3US1A

Structure of p63 dna binding domain in complex with a 22 base pair response element containing a two base pair "gc" spacer between half sites
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
194
structure length
193
Chain Sequence
SPSNTDYPGPHSFDVSFQQSSTKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein 63
publication title Pliable DNA Conformation of Response Elements Bound to Transcription Factor p63.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/dna
total genus 40
structure length 193
sequence length 194
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3us1A00
3WTXA 4IBYA 4KVPA 2X0VA 3D07A 4HJEA 1GZHA 3QYNA 3D0AA 4MZIA 3IGLA 1EANA 1E50A 4AGNA 2YBGA 3WU1A 3US0A 3Q01A 4IBZA 3VD2A 2BINA 1LJMA 1HJCA 4G83A 4LO9A 2WGXA 1YCSA 3D08A 1CMOA 2IOOA 3WTTA 5LGYA 5ABAA 2P52A 5BUAA 5G4NA 2GEQA 2J6WA 2J20A 5KBDA 1EAQA 2FEJA 3WTUA 3D09A 2BIMA 2IOMA 3EXLA 3Q05A 4L18A 2BIOA 1KZYA 5AOLA 3VD0A 5AB9A 5ECGA 2X0UA 3D06A 1UOLA 3ZMEA 2J21A 1HJBC 4AGMA 4IBQA 1TSRA 4G82A 3WTWA 3D05A 4AGLA 2J1XA 4IJTA 1HU8A 1EAOA 1TUPA 4IBUA 4IBWA 5LAPA 2MEJB 3QYMA 2ADYA 2BIPA 3Q06A 3KMDA 2XWRA 2J1YA 2XWCA 4IBSA 3WTVA 5AOKA 2H1LM 4MZRA 3US1A 4IBVA 1GZHC 1H9DA 4GUOA 1T4WA 4AGOA 2J1WA 5AOJA 2OCJA 2VUKA 4XR8C 3TS8A 1CO1A 2J1ZA 4GUQA 4QO1B 3VD1A 4AGPA 4LOEA 5AOIA 4L0YA 3WTYA 2AC0A 4LOFA 5AOMA 1IO4C 2X0WA 5G4OA 4A63A 3IGKA 5G4MA 5A7BA 3KZ8A 2PCXA 3WTSA 3EXJA 2AHIA 4IBTA 2BIQA 2RMNA 2ATAA 4L0ZA 2IOIA 4AGQA
chains in the Genus database with same CATH superfamily
1JXJA 4FFZA 3ZQWA 1FNGB 4YHKL 1GY2A 1N0XL 1KCBA 3CXDL 3AUVA 3FW6A 5DFVD 5JW5A 2V7HA 3MA7A 5DJZA 3TASA 1SUJA 4LSPH 2RR3A 2Y2TA 3KLQA 3OPZH 5EZLB 3SKJH 5K5YA 4FZ8H 3DJZA 3QCUL 3HHMA 3LPGA 1A6ZB 4U1LA 3FO9B 2HLFC 5ITBL 2FT6A 3R06B 5GS3A 2JXMB 3MVSA 5DJYA 2VE6B 2PLTA 1CWVA 1U4EA 1I9RL 2V9TA 3FUIA 3LCYA 4GAYB 4XBMA 2PYFB 3QI9A 2Q1EA 4D7BA 3QFJB 3IGFA 5EFIB 1J86A 3I6GB 5AZ2H 2CSPA 3JT0A 3BO8A 3WY2A 4X99B 1S3KL 4B9PA 1WZLA 5F7YC 5ICZB 4RLDA 5KVDL 1K5NB 1T66C 3GXDA 3NFPB 2P8PA 4WJKB 2Y1VA 1E5UI 2AK4A 3BD5A 1DVYA 4UILL 3DROA 4GRMB 2OQJB 4L1DA 4A38A 4BK5C 1OT1A 4WHCA 3HPJB 5D93B 5FHAL 1TZGL 3DTDA 3ILPB 2E74C 1VHPA 2BY2A 3IF1A 2MQ0A 3O3EB 3PDDA 3Q1SL 3E6FA 4NUQA 4QIRA 4DUWA 2L0DA 4ONGH 3FFCA 1BFVL 3KNBB 3CVBA 1QW8A 3E3QE 2GB2A 4JO1H 4M5YH 4NM8L 4AEHL 3MRPA 3TWCH 5C0CA 4CBPA 5IMKA 4EQ3A 2NTFA 1S9WB 2XFXB 4NQDE 3CQQA 4B9KC 4XVUC 3VGDA 1NCIA 1NFDF 1LK2A 1PCXA 1IC7H 1J5CA 2IPUG 2X10A 1HQRB 1PAZA 2EIJB 2VW7A 3I9GH 