4NQDE 3IXTB 4HKJA 4N1HB 1AIFB 4H0HB 1AR2A 2H1PH 5CMAA 3LKSA 4LPCA 3O8XB 4YEFA 1YUHA 1AO7D 1TJIL 4HKBA 4WU5A 5JQ6L 1AGBB 2YK1L 3ARRA 3LEVH 4LARH 4PJ5D 5DJAB 3JBG7 1IBGH 1NAML 1HNGA 5SWSE 5ICXA 2VO5A 1QACA 3WBDA 1IC1A 3CSYB 4M1DH 1EK3A 1UH4A 5LXGH 4HKXA 4JFFE 4XWGH 5LKNA 3RNQB 2X1PA 5INCA 3B2UC 1FZKA 1DVFB 4LLDB 3ARUA 3UTTD 3WEXA 3BXNB 2HT3D 4UV7H 4MCZA 2YN5A 4JPWH 2HVJA 4QRTA 1UB6A 5ESVB 3ZTNH 3BKJL 3UDWA 2DWEB 4EI5B 3R0MA 3OB0H 1PQZB 4PRBB 3T0BA 2PW2B 5DRNA 3RP1A 4FQLH 4LEXL 4Q9RL 3VGFA 4S1RH 1KEMH 5A2KH 3U2SB 5FYKL 2HFFB 1P5UA 4KVCL 3AMKA 4J3OC 1JIBA 3IJSB 5DK3A 2E9BA 1KN4H 3QDME 3MGOB 2BNUA 3RWGA 1KOAA 1I3VA 4U7KA 4KK5D 3V0VB 2OL3B 3LS4H 1DBAH 1G9ML 3ZKMD 4ODBD 1FZJA 1UCBH 5DO2C 5I71B 3NZ8B 4JQXA 2XYCA 3X3GL 3VXRE 3B6SA 1MHCA 2BC4B 3C6LD 3MOQA 1S9YA 4M48H 4CMHC 1FNGB 5DD3L 5DD6A 5F1NB 1C1EH 4Y2OA 5KSAD 4X6FB 5FA4B 4DK6A 5KTEL 3CDFA 15C8H 1L0YA 4HK0B 1T22A 4LLVB 4O5LH 1UB5A 2YD7A 2I5YL 3IAPA 2AXFA 1JGUL 4UI2A 3G6AB 1U8NA 3QH3A 3PGDB 3GUTA 3S97C 4U1NB 3TVMB 1YY8A 5JIPA 3T2QA 3C87A 4PB9H 4RX4D 4N5EC 1T0PB 4U1JA 4M93B 4MJ5A 4AEIL 3HUJB 4GMSH 1XF4A 3V5HA 2QJDA 2AV1B 3BP5B 4JG0H 2HFTA 4Q7DA 4PJGA 4RGMC 4X9GA 5DJ0B 3FO2B 1MJUH 5FCSH 4BFBD 2DM3A 4PIRF 3WS6C 2EIBA 4P5TC 3EDEA 1GGBL 1YMMB 3G6JA 1TDQA 3AXLB 1DBBH 1YYLH 3KLDA 4M9OA 1NAMA 5GSRB 4P23C 1XGQA 2CPCA 4XPTH 4YHKH 3O3AB 2OK0H 5D93C 4GS7B 3O8XA 1PSKL 2C3VB 5KN5B 3QISA 1KSRA 3MRRB 2NPLX 1SJHA 4PG2C 1SJXA 4NQSB 1EEUA 3B9KB 5FGBA 5MHSE 1JGVL 5HVGB 3GMLB 3MLPA 2DLFH 3B9DA 1LK2B 3C8KB 4PJXE 2IMNA 4Z7OE 1IAIH 1YEIH 1KB5L 1MFNA 5C09D 4GG6E 4TNVK 1IC4L 7FABL 1KJ2H 5J9PB 4YXLL 4PRIB 4EI5A 1BIIA 3MRCA 4QOKA 4LKCB 1UCTA 3SDAB 3VFPB 1FO0L 4LSDA 1EZVY 3O2VL 5HGAB 4LPXA 2FBJH 3ARFB 4J3TA 1J0IA 3LV3A 5D2LA 5F88B 5SX5K 3VFOA 4TSAL 2FX9L 1D5IL 1AJ7L 4XAKD 4E9LA 4XNYL 3SQOH 4WGVB 3TZVD 4OGYH 4Z77B 1S9WA 5D4QA 4MQXC 4MA1B 3HN3A 2OL3A 4M00A 4HIHB 4X6DF 3EFDH 3NZ8A 4UQ2B 2DM2A 5E4EC 4M7LH 1KGCD 4FTVB 2Y6SD 4L4VE 4MLSA 4N0UB 1EGJH 4OZGB 2Z0BA 5F1NA 1UJ3B 3LDBB 5FA4A 5DEGA 3V0WH 4P3DB 4RNRA 3FCTA 4LLVA 3BPCB 4FXGA 5F6IC 1FNEB 5DD0L 3FQNB 5IB1A 4FQHB 3IDYB 5E2WH 1KNOB 4ZUTB 2F8XC 1T5WA 3ECBB 4Y5YB 3TJEL 1E6JH 3G6AA 3BSZH 1GIGH 1I7RB 4YZFE 4P9ML 1I9IH 2FR4A 2AERT 3RDTD 2AJ3A 4HUVA 2I60L 3UTZB 1XF1A 3INUL 2AEWA 4Q74A 3VWJD 1QLRB 1X5FA 4I9WD 3U30B 3RL2A 4PYHA 2ZUYA 1XCQB 1YEGL 1FORH 3CDGB 3GI8H 4NO0A 5L2KA 3TO4C 5DJ0A 5E08L 4Z7QE 2VLKD 1VPOL 2QHRL 3DURB 5FB8B 5C0CE 5DJCB 1HZHH 3FT4A 1JPST 1MCEA 1YMMA 3G5VA 5ICZA 4ELKA 1I8KB 3LSOA 5CILL 3AXLA 1FC2D 5EZOL 2VXTH 2GITA 1LD9A 3K4AA 2W0PA 3NCBB 3VD5A 4X7SL 4HIJA 1T6VN 5T1MA 1R5IB 1G1YA 1KELH 4NQSA 4LKXB 5FYJE 5JR1L 4XC3H 1KB5A 1S9VA 2H1PL 5ALCH 4HHAB 2ARJB 2EEBA 5DF0A 5E00B 2EXYD 4HDIA 4X4MA 3LEVL 2AQ3A 2XTJB 4U1HA 1IBGL 2EH8H 3EDJA 1PEWA 3NFPA 5EZIH 4YAQB 3JV4B 