3US1A

Structure of p63 dna binding domain in complex with a 22 base pair response element containing a two base pair "gc" spacer between half sites
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
194
structure length
193
Chain Sequence
SPSNTDYPGPHSFDVSFQQSSTKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein 63
publication title Pliable DNA Conformation of Response Elements Bound to Transcription Factor p63.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/dna
total genus 40
structure length 193
sequence length 194
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3us1A00
3Q01A 3WU1A 2VUKA 5G4NA 4QO1B 1EAQA 1TUPA 3WTVA 4IJTA 4A63A 4AGPA 2PCXA 3IGLA 3TS8A 2GEQA 2J1ZA 2J1XA 1E50A 4L18A 4MZRA 4L0ZA 3D05A 1KZYA 4GUOA 1IO4C 5LGYA 2BIMA 2P52A 2OCJA 5AOKA 1HU8A 4LO9A 5ECGA 2J1YA 1HJCA 1GZHA 1GZHC 5G4OA 1YCSA 2J21A 5KBDA 4AGQA 3D09A 3WTXA 2XWCA 5ABAA 3EXLA 1CMOA 2BIPA 3WTYA 4KVPA 4IBUA 2BIOA 2IOMA 2X0WA 2BINA 3D0AA 4IBZA 4IBSA 4GUQA 2J6WA 5G4MA 5A7BA 4IBYA 3VD2A 3US0A 2H1LM 1EAOA 2AC0A 2IOOA 2ADYA 3EXJA 4L0YA 4MZIA 5AOJA 1TSRA 3QYMA 4AGLA 3KMDA 4HJEA 2RMNA 2IOIA 4IBVA 2X0UA 3VD1A 4LOEA 4AGMA 3VD0A 4IBWA 1T4WA 3Q06A 4LOFA 5AB9A 4AGOA 3Q05A 5AOMA 5AOIA 2AHIA 3D08A 1HJBC 3WTWA 3WTSA 4G82A 2J1WA 5BUAA 3WTTA 2FEJA 5LAPA 3KZ8A 2J20A 3US1A 1CO1A 2X0VA 3ZMEA 3WTUA 2MEJB 4G83A 1EANA 4XR8C 1UOLA 3D07A 1H9DA 4IBTA 3QYNA 1LJMA 3D06A 2YBGA 5AOLA 2ATAA 4IBQA 2WGXA 3IGKA 4AGNA 2BIQA 2XWRA
chains in the Genus database with same CATH superfamily
5B39G 4ZO6A 1L7TH 3CU1A 4WO4A 1UGKA 4PWGA 1AKPA 5AW6B 2EACA 5F1NA 5BRZE 1L9QA 5IMKA 3SO5A 3WO3B 5A7EA 3E3QE 4PGZA 5E6SB 4HHWA 4KZDH 2NY3D 2VW6A 4U1KB 5A16A 2IDUA 3QIWC 5FC9A 5GHWL 4I0PD 4R0LA 4Y4HB 2E74C 4C54A 5E4IA 1Z66A 1KYFA 4MKMA 1DANU 3B83A 2WLZA 3DVFA 4TTDD 2XVLA 5I0WA 3FL7A 1SJVA 5HJBA 4DQAA 2Q2EB 3GSUA 4IOFC 4BZ1A 4L3FA 2VDRL 4JFDD 5L9DH 1NBCA 5DVLA 4XN2A 3N5AA 4YMPA 1M6UA 4XODA 2KERA 5T33H 3Q9PA 3VG0H 3US9A 4TSCH 3D2TA 2W60B 3O3EA 4PBVC 3SJVB 5C0AA 5JR1H 4AEIL 1FV1A 4NUGH 5DUMH 2EJ1A 1BG1A 3QUXA 5IOPB 3FU8A 4NQEE 3FU9A 3ZMNA 1XF4B 3RUGE 4N0YH 1KTDA 4YHMH 4ENZA 2IH3B 1S9WB 3C08H 4XAKD 5CJBA 1O6TA 4WWKA 3RE0A 4ADGA 3WXWL 1PZUB 2WSPA 4NEHB 1ES0A 3OMAB 4YIQA 1D5IL 4R7XA 4HVBA 4BK4A 3GIVA 5IVXF 5KBPA 4NKIH 2Y5QA 4I2XB 5T5FA 3DA0A 1C8PA 2X12A 4LSUH 1D6VL 4R7DA 3MV8B 3W56A 4PP1D 1GTNA 4PJ7F 4FA7B 2V7NA 5D6DC 2VDNL 1RLBA 3GNMH 3SGJC 3IJHB 1NFIB 4Y5VB 3SGKC 3VE0B 3AG4B 3NCBB 5F1OB 1KB9J 5C09D 3QJTB 4TPRL 5IBTL 3RL1A 4NKMB 4XP1H 3O3BA 1CICB 3SKMA 3EBAA 1LP9E 2FATH 4QHMB 4RA3A 3H9SB 4IKLA 1EAPA 2R2BB 5AUMB 4Y19D 1A9BA 1MHPH 1YEFL 3HHSB 4L4VE 1QAWA 4NI6A 1UB5A 3WMPA 2E86A 2I7SA 5FA4A 2PMZA 2X88A 3UC2A 2YBGA 3LPGA 4B6ZA 4PY8J 4Y16D 1SJMA 3ULAB 1EV2E 4C4KT 3IDUA 1S8DA 4NOFA 3RL2A 1SVZA 4L3EE 3BIBX 1RZ8A 3DTXA 3OQRA 3F7VB 2A9DA 1S7RB 2I7OA 2WVSA 3MUZ1 3U6XS 1ET8A 3CFEB 2R23A 3HZKA 3QPXL 5LKNA 4HHAB 4PRDA 1NM4A 4GKNA 3VFOA 3BP5A 2E46A 3VQ1C 4FQLH 1UT9A 3DUHA 3ULUL 1XF1A 2FBJL 3FSVA 1JZ3A 3TESA 4K9EL 4MS8C 1ZVSA 1CJYA 3P9LB 4QEGA 5ACZA 5DZOA 3LKRA 1S9VB 3HUJB 2JKXA 3Q0HA 4U1SB 5ISZA 3VFRB 2FT6A 4XZUA 1L3WA 2Z8VC 1HINL 1MZZA 4RGOL 1J5IA 3IYLW 2NY3B 1FGVL 2YPVA 4OM1H 4UIMA 3T3ME 4I0PB 3X13A 4ANVA 1MLCB 4WI5A 5I1JL 1CG9B 3BWAA 3BLKA 4KDTA 5HVWA 2XA3A 2EDTA 3OAUL 3O6FA 5M95B 4LSSL 1FAKT 1AXSB 5I6XB 1C8QA 4E5XA 4ZZFA 1JGIA 4JFDB 3NACH 4K73A 4O2EB 3PHQB 3KDPB 1UA6H 5DJ6B 2BOBA 5EBGA 5MENA 1KGIA 2QDWA 1UKSA 1O9VA 3CE1A 3X17A 3P0GB 4PS4H 1BQLL 1JCVA 1ZRUA 4XMKL 1KYOJ 1CE6B 1NGXA 4WKXA 5DUPL 1QSEA 3D18A 3S2CA 1FLRL 4Z3IA 2ZKWA 5SX5K 2OBGA 4C58B 2KLRA 3D39D 4HS3A 3MDJA 4JPVH 4LCWA 4YLQT 5HI3D 1MREH 3PABA 4LKXA 5D7LD 1FUNA 3WKYA 2V17L 3G6JE 5JOFB 1JNHB 2R0ZL 3Q06A 2B5IB 4LCUB 3I2CL 4XX1G 4NC1E 5C0DB 2CR0A 5DT1L 4OLUH 5T1KA 4U1IA 1LE9B 2CDEB 2UZXB 3U0TA 1ACXA 1HKLH 2WTOA 4N28A 5GZNA 4WHYG 1LWHA 1Q9OA 3VO0A 2WWKT 1GR7A 4LEOA 2FEJA 3ETTA 3T0XA 5GS1A 1F42A 1X5JA 1RI8A 1PYWB 5FB8B 2GTWB 2NXZC 4MFHA 3ZO9A 2ZWYA 1OCOB 1ZDSA 5DEFB 1S5HA 3H6JA 3FFOA 4BHUA 1FBIL 2PNDA 1HOEA 1M7DA 4H5SB 4P5MB 1B3JA 4G83A 3W2DL 4XBGA 1RIVL 1JFQH 1BOGB 2X70B 3IS0X 4RQQB 4UTBL 3TH4T 3SKJH 3MXWL 4Y0GA 5DHDA 3CHOA 4LHUA 1XCQA 2VXVH 2BNUA 5KSAC 1WA2X 5LWYL 2JJWA 4M7JH 4NYLA 5C09B 3TVMD 2Y36L 1CT8A 4FKEA 3OC8A 3S8FB 5TQ0L 3FTSA 4Z6AT 4WFGD 3HRZC 5CMAA 4GLRI 4Y19B 5SV3A 4LP4A 1PEZA 1VFMA 3HTLX 1PPIA 1I31A 1O6SA 1HILB 1U3ZA 2D3VA 2W0LA 3BKJL 4L9LA 3IM1A 4DGYH 4PW9A 1TT6A 2CIIB 4Y16B 5KYYB 4C56A 4WGWB 3WAJA 1KZYA 1DVSA 1O5DT 1RZQA 3AXHA 3HN8A 1TU2B 3L4UA 2VZ1A 1E27A 5KAQF 3D33A 4ECNA 2WWMD 4ODVH 4QD2E 5KVGE 3KVDD 1BG9A 1C1EH 4RFEB 1UACH 4F33A 3A6OA 1WQVT 2R7EA 1PZCA 1TJGH 1TETL 1NMCC 3RGVD 3F64A 3QQ9C 5DRNA 43C9A 1HJCA 3FQWA 4LLMB 3P11L 2J12B 5I1EH 5LBSL 1BQKA 3CDZA 1IGCL 4FERA 5CZKA 3VGFA 3MBEA 2BIPA 3C9NA 4F9LA 4NXKA 4QYOB 2XYCA 1U8PB 4P5TC 3VSUA 1Z9MA 1KMGA 4NLHA 3RWEA 4JAMB 5LCVL 3VD3A 1E4HA 3AY4A 1WZAA 3MODH 2YXFA 3TM6A 1F4XL 4GW1A 4QHUA 2NSMA 3TBVA 1NJ9A 2ITCA 5F7WC 3RWDA 3N42F 4DHLA 2NZIA 5JHDB 1LO3H 1XAKA 1M1XB 4NQSB 3EYUL 4J8RA 3PWLA 2I26N 3S36X 