3US1A

Structure of p63 dna binding domain in complex with a 22 base pair response element containing a two base pair "gc" spacer between half sites
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
194
structure length
193
Chain Sequence
SPSNTDYPGPHSFDVSFQQSSTKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator/dna
molecule keywords Tumor protein 63
publication title Pliable DNA Conformation of Response Elements Bound to Transcription Factor p63.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 193
sequence length 194
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3us1A00
4IBQA 3EXLA 1GZHA 2J1YA 1YCSA 2IOMA 3WTWA 5LGYA 3VD0A 3QYMA 4L0YA 3Q05A 4IBTA 3D05A 1TUPA 2BIOA 2BINA 3VD2A 4AGPA 3WTTA 3VD1A 5G4OA 4MZRA 1CMOA 2BIMA 1LJMA 4AGMA 4IBYA 5KBDA 4GUOA 4AGQA 3KMDA 4LOFA 3D09A 2MEJB 1T4WA 2X0VA 3TS8A 1CO1A 2AC0A 2BIQA 1TSRA 5G4MA 5G4NA 5A7BA 3D06A 5AOLA 2P52A 5AOJA 4IBSA 2XWCA 1UOLA 2J20A 4IBVA 4A63A 2J1WA 4XR8C 2IOOA 2AHIA 4QO1B 1GZHC 5AB9A 3D0AA 2ADYA 2RMNA 4L18A 4AGOA 3KZ8A 2ATAA 5AOKA 5LAPA 3WTUA 3IGLA 2XWRA 4KVPA 2FEJA 3EXJA 5AOMA 2PCXA 3D07A 2J1XA 4LOEA 4IBWA 4IBUA 2VUKA 4LO9A 4L0ZA 3WTVA 3QYNA 1EAOA 2X0UA 2BIPA 1H9DA 3Q01A 1EANA 4IBZA 4GUQA 2J1ZA 4AGNA 1IO4C 3US1A 4IJTA 1KZYA 2H1LM 4MZIA 5BUAA 2J6WA 2J21A 4HJEA 4G82A 3WTXA 1HJBC 3US0A 2WGXA 4AGLA 3IGKA 5ECGA 1EAQA 2YBGA 2IOIA 5ABAA 3ZMEA 2GEQA 5AOIA 3WTSA 1E50A 1HJCA 3WU1A 2X0WA 1HU8A 3WTYA 4G83A 2OCJA 3Q06A 3D08A
chains in the Genus database with same CATH superfamily
1KTLB 2DQHL 4S1RH 3UTTB 3GXDA 4P9ML 1NANI 2XN9E 5TFSL 1ET8A 5FM4A 4R5XA 1T2QH 2YZ1A 1BREA 1OK8A 2DQIH 2ETWA 4FTVB 4MCYA 1R5IB 3W11C 2CLVB 4LCWD 5D55A 1UT9A 4D9RE 2WYHA 4HUXB 5CLZA 2WN2A 2B3IA 2O5NA 2Q5BA 4XVUC 4Z7QE 1MREH 1RD6A 2HG5A 2P80A 3MOBH 3A23A 4AM0A 4ODBD 4OV5A 1A9BA 1E43A 5FC9A 3LKPA 5I1DA 2IG2L 3FQ1A 2OTUB 3FOMB 1WVZA 2W59A 1JK9A 1JAEA 1VGKB 5IVZA 3V5KB 1G7JB 2FJSA 4FNQA 1SFDA 1J5HA 1XCTA 1BD2A 4JFDA 3FF8A 3GSWB 5BV7B 3EGSB 4G8FA 1NBYA 2HVKB 2XN1A 1MG2C 4HA1A 5GRXG 4P46D 1D6EA 4NN6C 3KDMA 3UBGA 3F58L 4PJHF 3EDDA 4RWYL 2WVVB 4Y4HB 5L8KB 4J1UB 1KJ2L 4GRLD 2WWMC 2XBZA 3GI9H 1XIWA 3MNZA 4AVKA 5DRXB 3WENA 2Z31C 4NSKB 4A7VA 2BS8A 5D9SB 3AREC 5C3TA 5F1IA 2HKHH 1M7DA 3EYFB 3WS6A 4FKEA 2Z7ZA 1F3JB 5CLTA 2P5PA 4DKFH 3E8UH 1KIPA 2NUPB 5I16A 1AIFB 5SWQB 2E9BA 5D7IF 3GMLA 1FN4A 3UTSE 5DRNA 1DBMH 5KUKA 1ZTMA 3FTVA 4PRHA 1AZUA 3ETSA 1N0XH 3RZCB 3H42H 4M6AA 1P1VA 5IFJA 1ORQA 1UM6L 4BZ1A 2CIKB 4FXLA 4RDBA 1RK1A 3UAJC 1I7TB 3H4HA 3G04A 4MMXA 4RGMB 1PY0A 1WD8A 1KJ3H 5ALBH 4PJCF 5I1KH 5MEND 3LS5L 3TEUA 1CK0H 3DOSA 5SV4A 5I76A 3DXAB 4ZOEA 2Q87A 4FI6A 1NCJA 5FGRA 2GIXA 5DZVA 4CVWA 2VR5A 3ABGA 3F7VB 4EVNA 2G2RA 3L3OA 1QR1A 5LCVL 2Q7YB 2XOTA 4RMSA 4EUPA 4MXWL 3OWRA 4YZWA 4LF3B 4JFED 1PD0A 3B4NA 4WEBH 1WAAA 1YMME 2YEZA 4UAOC 2VLLB 1B4JL 2WUCH 4JDTH 4KKBC 4Q9BA 2I5YH 3HKZA 2W91A 4RFEB 4RMBA 3LN4B 5DEFB 4JPWL 5IM7A 4DWHA 3OQ3B 4GXVL 3K5RA 2NY7H 3OM3B 5BUGA 3F83A 4PRBA 1P5UC 1AGCB 3T3MB 4D9LL 3CIQA 4LVHB 4X5XA 4O51A 5D2NC 1XF5B 3BXNB 3D06A 5FUCC 1BDYA 5A43C 1WGOA 1E8XA 3NACH 4XBEH 1IZKA 2FO4B 4XCFH 2ZTBA 1PAZA 1NCNA 3QJRB 3VXQA 4ZFOL 1YPZE 1NSNL 1QYGH 1AVAA 3GXUB 1VFBA 2YPLD 2HYMA 4PJXE 4X6DF 1M57B 3MRKA 2I32A 1JP5A 3K7UA 1WAPA 3FO2A 2XLLA 1RP9A 3DX9A 4K55A 5ITFB 2K70A 4TNVF 5JORA 1E4WH 2ZSVB 4JFFE 2DJUA 2J25A 5I82A 4FXGA 1KJVA 5B21A 1U6AH 1F4AA 3N43F 4Y9BA 1OSEA 4P5TA 4QI3A 3ILPA 4ZZFA 3TT1H 4J6IA 5CN1A 3MLUL 3JXAA 1KYUA 3D0LA 4AL8L 4ZUUB 3OPZH 3NIGE 4JQXC 4W81A 2Y36L 5ETUB 2WZ6A 3KCPB 4KTDL 1LEIA 2R29L 3FQRB 2VO8A 3DJZA 1S5IH 4E9RA 5IOPB 1CB4A 2Y2TA 4JFOB 5BUAA 2IADA 2LTQC 3H1ZA 2JJTA 1ZLVK 1FG9C 3GQFA 3TA3A 1ZV9A 3R8QA 4GKNA 6FABH 1TDQA 2CWRA 3WFBH 1UM4L 2GJRA 3LXBA 2RACA 2GJJA 5I1IL 1E4JA 4NWUH 5D70L 4R4BA 2CNZA 2R2EA 1LM8V 4W4OC 1FBIL 4QOKD 1GMIA 3O6KL 4XPTL 2D7OA 3LKRB 4L8DB 4W9EC 3BUYB 4WO4C 1NFAA 2WCGA 1AKJB 2BNRE 4YGVB 4OLZL 2YEVB 3VFGL 1AHWC 5FYKL 1J88A 2OMVB 2VZ3A 3PAVA 4S0TD 2TSBA 5CWSB 1OAZH 2G30A 4LLQA 3FQ2A 2MQ0A 3MV01 2NY5H 2Y23A 3ARFB 4MNQB 4A7GF 5FECB 3QZNA 3E0GA 4ODXB 3EFFB 3B2VL 5HI4C 1GGCL 3ILDA 2O61B 1RLWA 3C60A 3S4SA 1KCSL 2IMMA 4HEMA 4LASL 3BHBB 1W72H 3PQYD 1G87A 3GBNH 3GSRA 3BKYL 3M88A 2JKRM 5E7BA 2ARJA 4WI0A 4HUUA 2DQJL 4GO9A 1RK7A 3I2CH 1KTDB 4KJQC 4UBDC 2NNAB 5D1QB 2CO6A 2BOCB 3RIKA 4OD2B 3IMBA 3WJLC 1QEWA 5KBNC 5CN3A 4ZNEE 3BRFA 4GW4A 3GSVB 4LSTL 1WEJH 43C9B 3BZ4B 4UTBL 4BFKA 3BDBA 3QJFB 4F2EA 1MCJA 5DFTA 4KITB 2E9IA 3CXDL 3SDYL 5B39B 3UG3A 4PJEB 2MFNA 1H6UA 4HJJH 4P4KA 1ZVSB 5D1ZI 1WC7B 5DWPA 4KRPC 4F7CA 1S9YA 2B1AL 3TFKC 3ORJA 3KPNA 3P30H 4PWIA 1LE5A 3KNBB 4O2CA 2W60A 1KJMA 3L4CA 5MEOA 4G43B 4Y5YA 5EBMB 4HEPG 1HS6A 1AR2A 4TUOB 1E2VA 4ODTH 3SDAA 5C7XL 3EJPA 2XBTA 4HSQA 3SEPA 1GTNA 4WWKC 4PWJA 3QC6X 5BVJB 1J5DA 3VRJA 4OQTH 1FIEA 4MJ5A 3BDYL 2WP3T 2NY0C 1BVKA 3RWFB 4WI8A 1KTBA 3ZJAA 7FABL 5EA0L 5FGSA 3V6OC 2B08A 1CD8A 3TO4A 1MEXH 2GBVA 3O41B 3BP5B 4YHPB 4ENEC 1NCAL 2VM4A 4ZPVA 1B0GA 1G6RA 5DHXB 2VAAB 4KZ0A 1P4LA 1PZCA 2WOYA 1MCWW 3SDDB 2R9HD 5FUZH 4MHHI 3IS0X 3LPPA 1XGUA 4DP6X 5T5NF 3KWUA 