2H3NB 3VXQB 3L95B 3O4OB 3CX2A 1IJ9A 4PJFB 4I5BB 5LXGL 5D8JL 5BRZD 4DKEH 3O3BB 2NZ9C 4XWGL 5J9PA 2Q1EA 3ZE2F 1FO0A 1NC2B 4MXQD 4PRHB 1VADB 4EQ2A 1A6TB 5SWZB 3QAZC 4HIXL 4LHQB 5CIPA 3ZHLA 3O6FB 4UV7L 5DVLA 3PWNA 5DHVH 2LE9A 5J56B 3ZTNL 3LRSA 3MXWH 3ARFA 3BMVA 2P8LA 3MJ8B 5DMJB 5F88A 5I0DA 3UAJD 3STLA 4WUUD 4ODTH 4PD4J 1KCRH 3CZJA 5B8CA 1LEIA 3QDGE 1D9KA 4FQLL 1IAOA 1R5VA 4JG1H 1O7VA 4Z77A 3VFGH 4R90H 3L7EB 2CR3A 4HBCH 1KEML 5GS1B 4KKLD 1F6AB 3FONB 1K2DB 3KYKL 4LHJB 3PQYD 1HIMH 3WNNA 1KN4L 3H7LA 3VRLF 1HOCB 4FTVA 4PJ9D 3MRDB 1PKOA 4KQ3H 4LK4A 4N0UA 3CNKA 4OZGA 5IWLC 1UJ3A 1DBAL 2JB6B 3NIDF 1P69B 4WO4A 1UCBL 4M6OL 5I1AB 2IAMD 4OM0H 1KPUB 3PHQB 1I4FA 3FQNA 4Y1AD 5IT2L 4PJCB 3EYVB 1C1EL 4N8CH 4YDJB 5D1XD 1QTYT 3RHWF 15C8L 2R0KH 1OHQA 1I7RA 4O5LL 2X4RB 1RFDH 3X11A 2FDBP 5I16A 5AAMA 5HHOB 4PY8J 1QLRA 2IEPA 5C86A 1GHFH 4ZOCA 1Q0YL 4QF1B 5JW5B 1CD1B 1NBVH 4Y5VC 1QRKA 1QSFE 3CDGA 4KU1A 1JWUB 3EYFA 2DBLH 5K59E 4PB9L 5EO1B 2VL5A 4WHTA 4MCYB 2HLFD 2WBJB 3RVWC 4IJ3C 3QUZC 3D0VA 4GMSL 5FB8A 5ADPH 5DJCA 1OGTB 4JG0L 5KSUB 4UAOC 3QQ4B 4P2RD 4DK3A 4XCNB 1I8KA 5EUOB 2HN7A 1MJUL 2DL2A 1A6ZB 5JOFB 1IZKA 1QPXA 4OF8A 1JYWA 4HLJA 5CWSB 3KPTA 1R0AH 4L8DA 1FH5L 2DJSA 2Y06H 3HG1A 1F90H 3P4OA 3B83A 2E7MA 5B3JF 2P8PB 1FFPA 4S1DD 3ZYIA 1JZ4A 1YYLL 4QT5A 4UUJB 4XPTL 4YHKL 5GRZA 3NGBB 4HHAA 3AU1B 3L5HA 3MV8D 4GRMA 3PNWA 1PKQE 1U8JB 2VZTA 4PJEF 3NVQA 1W8NA 3BP6A 5I1EH 4EOWH 4FNLH 1BVKB 1GC1H 4YAQA 2F54B 3L95A 1I8MB 4PJFA 4PJ7F 2BSED 4N68A 2AJSH 1KJ2B 2DLFL 2H8PA 1AHWB 2F5BH 1PX3A 2F19H 2G5BB 1JMXA 4K3HA 3MYJB 1IAIL 1YEIL 4PD4K 4OV5B 3DBXB 4M43H 3RGVB 1KJ2L 3RBSA 1L9MA 1CGYA 1HYRC 1WT5C 3MJ8A 4PTTB 1A1NB 1DUYB 1T3FB 2I9LB 5SV4A 4Y16A 2AK1L 3RWFB 4QHMA 4KHTH 1SEBB 4YFLF 5FYKU 2QQLH 4JQVC 1RJZB 3CXHJ 4RGOH 3GSOB 3BPNC 2IWGA 2FBJL 2CLVB 2Q76B 3KS0J 5D72H 3FONA 3H9HB 1FPTH 4HG4J 3TPUA 1UT9A 4YLQT 2X44D 4QCIA 4PP1D 5F1IB 5EN2A 2CKBH 5E6IC 3OAZH 3MRDA 1CDIA 3A6OA 3RWIA 3SBWC 2GJZA 5IEHB 2J8OA 5I1LB 4ODVH 2JB6A 1FNAA 3EYQC 4N8VG 2AVGA 4CBPA 3NIFE 2WAHA 5I1AA 3TN0A 4XP1H 4HAFA 5B39B 3F62A 1KPUA 2W07A 3GNMH 3PHQA 4M7LL 2CIKB 1N26A 2QV2A 3X14B 1P4IH 5FDWB 1QFWL 3F5WB 1EGJL 3MXVH 3EYVA 3G5XB 5BV7H 1UADC 2X1OA 4YDJA 5I19H 3N06B 3V0WL 4HS3B 3L3GB 1UG9A 3I50H 2X4RA 3FQWB 4AEHH 3U7YH 4I48B 1U8OB 5E2WL 1LVEA 4KUCD 1WBYB 4IRSB 3HPJB 4P4RA 5HHMB 2Q7NA 4JRXA 5C0RH 3OMZA 3FQXB 4TUJA 3OKLB 4PBVC 3HNSH 4QF1A 5JW5A 1I9IL 2B5IB 3EFFB 4OM1L 2AGJH 3BH9B 1JWUA 4X6CE 3SE9H 3JWOH 1JJUA 4I0KA 2YBRB 3WUWG 1MEXL 5ANME 3O3UN 1AXSB 3UYOD 1ZE3C 1FORL 3QQ4A 3GI8L 4QWWC 3TCXA 2X4PB 5HDBE 1AXIB 3Q6FA 1C5DB 2XWTB 3EAKA 4MVBC 5CWSA 4ERSL 1NEZG 5CEYA 4HWZB 1HHKA 1HZHL 1JTPA 3RZCB 4KZDL 1JTOA 4Z0XB 1X6NA 4RDQF 2P8PA 3ROLB 1D5BB 3S3SA 1K4DB 1HQRB 3SJVE 1E4WL 3WLBA 4JKMA 2D4DA 4KRNA 5F3HB 1UWGH 1LO5B 3BVNA 4LPTA 