3US1A

Structure of p63 dna binding domain in complex with a 22 base pair response element containing a two base pair "gc" spacer between half sites
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
194
structure length
193
Chain Sequence
b'SPSNTDYPGPHSFDVSFQQSSTKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein 63
publication title Pliable DNA Conformation of Response Elements Bound to Transcription Factor p63.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/dna
total genus 40
structure length 193
sequence length 194
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3us1A00
4IBZA 1CMOA 1HU8A 4AGNA 5KBDA 3KZ8A 4KVPA 2IOOA 3Q05A 2J20A 2J1YA 2VUKA 2XWRA 1CO1A 5ECGA 3US1A 3EXLA 3ZMEA 4IBSA 4L0YA 1GZHC 3VD0A 1KZYA 2X0UA 2J1XA 3WTSA 5LGYA 2X0VA 4QO1B 1EANA 2BIQA 4LOEA 2ATAA 5G4NA 2J1WA 4MZIA 4XR8C 4L0ZA 4HJEA 3D0AA 3VD2A 3QYNA 5AOKA 3D06A 1GZHA 2BIPA 3VD1A 4LO9A 1T4WA 3D09A 3KMDA 1IO4C 2MEJB 3US0A 4IBTA 4IBWA 1EAOA 4IBQA 4IBVA 5AOMA 4AGPA 4IBUA 2XWCA 3D05A 4AGMA 3D08A 1HJCA 3D07A 2BINA 2FEJA 4IBYA 3WTVA 2AC0A 4GUQA 5AB9A 4AGLA 3IGKA 1UOLA 3WTUA 3EXJA 1TSRA 1E50A 2BIOA 3WTWA 4LOFA 4AGQA 3QYMA 1TUPA 2WGXA 5AOJA 4AGOA 3IGLA 4MZRA 3WTXA 2AHIA 2P52A 4A63A 1EAQA 2J1ZA 2H1LM 5BUAA 5G4MA 2GEQA 2ADYA 5AOLA 4L18A 2J6WA 5ABAA 4GUOA 4IJTA 5LAPA 1YCSA 2J21A 2X0WA 3WTYA 4G82A 2OCJA 2RMNA 3TS8A 2PCXA 3WU1A 3Q06A 4G83A 1HJBC 3Q01A 5AOIA 2YBGA 2IOMA 1H9DA 5A7BA 1LJMA 2IOIA 5G4OA 2BIMA 3WTTA
chains in the Genus database with same CATH superfamily
2VZUA 2R8SH 5ESVB 1QG3A 3L95B 3ROOB 2ORBH 3K8LA 3QPKA 4UYPA 5D71L 2HG0A 1RIUH 4FQJH 2A77L 2CH8A 1NEZA 5FYJD 1K8DB 1XEDA 4L3EA 4XAWH 2XJLA 1LP9A 4P2QB 5KSUB 2APWA 2CK0L 3WLWD 1E4WH 1JVKA 3GUTB 3N3EA 7PCYA 3ATAA 1ORSB 4NC1E 1AHMA 1TZOA 4F1SA 1A6UH 5F7FA 1HXMA 3W57A 4AIZB 2DH3A 2B4CL 3QIUA 1J8HD 3GGWB 4WV1A 5I1EL 2IANA 2VL4A 2DD8L 3L3DA 4MX7B 1BOGA 1A9BA 2WUBL 3ARDD 5CAYB 3G5XB 4XOAA 2A9NH 1WC7B 3HAEB 3VD3A 1JWUA 4AKQA 1FORL 4V1DE 5EUKB 3A47A 5SWZE 2KHAA 1DSYA 3SGJA 3L6FB 4XPBL 4PG2C 4JFHE 1SF5A 5SX4I 1J87A 1KWGA 5HYSB 2OMTA 4A7SA 3ABKB 1FWXA 5KJ4A 2YBRB 1NPUA 3BDYL 1WTGT 3PAZA 4QY8B 1E3XA 1K5NB 1ZHKA 2C7UA 3FQWA 4LSUH 1BIIA 1JUFA 3M86A 4JO8A 3LNFA 4P2CG 1JPFA 4TLUA 2RGSA 4I3RL 1Z5HA 4X7CC 4X6FB 4XODA 3ZJAA 1G7LB 2VRKA 3D48R 5D7JD 4D3CH 5DI8B 4Z7IA 4JQIL 4BFKA 1HILB 4AM0Q 1A3RH 2BDNH 3MGTA 1CE1L 2WXJA 4G43B 1NCAL 4H8WH 1A14L 3WTXA 4GAAA 2XNAA 2JQAA 3QS2A 4P2RB 3VSQA 3EJTA 3MJ8A 1T21B 2YOCA 4G7VL 1ZWIA 1ORQA 3DETC 2NNFA 2OTUB 1H5BA 1K85A 5BV7B 1QW9A 2BCKB 2QHLA 3KNBB 4OLWH 5F8QC 2WHVA 3UTTD 1EHKB 5FK9A 4B9YA 5IIEA 2NY7L 1KTDB 4WCYH 4XT1C 1FZKA 3HB3D 1KYDA 4CVWA 1VRSA 2W80C 3WFEH 2BJMH 2WMPB 3FO2B 3H53A 4XMPH 5BV7C 2OSWA 4U0QB 1JXJA 4QKXB 4HFWA 4PD4K 5C0GB 3NJXA 2MHAB 2MNUA 4JN1H 3VXUD 1X7QB 2HVJB 4AIXA 5F1SA 3VFGH 4HIJA 4Q58C 3QJOA 1X6LA 2WZAA 5E8NB 1Q9WB 4Z7UE 1G9NH 1T80A 3APFA 3ILDA 3RX5A 2UZXB 4ODWA 4ZUVB 5TJWK 3DVGB 5I8KL 2IAMA 2CGYA 3EHBB 2V2XB 5ITBL 1RHHA 4PWEA 3FTZA 4FNRA 5DHDA 1FFNB 5KVGE 1BXVA 1AGEB 3ECVA 1IVTA 1TENA 2GCYB 5IMMB 4YX2H 4UNTA 3RYMA 3MLYL 4OFDA 5CP7B 5FO9A 5I0XA 1Q90A 1EZSA 4UDTA 1YEHL 3UAFA 3VMNA 3WTSA 2Y2TA 3EHBC 4PJEF 3VCLA 2VISB 1LQBC 4KRPB 5HHVL 4JFEE 5BOJA 4G6KL 5ESVA 2JCCF 4FI8A 3HTLX 3L95A 3ROOA 3WFBL 3KPLB 3PGCB 3NIDB 3PIQB 4KJQC 3OR6B 4KRPC 4NP4H 4A2GA 4AT6B 4YSUA 5JUEL 4XI5D 5D7LD 1K8DA 4KKLC 5FOBB 4HXAL 1OE3A 4YL4A 3IYLW 1QEWB 4P2QA 5KSUA 3S3DB 3WSQL 4MXQC 3GUTA 1BYNA 1RIVL 1NCWH 3D07A 1ORSA 1GVIA 4G70B 2DM3A 2FYYB 1RP9A 2C9AA 4PIBA 4AIZA 3GGWA 4AMKL 2JSFA 1CGWA 3QUXB 2ZF9A 4MX7A 3D85D 4PG2A 1RZFL 2OM5A 1U8LB 5GS2H 3HAEA 1WC7A 3EXJA 2PR4H 4HKBB 3OZLA 5HSFA 4AL8H 4J28A 5EUKA 3F65A 4N0UB 3Q9PA 1JYWA 5C97A 1GGCL 3NEOA 3QUXC 1LL1A 3ESVF 3L6FA 2JB5L 1S7QB 2YEQA 3S2CA 2EE0A 4CSSA 5HYSA 2R4RL 2ADYA 3Q1SL 4Y4FB 2AV1B 2YBRA 4E41E 4QY8A 3LS4L 1NMAL 4Y19D 1TU2B 1XSOA 5A2FA 3F62A 4X6FA 4LNVA 1IM9B 2Y5QA 4LGSB 5DI8A 4OLYH 3UXFA 4G82A 1HILA 4Y4FC 1PL3A 1T1XB 4JFZH 3FMGL 4BQCA 5J3HD 4G43A 4P2RA 5GRUH 1T21A 4KY1H 4RDQG 4AVIA 3A6CH 2P80A 1H3GA 2CO3A 3JWOH 1ONQB 1JWSB 2V6HA 3KCPB 4ZPVB 3VI4E 4XNDA 4NRXB 1C16B 1O9VA 2BSRB 2OTUA 3GI8H 1L3WA 3CZKA 2BCKA 3KNBA 4FTVD 3ULUD 4KO5A 1KTDA 1D6EB 1R1CA 4M62L 4MQXD 3ATBA 4LOVA 2WMPA 1EHLL 2VDOH 2C3GA 3FO2A 4QOKD 3SDDB 3UO1H 3ETBJ 2IJ0C 4ZMPA 2I32A 5IP4A 3QHFH 4JFFB 5C0GA 2H9GB 3QDMB 1NANI 2MHAA 1JI1A 3GKWH 3CDFA 3RZCD 1X7QA 2HVJA 4XN5A 5E2UH 5JO5B 1ZGLB 4JKPH 1U3JA 3K0WA 1RZJL 3ESUF 2BOBB 2PWDA 4XH2B 3N91A 1F4YL 1Q9WA 5E8NA 3SDDC 3ZDXB 4B41A 4QJ3B 1NDMB 2XTSA 2UZXA 1BZOA 4ZUVA 3DVGA 2YKLL 5KW9H 2V2XA 3II1A 4MVBD 4TV3A 2O93L 4TNGA 4RMSA 1FFNA 3PHOB 1AGEA 2GCYA 5IMMA 3IDNB 4EE2A 5CP7A 4S1SL 3QJQB 4IBVA 1CJYA 3MNMA 2HT2C 4PAZA 2A7BA 2VISA 3IGFA 2BRRL 4I5BB 5C8JB 4UZSA 2FX9H 3BWUF 1M42A 3QQDB 1IX2A 2VC2H 2WY3B 1WAAF 3LQMA 5EZLB 2CO6B 3BIKB 2FUQA 3KPLA 3PGCA 2BMKB 3PIQA 3OR6A 1LMIA 4AT6A 4JHWL 4MS8D 5FOBA 1NCCL 1QUNB 3GNML 1QEWA 3VM5A 5EB9A 2H32H 4Q89A 3LXCA 1IE4A 3DROB 3HHSB 4QTIL 4M6NL 4ATWA 2FYYA 1XVSA 1QZ1A 3KR3H 4G8IB 4AEFA 1HHJB 1NGZB 3QUXA 4PS8A 