2OMBA 4LAJH 4X4XA 4Q6KA 1PW3A 1JZ7A 2FYYB 3Q5YA 4NUGL 4KY2A 3TM6A 1F4YL 3C9NB 4DOHB 5AOIA 2QELA 2WXNA 4HC1L 5D6CB 1QFWL 3D3VE 3PWUA 1HU8A 2VN3A 3ROOA 3O3DA 3G7TA 3FC8A 1TQTA 4UTCA 3O4LE 4BK8A 3LV3B 2EO7A 1U3HB 3D08A 3DV6B 4HGWB 3T4AB 3EBGA 2PPAA 3L3DB 3C6LB 1AGEB 4LSPL 3RB7A 5T3ZE 4OZGE 1M05A 3PHOA 4TNGA 3P2TA 4EDWL 3VYNA 1FAIL 3BUTA 2F1EA 4FQQA 1PY4A 1KWGA 3QI9B 1HKLH 3P77B 4FLOA 2YLKA 2FEEI 3MRIA 3RU8L 3DO3A 5ES4B 4ACTA 5GGVL 4LLYB 1WK0A 2F7RA 4FYTA 3SD5A 2N3JA 1KV3A 2HT4C 2H2PC 4S2SB 5SWSA 3L7FB 1MVFA 4C56A 1EZSA 1HXYA 3OHMB 1IAKB 3QXTA 4HF5H 3CZEA 3JZYA 1TTGA 2D2OA 3C8KB 3AS0A 1QTPA 4KO7A 5CHNA 4BCZA 3KPLB 2WLZA 2XX1A 2YQ2A 2GFBB 3MRDA 4GKSB 3WV0A 3GKWH 1N18A 3F6JA 1P4BL 4LBEA 3MXWL 2ORBL 5D1XB 3RWGB 1KFAH 5AYQA 2OX5B 3HJEA 4KJPD 3R19A 3U9PL 3WELA 4ZSOE 1F56A 3VG9B 3MUJA 5EZLB 5B1JC 2X89A 1EZLA 3ATEA 3CK0L 4JG5A 1JZ5A 5KVFL 2HT3C 3D48R 3IRPX 2F8VA 1MJ8H 2Z6FA 1WIPA 3MRRB 4TRPH 1RP8A 4PG9B 5DS8A 3NRPA 2VITB 5C08E 1H5BA 3DX6B 4W9CC 3VWJC 5F6IC 3EIFA 1CLZH 3QNXA 1FL6B 4N0UB 4JG1H 2ZAIA 3HNVH 4AMKH 3FU8A 4J8RB 4F80A 1XCWA 3CSPA 2DWDB 4U2YA 3CPUA 5GZND 4YK4C 3U4EB 1QHOA 3N06B 1ZTXL 4EOWL 4GUQA 4S10A 2WUBL 3QJOA 4JFQA 3T71A 3GHBH 4R5VA 2FQGA 2Y69B 2W88A 4HOXA 2YIHA 3LZNA 4LP8A 2D0GA 2VKXA 1HHHA 3QFDB 3F6LA 1HI6B 4J4PC 3LNIA 1AMYA 1PZBA 2WN3A 4YXLL 4PJAA 1CFTB 4DGUA 2OYPA 1F6AB 1A1NA 3IE9A 2YS4A 5AG9A 3WFHA 4L4TB 1F0LA 1E28B 3VYOA 1FVCB 3CBJB 1EJOL 4XNYH 2O6EA 3L7EB 4JY6B 5CEYA 2EIZB 3QQ9D 4MSWB 3CX5J 1CVRA 2DQDH 2I85A 4BK5C 2NY2C 2B4CL 1A4BA 3QXUA 4KI5D 5CZVL 1KB9K 1GY2A 2VDNB 4NRZB 3EHBD 4AZ8B 3SY6A 1A14L 1ZHBA 2YO3A 4HOWA 3TBYB 1K6QH 3WSQH 1CD1A 1TQSA 1EEYB 4P4RB 1TCMA 3WE6B 3KR3L 3FSVA 4AE1A 1LWHA 4TVPD 4PLKD 1GAFH 1PEZA 4GI9A 3L3HB 3T1WA 3VWKA 2X88A 3EF4A 3MV9E 1EEZB 4UUJA 5DVLA 5IJKA 3HAEG 2XXCB 1JXFA 3T2LA 2EDOA 1F1AA 3IGAA 3MV7A 3V95A 4FG6D 3QS2A 2A4CA 3HW7A 1E5BA 5EUOB 1MCWM 5AUMA 5TQ0H 4MQXC 1EXGA 1A7QL 4YBQD 1SBBA 3HUJA 5KYWA 2ZWLT 2J6EH 2UZIH 1OM3H 3UBFA 4WFED 4BV1A 1J87A 5JPNC 2ICCA 3BZFA 3UJTH 2A9AA 2PPEA 4XCYA 3EG9A 3VQ1C 4EZKA 1O75A 5C09D 5IMLB 1BAFH 3DX3A 5DGRA 1DVQA 2FT6A 1H6TA 1IM9D 1CLYL 3QCUL 3X14B 5T3XD 1TYEB 4TNVK 3JWNG 2R27A 2QZQA 2LU7A 5INDB 5DJ2A 4IM8A 1FH5L 1YG9A 2BHFA 3DGDA 4AGOA 2BWQA 2J8OA 1KYOJ 2VXVL 4XXDB 5D4HA 5EU6D 3SQBA 1HHJA 2EIKB 5KSAA 5FCUH 4RMWA 3PJLA 1GC1C 1PPIA 1X9LA 4UYQA 3F85A 5C0EB 1A25A 1N5YL 3CLFH 2GI0A 1PD6A 3K8KA 4L3CA 4Y2DB 5CINH 3ZLQC 3W3BA 5DRWB 3BW9B 1RLBA 1RXLA 3BYTA 4IS6B 4NQDD 3RVXC 2OSWA 1IGCH 4JBSA 4HHGA 3UBXG 5DT1L 4L9LC 3WIAA 1ZLWK 3POHA 5BZDA 2QLYA 3GZPA 4PAZA 3MRLA 2NR6A 4WW2F 4Y1AB 3BAEH 3FUFA 5HVWA 1IAIL 2BDNH 3PP3K 3CGTA 3MAWA 4BKLB 3DDGA 1HINH 2ESVE 4FF9A 4H0IA 2GSMB 1BQKA 5D96B 3AU1A 1T0MB 1FRGL 1KLUA 4H8PA 4KV5E 1DJHA 4FP8H 3MBXH 4AQAA 4IGBC 1TFPA 1IKNA 3QFJE 4KMTH 3ZO0A 3H6JA 5I2IA 2B5IB 5IB3B 2VLRE 1B6UA 1KY7A 4OF6A 1D5RA 1C9SA 3GBDA 4H2AA 5GGTA 3HCVB 4FQCL 3VRIB 5BRZE 1NPUA 4GRWE 4OGXH 3TU6A 1W9XA 1MHEB 4HCRL 5B7EA 4M8QA 9PCYA 1EFXA 1EEUA 2L3BA 3LY6A 3T0EE 3VXUE 1T2XA 3E2HC 2L7JA 3K2KA 3LVTA 4GBXA 4Z3GA 2WXGA 4Q74A 1AANA 2EDKA 5JA9A 3TYGH 1RU9H 4AQEB 4ANUA 3GD1C 3ISYA 4RAUB 1X6NA 5C0CD 4A37A 4CVUA 3IU4H 3LB6D 2CMRL 1EV2E 4N2HA 5HHVH 4DVRH 3GM8A 3ATFA 5JXAH 4NZUL 3T5WA 4DEPB 1QEXA 3EOYG 3SDXA 3S34L 3KH3A 4FQ1H 3SE3A 4Z76B 4G9DA 3HJ0A 1C5BL 1G4RA 2GSIA 3U6RA 1PSKH 1RZPA 1EGJA 4TVPH 3W38A 4QRRB 3A24A 1U8HA 3V10A 2XXMB 5AVYB 5FXCH 4P06A 1E65A 3V6ZA 2AJYH 1L7TH 2WNXA 3CFNA 3P11H 4CSPA 4FZ8L 5ABZA 2GHWB 4XGZA 5GJTL 4TTDD 3TBBA 1KOAA 3OF6A 4NQXA 2PW1A 1LQBC 4TUKH 4U6VH 1MXDA 2WQXA 4WV1B 1A6AA 2CBPA 3U2SA 2EDNA 2HFEA 1GGBL 1LP9B 2IV9A 3O6FD 3R4DA 4GXFA 4JGUA 1MI5D 3RWHB 1PIGA 5F9WB 4AEIH 3MODH 3QQ3B 1NUFA 3G9AB 2GJZB 5DQDH 2ICES 3HI6L 3MREA 4AEFA 5KSBA 2YWYA 3US1A 2FH8A 2CRZA 4GLRI 4HWEL 4NPKA 5T3XH 1QFOA 4QYOB 1R1CA 3FHQA 4KTYA 2DIBA 3OD3A 4OZFG 3FFOA 3R18A 3HPJB 4OCWH 4TPRH 2ICEA 5BXFA 3KXFE 3TEWA 5K9QI 1CZ8H 3QPXH 3B2XA 5KANI 5IIEB 2BCMA 2TSAA 2WGXA 1MJ7H 4JGNA 1HZHL 3FTXA 5T1LD 4HP5A 3KPRD 3QORB 5DK0B 1KT2A 2EDEA 5BO1H 5FO2A 5FYJU 3D50A 1U8QB 5JNYA 1RZFL 4BFFA 2XWEA 3HG1B 3FTSA 4OFKA 2BNUA 3Q8AA 5JR1H 4Y5VB 2DBLL 3GT6A 1JK8A 4G72B 4LCYB 3SYAA 1E9QB 1HSBA 1JVLA 5ERWA 1CXEA 1WV7T 2BY0A 2GSGA 1XGZA 4JFPA 4Y16B 5JIDA 1AR1D 3MXVL 3QW9A 1SBSL 3JTBA 4LHUG 4KJWC 3AAZB 4ZO9A 1AO7E 1WZKA 3RX7A 1WDAA 1ZLEA 1WGVA 2OJEA 2XNAA 4ESKA 1S7QA 4OZIF 5DJZA 2D31B 3DC0A 2IAMD 4EDXB 2IWGA 2IPKB 3AADB 4PIBA 3PGFH 3IDJA 4UIKH 4NO5A 2WLMA 1R46A 3W9EB 4BDVB 1LLAA 1XZ0A 5AKTA 4WZ9A 1B2WL 2E6QA 4RRPG 5E9DE 5KBDA 2ZXBA 5IHZA 4P2OB 4L3AA 3VFMB 3KLHD 3E6FA 3QB7C 2NUTA 1YNTB 4Z7OF 5JOEA 5FB8B 5GRWA 5I1AA 4NQCB 1IC4H 4CRPA 4OFYA 3TPUB 4MMZC 1JZ4A 1A1MB 4GW5A 3H54A 4XOBA 2ZKXA 1M7IA 2ZE0A 3QZBA 5HJBA 2MPAL 4IRSD 4EI5B 4PTUA 4V1DB 1SHSA 1XH2A 4UM9D 4KROC 1UHVA 5J13C 3CFJB 3VXTA 2ZX8A 4NZDA 1NDTA 4UANA 4A7UA 4HBCH 1F11B 1YJDC 3WHXA 2QKIC 4E41D 3MUUA 4BD4A 5EO0A 1OGAE 4JHWH 3IDGB 2GUOA 1PFOA 5IHLB 2NY4C 2Z0UA 5CEZL 3TIEB 3ZKQD 3D5OF 3QRLA 2VWEC 4E9VA 1NGPH 5F1OB 4PRNB 2QTEA 1MCSA 2ID5A 1D5IH 2F7QA 1UXSA 5T5NG 