2VDOH 3HKZA 3L4TA 5ICXA 3SO3B 3TA3D 5EEZA 1PNDA 4OGYL 3FCBA 3IMVA 1KIQB 5HGBA 1H15B 2CHDA 3EOYG 4YHOL 5K9JH 2H2PD 5LO7A 1H6UA 1CLCA 3HHRB 2YAQA 5C0BE 3JWOL 2NNRA 2AAVA 5E1GA 4FE9A 4X6DB 3VTTA 1T1WA 1GYUA 4C57C 1NCHA 2DBJA 2PYEA 2WM0A 2PTUA 4TSBL 1F2XK 1XF2A 4NNXB 4ETQB 3TIEB 4WJ5A 5D7JB 5IBLC 9CGTA 3WNMA 2VRAA 1MY5A 3WTSA 2CLZA 3T1FA 1CXIA 5DZJA 1FG2B 4EIBA 4R4ND 3P9LA 1GTNA 1QVOB 4KVCL 1IGYB 1HHKB 1NCWL 2DD8H 3D25B 3G5ZA 1KTKE 3QIUC 4UU9A 5HHME 1FPTL 4MMYA 4I9WD 4KROB 3WHXB 1FNAA 4L8CA 3BYTA 4AGNA 4YZFE 1XFPA 2VDNB 4AYSA 1CFVH 2YPLA 2OMUA 1HSBB 2R69A 3V7AE 3WFHA 4B3VA 3PGCA 1JHLL 3R8QA 3ULVL 4AM0A 3KPNA 1KV3A 4YC2B 1WHPA 3BSGA 4Z7QF 3KL5A 4WHTB 3OKDB 4Q14A 1UATA 4QTHB 3OJDB 1CPUA 3UYOD 3DXAE 4OI8A 5EUOF 3ESOA 3L6FA 1KYUA 5A16A 3KDPB 2C9XA 4KRPC 3RILA 4H8WC 2K78A 1J9CT 1CD1B 2A74A 3CHSA 3ZKNC 2NY1B 2G75B 5JUEL 4KJQD 3TEYA 1HNFA 3X1BA 4NO0B 1QNIA 1AP2A 5DI8A 2CA4A 3GBDA 4ZX3A 8FABA 4HXAH 4LVHB 4J3VA 4OF3A 2NY6D 2Z8SA 3WG7B 2A6DA 3I9IA 1G7HB 5IW1A 4ZFOB 4N85A 3W57A 2HKHH 3NZ8A 3LKOA 4PH8A 4X9BA 4N2FA 4Y2DC 1DO6A 2PWGA 1I85A 1RJZA 2VQ1B 4QRRB 2WB7A 5BCAA 1KPRB 5JIMA 3EGSA 3FTWA 2YC1A 1YJDH 5AOZA 1EV2E 1PSKL 5EEWA 5EOCL 1HU8A 5CZKA 3GINA 1I7UA 2EC8A 2UWEF 3DHMA 4ZO8A 1IKOP 3BKYH 2H26A 4MNHB 4KVNH 1BVZA 5FX3A 3BAEH 1IC0A 1OT4A 5I26A 2B77A 3MOQA 4F7TA 3RDTD 2IMNA 2AK1L 1F11B 2X1OA 4P48A 3PFQA 4ZD3H 3EYOA 5ACLA 3PWLB 3FCTB 3N50A 1W0WB 3Q8FA 4FFWC 2EDQA 2NTSP 4WW2C 5I75C 4LVOC 3K7UA 1C08A 1LWRA 3MNVA 3EJRA 4OKVB 3B2UD 4FQCH 1OE1A 1IQDA 2DDQL 1E42A 3MX0B 2YD4A 2B1HL 2IFFH 2HWZH 3GSQA 5CNHA 5DJXB 5GRUL 4Q9QH 2HRGA 3KLLA 2ZOKB 3NPZB 2NXZD 4PRAB 3ULVF 5G4MA 4FJ6A 2OMZA 3QDJD 3K6DA 4DGVL 4OZGF 3LVEA 3LNDA 4DPBX 3DHUA 5F7AA 1KTDA 1KEGH 3A67L 4FZEH 4GQQA 4H8HA 4ERSH 7CGTA 3C5SA 3W2DL 4K5LA 1LD9B 3NG5A 1GL4B 1H8LA 4FQXB 3V55A 1HHJA 3QG7L 3S7GA 2SEBB 3SKNB 3SEPA 4F7KA 2YFOA 4LFHD 4AT6A 3X13A 3L3KA 4BK8A 4CKVX 3L2MA 1JZ5A 3PWVB 1S5IH 2V3EA 3H7BB 3D18A 3VFMB 3HS0C 4RQQB 2Q10A 4LSPL 4OZFA 2K3TA 3SKJL 3DO3A 3HG1B 3OPZL 4AWJC 3GMRB 4FZ8L 3SKOA 2E7LC 4XXDA 2NW2A 5KSAA 3NEEA 3TVMD 1IAIH 5DJ2A 1P7QB 3GB7A 3M88A 3QQXA 5EPMB 2AERT 1NLDL 2G3ZA 3QORD 4PJAA 4NQCD 5A6IA 1ODUA 3QIBC 2D31B 2WXFA 2VXQA 5FPIA 4NENA 5KVFE 1X5JA 4GINA 3MRKA 2H6OA 1AOHA 3IJHA 4U1KB 3DX6A 5AZ2L 2E4FA 3OHXA 4N28A 4QYOB 1H5BA 4BFBD 4Z3TA 1UXSB 5E9DB 5JPMC 3K72B 4ONHB 3FT2B 3QZOA 2Y7MA 1MCOH 5I73B 1E8XA 1J88A 2VLJE 3IM1A 3P4NB 4IKKA 4UV7H 3PP4H 4G7YL 1ZXKA 4QHNB 5EZLA 3AVEA 3GZQA 5I71B 4U7MA 1A6ZA 