1LO4H 1U8LA 4F24A 1BMWA 1BM3L 3HMXH 3K6IA 2AJXH 3HBPA 4HKBA 1I53A 5DC0A 2X4UB 1J5DA 1G9MH 4PJBE 4Z7WB 4N0UA 1PMYA 3F84A 5TD4A 3QHZH 4P5TB 3O3DB 1W8NA 2EEBA 3FH7A 3F00A 1T7XA 3I3DA 3MN8A 2WKOA 4M6OL 1CLZH 1S7QA 3Q43A 4XVUD 5FYKL 1DQQB 4PMFA 4OJFH 5AVQB 4UV4L 1VA9A 5F7NC 1J12A 4Y4FA 5IJVB 4XN4A 2AV1A 3ARFD 1WUZA 1EJOL 2F1BA 5TTRA 1JZ3A 2VUYA 3HLAB 4P5TC 1TU2A 2GPZA 2FECL 3CSPA 4KVPA 4L8DB 5ACMA 4PM1A 1IM9A 1ZXQA 4Q7DA 4YHNB 4BD4A 1J1OL 2FQFA 4HZAA 1T1XA 2DQUH 3QUMB 4U3HA 2D7NA 2WQRA 5MHSD 2AANA 4JFUA 4JO3H 4OSUL 5E9DE 3GS4A 3KCPA 4FYQA 1ONQA 1JWSA 1GGIH 4ZPVA 5FYLD 43C9B 2C1OB 1C16A 1UT1A 2BSRA 4NRXA 4NXKA 2YUXA 1LK3H 3RX7A 3TVMD 4A6YB 1CFNB 2OJEB 3P3TA 1D6EA 4TQEL 2KDYA 4L0PB 3QXAB 1GOGA 2RA1A 4XMVA 3LVEA 3QQ9D 5F44A 1AZRA 3E3QC 1MREL 2WQWA 4M1GH 3SDDA 4F8PA 2VDLL 4OGQC 1X5HA 4JFFA 3ZX1A 3T1WA 2H9GA 4FHKA 3QDMA 1MFMA 3UERA 3BAEL 4AQOA 1RMFH 4XPAL 3QT2A 5JO5A 3HVNA 3EO1B 3JXAA 2ERJC 2HA1A 5JQ6H 2P8PB 4A67A 5CWSB 2BOBA 2BH0A 4XH2A 1BAFH 1U3YA 4B9JA 4P9MH 1NDMA 3CZFB 1YA5A 3GJEB 4ESKA 3BRGC 3K1DA 5MHSE 2D0FA 4QMEA 3FUDA 4ERSL 1LDPH 2VXUL 3E9UA 3V5DB 1TSRA 3PLYA 4NWUH 3NCJL 3PHOA 3VFWB 4PVMA 5D8JH 4XX1E 3IDNA 4HIHB 5E08L 4NM4H 3EYQD 3NJHA 5HHMD 1TJXA 4ELDA 2VUOA 3V5KB 4WRLA 2Y7QB 2OCFD 5DUMH 1O6VA 5HHOA 5AOLA 4I5BA 3SEPA 3GXPA 1AY1L 5C8JA 5C0JB 5AZEL 2W95A 1HZKA 1FNFA 4DO5A 3QQDA 1T03H 4Q8BA 5EZLA 4AJVA 1PSKH 2CO6A 2FIKB 3BIKA 3VGBA 4A2MA 2BMKA 4EZJA 3VSUA 1QUNA 2WP3O 3VXSE 4JKWA 3IVKB 2VRQA 4NPKA 3QFJB 4HQQL 3HHSA 3S98A 5GGTL 4EPSA 1K72A 1QYGH 1UB6B 2WBWB 1UQSA 5KAQF 1JMZA 4PB0L 3DUUB 5EFIB 1A6VH 2V33A 1UUNA 1GL4B 4DESA 3N43F 2ENJA 2RQEA 4G8IA 3T0ED 1HHJA 1NGZA 4XVTH 4HC1A 1RY7B 3BAWA 1G4RA 2IG2H 3SGDI 2K4AA 4M5SA 1EZVY 2APTA 4KVCL 3ZE0E 5GS1B 2DQCH 3RY4A 2BNQB 4WEBH 1CR9L 1LD9B 4KXDA 2X4UA 3ATEA 5L2KD 4Z7WA 5DD0H 3RG1C 1BEYH 25C8L 3B2DC 1I8LC 4P5TA 3O3DA 3UPCA 4N2HA 1EWHA 3HHMA 4OQTA 4H13C 4QUOA 1IGML 1KTBA 2VZSA 2CM5A 5E8OB 4AM0B 2J88H 3NCBB 5GS1C 4L0ZA 4YL9A 1DQQA 1F4XL 3ML9A 1G6RL 5IJVA 3G7TA 5FUOH 2R2BB 3QRGL 2ZX8A 1NGQL 3RUGF 2QTVA 4ZX3A 4JPWL 4KQ0A 2ZWZA 3EFDH 3HLAA 3WNMA 1NBVH 5DC2A 4OFYD 2CJSA 4KTDL 4GMTL 3OB8A 4L8DA 2CZNA 4PWKA 4ADJA 2XWXA 2Y6SD 2WTPA 1IO4C 3O6LL 4YHNA 1UC6A 5D1QB 4GS7B 4MMZB 1L6ZA 1HKLH 4DERA 1IB5A 4CMHB 1MFAH 3PUUA 4XBPB 2XN0A 3QUMA 4NLAA 3K6DA 5KYWB 4W9JC 3DX2A 4F93B 1KGCD 4OZHF 4RZKA 1E67A 4Q97A 2YGOA 4YXLL 1N5AB 2EXSA 4KKNA 4F7KA 5ACZB 1CICD 1MH5B 3KDMB 4KKPA 43C9A 5IQMA 2C1OA 3L9YA 5D1QC 4GS7C 4MMZC 1JD7A 4N8PA 4CMHC 1QSED 4A6YA 3HG3A 2DJUA 5LGHL 3RFZB 3QCUH 1CFNA 2OJEA 3KVQA 4R96B 2DQTL 2CJUL 3KPRD 2Y7OA 4KI1A 2BY2A 3QXAA 2WZPD 4NZFA 2E7MA 1MIML 4AGOA 3ZZ1A 2P7TB 3E0GA 1UA3A 3GZPA 4LLVB 4N0YH 3CX5J 2EACA 4I4WB 1E28B 3CV5A 1EJ6A 3NT0A 1Z3RA 1SM3H 3RFZC 4DQOL 1P84K 4S0HA 1RI8A 4OJYA 1MAML 1E8ZA 2YAPA 3R06B 3EO1A 1XR8B 5D2NE 3OAYK 4NQSB 5B8CB 5MEND 2P8PA 5CWSA 2CPCA 5BRZB 3TEYA 2FDBP 3MCLH 3CZFA 3GJEA 2CHWA 3AZUA 3WOVA 4W9FC 1YYMH 5D2LE 4UTBA 2IH9A 1KGCE 1MVYA 2V3EA 5HDLA 3V5DA 4CBPA 4TPRL 4TQIA 4JFTA 5B8CC 3VFWA 2ZZUT 1TTGA 1J0HA 4LCWE 4HIHA 5BUGA 4J8QA 3GD1C 4G9DB 4NZTL 5DFAA 3KG5A 3V5KA 2HB0A 2Y7QA 3QXDB 3MR9B 5DJAB 5ITFB 3U46B 2ZG2A 1FE8H 5LWYL 3TFKD 1MEXH 5C0JA 3BT2H 4YDZA 4Z5RB 3VXMD 2YR3A 5A2JH 1T0PB 2AKRB 2CJ3A 1ZD6A 3U48A 2J20A 1S7SB 1V3LA 2FIKA 2YO3A 1F97A 4Y5XB 3HW7A 4R7NB 2VB5A 5GGVH 1LVEA 2ZKMX 1DQDL 1TOXA 4I77L 2NDFA 3DX9B 1WWAX 1WYJA 3EYUH 3Q2CA 4M7LT 3VD7A 2VZVA 5EEYA 3FUFA 3IVKA 3ILPB 2VQ1B 4PJEB 1E5BA 2I69A 3QFJA 1UB6A 4Y5XC 4M5ZL 1ZA3B 1ZHNB 3MFGB 4TOYH 3DUUA 5EFIA 2FO8A 4MA7L 1N9PA 3L1EA 4QEGA 2GVYA 1I8LA 3GLAA 1HT6A 3SE3C 5K9JH 1Z0NA 4UV7H 4QJ5B 3QORD 1JPEA 4X6CF 5GS1A 3WXWL 2BNQA 4P9HC 1LNUB 4DP9X 1DEEB 3U6XA 5D5ME 4BHUI 1NAKH 4O02L 5KVEH 1CL7L 3OJDB 2VWEE 4FNPA 4KX7A 1GYVA 2CR0A 2TSAA 5E8OA 2OULB 3FT3B 4G6JH 4GKLA 2DS4A 4AM0A 4AC4A 1NAMB 3UPRB 1CFSB 4L4JA 4ANWA 4M1CC 2R2BA 9CGTA 3HVDA 3QIWB 4BZ1A 1FV1B 35C8H 4AENB 3MRQB 4GO6B 3P11L 4NJAH 3ZYIA 2BOCB 1QNZH 2JK5B 1ZXKA 3FU9A 3OF6D 4G3YH 5KANG 4MD4B 3GXUB 1HWHB 3QFDB 5KVFL 2ZUVA 1MF2L 1OT2A 4X2UA 5D1QA 4MMZA 2YQBA 4CVUA 5HVWA 4LSQH 2Q1EA 4XBPA 4AQZA 2XFGB 4WUUD 3QIWC 5ADPH 5KYWA 1H15B 4N8UA 1E4JA 1JP5A 3L5WB 1MI5E 5ES4B 4YHKH 5CIPH 1N5AA 4Y16D 2Y23A 5GRJH 3SE8H 3KJ6H 1MH5A 3KDMA 4R26H 5ACZA 4YAQB 2E9WA 3HZVB 1CQYA 4JM2D 2F5BL 3LH2H 4KROB 2VLJD 1SXBA 3B7TA 3ZYJA 1WIUA 3RFZA 1NEZG 1BECA 4R96A 3SQRA 2WXHA 3ATDA 3RP1A 4FFZA 3QJZA 1IC5H 4OCSH 2Z91B 4EI5B 1BZ9B 4LLVA 5CXPA 5E5LA 1J0JA 1NBCA 4KROC 4I4WA 1E28A 3T65B 2KPNA 4B53A 2H4EA 1D5IH 2BVUA 3T3PF 3MODH 4K0OA 1I8KB 1U8CB 4ZNEA 2IBBA 3R06A 4OFKA 3DDFA 4E42B 3SY6A 4IDJL 5ILTL 1XR8A 4Z8FL 3LQAH 5B8CA 4NQSA 1BQLL 2B4CC 5ALBH 3QEQD 3L45A 3T4AB 1XF5A 2BW4A 4EI5C 5BRZA 4FA8A 1Y6NR 4CUCA 3B4NA 2AK4D 4JUSA 4JM4L 5I6KA 1PVHA 3QJTB 4PJFB 1RFDL 4F7TB 2J1YA 5TE4H 2ZYRA 4R4NC 1FLTX 2OZ4H 1CU4H 4H4NA 5F1KC 3T4YB 3T4AC 3DX8B 3LY6A 3D6GA 5EU6D 5D72H 3B9KD 4JPVH 4G9DA 2PPFA 3AG3B 3MLZH 5I30L 3L5XL 2O5XL 1BPLB 3QXDA 3UO8B 4PLNC 3MR9A 5DJAA 1FFPB 1QFWI 2R9HD 3O9WB 4YDVB 3U46A 5ITFA 5E5MB 3TF7C 2YRLA 2X4TB 3FFCB 