5FKPA 4TNEA 1YEHH 2DL9A 1TJMA 2FATH 2NSXA 3RTQA 3V4VB 4JZJC 2DYPD 2AEIT 3OKDB 1C16A 4NZRH 1DQJB 3U2IA 4J6RL 3LRKA 3DVGA 1IAOA 2NY1B 4PH8A 4GO6B 5E03A 5A40E 3KYNB 4HS3A 4NT6A 3O81A 2B8OT 5KJ4A 1AJ7L 3U0WL 3IJYA 2CM6A 2BVQB 2YMXH 1BM3H 1NGZB 3D39E 4FYSA 2A6JB 1CF8L 4XPBH 1MY5A 1KACB 1W80A 5J6SA 5D1ZD 1BVOA 3QFGA 5L4FA 5BVPL 1T03H 1LD9B 4JO2H 1MFNA 2YA0A 1R3IH 2F54E 2OMXA 2Z8WC 4FOMA 1HJCA 1IUZA 4ICWA 2V5SA 4D0DA 2F15A 1RJZB 3MX0A 1NJ9A 1QWUA 3QIUB 3JTSB 2R0KL 1N64L 2XJKA 2PLTA 4NAQA 3TBWB 4B97A 4UU9B 5GGRY 2W9DH 5BV7H 2JCCF 3WGVB 4I18A 3AQYA 5CU5A 4G70B 1PLBA 1DJSA 3BO8A 3NCEB 1GZQB 1VPOH 1F97A 1W0YT 3D05A 5FYKE 4OCNC 3LKNA 3SDCB 2Q8BL 4POZD 4HIHB 1WBYA 2Z1KA 2J5LC 4JR9H 4B95C 5KBMA 4P3CL 2B7DT 5SX4I 2X4NA 2JKNA 3IPFA 4FG4A 3L5XL 1PZ2A 2I9TB 1ZT1B 4UQCA 3CZLA 3L1GA 5CD3B 5KVEH 1HXMA 5IBTL 5IB2A 1T5WB 2IIJA 3NA4A 4XTRC 3GBLA 3IXAB 5DSCA 1U0QA 4UQEA 5EBGA 1U8NA 4HIEB 3UMTA 2KMWA 2VW7A 4DUXA 1QBMH 1ZT4A 2X2IA 4AENB 1P2CA 3CVHA 1O9WA 4QRAA 3VGFA 5IGXH 3U7AA 4HW6A 4JO4H 2Y07L 4XWOC 5CJXC 5JXEC 3L5IA 3BKML 4J3UA 5EWIH 2E7HA 4M6NH 5KG9A 3CDFA 4HSCX 3U83A 1Z2KA 2ED6A 2HH0H 4GYBA 4MRBA 4XBGB 1CFNA 5CGTA 1UM5L 2PXYC 4YAQB 3TVMD 2X5PA 4YL9A 1J86A 3MFGB 5EULV 4HIIA 3IFPA 2APWA 1GSMA 3QWNA 4HUKB 4ERSL 2VLME 3W0WA 3KLSA 4M4RB 4G1EA 2X4PA 2ITCB 5E1AA 3D12B 3HEIB 1IX2A 2K3HA 2VMFA 5CJQL 5A16A 2ZSWA 5KYYA 1HYRC 2C1PA 2PTVA 3GRWL 4GINA 4LU5L 4G3YH 5FYJD 5FO8A 4R84A 4XNUL 3IYLW 5HJDA 3ULUF 1W0VA 4NC1E 5LLIC 1AZBA 4Y1TA 1U95A 1EO7A 4FNSA 3FO1A 4L8SA 1TZIB 1ZGLB 4KY1H 3DJTA 2VERN 5DUMH 1WIOA 5GS2D 5SWZD 2YXFA 4OV5B 4GAGL 5J6GB 2R56H 4EO5A 1EJ8A 1M6UA 1JK9B 3T6VA 1I9EA 2EACA 4PJ9D 1A65A 1KIRA 3PP4L 3KYKL 5EOCJ 1WICA 5TE4L 3X11A 4NZ8A 3S3JA 2BHUA 1ML0A 1XCTB 1BD2B 2QGCA 2LVCA 3BGAA 3CX2A 3L5WB 1AD0B 2DKSA 3E8VA 4NS0A 4N0RA 3NIFF 1KJ2A 3ZMRA 4DGYL 4NM4H 4G8FB 5MP6H 4JKPL 2JV6A 4AKOA 4UT9A 3N44B 3ZE1B 3O4OB 4HISA 1D6EB 5DZ9A 1I85C 3KDMB 1CDHA 2ZCLL 5AZ2L 5B4MD 4O58L 1V7NL 1JE6A 3IVKA 3L2NA 5FKAA 4C8XA 3HE7A 4IBQA 5J0BA 2P24A 4ZUVA 1LO0L 3BZDA 3X1FA 1XIWB 4OB5L 2ZOLB 3RG1C 1K4CA 2Y6TE 2DQCH 3P4MA 2EYRA 2GTZB 5EZOL 5HDBE 2OYKA 5KS9E 3BGMA 1PJ9A 1CLVA 3PL6D 4ZTOL 4FQPA 4PVMA 1XAKA 3NCWA 4XAWL 3K8MA 1M7DB 4F57L 3ZE0E 2F9BT 4V11A 2ATKA 4HX1A 4QXUH 4X9IA 5MEQB 3W5NA 5DHVB 4BCYA 4HUNB 4OBRA 4CILA 2X44D 2DLEA 1UGKA 5DD1L 4L4JA 4KJYB 2F19H 2R23B 5GJSH 2Y24A 1KIPB 5C0RH 5DHYA 4K4KA 4L4VD 1YA5A 3KVQA 2HJFB 4PJFF 4PRIE 1RVFH 4WGVB 3GMLB 4YDVA 2C3WA 4JO1H 3SJVB 4EXPX 2P4AB 1DZBA 1X7QA 2WVUA 4PJIA 3J27A 2YD4A 3WMSA 4PRHB 4JFHD 3QWQB 3T6WA 4FRWA 2JELL 5IFJB 1ORQB 4U2ZA 4O9HL 3UG4A 3OLIA 4KPHH 3X1NA 1RK1B 2G5RA 3MJ9L 5CCGE 3IGFA 4JPVL 3LNHA 3QDME 1N7ML 5HJ3A 3WIHL 4U31A 5DLMH 2ZG3A 2OMTA 3MRHA 4TVUA 4F33A 4Y4KB 4XP1H 3VI3F 1CS6A 4F9LA 4NIKB 4HS6A 4X9GA 1XL4A 4OIAA 2XQYG 1GW0A 3PU7A 1GHFH 3EGDA 1AC0A 4OU3A 4LOEA 2G2RB 4R7VA 4H20L 3KGTA 3H7BA 2FO8A 2XI9A 3E9UA 4EUPB 4RGMC 2VMCA 3ML9A 1P0SE 2B39A 1GR7A 3R8BB 4HWBA 5KVFE 1LHZA 5EU3A 1OWRM 5AL8A 1VZHA 2J1ZA 5AWNH 3PF2A 3QA3B 1I7RA 3N1GC 1JG9A 2VW4A 4LEOA 1JZDC 5EIQA 4B5ZA 2GQHA 2UXFA 5E4OA 3T3PE 3QAQA 1CGXA 3WTXA 1F8TH 4PRBB 2VMDA 2AJ3B 1ZTXE 1DFBH 4X5XB 1N6UA 3PDGA 5FYJH 4APXA 1L3NA 2YARA 3H9HB 4NUJB 5F0JB 4WHYH 4P2AA 4AQOA 2KPNA 4ZMPA 1IEAA 2X1OA 4ZPTB 5BQDA 3T8XA 3VXSE 4CAGA 2XWBA 1I9IH 1OD7A 5F7LB 3R1GL 1HKFA 4ACPA 3JUZA 2IFFH 3Q8FA 4LGRB 5GS2H 1TOXA 5JORB 2AABH 4XH2B 1F86A 1JGVL 25C8L 1ITCA 2AJXL 4FXGB 1MH5A 1JERA 3H3KA 4HXBL 1Q72L 3BQUA 3VX0A 5DUPH 5EU4A 4P2QE 3FB7A 4LEEA 2QSTA 1UWGL 1RZ8B 4IRJA 3ILPB 4PREA 3VFPB 3V7AG 4N2KA 1DN0B 5IHBA 1BF8A 3D0LB 4GG8B 5CP3A 2D03L 4JGMA 1CU4H 1D2OA 1M71A 2J73A 4YDLB 2HMIC 3B9KB 3F2LA 3UZQA 5DMIH 2WINA 2AXJA 3QJHA 4RESB 5C07E 1NLDL 1SNRA 3BD3A 1N4XH 1FO0A 2AERT 4G9FE 5BRPA 3TA3B 4M62H 3I6GA 4OLVL 3CFIC 3WKQA 4WFFE 5KUMA 2AAVA 3VMOA 1I8LA 1PS3A 4EBQL 3TEXA 1M9WA 4R4BB 2R2EB 3QJQB 3FFDA 4M5YL 4P05A 4Q8BA 4JQVC 5D7HA 4Z7UF 3V0WH 1H8OA 3WJMA 1FYTA 3MLSH 3O45A 5L7XL 4KTGA 3VFOB 1CDBA 1XGPA 1BIIB 2AQNA 1AHKA 3V8OA 1ODUA 1IEBA 2PR4L 4IOSA 4NRYB 3QDGA 1CGUA 4OT1L 1WISA 2GABA 1BQHG 3FOLA 3V0GA 1R17A 3O2WH 2ED7A 4GAAA 2X7LA 4PWEA 3WO4B 1Y1UA 4XHJC 3QIBB 4Y4FA 5IOKA 4BK4A 3CMOH 4AV5A 3S3PA 3C60B 4IRZA 5AZUA 3S4SB 1CE1L 2AK4A 2B9BA 5IREA 3KJ6H 3BT2H 1HAUA 3QARA 1J8RA 1FC1A 1QLEB 2W07B 3IDYB 5CP7A 3GSRB 1GIGL 4WI0B 3ZTJH 1MFEL 1BVNT 4NFCA 3EADA 2A9NH 3MNWB 4K15A 6TAAA 2CO6B 2VXSH 4GQ9L 4TUJA 4HXAL 1U3NA 1QEWB 2DPKA 1ZE3C 4OZHF 1NIAA 3UTSD 1V7MH 2XUWA 3FCBA 1R3HB 3O11B 4CMHB 4L3EE 2DWXA 2RTTA 2UY7A 1QBLL 4E68A 1H15B 3GXFA 4I0PB 2JQAA 4BFEA 2QDWA 2VZ1A 4M1CD 3NTCL 4Y0GA 2EC9U 3MN8A 4H0HB 3BKJH 2EE6A 1E2ZA 32C2A 1KSRA 1CE6B 4HZLA 3FQWA 4P4KB 3MI6A 3DKHA 1DBKH 3QZMA 5CLYA 1QLFA 4M29A 1DO6A 4AJWA 3AS2A 2EILB 2NTFA 5IVXA 3QXWA 4UV4H 1XSKA 2FJGA 4F2MB 4KUZH 3KPNB 3P3YA 3D4YA 4OLWL 4TL5A 2BP0A 3QUHA 4O2CB 4RRPM 4Y8AA 5E2WL 2W60B 4QT5B 1DJZA 1KJMB 4NP4L 3EXLA 5MEOB 2IOMA 4HUVB 3OR6A 2VSCA 1EBAA 3B37A 3SDAB 4FFWD 1BOGA 2G75A 2CJUL 1XMEB 3ZDYF 2DL2A 3CIAA 1JPSH 3CC1A 3TT3H 1NL0H 2E4FA 3OG6B 5CSZB 3VGGA 2FLRT 3RPIB 