3AACA 1MG2C 4WVRA 1QBLH 2IV9A 4JZJA 2JXMA 1PLGH 4Z3HA 4DEUA 3MACH 2VE6A 3FAXA 4ONGL 2LAAA 1JZDC 5I6LA 4M5YL 4KXCA 4GAYA 3H4FA 4XI5C 3S8FB 2PYFA 3TWCL 3HRPA 1UGKA 3IMTA 4D3CH 4G5ZH 2RFXB 2XX1A 3IKKA 2D7QA 2EDMA 4C55A 1MRCH 5CF3A 4HIJB 3CFJB 1SY6L 2FTAA 4AH2B 4ZNCD 1IC7L 4PJHB 4OGXH 5ICZA 5L2KD 1CVRA 3I9GL 2P46B 4F2ME 2E9BA 3NFPA 4G6FD 4AKOA 4C56E 4JFFD 2CGRH 1M57B 5TQ2H 2GIXA 4L4JA 5K9JL 4FQPA 5GGQH 1BEXA 4GRMA 5AOIA 2OQJA 3V6FB 4RISH 4JZNB 4P23C 3HPJA 2YEVB 4OIIH 3ILPA 1HHHB 2J1KA 5DS2A 2F18A 4ALAH 3VGAB 3ISWA 3IGKA 3KNBA 2ISDA 5DMKB 1DP0A 1JF1A 2HRPH 1UD6A 1F8TH 1QBMH 1S9WA 1DBBL 2BIHA 2XFXA 4B95C 4HIHA 2KZWA 4HW6A 3VD5A 3DX8B 1G94A 1NMCB 2VLLB 5T5NF 1HQRA 4GBXC 5J57B 1UJ3C 4H2AA 1SXBA 3KAAA 4CC0A 3AM8C 1KIQA 1YMMB 1H15A 5JLZB 1NLBH 2DD8L 4BV1A 1VKXB 4NKIH 1BJ8A 4BKLB 1PEWA 2AJUH 5LBSA 1A0QH 5C0AB 2BY3A 4MCZA 4X6DA 5JXEC 3B2MA 2Q5BA 4KZCA 1BVNT 3DBXA 3L3GB 1XBRA 1CFVL 1IBHA 2VO8A 1TO5A 2YZ1A 3A21A 4YLBA 3WSQL 5HPMB 3BGFC 2Y6TE 3JXAA 1T83A 1RZGB 5D7JA 2JI3A 35C8H 4M02A 3D48R 5B7MA 4XOBA 5BQ7B 1FG2A 5I1GH 2ID5A 2COVD 1NDTA 2CKBB 1OAJA 1LWJA 1X3DA 5HYJD 5MEOB 2YUXA 5B38B 1QVOA 5GGRB 1IGYA 1NUFA 2C3WA 1HHKA 3ULUC 1HOEA 3D25A 1NOAA 3QDGE 4KV5F 3RQ3A 1U36A 1MFNA 4Y4HC 4B9ZA 3C12A 4HXAL 2XYCA 3MROB 4QKXB 3WHXA 3V4UH 3T65A 3VFGH 3ZN6A 2HKHL 5SWQB 1Z5YD 3MCG1 2J1XA 3NVQA 3RVWC 2Q3ZA 3VU1A 2E9WA 3B7TA 4O9HH 5L4MA 5J1SC 3FBKA 3OKDA 4QTHA 1IC5H 1YYMH 3U36A 3OJDA 1YJDL 1WAAE 3JT2A 4G9FE 2QPSA 3QZWG 1V55B 3AGVA 2Y72A 4LPCA 3QUZB 1S78D 1CD1A 4KI1A 4KVNL 5AW4B 4TF4A 1MRDH 1VA9A 5KS9F 3OAYH 2G75A 2CH8A 4YR6B 3TBTB 1IGCH 3JVFC 3PWPD 3PHAA 3NIGE 3CN2A 4M9PA 5E99H 1GZQB 3L08A 1AG6A 2WXIA 3ESUF 4EKXA 4LQFH 4ZFOA 5I6PA 3MXWH 4HLJA 2VL4A 3ROOB 3ZIYA 2LGNA 5BS0D 2IPTH 4L0YA 3C6LD 4PHZA 3BGMA 3B9AA 2VQ1A 4DSYA 4FQCL 4QRRA 3WKMH 1EVTC 1LQSR 3HE7C 1KPRA 1NINA 3GI8H 3RFZB 3NJNA 4PGDB 4BQBA 1RZJH 1F90H 3HBQA 2IFFL 3K71B 2HWZL 4Q9QL 2E8ZA 4I7ZC 3ZL4L 5A43C 4MNHA 4S11A 1CDYA 3HAEB 1R3KB 1CGSH 4IHOB 1RMFL 4JFYB 1F11A 1JPEA 4TM9A 4JDZB 3RVVC 4DP8X 2QEJA 4LFHG 3IWVA 2OJEA 3V52H 4JKPH 4P0DA 3PWLA 1W0WA 3DNKA 3IJ9A 2R0ZH 3QUGA 4FZEL 1KEGL 4ERSL 15C8H 1AQHA 1Y0LB 4U7KA 1T0NB 1B2WH 5ALBH 2QVTA 4WI6A 3ASOB 1I1YB 2VLKB 4GIPD 4M6NH 3EF4A 3MX0A 1KPUB 4XVJH 1S5IL 3DX1A 3PQYB 5DJXA 3D1MC 4ONFH 5LN4A 4NO3B 3MYZA 4H13C 4OFVA 2ESVB 2ZOKA 4MYPA 3QWRA 2DKSA 1Z9PA 1IAIL 2YSSB 2YZ8A 4AV0A 3GEFA 3KPMA 1M1XB 4NS0A 4R5VA 2MQGA 4O02B 3L1GA 4WV1C 2O6FA 5FF6B 2EDRA 3VX1A 3A6BH 1AH1A 1QFUH 