3CSYB 2ZX7A 3HZMB 1W72L 4Z5RA 3R8BB 1SLWA 1MFDL 5DYFA 2AKRA 3H54A 3QC5X 4LSTL 1EHXA 4IM8A 4QRRE 1JNJA 1S7SA 4HCRA 3O9WC 3QR0A 4Y5XA 4LLWB 1G9HA 2EXWC 4XX5A 5JZ7C 5F7EL 2DB8A 4FMFA 2M26A 4R7NA 3BVXA 2CIKA 2LU7A 8CGTA 2AQRA 3DX9A 2GJZB 4XC1H 4XB7A 3SE3A 1JXGA 2F8OA 1QSFB 4UUJB 1BG9A 2NNRA 3ILPA 2VQ1A 4PJEA 4WW2F 1T1WB 4X8JB 3VNYA 1ZLUH 3ZIYA 2UX7A 4LLYB 4K7FB 4U6XB 4X99B 1ZA3A 2A99A 3CHQA 5KYUB 5I8EB 1DN2A 1USQA 1KEGH 2XDHA 5CLXA 2B15A 3GSVB 5J4MA 2I9LB 3F83A 1YYLH 4GQ9L 5EOQL 3FBKA 1NDTA 2AEWA 2N0KA 3TCLB 2D73A 2DQMA 2X3AA 3MCG1 3IJ8A 1DBML 3KHOA 1BIHA 4A2EA 3IPFA 1LNUA 3JTSB 5TF0A 2CUMA 5L4IA 5HI5C 4KI5E 2IQAB 1TYRA 4MRBA 3OJDA 2WXPA 5GRYA 4CN6A 1CK0L 1HAUA 3L1OL 3UPAA 3L2MA 1XHHA 2SODB 3WEXB 3FT3A 3C75A 2RIKA 1NAMA 4ZSOE 4RESB 4AJ0A 3UPRA 1CLYL 4B9FA 1CFSA 32C2B 2IV8A 5J6GB 4HUVB 3NOIA 1VZHA 4KKZA 1CYXA 4KK5D 4BFEA 1ZIBA 2Z34A 1UWGL 2BSTB 3QIWA 1OARL 1FV1A 3UACA 4AENA 3MRQA 3RY6C 2BOCA 3ARVA 4ENZA 2JK5A 2GK0B 4DUXA 1XSJA 4R8WL 4MD4A 3QFDA 1FO0L 1NL0L 1JGEB 2WLHA 3NCWA 2LE9A 5I15H 4XXWC 2AEQL 1UT2A 5ERWB 1H15A 3AJ7A 3L5WA 5DS1A 1PZDA 3BKYH 3OMNB 1KIRB 5I74B 2J2ZA 3AXIA 1TPXB 4NN5B 1F6AB 3BKMH 4P2OB 4YAQA 2RFXB 3HZVA 2GSGB 3FUMA 4FKEA 4F7PB 2P1YA 2CIIB 5F96H 4AYEC 5AW5B 4G11A 3CZSA 2EUZA 3B7SA 2V37A 3CLFH 3P0VH 5I74C 3P0YL 1TPXC 2J44A 3K4AA 4NN5C 4MBOA 3B5GA 2Z91A 4KZCA 4P2OC 3GK8H 1BZ9A 4EI5A 2VO5A 2A38A 1AZBA 5CCGE 3T65A 4AX3A 5I1GH 1I8KA 2DI9A 1U8CA 4E42A 1VFBB 4Y7MA 3QNYB 3KXFE 1RV6X 4D0BB 1QD0A 3T4AA 1TJIL 4BJLA 1UH3A 3EF7A 3OMZA 3HAEG 5HD8D 2CUAA 4WU5B 2DMCA 5HYJB 4PJFA 5I8OL 4KRMB 2EC8A 3I2CH 3IFOB 4OJEH 4F7TA 1GXEA 1DQJB 3T4YA 4Y9GA 2EYRB 3DX8A 3STLB 3UYRH 5HYSG 4ZMLA 1XCWA 4JQIA 3ULAB 1T04B 4PTUB 1N0LB 4PPTA 2I24N 1FFPA 3O9WA 3EYOB 4AKOA 4YDVA 5E5MA 3LKRB 3MRFB 1MNUH 2XVKA 4KK9D 4HYTB 2Z6FA 2X4TA 3RRQA 3FFCA 3CSYA 3HZMA 3HR5B 2EDQA 1IV8A 2YD7A 4ABWA 2W5PA 3HAEH 3KWTA 3CGTA 1M4KA 2KZBA 1Z32X 3SO3B 1FYTD 3GSRB 2XPYA 1KXQA 4LLWA 4NO5B 5DFVD 4WUKL 3PWPE 1GGBH 5SV4A 3U7WH 4UIMB 4PGBB 1YEFH 2GJZA 4Y4HD 3JWNC 1MIEH 4Q6IB 1QSFA 3C5ZD 4UUJA 3HG1B 3SO3C 4X8JA 4P05A 3WIHH 1T1WA 2W9EL 1UOVA 2WVVB 4LLYA 2DQEL 2QTEA 4K7FA 4U6XA 3CCHB 1JTPA 4X99A 2FB4L 5KYUA 5CEXB 1EUUA 4DKDC 5I8EA 3BAYA 4WK2B 4DFIA 1CFQB 5DR5L 1NGXB 2FK9A 1A0QL 1CVSC 3GSVA 4UWQB 2I9LA 1J18A 4M7LL 4Q6IC 3SYCA 1A7BA 3TCLA 5HYFA 4GMSL 1NWOA 3WI9A 2FGWH 3JTSA 2IQAA 5E4OA 4S10A 4PS4L 1QUPA 2YFNA 4U31A 2XZCH 4XN1A 1RZJC 3RY6A 4WIQA 3BKJL 1RKRA 2JJWA 3QDGD 3WEXA 2EH8H 1AKPA 2AJVH 32C2A 5EZJB 5J6GA 4HUVA 4ZBJA 4XXWA 4OTXH 3L48A 4GRLB 4FC3E 4YUEH 1W9XA 2VITB 2BSTA 3B9DA 3FZUD 4YLBA 5DC4B 5E2TH 5HPOA 1SHXA 3PQYD 4M61B 3FJTA 3TTSA 3P4NB 2JVUA 3EJQA 3LZQA 2GK0A 4NEHB 2VM9A 1AFVL 5HI3D 2ATPB 1DVQA 1JGEA 3NJMA 1JZGA 4KK8C 1RURL 4TVUA 3SQBB 4GRLC 3O6FD 4WI9A 5ERWA 1MCEA 2RCSH 1FN4B 3OMIB 1AXSB 4N4YB 3DTUB 4YE0A 3CSTA 5KTEL 3VU2A 1F6AA 5T3ZL 2ZAIA 1IKFH 4P2OA 2GSGA 2QHRH 3H1ZA 1FI8C 4JRLA 4F7PA 2CIIA 3HN5A 1B3JA 1YJDL 1BQSA 3BWSA 5JTWA 3QDGE 3EOBB 3A21A 3OHXB 4FG6D 2AS5M 2WXFA 3VFRB 1WHOA 1OP3K 2ICWB 3CBRA 3O2WL 3RWCB 1Z9PA 5FV2A 3WE6B 1VFBA 1KB9J 4JRWA 3QNYA 2XWTB 2NSQA 4NJ9L 5GGUB 4D0BA 3OHXC 4JY5L 1F4HA 3S34L 4UM8B 3NQKA 4EDWL 4WU5A 2X1QA 4KJWC 5HYJA 3QEHB 3T3ME 1CFBA 4UOW0 3VM7A 3E38A 2F8VA 3IFOA 2OZNA 5IB1B 3ISYA 1DQJA 1ET5A 4PI0A 2D7PA 2EYRA 4UB0H 1W6WA 3STLA 5G2NA 1R75A 4EZLA 1ACYH 3QJUB 3TTYA 5AOZA 1EMTH 4AEHL 4CKVX 1T04A 2MIZA 4M6MH 1N0LA 4PTUA 4R4FH 5CEZL 4TVPD 3EYOA 2X2IA 2W9DL 3LKRA 3MRFA 3GHBH 1UM5L 1IIKA 2K6YA 3HR5A 2BWDA 3J2PA 1OGSA 2IAND 3WEAA 5EOCL 5D4QA 1U91B 5ESAB 3EZJB 4YO0B 2LFGA 3GSRA 1S8DB 2Z8RA 4NO5A 2YLHA 2Z4QB 2JLPA 2D7TL 1G9EA 4FNLL 4UIMA 4PGBA 2YBGA 1S7RA 4JFWA 4Q6IA 3TA3D 4PIRF 3VQLA 2B0SL 3HG1A 2VDLB 1O75A 2EIMB 4B5EA 2AABL 2WVVA 4DT2A 4QHPA 5LN8A 1HOCB 3CCHA 5CEXA 5D70L 4HD5A 1R5VB 3MNZB 3TPUB 4JK0D 3BPNB 1HCYA 1BAGA 1CFQA 1NGXA 2XWJB 4L3EE 4ZTPL 3ZKMD 2EUXA 1JS4A 2RBLA 1KJ3L 5A6IA 1LP9E 1PLAA 5C3LD 4XB8A 4TVPE 1DLFL 2FNBA 4KXCA 4X6DB 5T3XL 3ZZQA 2H0EA 2Y9RT 2YPKB 5JW3H 1MFEL 4NNYB 4DKFL 3QEGH 4HWBL 5BS0B 3U7YH 4FADA 3BPNC 1ZVHA 3ERXA 5DQDH 4UQ9A 2CJTA 3DLQR 1KFAH 3FB6B 1B4JL 5GZOC 2Z9TA 3ULVD 3IJHB 3VD2A 1YMMB 4LU5H 1W0YT 5B4MC 1IC7H 2C34A 1KTRL 3Q6GL 5DU7A 2R0WL 5EZJA 4HF5L 4KFMA 3GUFA 4GRLA 4BIKA 2WKGA 5HYQB 5L2JB 2VITA 5E56A 4X80H 1SYSB 1MCCA 4M61A 3W1ZA 3KPTA 2D03H 3P4NA 3GPEA 5GS0D 2J8UF 1N64L 3HE6B 4J3UA 4TF4A 5DRXB 4A7UA 3I6LE 2WBJB 2ATPA 5JORB 2VLME 4WVRA 5I1JL 2EINB 3GSOB 3LHPL 3DKHA 3SQBA 3DIFB 3O2VL 4JKNA 2QADB 4YSPA 2QPSA 3BLBA 1FN4A 1NC2B 4H2CA 1AXSA 2CCWA 2B39A 2ATKB 5I19H 2C4FT 1FL3B 3HE6C 5FWQA 4F27A 2NYZA 1UUSA 3WNLA 1PAZA 2WBJC 4BA8A 2PPEA 3RHWK 3HJ0A 3QH3B 1ZOXA 5E94B 2QADC 3RVWD 2FE0A 1OM3H 2IAMD 4P59H 5HGAB 3OHXA 4DCQB 5GGSY 2PPCA 3VFRA 2NY0B 1C08B 4KUCF 1SHMA 4RDBA 2PYFB 2ICWA 1L0QA 2AQNA 3RWCA 3PP3K 4XCCH 4ODXB 3REWB 3D0VB 4I0CC 3WE6A 5IW6B 2XWTA 2GC7C 4FQQB 3VG0L 5GGUA 2LAGB 3FCTB 5GJSL 2ZXAA 2NY0C 4PD4J 4UM8A 3RWDB 2LLLA 1UGNA 4XMUA 3KW8A 3QEHA 1NIEA 1SUHA 3RWHB 1QBML 4ZTEA 1G6RB 1O7DC 3ZDZB 3AG4B 4PHZA 2ADJB 2ICWJ 5K1NA 4WNJA 5IB1A 