3T2OA 1DEEA 1YAZA 2BPBA 1RJYA 3MBXH 3V4LA 1CIDA 3OAZH 5CEZH 3I3EA 1AC6A 3BN3B 4FG6C 4PGEB 3TCLA 4AH2A 1RP8A 4PGCA 4DKEL 4X6DB 3CXDL 1NMBL 5I0XA 2E9GA 4HV8B 2F19H 2VZOA 1OD7A 2NXYC 4QXUH 5BW7A 1T03H 2ZUXA 4X99B 2X2HA 3VWJC 4RCAA 5FGBA 1N19A 3ZTCC 3F7KA 4YHNB 1L9NA 1U8QB 2IQ9L 4FCAA 1U8JB 1FAIL 4HBCL 5IJKA 5BUAA 2VXTL 2VUYA 3DV6B 2F8VA 2ZXBA 3BAKA 3D39B 1XL4A 4QRTB 5E0FA 3AM8A 1AZUA 3PP4L 3QDMD 4JHVA 3FT0A 3MRHA 3HI6L 4MGXA 4ZQKA 4ODSH 1ZGLM 4JR9L 4YL4A 3M1BA 1JZHA 4OI7A 2HN7A 3LNGA 2AJSH 5HHNA 4PV1C 5D8JH 1F18A 1PIGA 4JO4L 1F8TH 5IB3A 1EXHA 4YC2C 3BPLB 4I3GA 3V0WH 3WFHB 1LE5A 3FU5A 3CVBA 4GQ9L 3QEUA 2PCPB 4G11A 4HETA 4Z7NB 3D25A 4MMXA 3QUZC 4N90E 2Y1ZA 1SUJA 4W6WB 4JDVB 1LK3H 5FO8B 4YGVB 4OCMC 3FQTA 3LD8B 4OUUA 4MS6A 4FXTA 1A6WL 3WNNA 2ZONA 5IHZB 3PJSA 3ARDD 1EAQA 1NL0H 4D0DA 3O9WD 3BAYA 3RX5A 2O72A 3D3VE 1BVKB 2DH3A 4QCIA 4FXKA 4PS8A 4DKAA 3D05A 1ZK5A 4FTVE 4R96A 1TKWA 1JIBA 3ALPA 2I5YH 1OAKL 1XDTT 5EZLA 3A67H 3MV7A 1K8IB 3LX9A 5EOCJ 2EIKB 2BP0B 3TIEA 4XO4A 4PJ5E 1U8NA 3LEVL 3UBXA 3L3JB 2VRQA 4PB9H 3QW9A 4I48B 4QI3A 2KL6A 2HG5A 3GMRA 3N0AA 4PJEB 1XD0A 3QRLA 3PWJB 3NIFB 4PRHD 4Q7DA 4BZ1H 3VXQB 4OCNC 3K0YA 1FIEA 3RVTD 1QEWA 2MKWA 4LPCA 2DOCA 2YD2A 3VRIA 5B4MC 2F5AH 5INDB 2VDKL 3ARRA 2L8AA 3MLYL 4Q9RL 1JPSL 5TF1H 4QLRA 4JEGB 5ALCL 5IR1B 3LYRA 3RGVB 3X3FH 4ETYA 1AC0A 4D0BA 4MNHB 4EKXA 5K1JA 4NO3A 2KT6A 2HVJA 4XPGH 4XXWC 5F96H 3TV8A 1G7PA 4LNRA 3TYGH 4G7YH 2A73A 4KUCF 4K5MA 2DY2A 4HWBA 2AEQH 1J0KA 2B0SH 5IFHH 4NZ8A 5E08L 5GRJH 2Z8RA 1DLHB 3MFFB 3LRLA 3AITA 3NIGE 1URZA 1QI4A 2QSCL 4J12A 2DQUH 5L8LB 1QTPA 5I6MA 4TVUA 1E9OA 4WEUD 3BAXA 2C9SA 3VD5A 4BWWA 1MRDH 5T5FH 1R6VA 1NEZA 4JFWA 4MAYC 1KBWA 1F6AB 1N70A 1YQ2A 2BVOA 3ATDA 1IGTA 3HMXA 4EPSA 2R0WL 1KPUB 2B1HL 1QSFD 3UO1L 3VM7A 4DCQA 2GSIA 3H2PA 5K59F 2Y5TA 2YMXL 4YSEA 5IHBA 3O4LA 4CAGA 2R83A 3IFLH 1E3XA 3KPLA 5TGBB 2BW5A 4ZO8A 4AIXA 4G42A 5HDQH 3U48A 5I1LA 4P2RD 5TDNB 3QZOA 4D7BA 4FI6A 1M7UA 3IF1A 1JHKL 4MMZB 1KLFA 1JUFA 3V52L 4K8RL 3D85D 3QWOB 5B39B 1VDGA 4KK5C 1VGKB 3P2BA 4HSQA 2WN3A 1I85C 2O5YH 3QDMB 3U2IA 5J9PB 4JKKA 3DUSA 3TFBA 1CGXA 2OTWB 5EFIB 4OVUA 3IRZA 4NNXA 3T4AB 2NNCA 3GMLB 5HGAB 3QJFB 5JQ6L 5SX4H 4HJJH 2OMWA 3T6ZA 3U4BL 2VJXA 1EEZA 5KTEH 2C9RA 5D2NC 2AJYH 2FT7A 2KLTA 1W0VA 3LNDA 3BFQG 3X14B 2B1AH 5F3HA 3GMPB 3NCEB 2B59A 4XAWL 2AV7A 3O0RL 3PPEA 1S7XA 1A6PA 4GY4A 2ZOTA 3S3CB 5IQ9B 5JHLA 2ZG3A 5EO1A 4S1QH 3DJRA 5J6GA 1MJ8L 1DO5A 3K2IA 4OFQA 4F8NA 3R0NA 4AK2A 1XGRA 1GH7A 3ARDB 2H3NB 3LKOB 3H2WA 4DP4X 3BRGC 5HYFA 2BVPA 5F7BA 1EHLL 2BOCA 2DKMA 4UTAH 3AMLA 1HSAA 2ZXAA 4N2HA 1UCTA 2DQCH 1G43A 3BQUC 3HG3A 5TDPB 2CNYA 2YPVH 1XH2A 3KL5A 1J8HB 5FO9A 1CMOA 4G6JL 4KUZH 2E6JA 1GOGA 1UCBH 3PE9A 3PPSA 4D3CH 3CN0A 1ZLSL 4BINA 1DVXA 4Y5YC 2WC7A 1T7VA 1TTBA 3NJXA 1FG2A 1J9SA 2EDWA 4PRHB 5CFHA 3EGXB 2FWOA 2VZUA 3NJMA 1A7QH 2CKBA 3V4UL 1BLIA 3ECBB 2NNRA 3C09C 3I6KA 2W0FB 4W6YB 3WXVL 1HS6A 2LLGA 4W9HC 5F21B 4XCNA 4AYID 4B9GA 2R9HC 3PREA 2X05A 3IAGC 5BMFH 1G9ML 1EQWA 3FN0H 4XP6H 4N9GA 5B3NA 1DQVA 4PS3A 3OJVC 3C5ZC 3BGFB 2Z4QA 4LESA 3E2HC 4KPHL 1AGDB 4FKHA 1WH0A 2ZX6A 3I9GL 4N8UA 5I19L 4HPYL 4N5ED 4HSAC 5EWIL 4LCCB 3ABMB 1Z3GH 2H6OA 4JRYA 1CL7I 5I75C 3V5KB 4PRPE 4UYQA 4WSKA 1S7SA 3SE9H 3WG7B 3KVPA 4MDJB 1PNCA 3EBHA 5E1AA 1G7QB 1AXTH 3H3PL 2HT2C 1L7IL 2PTTB 3MRFA 4BGLA 3WIFB 3TN0D 2PWDA 3VFWB 2IWKA 2D0FA 2Y3NA 1I1AD 4G8GA 1SBSL 1H5BC 2V5MA 4KKLC 3T0BA 1H3WM 2MSPA 3SGDI 4P46C 1ETZA 2X1WL 4DERA 3MJWA 4NSKB 2R69L 3GXDA 4J1UA 3PV7A 1QSFB 3DROB 4P59L 2JB6A 4WU5B 3HG5A 4QRSB 3PWPA 1RU9L 5CD5D 2ATAA 1ZXQA 2AMGA 3ATAA 1KPVA 2ZOLA 3BVWA 1Q0YH 3GBNH 3VFNA 2LFEA 4P2RB 5CN1A 3HZVA 1N0LA 1TO4A 4GRLD 5EBMA 5HD8C 3UJJH 4LIQL 3B7TA 3ARVA 5ADPL 4LZKA 3UAFA 3BT0A 4MZ2A 3CWGA 4ONGL 1G9NC 3D85B 3P0VL 3KG5A 1N68A 5HJ3A 2F68X 3U46A 3NCJH 3ZDYE 5JNYB 5CINH 3B2UD 4D0CA 5D7IB 1VFBA 5B8CC 1DCLA 1R3JA 1HL4A 3F00A 2N59A 1AAJA 1QACA 5I9QB 1YY8B 4QRPD 4I18B 2UV3A 3UAEA 4WHDA 2DQIL 3DURB 1ZHNB 3FTXA 3MJ8B 3U1QA 3ZE1F 4K94C 1TENA 5H94B 5E94B 3V0AC 5E99H 1OE1A 2JCCA 3LY6A 3TH2T 1ZA6B 2QSTA 3W38A 2IAMA 3DWTA 3J2PA 2HKFH 2J21A 4UI2A 2AZAA 1GS8A 5G4OA 5BS0B 1N64L 5LNGA 3S9DB 3MLWH 5EBLB 1BAFH 1ZJAA 3NSFA 2ZKYA 3TCTA 1UWFA 5F71A 4M6OH 4WENB 1XGTB 2AQSA 3TU6A 2DQHL 1AQHA 4YHPA 1I8MB 3QDJD 1EH9A 1Q72H 4BE5A 1CDHA 1MELA 2OL3L 3LZNA 1GOFA 1A6UL 2AP2A 1DCEA 4YDNA 3VXNB 4ZW6A 4BDVB 3N9GL 1E4WH 3IGAB 1FFRA 1QLRA 1SOQA 3I6GB 5FOBB 3LKQA 3DMMC 5J12C 2VMCA 3GRWL 1CGYA 4NNPL 3RKPA 4LBEB 2AAAA 3A6CL 3OM3B 4HJEA 1DBKL 1YZZA 4RGNE 3VSQA 3TZVA 4UIKL 2C4FU 3FT3A 1FPTH 4UT9A 1NBVH 2H47C 5AENA 4EF3A 4C47A 1DQJB 1I1RA 3ORJA 1KTLA 1QA9B 1BXXA 1KJMA 1LDPL 2RACA 2ESVD 3AMKA 1TQCC 1ULVA 3HZMA 1LO0L 2AQTA 2XQYA 3W0WE 4Z7NF 7CGTA 2F5BH 2FYYB 4TUJA 5E2VL 4C59B 4HEPG 3TT1H 5C9JA 3ULUD 4Z7UA 3BP7B 2WXHA 2K8MA 3VG9B 3HLKA 1S9XA 4XPHL 5F9OH 5ANMB 2XWJA 4TQIA 4ERSL 2OTPA 2X6MA 5KVFH 2FECI 3BCDA 2QMJA 2YQ3A 2LFGA 3GTVA 2B1OA 4JGMA 4WI2A 1BZ7A 2FD6L 2Y7NA 4EZMA 3BDXA 5AVUB 1F13A 4N2EA 2FO4A 3F01A 2BC4B 1MJUL 1NCHA 4EQ2A 1U3YA 3BESR 1I7UB 2FJGA 3TN0B 4ZTPH 4EOWH 4A2EA 4G6AD 