4KQ0A 2MTAA 4PGJA 1BZDA 2EDKA 1LD9A 4FQXA 4ANVA 4QMEA 4WWKB 3QDAA 2SEBA 1NICA 3FHEA 3DMMC 2WKGA 3SKNA 1SOXA 4FG4A 4PCKA 4IMKA 3GXFA 3EHBD 3ATAA 3PWVA 2VZUA 4G7RB 4ZUWB 1MCOL 3VFMA 3QUYC 2YPVA 1BXXA 4JQVA 4RQQA 1D5RA 2QHLA 3PP4L 4LIQE 1U8MA 3HG1A 5BVPH 5MP6H 3GMRA 1QLRB 2B15A 3RPKA 3D33A 1P7QA 1WAEA 4OF7A 5EPMA 3O6MH 1WYJA 3V0HA 3KPRE 4N5ED 3KGRA 1ASQA 2C34A 3QR0A 3EDJA 4ZXBD 1JS4A 1YQ2A 3MACL 4X4ZA 1J8SA 4LCWB 3C5JB 5ADOH 1MCDA 1S5HB 2J4WH 4QRTB 4I0PC 4MAYA 3BAYA 4G5ZL 2AZUA 1OGAB 4QYOA 5IFAH 1MRCL 2XJLA 3S9DB 1UXSA 5E9DA 1QUNB 2YUWA 4OGXL 1KGUA 1IUZA 3FT2A 4ZW8A 2O72A 3DX7B 1BYPA 3P4NA 4JG9A 1P5VB 4QHNA 2PWDA 2CGRL 3L3OC 4YEFA 5B8CC 5TQ2L 5BOJA 2XPZA 5GGQL 5HHVH 2I60H 4UINH 2HLFD 4PLNC 4RISL 4LRNH 1J5OH 3WENA 4OIIL 3DHJA 1OCWH 2V37A 4ALAL 4IGBC 5AEAA 3BHBB 4WZ9A 1NCDH 1GSKA 4G11A 4Z18A 1U3HB 2HRPL 4E9LA 1F8TL 5DD1H 2W95A 1C5DB 1QBML 4CADA 4H20H 4PU2A 1E50A 4B9IA 3WEMA 4IRZA 4WUUE 3UPRB 1T66D 3CFJA 4YH6A 5DZVA 4AH2A 2VMCA 4PJHA 4K2UH 3NYKA 1N8ZB 2X9WA 1L0PA 1BF8A 4AW7A 3LXBA 1OAXH 4L37B 4HULB 1NLBL 3NEOA 5FO8B 1G9NH 4NKIL 4DN4H 1M3JA 4ZS7H 3V6FA 1I8IB 4AQOA 2AJUL 4JZNA 3I9PA 4GFXA 2ADGB 1HHHA 3L5XH 1CXLA 1XWVA 2QLYA 1KBKA 3UMNA 3WTUA 1L6PA 3RVUC 2ILLA 5DMKA 1EO8H 3FZUC 4S1DD 1VAHA 1V05A 4FLOA 3WS6C 1GC1C 1HT6A 5FR3A 1XH3B 1GGBH 1GOFA 4XVUD 3UMTA 2COQA 1CR9H 4OM1H 5EU4A 3SOTA 2GSIB 5IESL 3S2CA 2ZOTA 4HISA 3DX8A 5IT2H 1B9KA 35C8L 4OKDA 1Z3RA 4JLRB 4A66A 1JD9A 4EAEA 2BC4A 3T1WA 3UX9B 5ISZD 3NESA 5EF2A 4KK8D 4YSUA 4PD4K 2GI0A 5CZRA 1YMMA 3VXSB 5JLZA 1AGFB 5AL0A 2QTEA 3CN0A 4BKLA 4DT2A 2ARJB 2J5LC 1RUAH 4JN2B 1YECH 3PWNA 5C0AA 1RVFH 3QRGH 1XMEB 5F44A 1GKOA 2VQ4A 3V4UL 4AQEB 1PD0A 1QWNA 2I24N 2XWRA 2YMTA 3N55A 3L3GA 5E2JA 3K2MC 3OKLB 1GOHA 4LLVB 1QSEB 5IBLD 1BFOB 2AQ1A 3US1A 4O9HL 5HPMA 2X2HA 1CGUA 1IC5L 3O3UN 3HEIB 1RZGA 1S7RB 4FL4B 4UZUA 5DT1H 5LN8A 5L2JB 1E6JH 5BQ7A 3D8MA 4JM2F 5KEZA 5I8OH 5EF1A 1KN4H 3C2SA 2CKBA 4JGJA 1CFMA 4G8AC 1WT5A 3QIUD 1MRDL 3VSQA 3X14B 5GGRA 3TO2B 5B38A 5B3SB 5MEOA 5J13B 2R2CA 1E4KA 1IGCL 1B0WA 3IK2A 2PW1B 3NIGF 5AW8B 3QIWB 5E99L 4D0CA 3VO0A 1QR1B 3MROA 4ZTPH 4LQFL 4EXPX 3MXWL 5SWQA 2HMIC 3LPPA 1MN4A 3NEXA 2IPTL 1OQXA 4WI2A 2IADB 3WKML 3F5WB 4PJXF 4HAGA 5I1KH 1A02N 4MMXA 2FLBT 4DO6A 3GI8L 1AXIB 3CU7A 4I9XA 1F90L 2A4EA 2ZWSA 4YXKL 3ZT5A 4UAOB 3L4CA 4QHUB 1IBDA 1Y6KR 4ECNA 1N8OE 3QUZA 2FD6H 1GZHA 1XT5A 2N1TE 4QNPE 3AS2A 4P2RE 2UYLB 1DQJA 5IFJB 5J3HC 3IGLA 4NT6A 2Y7QA 1CGSL 3TBTA 5FOBB 3T0EB 3QDHA 5AAMA 1BVOA 1I7RB 3V52L 