2XTLA 4OD1H 4XO3A 2CAKA 1KT2B 4YQXH 3BEWB 1XGUB 1S7WB 3ESMA 3SZ6A 2FBRA 1GAFL 5KBKA 4P2QD 4KOBA 5BMFH 4K55A 4OCWL 4QYOA 2BSED 3TURA 1B6UA 1B6DA 5A3ID 1S3KL 2QR0B 5A2CA 3EFOB 1PCXA 1E4KC 3ENEA 3QZBA 4D0DB 1EEQA 1MFCL 3DXAD 4ISVB 1ZTMA 1U91A 2A83B 3PXLA 4KMLB 4QKTA 4YO0A 5ESAA 4WW1B 3DPDA 4A37A 3RGVB 3KLSA 1KY6A 3K2KA 2Z4QA 2OX5B 5DVKA 4OQTH 1IBGH 3KLQA 1IT9L 1NUFA 3VD4A 2P5ED 1N10A 2DW5A 3QJFB 3MOBL 5IT2L 2I85A 1SOXA 2HT3C 2OW7A 3EBIA 2KS0A 2YA2A 3OB0K 4U7KA 4X7TA 4K23H 3S35H 5JMRA 3TV3H 1HOCA 4K3DH 3RGVC 1YRKA 2ARJB 1R5VA 3MNZA 4M43L 2GHWB 1DANU 5F3FA 3TPUA 3MVSA 4ZS6C 2XWJA 2NYYD 2WM0A 3ZHNA 1T89C 4NQXB 4P2QE 5B1AB 5GZOA 5KSBB 3EF4A 4P5KB 4JDVB 4HXBL 2NT1A 3IAQA 4X6DA 3QUMH 4DP8X 3S2AA 4FCHA 3BEVB 1FC2D 2YPKA 5C0DB 1NGYB 4LQFH 2XBZA 4NNYA 5BS0A 3TBCA 5CR8A 1IGCL 1UHVA 3GLZA 3O3BB 4GOSA 5FM8A 3FB6A 1SXZA 4GBXD 4WI0B 3IJHA 4YEEA 1YMMA 3UG4A 4J4PC 3HUJB 4K5PA 3C5XA 5HYQA 5L2JA 5HDBE 3GM0A 4KV5E 1OCOB 1SYSA 1QVOB 2F1AA 2CRYA 3AADB 1HQRB 3HE6A 1N4XL 4QIRA 5DRXA 4HAKA 2WBJA 5C2UB 1HE7A 1MJ7H 4LSVH 2F19H 5JORA 2M2DA 5D6DC 3U1SL 1ID2A 1G1YA 2J1ZA 3DIFA 1H6TA 2OR7A 2EVFA 3WJMB 1XD0A 1NC2A 3T0WA 4X9FA 3SGEI 4DP2X 2FBJH 2ATKA 5CGYD 1FL3A 5DD1L 2A5UA 1SOSA 2ENQA 4Z7NF 2FD6H 2H5UA 4UTBH 1F11B 3QH3A 2R51A 5IB4B 3RJOA 5E94A 2HRHA 5GGTA 1MN4A 4OCNC 4P2RE 1DZBA 1JAEA 1YY9C 3EHBD 4XP5L 5HGAA 4JHAH 1U33A 4OZIB 4DCQA 3O6KL 1C08A 1ZSHA 2PYFA 4UOQA 1NFDF 4ODXA 3MA7B 3GSNL 3QUZD 3D0VA 3REWA 3SPVB 4O02B 1ASOA 4HU8A 4YHOL 1S78C 1PJ9A 4FQQA 2LOEA 4W6WB 3FCTA 4KRPD 3WIIH 3RWDA 3TEXA 4KKLD 4ZMZA 1T0NB 4ONGL 4YH6A 2VN4A 3RWHA 4BUGA 2JIXD 5AVWB 1G6RA 2HT4C 3K74B 5BZXA 4PJAF 1J0IA 4OCYH 1R19A 2ADJA 5DLMH 2CMRL 3W39B 1A3ZA 2WCSA 4CU7A 1KT2A 4YFDB 2XCMC 3BEWA 1E4KA 1XGUA 1S7WA 4LSSL 5DVMA 3OD3A 5LG6A 3ELQA 2WIMA 4R90H 1YEIH 3DTXB 4YIQB 5F7HA 1TQVA 4A2LA 1SN2A 1TTCA 2WUCH 3Q0HA 2VMJA 4IIZA 2MPAH 1AYOA 2QR0A 1UM6L 3EFOA 4J23A 4J6RH 4PJIF 5GRVK 4D0DA 3L5JA 1OAZH 3LPOA 4ISVA 2FTAA 3QUXD 4HETA 3ZDWA 3I9GL 2A83A 3ZE1F 2KH2B 1WGOA 2HKFH 4WW1A 1T7VA 5CS7A 5FYJL 5BRPA 4OI8A 3RGVA 4UT6L 2OX5A 1LO0L 4OF3A 3I6KB 4XOBA 4L4VE 2X1PA 5H37H 3CE1A 5ALCH 2YGQA 3M88A 3QJFA 3UBFA 4B7LA 1T89A 3AG2B 4YWGH 1ETA1 1JDDA 4IIQB 4P5RA 3RTLA 4B9CA 4F9LC 5L0QB 4KO9A 3NZHL 1BZDA 4XN2A 3VE0B 1MDAA 3NIDE 2VR4A 2ARJA 3IBOA 3QAZB 1N7ML 4Y4FD 2K6WA 2JXMB 3GLEA 4RBPH 5LCVL 2WWNA 2OSXA 4NQXA 5KSBA 4WSGA 3JQOB 5FGSA 4P5KA 4JDVA 3MXWH 4IIQC 4J4PA 5L0QC 3CMOL 2ZUWA 2XOTA 3ALPA 4UINL 3BEVA 2WYZA 4XNYH 5C0DA 1NGYA 3I50L 4LMQI 3QAZC 2VAAB 3X14B 2GEQA 3QULB 3O3BA 4ZTOL 1KIUB 4TN9A 2B2XL 4WI0A 5E00B 5E6RB 4K3HA 1NIBA 3HUJA 5D6DA 3BYYA 2GBVA 1DBJH 4PRDB 4FFZH 2RQ8A 2ZKHH 1QVOA 3CSBA 1CGXA 4MDIB 5EORL 4MJ6B 1HQRA 4AW7A 4C56B 4MSWB 4W6YB 1CXFA 1W72B 1I85C 5IFHH 4XVJL 1P69B 5CFHA 4EUPB 5ICYB 3O6ML 3B56A 1SDYA 2KZ1B 3WJMA 1I1AB 3QDMD 4UOZA 5C71A 1J5OL 4PRPE 1CDBA 2WZ6A 3N42F 4HIXH 3FPYA 2NRDA 1XV8A 4ZRGA 5IV2B 3GI9L 5EV7A 1H3WM 3Q05A 5IB4A 1BX2B 2J55A 3H3PL 1OGAB 4YK4B 1I1AC 1WZ1H 3CPLB 3FSOA 2HT2D 3SGKC 2F2HA 3D39D 3E9TA 1JRHL 4CW1B 4OZIA 2IQ9H 3JT0A 5LVEA 1C8PA 3M8OL 3TN0D 1DSFL 5PAZA 3RDJA 3K81A 4L3FA 5J9PB 3L4UA 4YK4C 4BZ2L 1WWBX 1TETH 2PPAA 3MA7A 4ZFOL 3IF1B 1MW0A 2G4GA 3SPVA 2YMXH 1ACXA 4G7SB 2WQ8A 3HG5A 4O02A 4RMTA 5CMAB 3V0HA 5LNGA 3QVAA 4WTQA 3P9WB 3LZFL 2CLRB 4HWNA 4JFFE 3GEFA 4L4TB 1T0NA 3MSPA 4OM1L 3NFSL 2APSA 1P6AB 2CLVB 2PKDA 5E6ID 4K3GA 1KCUL 4YMPA 2QGDA 2IDQA 3MKKA 4LFHG 4DFHA 3U2JA 3W39A 2GSMB 3DVFA 1X5LA 4YSSA 2AJUL 3N04A 3ZDXE 2BCMA 5J13B 1QATA 4EF3A 1FO0B 3DTXA 4YIQA 1RUPL 2ZUYA 2WXOA 3AS1A 1O7SA 1UGKA 4TULH 1VSCA 4IS6B 4UOW1 2XJKA 3MC0A 4UAOB 3V0JA 3O81A 4LCIL 1JCVA 1MRFH 5J13C 1R6VA 4H44C 1U2YA 5L7XL 2WJ7A 4AV4A 5IBTL 1UA6H 3HC4L 3AS3A 5LBSL 1F45A 4EXKA 2P24B 1ROCA 3F04A 4F9LA 3QRFM 1OLLA 3QG6B 3EJRA 5HHOE 5AVUB 2IFGA 1E6JL 3BKCL 3I6KA 4UAOC 1XCXA 3I74A 3LN4B 1HXKA 3AWGA 3DJRA 1KYAA 1NAMH 4XWOC 2YMTA 6FABL 1OK8A 1UD6A 4K3EH 4IIQA 2OK0H 4JO1L 4W4NA 5KSAD 2AQQA 3VE0A 2YAOA 4K07A 3MLXH 1CGUA 1INEL 1OD7A 2JXMA 4O2EB 3VX1A 4L5FL 4JRXE 2JELH 2PUQT 4X7SH 2V7HB 5HVGB 2N0MA 2Z7YA 5D71H 1HZHL 2A77H 4MQSB 4WWKB 3RJQB 2VAAA 3X14A 5E2VL 3A67H 1X44A 2DQJL 5E1AB 2C26A 3QULA 1XF2B 1KIUA 3RHWF 2ROYA 1MLCB 5E00A 3ABGA 1I85A 1IQWL 3EAKA 3ALXA 5AYTA 4BQBA 2FHFA 3SODB 3V0AC 1SHSA 2HG5B 4KZEH 4PRDA 4WWKC 4Z7WE 2J8HA 5AYUL 4XVSL 2B4CH 2LAAA 4XOCA 2P5WB 4MDIA 2Q6WB 2DD8H 4MJ6A 2F58L 4ZMTA 4C56A 4MSWA 4TRPL 2WUBH 4BFOA 1W72A 1GYUA 1WIOA 3F5WB 4ALAL 3LNGA 5ICYA 4EUPA 5IJBC 5DO8A 3WNPA 4YBLB 1FORH 2KI6A 3L3IB 1CD1B 3LIZH 1AKJB 3SGKA 5E8PB 3VD1A 4XPBH 3ULUL 1BHGA 2XETA 4OGAC 1NGPL 1XSIA 3JVGC 4L2LA 2DWYA 5IV2A 1AJ7H 3MKGA 3FO9B 4YBLC 5J0BA 5JW4R 1LQSR 1BX2A 4ZX5A 1OGAA 1E27B 3CPLA 5MP6H 3KPSD 2XN9B 5BVPL 1PZ5B 4DVBB 3WD5L 2OR9L 2ICES 4L8SB 1HNFA 2HTKC 4CW1A 3E3QE 3SY0B 1EDYA 4K4KA 1Q1JH 1L9MA 1OCZB 2YGPA 5AQ0A 1CE1H 2YLKA 4Z7UF 5F72S 5J9PA 4WFFE 5EF3A 1M7DB 4L1SA 3SDAB 3GDCA 5DD3L 4KDTC 3IF1A 3SD2A 2X05A 4Y4KD 4G7VH 4L8SC 1AXIB 4GXVL 5CMAA 1UATA 4AUJA 2FR4B 3MPCA 1XMWA 3SYPA 5F6HJ 3CZUB 3LKOB 2CLRA 1IVLA 2D0GA 4L4TA 5ISZD 