2V2WB 3AU1A 4LRIA 3HPLB 1RJCA 4K94C 4D9LL 1T66D 2CUMA 4NM8H 3TBWA 3VXMA 2J5LC 1KELL 3F7RA 2BP3A 3E2HC 4G42B 4LCYB 3GHBH 4XC3L 5KOVC 5ALCL 1ZHLA 1PD6A 1J0JA 4HV8B 4HJ0D 2MOVA 1DBMH 1KJ2A 3BJ91 4PJ8C 3UTSB 3F7YB 2G5BA 1CXFA 5EZIL 1KULA 4KV5F 4OLZL 2X4SB 3EUUA 4WFFD 2I24N 4IDJH 3DI3B 4YBLB 4OGXH 4OV5A 3QEQB 3RGVA 3SPVB 1A4JB 3VXPB 4LLWB 4OBSA 3MLUH 3HZVB 2EDEA 1FVDB 1NJ9B 3K81A 3O45A 4FQ2H 3Q3GB 4LIQE 4EDWH 2NTSP 1A1NA 1DUYA 1T3FA 1DANT 3DO7B 2DYPB 1Z9OA 2QSQA 3IDMA 1HH6B 4HG4K 4RQQB 3VFWB 1U8IA 3QDHA 1RJZA 4XPGH 1BGXH 2ESVE 1CFVH 4OZFG 4AL8L 3NCCB 2GK0B 3D87B 1KCRL 3AROA 4W70A 3IDUA 3UTPE 5ISZD 1HYSD 1IEBA 4MB3A 4PLKC 3CZFA 2A1WH 4U1LB 2BXYA 2GW5A 4NJAH 4TVPE 4JG1L 3VFGL 2X40A 2E27H 3R8BB 1N0XH 4HBCL 4Y5XA 1J1PH 1EGJA 1FRGH 1P1ZA 1R3JA 4JO4H 4JFXB 4OZIE 1CD0A 3U0TA 1HIML 4PJHE 4Y4HD 2VE6B 1VKXA 3L3DB 2GIYA 4KROC 4AEFA 3X14A 4KQ3L 2BSSB 4X0KB 3RNKB 1WQVT 5FDWA 1F8TH 3L3GA 4P9HC 1S9XB 2ZKHH 4WI4A 5JMRA 4OM0L 4K3EH 4L3EA 2FL5B 4YE4H 2ZCHL 2V7NB 3ZKXC 4IBLT 1ZT4B 4Z8FL 2FB4H 4IIQC 5GGQH 1MFEH 1X5IA 4IRSA 4N8CL 4NDMA 2R0KL 3FQXA 3LN4B 2J7LA 5C0JB 1AQKH 1RFDL 2A77H 4QXWA 3S35H 5IVXF 4F7CA 4PGDA 4CAGA 1LP9F 1YPZE 5FOBA 3QZWB 2CDEA 1KPVB 3MRQB 1AXSA 1NBVL 1U8KB 4HGMA 3WFHA 3MV9D 4PGCB 2UUDK 2X42A 5HHVH 2DBLL 4WWID 1FVEA 1W72B 4DVRH 3WLWD 3PJSB 5BS0D 3DMMC 5HYIA 4HWZA 3I2CH 2XPGB 1IKNC 1MI5B 3A6BL 4Z0XA 4HS6B 1D5BA 1B6UA 1PG7W 4CNIA 2EE9A 2DQIH 5CINH 1LK3H 3P4NB 3LQAC 1R0AL 3VDAA 5F3HA 3VXNB 1V7MH 1FGVH 2CGRH 4XPHH 1LO5A 2Y06L 2EH7H 4K07A 4EDXB 2VXQL 3ZTJH 1NBYB 3VFSB 3I9GH 4XMPH 3R06B 1JWMB 4MAYA 1I1AB 4TQEL 4HV8A 1ZKAA 1EO7A 2CXKA 4JKLA 4OCYH 1YZZA 4EOWL 2Y9RT 4FNLL 4Q2ZB 3F7YA 2DQHH 1MRFH 1GC1L 4Y4FC 4PREB 5D7LD 4BZ1H 3BWAB 2HT4C 3N1PC 3QIUB 4D2NA 3VXUB 5I1DB 4JEGB 1LE9A 2AJSL 5DHVA 5I9QC 3SPVA 1T03H 1A4KB 3VXPA 2F5BL 1NJ9A 1A7PH 3TWCH 5FA3A 3C5JA 3KNBB 5GGTH 2XV6B 1JV5B 2PN5A 1P2CB 1ZT7B 3KPPB 4XX1G 4WIQA 4M43L 4XHJC 3VFWA 1KEGH 3FQTA 4X6DA 3ARTA 2C3GA 4IM8A 1BFVH 3PDGA 4NO2A 2Q8AH 3RL1B 2NY6C 4YFDB 4Y7MA 4KHTL 3ZKQD 1JPSH 4L3AA 3DRQB 2QQLL 2D7PA 1K85A 3CCHA 1NLDH 4RGOL 5H2BB 4WVRA 4OGAC 2CKBB 1FFOB 4LLUB 4M1CD 5D72L 5D2NC 3N1QC 1FPTL 4GRLC 5H94A 3V6BR 1A7OH 2NR6C 1I8LA 3NPSB 1MUJA 1RJLB 4PPTA 1P4LA 4MWFB 1P6FA 3TNNB 4ODVL 2R0WH 4N8VA 1Q94A 3MUY1 4XP1L 3VU2A 2NXZD 4Y19E 3GNML 3T3MF 1IC7L 2W59A 2YD4A 4CVZB 5IW6A 1KXVC 4KK9D 3MXVL 4ZFGL 5BV7L 1RD6A 4HCRH 3QFJD 3LN4A 5KSBF 5EO0A 2HG5B 2IPUG 4J8RA 5EO9B 3U7YL 4AEHL 4JRYD 1OGAD 3PF2A 3ALXA 4K71C 1UM5H 1U3ZA 4BH8A 1JYNA 1FG2B 2OTUB 3G04B 2DOCA 3I6LE 4OB5H 2HRPH 4RDQG 1TIUA 5DJ8B 5D2NE 5F1SA 1KPVA 1FNLA 1G6RH 4LGRB 4F57H 3QIBD 1S8DA 2GJ6B 3AMLA 2FIKB 4TUKH 5EPMA 2VR5A 4PGBB 3FFCD 2AGJL 2O5XH 4RFNB 3SE9L 3JWOL 5D7IB 2HTLD 4HD9A 3WUWA 4C56D 4WENB 2OSLB 3SY0A 3EYUH 1QFWM 2LTQB 3BIAX 4FXKB 1BF8A 