1QFHA 5SV3A 4E41D 2RAMA 1WWWX 4Y2DD 4YDLB 3WTTA 2V33A 1QSZA 2R0ZL 1PMYA 4LRIA 3GFUA 4LDLB 3K8KA 3DV6A 4RRPG 1B2WL 5ALBL 5C3TA 2F19H 2J20A 3BPNB 4M6NL 1KB9K 4PGDA 3ZYIA 4X5RA 2BHZA 4XVJL 1QHQA 1IAMA 1TEYA 2VIRB 2X6AA 3MRQA 2IXQB 4ONFL 3C2AH 4NKOB 3AG3B 3I3EA 3O0LA 4I3RL 1H3TA 3BLBA 3HAEA 3RURA 1G7JB 3WDJA 3GKWH 2C1PB 1R3KA 4IHOA 3ZDXB 2WKOA 2ZSWB 1U9KA 1OSPH 1UZGA 2YN5A 4JDTH 5LNGA 4JDZA 4NSKB 4AYFB 4FFWD 1BD2E 1G4RA 1M2VB 4DOHB 2CJTA 4ZDHB 5T3ZE 1CLOL 1JNNH 3IPFA 1QFUL 2H0FA 4AC4A 1NCNA 3G5VA 3MMEB 4JCWA 1Y0LA 2BS8A 5EC1B 1KGCD 5FFLA 5IJBC 3ZMNA 3ZHNA 4F80A 2BDNH 2VM3A 2ZUTA 5I0WA 3QYMA 1I1YA 4NP4L 2VLKA 4AYEC 2ZWLT 2XVKA 1KPUA 2ZUWA 2A74C 1CDHA 1FNFA 4G6AD 3UJTH 3WTVA 4PRIB 1AYRA 3PQYA 2OSWA 1FYTB 2BM3A 1AOZA 1QD0A 4NO3A 1ITBB 1D6VH 1P9MA 1UZ8A 1ZTXH 1HHIB 4J6IA 5MP6L 2ESVA 1TFHA 4BHUI 4GSQA 2BNRE 1AHMA 1TETH 3Q2NA 1M1XA 2BJMH 4KZ0A 3O6ML 4ISVB 4LHUD 2PO6C 1O7DE 1QKZH 4O02A 5FLVA 1P1ZB 1XIWA 5FF6A 4QO1B 5L4IA 2XV0A 2IJ0C 1JFQH 5ADOL 1D9KD 1T1ZB 3VNYA 2J4WL 1P4UA 4WWKA 1G87A 3P1VA 5J12B 3ZKXB 5IFAL 4X0KB 3EFOA 4OZIE 3R18A 3BX7C 1A64A 1A4AA 4ZUWA 3MBWB 4AYGA 5SWSD 3BE1H 5E6UB 1UUSA 3ARBB 3EZ8A 1QLRA 3JWDC 5HHVL 2HX9A 2I60L 3ZZSA 4UINL 3QIBD 4N20A 4E5XB 2OTPA 4LRNL 3WNJA 1PZ2A 2C3GA 3JQOB 4XC1H 2OP4H 3EOBB 4MJHA 3MV9E 3ES6A 4JRFA 3R7RA 4BFIB 1CGTA 5IR1B 1VB9A 3W39B 1FE8H 2MMXA 5E5MB 5IOKA 4LCWA 4XX1G 1NCDL 3C5JA 5AVWB 4KOBA 4POZD 2IG2H 5DD1L 1S5HA 3TFBA 4PN6A 4QRTA 3SO5A 3WIHL 4DZ8B 2ZOLB 1NWPA 4PWFA 4WUUA 4H20L 1OGAA 5CCGE 1OF2B 2H2SC 4KO9A 1LGVA 3VVVA 1QUNA 1O9VA 1CURA 4K2UL 3DX7A 12E8H 1MHHB 4LPYA 2EIZB 1P5VA 4NO5B 1L9RA 3KBPA 1SMDA 4V33A 3RL1B 4MB4A 1G9NL 5C07D 4DN4L 3WDIA 3LAFA 3CDGB 2CPUA 1WH0A 3L5XL 3IJEB 4LU5H 3OG6B 5AW5B 2P5WD 2V3DA 3U48A 3BHBA 1MJUH 2CDEB 4TL5A 3OR7B 1PG7H 1EO8L 1QRNB 2GJ6D 3CHOA 1XDTT 3GM0A 5DJ6A 1U3HA 2X9YA 4PG2C 3TH4T 3ZTDC 5LDSA 3IFPB 5KN5A 1CR9L 1DYZA 5CLXA 4F5CE 4YHIB 5F2FA 3L2NA 5I9QC 1JXKA 2B9AA 1EPFA 5IT2L 4Y4KB 4ZW5A 3UPRA 1QW9A 2GJPA 4JPIB 5K69A 1N8ZA 4OVVA 5AENA 5GRVK 1GHFH 3U2JA 4L37A 5IVXE 3U1SH 5FO8A 3IS1X 3VRLF 2ZCKH 3DI3B 4H8WH 4XNMB 1AZBA 1LLAA 4TUOB 4YLCA 1RUAL 4HUMB 2Q8BH 1YECL 2PP7A 4M5TA 2ADGA 1RVFL 2LFEA 2LLNA 3QRGL 1H9DA 3WJJC 5F7EH 1QYGH 4BZ2A 1GY1A 2IPKB 4UNVA 3BD4A 5EU7C 4L3AA 4MJJA 3GTTA 2OCJA 3P77A 2MPAH 2FRGP 2WNXA 1WIPA 1MHPH 3ARGA 5DT1L 5I5RA 1VFBA 1E6JL 3VYOA 4N8CL 4F2FA 2Q2EB 2WBXA 5GZOA 1KN4L 2A3TA 3T3PE 2F8OA 3PV6B 4JPWH 5D7KD 5FUZH 3KGSA 5I6OA 4N3UA 1J5IA 1MCPL 3VXSA 2WZAA 