1P84J 1B9KA 5CINL 4MNGB 4RX4D 2CLVA 2NY7H 1UWXH 3SDAC 1CFVL 2F7QA 4X5PA 3GJFH 5EULV 5MERA 3WIAA 4XP6H 4H0GA 3NACL 3BW9B 2W59A 1IRAY 3MUZ1 4JFOB 4XPHL 4N25A 1FO0A 5JQHC 4D9RD 3EJYD 3ZXAC 1XH1A 3L3OB 3H9HB 3UGEA 4Z7VF 5EEXA 4FZ8H 3G5YB 2J25A 3CLWA 4IS6A 1HWWA 2R2EB 4G5ZL 3H9ZA 1SXNA 2A1WH 2VT0A 4KHXL 1W0WB 1AQHA 1I3RB 4ANXA 4GXUN 4F92B 3L3OC 4KPHL 2P24A 2DLTA 4JB9H 3QG6A 4B6ZA 2Q2LA 4Z7QF 2BNQD 2UWEF 4NAQA 4YJZL 1U4EA 4EIUA 1MJJB 3LN4A 1H3PH 2GI0A 2ADIB 1U8PB 3ARPA 3THML 1YEHH 2WSKA 5BZZA 5A6LA 3R7QA 1X5GA 1EZVX 15C8L 1YJDC 2B16A 2AAVA 5E0FA 3ZOAA 5HHVH 3V0IA 2RH0A 4Z0BH 3TFBA 4O2EA 5IFJB 1BCIA 4R7LA 4AI7A 2R1YB 4G6KH 5FUCC 2HPTA 2V7HA 3QFJE 5CHNB 3EOTH 2ARWA 2CUIA 3X2QB 4XTRC 5FOJA 5AVSB 4WWKA 2Q7AA 2ZG1A 3F3HA 5E1AA 5JUEH 1JGLL 3WKYA 1E5CA 2ODIA 4L23A 4HXAH 1XF2A 1U2HA 1V3JA 3ZL4H 4JVPA 5JHDD 1DLHB 2VW6A 1ZV2A 2BNQE 3ARYA 4LO9A 3O3AB 4APXB 3MRHB 3REVB 4UILL 2HG5A 4H20H 3KM2A 4GFTB 3ASOB 5ADOL 2CNYA 1NC4B 1B4LA 5TPWH 4AMKH 2P5WA 1YHPA 3P0GB 1TLMA 2Q6WA 2WLMA 4YSRA 4XMWA 1RZFH 3F5WA 5LBVA 3SPCA 5FLUA 3WO4B 5GJTL 3JVGA 5F7UA 1P1ZB 2NY5L 1OTSC 5FFGA 2PP7A 3VI4F 3P69A 1EO7A 3L3IA 4M5TA 3HNSL 1R47A 4KZDL 1T4KA 1CD1A 5FYLL 4NYLB 3ZDYB 3LRHA 1GGCH 4NNPL 1AKJA 3QCVH 3JWNG 5E8PA 1GCYA 4M7ZB 2H1PL 2R29L 2W94A 1GOHA 3WO4C 2NX5D 5D1QE 2IGFL 2W38A 5BRZD 3FO9A 4NQDD 2B59B 3ALWA 4FQ2H 3ASWA 4WZ9A 4LMQE 1E27A 4H1LA 3GXNA 3LS4H 2ZPKL 4H8QA 4NKDB 4U6HB 2XN9A 2PXYB 4KDTA 4FD0A 4DVBA 1LLAA 3APMA 3ECBB 3LN5B 3QBTB 4N2NA 3SKNB 4L8SA 3U4AA 3IKKA 4M7ZC 1FLRH 4J5VA 3BUYB 3MRMB 2UYLB 1CPUA 4RRPM 2HWZH 2QVKA 3DGGB 4PJ9B 3SY0A 1KBWA 1EXUB 1TO4A 3NJNA 4B9ZA 5T5FH 2K1MA 3HKFA 1M7DA 3HHRB 3SDAA 2PXYC 1FBIL 4KGJA 3NCXA 1RUAL 4ZK8A 2EC9T 4PW9A 3JWNH 2FR4A 2EH7H 2KLRA 1C5DB 4PJ9C 3EKCA 1CN4A 3LKOA 4CL7A 1FPTL 4I0KA 5DJ2B 5AVVB 3ZUCA 3ULUF 4TL5A 2RHEA 4MNGA 3W11D 3IMBA 3DYOA 4BV1A 4ZNEE 2BERA 4Y2LA 3TZVD 2Y1ZA 5DJ8B 4F5CA 2A6DB 3MRCB 2BSBA 3BW9A 1AIZA 4JFOA 5I0WA 4UNIA 3S3JA 1L7IL 3RWFB 2UXVA 3VRLE 2MOQA 3H9SD 4HSCX 2Y06L 3L3OA 1NKOA 1UG9A 2YK1L 3H9HA 4EDXB 1OP4A 3TNNB 1SLXA 3G5YA 5CZKA 4G8GB 4Q9CA 1N5YL 3RTQB 1AZZC 5DMJB 1F4YH 2R2EA 5A40E 4ODSL 1I3RA 1MCPL 2G9KA 1IGTB 5I1HL 2W0PA 2YKLH 5EF0A 3UJIL 2WO2B 4ETQB 4PJAB 4PYHA 3CTTA 3QISA 2X0UA 3SQOL 4O5LH 3X1BA 1EA9C 3C8HA 5E1IA 3WV0A 4M1CD 4HKJB 1SMOA 1EDQA 2NQ3A 1PLBA 3C60B 4KVNL 3RTQC 1MJJA 4ELMB 3S7GA 2WLNA 3U82B 4RWYL 2ADIA 4S1SH 4PQXA 1U8PA 3SPGA 1U93A 3Q2LA 5I18L 3H2QA 4HCFA 1RIHL 3WLBB 1JNNH 3I84A 2BRRH 3WEMA 3Q1EA 4BK5C 1J9RA 4XOEA 4FP8L 3V52L 3C60C 4JFYB 1DJGA 1PDKB 5IFJA 4WO4B 2CGRH 2AGJL 3GT6A 4CAGA 4HPOL 2R1YA 5FS5A 5C07B 3DA0A 3WGVB 3ZE1B 1L7TL 4PJEE 5EDXA 1MHPH 4GAJL 4QXGH 5CHNA 5IW1B 3RBGA 4Z78B 5A1AA 4AGMA 1ZLDA 3BVVA 1X9QA 3D08A 5I1KL 4QXUH 2CDEB 2Q76B 3PV7A 1DQVA 1F2XK 3FOLB 4WO4C 3WHE0 1NCCH 4OI9A 2WXLA 3EGDB 5CJ8A 2E4TA 1L0XA 3CUPB 1DLHA 2JJTC 3O3AA 1HTYA 3MRHA 5FAAA 3REVA 1BBDL 3NZ8B 4APXA 2YSTA 4XMKL 2X2UA 2XVGA 4KROD 5C1MB 4N2IA 3W2DL 3D2TA 2EUVA 3GFUA 1LEGB 2GHZA 5F71A 1NC4A 3HC3L 3NJVA 4P4KD 1CF8L 1NBZB 4BCZA 4DW2H 1D9KB 4XC3H 2A9MH 1BM3H 4ZAKB 1AANA 1P1ZA 4EI5D 3SBWC 3ZSTA 1ESOA 5CJXC 1JHLL 1RQ5A 2PCPB 1UWEH 3H6AA 4I3SL 5D1XB 3F05A 1TR7A 5ABAA 4NYLA 3IJEB 3V4PH 1J48A 5LKNA 4M5YL 1D9KC 1V54B 4M6OH 5FYKH 4ZAKC 3D7PA 4HGKC 4UV4H 2NUPB 3UP1A 1O6TA 2B59A 1ASPA 2WW8A 4KDVA 4DKEL 3TEWA 5D1XC 1AC6A 4IK6A 4ABUA 2Z3FA 2JKSA 4NKDA 2XV3A 4U6HA 5EOCJ 2VN5A 3UH8A 1G87A 1Z9NA 2PXYA 3Q01A 2AXWA 2AJSL 2BX5A 3ECBA 3LN5A 3SKNA 4IOSA 1JBJA 2P9RA 3OM3B 3C8DA 3MRMA 1AG6A 4LEEA 3DGGA 1J1OH 4MKMA 3F85A 4MLSA 1MJUL 2BVTA 2KT6A 4PJ9A 5A7BA 1EXUA 3WY3A 3RI5K 1NICA 3RURA 2QKIB 1JOIA 3VA6A 1HXYB 4HWBA 3O9WD 1UZ8B 4X4MA 2N7BA 4JDZB 1C5DA 3AUWB 2R4SH 1C12B 3TXAA 5DJ2A 3ESOA 5DJZB 2VLRD 1OPOA 4PREB 3MLPA 2QKIC 1FCCA 4TQEH 4HHAB 3WKML 4HHWA 3FH5A 2MCPL 2XXMB 3VFSB 3WNJA 4HJUA 4W1TA 5DJ8A 4O51B 5A16B 3BWAB 5EU7C 1MCOL 2APXA 5I28A 5FW8A 2A6DA 3MRCA 1MREH 2IDTA 1QRNB 4FQLL 4FLSA 4W9ZA 4UT9L 5LB1A 4I9WD 4OZ4B 3RWFA 5DUJA 4ENEC 3BAEH 2X1OA 1P4IL 3QO0B 5EWIL 4EDXA 3RZWA 3TNNA 1T4WA 2DOCA 3K8MA 4G8GA 1KENL 1Q9LB 2V8MA 5DZPA 1JZJA 2BS71 3RTQA 5DTFB 3U6RB 3DV6B 4ZUUB 5AKVA 1S3RA 2COQA 4M3KB 1Y6KR 1P4BL 1YEKH 2WYIA 3RPKA 4LIQH 1IGTA 4YHIB 1KBBA 3VXRD 4ERSH 2VXUH 4NN7B 4ETQA 4PJAA 3UIZA 1TTAA 1CUOA 5IHBA 1T5WB 4M48H 5GISL 4G9FD 4HKJA 3C60A 3FFCE 3S5YA 2FWUA 1PU0A 3K1KC 1GPOL 2ZKXA 1LILA 4GSXA 3N41F 3IMVA 4LASL 5F7WC 2XXFA 1QLEL 2BNRB 4NN7C 3BH9B 2ZUTA 3WLBA 3ZE0F 2LABA 1KXQE 3K6NA 4K3JL 1FH5H 1FG9C 1J5HA 1XF4B 4JPIB 2GFBB 3GSNB 1G7IB 1OE2A 1PDKA 2CRMA 4JFYA 5AZEH 3GXIA 4WO4A 3L3GB 5CD3B 3BUPA 4DAGH 5C07A 1QSFE 5DZ9A 3CSFA 5SWSB 5IW1A 4Z78A 3VWJB 1OE1A 1X4YA 2JJTA 2AZUA 4LQ1A 3TLRA 5TDNB 2CDEA 2Q76A 3VO0A 2XC8A 4ZUWB 1I7TB 5GZND 1UKTA 2VDQL 4P2AA 3EGDA 1C5CH 3PS6A 1ULVA 4JCWA 1C1EL 2HUHA 3VWJC 5CBEA 1FC1A 3TNMB 3NZ8A 3LZOA 4U0RB 5CJXA 1SY6L 2CKBL 4L1DA 1LEGA 2WNGA 3EBHA 4WHYG 1X5IA 1NBZA 2BZDA 3R1GL 1I9JH 2E46A 4NUGH 5IEHB 3IMUA 1D9KA 4ZAKA 3O2DL 2E27L 1QPKA 2OP4L 3OZKA 5C0NC 1IIIA 2G30A 5HY9B 2DI7A 1M2OA 4U0RC 1DZ0A 2FJGB 3TO4D 2PCPA 3GRWL 