1H3UA 1I1AB 5EIVA 4DESA 2YMTA 3T4YA 3WIIH 4ADJA 4XOAA 3ZT7A 2J43A 5HYQB 2EZ0C 3WJMB 3QK0A 2WXMA 5JIDA 1R5IB 4PLKC 2VDRB 3NIFF 4GB9A 4HZLB 4K71C 4XE5B 5BQ7A 5IESL 5HTSA 1U8HB 3MV01 4OIFA 1GTFA 2AEOA 3VMNA 5AB2A 4RIRA 1QRNA 4GRLB 3U7YL 5DR5L 5I30H 2G2PA 3F85A 3TA3A 3VI4A 1T1YB 4N25A 1MFBH 1UH3A 3WS6A 2EEXA 1WFMA 2MHAB 3VWKA 5HVHC 3FFCA 4NC2B 3MRKA 2XBTA 1YYMH 2DTSA 8FABA 4P2QB 5E8EB 5J1AA 1DQTA 3SBWA 1XD1A 1HQ4B 5DRZA 3QNZB 1MCOL 1DUYA 3DOSA 4OIAA 3G9AB 3JTSA 4QRPB 4F8OA 4L29A 3N44F 3MJ9A 3QIWD 1PNDA 4LOUD 3V4PA 1NAMA 4LVOC 5CBEB 5IQ7H 5H2BB 1OP3K 1MCHA 1S3KH 4JREB 4LF3A 5F3BA 3WLBB 1UYWL 1MLBB 3MNVB 2XFXA 1BFSA 4Y9FA 7PAZA 1A7PL 4HJ1A 1HEHC 3GBMH 1X5XA 1CF1A 4ZTOL 3QDJB 4IJ3C 4HWBH 4YSSA 3E6HB 3T2LA 3MNMA 1MAKA 2HVBA 3BKYL 4JKPH 2LW3A 5KYXB 3P54A 3FULA 1UD2A 3QWRA 1FP5A 1VZHA 1ZHLB 1MIML 3CN1A 5AVRB 5JXAL 3NCXA 4XNBA 1FSKC 4NZDA 4JFPA 1SMAA 4PJAA 1PKOA 2CJTA 2E9JA 5GGVY 4CKVX 4NX0A 1X7TA 2V2TA 1UUSA 1T3FB 3KPRE 2Z0BA 4GAGH 5L4FA 1U4EA 5LAXB 4N6QA 4HKBA 3TPUA 2F7QA 2ESVB 5FYLL 5HBBA 1OAUL 5ERWA 4H20L 1UM5L 5I1HH 1JV2B 3S35X 1VZIA 4FZ8H 5GJSL 2B2XL 4Z7WB 4K94L 3B9EA 4BFRA 1U6AL 3AACA 3CFTA 4GS7C 1Z9SA 1DQDL 1T5XA 2GC4C 3KXFD 1NDMB 3SD2A 3KL3A 4KBPA 3O2DL 4X9BA 5F9JB 3MOAH 3NCYP 5DQ9B 4LFHG 5LG1A 5CLZA 4DEPB 3P73B 1CFMA 1DDTA 4JO8A 1F1DA 5FKAB 5I82A 2OMZA 3FB7B 3MREA 3RDTC 1OGPA 1D5XB 4POZC 1J5HA 1K8DA 4YDJA 4IRSD 1Q4NX 3EOBA 3M1CA 1AQKH 2ZKHL 5D1QA 3ZKND 3ULVE 5LN4A 3BDYH 4PTUA 4IYKA 4IMLB 4MRCA 5E2UL 2G2NA 3OAYK 1AFVH 4WW2C 5KVDH 5HHMD 1Q1JL 4F1ZA 1TJMA 2GSGA 2EVGA 4MMYA 1JS4A 2WMPB 1TEYA 2ADFL 3MOBH 1NBYA 3ZVVA 4XWOC 3MRBB 4WI0B 3O45B 2C3VB 2RBLA 3JV6B 5B1AB 3QG7L 4L4JA 3ZRFC 3M45A 3OGOE 2F54E 2JE8A 4NZUH 4MS8D 1LQBC 2D3LA 2Z93B 4H2AA 4QRUA 4XC1H 3D34A 3BAJA 1IIKA 3O41B 4MSWA 3QO1A 5E9DE 3BSGA 4PJ9D 4TUOA 2ZOKB 4DO4A 2K9UA 1MI5A 3QJHA 4P06A 4YX2H 2CKBH 2UZYB 3WI9A 3QIWB 3WDHA 2XWXA 2RCSL 2YJLA 5FA3A 2VN5A 3RY6A 3ZTNL 5ESAB 4B95C 4PR5A 2HCZX 1ZCRA 1B0GA 4AWJC 2X4OB 5KS9B 2ZSVA 3CZEA 4J3UA 4OD1L 3QZPA 4S0SD 1RUPH 1T1XA 4JPSA 4N4YB 5C0IB 1TCRA 2VO8A 4PG9B 4TQHA 4WI6A 5I2IB 4CU8A 2D8KA 2EEAA 4U31A 1MFAL 1P4UA 4HWZB 2IFFH 4P9HH 5C6TL 5I0VA 5CP7A 2UX6A 4LAJH 4MX7B 2X1PA 1GA2A 1QYGH 4KY1L 1NCCH 2CBPA 5GISH 4E41D 4OAWA 2IGFL 5C08A 1CLYL 3L3KA 3LRKA 2AJUH 2KDYA 5I8CA 4Z18A 1UWXH 4UUJB 4AG4H 1ZLEA 4OKDA 1OQOA 1TVDA 3REWA 3PV6B 4BYHA 3FCSA 5DHYB 2NUTB 3VAEA 4IIQA 5C92A 5D7IF 5F97E 2OSXA 2CGRH 2JB5H 1BIIA 4WW1B 5JYMA 3TBYB 1IEBB 4JMNA 4V2CB 4X7TB 3K74B 2LVCA 1D5ZB 3V0DA 2FBJH 4WY7L 4GSDL 4OT1L 3H42H 2YGNA 1M1SA 3RDJA 3FT4B 3O3DA 2NXZD 3G6DH 4XVSL 2QVFB 1RSYA 4NDMB 5HI5C 2YRZA 5I18H 4W4OA 3SYAA 3F7QA 2D4FA 3TT3L 2KUTA 3KWWB 1ZTXL 5D7JA 3RP1A 3ZDZF 3KXFB 1IAIH 2HYMA 3MRIB 1MWAB 1JL8A 3N85H 3OD3A 5L7XH 3B4NA 5KSAD 1A7OL 4FFYL 3DVNB 3WFEL 4XN9A 5LGKA 1I8LC 4XH2B 1MKFA 3NQKA 4DN4L 3MRGB 4LLYA 4LGRB 1AR1C 4QHLA 4NQDA 3BO8B 4OQTL 3UZVA 1PCSA 4QRRA 1V55B 4YSQA 1RHHB 1BZEA 1UD8A 3MRCA 4CNIB 1QVOB 5DZ9A 2BP8B 3DXAE 2FJUB 3KYKL 3REVB 5CBAB 3RIAF 4LARH 4FYQA 2Y6SC 2VN4A 3ATFA 4FD0A 2BIOA 1HWWA 4IRSB 2EQDA 4X42A 4DGIH 3T9WA 3HS0A 2VMEA 1EZVY 3JWNH 4NENB 3QDHA 5AW7B 2GY5A 3NSXA 4U3SA 1U8CB 3OKYA 3BKCL 3DX9B 3MNDA 1WD8A 4HH9B 5HHMB 5A6IA 2ITDB 4PTTB 5EC2B 3VD4A 2ED8A 2R29A 2ZYIA 2HRPH 3LZFH 4HUWA 4AGLA 4A6YA 2Q8BH 3LH2L 2VKXA 1JDDA 3IN0A 4XMXA 2GW5A 3KS0H 3SPVB 4NT6B 4P5TD 4PJ9B 1WF5A 2AI0L 3HLAA 2BZ7A 3OLGA 4U1KA 1J8KA 1ZWIB 3WN6A 5H37A 3EJSA 3DHJA 4Q0XH 3D6GA 2WCGA 1GAFL 3BPNB 4QOKD 3W2DH 5CR8A 4L4TD 4DQOH 2IADB 4F2MB 5H4ZA 3GJFK 4K5LA 1KEMH 3CLFL 3T3PF 3OL2A 1X6NA 2AW2A 4FE9A 1FVEA 1RULH 4ORZC 2B15A 2XWBA 5MEOA 2VN6A 4FG6D 5CGTA 5CJXA 1AYOA 3RZWA 2A4CA 2XIIA 1GS6X 3CZNA 1BVNT 2BMKB 5IWLC 3AS1A 3D12B 1B6UA 3R4RA 4G1MB 3VTAA 3T8XB 1YEEH 2OX5B 4E41B 2W60A 4GO9A 3ZKMC 5E1IA 3QCUH 2VABB 4KI5E 2DQTL 2WYHA 1QUPA 2DQDH 4L5FH 4XPAL 2YD9A 3VH8G 2VQ4A 1P5UC 2NR6A 3PG2A 1PAZA 4GXUM 3F83A 4G72B 2A74C 4ZFOL 5B1KA 2IH3A 3EO0A 3V0IA 3KYMA 5GGTL 4K2UH 2J71A 3M6DA 2F08A 1N59A 3M7OA 2VDKB 1CYGA 2BIMA 4AIZB 4MLSA 4I2XA 3HG4A 3CD4A 2BS9A 2NXZB 1SEQH 1BFVH 4X83A 3NFSL 4ZMVA 1JYNA 1KBGH 3OHXC 1XO8A 2PN5A 3EHBC 3GXMA 3VXPB 1YCSA 4MAUH 1ID2A 1IM3D 3WTXA 4MJ4A 1A1NB 1K5NB 4Y5VA 3U6XA 3OB8A 1JFHA 4KVPA 3C6SB 3WOVA 1FYTD 4G3YL 5KSAB 4B9FA 4NKMA 3N50A 3CLEL 3KEDA 1BVNP 4NN6C 4QHMA 2P8MA 3ARQA 3MJ9H 5ESVA 3V4PH 3H9SA 2VQ1B 1SDDB 4FMVA 4JRXA 1WITA 4GI9A 2R2BA 4AVKA 5AUMA 1BBJB 1QFPA 3HHSA 2YAQA 3HRZB 4FFWC 3I9AA 4O5LH 3BQVA 1EFQA 3QUML 4DUXA 1A9EB 2VRKA 2AK4D 3TCXA 3SE8H 4JFSA 1CR9H 3D48R 3HC3H 4HG4K 3FTWA 2CRIA 3QDAA 4FGMA 4PJDF 4YHIB 3AJ7A 1S7RA 3QULA 5BVJA 1FFOA 4ZMXA 3VI3B 4PV9A 4Y9BA 2VLRA 5LGJB 3TO2B 5EZIH 2VNCA 2WQAA 3BZ5A 3ZDXE 1LNUB 4E9QA 3RNKA 1J5OL 3IRPX 4NKQB 3QIUD 1Q0XH 1NMCB 2EIZB 2XETA 3GJFB 5D72L 2UY7A 3L95B 5DLML 1XB8A 4GRWB 2F18A 1S9VA 3HUJA 1GIGL 5EU4B 3VFRA 3S36L 1DVQA 4P5TB 3NRPA 4R84A 1EEUA 2EXWD 5D4HA 1LEKA 1CVSC 2X0VA 4BCZA 4I0PA 1WD9A 2X3BA 4FEMA 5BO0D 1H3PL 1G9EA 2ZCZA 1JF1B 2CWRA 1EIBA 1A2YA 1KCUH 1T4KB 1WC7B 2UY6B 4QOKB 3G5XB 4L4TB 1MW1A 4MLIA 4U6VL 4AQ1C 4YXLL 