4F7TA 1PG7H 2XPGA 1MI5A 3KHQA 5HY9B 5DJXB 1N5AB 4GBXA 4JANB 4UU9B 5FM5O 1QP1A 3RTQD 3REVB 3ZTJG 2H26B 3P4NA 1A6UH 4V1DD 4W81A 3VXNA 1HXMB 3AREB 5J3HC 3O3EB 1SVCP 5HDQH 1VHPA 1S5IH 4X7EC 1ZANH 1WGOA 1AGFB 3DSFH 4EDXA 1JBJA 3ZSTA 5CHNB 4CDHA 1N59B 4YH6A 3T0EC 1UWGL 3WXWL 4UQ3B 1I1AA 4YGVB 3QFDB 5EU5A 4QTIH 4Q9QH 4ZO6A 5IMMA 5EZLB 4GQ9H 4NM8L 2NY7L 3X13B 5T1LD 5HGHB 2VKWA 5EBMB 5EZJA 3WL9A 4GRWB 4PREA 3OAUH 1IGCH 1E0OB 2Z31B 3EJZD 3BWAA 1T7YA 3OZ9H 4DCQB 4JJ5B 3IRZA 3QIUA 4R7DA 3VXUA 1DBML 3OL2A 3EZJB 4KVNH 4NC1C 4XGZB 2VLMD 4HJJH 5J8OA 5L0QB 3MUGB 5J12B 3AVEA 1BZ9B 1QRNB 4XPBH 5BW7A 5BMFH 5EU4B 3QDJD 3HS0A 3KNBA 1WTLA 4IDJL 4JFEB 5K93A 1P2CA 1ZT7A 3KPPA 1OD9A 4FQXB 1XIWA 3IRPX 2A6JA 4WU7A 3MLUL 3RL1A 5JOPE 2MFNA 4FQ1L 3T0EE 4NZRH 5HJ3B 5H2BA 1CFVL 3DX9B 5HYSB 2CKBA 1FFOA 3LHPH 2KL6A 5CSZA 4LLUA 1U3HD 4UT7H 5E6YA 3HR5A 1OQXA 4XZUA 1JF1B 5IF0B 4PY7B 2A1WL 3RVXC 2Z8WC 3NFSH 5E7FA 5D7SH 2E27L 3LKQB 1RJLA 1J1PL 1R3KB 4FQIH 4NC1E 1IKFH 1NDGA 1FRGL 3TNNA 4GG8A 3TH3T 4JO4L 5CJOH 1VERA 3MRHB 4JFDE 4ZTPH 5IVNA 4L4TA 1ZHBA 4P2OC 4P0DA 4FZ8H 3MLWH 1DCLA 2JK5B 5JNYA 5MEQA 2D9CA 1F8TL 2IANB 1OARL 1EVUA 1U3JA 2HG5A 3MGAA 4PTUB 4PJAE 2ZKHL 1AGCB 2VDKH 3RVVC 4K3EL 4NQEB 2P5EB 2FB4L 5GGQL 2AK4B 1MFEL 3W0WE 1BOGA 2Y7QA 2A77L 1PZ5B 2IBGA 2OTWA 4U31A 5JQHC 3S35L 5BZWA 2H2SD 3VH8G 1F02I 3C08H 3QQNA 2OSLA 3LEYH 4K8RD 2EDQA 5ID0B 2G2RB 4F3FA 4FXKA 1H5BA 1QLFA 4Z7WB 2HT3C 3W9EB 2JCCF 5HHVL 2YD2A 1T6WA 3CLFH 5C07A 5K9KB 3R4DA 4K7PH 5KVGH 3IJHB 4JANA 3JXAA 4UDUB 4PJEA 4IOIB 4DVRL 4ZXBB 5IFHH 2MCPH 1RURH 3G5YA 3AREA 4QRRA 3O3EA 2ADGB 5C0EA 1KV3A 3MV7B 1KPRA 4GLRH 5IROA 3VDBA 2C1OB 1AGFA 2DQIL 5CINL 1LK3L 1AO7E 1NGWB 4X6EB 5L2JB 1NEUA 3N85H 4PJ5E 1N59A 5F7NC 1QPPA 1V7ML 1FGVL 2CGRL 4XPHL 3QFDA 4G7YH 1NANI 2EH7L 1HK6A 1CDHA 3MQIA 3O9WB 4ZMAT 1J86A 4XCYB 5IW3A 1LO2H 5HGHA 1J5OL 5EBMA 5I2IB 2NY1D 3I9GL 4XMPL 2VR4A 4Q9CA 4KK5C 3DETD 5DZNA 5GGSY 3ZO0A 5KG9B 4DCQA 4JJ5A 3RWHB 3UTTE 1C08A 4OCYL 2XN9E 4GMTH 4XGZA 3MUGA 1FAIH 3EDDA 2DQHL 3C6LC 1QRNA 3E6HB 1MRFL 2DRUA 1CF8H 5EU4A 4BZ1L 3QI9B 4DGYL 5AG9A 1RI8A 4DGIH 1PY4A 2QSCH 3PIQA 4FQXA 4WNQA 5D5ME 1T03L 2X4OB 1JZ7A 4E42B 3PDOB 1MCJA 1ZOXA 2YPVL 1A7PL 3TWCL 5GGTL 5KVDL 4UT6H 4NPYB 2EIEA 1JRHI 4NBXB 4Q6IC 2X1XR 3BKMH 2VDNH 1NGQH 1UH3A 5T5NG 5C0AB 4LLYB 1NCAL 1NMCC 5ILTH 2NX5B 5DEZA 3UPRB 4PY7A 4Y2DA 1JPSL 3U0PB 2IQ9H 1N64H 1UACH 4AQOA 4Z7UE 1NLDL 1PDKA 3C09B 1EFXB 4MYWB 2AI0H 4LNVA 4OT1H 1F45A 1YEFH 3BN9D 4H0GA 4F9LA 3VA2C 1Q9KB 3QWOB 3B2VL 4ORGB 4X9IA 4MZ3A 1T89C 1OAXH 3U6RB 3LKOB 3MRHA 2BSTA 4PP2B 3F58H 4EI6B 4OD2B 1XF2B 3F65A 2R0WL 1NGZB 1KTRL 1JI1A 4BQ8A 2GSGB 3B3IA 2R2BB 1X5LA 1TZHA 3EDFA 4LFHG 2AEPH 1UEMA 4NN6B 3QR2A 4HCRL 4TOYH 1FZMA 4F2MA 2D9QB 1FLRL 4IS6A 4ZFFA 1NGYB 2ZSVA 4GW1B 5T3XH 3ZDZE 3OBAA 5L88H 1UM5L 