3VRJB 1OHQA 3C5ZD 5E94B 2Q20A 5IQNA 4UQBA 1REIA 5KEZA 4HZ1A 1YMMD 3P4OB 4JFXB 4DKEH 1VLXA 4XC1H 2HFFB 1MW3A 1U8KB 3FYIB 4BSJA 3HFMH 1FNSH 2QGBA 5BZWA 1WYJA 5LUMA 1JPEA 4F1ZA 3ZDZB 1G6RB 1ZPLA 4QNPF 1WA2X 3B7RL 3NQIA 4OCYL 4AJVA 2V8LA 1P4LB 2JJSA 4BRVA 3ZL2A 3LN5B 2W8CA 3ARBD 5JW3L 4QR7A 3A4DA 1CDCA 3VGEA 4WWID 2ZWKA 1XGUB 5A7BA 1NBZA 2FD6H 3H9SA 2O5XH 2GTWA 5HI5D 4F8OA 4XMZA 5KJ7E 5I8EA 4YEFA 1NLBL 1GYAA 4ZW8A 4XR8C 3O6MH 4K71B 4ANWA 3KLQA 1S3KL 5BCAA 4HKBA 2R7EA 4Z9KB 1RZKC 1WBZB 2UWEE 3MNDA 1X5IA 2IH9A 4JFFD 3LQAH 2VR9A 3MA7A 1T7XA 3SDDC 5FLUA 5AL0A 3N50A 5IEKA 3S5ZA 1A66A 1U3ZA 3BLBA 2BP8A 3RA7L 2X4SB 3G5ZB 4JHVA 2GHZA 2YHGA 1EAOA 2H1XA 3MRIB 4YFEA 3I50L 5F97E 4OJCA 3O0LA 2BW5A 4D0CA 1MNNA 3FO0L 1H3TA 1IRAY 3ISRA 2X6UA 2YSSB 5AOZA 2C9QA 2VN6A 3T4AC 1DJGA 2EAEA 2OYMA 3HMXH 1LDPL 4FMVA 4FFYL 3O2DH 3EJZD 1UKQA 4PS7A 3CN3A 1RULL 1KTKE 2FLBT 3LZQA 3N85H 4C56B 4YHKL 4MGXA 5L2KA 4BZ2H 4HQQH 4N5UA 1UA7A 1QO3A 4BFIA 4EN3A 1HJBC 1KULA 1WA1X 3QI9C 3CFDA 3CSBA 1JHLL 4AMXA 3BMWA 5LBVA 3QNZA 2Q2EB 5CHNB 3VDBA 1INEH 5IFAL 4MASA 1L3WA 2BNRD 4EMZA 4OGYH 1D5ZB 3MRDB 1FL3B 2CJTA 1TO5A 3CVDA 1BQLL 1HH6A 4IU3B 2RQ8A 4LBEB 3IDIB 4I9WE 2KUTA 4P57A 4HMEA 4P9HC 4Z3HA 4MKTA 3CXFA 3FB5A 1JZ8A 1XF4B 3DIFA 1M1XA 1XD1A 1KNOA 4FXKA 3CC5A 2Y3AA 3O8XD 3T2NH 3QGVA 4MA7H 2EXWD 1OSYA 4HKZB 2ENYA 1D5XB 4N2DA 5DS8B 5E6IA 3APCA 4TQPA 1QPKA 1L9QA 3L45A 5D6DC 5HYSG 2OL3L 1DUZA 2I24N 3ZSTA 2PW2A 4POYA 5D1XC 2WXLA 2YC1A 3G3LA 3SO3B 4GSQA 3EAKA 2KS0A 3OKLA 4LDOB 3E1ZA 3QZWG 4PJDA 1S4IA 5CJBA 4JFQB 4Z0BH 3VG9C 4DFIA 4DGIH 2M2DA 2XRAH 1CFBA 4DP0X 3V9CA 5AQ0A 1A7RL 5F3HB 2F53D 5HVHC 3THML 3UTPE 4TQHA 5LGKA 2VC2H 1HHHB 2VJXA 3P9MA 3PWJA 1XGYH 1JS4A 3FH8A 1GZPA 1ZDQA 3MBEC 2GYSA 1WWBX 5HHOA 1ORSA 1CL7I 4H8WC 2V3DA 4N1EA 4PJAB 4P2RA 1JIBA 1ZJBA 1VESA 3T0VA 1A1NB 1SGKA 1UWEH 4HPOL 4PJHE 3NH7H 1OTTD 1E9PA 2VSKB 4LCVA 2ZX5A 4GW1B 3ECUA 3PHQA 2QV4A 5CEYB 5HVFB 3Q2WA 4ZD3L 1P7HL 2QEJA 3O6LH 4LEXH 3PWVA 3WY2A 1A7NL 6CGTA 1S7TA 2WMPA 1JF6A 2WXKA 5E8EB 5FFLA 3HFFA 5KAQF 4PJ5A 2W5PA 1RZJH 1U8PA 3CFQA 1PCSA 1MFAH 3ZDXF 1M2VA 1A6ZA 3AWFA 1TENA 1CD1B 4U1LA 3EDFA 1J9RA 3I75A 3MRGA 5CEZE 1S6NA 1FL5A 3SODB 3HBQA 5DGQA 2GK0A 5KOMC 4XMLH 2DQFB 3JWNE 1FA4A 5F7EL 1LO3L 1YEKH 4UUJB 2LQRA 2GBAA 1BFOA 2PCFA 5D7IE 2F8XC 1BYNA 1QR4A 3IGAB 1FCCA 4YDMA 2WYIA 2WOBA 5AUMB 3KGRA 4G8AC 4U7MA 4OM0H 4LNVA 5D2LF 4GMSL 1X6LA 1JD9A 4GRLB 3HUJB 5KYWB 4U1HA 4I1RA 3BVWA 3P54A 4HAKA 3UO8B 4QGYA 3NIDB 3D3VD 5IKCA 5AEAA 4FULA 2IFGA 2AQ2A 4XCYB 1OT4A 3O4LD 4IHBA 2UVEA 5MHSE 1FFOA 1RJLA 4PJCE 2V17L 4FQXD 1HCYA 3Q06A 1CT8A 1HFUA 4KVNL 4FA8A 3B56A 4C83B 5T3ZD 4YFLF 5DJ2B 3VI4F 5E24E 5C0AE 1AZCA 3SQBB 2GBTA 1DBAL 3PWPE 1HHJB 4ETQA 2WTRA 4JPIB 2QHRL 5KSAB 2J5WA 3VFNA 1SYSA 1VB9A 2H32A 4WWOA 2Z31A 3TZVD 5IQ7L 3QS3A 4Q52A 3BUBA 4JN1L 1W72B 3AREA 2RBLA 1TPXB 1S46A 3D8MA 4LIQE 4MVBC 1TITA 3GZKA 1C1EL 4EEEA 5DUBB 4APQD 3VXRE 4X80L 4K9EC 3P9LB 4OSUH 5MENB 4W9JC 1OF0A 3IDNA 3RY6C 2HKFL 4NQSA 1H3UA 2GT9A 4TSAH 3WNOA 4Z3EA 5BZDB 3NBNA 4HDIA 1HN1A 3QE5A 4S0HA 3Q44A 1YLBB 3ESVF 4Y2DC 1ZT7A 1UD2A 3RIFF 4NOBA 2UZYB 2J8UF 2VQ1B 1CYGA 5KSUA 4XI5C 1NCBL 4X6DE 1BZEA 2XG5B 1KLUB 3QH3A 5GXBB 3UAJA 3EW3B 5GRUH 4JFEB 2K6YA 4AQAB 5CD5C 1HEJC 1Q90A 1FE8L 2Z8VC 1P1ZB 4LARH 5D71L 4Z7VB 4HLZH 3F5WA 2A6DA 3FMGH 5AOKA 1SEBA 1AD9A 1XB6A 3ARQA 3FFCD 1E6JH 3QYCA 3JWOH 1NAKH 5C08D 3WEBA 5FHBL 1ETZA 4B9FA 1WS8A 1YO4A 4XVTL 5D96C 1ACYH 1KPVB 1EFXB 4FLHA 4M7JH 5E8PB 3ABMB 4GG6B 2JXMA 2PWHA 4KAQL 2HN7B 3NJIA 4TKWA 4PV8B 3AACA 1JMZA 3T0BA 2X6AA 3BPNB 4ALAC 3ESOA 1F3DJ 5GZOC 3QUMA 5GHWH 4UQ9A 2J4WH 2XN9A 4ODSH 2XKSA 3F01A 1TZGL 2O5ZL 3OR7A 3Q6GL 4HAGA 1AGFA 4NZTL 2NW2A 4L1DA 5CO1A 5T33H 1JPGB 4H0LC 1P5UA 3MCYA 3TV3L 4U0RB 3UJIH 3HG4A 5IFHL 3PE9A 3MRCA 4MYPA 4G9DB 5A7EA 2QR0B 5HYFA 2PYEE 5FGBC 3IBEA 1SY6A 2GSIB 3U6RB 4U33A 2ZOTA 4DT2A 5DI8B 3QJUB 1H8NA 4PVBA 1U8HB 3ARDD 1F1GA 3V6ZB 3LKOA 1GA2A 3IDMB 3WKNA 3MUGA 1RMFL 1FPTL 5FCSH 1VRSA 3AY2A 2Q76B 2PW1B 5E99L 4DEPC 2EZ0C 3QEQA 1AY1L 3GMNA 4MS8C 3U2SB 1UYWH 4WUUA 2HT2D 3PCYA 1SM3L 5HJGA 2YEQA 1E27A 1MLCA 1NAMH 2R69A 2WCSA 4L8BB 4N86A 4WIQA 3VCLA 5BNXD 4TSBL 5DZNA 3MV9D 3MRBA 3MREB 3HC0B 2BVUA 2YN3A 3CU7A 3KHOA 1EO8L 4NGHL 4PU2A 3X3GH 4CNIB 4PGJA 1O6SB 4D3CL 5T3ZH 5ISZE 1NICA 2F1AA 4G42B 4IDJH 2ICEB 2JKJA 2DIJA 4XNZB 4M4PA 1MDTA 4WV1C 1J1PL 4C58B 1QSEE 3U0TA 1CLOL 3VFVA 1VHPA 2M8XA 2R4SL 3AFLA 4M7LT 3LDBB 4I2XB 1GYUA 5F9WC 1KT2B 3KS0J 3AROA 1IIIA 1WWWX 4W4OA 3ARGD 2B1HL 4XNMB 2BNUB 3UJJH 4B7LA 1AFVH 4WO4A 5DJCA 4CC0A 3L3KA 1JK8B 3LS4L 3UAAA 2AHIA 4K8RC 1G7HA 5EZJB 3ULUL 1HSBB 5ERWB 3KGUA 2GSGB 4JFPB 1MHPL 1H3WM 3OJ2C 4RZCA 4ONFH 2JJWA 4YSEA 4G8GE 4Q6IB 4XMPL 4ONGH 1DVFA 2WXHA 2E46A 2XNAB 4X7EC 1S7QB 4WTWA 1WWAX 3EGXB 2IDFA 4MAYA 2K4WA 5J12B 5EDSA 1JZ6A 1J5OL 3IDJB 2QQQA 3RGVD 2D73A 3MVSA 5HHNA 3D69A 1MRCL 1R3LB 1XZ0B 3INOA 2V2WA 3LPFA 3QULA 3A4EA 3W57A 5IHZB 5BS0A 4ELKA 4Y16C 4DPRA 3ZMNA 3RLSA 3QR2A 3UX9B 2NUTB 1C12A 4HPHA 2R2CA 2UVFA 4H8VA 3WFCH 2X42A 2DM2A 2P5EE 4N2FA 1OAUH 1QASA 2IANE 5DRZA 4DP2X 2CBTA 2WO2B 3PWNB 