4NUQA 1OE3A 2AXGB 4Y1AE 1NSNL 4MAYD 5CP3A 5DZLA 4AGNA 4O2CA 1X7QA 3H3KA 3OSVA 4LQ1A 2X9YA 4OLEA 4PW4A 4HUUA 2SODB 3DRQA 4JFDA 4IK6A 3NJLA 1A3QA 4O2EA 3F6JA 4JGJA 4L48A 3PHQA 3RGHA 3MI6A 2G75B 4B3EA 5CJOL 1GCYA 4GXVL 3LEVH 4AV0A 5EUOA 1JYVA 1CE6A 4YDKL 2IFGA 4DSYA 4YHKH 5IBLD 1NKOA 4H8UA 2J8UE 3LTVA 1BW8A 1BJ8A 5HGHB 4KK5D 4P4RB 5JOFA 2MOGA 2VLMD 4X4KA 3WJLC 3T0DA 1WAAA 3UBGA 3BZ4B 1CFVL 4N8VG 1JXKA 4PJFE 1NM9A 2DQEH 1ZT1A 3EYVB 4ZFGH 3EO1B 2CDEA 2NX5D 2UZXA 4D8OA 1EDQA 3O8XC 5KBDA 4TTGA 2C9XA 2KS0A 1MPAL 1H6FA 3VU2A 5FB8A 1OWWA 1PYWA 2GTWA 3P77B 2XXGA 2QBWA 1T2JA 2Y25A 5F88A 3X1GA 1MH5B 4IS6B 4LDCA 4P5MA 4QGYA 2XFGB 1ACCA 2WLKA 3CIAA 3WN5B 4IGBB 3ZE2E 1ACYL 1NFDB 3LS4L 1BOGA 4RQQA 5B8CA 4P9MH 1IM3B 4PHZA 3I6LE 3I75B 5TJWK 5LNDA 2FB4L 5IHLB 5EO0B 1UATA 3DV4A 2G2RB 1FYTB 1ZMYA 4OJFL 1NCBL 4KX7A 4S1DD 2WANA 5IFAL 2NYYC 5AFAA 4WEEA 5K39A 3CXHJ 2Y7OA 3QZWB 4K15A 3O2WH 5DD1H 2DEXX 1RV6X 1XMEB 4Y19A 4ATTA 1KULA 1T21A 5INCB 1KYAA 3KYOA 3VXMA 3WL9A 1MXDA 4IW4C 2AK4B 4Y16A 2WVVA 5DS8B 5KYYA 4GXFA 4AC4A 1RJCA 4G43B 4K7FA 4OBSA 1ND0B 3HE6C 1D5MA 5JQHC 3EKCA 2VDQL 1GHFH 1QABA 4QYAA 3B7RL 4QAMB 3EYQC 5DJAA 2PLTA 1OT2A 4D2NA 4U6XA 4ABUA 2PWGA 2R9HD 4HIJB 4OCSH 2CUMA 3C8KB 4AYMC 1YEWA 3QIUB 2F6AA 2VSCA 3EO9H 1XXDC 3DNKA 2O6DA 4QYOA 5GS2D 1U8PA 4AQAB 3MV11 1HAUA 1OTTC 3ZX1A 1V7NL 5IMLA 5ILTH 4TVSa 3L9BA 1M1XA 1RIHH 2YAFA 4HS6B 1U21A 4K3DL 3VFTB 4TVPD 5KJRH 1FVDB 1MJ8H 4UZSA 3JWDC 1R33A 2BNQD 12E8L 4Z3EA 4KKZA 5M7QA 1FNSH 1X9QA 5D9SB 3IU4H 5C0AE 4KKLD 4N2AA 3UTTA 4MAYB 1IBGL 1GS7A 2Z4TA 3MZTA 4PGEA 3INUH 5DD6B 4X6DA 4TN9A 1A6AA 2DKSA 2JLPA 5KWYC 4HIQA 4LSVH 3O6LH 2DMCA 3FB5A 2ZKXA 2OL3B 3MRMB 5F7DB 3NCCB 2WXIA 4X99A 1FJ1B 1KTRL 2EC9U 1LILA 4YHNA 4Z95L 5HD8D 2CK0H 5D5MF 1U8QA 3VFGL 4ZRGA 4NIYE 5F0MB 4MKTA 1FRGH 3DV6A 3D39A 1PG7H 3NJKA 1IGFL 4NWUL 4AEHL 2QGBA 2DM7A 2I9TB 1T83A 1VJSA 1J0ZA 3LKSB 5IMOB 3QUKB 3DTUB 4J3OH 2PWFA 2W9DL 2EDOA 1E8WA 2YBRB 1GZPB 1KJVA 2NX5B 1EO8H 4WUUD 3VD2A 5FYLD 4OLZL 2WKGA 4YDZA 1I8AA 3IMRA 4Q6IC 5IROC 2EE2A 2ILLA 5D2NB 2PCPA 4ZUVB 3DX1A 4B9PA 1FHNA 1XF5B 4C83B 5GIRA 2YQBA 4NNYB 4OCXH 4JDVA 1IGML 3KMDA 3CVCA 3VJ6B 5F1IB 2ICEB 4A6YH 2OMVB 2DV6A 3M88A 4PG2A 5IHZA 4WK2B 1JWUB 2WNKA 3UADA 3H3PH 1FN4B 1CFTB 5T1DH 4KO7A 3FTYA 5H35B 2X09A 4PB0L 4JFQB 4G80B 1XSOA 1SBSH 2D0GA 4X7DC 3ARUA 3TVMA 4W81A 2RAMA 3AWEA 5EC1B 4JS7A 2YAHA 1A21A 3TPKA 3UTZB 1K8IA 3DMMD 4LEBA 2FGZA 1PZBA 3FHAA 1DJZA 3OG4B 1TQUA 4BWUA 3QFDB 4YSAA 1JRHL 3WKML 4F58L 3PWJA 5ISZE 3HCVB 1JZFA 3VXQA 2YZ8A 3PJNA 4JANB 1N9PA 3EYFA 3CZKA 3DX7B 1I7ZB 4OU3A 4XNYH 3U6RA 3UTOA 5CCJA 5HHXH 4IHOB 5I24A 4ZXBD 2H5UA 3C09B 5INDA 1M9WA 2NW3A 4BWTA 4J3WA 4LQFL 4F8TA 2Z92B 3PP3K 3QJSB 2GAZB 3V5HB 3UAJA 4XC3H 5IR1A 2X3AA 3U0WH 5EIQA 4MNHA 1WZ1L 2LT9A 1ADWA 3PWUB 2OJEB 1HIMH 1IKFH 4YHLL 1P0SE 2DQIH 3ZMRA 4Y8DC 4S1SH 3VRJA 3QXDB 1Z5LB 4HOMA 2PW1A 3MFFA 1S7QB 1KF9B 5MENE 1ZY9A 1CDUA 3V4VA 5J5EA 1RZ7L 1E4KA 1KGXA 3K8LA 4XNZC 3AB0B 3RWJA 4RFNC 3WNLA 5KSBE 1CGSH 4PEEA 3PGFH 1QSEE 2EABA 2KZBA 4X7SH 5BZDB 2CBQA 5GGSA 4YE0A 2BNQB 4QTHB 4JQIL 4CADA 2NZ1A 4AQ8A 3QZMA 4XVTL 4LCWE 2R4RH 1F6AA 1FNGB 5CNHA 1VACB 5F6HI 5ACLA 4KQ3H 1KPUA 3DHUA 3N91A 3OKLB 4TOYL 3TO4C 1P7QD 4JFZL 3ABZA 3EDJA 2D7TH 1D5BB 3ILQC 3MUGB 3QJVB 5FGCE 1CUOA 3A6CH 3MRNA 5TDNA 1OGTB 2IG2H 1N6QH 3DLQR 1AZNA 5HHVH 4MMZA 1BQRA 1ZE3C 4W6XB 4UIKH 2WPGA 3ARBD 1I3VA 3COOA 3LXAA 4ZODA 4EUPA 3IJ9A 5B39A 1VGKA 5JOPE 3KR3H 1ZA3B 3NSYA 3QDMA 2CBOA 1NANH 5HYSG 1R0AL 3H7LA 3C87A 3AQDA 1EXGA 3HZ3A 5E8PB 2X38A 3T4AA 3GMLA 4E9VA 1BMGA 1F86A 2ZYHA 2X2IA 3QJFA 4XN5A 1E9PB 3QQ4B 5B8CB 1ZLWK 1BX2B 1OLLA 3AZUA 5IHHA 2UWEB 4WUUB 2XC8A 1C08B 2PO6A 4KQ0A 5EEXA 4YDIH 4PWJA 3AQZA 3X14A 2GSMB 4XPHH 4JUTA 4R26H 3GMPA 3GHBL 4WSGA 2XVGA 3OX8B 5FUCE 4OM0H 2EDKA 1NCWH 5HYIA 1X9UA 2WUCH 3KLQA 2KHAA 5IQ9A 2B8OT 1N8ZB 2QQQA 1RVFH 3THML 5C9KA 3GEWB 2GJJA 1UWEL 2Y7QA 3ARDA 2H3NA 1TIUA 4GXUN 1G6RB 3QBTB 4PRID 5D2LB 3SDXF 4C56E 2WKOA 4MCMA 3FYIB 3O9WA 3PGDB 4Z1PA 1WE5A 2A6JB 2EDEA 1RAMA 5TDPA 1JK9A 4P23C 1RZFH 4TS6A 2XZQL 3UZQB 3HNSH 4UILL 2B4CH 1JN6B 1DVFD 5B3SB 3DMMB 2Y69B 5J6SA 2WQWA 1RUQL 1EZVX 3CN2A 3VH8B 4UQAA 1JYWA 1SOXA 1UQSB 5JZ7C 3BD4A 5H8DA 4NIKB 4Q8BA 1BD2D 3M07A 5CP3H 1M2VB 2DN7A 2CD0A 1XIWC 1UT2A 4WHTB 2XWTA 2H26A 1N7ML 1S7VA 3N55A 1NAKL 2H41A 5JPMC 2PCXA 2CLRB 2GJZB 4P4KC 2WLYA 1O0VA 2QHRH 4ZXBB 3T2NH 3H9HA 5JYLA 4OSUH 4JO1L 4DGWC 5DFWH 3T0VA 3N41F 2Q86A 4TLKA 4FNRA 5DJXB 1PZAA 3PXHA 3IETB 3NJVA 5KN5B 1OSYA 4RMQA 5JO5A 1HWGB 1MCOH 3MV9D 3UDWA 2K9FB 4E9SA 4H40A 1AVAA 4FNPA 2XZAL 4WNJA 1WFUA 2Y6TE 4Q9QL 1AGDA 2G3XA 4CKQA 1MCDA 4K5NA 4MXVE 3V5KA 2FZ3B 1E3FA 1RPQA 2GB2A 4MDJA 4ZAKD 3STBA 1DTUA 2W88A 4QT5B 2PTTA 4HGMA 1T80A 3ET9F 3VFWA 4GP5B 5CUSL 4IBUA 2QR0B 3MLZH 1ADQL 1N3NB 3G7TA 5I15L 1ZVHA 3NABL 3S8GB 2IPTL 4MYPA 2VRAA 4P2OA 5KVMC 1DFBH 2EDFA 4GBXD 1OAZH 1OIOA 4MJ6B 4OGAC 3T5WA 4DZBB 4HIHB 2MKLC 5HPOA 2ZXDA 5EMYA 1QSFA 4RX4D 2NT0A 5KVFE 1P7QB 3POHA 4K71B 3X1EA 4KZEL 3F65A 3AM8C 4H8VA 3QQDB 3KGRA 1SZNA 2DW5A 1X5MA 3CU7A 4QF1B 5GSVB 2C9UA 4YJZL 3STZA 1SJHB 