5D1XA 5CILH 3U1PA 4MB1A 4TKWA 3IJEA 3T0VA 5EDSA 5EPMB 4ZDHB 1TKWB 4XP4L 1IGMH 4DKAA 3MRPB 1MZYA 3MTRA 1F4XH 2NUPA 1K3ZA 5H4ZA 3QRGH 4JBSA 1TZIB 1RPKA 3BUQA 4E68A 2UZYB 1GZQB 2CALA 2X9ZA 3UJTL 1H3XA 3APNA 4GMTH 1NM9A 4WI8A 2QV4A 2WQAA 5C6TL 2VTFA 5C7XL 1HESA 4IRSB 4N2CA 1LO3H 3S96B 2A9AA 3FUNA 3HZ3A 3FTXA 2J43A 2GT9B 3TYGH 2QKIA 5B39B 5KS9F 4HSQA 5FR3A 1CDYA 5D2LF 4K2UL 4ZMYA 2Y1YA 1UZ8A 2YSSB 4IRSC 1HYSD 4JDZA 3WDJA 1PD1A 1C12A 5DJZA 4PREA 1Z3GL 5KZCB 4G6MH 4MAZA 3VACA 2F8XC 4HHAA 1OCWL 3VFSA 2ZXQA 4XNZB 2CJUH 4JVWA 4O51A 5A16A 4WI3A 3SE4C 5D7JB 1E2VA 3DARA 1JGVL 4NKIH 2FX8H 1BF5A 3FQYA 1QRNA 3CZJA 3RAJL 3HI5L 4H88L 4OZ4A 3TX4A 5HYJE 1XMEB 4R0LB 4WGKA 3QO0A 4D2NA 3HG1D 3GBLA 1CT8B 4XNZC 3T8VA 1TYJA 1P6WA 1P7KB 1UYWH 4IHOB 1Q9LA 5D7JC 4YSTA 3HIZA 3MV7D 3SE9H 3U6RA 5DTFA 3DV6A 4ZUUA 3COOA 1T0OA 2DJ4A 2A4ZA 3UTTB 4POYA 4R0LC 3CDZB 4Z23A 1FNEA 4Z3HA 4RDQF 3G5ZB 3HB3B 4TPRH 5SX5K 4U3SB 1T5WA 3GMPB 2YQ3A 2IAAC 2V2TB 4BFIB 4BBWA 1KF9B 1Q72L 3SDYL 4NAJA 4LCYB 4QLRA 1VCAA 1L3NA 3JWNE 3BZ5A 1MCKA 3VW3L 2PW1B 1ACCA 2WTOA 5CGTA 4N86A 2BNRA 3BH9A 4B7IA 1TJHH 4Z7VB 5ANHA 3VXUB 3AQZA 4NENB 3HB3C 3QJHB 1XF4A 4KK8D 1O5PA 4JPIA 3DX0A 3CBKB 3SKMB 3GSNA 4ZFOB 3V4UH 2L0DA 1WEJH 5D5MF 2B1OA 3L3GA 1FIGL 1RZPA 1YAIA 2DBLH 3FO1B 4IYKA 5CD3A 3O41B 2AMUA 5SWSA 3FTVA 4AYID 5IB2B 5T5NG 4QPEA 3VWJA 4G72B 4YC2B 4WI6A 5TDNA 3P3YA 3RPBA 4I2XB 1PG7X 3APDA 4ZUWA 1I7TA 4PEEA 4I77H 4WFEE 2HRPL 1T7YA 3TASA 4ZW8A 2JQMA 5IQ7H 5ETUB 3MX0B 4A55A 1O0VA 1EFXB 1SEQL 4JMNA 4YC2C 3TNMA 3VXPB 1F90L 5FX3A 1U21A 2DQDL 3KD4A 3MLRH 1OAQL 3QZOA 4BDVB 4L0YA 2H47C 4YE4L 5IEHA 1AG0A 1WF5A 1KJ2H 3T0AA 4PR5B 4UQEA 4HK3N 2FJGA 3MJ9H 5CJBA 2VQ4A 4UT6A 1CL7I 1FAIH 1WCBB 3G6DH 2NY1D 5EPMA 4ZDHA 1TKWA 3MRPA 3U25A 4XZUB 1N70A 1YY8B 2C3HA 3P9LB 3FF7A 5DFWH 4P49A 1TZIA 5KOVC 2R56L 5ACLA 5C7ZA 2FH8A 3P4LA 2UZYA 1GZQA 1TITA 1GJUA 5AW7B 3P30L 1T2QL 4FNSA 4ODHL 5LCVA 2YXVA 2EEAA 4IRSA 5KVFH 5F9JB 3S96A 2AQSA 3A0OA 4XO5A 2CDFB 2V9QA 4J27A 5E7BA 2GT9A 1M05B 1OWWA 1F86A 5B39A 2GY5A 3POCA 1OIOA 3FH8A 5KYNA 3H4FA 5DHEA 1A3LL 2YSSA 4X4XB 3SE4A 5CSZB 4IRJD 4KJYB 2F5BH 1ROWA 4JM2F 3RY5A 4GRWB 1CIDA 1JL8A 4JCLA 4Q14A 1U8JB 5EBMB 5GQBA 4YLCA 3DK2A 4NQUA 2GG1A 4Y19B 4A1RA 2YHGA 5CLYA 2VQUA 4R7DB 4AIEA 3BFOA 4GUCA 2OMNA 1KBGH 4QHKJ 5D7JA 1ZV9A 5JIPA 1HCVA 5FYKE 4MQ7B 3LXBA 4R0LA 1SMDA 3ZIMA 2D3JA 2ZOKB 12E8H 1VFOA 4JR9L 1CT8A 4AE1A 4IDJH 3B2VL 5ILTH 3HFML 2IH1B 1P7KA 1BQLH 2GK2A 2WPGA 3JBG7 4IHOA 2VZ1A 1A22B 4MAYD 2UVEA 4EUPG 2XXCB 1TSHA 2YZ1A 3PE9A 4IDLA 4ALAC 4JM4H 1CD8A 3UTTA 5DHVH 3CDZA 4L1LA 3J07A 5GZOD 5J3HC 4C59B 5D1ZI 4K5NA 4HZ1A 5B4MD 3LZRA 2K7QA 3GMPA 2AEOA 2V2TA 4BFIA 1P4UA 2DTSA 4X7FC 4G7RB 1DTUA 4QOKB 5F7YC 4BKLB 4LCYA 3KE0A 1E7VA 5I5MA 3ECWA 1P1VA 3ULUC 2PW1A 4HIEB 3ZTJH 5I30H 1TVBB 2WXIA 3L5XH 4P3WA 3VXUA 4Z7VA 4NENA 2DEXX 2VE6B 2X4NB 3EJJX 3QJHA 1R4XA 3QPQC 4BZ2A 2MOVA 4JPKL 4EI6B 3SKMA 4ZFOA 2DIBA 5IFAL 4KI5F 1ZVYA 1SJXA 4HUWB 3FO1A 3O41A 1BPVA 5I1CH 2UY6B 1TZHB 5IB2A 3OGCB 4ZXBD 5LGKA 3KYAA 4MJIE 2WBJD 1MW1A 2AVGA 4KWUA 4PW3A 1RU9L 2LU3A 5DK2B 5J89A 2F9BT 1XL4A 4I2XA 3ESNA 3NAAL 2MNWA 3ZKXC 1NC2D 3M46A 4PRID 3NEEA 1J8SA 3TO2B 3HRZB 5JR1L 1WBYB 5ETUA 1QR4A 4K5MA 2YC1B 4X6DE 2V7NB 3MX0A 4P46D 1PY9A 1EFXA 4MVBC 3LTVA 5EZPA 2ENSA 3VXPA 3OAWA 5BS0E 1N67A 4HIIB 4BDVA 1UZ6F 3LPGA 3NTCL 4MXWL 4AC2A 1A7PL 1M9WA 1MPAL 4Z6AT 1U9KA 4KTEH 3HRZC 5EOQH 2VABB 3LS5L 3RI5F 3PRZA 1YMME 4J3TA 3OAYH 1DBMH 4PR5A 1FVCB 2QQNL 5E8DL 5LBSA 3TL5A 4M1DH 2DH2A 2F15A 3UOAB 3QPXH 1OZTG 1WCBA 3L1OH 2HCZX 4X9GA 5I0VA 4QT5B 2COVD 2AQTA 1TUPA 1CLYH 5M7QA 4XZUA 3TA4D 2GBUA 1YY8A 1HX0A 1YEJH 3W0WD 4ACTA 3P9LA 5I0DA 1KWKA 3LQZA 5IQOA 3LZLA 1UWGH 2YFOA 4MS8C 5TK4A 1OARH 2APBA 4HUUB 5HHQB 5KVDH 1QASA 5BUAA 2A9DA 3EDFA 4R8WH 2NSXA 4U6VL 1FO0H 5F9JA 5INCB 3H42L 5J11B 4HLEA 3PFQA 2CDFA 1I4FB 2DMKA 1JPST 2ZONA 4QI3A 1M05A 4BKSC 1GSKA 4O58L 4YBHA 1FGNL 1W8EA 4KKRA 3D33A 1QSVA 1VZIA 3WHXA 4X4XA 1KY7A 5CSZA 4KJYA 2C9PA 1RZKL 4B0MB 4H8UA 3Q06A 3N2JA 3ARFB 2PWFA 4WTXA 5EUOF 1KUMA 1U8JA 5EBMA 5BCAA 1O7DE 2PW2B 4YBQC 4Y19A 1NOAA 3G3LA 3P0YH 3ZHLA 1DQML 3GO1L 4R7DA 5JYMA 4XVUC 3JUYA 1TYEB 3QXWA 3CNKA 5FKPB 4NHUB 4ZS6D 2EECA 4MQ7A 3JUZA 3ARFC 2XN1A 4BSWB 1LMKA 3OKYA 7FABH 3E1ZA 5FCUL 4HS6B 2ZOKA 1QFWL 2XZQL 2IC2A 2IH1A 4IKIA 4MMYB 1CURA 1TJIH 2VKWA 2OJ1A 3L2LA 2WANA 4MNQD 3S3SA 3WY2A 1PFOA 3TVMB 1PBYA 3GYRA 2NY5C 5IESL 2C9QA 4Q6KA 4KC3B 3U4EB 3FUKA 1A4CA 1SOKA 5FKAB 1AGDB 2F53D 3EYSL 4QOKA 4BE5A 5MEOA 1UD8A 4BKLA 4BWUA 4ZMOA 3TVMC 4HIEA 1TVBA 3RZCA 1GHFH 3BT0A 3CFIC 3P2TA 2VE6A 2E7CA 2X4NA 3UGXA 5A7EA 2BY3A 4F9PC 2XACC 4X9YA 4EI6A 4P3DB 4JFDE 1NCOA 1EO8L 3QQ9C 4HUWA 1PS3A 1ODAA 3IFPB 3CLEL 2NTFB 3NPZB 3LJ3A 3BXNB 4HJJL 2K4WA 2UY6A 1TQSA 1TZHA 5C0CD 3PWUB 2HLFC 3OGCA 1O6SB 1R5WB 2HJFB 2ZCLL 1OTTC 4WUKH 1URLA 1BD2D 3BPLB 5DK2A 2JJUA 1MSPA 3ZBMA 1NLDL 1XGYL 4LEBA 4ZFZB 2LGNA 1QFOA 4PRHB 3RVVC 2EVJA 1ECZA 4GG6B 1IJ9A 2PWHA 3DPBB 3LOWA 3TO2A 2X70A 3HRZA 5HHMB 1WBYA 5EU3B 1KBKA 1YY9D 2YC1A 5BW7C 2V7NA 4A38A 4WWPA 2MQ0A 4H1LH 2ZNWA 4FFWC 1VADB 3BPLC 1F6LL 