2ESVD 4GW5B 1GJIA 1EUUA 4RA3A 2DMHA 5EZIH 1BEYL 2R2BA 1Y0LA 3ZRFC 2CKBA 4PTUB 5EO1A 2FECI 4P2OC 1HCVA 3ZZSA 3IE4A 2NNFA 4WUKH 3UYOD 2YGNA 3QFJD 2Q6WB 3AMLA 5F21B 2VDPH 2VLRD 3GMRA 5EO0B 1MKFA 1GXEA 4LSQH 4DP9X 1BMGA 1MCOH 4UINH 5BRZD 2W0KA 3MC0A 3BSZA 1X44A 3QHZL 4XPAL 5K39A 3IMVA 1SJXA 3GLZA 1UXSB 3COOA 2AK1L 5F7UA 3T0ED 5D4IA 3VXUD 3UL4A 4AQ8C 3V4PH 3ULVC 3RTQB 1IGIL 3OX8B 2ZWNA 1NGYB 2NY3D 4BFBD 3FCUB 4HULB 1IGFL 1LNUA 1C16B 1YPZA 3FQNA 3LEVL 4WTZG 5E1HB 5CZKA 4F5CA 1T5XA 1MVUB 1D6VH 4ADIA 1OAKL 5K9JL 4AGQA 1IAOB 1E40A 3UROR 3OXRA 5F9DC 2O5YH 2WCPA 1BJ1H 2AV7B 2NZ9C 5LGJA 1IBZA 3EH2A 3NCJH 1JGEB 3IJYB 1TETH 3D4ZA 2J1KA 4UTAH 4WHTA 3J07A 2L8AA 4M61A 5I18H 1DQQA 2V3FA 3VH8G 1K3ZA 5I8CA 2OMXB 2QKSA 2ZNXA 1FJ1A 4LKCA 4LSUH 2NY1C 4D0DB 5B8CB 3NRQA 5IB1A 4MQSB 2LU3A 2XZQL 2ADYA 4MXQD 3TN0D 2YA1A 3FUJA 3U30B 2OK0L 3MZGB 2EJ1A 4N6RA 2VM9A 4WI7A 3ZT7A 4ZFGL 3HNTH 3OJVC 1ECYA 3P4NA 4KKAD 1A4KA 3GI8L 5HHPB 2DIEA 3BO8B 3BISA 1L6PA 4NJAH 2KZKA 4ES8A 4Q9RH 2ZOOA 4RX4A 2VDKB 3VM5A 4OLXL 2NY6D 3APMA 2JTYA 2BVPB 3QIUC 4DGVH 1RUMH 3QQXA 1VACB 5JDSA 4BQ9A 3B7SA 4GO8A 1JGDB 1WAAF 3KXFD 5T5FH 3DHUA 5DSCB 1FNLA 1MWAH 3VTTA 3H3PH 1NC2D 3IJEA 1U8NB 2BNQA 2BMKB 1P2CB 2VQUA 3CVHB 4E36A 1BG9A 2I60L 4MJ4A 4KKQA 4GFTB 1AQHA 5HGAA 1M42A 4Q7DA 4ETYA 5ITBH 1F42A 5LKNA 1MWOA 3RDTD 3ABKB 5KG9B 4FJ6A 3FXIC 1Q1PA 1E50A 2X4QA 3F04A 1CFNB 2HVBA 1JYWA 3BWUF 3P9WB 5EIIA 1MCKA 3CLEH 1U8OA 3KVDD 3QZOA 5C0JA 1OE1A 4ZS6C 2X05A 2H5UA 3LNDA 4JGJA 3U9WA 1XXDC 1AO7D 2W0LA 1E0OB 2WGNB 3KWWB 5IW1B 5B1JA 1F3RB 2HTKD 2X2HA 1UD8A 3IU3A 2EECA 5A16B 4GB9A 3Q05A 5KYYB 3IDUA 1TF4A 5FO8B 3M86A 2APXA 3KPQB 4M48L 4Q0XL 1LEGA 2BPBA 4P9HL 1W0VB 3UZEC 4HOZA 5G4OA 5ID0A 4NO0D 5F71A 3F7KA 1U95B 2AQPA 3L3IA 4TSCL 5BRQA 5I0DA 3FO1B 4L8SB 2KC0A 5J89A 5LQBL 3BEVA 3F00A 1AI1L 2VDQH 3HBPA 3HZKA 4TLKA 5DS1A 2IGLA 4FMFA 3GSNA 3ZBMA 3SBRA 1VIWA 2MNUA 3PV6A 4FNLL 4GRWH 3MJ6A 1CQYA 4XXCA 3MYZA 4LAQL 2XV2A 1KIRB 3MLZH 4LLUA 5F8QC 2B16A 3JVGC 2B0SL 3RVUC 1FDLL 4PP1C 5KAQG 2DQHH 3X13A 4P9MH 3RIFK 4J4PA 2E6JA 1HEZB 2CDGA 4P59H 2LFEA 3ZXAC 4GMTH 1UWXK 2BZ7A 3KYOA 2R1XA 3KPOB 1NKGA 1KB5L 2YRBA 1RIHL 4N8CL 4MXVF 4WKZB 5FKAB 1PLCA 4UB0L 4CU7A 3HE7B 2ZP0T 5JIQA 1TJGL 1J0IA 3AUWB 3BPCA 3VFRA 4ZUVB 2DI9A 2EUXA 5F7HA 2V9QA 2Z7UA 1VZGA 3FTGA 4BK5A 3CDGA 3F12A 3LRSA 2FEJA 1E5CA 1K4CB 4OVVA 2BWDA 3RVWD 3CHRA 4HT1L 3BGMB 1XH1A 2NZIA 3BDXA 3L5HA 2DQEH 4LFHG 2DTSA 3O4OC 2WLHA 1RHFA 2XT1B 3KBEA 3P0YH 4I48A 3FTWA 4RGNB 5E08L 2XWDA 4HX1B 2ZUTA 1WBXB 2CM5A 3VU2A 1KZYA 1CFQA 3GNML 1HWWA 5DD6B 4NKOA 1IM9B 1CGWA 2VH5L 3W1ZA 1JCKA 3RNKA 1B9ZA 3FYEB 5IJDC 3D39D 4BQBA 4DK6A 4OZGA 5I30L 2A0LD 3F58H 3RKPA 2H8PA 2ZNWA 4RWYH 3DETC 5CIPH 5JUEL 3S35L 2VQTA 4BE5A 3ZHNA 5F89B 2MQ3A 5TDOA 3WEXA 4K73A 4WEEA 2F54D 3NFNA 4E9WA 2A1WL 2COQA 2Q86A 3ESMA 1S9WB 2WLKA 3SPVA 5JPNA 3VGBA 4QAMB 1EZUA 4W6WB 1D2PA 1KCVL 2UZPA 4KK5C 4R8WL 4OW6A 1ET7A 5HJ3B 2VDNL 2WNWA 3OKOB 1XGRA 3CBRA 5FV1L 3MRHB 1BP3B 2YLHA 4NQDB 4F33B 3CFCL 3WKMH 1JGUL 4GUCA 5FYKD 3HRPA 3PDDA 4DZBB 4Y19A 1JNHA 4PWHA 1CGTA 4F2FA 1HL4A 5AKSA 5LDUA 3N3EA 1N59A 2FB4H 4UQIM 5ESVB 4Z95L 4PJBE 4Y4KC 3H85A 3VFTB 3LVEA 1I7RB 2BIIA 1UM6H 4LEOB 1FGNL 3PAYA 3TGXA 1NKOA 2K8QA 2OXHB 4YSOA 1GKOA 3KPSA 4L9LA 4TQIA 1RFDL 2GB2A 3G6JA 3HE6D 4H13C 1HE7A 3LS5H 5C08A 2JVUA 2IDTA 1QKZL 2E6PA 5EO9A 3V7AE 4APXB 2PR9A 1XH3A 3DUHA 4JL1A 4AYID 1OGSA 4JANA 3QJVB 4LPWA 1JPTH 2OZ4A 4K9EL 1OAYH 4JJHA 2V0AA 1G1KA 2XWBB 1DQVA 1MQKL 4PHZA 1XWVA 4RBPH 5LCVH 2YD6A 1G9NL 2VLMD 4MXWH 3BH9A 4PP2A 5C7ZA 4ZW5A 1CGVA 2HLEB 4IGBA 1I8IA 3L9EA 5CCKL 1B4JH 1NFDB 4OV6F 3BQUB 3QDJE 2D0HA 4PRPE 2ZWZA 4RMVA 5C0CB 3FB7B 4XN5A 1SLUA 4YPGA 2NXZD 4JPWH 1XR9A 3OXSA 4PREB 4UOZA 2IPUG 1DQKA 1KDJA 4OFIA 1BM7A 1JZ3A 2R0WL 1C5CH 3D85D 3BVTA 5DC4B 5AD0B 3GINA 1S7VA 1EANA 4D9LH 1M71B 3MO1A 4WCYH 4XBPA 3MLVH 1JHKL 3UZQB 4ZW6A 3QJHB 4PJ7E 4FXGC 1JWUA 2FJFA 3GMPA 1KELL 5H37G 1NSNH 1FO0B 4ODVH 1UXWA 4U1IA 3IKCA 1OGPA 4JY5H 1X5HA 2ADGB 2V7NA 3INUL 1PZ3A 3C12A 4XNAA 1ZEAL 5E9AA 5IBUB 2EADA 4UTAA 2BSCA 3FFDB 1QFUL 2V2TA 1J1XL 2EH7L 5T1KA 3O45B 1PF3A 2C3VB 2VQ4A 2X1WL 3B9KC 3O6FB 1QLRA 1UASA 3ARRA 1MI5B 4EAEA 4F8LA 1JV5A 3N5AA 1DVYA 2F8IA 3A0OA 1IEBB 2H7WA 2ENPA 1PKOA 3QDGB 4XAKE 4LEBA 5GGSY 3FOLB 3UTTE 4WW2C 3FN9A 4Y5XA 2FHCA 2Y36H 2DM3A 1CL7H 3BWSA 2R29H 4OZIE 4XPFL 3E38A 3OTTA 1OCZB 5KSVA 4OFQA 2WJ5A 4PEEA 2V2XA 1WSST 5DO2C 5T1LB 4LVOC 5D72L 1YUHA 3L1OL 1UM4H 3NJXA 1K5WA 2ENJA 1MNUH 1P9MC 1MW1A 5D70H 5DZPA 4PJXF 3SBQA 4ONHA 2FR4B 1R9FA 3HKFA 1FBIH 4TUJB 4EJ1C 3O6KH 4XPTH 4Z7OE 5KVGL 1UH3A 2YD1A 2ZX7A 3QIBC 4LL4A 3KW8A 2ITFA 2UY7B 5K9KA 4OLZH 1MWAA 1JD7A 3C60C 3VFGH 3HC2A 2JKTM 3CN1A 3HZ3A 5FYKH 3ECBA 4LSRL 1Q0XL 4NUMA 1RIVL 4IKJA 4A04A 4MA8L 3EH3B 4HK0A 2H0EA 1XD0A 2CK0H 4X8JA 2J56A 4WK4B 3WEMA 32C2B 3KDPB 4WO0A 2DLFL 2Z35A 3FQWB 3QDMD 1UJ3B 3B2VH 2NTSP 4HZLB 5J3HC 3RKDD 3RGVA 4I3SL 1KCSH 1OIOA 4CMHC 4LASH 4W9KC 5IVXB 2DYRB 2FJGB 1LILA 1LL1A 3JWDC 1RH8A 2NYYC 2BP0B 3KPTA 4W70A 4R96B 3B6SA 4I0PC 2DQJH 4Y2NA 4PR5A 3IGUA 4H1LA 5DVPA 1AZZC 4DZ8A 4D0BB 1BOGB 