3EBGA 1D3CA 3FUIA 1R5VB 1LD9A 1MHHB 3ARBB 1JZ4A 4ACTA 3D85A 5ESQB 3V6FA 5CILH 2WBJD 4XWOD 1T0PB 5EOTB 2VN3A 5T5NF 1EBAA 2GFBB 1YEIL 2R2CA 2AHIA 1RIUL 3QHZH 2HLFD 4H20H 1ROWA 4HWEL 1BMZA 4JQXC 5DUBB 1CLZH 2PABA 4PJXB 3DURA 1BQHB 4DGVH 4AW4A 5T1JA 3VD7A 1Z6JT 3GSWB 2BFGA 2HA1A 4YK4C 2CXKA 2ZJSL 3MV7E 4Y5XB 4DKFH 3QCTH 5DRXA 3WAKA 4X6FB 3O2DH 1P9MA 3MROB 2UX7A 4KQ4L 5A2JH 3VQLA 2I24N 1YJDC 4K9JA 1MY7A 2RFXB 1XGTA 1ILSA 4WU7B 5I1DB 3TF7C 1AKJD 4FI7A 4PRIB 1B88A 3ZE0E 1I8MA 2BIQA 3SDDA 3F6LA 1SHMA 4NPJA 4LL1A 3VTTA 5ENWA 4I7ZC 3N40F 2ZXGA 2K45A 3IGAA 1RZJH 5EG6C 3ZDZE 4L8SC 5BRPA 5CKGA 1DVFB 2N1TE 4H25A 3TBSB 1SF3A 4U4BA 3MKKA 3P02A 4U4IA 1G7HB 1J1OH 3CZJA 2XN0A 2YXVA 4UCFA 1FSKB 2OMUA 3FB8B 3NPSC 4N8VB 1T6BX 1BD2B 3S35L 3L7FA 1DQJA 3FU3A 1YEDA 1B4RA 2FX8H 1EMTL 3SBRA 4OZ4B 3VXTB 4UINH 2VC2H 1H3TA 4JM4H 5T8IA 3MLXH 4UQ3B 1WFTA 4QTIH 2AJVL 5I74C 3EDDA 4R6UA 2HTLC 2HFGL 3VXUA 3BH9A 1KTBA 4PWKA 2QQNL 2JI3A 3VRLF 3MV9B 4HG4J 5F7MC 3WFBH 2PPDA 2BCKA 3F3HA 5ANMA 3PNWA 3K81A 1T6VN 2R0LH 3IU3B 3O4LE 4JJ5B 2X42A 4LPTA 1DBMH 1IC5L 3IAPA 1JZ7A 1MQKL 2VLLB 1MCNA 2AEIT 1VFAB 3HC0B 3NZUA 2BC4A 4FNLL 1DJIA 1DSYA 4FULA 4ZAKB 5GGUB 5KVGL 2QPSA 3PDDA 4JHBA 3TN0A 5SWQB 3JYBA 3Q1EA 5FUZL 2IEPA 2VXSH 1I1AA 4JFXA 1IILE 1AR1D 3UTSA 3D51A 4HQQH 4GBXB 5ITBL 5HYQA 4FMKA 5JHAA 3BZFA 1ZLUK 2VITA 3WJMA 5BJTB 1U0QA 2H2PD 1OW0A 4HZLA 1U8HA 3QI9A 4LEXH 3U4EA 1XZ0B 1AQMA 1JWMA 1B9ZA 3MLRH 2EEFA 4B9IA 3P3SA 1DHKA 3V5DB 5J1TC 3WTSA 2JV6A 1FF5A 1XCWA 5EA0H 1NBZB 4FXGA 4WW2B 3FU6A 5CIPB 2PP8A 5HHQB 1FA4A 3ZKSD 1LO5B 4AYDC 2MHAA 3FRPG 5I8OH 4N2MA 5CEYB 2WBJB 4YZFF 4F7TA 2BVYA 3G9VA 3L9RB 3UG3A 1FQ9C 1U42A 5E8EA 4HAKA 5K9OB 4RBPK 4JY4B 4F20A 1FDLH 1HQ4A 1ZSHA 1WS8A 3OXRB 1B6DA 3QNZA 4ZFOB 2ZCLL 1AMYA 2XDHA 5EU5B 4CILA 4FADA 5DZAA 1WT5C 2HPOA 2JJVA 1E6JL 2VAAB 3Q5TA 5CBEA 4AM0Q 3QO0B 1KJ2L 2EE3A 3DHPA 2DYSB 5HDWA 4U6YB 3L81A 1MCEA 1O7DE 1SJEB 1USQA 3AXIA 2FVNA 1MLBA 3MNVA 2WZ0A 4WFEE 1MCBA 2QSVA 3B3IB 3CFMA 2E8ZA 3QEQB 1JPST 4HCGA 4LKCB 4X9YA 4MD0A 4K3EH 4OLXL 4GIAA 2KKQA 1XCXA 3WFEH 2HJLA 5C7XH 2HAZA 4NO0D 1JPGB 3SQBB 1U9KA 1AKJB 5KOVC 15C8L 1DJSA 2EE6A 5D71H 4CDHA 5MI0C 3E6HA 1INEL 4LAQH 3K4AA 4GAYB 3GBDA 5KYXA 1EJFA 5GSRB 1FL5A 1ROCA 3V4VH 3T0EC 4PJCF 1IUZA 5I5JA 1KIUB 1G7JB 4I3SL 4D9RD 1UFUA 3DI2B 1JZ6A 3QUMB 2VH5H 3QR1A 2DBLH 2NY5H 2BFVL 5IT2L 1AIZA 1OSPH 3LRSA 1RUKL 3S34H 5CZVL 5I1GL 3ARSA 2BJML 4KX9A 1J7VR 4JRYE 4JO2H 4B9ZA 1F11B 2N7BA 2ESVA 1T1WA 3FCBA 1JGLL 3QORC 1J10A 4LASL 3LH2H 1IGYB 1IBYA 3K80A 4PGJA 2DIBA 3PAVA 2QPDB 4UZGA 2NY0C 2YOCA 3M17B 4G8GE 5E1QA 3UTQB 1EAOA 4EUPH 3M7FB 1C9SA 2HX7A 2AI0H 4L0YA 1U8OA 3RNQA 1DVZA 1T7WA 1CXKA 5IJDC 3JT0A 1PDKB 2OJZH 1NDMA 3LHAA 4YO0A 3ZOAA 2Z8WC 1ZIBA 1GAFH 1AOZA 3PWPE 3BHBA 2EVHA 2IALB 2Q8AH 1QATA 3CBRA 3E8UH 3AT9A 4HF5L 4J3TA 3WNOA 5IV2B 4GG6A 1QLFB 4LL4A 5F7YC 2NY6C 4MJ2A 2GHWB 5JMRA 3X2QB 4XMLH 1AR1B 3WMQA 4M3HA 3BWUC 4EDXB 3RZCD 1T20B 3FQ4A 2ADIB 2EDNA 4ZD3H 1GPOL 5JW3L 4Q9RH 3D50A 4FFVC 3KCPA 4FQQB 2OSLB 4EDWL 3LAFA 3G6AB 4GAJH 4JFED 4R7LA 5I1KH 4IMLA 3SKOB 4ZO7A 4GMSL 4JN2B 1UOLA 4PV8A 4IHBA 1XF2B 3TWCH 1ZANH 3VNZA 1CFNB 2R1YA 4KH9A 4KITB 5DD5H 1JD7A 2JCCE 4EE2A 4JDTH 4GT0A 3L5XL 4U1NB 3D4GA 2W1NA 1JPFA 4KTGA 3EJUA 1KIPB 2Z93A 1UM6H 2DQGH 3GB7B 3H0TB 4XP9H 3O41A 3LKNB 3QIBC 5TE6L 2NY7L 3KPPB 1F5WA 3JWNE 5CZXC 3GXPA 4WI3A 4IJTA 3QIWA 2HWZL 1C16B 5GS0C 1A64A 2PUQT 3LHPH 2JJSC 4M7ZB 2X4OA 4HC1A 2P49B 1QNZL 4LU5H 1COBA 5D7LB 5KS9A 1II4E 1U41A 3GK8H 1P7BA 2AGJL 5AOKA 3HNVH 5C0IA 1IV8A 4PG9A 1A4CA 1S4IA 4NO0B 5I2IA 3OGCA 3MUHL 1VB9A 3UJIL 1UJ3C 4OZHF 2W0KA 2HJKB 4EI5D 4J28A 4K7PH 3FB6A 2R39A 4F37K 5EDXA 1U58B 4HIXH 4F93B 3JZYA 1RJLB 1BZOA 2ROXA 5JMOC 4YUEL 4YL9A 4A38A 2ARWA 4I85A 4RRPM 3ZHLA 2EC8A 2JI1A 3F12A 1PLAA 3CMOH 1HYSD 1LO2H 4Z7UE 3WDJA 4UUJA 2ZXWB 3G5YB 4FQJH 1WTGT 3MLSL 2RJMA 5HYSB 2NCMA 4P3CH 3CSGA 1T04B 5DHYA 5CHNB 2NUTA 3GGWB 3QFJA 4HDIB 3EH5B 4WFFD 2O5ZL 2UXFA 2DJSA 3NZ8A 3TBYA 2CAKA 5LDSA 3K91A 3QS2A 1U92B 2Z91A 3EAKA 4PJXF 3O8XD 32C2B 3C5XA 2ICWA 2VDQB 4CW1A 5J57B 3VVVA 2X0UA 2F15A 3P1VA 5DLMH 4LP5A 4J3SA 5PCYA 2PWEA 3FT4A 4N0CD 1A3ZA 5IFJA 2OQJA 4NDMA 2Q3XA 1TZHB 4L5FE 4GW4A 3K46A 1BV8A 5IQNA 4AL8C 3DSFH 1PAMA 1GRWA 3CFDB 1T89C 3BSZL 1FGNH 3AUVA 3KWWA 3LQAC 5DD3L 5CU5A 5HI4D 1I3GL 3OHXB 5D6DA 2VN7A 3EF4A 4HK0B 4ZW3A 4G82A 2WLJA 1JHTB 2M83A 1MWAA 2DJUA 3SGJA 2HVKB 4M03A 5GZOC 4L8BA 3OG6B 3OKOB 3SGKA 4H8WH 4AQEB 1PD6A 4GMTH 4M93C 2BH0A 2CDFB 2A0LC 1CF8L 3DVNA 4X9HA 3WFCL 3US1A 1QRNE 1OSZB 4NWTH 2OZ4A 3P4MA 3L5HA 4BXSV 4BGDA 4NN6B 3MRGA 2JQAA 4NHCH 3VI4E 4MBRA 5DGQA 3DIFA 1QFWH 3FT2B 1RHHA 1SLWA 2FO8A 3FFCE 2YUVA 1QVOA 1SHWA 2BP8A 1U8MA 5DDHB 1JBJA 3REVA 3RZCB 5CBAA 2HXAA 5D6CB 2YZ1A 3D4CA 4GXVH 5BRZD 2WIIA 3GIZH 3VA2C 2QHLA 4R4BA 1KENH 4F92B 3HAEB 4XMPH 4JFEB 2XWRA 2DL9A 2Q87A 3KDMB 1U8CA 3HE6D 4UOW0 4XRCB 4CDGC 4MA7H 4MXWL 5DS2A 1INQA 2OMNA 1CXEA 1U8LB 4V1DA 2XWEA 1CFVH 2VL4A 3B6SA 3EYQD 3DJSA 3HI1A 1OE2A 4NQCA 4YE4L 5AYTA 5GRVL 5A6MA 2Y1VA 4HIIA 4LGPB 4WJKB 1W0WB 4LP8A 4U33A 5KSVA 3VMPA 5LXGH 1MPAH 4A7SA 3SPVA 