4M7KL 4CA4A 5GS0L 5E70A 1EEYB 1S5IH 3GTVA 4HIIA 2K8QA 1A0QH 1YQVL 4XP9L 5C9JB 2MNJB 2ITFA 4YSCA 2O6FA 4M7LH 4NUQA 5GGQL 2VABA 2WSPA 3SOBH 3BAXA 4DK6A 1S78D 1F8TH 2OYKA 1THCA 2ZWKA 1FVCA 2DDQL 2E74C 3FQ2A 4XMLL 4G71B 4IJTA 4PS4H 1HK6A 5PCYA 4JFSA 4J8RB 3PWJB 2GTWB 3FCGA 4KQ3H 4R9HA 1CQKA 4QRTB 2J73A 3BKJH 1MHHB 2R27A 4QT5A 3UC0L 4HAFA 5FA3B 3CN4A 4HU2A 2WWMD 4TS6A 3C2AL 2YQ2A 3K0YA 3KPOB 4M3HA 1KC5L 2D4DA 1PG7L 4U7MA 3T0EB 4HUUA 5HHQA 1ZANH 5F8RC 2ZAGA 2O5ZL 4QXWA 1AFVH 3IJ7A 3IRZA 4QRQB 2VN7A 1I4FA 4MASA 4DVRL 4JE0A 1MWAL 1FYHB 4PVNA 4BYHA 1M3JA 4BCYA 5L2KB 4MZ2A 2J12B 3T0EC 3T3MF 2EUWA 3ET9F 5CO1A 3KGSA 3CFNA 5KTEH 5ECGA 5T3ZH 5B7EA 1CDIA 2B1HL 5KUMA 4OZIE 5DQ9B 4F7MB 3ARFA 4ZW5A 3CIQA 2X5PA 1YJDH 2V5YA 2PW2A 5EA0H 4TQHA 1OL0A 4TTDD 3GM8A 3NFPB 3QXVA 4OZGF 4EN2A 2V8LA 4Y8AA 5L8KB 3U2IA 3UTOA 3HMWL 5FKPA 3LRSA 4PVBA 4NHUA 3LCYA 4IGBB 4XPGL 2Q8AL 3ORJA 4BSWA 5KS9B 3EOAB 3V7AG 1OCRB 1WIPA 4HS6A 4KAQL 3ABMB 4HCGA 4JW3A 1JXDA 2VH5H 3PREA 4Q0XL 4NJ9H 4MMYA 1CICB 1MFUA 2Y6SC 2FBOJ 4JY5H 2XBTA 1NOFA 3S34H 1I1YB 4IGBC 4JG1H 1GYCA 2R29A 1FFQA 2WAQA 1KGYE 5KVFE 3TVMA 3JV5A 2J1KA 2EDFA 2NYKA 4NI3A 4YDIH 1X7TA 3U4EA 1SNRA 4F9PA 5FKAA 1AGDA 3U0WH 1CICC 2F1EA 4PB9L 5D1ZD 3WS3B 1VPOL 4ODTL 5F3HB 2WBKA 3NSJA 5AAPA 1TG8A 2NNXA 4OCRL 4V11A 3O4OB 2DKMA 4QCIB 2OSLB 1LP9F 1X5JA 4WF7A 1OGPA 2WJ5A 3TJEL 5J8OA 5DS8B 3IDXL 5MENB 1UM5H 4P3DA 3BE1H 1PD0A 2FEEL 4ZOAA 3IETB 3WDIA 3S48A 3Q44A 3DRQB 3IFPA 5GRXG 2NTFA 5CZRA 2NNCA 3BXNA 3QARA 3O4OC 4C56D 5BW7A 1O6SA 1R5WA 2HJFA 4X50A 2NNAB 3HS9A 1HIML 5DZAA 2GI7A 4FNLH 4KNSA 4P5SA 4ZFZA 4PRHA 4GG6A 3DPBA 4HLZH 1I1AD 3LMJL 5I73B 4XAKD 4XPTL 5LXGH 5EU3A 2FL5B 1T0MB 1XGTB 2EDTA 2AABH 1V55B 4D0CB 3P2BA 3KPNB 1U8QB 1VADA 5D70H 5DMIL 4Z76A 5FO8A 5DK0B 3KYKL 5AW2B 4HVBA 1DVFD 1EEYA 4U1NB 2JKXA 3IU3B 2C8NA 2E7BA 3MV9E 3VXMB 5C9JA 1OGAD 1EEZB 5I73C 4GRMB 1S9XB 2ITCB 4WJG3 3FO0L 1DLFH 5T3XH 4HOZA 3AWFA 1MXDA 3W56A 1MFEH 3TFKC 4Z3EA 2DQHH 5L88L 2P8MB 4J8RA 4U1JB 3PWJA 2GTWA 1B4JH 4C56E 5IEKB 4JDTL 1MHHA 3ULVF 5FA3A 1ETZB 3F7KA 4WHCA 3QDAA 1JE6A 4S1QH 1QLEB 1BLNB 2WN2A 3KPOA 1IFRA 1AS8A 1KZYA 2QT6A 1K4CB 4L4TD 4KUZL 1KXHA 3UX9B 3GSUB 3T0EA 4Q56A 3MLVH 3QORB 4CGUB 2XY2A 4HLJA 3LHPH 1YNTB 3MOQA 2Y72A 2K8MA 4MFHA 3DX4A 1II4E 3CXHK 3O2VH 3HPLB 5L2KA 3FQRB 3VSVA 3A4EA 1OTUD 3B8YA 1FVDB 3GZOA 2FJHB 4Y9CA 3VI3B 4OIFA 2O61B 3MACL 5CLWA 2JKRM 5CZVH 1QBAA 3ZHKA 1G7JB 3QORC 5E9AA 3DSFL 3VMOA 2B9AA 2X2YA 2GJ6D 5DQ9A 1E5ZA 4F7MA 2EE9A 2VDQB 1IAIH 3D2UB 2WB7A 1HCZA 1JPSL 1CC3A 1DJZA 1OPGL 2QVMA 3GSQB 5GRWA 4OFYA 8FABB 5D7SL 3NFPA 2CKBB 2HX8A 4FFYL 2P47B 1NFAA 1NWPA 1NCDL 2OYLA 2L04A 3QCTL 5TK2A 2XKNB 4DN3L 2GIYA 1BF2A 4L4TE 4IGBA 1XD1A 3PL6B 2FAUA 5DDHB 3OSVA 5AB9A 5KS9A 4AJYV 3EOAA 3MO1B 2X12A 1R17A 2JV6A 1SN0A 1TO5A 1KCBA 5I16B 1CICA 5GJSH 5KVDE 3ZRFC 1KJVB 3S37H 1I1YA 1TT6A 3PL6C 4DN4H 2VLJB 4E9WA 1OOAA 5A2LH 2QQQA 3GBNL 5FFOA 1MVUB 1UEYA 2H8PB 2OTWB 3F7YB 4UANA 1EBAA 2RD0A 4HMEA 3UBGA 1C7SA 2G75B 3HS0B 2MSPA 4LCUB 3WS3A 2Z0UA 3IFNH 4NUJB 5F3HA 4M8UA 5FXCH 2J21A 1I3UA 4NGHH 1SLVA 2OSLA 4QCIA 3IS1X 4FZEH 3UL4A 5ID0B 4YHZL 3QUGA 4OCWH 2PO6B 4RFEB 2G60H 5DS8A 4X4KA 5E5UB 5MENA 3QEQB 1U6AL 5BQDA 3IETA 1DO6A 1NSNL 3NJKA 1DJWA 5KN5B 4HJ1A 3DRQA 4HGMA 1MFCH 2AK4B 1EEUA 4LDLB 4GKSB 1UCBL 1X9UA 2PO6C 1YEEL 3NMEA 2H2PC 4OGAD 5D9SB 1UXMA 5JIQA 2NNAA 2O5YL 2FEDC 3BGMB 4MXVF 2L8AA 1JFQL 2DL9A 3D18B 1PD6A 4FI6A 3L1GA 4L9LB 3B9KB 3NCYS 4KV5F 5EU6B 3FPXA 3D3VD 4EOWH 5IT2H 3HBZA 3GBMH 3D9AH 2FL5A 1T0MA 2KLTA 3N1FC 2DLGA 1XGTA 2E5EA 2X4PB 3GMRB 4UT9A 3WMSA 2HTKD 2JLLA 1ZGLP 4D0CA 2OCCB 4EIBA 1SDAB 2E6JA 3DHMA 1U8QA 3KPNA 5CJQH 1KJMB 4M43H 5DK0A 3VXTB 4U1NA 3IU3A 3VXMA 4L9LC 1EEZA 3B9KC 4GRMA 3RVUD 4OKVA 1S9XA 2PYEB 3F7PC 2ITCA 1ES0B 3P4OB 4OV5B 1LM8V 1RJYB 2K3TA 2I7SA 2R9HC 2V9TA 4FYSA 2UXFA 1HWGB 2YXMA 2YEVB 1Z5YD 5LNEA 1N19A 4CC4A 3BGAA 1ADWA 5AWNL 2P8MA 1IGCH 4GYBA 4U1JA 3U4BL 2P5WE 3HRPA 3KLAB 3SDAD 5IEKA 3VFMB 3GXFA 1ETZA 5HHXH 3ETBF 3FU6A 4LL9A 2R0ZL 3MLSH 4KXZI 1BLNA 1K4CA 1ML0A 4UTAL 5B3JF 3GSUA 3H2WA 3ZE2B 5L6YL 5D7KD 1B0WA 2NY2D 1ET8A 1MQKH 3NA9L 2YWZA 3QORA 3HN8A 4JKLA 1F5WA 1SZNA 2X09A 1YNTA 3MHZA 3FCSB 3V10A 2CUHA 3HPLA 2DPKA 1F3DJ 1OZUA 1W80A 3FQRA 4HPYL 1FVDA 3VI3A 2FJHA 2FJUB 2XN9E 2O61A 5JW4M 3LB6C 1G7JA 2DYPD 4S1RH 4L3AA 4ZMVA 1CDGA 2VDKL 4GAGH 1QBLH 3D2UA 4F80A 1KDJA 1L9NA 3M45A 4YDJB 3M07A 3GSQA 5KVMC 1XDTT 1N3NB 2XKSA 8FABA 1SY6A 2CKBA 2DWEB 4UQCA 2XRAL 4ZYKB 1OAJA 2MRYA 5L9DL 2XKNA 1IAKB 4OLZL 5LG1A 2JKIS 3N44B 2OL3L 2LLNA 1NMBL 5DDHA 5IQ9B 1YLBB 4J2XA 4KK5C 3O2DA 3MO1A 4WUUA 2LHAA 4MNGE 5M95B 3GSNH 5LNDA 3WN5B 1AO7D 3GRWA 4YHOH 5I16A 4XTRD 4F5CE 1A6PA 2B1AH 1GC1H 1KJVA 3LRLA 5A2KH 2VLJA 4NQCD 3NYKA 3PHAA 1Q0EA 2ZXBA 3Q5TA 1IFHL 1MVUA 2FRGP 2H8PA 3LXUX 1IZKA 3WN5C 2A0LD 2OTWA 3F7YA 4A66A 1RJLB 3OWRA 3MJGX 2CMRH 3MOAL 5I82A 2G75A 3HS0A 4LCUA 4F2FA 3NIDF 4NUJA 4AY0A 2P46B 5CZXC 5T3ZE 3IDJB 5FEBA 4FQIL 3FL7A 3INUL 3FUIA 1RUML 4PGDB 3NJJA 4ZJ9A 4KNQA 5ID0A 1DJSA 1E4XL 2PO6A 3PP4L 4RFEA 2X1WL 5SWQB 3EYFB 2E59A 1OTSD 3AT9A 3ZKQD 3QEQA 4YHLL 4B9IA 