2Z8SA 5IB4A 4F7MB 3KPSE 4JAMA 4UNVA 3RWDB 4OB5L 2HRPL 1RHHA 5ID0A 1G6RL 4F57L 5JUEH 1U8MB 3T65A 2YR3A 4Z7WA 2H6PB 5CP7B 2O5XL 3A67H 1QSED 2C7UB 2ZSWB 3IJHA 1JN6A 4UDUA 2JJTA 3EYUL 4FZEH 5JXEA 4M9PA 3PABB 5BVJB 1H8OA 2DMKA 1PG7L 5I18H 2N7BA 2J8UB 3KVQA 1HEZB 1G9NC 4H25B 1F4WH 3G9AB 4QRPA 1A6UL 5K9OB 3AM8A 1IL1B 4U3HA 1MRDH 3UPAA 2NNAA 1CGSL 1ORQA 1S5IL 3MCLH 3KPMA 3O9WA 3GSVA 3TZVC 1ZANL 3DSFL 3GSXA 1B0RA 4X7FC 4XCYA 2IMMA 3PWPE 5ESQB 3VG0H 3DYPA 5I2IA 4UB0H 4O2EB 4W4OA 5GISL 4X99A 3RWCB 5IUSA 2P5WB 3CFKA 4H5SB 2XKSA 4KRPD 5KG9A 4LCWB 2Y5EA 4A6YB 3O6KL 5C09E 4GQ9L 3DX8A 4XRCB 5EU6E 2DJUA 3HB3D 3O8XD 3L3KB 3ZE0F 1A2YB 1IGCL 4POZD 5GGTA 3C5SB 4OBRA 4EIGB 3OZ9L 4XNQB 4KVNL 4YHYB 1TNNA 4HJJL 1WFOA 4XPBL 2AKRB 3MO1B 1U42A 5BMFL 4EUPB 4DOHB 5GGVL 4XBPB 5D1ZC 2GJJA 3S37H 4RMUA 4NPYA 2EIDA 5EIQA 2VDPH 4YHML 3OXSA 3TEUA 1N6UA 3RDTC 3DVFA 1B0GB 4LLYA 3VWJC 4PJBB 4Z9KB 4EI5D 3D69B 2NX5A 4ZSOB 4NGHL 5FYKD 1BLNB 5E2VH 2PCPB 4NZRL 1UENA 5I75B 4QOKD 3KYNB 5E1AA 3LHPL 4G6MH 5T1DH 4UT7L 1KGCE 1CFQA 1EMTH 2BY0A 2F9BT 2NY3D 2P24B 4G3YH 2FJFB 3QWOA 4NJ9H 3NFSL 1KIRB 4YHNB 3U6RA 3LKOA 2LU4A 3DGGA 1BZ7B 4OZHF 2BNRB 5C08B 3E6FB 2VDLH 3MGTB 4FQIL 1IKFL 2CRYA 5F72S 5IVXA 1XGTA 1XF2A 4HCRA 2ICWB 1NGZA 1UXSB 1LP9A 1CICB 3VXSB 3D39B 4RA3A 1YN6A 1G0XA 1J8KA 4ZTPL 5C9JA 1W0VB 3HR6A 4X8JB 4MA3B 2B2XL 3WN5B 3MYZA 4FZ8L 3MLWL 1OY3B 1EAPA 4MAUL 1G6RA 4UTBH 4LQ1A 3NH7H 2VDKL 1QSVA 4X4XB 1NGYA 4GW1A 4KMTH 4ETQB 1OW0C 3GMOB 2D0FA 3TIEB 5DJYA 3BKCH 2UWEB 1IEAA 1TQCB 2VLKE 2H6PA 5E9DA 2IH1A 3FN9A 5D6CB 2J8HA 2PO6C 3VH8A 2A83A 2C7UA 2ZSWA 4KI5F 1ZA6A 1KTDA 3C08L 5DGRA 3LEYL 1RQ5A 3WE6B 2CJUH 2YA2A 4KZEL 3V8CA 5D71H 1IQWH 5BVJA 1DLFH 1B4RA 4NN5B 1IAII 3CLFL 5KVGL 3PL6B 3BE1H 4H25A 4NO0D 5L2KD 1N7MH 4NUGH 1B0WA 1ZVYA 2H2PC 3NZHH 5IFHL 2MCPL 1RURL 3UEZA 1F6FB 1L7TH 3H3BC 5JIKA 3CDYA 1CBVL 3CFEA 1YMMD 2RGSA 3D3VE 1Q72H 5F1KC 4F15C 4R3SB 5ESQA 3JTSB 4KKLC 2YPKB 3H9SB 4G7YL 5ITFB 3K4ZA 4LCWA 5D7KE 5GRYA 1MNUL 1NFIA 3JSSA 4XRCA 1LO2L 2D31A 4PJ9C 3MRGA 4HH9B 3DSNA 5D7JB 1JHKH 2IAMC 4Q0XH 1NC4B 4GMTL 5IMKB 1FAIL 2AKRA 4D0DB 5TE4H 5BXFB 2HLAB 5DMGD 3DVIA 3JV6B 5D1XC 8FABB 5T1KA 1MCSA 4DGIL 4FFZH 2QSCL 4H26A 1F4YH 5JW4Q 4DKFL 3I6KB 4JM2B 1H0DA 1MHPH 4QXUH 3MX0A 4DFIA 4NIKB 4PJBA 2FEEI 4OCSL 5HPOA 4ELME 4YNYB 4ZSOA 1BLNA 4WW2C 3AGVA 3BKML 2VDNL 3D18A 3PQYE 3QO1B 1HKLH 3KYNA 1NBZB 4GSDH 3IU4L 1QFPA 2C4FT 3ARFD 5ILTL 2F74B 3QUMB 2P24A 2HLFC 1FBIH 4Q97A 2IQ9L 1RZFH 1YEHH 1WUNT 1NUDA 4G8GB 3BP4A 4YHNA 1P7QA 1D9KD 3FMGH 2AI0L 1BZ7A 4OT1L 1YEFL 4CW1B 2NY4B 5GXBB 2X09A 2ATPA 4Y1AE 32C2B 1IM9B 1IFHH 1OAXL 2AP2A 5BCAA 5FAAA 2ENSA 4K3JH 3F58L 1J0ZA 4DUWA 4S1DC 2HFEA 2LVCA 4FTVD 3R1GL 3HE7C 1HQ4B 4HMDA 3UZEA 4L1HA 3DXAE 5C2BH 4ISVA 3ARDC 1TZIA 4WO4D 1F4AA 5L7XH 1ND0B 2EDLA 2AEPL 1JPGB 2YKLH 3MA7B 