4PJ9A 2PP9A 4ZOEA 4AE0A 1OTTD 4WI8A 1ZWIA 3BP6B 4WHYH 3FRUA 2I60H 2G3ZA 1MCWW 2VDPH 2FHBA 5K5YA 2CR3A 1X4ZA 4F2MA 3MFGB 2MTPA 5CR1A 4FQ2L 4GP8B 4ZBJA 2XV6B 1OB1B 4FNQA 4PJAE 5E8OB 1YVLA 1OVZA 1SLVA 4NQED 3QG6B 2EUZA 2OTUA 3TF4A 5C0RH 3GHEL 4EI5B 2X9WA 3DRTA 4FLHA 4G1MA 2BSCA 4PRNA 1LWRA 1IC1A 4HS8L 3T8XA 3D0LB 4BA0A 2OX5A 3UEZA 1I1CA 2WP3O 3AROA 4E41A 3MRQA 4I88A 1TEGA 2FUTA 4H8QA 2NUPA 5AKSA 2AKRA 1IFHH 4H1LG 3N40P 3P4LA 1A22B 3HHRB 4UQ2B 2BSRB 4I77H 1Y0LB 2R8SH 1A4AA 4BQBA 1JOIA 1I8KA 1JPTL 3IMWA 2I07B 3EJJX 4PUBL 3RIFK 5I71B 4OCYL 2W8CA 4APXA 4H26B 5TQ2L 4E9LA 3V0GA 2BZCA 3O8XB 3SYPA 1X9RA 2X4PB 4CC1A 2CR6A 2LTQC 4PJGF 3UIYA 5GS0L 1AGFB 4L4VD 3GXFA 5GRUL 3NK3A 1KFAL 1V7NH 3QRBA 3VXPA 2Y5EA 4EEEA 1NOAA 5D1QE 3EJQA 1K5NA 4K3DH 5EPMB 5ID1B 5GGRA 3VB8A 1KELL 4L3ED 3ZO0A 3IJSB 4TULL 5KSAA 4M7KL 3MU3A 1K4CB 4UT6L 2UYLB 3ASWA 5C0GA 1KT2B 2AMUA 5E70A 1HI6B 4ZDHB 3RB5A 1BBJA 1BXAA 5C0BD 4YNYB 3WU1A 2YD4A 2R56H 1RJZB 3HRZA 3QJRB 4JG1L 3OR7B 2XPZA 1B9KA 3HJ0A 5TF0A 1ZGLA 5BRZB 3RWCB 2ATKA 3SDYH 1GGCH 3QZBA 4NP4L 5D1ZI 4YHIA 1IC7H 4FAAB 4PJ8D 1MI5E 1G4MA 1S78D 2W07B 3ILDA 2IH9A 3KPNB 5TPWL 2J3SA 3VI3A 1G7MA 1Q90A 2P52A 1I9EA 5LGJA 4HEPA 1KXHA 3NQIA 1LNUA 2BY0A 4NM8L 4ODBD 4FFZL 1WBXA 4QXTA 2EIZA 4GJTB 3SZ6A 2CJUL 3GJFA 3H54A 2W9DH 4WKZB 1XGUB 1AHKA 2XN1A 5JW4M 4I13B 2MOQA 2Y07H 3L95A 3FO9B 4G9DB 4XMTA 5B21A 4P99A 1WJ3A 2JXMA 4P5TA 5K9QI 1FC2D 4JPWH 2K8QA 1R46A 4HFUH 1A3LH 4NZTH 4OD2B 4JY6A 4MDIB 3OMZA 2WB7A 5MEPA 5TFSH 4JPIB 1WC7A 4OFVA 3DKHA 1D2OA 3G5XA 4L4TA 5C08E 1AZCA 3DO4A 5EIIB 1E8XA 2FJFA 2BSED 3CZLA 4O00A 1FIGH 3PL6C 1OAYL 4XOCA 4YXHL 5JPNC 4GQRA 3IE9A 4MHHI 1QW9A 3P9WB 3HFML 2NQDA 3D9AL 5GGVL 3U30C 5JORA 5SWZE 4W9ZA 4NQEB 3RFZC 3FQNB 4XHJD 1A7NL 1WCQA 3S2AA 2ORBH 4YWGH 1P2CB 1XGZA 2G75A 3ILQD 4WEBH 1MW2A 2WQRA 3BGMA 5LB1A 1ZPLA 2MPAL 3UBHA 4EZLA 3B3BA 3RWHB 3VWJA 1JRHH 1HHKB 1QFUH 2H7WA 2ZIDA 3FRPB 5E8DL 2A2QT 2PR9A 2IMNA 3SB3A 5HGHA 3DX8A 1BJ1H 4P4RA 1EHXA 2K6WA 3B9KC 2X6BA 3TA4D 4F7CB 3HKZA 4MQ7B 4JZJC 1CU4L 3U9UB 5DD0L 4WLCA 3EYVA 5ICZA 3EO1A 2XVBA 1P4IL 4Z3TA 4IRZA 1TQTA 2E7MA 5IB1B 3D07A 1LP9B 2DD8H 4Q6IB 3P77A 2FGWH 4OGQC 4CSSA 4NQDE 4L4VB 1XHHA 3QUZA 5IB4B 4QRRE 4GOSA 2J73A 4LPUA 3IDXH 4XBMA 5B3JF 1NFDA 5D7SL 2NNFA 4O58L 1IM3A 1RURH 1XH3B 1R24B 3LZLA 5G4NA 3MLTB 1ITBB 4L3EB 5FECB 5HDBF 1Z9LA 2WN2A 2WOYA 4UDUB 4I8DA 4NZRL 4P23D 1JVOA 4GUOA 4OV6F 2X5PA 4PCTA 5F70A 1GY1A 1Z2KA 5C0BB 1HTYA 1FNFA 3X1FA 2H9GB 2CLZA 3WHE0 4OGYH 2FJHB 4RRPG 4HC1H 5INCA 1ZEAH 3GS7A 1WLHA 5D1XC 5DJYA 1AGCB 3HC2A 1I8UA 1QG3A 2XV0A 4BH7B 1XIWD 4G43A 4M43L 4XNXL 1HL8A 1ND0A 2PPEA 4OZIA 1L5GB 3F5WA 1JI2A 4PJ8B 1T0MB 4BIKA 1OP4A 4P4KD 1MDAA 4WTZG 4Q9CA 4YHZL 2HFFB 4FZEH 5I1CH 3VW3L 1RZKC 2BDNH 5AYUH 5C97A 5IY5B 2X2UA 4JL1A 1KGWA 2QGCA 5EU6D 1T5WB 1LO4H 2J6EL 4M4RB 4HIJA 2J6WA 3UH8A 1M57B 2QV4A 4Y4HC 5EU3B 4IBYA 3T71A 3ZKXB 5A6LA 5J13C 3LQMA 1QWUA 3ULVL 2AJ3B 4AQAA 4A2FA 2AQQA 2H4EA 3GI9H 4XXWA 4P5KB 4TM9A 3QXAB 3ARXA 5EV7A 1CBVH 4HS6A 4OZFG 1FO0L 4K07A 1FVDA 4DO5A 4OZGB 5EUKB 5ADOL 2B08A 4M9PA 1WK0A 4QRAA 1AP2B 1R5WA 2QEJA 2FAUA 3G6JB 4FQPA 2UUDH 4MQXD 4MAYA 4OGAD 1SYVB 4WJ5B 3WBDA 1L9TA 3W11C 3BE1L 4PCKA 5DD6A 3DETC 4ELKB 1SM3H 3KH3A 2LLLA 4URTB 1CGUA 1NC2D 3RILA 1TJIL 4JO3L 1FH5L 1AR2A 3MRMA 4POYA 1TLKA 1FJ1A 2BS71 2GI0A 3TJEL 2CO2A 3GSRB 4AV4A 2DMGA 5FDWA 3TBTA 3H2QA 2OZ4H 3GRWA 1MCFA 1EJOH 3OAYH 4I2XE 3SQOL 3NJNA 4LLQA 3G08B 1EGJA 5EH1A 5LBVA 1L7TL 2H0JA 1BGXH 1E2WA 1HSBB 1ZV5A 4EI0A 4A37A 1F4AA 3I3DA 3NFNB 4NQTA 1I85A 5AOLA 5LGHL 4BBWA 2X41A 3LKSA 2TRYA 3VTMA 2YA0A 3QUKA 1SNRA 5E4EC 4LLDA 4KZDL 4JO1H 3APCA 1I3RB 3ES6B 4L3AA 1GZPA 2DRUA 1M2OA 4GH7B 4CSTA 2AABH 2FLMA 4JK0D 3CCHB 5G55A 5D2NA 4ZUVA 3FK3A 1NUDA 3H9SE 1OARL 4K0OA 4JRXE 3ZTDC 4UU9A 4L9DA 2E7HA 4WV1C 1ED3B 1N4XL 3HR5B 4B5EA 3GRGA 1YY9C 3NP3A 1HHGB 3P9MA 4R7NB 4UAHA 1CICC 2FIKB 3NT0A 1W6LA 5F1IA 2YIHA 4KKBC 5E56A 2Q76B 3IDJA 5BOZG 5L9DL 1YNLH 1CFTA 1QBLH 4XO3A 3VG0L 4LCYB 3RY5A 4JFQA 4G80A 3T65A 2XBZA 5T33L 4N2BA 3UEQA 3VRLE 1TTCA 4GO6B 1CE1H 4TSCL 3BQUA 5EC1A 4P23B 4Y1SA 2VLRE 5IKCA 1KIRA 2X1QA 5JR1L 1OCWH 3LOWA 3FO1B 4UB0H 3VXRA 4NUGL 5DUML 3LMJH 1V54B 2C1PA 3QFDA 2WXOA 1YC8A 4GG6F 2CBMA 3RPIB 4OCRH 3HUJE 2AXFB 3GDBA 4N0YL 3SZKC 4YHML 5K9JL 4DH2A 3HCVA 1J1PH 3FQRB 1NEUA 3C08L 2CO6A 1R9FA 1I7ZA 4V11A 2GBVA 5FM8A 2J88H 3HPJB 3DECA 2WCPA 3ZT5A 5JPMB 1RXLA 2ZUSA 4NKIL 4P4KB 2Q7NA 4PHXA 4PMFA 1JGVL 1MW0A 1S7WB 2FX9H 2YC1A 4LSUL 2NY3C 5EU6B 2HTLD 3NEEA 3DSNB 4XCEB 2BK8A 5FCUH 3GNML 1J0JA 1SHSA 2P7TB 3PWUA 1U95A 3SQRA 3LXUX 2SEBB 3C5ZA 5DO2D 3ZIMA 1YG9A 2ZUWA 3DHMA 5IMMA 4W9GC 4JFDE 3KPQA 3EFOB 3QXDA 1Z5LA 1PS3A 4TTDC 3MNWA 1F45A 4XP1L 4RMUA 3VUAA 1XVSA 1PG7W 2FATL 5I6XC 5EUOE 4MNGB 1KJ2B 2HT3C 1MHPL 3W57A 2BNQA 4QTHA 3G5VA 3HEIB 3BUYB 5DHVB 4ATWA 2GYSA 2NY2D 2VM9A 1FNGA 3GSXA 1H5BA 4CVXA 5BS0A 3NZHH 5PAZA 4P46A 3QR2A 1WAAE 5A2AA 2Q5BA 4FQHB 3ILPA 3MUUA 1A6ZB 1MQ8A 2DIJA 2X4UA 2R1XA 3HMWH 3MR9B 4ZOCA 1NC2B 2A1WH 3MUGA 4NRXB 2XNAB 2JF1A 1UFGA 3CX5J 3DGDA 2B5IC 2NY1C 5F0PB 1OGTA 4G8EA 1RFDH 2AJZA 4M6AA 4S0TD 