2KERA 3JQOB 1N6VA 4JHAL 4MNHA 1FNFA 5AVXB 4AT6A 3RP1A 4HK3N 1ZPUA 4LSTH 1ICTA 4TYUA 5FDYA 3FU6A 3D4GA 1ACXA 2P5WE 1BECA 1AQKL 5DZLA 4GSDL 3S96A 1TEFA 4UM9B 1V05A 4IOIA 4QTFA 2VN7A 4OF5A 3PHAA 4JM2F 3FT2A 4CVZA 4MCMA 2VLRA 2GAZA 5G5DA 3WNPA 2GI7A 1EXUB 2B1AH 2F7IA 5BRZA 5BO0D 1WCQA 3H9SB 1URLA 3V55A 1MJJA 3NZUA 3MLTA 1FYHB 4MMZA 5JQIB 5ABAA 2F68X 3VXSD 2XYBA 3T77A 3BH8A 3PYCA 2CDEB 2X87A 2DYPB 3KYAA 4N8PA 4YH6A 2F5BL 5E2UL 5FHAL 4HKBB 2C3HA 3BDYH 2R7EB 4R0LC 5EU7E 2FX8L 1Z5HA 3JV0A 7FABH 2JCCE 3EKCA 4I7ZC 5EA0H 2IGTA 3ETBF 4O2FA 4YXKH 1AXTH 5IEKB 4ZMOA 4P2QD 2FQDA 3M07A 2H6PA 3UPAA 4DEWA 2Z34A 3GIVA 4F93B 1ZLSH 3BEWB 3TJEH 4ANKA 4MJJA 1BZ8A 5C3LD 1I9JL 3P4LA 5D1ZB 5JHLH 3QXAA 1HILA 4K71C 4D0CB 3UTZB 1HE8A 3QIWD 4JDEA 4JZJA 3GHEH 5C07D 2Z9TA 4OD1L 4NUGH 1XT5A 1IFHH 3NPZB 1F4YH 1Z3GL 1AH1A 1KLFB 1XMWA 4G9FD 3A5VA 3BPLB 3WLBB 4LKXB 4HC1H 1QFWH 4WFFD 3MUY1 3LPGA 3VGAB 3DMMD 5I66A 1FHNA 3X12B 4DEUA 2WZ0A 3JT0A 3RTLA 4BFIB 5EEXA 3ULVL 2YUWA 2LU5A 3CFDB 1HHGA 2OPCA 2WBJD 3QNZB 3STLA 1T0NB 3QT2A 3L54A 1WQVT 5F44A 3P69A 4MQ7B 3TEYA 2IV8A 1CJYA 5AKVA 3C2AL 3L95B 4EDWH 3CVIL 5GS0L 1AGDB 5E23A 2QPEB 4N6QA 2CIIB 4ZOBA 1IE4A 3RU8H 2VL5A 2CU9A 1M1XB 4NNXB 4PCTA 1O9VA 2RFXA 3CC5B 1KLGA 2J57A 4O5LH 2VLJA 3V4VL 1RIUL 4OI7A 4F7KA 4P5RA 3EXJA 3FS9A 4N3TA 5E6IB 5B1AB 4PW9A 4AYFB 3DX4A 4MA1C 1NA8A 3DROA 4KXAA 4JHUA 3ULUE 2KT6A 4PB9H 5LBSL 1DUZB 1DJYA 5IWLC 5EF2A 2YC1B 3JVFC 4L3FA 2EDQA 4YE0A 4PG2C 4X6FB 3SCMA 3ZK0A 1CICC 1MHHA 1NFIB 3C09B 4L3ED 4F9PA 3GO1H 4FADA 3ZGIA 2VMEA 3NZ8A 1W8NA 3MXWH 4NQEA 1ZKAA 2YD5A 3AT0A 4GS7B 5KVDL 1NWOA 4FI8A 1ETJA 3U9PH 3PWJB 3VQLA 1GZPB 3CFMA 2K1MA 3FRPG 3QHFL 4ZUSA 5HHOB 3CK0H 3D9AL 4G2AA 1ORSB 1VDGA 3VGDA 3QPQD 3SO3C 5CJXA 3DURA 3LX9A 5JXEA 5KVFH 4XMWA 1U41A 4GEIA 3SDXF 4P2RB 4UI2A 5DXWA 4CC4C 5E9DA 3CDZA 3DHMA 2PXYA 3PHQB 3ZTJG 2ROXA 4OQ1A 1JDAA 4PMEA 3OQRA 5GRJL 3G5YA 2HG0A 3PWVB 1ZTXH 4EOWH 1CDUA 2DWEA 2WUBH 4MD4A 4MNQE 4MFHA 5C0BE 4NLHA 3OKEA 1NBVL 4M00A 1KENH 4PJ9B 5IQOA 1U8PB 1QOKA 2ICWB 1RZ7L 4QHKI 1M2VB 1A6ZB 4DNLA 4U1LB 4EKXA 1BPVA 3I75B 1I8UA 4OF0A 3V5HA 3UTQA 1PCXA 1DEDA 3ZHLA 1G9ML 2YPLE 5D1QE 3LZOA 2XXFA 4X9YA 1KTLA 2K3TA 2X40A 3NP3A 4YXLH 4PJFE 2PCFB 4BELD 4ECNA 5KSBF 1DLFH 1OGAA 1UA6H 5PCYA 2OP4H 3ZR5A 4AY0A 1KGYE 5F9OL 3GLEA 2AEWA 3RUGB 1EJOH 5FF6B 1HL8A 3OAZK 4FTVA 1QSVA 2FSEA 2FH6A 1H3PH 2DLIA 1DHKA 4OY9A 1WUZA 2Q3AA 4GSUA 3OSVA 3S4SG 4A6YH 5IKCB 3STBA 4K9JA 1NFKA 1IQDB 3PL6B 3CHPA 3DGGA 4P46C 4B9ZA 2CO2A 3OC8A 2ROYA 1UCTA 1DQML 2A38A 3GPSA 4NN6B 4W9HC 2WXPA 3KBHE 3LPOA 4IJ3B 3KR3H 2QVMA 4GRLC 5I0ZA 1VGKA 3V5KA 1G7JA 2XWRA 3JZ7A 4ETQB 3D39A 3TWCH 2FGWL 3VFNB 4ZBJA 3L4XA 4L1LA 2H32B 2E4TA 3BUIA 4PGZA 5KYUA 5C6PB 2Z31B 4UDTA 3EGSA 4AV4A 5HPOA 4M6OL 4X9BA 1A7QH 2HVKA 4P04A 4QOKE 2ALAA 3AVEA 5I19H 3TIDB 3LEXB 4WU5B 1IC0A 5IROD 3ZPDA 4B53A 1DCEA 2W0PA 4H88L 5KSAC 4KKRA 2NY5C 2HZHA 2X4RB 4N5ED 1CVSC 2HKAA 2VRAA 1JXKA 4K7PL 2ZOUA 4NQSB 1CLYH 2GT9B 4YBHA 3WG7B 4HDIB 4NSKA 2I25N 2CKNA 4FHJA 2X1QA 3HG3A 2WXIA 1E8ZA 3FULA 1FH5H 1TPXC 3EYFA 3NPSB 3MRJB 4Q89A 4I9WD 1V5JA 2LHAA 2BLFA 1F3JA 1PFCA 1QI5A 5F88A 1UWFA 2APFA 4WGKA 3KAAA 1WZAA 2AP2A 3II3A 3ZKMD 5AENA 4XVJL 3LQMA 4QWWD 5SWQA 1ZLVH 1N5YH 2UV3A 1GGTA 4UILL 3JYCA 1YCSA 3FSZA 2NR6C 5D7JA 1EJ6A 4LK4A 4CL7A 1SEBB 5I9QB 1IB5A 2XZAL 3TASA 4YHML 2A77L 2UY6A 5L6YH 4E9TA 4KHTL 4HJIA 1YNKL 1AIZA 5DT1H 2BIOA 4XPHL 4UOW1 2CIKA 3HA0A 1NIEA 4BUQA 2MHAB 3FQXA 3ZSSA 2X53A 4QXGL 4UAOB 1A6PA 2CA4A 5JQHC 3D09A 2VXUH 3RWJB 1OARL 1LK3L 3QUMB 5CFHA 2XN9B 3DXAA 3UTPD 4BZ1L 3LIZL 1AG0A 1FRGH 3LAFA 3LZFL 4OJFL 5DFVC 2R4RL 3F7VA 3OR7B 4AW7A 3P0GB 4Z7WF 3QUXD 1T04B 2WXRA 4LSVL 5L0QB 2Q7YA 4KKNA 4RETB 3MRCB 3ZR6A 1LWRA 1NOFA 3MHZA 1OAJA 5IMMB 1KN4H 2VLLA 4HCRH 4Z7QB 4FMKA 2EDBA 5DEJA 4KJQD 1ZHLA 4UBDD 1H3VA 1XQ4A 1ZANL 3WYRA 3LN4A 5DEFA 3K6IA 1JGLL 3HLAA 1CDYA 1GS7A 3MUGB 5MI0B 3O3EB 1UT2A 1S7WA 5DA0B 4UV7L 5EN3A 3N6YA 2WPGA 3OLEA 4FEMA 2EDXA 4LCUB 5I1CL 3C5XA 5CEZD 1E27B 3CZJA 5LNEA 2KYIA 3S3DB 4FCHA 1T7YA 2EVGA 2QQKL 4AQZA 4J3WA 3TFBA 2CMRH 2XIBA 3MRBB 2ZJSL 4A7QA 1I7ZB 3GBMH 2XICA 4OZHE 3NCCB 3S34H 2VLKE 4WU7A 5ITFA 2EUZA 3CQFA 3W2DH 5LGHH 2ZSVA 1C5BH 3SQOL 4RMRA 4LPYA 1JFQH 4G82A 4ZQKB 3H7LA 3B5TA 3VFVB 4GY4A 4X6CA 2B77A 3KEHA 4PB0L 5GJTH 3AXHA 3HC3L 2C4FU 4ZUUA 5KYNA 5MHSD 1X4ZA 4PJGF 3WU1A 3BN9D 5ETUA 3KCPA 1G7IB 3L3KB 2H3XC 1GGBH 2F58H 2ICEC 5HTSA 4XNZC 4YDNA 3KD4A 5IQ9A 1DFXA 3VSUA 5IOPA 5ENWA 5C0AD 5K59F 3SY0B 4PRIA 3D18A 3RAJL 4S1SL 1FIGL 3WD5H 5JZ7D 3LDBC 2D2CC 3HI6H 1P5VB 2LU4A 4UOJA 3ZDYE 1ULVA 3TTYA 4AZUA 5AAMA 4RMQA 1DVFB 4EI0A 2J88L 5JMOC 4CU6A 1A3RL 2PO6D 1WZLA 4MAYB 5HYJE 1INDL 4IOFD 2HJKB 5D7LD 4L8DA 3BUYA 1L9SA 3M7FB 3Q8CA 4KH2A 5HHNB 1LYQA 1SJEA 5K1VA 4KVCL 3VSTA 3QULB 2XX0A 1BX2A 3B5GA 4XHQA 3N42B 3R06B 3VXRD 2OMVA 2XPZA 4F8PA 4TOYL 1E3XA 1GPOL 5CWSA 2OM5A 4QNPE 2Y6SC 3K71A 1C12B 3U2JA 2WQ8A 3N40F 2DBLH 4HIQA 4Q6IC 5FECA 1CO1A 1YNLL 3EFFA 4Z7NF 4EZMA 5J12C 3ASWA 3CN4A 3BHBA 2VC2B 3DBSA 3VU1A 2I7SA 3MXVH 2R2BB 2CKBB 1L6XA 4Z23A 3C5ZB 5EO1B 1MAJA 3FTZA 3OPUA 3F7QA 1ECZA 4NJ9L 