2AGJH 1LP9E 4GKZB 3QUKA 3MLZH 2ARJA 2JKRM 2CALA 3NJKA 4MJ5B 3ZE1E 5JXED 1GS6X 4JN2A 4X7TB 4IBTA 4ZTPL 3UPCA 1FH5H 4AQEA 3IAPA 3L3JB 1HYRC 1KSRA 1OZTG 2XWXA 1WF5A 1X5ZA 1VADB 1XSOA 3VXOB 2DQIH 4W4NA 3OKLA 4DWHA 3MSPA 5L4FA 4UTBA 3QB7C 5AYQA 1KG0B 1QSEA 1BFOA 2EO1A 2ADJA 5I1KL 2Q3XA 1NAMH 5MENE 1EFXB 1USZA 4JE4B 2VR9A 3GXIA 3B9EA 2CO1A 4YHYB 1DUZB 1TQBC 5L2JA 1ZEAH 2FD6L 2HX8A 3NCBB 3ULUD 2IMMA 5TE4L 2NX5D 1AZVA 3TO2A 3B8YA 5DD5H 3MRNB 3MLSH 5DO2D 3QIWA 1NAKH 1A25A 1GSMA 1JVOA 3WY3A 1KJ3H 1OCOB 2JNZA 2PNDA 2YD9A 4AVHA 4Z3JA 3RWDB 4NUJB 5KJ4A 1OB1A 1G7MB 1IB5A 2BCKB 3J7HA 5I0DA 3QJHA 4PY7B 2AANA 3UABA 1XL4A 2IADA 5C9JB 2WYHA 4BH8B 4UIKH 2F19L 3AS0A 3F5WA 2GJZA 4K9EH 1LO5B 4X9IA 5J56B 1MF2H 1A2YB 2Q7AA 5CR1A 5M95B 2VN4A 2RJMA 1P6WA 3ZK0A 4O00A 4QHUA 4G70B 3MHZA 4B50A 2EUWA 2J21A 1CD0A 4MXVE 2FQDA 1O0VA 3C2AL 3CDYA 4HLEA 4ACTA 3RGBA 4Q74A 3FO1B 3PFUA 1T2JA 4PJ9C 2QPFA 5KYXB 2UYLA 5IFJA 5D2NB 5E5UB 4FOMA 3GKWL 1YA5A 5F0PB 5FOBA 4JL1A 1E5ZA 4AGLA 5LUMA 3T0EA 3KLAA 4GJTB 1OSPL 2CR6A 4JDTL 2GKIA 5DHYA 4JJ5B 4FQLH 1U8NB 1YC8A 4PV1C 2QZ5A 4QXGH 4Y19D 2XZQH 4M48H 2WXKA 1JNNL 4UOJA 4CGTA 2E59A 3MDJA 2J1YA 1UQSB 3A4EA 1JZEA 1YMHB 3D9AH 4ZS6C 2BY1A 3S36X 1F3RB 3O2VH 3HE7D 3LHPH 5A2BA 4U1SB 4TQEH 3QZPA 2WY3B 2XN9E 2BDNL 4XAKD 3OMAB 5K9QI 2YAMA 4MWFB 3UJTL 4LHUG 5D5MF 1Z0MA 1NFDB 5BRZB 2IXQA 5C71A 1T21B 2V0AA 1D6VL 4NKOA 1QABA 1ZTXL 4PLJC 5HI3C 2F5AH 3RVVD 4AM0Q 1G7JA 2C1PA 3S3SA 1TETL 4YDIH 3JYBA 1HXKA 2BJML 2ZSWA 3N40P 3CFDB 4UF7C 2IEPA 4NSKA 1QKZL 4OLZL 4AYFA 4FHKA 2YK1H 4A7TA 1G5AA 1M2VA 1G0XA 5HSFA 5EB9A 4ZDHA 2BY0A 5AAWA 4KUCF 4B41A 4YC2C 5MHSD 2DMKA 4MRCA 1JFQL 4PGZA 3MMEA 1TVDA 5JW4M 5EC1A 4F9LA 4A2DA 2MQ3A 2VXSH 2AS5M 1OTUC 5ADPH 4QTIH 2YWZA 5E8EA 1XH0A 4HQQH 4PRIA 1O9ZA 4V1DE 3BE1L 1SDDB 1HHIA 4MJID 4EI0A 4LVHC 1VZIA 4HMCA 1BZQK 1R24B 3EJPA 4ISVA 5FW7A 1N64H 3ZHFA 1YDPB 2OP4L 1TTBA 3EJSA 1P1ZA 3FONB 5AVZB 1KMGA 1U58B 1RY7B 1F4XH 4QO1A 4F2MB 2HTKC 2AJYH 3GDCA 1FE8L 1A47A 3ZT6A 4OIBA 1PX3A 2M1KA 3BAJA 1T1ZA 4FXTA 3L7FB 4J6RH 1NA8A 3E9UA 4Z7QB 3RA7H 4X0KA 4GO8A 3QUYD 2YFNA 3WOVA 5DVOA 5EUOB 3BVWA 4B53A 3SDCB 3MBWA 1IAKB 4H40A 12E8L 4RSVA 2EDEA 5AOLA 3ARBA 2V2TB 2XXCB 3U0TB 4OLXH 4PPTA 4CGUB 1DEEB 3FN0H 4MQTB 2Y2YA 1ORSB 4E5XA 4Z78B 5I8KH 2EIDA 2UXFA 4LU5L 1ITCA 3O3BB 1Z1WA 4BFIA 5L8LB 5IR1A 2K45A 1N5AA 4IOIB 1MJUL 4I0PD 5E5MA 3W39A 4JAMB 1PG7L 4E9XA 3RTQB 4R0LC 3LNHA 3QDMD 5GRYA 2WNKA 4F5CA 2ZOLA 3W3BA 4YE4H 2JIXD 4AG4H 3CZFB 2QBWA 3FB7B 3FSAA 1OF2A 