3SE3C 2W0LA 3ARGA 4NFBA 5DRZA 4KFZC 1QA9B 2GCYB 4TOYL 4J7RA 4MNHA 3CFCH 1U8LB 1DQDH 5T3XL 3FZUD 4MD5B 1XZ0A 2VYRE 4LHUG 2G75B 1K5NB 5FV1L 2JJSC 4S0TD 4NQDB 1J87A 4LMQI 5JUEL 5C71A 3HE6B 1DE4A 3OX8A 5DK0B 4Z0BH 1O5DT 5KS9E 4HPOH 3RWEA 4TPRH 2VISB 5IQ9A 2VIRB 3NIGE 4FZEL 5FYJH 4NUJB 5SWSB 4YDLC 3C2AH 4LSSH 3OPZH 3H3KA 2VUYA 4JFFB 4LPWA 1A6AA 2BNQB 1D6VH 2R1WA 3QEHB 4P5MA 4HK3J 4M7ZB 4OD3H 2FJGB 3JTSA 4CU8A 1DDHB 4UILH 1GZPA 4GXUM 4HZAA 5ITFA 3QG6A 3MCLL 5T33H 1R3LB 3MUZ1 3HG1D 4PP1C 4YGAB 2ZG1A 4QNPF 2G9HB 5JDSB 3VG0L 35C8L 4UB0L 3MNZA 3BX7C 1WWAX 3D6GA 4M4RA 1WFTA 1AKJB 2EIZA 1OAUL 5D7JA 4ZNEE 1I8IB 4F8TA 4DFHA 5C9KA 2EKSA 1OLZA 3HZKB 5IMKA 2VDQH 4CRPA 2DJ4A 2UZIH 1CFSB 2SEBB 3C6SA 3NA9L 4KTYA 5BXFA 3ME0A 5CLWA 2HLAA 2XTJD 2EE6A 2E7LC 4GAYB 8FABA 1F3RB 2V7HB 1CLCA 1LDPH 2IH3A 4YDKH 4JREC 4WV1C 2A6IA 3W39A 2FECL 3QDMB 5F7DA 4NRYA 4F58H 2OP4L 1HI6B 5TFSH 1TTUA 3S37L 3LB6D 5CZVH 3MRPB 5FO8B 2VDPL 1A1MB 2H32B 5EUKA 1QKZH 3QO1A 3CVHB 3VXRB 4LGPB 4NNYA 5EU7C 4O2FB 4JY6B 1X5YA 3DUUA 4R0LA 5HI4D 5E2VL 4Y16D 3TT1H 1DFBH 1DEDA 4G8GA 5EC1A 5IB3B 1FZOB 3OKOB 1AY1H 1UEYA 4G6ML 1TVDA 3ULUE 1OAKH 2P43B 2LV4A 3VWKA 4CW1A 3NIFF 3GFUA 5B22A 5LAXB 4G3YL 32C2A 2ZWLT 4NJ9L 2AV7A 2QR0A 4MNGA 2B7DT 2RHEA 3L7FA 4JPVH 4KUCF 2VDLL 2N4IA 4JHWH 1N2RB 3QYCA 2R29H 4HEME 4X5LA 4YHOH 4CVWA 5TF0A 3O4LA 3QIWA 1DQLH 3TN0D 1T66C 3MA7A 2JCCA 2BRRH 2GI7A 2X4TB 1RJYA 2J1KA 4UMGA 1T0MB 4CMHB 1OPGH 1UWXH 5EU7E 4UTBL 3NH7L 1BIHA 5AWNH 5I17B 4B0MM 4M5YH 1U8LA 2DD8L 3P9LA 4HJ0C 4KMTL 5GGRY 1A7RH 1B88A 1I85C 2P49B 1NKRA 2X1WL 1WSST 3WFCH 4NQDA 3V5DA 2V5MA 3BKCL 4JRXD 3LOWA 2N56A 5EORH 4HBQA 3BO8A 4KTDH 1XGUB 1L4IA 4L9LA 5FF6B 1VSCA 5I74C 2FD6H 3EOAB 2CJUL 1MREH 1Y6NR 5L6YH 1AC0A 4NUJA 3RY5A 3ILPB 2R2HB 1DLFL 1KN2H 4S11A 3BE1L 2Y72A 1J1OH 1N7ML 4PJXB 4RA0C 5F8QC 5TE6L 1PZUB 4ODWB 3NZHL 1DJSA 1DDHA 2KH2B 1HYSC 1L7TL 3QEGH 4U1MA 4HAGA 1T1WB 4GG6B 4KMQA 3W9DA 1R3LA 3PWLB 4UT9H 1YN7B 4P5TB 5TH2A 5JDSA 3OV6A 4C4KT 1KJMA 2E6PA 4XNMB 1BFTA 4MNQA 5C6TL 4HQQH 5J1TC 3SKOB 1AKJA 1T7XA 5IQ7L 4WFFE 4P23B 1UYWH 1I8IA 1NCWL 1KIPA 3GMQB 2AJXH 1UVQA 2EYTB 4QHUA 2BVYA 2NLJA 4HW6A 1NFDE 5D93B 1CFSA 3VXMD 3VXTB 4LF3B 5JLZB 4NZTH 2PXYA 4LASH 2V7HA 2VN7A 4ZFOB 1JHKL 3VFVA 4EIZC 5GRVL 1RMFH 1P53A 2YN3A 1MJJB 2DLEA 1X5XA 3PGFL 1JP5A 4U0RC 4DZBA 2HJKA 5TE4L 3IDIB 3VGBA 1V3JA 1J0HA 2QLVB 4MJIE 1WC7A 4G9FA 5A2FA 5DR5H 2PKDA 4MDIB 4LPYA 4FFZL 4IMKA 3MRFB 1LE5A 2VQUA 1F4YL 3IFOB 2YS4A 3RGVD 1U2HA 2PTTB 3MJGX 3TCLB 3VFRA 4C54A 1MHPL 4QXUL 3SHSA 4L4VB 4O02H 4BM7A 1M7DA 2XWJB 5DT1H 1LMKA 3OTTA 4NQXB 1DR9A 5IR1B 1XCTA 3MC0A 5C0BE 5IB3A 2YXFA 1K3IA 1HKLL 2DWDB 4I3RH 4GSDL 3ARSA 5F44A 1P7KA 4MJ6A 4NZDA 4RAHA 5HI5C 3V9FA 4ODSH 5LAXA 3VRJA 1RZFL 1YEHL 5F8RC 2NY5H 1CTNA 3L3IA 1FL6A 1MHEA 2WM0A 3FMGL 4J3XA 5I15L 