3Q01A 2VL5B 4FLOA 4RMBA 2NCEA 2NTFB 3LEXA 4FQLL 4UT7L 3MAWA 3EJPA 5MEQB 5TE4H 1R3HA 1KUMA 2QJDA 4X5LA 2ZF9A 1QQDB 3K72B 1XXFC 3NUKA 4JM2F 3CTTA 2L0DA 3KPOB 5CF3A 3FSOA 2CM6A 3BXNB 5E8PA 4PJHA 4JG0H 1EXUB 2HB0A 1HNFA 3GM8A 3BEWA 4HALA 1E9PA 4OM1L 2ADGA 4PP1C 3D3VB 1BX2A 4X4XA 1R47A 4AVIA 3GLEA 3FN3A 2NLJB 2QMKA 2UWEA 3ETBF 1C08A 4WUUA 2KC0A 3MBWA 2VZVA 3MMEA 3Q43A 1H6TA 3ALXA 3CZFB 5DMKB 4Y2LA 2O1AA 1AHWB 3RI5F 4Y19E 3RKDD 4PJ5B 4DNLA 3I02B 5CFAA 3LB6C 3VXME 4H0IA 3QFGA 4ZFZB 3AGVA 4P2YA 4RDQG 5D2LA 3NACL 1CIUA 1P6WA 1G6RA 3A4EA 4ICXA 1Q94B 4HLEA 3RUGF 5IK3B 1UA6L 3PGDA 2A6JA 4HX1B 5FUZH 4ZK8A 3TEWA 3QWNA 4PS4L 1AS8A 2BM3A 2EEBA 3BD5A 4GUCA 2WBWB 1MNNA 3RIFF 1K6QH 4PCYA 1AACA 2BP5M 3KPMA 1JP5A 4FQXC 4ENED 2XG4A 4JPVL 3T0ED 3DMMA 4NHUB 2VOTA 1MREL 1YNKH 2NT1A 4H1LB 3VH8A 4DPCX 1U33A 4AKQA 5I6LA 4P8QA 4AT6B 3GKZA 1HHHB 3HPLA 4MD5A 1M2VA 4OLUL 3RURA 3L5IA 1FL3B 4FX5A 2A9MH 1IBZA 4B97A 1UD3A 1HKLL 2JCWA 9CGTA 3L4VA 3NIGB 1BOYA 1GGIH 1VESA 2GJZA 1HHIB 2WXGA 3D8MA 3VFSB 1OAQH 1LP9F 4NQQA 2HFTA 1DQMH 3QORD 3AABA 2GJ6A 1BEXA 3D08A 5FWRA 3QEGH 3UCQA 3WY1A 5DJXA 5I74B 3U7WH 4LCVA 3IETA 3IXTB 2CJ3A 4M62H 2IPUK 1FZOB 1QASA 2NY0D 1OM3H 1JFQL 4YH6A 3BGAA 3UTTE 2D73A 2XACC 3SKJL 2P43B 2YFOA 2VXVL 3CDGA 4X6DE 5E4AA 1YN6B 1HCVA 3IVKB 2IQAB 2B20A 3CLWA 3UZEC 4KK6D 4P3DB 1MDTA 2FZ3A 2HX8A 4GRMB 3RJDA 1FE8H 4IRZH 1S46A 2ZSWB 3BPCB 3GXTA 5GRVK 2QR0A 3QYNA 1N3NA 5FUOH 5JDSB 2NY6D 3CFBB 1XR8A 3D39E 4MJ6A 4ZYKB 4DZBA 2NY2B 4L37A 4DGYL 3W5NA 1WV7T 5JW4N 3NIDB 4HIHA 4HXAH 4MCZA 3EZ8A 3CQPA 4KTEH 2PW2B 4NN5C 2BRQA 3N2JA 3ABGA 4QO1B 3DIVA 4FFVD 5DQJB 4R3SB 1XR9B 3DYPA 3QXVA 5HI3C 1G94A 4ODVL 3T3MF 4NB7A 3HVDA 5GSVA 1C1EL 5F89B 5HVGB 4GI6A 1UACL 2PYFB 4HEMA 5EZOH 2O6EA 1TJGL 3D30A 3FZUC 1MHHA 4YLCA 5I1EL 2NNAB 5IT2H 2X3CA 5CZVH 2DEYX 3BPLC 4U3HA 5EOTA 3L5WA 3ISRA 3EFDH 3RYMA 2GFBA 4CVWA 3ZBMA 1KEGH 3GC3A 5DSCB 2CM5A 4M8UA 3IB4A 4AI7A 3FTGB 3MODL 3LD8C 3TP4A 3A47A 2XWCA 5HP5A 1P4LA 3SBPA 3RHWK 1PD1A 2NW2B 5DUBA 5BNXD 3BJ91 5CZXD 3VFUB 1LO3L 2XA8H 2WINA 1KPRB 1BQHA 4PWEA 2W9LA 4LCIH 1T1ZA 3GSWA 3GUFA 2ALAA 5GS0D 1KYUA 5DJCB 3MBXL 4WFGE 4GUQA 3IDMB 4G8FB 4LLVA 5BXFA 1T22B 5CEZL 4RGND 2EECA 4XE0A 1PX3A 5FO7B 4S1RH 1QKZH 1IBFA 3POCA 3B7YA 4LVHB 4WU7A 2WYIA 1ZLVH 4DAGH 4D8PB 5I1DA 1QBMH 4H44C 4PRIA 2FCBA 2F19L 2D03L 4QY8B 4QXUL 1QLEH 5DMIH 1T03L 3ME0B 4FFYA 3IBEA 4AMKH 4IBVA 1SEBB 1KNOB 3BIAX 2VDOH 3FQUB 3QNXB 1AI1H 1DVFA 5JW3H 1LMKA 3MA9H 3T0EB 1G7HA 2G60H 2JFCA 2AVFA 4ODSL 5CLWA 2IAND 1P7KA 3GJEB 3IK2A 3FB8A 4NJ9H 4N8VA 1QD0A 2AJSL 3IDGB 1BD2A 5D8JL 3RGVC 2TSBA 1F8TL 1WZKA 4OZ4A 3CN4A 3GHPA 3VXTA 3K8MA 3V0WL 4EBQL 4UQ3A 1NWOA 4WFHE 3MRRA 4GAAA 2EYTA 4URKA 3QORB 5FWQA 3OBAA 3T09A 1USZA 3EOAB 1XSKA 3LN5B 5DEZA 1DL7H 1EGJH 2NY0B 5E5LA 5AG9A 1SUHA 4Z7VB 3NN8A 4EVNA 4F7EB 4E0RB 1NL0L 1MAMH 4JKWA 2HWZH 1WZLA 2MMXA 4JJ5A 3P4NB 6PAZA 1O7SA 4P49A 1OOAA 1Q1PA 1UZ8A 5GZOD 1V3LA 3B5TA 2JIXA 4FQ1H 2I5YL 3CGTA 2K3TA 2A0LD 3JVGC 3A67L 1Q9KB 2WNXA 3BVTA 2GIMA 3GMMB 1IGJB 3QYCA 4RA0C 5CCHE 1IT9H 1I1YB 3TOPA 4NM4H 1DBBH 4PRAB 5DC0A 1D7DA 4PB9L 1G87A 2V3FA 4OB5H 3UJIH 5FV1L 3OKMB 3QDME 3P40A 4BZ1L 4M5YH 5BJTA 3CV5A 1BJMA 4PIRF 1WBZB 1QI3A 3RDTA 2AXJA 4RX4A 3DO3A 2HFEA 2MWCA 2OW7A 3OKEB 3U1SH 3WENA 2CALA 1J1XL 4M8QA 4MTMA 3BJLA 3FT9A 3KLHD 5ECGA 4ELMA 3V5DA 2GITB 2F5AL 1Z3RA 5TF1L 3CSFA 3MLSH 4WW2A 4GIPD 1MRFH 5CIPA 2ZP8A 3TV3H 1BEYH 4J8QA 5HHQA 5GGSY 1LO5A 3X3FL 2XTSA 5D4QA 5DF0A 5JIHA 1PLBA 2O5ZH 2ZXCA 4KKRA 5CEYA 4M1DH 4RMTA 3PCYA 3CSYB 3L9RA 1WTLA 4XPGL 5F96L 3TYGL 1XGYH 4JY4A 4LLWB 3VGBA 3TIDB 2AEQL 2B0SL 3H56A 5IFHL 3OXRA 2IPKA 3T77B 5GRJL 1EDHA 5I28A 2BLFA 4P2AA 2BIHA 2JKRM 2A9NH 2YGVA 5EU5A 2YSSB 4EZKA 5GGTA 4PYHA 4R4FH 3CG8A 2DQUL 2MQ0A 2VAAA 3SE3C 1FFQA 4PLNC 3MUY1 3JUYA 5KBLA 4U6YA 3ZL4H 1MRDL 1SJEA 2EYSA 5T5FL 3B3IA 3FCTB 1QHQA 4RGNB 1CC3A 3FAWA 1VPOL 1JZ2A 2GBTA 2YK1H 3JWOL 1JPGA 3LDBB 3QAZC 3IFLL 1AKJA 2HJFB 3KPRD 5GS2H 5HDQL 4HGWB 2EO1A 1JZJA 1EFXD 5CWSB 1KCSH 1UJ3B 4HKJB 2EH7H 4GFTB 2FH6A 2FK9A 4O4YH 2OULB 1PJ9A 5GSRA 1N10A 3EJRA 3PJLA 2RQEA 1KTJA 3ZQ9A 4S11A 3RVTC 5CGMA 1KIUA 4TVPH 1M6OA 3OKNB 2OW6A 4TNWF 2O5YL 4I3RH 3KGSA 4Z3HA 4QDGA 3SDCC 3ZDWA 2IANB 2BSTB 1MCLA 4XR8C 1KTCA 5DUJA 3LNIA 3QA3B 3QC6X 1IZJA 4HJJL 4RETB 4AV5A 1PG7X 3K1KC 1L9PA 2C8NA 5KTEL 4GSRA 1UB6B 5L2JA 2AJYL 3AG2B 3BGFC 4X6BB 1LMIA 1IGYA 1BREA 2B1AL 4P57B 5JA8B 3AG3B 4LCCC 1IJ9A 1U8KB 1CDIA 1H15A 1OKEA 3M17A 4LSTH 3UTQA 1MIEH 4OZIF 1VFUA 3NESA 3GUTB 5DLLA 3JVFC 1MOEA 3OXSB 3ULVD 1PDKA 1QSFE 2FTAA 2H2SD 3GINA 2QVKA 1EZLA 3BH8A 4JCLA 2IALA 2DQCL 2K7QA 1CD1A 3S5YA 2F1EA 2RR3A 2YPVL 4ES9A 5DVPA 1BYOA 3LVTA 1AS6A 2DYPD 4X6EA 1QLFA 2KLSA 4M93B 5FKPB 5IV2A 4KUZL 3RTQC 4Y7OC 1UCBL 5JXEC 4J2QA 4YQXH 2G5RA 3S5ZA 1JGEB 1I8LA 4D3CL 1BVOA 5DXWA 1E7UA 3L45A 3AADB 3D09A 4JDZB 4EDXA 4LSPH 1T20A 2ADIA 1T7YA 4ODHH 2X4NB 2XKNB 5JQIB 3B2XA 2J25A 1P4BH 4WGKA 1M05B 2D4DA 2OSLA 1A7QL 4K7PY 4QKXB 3CC5B 4P5SA 4M00A 3IFPB 4U6HB 4F9PC 2DLFL 4RZCA 3Q8EA 4G5AA 2AVGA 4D94A 1CFNA 1FNAA 4A7GF 4XNQB 5EEUA 2XZCH 4DTGH 4DOHB 3BKMH 5BMFL 