4AV4A 3MRHA 3FKUS 4WHDA 2EIZA 1GHFL 1VDGA 2UWEB 2DEXX 1E65A 2W38A 1E7UA 4NO5A 1ED3B 5BZWB 5I1EH 3U1SL 3RL1A 2I9LB 3QUHA 2ZCKL 4H8WL 1FC1A 2E86A 3V6OA 3W82A 3CDGA 2YMXH 3K1DA 2Q8BL 3KS0H 1JMXA 2VUKA 3BP4B 4ODUB 4ZTOH 4RFEB 1FVCB 4N25A 4EBQH 3ULUH 5F7EL 4FQXC 1JFHA 5FEBA 1QRNA 4UYPA 3FN9A 2G0LA 3MRRA 4M29A 1JGIA 1WUZA 2MPAL 3H3PH 3PF2A 3PP3K 4PHXA 5F7KC 1MHPL 4EKJA 4YHIA 4G3YH 2VSCA 3U4KA 2DL9A 4JQVC 4Y4KA 5KSUB 1JF6A 1HI6B 4L4VE 1FGNH 4NOFA 3HS8A 4FEMA 4JPIA 3Q0HA 3I50H 3P2TA 4HUKB 4JPWL 5FUZL 3MREB 1NIAA 3FF7A 1KY7A 2VUYA 3U7WL 1BVKB 2AGJL 2NYKA 4HCRA 4J3TA 4XNMA 4ZOEA 3ZE1F 2WQXA 3MLZL 3VFWB 5I23A 2EH7H 1R5IB 3RVUD 4BRVA 4QGTA 2GBUA 4UTAA 5KYWB 1FH5L 1OGSA 5E70A 3FZUD 3VGEA 2IANB 4OZGB 4ZMQA 3WU1A 3PHOB 2ICES 3T4YB 2DQIL 5EIIB 3G5WA 3OJMB 2ETWA 5BW7A 4R8WH 4WK2B 4YVNA 3C60B 1XZWA 4X0NA 1ASOA 5D7EA 2WVUA 2ALAA 1NAML 3N43F 1J05B 1L4IA 2KDGA 4N24A 1U0QA 5HI5C 5I73C 3RP1A 1DQQB 1ZEAL 2XYBA 3QFDB 4ELMF 5I71C 3WO3B 4ZSOB 1FZKB 4YSTA 4E68A 1CXFA 1JHKH 1UKQA 3PV6A 3PXJA 2VKXA 3MBXH 3RPBA 5DD5L 2M8XA 3MLSL 5FV2A 1NAKL 4GKZA 4IOSD 3D7PA 2Y1YA 1FAIL 4MJ5A 1IM9A 1KJ3L 3QI9D 3MLXH 4X7TA 4Y1SA 4Z95H 1TTUA 5K1NA 4HSCX 3VXOA 2F7QA 2IO5A 1QTYT 3QJFB 2DQJH 2Z7WA 3NCXA 4PRPE 1KG0A 3AMKA 3OKYA 3NIDE 4K9EL 1GMIA 1EFXA 1MF2L 3LH8A 2AK4D 2MNUA 1DANU 4QAMB 3UTPE 1BQRA 2LU7A 3LEXB 4KKNA 2X2UA 4XE0A 3WTWA 1DUZA 1KIUA 2MHAA 4K23H 4OF0A 4MXVF 4RFNB 1CIDA 4A6YB 2QHRH 2YA2A 1E5BA 4G6JH 3LPOA 1BW8A 2RB8A 4G6KH 1AHWA 2WK2A 3GQFA 3WFCH 4E9VA 5DWUH 3FFCD 2GABA 4IBSA 4G7VH 2R39A 3VGAC 4FQLL 4TQIA 4OUOA 2ZAHA 2X70A 4QXGL 2XZQL 4M48L 4P57A 3RWDA 4NUJA 3SDXF 3GWJA 4UT6A 3S5YA 1G7MA 2BCKA 2XETA 3D9AL 4LVNC 3CIAA 3O2VL 3LHPL 2QJDA 3GTVA 4PY7A 4TQEL 3HLKA 3SGKA 3P0VH 1J8HE 2VDMB 1KTBA 1AANA 1LO5A 4G9DA 1NMCC 5H4YA 1A2YA 1NC2D 3NCYP 4NQDB 3FU3A 2VWEC 4KI5D 3IFNH 1HEHC 1E9OA 1KTLB 5J11B 2KQNA 2AC0A 1IJ9A 1L9MA 3BP5B 3FO1A 5D1ZA 5KYXA 2F5AL 5AB1A 4L4TD 2PYED 3D5OF 1TG8A 5JHBA 2J8UE 2CBMA 4YDIL 3SOBH 3B9VA 4JJ5A 1YNTF 2YK1L 1U8NA 1CTOA 4OD3H 3L54A 1UQSA 1YMHA 3DGCR 4N2EA 5HDQH 2VR6A 3QULB 2WBJB 2WIMA 2VXSL 1T5WB 4M3HA 5ADPL 4QTIL 1P1VA 2ICWJ 2RIKA 1R3HB 1TYJA 3MNMA 4MWFA 1IBFA 1CJYA 5I30H 1DBJH 4KXAA 4Z8FH 4J4PC 5GQBA 4Y2NA 5DK3A 4XN9A 3G7TA 1MVYA 1T21A 4AYMC 2QMKA 1JNHB 1RK1B 1YCSA 4GT7A 1CMOA 1IE5A 3CFDA 3NZUA 1N64L 4E42A 5E4EB 4KXZI 1MFEH 4KRNA 1HWWA 3BCFA 1F4XL 5K33A 2AJ3B 2AJYL 2P5EE 3GC3A 2WCPA 5B1BB 1LE5B 2AQ2A 1L9TA 3LZLA 3L7EA 4ILDA 3NABH 2H9GA 3U2IA 4J6RL 2GVYA 2IALB 