1A9EA 3DX6A 4CVUA 3LIZH 3JVGC 2XFXA 1IT9H 1C12B 1IFHL 1IARB 4ZDHB 4DVBA 5E4EB 1AGDB 5EBGA 1GRWA 3BD5A 5I8CB 2X4TA 4DKAA 5C2BL 1T0MA 3DV6A 4S2SA 5C0CB 5I17A 5L7XL 4JFYB 3D25A 3UC0H 1HSAB 3MLTB 3I02A 4L3ED 2FLRT 12E8L 3VGGA 1QLEL 3OWEA 4JO3H 1MCFA 2J88H 3DNKA 5HGGS 1HHJB 2RR3A 1FJ1B 1M05A 2DDQH 4IRSD 5HHMD 4XH2B 1YDPA 1DQDL 1ZTXL 3MACL 5HYFA 5FF6A 4XXDA 4LHUA 3GJFH 5FKPB 2Q20A 1OP5H 4OQ1A 1BEYH 4Z0BL 3OHXB 4LEOB 2C1PB 4HPOL 2VLJE 3J7HA 1T1XB 1JI2A 1HDMA 5FYJL 3TO4B 2A9MH 2G60H 3QXVA 3C2AL 5EA0L 3IYLW 4LSSL 3OPZL 4M1GL 5K9JH 3L9RB 4XCFH 4M7KH 2WIIB 1DQTA 2HKHH 1MRCH 4P5TA 4OD3L 1DN2A 4ESKA 4M1CC 1I7ZB 5DXWA 5GZNC 5I66A 4UILL 4OLWH 1HHHB 4OAWB 1BJ8A 4ZPTA 5D7LE 3L3OB 5T33L 4M6NH 2EYTA 1N0LA 5KSVB 4JFZH 3Q0HA 3C60A 5GQBA 5JMOC 1XT5A 3HLAA 4LF3A 5JLZA 1K8DA 4P57A 4MAYD 5J06A 2NXZC 2VDQL 2UZIL 1LWRA 3IDIA 4KK9C 3QULA 2W65B 5FK9A 5DWUL 4MDIA 4OCWH 4YDKL 3MNWB 4LNRA 3I75B 1P4BH 4TVPH 4R7NB 3QEQD 3RY6C 1J12A 4F58L 3TCLA 1QO3A 5TFSL 1FVCB 4L4VA 2JELH 2VSCA 4NQXA 4OZHA 3NN8B 5CZVL 5HHXH 1HE7A 5AZ2H 3K8LA 5IR1A 2DYPD 3QIBC 3OAYH 1ZLWH 4PGEB 3QAZB 1H8SA 1QKZL 2LQRA 5IHUH 4MSWB 4OUUB 2A0LD 4YR6B 5I1IH 2Z4QB 3WDIA 4K23L 5I30H 3LAFA 5DC9B 5LBSH 2OTPA 1ACYL 1DFBL 1KCSH 3TT1L 4WEMB 5CEZH 1UKSA 3H42H 4RBPH 4TNWF 3ARXA 4AY0A 3PHOA 4NO3B 4H1LH 4W68A 3P9MB 3RTQC 1OAKL 4PJDF 3GKZA 5DFWH 1DZBA 5F9AC 4B50A 1QG3A 2Q6WA 3QFJE 2R2EA 1NDMA 1G7HB 1RK0B 4JPVL 4K9EC 1GCFA 1QSFB 3BOVA 4LCUB 5ACMA 1AGDA 3OGCB 5CBEB 2XY1A 1CZ8H 2R29L 4YHOL 1UM4H 3L3HB 3MBEC 1DQLL 5TDPA 4TRPH 1Z2KA 3RUGF 2CR6A 3CH1B 3LPWA 3SKNB 3FFCE 2FJHA 2BRRL 2ARJQ 3ARBA 4C56E 1DANU 1FJ1A 1OPGL 5FEBA 4ZS6D 2VR9A 1B90A 5AWNL 2HJLA 4M5YL 4XH2A 1A47A 1J8HE 3GBMH 1MIMH 3E3QC 2EDYA 2BVQA 5FKPA 3WFCL 3GHEH 4FQQA 1U93B 3REWB 5EIIA 2GSIB 3CH8A 1UXWB 5EORL 4V1DE 2WINB 3S5LG 2JJVA 2BXZA 1HHIA 3OHXA 2C1PA 1WFNA 4QXTA 4JFOA 5C0FB 4Y5VB 2FD6L 1XFPA 1U36A 4G6AC 1MREL 5L6YL 3SDXF 3MFGB 4N9GB 3WMSA 5ACZA 4DQOH 2X2YA 2CIIA 4IJ3B 3QUZB 2WIIA 4LSQH 5J4MA 1WLHA 5F7KC 1MI5D 4XBGA 4JFPA 4UAOB 5AZEH 4XAWH 1U3HC 4GBXD 1NAKH 3H9YA 3JWDH 4WJ5B 4X98A 4LSRH 1HHHA 5AUMB 1NMAL 4OCXH 5I1GL 2VABB 4WW1B 5CD5D 4P2QE 4M4PA 1TPXC 4NQUA 5KSVA 4ALAH 3X3FH 5HYJA 3E3QE 2C3WA 5DSCA 2VLME 3FQRB 1KBGH 4HQQL 5MEOA 2GEEA 3FO1B 5GSVA 3QDGA 1JHTA 4Z5RA 1I1AD 3RX8A 5TPWH 2AJXL 1G7QA 5KVFH 4NHUA 3BUYA 2EYRB 5MI0B 3EGSB 2XZAH 5I1JH 1NMBH 1Q9OA 4NZTL 1AXTL 2W65A 4LASL 4DJMA 1EJOH 3FB7A 3BEVB 3I75A 3IFNH 1D5ZB 3GZKA 3QIUD 3VXUD 1WTGT 1Z9SA 1YNTA 1A9BB 3OR7B 3SDDA 1FVCA 2GTWA 3MBXH 3BGMB 4GW4B 4HXAL 3NN8A 1AQDB 1XGRB 1MFCL 1U8HB 2H2SC 4MSWA 4OUUA 1XIWD 1ES0B 4YR6A 4O02L 4H1LG 2NXYB 4K8RC 3M07A 3WFZA 1Z9LA 4NN7C 4I3RL 2R15A 3HC3L 3P9MA 3TA3A 3PGCB 2X4UB 4ODSL 5IHZA 3MR9B 3GK8H 1ZGLB 2NY5L 4WDIB 4JFHD 2DLHA 2HFGH 5IB5B 4X6CB 5BOZG 1S7XB 3OGCA 5CBEA 