3U4KA 3D1MC 5I9QC 3FN0L 3LIZA 4XP6L 3S48A 5EEVA 2XPGA 4I18C 4AMXA 2G3NA 4MA1C 5DK2A 4U1NA 2VLKD 2V6HA 3I3BA 3JV4B 3PP3H 5F7KC 2ADJB 1D6EB 3H0TA 3L08A 4ZMWA 3CPLA 3SYQA 3DJ9A 3LKNA 5CCKH 1FFNB 1Z3GL 1CS6A 3FO2B 5IVXB 3KPPA 3ROLA 3N1GC 3SE9L 4R7VA 2GUYA 4UDTB 3B7SA 1G6VK 1L9RA 4PJ7B 1AXTL 3MGOB 5DQDH 5FF6B 5GRUH 3DPDA 1HDMA 3Q8CA 4IOIA 1QR1A 3L3GA 3G04B 3HC4H 1DEDA 1MCRA 2XTJE 4IKKA 4OCWH 3L48A 3D2UA 2EDYA 4ZPVA 3CDCA 3OMIB 1S5IH 3CVDA 3MCKA 2HLEB 4PWHA 4ODWB 4XX1E 3RWIB 4X6CA 4YBLB 1TQSA 3AREC 3NK4A 1IC4H 4NO0A 5A1AA 5IM7B 1HVXA 3KPRB 2QVIA 1Q0YL 3GBNL 4OF8A 2J1KA 3LKPA 2ZXQA 1EFXB 3LNHA 3TEYA 2BVQA 1SXSA 3UJJL 1XGPA 5C6WH 3RA7H 1U58A 4ZG1A 1TZGH 3L7EA 3DBSA 2QADC 4I1RA 5FIEA 3VXUE 3K6IA 2E75C 3BVVA 4I89A 5HDBE 3NCJL 5HYSA 1Z5HA 5T1MB 1YDPB 3DUUA 5CINL 2VDMH 1T04A 5ANME 4GG8A 5CHNA 4F5CA 3B9KD 4ZX3A 1L0QA 3VCLB 4UF7C 5CLTA 4AK1A 4PGDB 1P5UA 4DUWA 3FH8A 4IDLA 2WYTA 3IFOB 4MQSB 1JK8B 5CLYA 2A74A 1ODUA 1U92A 1JG9A 3NGBC 3I6SA 3VG9C 32C2A 1PD0A 3B2VH 4OFYD 5E99L 4N5EC 1HEZB 2HKFL 2B3IA 4Z7OF 2HLAA 3IJ8A 4F7PB 4LMQE 5J4MA 1BAFL 2LTQB 4GSUA 1BZ9B 1UASA 1K2DA 1TZHA 3UTSE 1IAOA 2F58H 2X4TB 2OI9B 1FNLA 2AANA 4M6OL 2P28B 3W39A 1FZMB 1HEJC 2ZWKA 3OHXA 4HSCX 4HK0A 3PAUA 1Q72L 5IEKA 2HVKA 4QXWA 2ZICA 5EB9A 5DRWB 3OVUB 3OKOA 4YDLB 4U1MB 4AQOA 3CHPA 1E4WL 1CD0A 2CDFA 2FBRA 1LDSA 1OAYH 4BFJA 4BZYA 5KANI 2DWDB 1FO0B 2DYPB 5IVZB 1UXMA 5B38B 1KB3A 1NLDH 1A5FH 1TDQA 2WXKA 5TH2B 1FVCA 2QELA 5DDHA 4GRLC 4UM8A 1FPTL 4PBWD 3OPZH 1NBVL 3PAZA 2YAPA 2MPAH 5LVEA 4IOSA 4FS0A 2QGDA 3CFUA 4JFEA 4M8VA 1J0HA 1NWPA 2FL5A 4XRCA 1PZ3A 5L88H 1N5YH 2EH8H 2ARJA 3B2UC 4J4PC 1OK8A 3RRQA 3TT1L 4BK5C 2ZG2A 4IRJC 3CJJA 1CU4H 2UZPA 2BY1A 2NDGA 4DUVA 5LN8A 5F9OL 2VLKB 4QHNB 4Y4HD 2WAHA 5EORH 4NFCA 5IW6B 1I4FB 3D87B 5KVFL 1R3KB 4P07A 5F72S 4NBXB 5FYJU 1BF5A 2A77H 4KFZC 1Q9LB 1JMXA 3PIQB 2J20A 2QPUA 2ED9A 3BWSA 2IWGA 3Q2CA 4EOWL 2OPCA 4ZTPL 4PJHF 1I9JH 3L3OB 3UJTH 4Q97A 1JZ8A 3WIIL 3NA9H 1NIBA 5C0CD 4B0MB 2OMYB 4AQ1A 1OB1A 4KXZH 1E2VA 3F8UB 4P9HC 3K71A 1VZGA 2XICA 3JSSA 3UTPE 1RH8A 4JKNA 4MA3B 1R17A 4NZRH 4XP5H 3W11D 3PHAA 1WCBB 3ZL1A 1K72A 1IEAA 2RIKA 3ZRCC 1JRHI 1SLUA 1WUNT 4XCYA 2VUKA 2ESVE 5I30L 3V8OA 3BIKA 4PYGA 3ZQWA 4ISVB 1TUPA 3D0LA 2ETWA 1MFBL 1TOXA 1U93B 3CMGA 2DLGA 5FYKU 1YYML 4RMSA 4FJ6A 2Z7ZA 4ZUSA 2AS5M 2BSRA 3WJLA 1PLGH 1Y0LA 2NOYA 3B9KB 4B60A 4OF5A 4A2GA 1PX4A 3WO4B 3ULUC 4JZJB 2I07A 4N2NA 1KWKA 3QDGD 4L3CB 4K9EC 2F74B 3AS3A 5IQ7L 1C12B 4DKTA 3O8XA 2X4PA 3UGUA 1S3KL 4GG6E 4K3HA 2YPKA 4WUKH 2D31B 4KUCD 2V0AA 1FORH 5CIPH 2VB5A 3QRFM 4CJ0A 3ZLQC 2ZWZA 1OD9A 3CH8A 4ZX4A 3H53A 2LU5A 4YSDA 2R2HA 3GBML 3HB3C 3VYOA 4AEEA 4CC4C 1W16A 2ZUQC 4HWBL 1GMEA 5HHPB 3IJSA 2E4FA 3WY2A 4JKPL 1A4BA 1K4CA 2D9QB 5C3IA 2UYLA 4X9GA 3NPZB 4QR7A 3AT0A 3BYYA 1HI6A 4ZDHA 2C3HA 4BH8A 4UZUA 3BUQA 4PI2A 1W2KT 2NPLX 1D7BA 5ETUB 4AGMA 2CSPA 3OR7A 1MNUH 3ZYJA 1PGRB 4KKAC 2JKLA 2APXA 1YMMA 5SWSA 4OY9A 4GAGL 5F0LB 3RWCA 1DN0A 3NTCH 5I26A 1U2HA 2J44A 3LQZA 2C7FA 1CQKA 1HJBC 6FABH 1SXNA 2VO5A 1X9LA 1YNTB 1IM9D 2W07A 4OI9A 3EGSA 5I1HL 3HE6A 1PZ5B 1V10A 4FZ8L 2G0LA 5LGHH 2HSIA 1JJUA 1SGKA 5KS9E 4QXGH 5F7EL 4FG2A 4GUPB 4Y1AD 2CQVA 4LOUC 1XGUA 1MFMA 4MNQA 3FO9A 2OMBA 2GKIA 2YEVB 4G9DA 5J13B 3CK0H 1DVTA 3MGTB 4KKNA 3MOAL 1OARH 4IBTA 2P5ED 4YLBA 4JRFA 1DBAH 1J9RA 4DEUA 1N4XH 1F41A 4CUCA 4MDIA 4R9HA 1YHPA 4U49A 1BF8A 1QHOA 3BWZA 5FEBA 3FONB 2B9AA 2HT3D 3KD4A 4X4YA 3LVEA 1UURA 5CEZD 1A6TB 3QH3A 3Q7JA 4XN1A 5C0CB 2WLLB 4OF7A 4O02H 5JHLL 1W6WA 4XPBH 3GKWH 2WK2A 2DAVA 1AQKL 4NN7B 3ECVA 4PVNA 1JZEA 2NNXA 3JUZA 2X87A 3BDYL 3QFJE 4M29A 1DJXA 2B14A 2AZUA 2E8YA 2YRPA 3MA7B 5L4JA 3ARGC 1N26A 3KAAA 1AGBB 4HLZH 3KPTA 5E00A 3SCMB 1AFVL 1MUJB 5AL0A 5KVDL 3P4OB 1KB5B 4YEFA 4YFEA 5DWUH 2NY1D 3MOBL 4LO9A 3OAZK 3RWHA 1HHKA 3LRMA 3FRPA 1YEHL 5K9JH 3G5ZB 2J7LA 1KCVH 1PY4A 4O51A 1PY0A 4XNAA 3CUPB 2WTRB 4NZUL 4XC1L 5DK3A 4MQ7A 4XN7A 3U9UA 3WE6B 5AVSB 3I6LD 5I23A 3EDFA 2XYBA 5IF0B 1HC1A 4YX2L 1JGVH 5E4EB 3S4SG 3ZZSA 1HHJB 2CKBL 4LPWA 4RBPH 3QDGB 2NZ9D 2JK5A 2Q20A 4H0LC 1R3LB 4HULB 1ID5I 3GMOA 1QZNA 5I17A 1ML0A 4NBZB 4Q6IA 5IROA 3VX0A 4TL4A 1X4XA 2X4RB 4Z0BH 5A2KH 1N5AA 5FR3A 3GTNA 4E9WA 5IB4A 2XN2A 3BFOA 3CSPA 3PFUA 1GOHA 2H32A 3LIZH 3WNIA 4WV1B 4WO4D 1RUPL 1E9QB 4EN3B 5DK0A 5I8EA 3RVXC 3LB6D 2IF7A 5IOKA 1BHGA 1MCCA 3HVNA 5MHSD 1UM4H 4P9HL 2IFFL 4C4KO 2RA1A 2VQUA 1QYGL 2VR4A 1I8IB 1NCCL 5GISL 2YPLD 4AITA 4IRSC 3ZKNC 4ANXA 5HHME 4F8PA 3NCYS 1GKOA 2AJUL 4V1DE 3ZDXB 2FSEA 5C0BA 4FQXD 4NQCE 4AG4L 2H9GA 3UPAA 2MCPL 2FJHA 4CC0A 2BSSA 2C7UB 1AGCA 3MSPA 2CGRL 2JB5L 3CQFA 4BH7A 3U2SB 2O30A 4JW3A 3SOBH 4XB7A 3WE1A 4UT7H 2ATPA 2GCYB 1L5GA 5HYJD 1IM9B 3H42L 3QXUA 4HKXB 3EJZD 4AQZA 1ZKAA 4LSRH 3TBWB 3G6DL 4PJ9C 5EEWA 4NRYA 4F2ME 1E8ZA 1T5WA 2EDMA 5I18L 3KNBB 2P44B 2O26U 1CDCA 3GSNA 4M4RA 4OLVH 2C3WA 5C0AD 1WEJH 3ELAT 3GXNA 4KC3B 3T1FA 4ELMF 4MJJA 4Y1AB 3S37H 1H6EA 1UH4A 3BPNC 2TSAA 3HG1A 5AW5B 3SIKA 2MFNA 3QUXD 4NO2B 3V95A 1IQDB 4AM0B 1IAIL 5JHDD 5JW4R 3ULVF 3N85L 4ONFH 1AD0B 5L7XL 2I69A 3V6OC 1INDH 4P5KA 2XVKA 3QXAA 4RH4A 4OV5A 2P5EB 5A3ID 1A7BA