2PTTA 4ZXBD 2NNAA 1YMMB 1OV8A 2ATPA 3FO9B 4OD2A 4ODHL 3SOTA 3NJHA 4KRPB 5FYLE 3GMRB 4OAWB 3ZVVA 2WZPD 1RUKL 2CHZA 1T2JA 1QLEL 3GSVA 3ZE2F 1IBGL 5L2JA 43C9A 3EOAA 1B2WH 3BZ4A 5KW9L 3KZ8A 3EBHA 4F3FB 3QJFA 4U6TA 2X6MA 4NN7B 5DURB 4KKCD 2YK1L 3OAUL 5FUOH 3NCMA 1KBGL 5B39A 3ARBB 1N70A 4PJEA 4B9PA 2ZUQB 1IGYB 2WAQA 1V27A 1TVBA 2AQRA 4XP5L 4ELMF 4QJ4B 3HAEH 1YPZB 3FQNB 4BXSV 3E3QC 2LT9A 1CDGA 3BZ5A 1U58A 2YA2A 4IMLB 4G6JL 4JPQA 3CH8A 1R3KA 3KNBA 1JXJA 4QRPA 4DN4L 3AXLA 2I9LB 5EBMA 1FWXA 4JFFB 2A73A 4JO8A 1A6WL 2DEYX 3NAAH 4HLZG 4OF3A 2R9HC 5C8JA 5LB1A 2DMCA 3ET9F 1BJ8A 5F72S 4M61B 3GK8L 4PJIF 3VWJD 2D9CA 2PYED 5CEZH 5FA4B 3M46A 3WUWG 1DQQB 4N0YL 5I8CB 1VENA 2C3GA 1OZUA 3QJTB 4A6YA 1FJ1B 3M1BB 3NIGB 3JWNH 5A1AA 2R0LL 3U4AA 2N01B 2Q7AA 3GMOA 5EPMB 4PWFA 1T2QL 1I1RA 2RD0A 5B7MA 2DQIL 4U05A 5AAWC 2VAAA 1G7PB 4NN5B 3P3UA 1UT1A 1FZOA 3Q8EA 4FQIL 4J6RH 4PS8A 4OGQC 3UAFA 5FM5M 4K3JH 5AW4B 3V0HA 1LGVA 4YX2H 1CIUA 2ITEA 3H2WA 5E6RB 2VXQA 1TQUA 3FT9A 3MOBL 4YSPA 1PLAA 3ATBA 4G7VL 2JF1A 3U36A 3POCA 5B8CC 1G6RL 4XMUA 1UEYA 2JQMA 2BNRB 4MA3A 1CF8H 4NOFA 3OAYK 1PZAA 4PLNC 4LHUD 3U30C 3LV3A 5BVPH 2UZXB 1CTOA 5ISZD 3K8LA 2DJMA 2IVFC 1JL8A 3T4AA 3L3DA 1GMEA 4O4YH 3IJEB 1QSED 2SEBB 2QQNL 2IDUA 5ICYA 4GXUM 4HKXB 3O8XB 3GXTA 2WXJA 5EU6E 3RBGA 2R0KH 2OMUA 1N64H 4ABUA 1U8JB 1KPRA 1N9PA 2RHEA 3QI9A 4H26A 1WTLA 4X5LA 4CKVX 4LIQH 1F90L 1N5AB 1TMCB 5GRZA 3SYQA 2BH0A 4LLYA 1U21A 2BOBB 3GI9L 5EIIB 4N28A 1YY9D 1WWCA 4KJPC 2KDGA 1XBDA 5C0JB 1IBDA 1QI3A 1IJ9A 2Q8BH 4I1PA 3L7FA 4HEPA 1PBYA 3ZQ9A 4P3CH 1U36A 3M6DA 3E80A 3I84A 3L5XH 4G8GD 1IAKA 5E8NB 1WP6A 3IFOB 3S36L 3FN3A 1DSFH 2BSSA 3IU3B 2FL5A 2GW5A 3ZDXE 3KPLA 1LEGB 5A6MA 1NGQL 4GKSA 5D6DA 2W94A 3GS7A 3K4AA 3E8UL 5ID0B 5GZNC 2QPFA 3BJLA 2NSMA 1U3YA 2VUYA 3L3IB 5D1XA 3RWGA 3UPRA 1ZGLP 4FFZH 5DJ6B 3BEVB 3HZKB 4X99A 1FV1A 4Y9GA 3BKMH 3UBHA 1L0QA 1DBML 4AVJA 3GSNB 1QVOA 2QPSA 5EZLA 4BFOA 3PV6B 2P5ED 2VSDA 2J6WA 4PM1A 5D2LE 1UM5H 2IAND 2JKXA 3D0VA 3MRRA 3CV5A 5E51A 1DQTA 1FNHA 5EF0A 3EDJA 1EVTC 3DX6A 5HGGS 3X17A 4AI7A 1PNDA 1FL6A 2ZT9C 4F7EA 4ERSH 1KCUL 4N0UA 1KJ3L 3DX0A 3OKNA 4J8RA 2CCLA 4L05A 2IOIA 1AXSB 2CDGB 5I1KL 4L8SC 2DWDA 3S8WA 1ZIAA 3MBEA 1A4CA 4K3GA 2CUHA 3MV8E 1R24B 2CHXA 5CJQH 5L9DL 3GRWH 2UXVA 3ASNB 4QLRA 1CI5A 3KBPA 3QQ9C 1AAJA 4KDTC 1E4XI 3VI4E 2CE6A 1ZLWH 3VFRB 2YAOA 1WHOA 4R90H 1J8HA 2YAQA 2C4FT 1ASOA 4KI5C 2E9JA 5AKRA 1OT2A 2WTOA 3CDGB 3F12B 3LRSB 3PP3H 2RIKA 4QXWA 3EHBC 1ZVNA 2VRKA 3BFWA 4HH8A 3TCLA 1AC6A 3NVQA 4QJ5B 2ZAGA 8PAZA 3WY1A 1CFTA 1NGWB 3KYKH 5IMKB 3D3VB 4OZFH 1TTRA 4PLKC 3GXNA 5TE4H 1FVCA 1G1OA 4TTGA 1N0LA 3L7EA 4QGTA 3O4LB 4MSWA 4DGYH 2UWEA 4FG6C 2ZUXA 1FNGB 4HJGB 4JPSA 4OZGB 3IMUA 3DJ9A 5AZ2H 1T6WA 5EF1A 1YEGL 4XCFL 1EH9A 1V7NH 3Q13A 3VYPA 5H4ZA 4AZ8A 3K5SA 3U79A 5TDOB 2LE9A 1QYGL 2ERJB 5C0ND 4Q4EA 3TBYA 5EN2A 2RCSH 4RGNC 1KBWA 1ZVHA 1LO0H 2J8UE 4P4RA 1EEYA 2Q86B 3LKQB 3WE6A 4CJ1A 5T1JA 2P45B 1BYOA 5EZOH 3TZVB 2JWYA 2H2SD 1QSFE 1NCIA 3IBOA 3BGFB 5FO9B 3VE0B 4ZTOH 1XGRB 4X5RA 2MOGA 4YO0A 3S35X 1U6AL 4XAWH 1E6OL 2QFRA 2PN5A 1L5GA 5EUOA 4F57H 3TT1L 3BSHA 3VTAA 3WDJA 4WHCA 1I8AA 2XVBA 2IAAC 3OPZL 3WN5C 4XPGL 1WD9A 4Y19B 2VUOA 5HGDB 1JNHB 3HS8A 2NX5A 1KY6A 2KQMA 3QO0A 5DWUL 5TE7L 5I26A 2EO1A 1MFCH 4GKOA 4PQXA 2D8KA 3NUKA 5CJOL 3VQ2C 1MFUA 3BP6B 5IT2L 4F7PA 4OLEA 4O9HH 3NCXA 2CGZA 4ZSOB 4C4KT 3B7TA 4NWUL 4R83A 3MJ9H 4JPVH 4XCEB 3J2PA 1N7MH 3M1OA 3WIHH 3G6JB 3GRGA 3L48A 3RY6A 1KTJA 4R7LA 1WS7A 3PNRB 5C08B 1JNNL 1RHHA 5EO9B 5FPIA 5K69A 1RZGA 5KS9F 3NZHL 4J7RA 2C26A 3V0VB 1JRHL 4L5FL 4WEUD 1E5AA 4JANB 4QYAA 3M8OL 5C2UB 1XL6A 35C8H 2F2HA 4G80A 3WMQA 5KVDE 1EO5A 4IS6A 4OFVA 3BRGC 4H20H 2EVJA 1F00I 3ALWA 4OLYL 3LN9A 1FLTX 1I8IB 4XCCH 1NMBH 2VDPB 3BCFA 1DJXA 2W95A 3GBNL 4KXDA 5DJ8A 4WEMB 5DVMA 2FAUA 3IETA 4XX5A 4XZ4A 4YPGB 1EDYA 5ESQA 4BKLA 2BS71 3C5JB 1XR9B 1ZOXA 3OXSB 3H53A 1HL5A 3MLXL 4KK9D 4QKTA 5E5UB 4GJTB 2O6FA 2PCYA 1S7VB 3V4PB 1MUJA 4PJHA 4RFOH 1WEJL 4XBPB 3HAEA 3E2HB 1BYPA 3LOWA 5H8DA 1NC4D 3CHQA 4HK3J 1TQWA 3EDEA 2FJFB 2G0KA 3ARDB 1TZ8A 1DN2A 3A47A 2BM3A 1UXWB 4U1IB 3STZA 3LB6C 2WWNA 2V7NB 1MHEA 4HS8L 1TIUA 3MLYL 3WXWL 1U8IB 2QPDB 4XNDA 1A7PH 2GJ6E 2EO9A 2V2TB 3FUDA 1DTUA 25C8H 4ISVA 2JQZA 2AJXH 5LNDA 4LPXA 2A9DA 4HXBH 5J5EA 1Q72H 1QLRB 2FWUA 4Q4IA 3TBSB 5FGBA 1UWGH 1JV5B 1T83C 3EYOA 3ZUCA 3MV9B 3SD2A 3P40A 4NPYB 4AQEA 4RAUA 4TTDC 4B0MM 2D4FA 4Y5XB 3GSQA 5F0MB 1UATA 2DOCA 3ZN6A 3ECWA 3IRZA 4P23D 4XT1C 1TTBA 1QRNA 5F2FA 4OGAD 2J1XA 5CFAA 2OMZA 4TLSA 4URTB 3S37X 2BFVL 1NLDH 4PYHA 5KSVB 3O6FC 4Z76A 1EX0A 2H0JA 3LH9A 4M6MH 1MEXL 1JXDA 5C0DA 3BIAX 1XTLA 3FUNA 3OSKA 2EE2A 4OLVH 4PGDA 5CUSL 5CGBA 4EBQH 4FX5A 4I4WB 4YOKA 4ZUTA 1W2KT 4QRRA 4PJCA 1OY3B 2R1YB 2VNCA 4HJSA 4M5YH 2ZQKA 4PJDF 5L7XH 1SXBA 5BV7C 1KFGA 3BKCH 5F9AC 1MWAB 1J05A 3G6AA 4GIAA 3L5JA 3PWPA 3ECBB 1EGJL 2PR4H 5KYXB 1HT6A 4YHZL 4HK0B 5JIIA 4JFDE 4CSTA 3WY4A 3RWHA 1MLBB 1CDIA 2Z35B 3FK3A 5T1DL 1RI8A 2GJZA 4BH7A 3RGVB 4U7KA 1EHKB 1CE1H 1XGQB 3BIKB 5IBLD 1H6EA 2YAPA 4WK2B 4KNQA 2ZKHL 3ABZA 3P0VH 3KM1A 1YEDB 4RBPK 3BAYA 4QJ3B 4UT6A 1AR1C 3B6SB 