5ANMB 3WDJA 4S10A 1OF2B 3MNVB 3U48A 4HWUA 4HSQA 5F7HA 3CH1A 1T7VA 1Y6KR 4Z95H 2ZUXA 4JPIA 4QRUB 1JE6A 1IM3B 1SYSB 5IW1A 3DETC 2NTFA 4X4ZA 5HBBA 3R0NA 4XCCH 3ZMRA 5B4MD 1R5WB 2WBKA 1T2JA 1LQSR 4JO3L 4OLUL 3SJVB 2DDQL 3F6LA 3REWA 2GSIA 5D1QA 1CD9B 1RIHH 2WINA 5K33A 3SE4C 1CYGA 1PKQA 5DZOA 1MCDA 2CLZB 2AXGB 4Y5VA 2DQTH 5ENWA 2A6KB 5CFHA 3BFOA 3O81A 1CXKA 3EJYD 3IF1B 1GOFA 4G9DB 3C9NA 4O2CA 4CUCA 1I3RB 5DFVD 5C07D 1BJ1H 1T83A 2P1YA 5EDXA 5CLTA 5HDLA 3UDWC 1INQB 2A9ML 3SKUD 2G60L 3MRKB 1D7FA 3TM6A 3GSRB 2NCMA 3ARED 4QRRD 4XCFL 1X5KA 4M7KL 1J11A 3EOBB 4N0CD 2HKHL 3S36X 4LPUA 4PRNA 3UYRH 4EN3A 1BQSA 4FFYH 3BGAA 3HKFA 4Y4KA 3BN9C 3RWJB 2VLLA 3TFKD 1GZQB 2CDFA 5L8JB 4M6NL 1ITCA 4RGND 4ENEC 4L8SA 4JZJA 4JFZL 4JZNB 4F9PA 2ESVB 3H0TB 1E28B 2X05A 4YC2C 2EYRA 3QXDB 1OAZH 5HHQB 2J5LB 3ZHKA 3MODL 1CFNB 3DVGA 3E2HB 4AG4H 5CD3A 2OM5A 1FV1B 1BVLB 2D3VA 2Z31D 2E6JA 1RZ8B 2XNAA 4NBZB 2V2TA 4OKVB 4JQXC 4NRZA 4UDTA 2XWBB 1K6QL 3MUJA 3OR7A 1IAKB 2NW3B 1QRND 3CD4A 3HI6H 3BGMA 5DD1L 4GW4A 4I2XA 4LLAA 1ETZB 4OZIB 1P4BL 4PJHB 4TVPL 3IDGA 3QXTA 4FQXD 1KLGA 1ES0A 4W6WB 1NL0L 1MVFA 2W0FA 5HHXL 5AZ2L 1DL7L 3KG5A 3PP3K 1D6EB 2WANA 2YMXH 1L7IL 2VQ1B 3EHBD 4JQVA 2P47B 3KXFA 1F42A 1EERB 4NCC1 5I1IL 2Z93B 3ROOB 4OF5A 5LBSL 1URLA 1KCSL 1C7TA 4Y2DD 3CC5A 5CEZL 1LILA 4WDIA 3CXDH 2OJZH 5IK3B 2XA8H 2Y1VA 1Z9MA 3BPOC 4S1QL 5GJTL 1RUPL 2W9LA 5JA9A 1ZLSH 1GGCH 5DVKA 1AC6A 5ANMA 3LQZA 1OD7A 2VZ1A 4JPKL 3OKKA 1MLCB 5DD5H 1MJ8H 4NCC2 2Y25A 1Q0XH 4YK4B 3MNVA 2IANE 3V6ZA 4XP5H 4E41E 4KROB 3IU3B 4GLRI 4IOFD 4M7JH 3HZYB 1EEYB 1SYSA 2OCFD 1UM4L 4Y88A 4KRPC 4G6KH 3OQ3B 3WS3B 4TRPL 1DEEB 3LS5H 4PJIE 5F7YC 1T04B 3GJFA 2DTMH 1QQDB 1JL8A 3ZKXB 1RPQA 4I0PB 1VDGA 3BEWA 4POZC 4IIQB 5FGBC 3QG7H 4GXVH 5IVZA 3GBML 4NZJA 1K3ZA 2AXGA 4NP4H 5CGYD 1PY9A 1TTFA 3GHEL 4DW2L 2J4WH 5HGBB 4PJGE 3L1OH 3S5LA 5FYJU 1NUFA 3IF1A 5EIVA 2ATKB 3ARQA 3GDBA 1RUKH 3QHFH 4ZFZA 2LFGA 1WCBA 2W9EH 2QKIB 1B9ZA 3NCJH 3O2DH 5ESAB 3G6JE 1HKFA 1E27B 1S3KL 1OOAA 2CDGA 2JIXA 3EO0B 3K46A 4I18A 4LSPH 3GJEA 4ZXBD 3D85B 3FQUB 4DQOL 5JXED 3GSRA 3DMMB 1KYOK 2O61B 7CGTA 3EOBA 2P46B 4K3DH 5AZEL 5CJQH 4XAWL 3X12B 4JGUA 3JWDL 2DIAA 2ITDB 2NY3C 4LSRL 4QRPD 1D5MA 1KACB 1YMHA 4S1SH 2ZOKA 4OCXL 5H37H 3FT3B 1G9MC 1LEGB 3U46A 4TSBH 1AH1A 1T7WA 3EJJX 3O9WD 4JZNA 2ESVA 4ALAL 4K2UL 1E28A 2H9GB 3X3FL 2IPKB 3QXDA 2FHFA 5HHQA 1KBGL 4HUMB 4WTWA 4XVSL 4G8EA 2MQ3A 1CFNA 1FV1A 5E0QA 4AZ8A 4F37K 5TPWL 3V0AC 1OCWL 4LDEB 1U8QA 4OKVA 5IP4A 2UYLB 3QPXL 3E0GA 3W5MA 2XWBA 5KVFL 3CX5J 2XZAL 5I1JL 1NMBL 1IAKA 4KDVA 2OQJB 4Y4FB 5MEPB 3IFNL 4PJHA 2RIKA 1JGLH 2YRPA 5FYKE 3VDCA 25C8H 1DLHA 2VLRA 3CPLB 4LSVH 5J7CC 1GAFH 3KWWB 3MBXL 3RIAF 1G7IB 4P99A 2ICEB 4OFPA 3S34H 5ALBH 3EYOA 5D2LE 4HWBH 1D6EA 1E4XH 4RMVA 4Y19B 4OI8A 4H1LA 4GKZB 2X7LA 3WNOA 1A5FH 2NY6B 4GKSA 1G9EA