1MFBH 3WMPA 1UM6H 1XXFC 5CEZD 2JWYA 4XNAA 5KN5A 1NC4D 1HDMB 2AK4A 3VTTA 2QDWA 5FUCE 3I9GH 3PAUA 4PGJA 4Z77B 4JEGB 5B39G 4ZODA 4GKSA 5FYJH 5D9SA 4CN4A 2PN5A 1RL1A 4N5UA 3PDGA 3F7RA 4UT6H 3FAWA 3PWNB 1LO0H 3BGMA 1N2RB 3MQIA 1WA1X 4L9LA 3D18A 5E51A 3SIKA 5EU6A 5HD8C 3B9KA 3UEQA 1XAUA 3F6LA 3PGFL 4YHML 1N12A 3BRFA 1BDYA 3GMRA 2X4PA 4RGOH 2WKOF 1HL9A 2VN6A 4AYMC 2X40A 3KDPB 2AQPA 3HFFA 4LP4A 3GHPA 4GSUA 1KJMA 4LNRB 1FVEB 2R8SL 3VXTA 4M7JL 5LCVH 5CNHA 1NIDA 3PP3H 4JL1A 1HH6B 2ORBL 2X2HA 4NT6B 3LYRA 4QAWA 1Q38A 1ES0A 1X4ZA 3P4OA 1RIUL 4OV5A 4RVBA 1FYTB 1RJYA 3WTVA 1RZGA 4KH2A 4PJ9D 4K7PH 3I50H 4XAWL 1XCQB 3V7AE 4KK9C 5CEZE 1J05B 1OSZB 1WD8A 4IOFD 3MV8D 4ZTOH 4Y4HB 4DETA 5I23A 2YS4A 2D7MA 3GS7A 3C5ZB 3NIGB 4GXFA 3VFMA 1V3KA 2N7SA 4RMUA 5JIIA 3IE9A 3WY4A 4HJ0C 6PAZA 1EERB 2VCOA 3UIYA 1A25A 2CR6A 4ZQTA 5K69A 2Q2EB 2HZHA 3ZDYE 4Y4HC 5EORH 5FPIA 3C5ZC 1PZBA 1XZ0B 1B0IA 1HHKB 1WK0A 2WNWA 2IDSA 3FCSA 4Z0XB 4LSRH 1IAOB 2WNXA 3ZR6A 3MAWA 2X0WA 4NWTH 3RIKA 1U8OB 5DHYB 5KVGH 5LBGA 4XWGH 1MELA 4G80B 4KDWA 5CP3H 4ONOA 3P3SA 3AB0B 4J2QA 4X42A 2YOAA 4G8GD 3VRIB 4ZMAT 4NCC2 3ARXA 4LSUL 5AOIA 3RTQD 2AITA 5T3XE 2WIIA 1NOLA 3ZR5A 3ZDXF 4YDJA 7CGTA 2VXQL 5DVOA 3ILQD 3OKMB 4D3CL 1N3NA 3OB0H 3PQYB 4LVOB 4JUTA 2DWEA 4ZYKA 1A3RL 2BDNL 4X4ME 3AB0C 5IHZB 3OR7B 1IAKA 2KKQA 3M8OH 2C4FU 4H8WL 4LPWA 3SOTA 5IQ9A 3FU5A 4OD2B 1P53A 1TXKA 3M7FB 1CO1A 4BUHA 3FZUC 5BOZG 2AP2A 4HFUL 1QI3A 3WN5A 4LVOC 4RZCB 1U30A 1NBQA 5HI3C 4LXFA 2A2QT 2FZ3B 4YXKH 3LZFH 3DVNA 5EUOA 4YSOA 4P5MB 3OSKA 1G6VK 4OM1H 2CHNA 4EIGB 5C07D 3OV6A 3WFEL 5AFAA 4N90E 2W0FB 2CNZA 1RJLA 3H2PA 2JH2A 4H2AA 2A9CA 2DWDB 5TQ2H 3WAKA 4JN1L 1AP2B 1ZTXL 1EQWA 3WAJA 2AZAA 3IDJA 3SDXB 3VFGL 2O30A 4D7PA 3KMDA 1RUPH 4PGDA 4PJAE 5SWQA 4NSKB 5F7KC 3D8MA 3CU1A 3EYFA 3ZT5A 1D2OA 4AGPA 3KW7A 4WGVB 4LCIH 1E8WA 1JHTB 4LP5A 1HDMA 1PY4A 4UQAA 4PRAB 5LBSH 2FEJA 1ZJAA 2CU9A 2D9CA 4Z77A 5FF6B 4YX2L 1I3GL 2WOYA 5C08B 1E6JH 3PWNA 5EBWB 1N2RA 4YGAB 1DL7H 5DD5H 3V9EA 4OCXH 5D1XD 4Z7WF 5C07E 1VGEH 3FN9A 4PG9B 3ZE1E 1RZKC 3V9FA 4JO1H 3BLKA 4K71B 2MQ3A 3FU3A 2XWDA 4LNRA 1FVEA 3FQUB 1GR7A 2VO8A 3NJLA 4A68A 3LV3B 1HH6A 4NT6A 5D7IB 2UUDH 1AMYA 4JNXA 2DQFB 2CBTA 1SYVB 2VIRB 1FYTA 4TSCH 3U0PB 4K71C 2YGNA 5DEFB 3V0WH 4P07A 3ARTA 3GXMA 4OZFB 2HN7B 2BK8A 3MU3A 3T2OA 1J05A 5E2VH 1OSZA 5AAWC 2XZZA 4Q9RL 4Y4HA 1NCWL 1CE6B 2EKSB 4RLDA 3VU1A 3TA3B 4DK3A 3C5ZA 1IQWH 5JA8B 4G83A 4BZYA 2BIHA 2QQKL 1EO5A 3W82A 5D1XE 2KBGA 1H6EA 4ENED 2V4LA 3T2NH 3WTTA 2CQVA 2PR4L 4U7SA 3OAUH 3DECA 2AJ3B 3KEDA 2RJMA 3T04D 3TA3C 3WEOA 4AL8L 2GABA 1WJ3A 1XZ0A 2E7DA 4FULA 4RWHA 5IHWA 4Q9QH 1OVZA 1HHKA 4Z0XA 3UJJL 5DEZA 1IAOA 3TIDB 2D31B 4JPQA 3B8SA 3I3EA 1L9SA 4PBVC 1EHAA 3ZKMC 5KBNC 1U8OA 5DHYA 4BHUA 4G80A 3ULUH 2I26N 3VRIA 1V27A 1U3ZA 4GLRI 4W9CC 3PV6B 5K9QG 1BXUA 2BC4B 4JQXC 3OKMA 1OHQA 1XCTB 3K4ZA 5BVPH 3PQYA 1Y1UA 2OR9H 5EIVA 1BFVH 5EU7E 3OR7A 4JFZL 5IHZA 4J3OD 3Q13A 1ANUA 3TONA 2ALWA 5FDWB 4OD2A 5GRUL 4KY1L 1JGUH 1SHWA 1J5IA 5C0AB 2YGVA 3KGRA 3L3HB 2BNRD 3HOGA 3IMSA 3L08A 3GI8L 2BM3A 4RZCA 5GS0C 4KMTH 3BRDA 3WKQA 3FN3A 3Q8FA 4FYRA 3UTZB 2KC0A 4GB9A 2EYSB 4NQEE 1QRNE 2FZ3A 4YPJA 1JXFA 5E2WH 4HV8B 4P5MA 4FAAB 4H26B 3TT1H 5CINH 2OMXB 4BWWA 4E9RA 4AXWB 5SWSD 3LPWA 1CXHA 1CVRA 2W0FA 2ZOWA 4OZGA 3QHFL 2DWDA 3MFFB 2J5LB 4IBLT 4HJTA 2OS7A 1AP2A 4XPHH 1MNNA 3VWKD 1KGUA 3MYJB 3SDXA 4YSAA 3RVWC 5B7FA 4JKPL 5EMYA 1E5UI 2HPOA 4M8RA 4WU7B 1MWAB 2VYRE 4NSKA 5F88B 4MZRA 1XTLA 4Q74A 4BH7B 4QRFA 1BJMA 4X9BA 4N68A 2DY2A 2J5LC 4WHTB 4G5ZH 1JHTA 3TGXA 4G8EB 4KHXH 4G7YL 1V7MH 3NZUA 3VGFA 1CTOA 4PRAA 1GTNA 2PR9A 4KPHH 3UTSE 3QP3A 5FF6A 4DOHB 4X9IA 4NFCA 2GIXA 3L7EB 5C08A 3V8OA 5DJ6B 3OZ9H 2YUVA 5ANMB 2VR6A 4FYTA 4CN1A 1F41A 4C54A 4PG9A 1G4MA 5AB0A 2QSCL 3PHQB 3S5LB 2FX9L 3KAAA 4X0NA 2VC2L 3FQUA 1R3IH 5AAWA 3LV3A 2FATL 5JIMA 1NH6A 5D7IA 3DXAB 1MCFA 2DQFA 3PXHA 2VIRA 1SYVA 2VLKB 4PJXB 4PY8I 3EH1A 4IRSD 5DEFA 3U0PA 4MAUL 1SFHA 2GKIA 4OZFA 1CTMA 2HN7A 4YNYB 1Q1PA 2CHXA 2MKLC 5A3IC 1JGLH 4MA8L 1BMZA 4WWNA 2P5EB 2EKSA 4LRNL 2YQGA 4QGTA 3TA3A 2N1TE 3UTPD 3FT1A 1P7QD 2P4AB 5C0EB 3L4CA 4P06A 2Y22A 4N24A 5FYJE 3TWCH 4JO2L 1UTDA 4C58B 4LCVA 2UZIL 5KZCD 3HMXL 3KVPA 4A7TA 2AJ3A 5JHLH 4P48A 1KNOB 4XN7A 5B21A 1VKXB 2R69H 1G9ML 1OAYL 2BFGA 3BN9D 3CXFA 5GJTH 2QPFA 2NY5H 3FK3A 3QHZL 3MUUA 4U1SB 1CXLA 2XWBB 3LAFA 3TIDA 3HNSH 2D31A 3UBHA 1GJIA 4BXSV 1T7ZA 3FT2B 4JQXA 2NYYC 5FYLH 1J8HE 4FX5A 4NNPH 2V2WB 4GBXB 2CHDA 3KJ4B 3F64A 2H1PH 2R29H 1X5XA 1J9QA 3N9GH 4U2YA 1SEBB 4DPBX 3RL2B 2IGFH 2IF7A 1AI1H 3U9PL 3PV6A 4L37B 3PPSA 3L4XA 2Q20A 3AGWA 2BC4A 4MZ3A 1XCTA 3VRLF 4GBXC 4XGZB 3KJ4C 3AY4C 2A73B 2AI0H 2GUYA 3A4FA 4JO3L 2XIIA 4Y2DB 5FDWA 4GJTB 1NIAA 1GOFA 5C0AA 4JFXB 4F58H 1D5ZB 1PZAA 4N3TA 1RUAH 2NQCA 2XQYA 4B9PA 4IW4C 1KPUB 2JI2A 1LK3L 3UTZA 4H0IA 2Z7UA 2EYSA 4G6FD 3SPIA 4Y2DC 1F02I 1FPTH 4N9GB 4HV8A 4H26A 4ODVH 3N0AA 1RVFH 2OMXA 4QRSB 4AXWA 3MUJA 4M1GL 3UP6A 4JM0A 5CGYC 4CDGC 1OQOA 2J71A 4QXTB 4B60A 3MFFA 3DO4A 4XZ4A 1RMFL 4ZI8A 4ADGA 3UTTE 1QWNA 2KQNA 2YK1H 1ZE3C 1BAFL 3QUZB 1UCTA 1MWAA 1MWOA 4WU7A 2ZUXA 1BQUA 3IMTA