1MFEH 3IXTB 5IIEA 4PR5B 1CTNA 2ZYRA 1ROCA 1O7SA 4DZ8B 5BOJA 4GQ9H 4KO6A 1QX1A 3FUIA 4UQ3B 5DK0A 4AT6B 2IAMC 1UJ3C 1QBLH 1BXUA 1IM3D 1KGUA 5DDHB 1F18A 4ZK8A 2WHVA 3HG1A 3S9DB 4YE4H 1MOEA 2FE0A 2FWSA 1ED3B 1FLRH 4LCYA 3S96B 3SYOA 4R7DA 5A6LA 3KLHC 3QFJB 1OZTG 2VDQB 1FCGA 1BFTA 1ZV2A 3J8F7 4Y16A 5CILH 4A2DA 4ZO8A 4G71B 4CUCA 1GCYA 2VLRB 4NC2B 4XO4A 1OALA 4RVBA 1OXYA 2VRQA 3W9DB 5BRZB 3V79C 4GRWB 4AH2B 4EDXA 2IPKA 2BP3A 2ZP9A 4KFZC 1MJJB 1ZA6A 4IRSC 3MLTB 4QTIH 2ZIDA 4X9HA 2OYLA 2MTAA 3T0EB 4BDVA 4U1SA 3VXUB 1U9KA 2CJUH 2ENSA 3T77B 4MTMA 3F62A 2WLLB 2VAJA 4YS4A 1OAXL 3VFMA 4KROB 5J13B 2X3AA 3ZRCC 4TRPL 3QDHA 3AY4C 5J6HA 2JJSC 3GJFK 5SWZE 3DNKA 1YNTA 3H2QA 4N2BA 3VA6A 1CLZL 1FFPB 4O2FB 3QDJD 4NQCA 2WYZA 4PRPD 4AMKL 3HNVL 3SGJC 2H6PB 1A64A 5DJXB 3TPUA 5KZCD 1KBBA 3MUZ1 5CMAA 2D7MA 4HFUL 4GKLA 5JIKA 3MCKB 5AVSB 5D5MF 4OCYH 4DN3L 4FFTA 1DZ0A 4JK0D 3ZKXC 1H9DA 4K94H 4AQ8A 5JW3H 5I75B 5FWRA 4JDEB 4JZJB 1WAAE 4C4UA 3MLRL 2FO1A 1KEMH 3IDGA 3BWZA 4YUEL 4A7GA 2WY3B 4FI7A 2BSTA 5I66B 1XEUA 1QWHA 1PD1A 5TTRA 5JW5A 5D1ZC 5ESAB 4MJIE 2DD8H 5DZAA 3STLB 4YBLB 2Y06L 4NCDA 3NSXA 3A22A 2FEDD 2BHYA 3Q1SL 4WJKB 2DQDL 1ERNA 1FGVL 1Z9NA 3WHE1 5A3ID 3VTMA 3BPLC 3QP3A 4X4MA 1ZS8B 4XAKD 3KYNA 1IFRA 3UTTD 2CRIA 3I50H 3VGAC 4NPJA 1JTTA 4LHUA 5ISZA 2RFXB 2NCMA 4IIZA 3KXFB 3QJSB 3NJGA 1NGZA 1NC2B 1NCHA 2A6JA 3KGSA 4ZAKD 1LDPH 4FFYH 1SRDA 5EEZA 3DROB 1BZOA 3DO7B 1GAFL 4UDUB 3SB3A 1WA0X 1ZWIB 2PNDA 3U46B 5I5JA 4POZC 4FCAA 2F7OA 4YHKH 4K23L 4YWGL 4PD4K 2MCMA 4RRPA 3NGBC 1S7UB 1MW0A 4LMQE 3CZGA 1JHLH 2Y25A 4LHQB 2J5LB 4N22A 4N2LA 5E1QA 1AQDA 3HB3D 2HRHA 5TQ0L 3D52A 3GXMA 3BI9X 3JTSA 3HHSA 4FZEH 4S1DD 4PJ8D 4XNQA 3SCMB 1MHHB 5IFAH 5JW4M 1OM3L 1EVUA 1P4UA 4P5MA 1CCZA 4XNBA 2VOTA 1JF1B 2R39A 1N8ZB 4OKDA 3L1FA 1MZZA 4BEIA 1BAFL 4OIBA 1FC2D 4NNPL 1GGIL 3WFEL 1BV8A 1T0PB 2IPTL 1N3NB 3DURB 3KPPB 1KYOK 1ACZA 2J20A 1QFPA 3DX7A 2BRQA 4MXVE 3TVMC 5E9DB 1ZT1A 3CDZB 5GGRB 3S88L 3D7PA 3I02A 1MFBL 2RGSA 4Y4HD 4KMQA 4M7KL 1SOXA 4GXUN 3IXAA 1ADQA 1TR7A 4MJ2A 1HCZA 1EIBA 3TH3T 3T0XA 3MFFB 2VDKL 4GS7C 4Z0XB 4PVLA 2HJLB 4AENA 2L0DA 2WJ7A 4X5QA 1UUNA 1XTMA 2XHNA 3H2PA 3PIQB 3K4DA 3BAIA 1WCBB 4MZ2A 3TBTA 3OKEB 3V0AC 2YWZA 2XTSA 2YUXA 2UX6A 1UKSA 2EDDA 5I0YA 3CNKA 4HEME 2P5WD 5C9KA 3B2DC 3ZTCC 1IGCL 4EPSA 4ZOAA 4JMXA 2AW2A 2N7BA 3WLWD 3UZEA 3V5HB 3UTQB 3CVHL 3WS3B 1IL1A 1SVBA 3LNGA 1T80A 5I1EL 1WHPA 3BAEL 2ZP8A 1ZA3B 1OGAB 2BDNL 2OW6A 5DCCA 4KFMA 4M4RA 4U1MB 5AW8B 3OB0K 3F7RA 3ELQA 4JG0L 1HINL 2ITCA 4PJ9C 4XODA 2YGQA 4ZFOB 5TH2A 3BRDA 3RZCD 1WFIA 1DDHA 4ZD3H 3ZY7A 2FSEB 4X98B 3JVGA 4NKIH 3MBXL 3RFZC 3W5MA 2DN7A 4OFPA 1A9EB 2MOQA 3DGGB 1TZIA 1ZGLA 1PG7L 4QHMB 5B4MC 5I8KH 1UENA 2R8SL 1HYSD 3QNFA 1J9CT 1USZA 5J6GA 1OF2A 4OGXL 5ILTH 2OZNA 1FVDA 2O6CA 3VFWA 2K78A 4YXHL 3FSAA 2E9WA 3BN3B 1NIFA 2A6KB 5B22A 5B3SB 3D39B 3PWLB 2HLAA 1CXLA 4WENB 3LH2L 1Q1JL 3L5WA 4Z5RA 4XP4L 1AD0A 4HJUA 5KYUB 2P28B 3PL6C 4UDTB 4ZX3A 2WXOA 4L23A 1J0ZA 4GMSH 4QDGA 4AE0A 1BIHA 3ZL4L 1RU9L 4AEEA 3UABA 1PG7W 5HP5A 3CLWA 1IVTA 4IJ3C 1Z3RA 4HETA 3IU4L 5DC2A 3WNLA 2COVD 3SO5A 5HHVL 4HUWB 1KF9B 5LWYH 5DMJB 1YC7A 4AXWA 3NCYP 5JXAL 4JM4H 4UT9L 4FQ1L 1E67A 2ZOLA 1T3FA 2GTZA 3GSUB 4KVNH 3ZT6A 5HI3D 5C86A 3OLDA 2MNWA 3DI2B 1MRFL 5GISL 1DBAH 4ABQA 2E74C 5MEQA 1A7OH 5DHVA 5F88B 1DQLL 5AB2A 5E6ZA 5I6XB 4KJYA 1PZ5A 2R23A 5IQ7H 4X6BB 4TUKL 5JIPA 1ZLDA 4JN1H 4ZZKA 4JQIH 2HJFA 3SJVA 1R34A 4RAVA 4YFLI 1ZLUH 5D7JB 3HZYA 2IWEA 2CO1A 2VL4A 1C1EH 4LBAA 4F92B 5KBLA 3BVDB 2UY6B 3CQPA 4AEIL 5EEUA 3MODL 3ULUD 3N41F 5DQDL 5EEVA 3NPSC 3HE6B 3SE9L 5IK3A 3ISWA 3LIZA 4MWFA 3GYRA 2HKFH 3UACA 4TPRL 2CPUA 3FQXB 1I75A 4OCRL 4JO3H 4X4KA 3TONA 3FB8A 1J8SA 2WQRA 2PPFA 3MPCA 3PPSA 4Y4KA 2CCWA 2LLLA 5I9QC 1NCBH 2A2QT 2VN5A 3HLKA 5SWSE 3CH1B 3T09A 2DLGA 4EKJA 4FKHA 1YEIL 4JFTA 4CA4A 4I85A 1HDMA 3AABA 1PY9A 1XCQB 1RPKA 5E5RB 3VB9A 3ARYA 3NEOA 5D71H 3CU1A 3IGKA 1TXKA 2UXTA 2YBRB 4BFGA 1M6OB 2NXZB 1AKJD 3QDAA 4R9HA 4BINA 5FHBH 3WKPA 2O30A 3CDCA 3H9YA 4XP6L 3QA3A 4DVBA 2CLZA 1S8DA 3U7WL 1ZHLB 4B7IA 4F24A 1NKRA 4FD0A 2CLRA 3JV4A 3HLAB 5AYUL 2VR8A 3ARFD 4MNQD 4X5WB 5C0BD 1S7WB 4HWBL 4UIKL 5L0QC 2AJ3A 1QNIA 1SLXA 4W9IC 2Y2YA 3FH5A 3H9HA 2Y5QA 4J3VA 4NUJA 5C1MB 2P49B 1OTUD 3KM2A 4W68A 1EHLL 1TZGH 4XB3A 2O5ZH 4ZPTA 3Q6GH 1K72A 4D9QE 5D1QD 4NZTH 5IMOB 4Q2ZB 4WSGA 3TV3H 4YIQB 4GUOA 1SOKA 3MQIA 1IC4L 3EYQD 5MI0C 1BLNB 3LQAC 4WU7B 3TPKA 2XTJE 3IAQA 4XH2A 3DHPA 1TKWA 5BUPA 2OR9L 3B2UD 2NQ3A 4X6CB 1MCNA 1RZ8A 3LSOA 5HDBB 5HD8D 3VFPA 3EYUL 1NCOA 3UC2A 1RMFH 3NG5A 1DN0A 3T2PA 1OT1A 1BZ9B 1JCVA 3K6DA 3NJVA 4GG8A 1LMKA 4CC1A 3EO0B 1NEZG 5E99H 2NDFA 3ZE0B 2MQCA 4PJAE 1TT6A 3GC3A 1AY1H 3B9KA 3K6FA 1R5VB 5AVWB 5IV2A 4K3EL 1NGPL 3T1FB 5AB9A 5IQ9B 4BKTC 5ENWB 3T04D 4TSBH 4JREB 4PRIB 3D18B 4M43L 2AXWA 2FATL 4WW2A 5IUCA 2ADJB 1XF3A 2UUDK 1EO8H 2X2UA 4NGHH 1RQ5A 4D3CH 2H1PL 2VO5A 2EXYD 4QRBA 1NUGA 1MCCA 1KGJA 3VFOA 1J1PH 3HHRB 4ZX4A 1BIIA 1MFMA 1CLOH 1FO0L 3ATDA 1E4XH 1FZMA 1SJEB 3EFDL 1BX2B 2CBMA 3QDMB 5IVOA 3Q6FB 3WDHA 4NRYA 1C8PA 1P9MA 5TE6L 5GSVB 2B1HH 3K71B 3MV7E 1UD6A 3Q3GB 1RUAL 3X1EA