3UTZB 3Q3GA 4YAQB 1GXEA 3CX5J 3L5HA 3B2VH 4NPYB 5E08H 4M5SA 2Z8WC 4HALA 4MKMA 2GTQA 2NY5C 3GS0A 1DJIA 2O6DA 3LQAH 2FQGA 1SDDA 3EGDB 1W6WA 4OLXL 3VXNA 4DKFH 3RE0A 3TF7C 3MV8E 3FN0L 1GGUA 4NUMA 1R24A 5I8KL 4IKLA 1YDPA 2CO2A 2X1WL 4LRIC 5BRQA 1FQ9C 3FONA 1U58A 1F6AA 3PAUA 3CXHJ 3WMPA 2AVFA 1J8KA 1I3UA 1SNRA 1UOWA 5EEXA 3RFZC 4Y4FB 4OGAD 2JQMA 4TMPA 4ELKB 1KCVL 5TDNB 4YE4L 1L3NA 3PL6B 4AG4L 2O5YH 2N3JA 3LTVA 2J57A 3TT3H 4ADJA 1IE4A 5EUOA 4YSRA 1OAYL 2NCMA 4MXQC 3SDCA 5HHPB 1IAKA 4YOKA 4M3KB 3S2AA 2DWEB 2UZXB 1I9IH 3JV6A 3WUWB 2ZPKL 3B7SA 4HFUH 3U0TA 4QOKE 5I1EL 2FE0A 3LZFH 1DJWA 4OCWH 5IHWA 1IZKA 4BBWA 1BQ5A 5C70A 5KS9B 1DEEA 2YMXL 1EXHA 3RYMA 4Z78A 4KKCC 1EAJA 1WZMA 2CXKA 4ZTOL 3SPCA 5KYNA 2EC9U 2ZQKA 3EBAA 4DP9X 4IOIA 4JAMA 2XACC 4PWEA 3RTQA 2V9RA 4NRYB 3H3PL 3TM6A 4B96A 5AW0B 3KPLB 1TJGH 1KJMB 3NACH 4PGBB 4PVNA 4JQIH 3L48A 3FB7A 4L4VA 4ZW7A 1FGNL 4OZ4B 5EZJB 1CXEA 4LCYB 4Z77A 3I50L 2CRZA 2UWEA 1FFQA 2B2XH 3BW9B 3CZNA 1KTCA 1ED3A 1HTYA 5BZWA 2I9LA 2G4GA 1FO0B 4IKJA 4Z76B 3NSFA 1U8PB 4DZBB 2EH7L 1Q94A 4ODUA 1ZGLB 3BP4A 2NR6A 4RFEA 2VN3A 1B90A 3DJ9A 3IXTA 2BS71 5DJCB 1QSFA 2Q3AA 5F7NC 1S9KC 2WLMA 4R8WL 4NJ9H 3I75B 3MLVH 1X44A 4N0UE 3M6DA 4DP1X 3NDZE 4GLRH 3GLAA 5KSAD 2BZ7A 3ZSSA 5KSUA 1HI6A 1J1PH 3MRGB 3QW9A 5E1QA 1JP5A 2WJ5A 1J7VR 1JHKL 2BNQB 3MREA 2GY5A 2F54E 3MBXL 3MLRH 4QR7A 4K3GA 1BVKA 3BH8B 1SN2A 2VJXA 3MLXL 1R5IA 1VEMA 2X44D 4M93B 1UACH 4Z95L 3ZIMA 4B60A 1JGLH 4DTGH 5KYWA 2IWKA 1TNMA 2IANA 1JWSA 3BVVA 1D5IH 3FT3B 3BYYA 3T4YA 5JIPA 3WHE1 2DQJL 4HUWB 1J11A 5E2VH 4KZDH 5AVRB 3C60A 5KUMA 3MCLH 3KLSA 4GAJH 4HKBB 4X5XB 2C5DC 1QPXA 1Q38A 2BVEA 3RHWK 1BQHA 1DQQA 1XXFC 1XXDC 4K23L 3MUY1 3QFDA 2MKWA 4XMLL 1A5FH 4ZSOA 1FZKA 2QHRL 4OUUB 1ZVSA 4G6JL 1NDGA 4Z7AA 3WFCL 4X4MA 5AG8A 2E3VA 5DWUL 4HA1A 3NIFF 4NI3A 3P3TA 1L6XA 4G7VL 3KPTA 4JRYE 3C8HA 1MCWW 4PJ5D 1S2EA 3QFJD 2OJ1A 3NAAH 2B1AH 3ABMB 1U3HC 3VD1A 4Y5VC 3MRLA 1WBXB 1MJ7H 1FDLH 3QJFA 4X8JA 3O41B 3EOTH 3P0VL 1HWHB 3WL9B 2RBLA 1A4KB 2BP5M 1TJHH 4ZFGH 4DNLA 3L1FA 4KTDL 1F4WH 2HH0L 3ZDZE 2X4QB 3IFNL 2F1EA 3CC5B 5E6YA 5D55A 3DIFB 3HG4A 2JJSA 3BZDA 4A6YA 2OCCB 5FYLD 4F2EA 5KVEH 4M1CD 4B9FA 4H4NA 3MV7B 3ZTNH 4ZFFB 4DGYH 3ZKMD 4RMSA 3D4ZA 2Q7YB 3SOBL 4AYBA 2X1XR 2WSPA 4PJ7F 3ARFA 4A39A 3GRGA 3UGUA 5HYSB 2Z91B 3MLWH 4OD3L 5KOMC 5EBLB 5E6SB 4PWIA 5HDQL 2VN5A 5FGBC 2HRLA 4FKEA 3IU3B 4L8DB 1B4JH 3C09C 1RULH 4JFZH 2XTJE 1FL5A 3I6LE 5I30L 1DBJL 2YQ2A 3AZUA 3KGTA 5L0QB 4Z8FL 1KTLA 1NCAH 3BP5A 1JF5A 5E5LA 3QZLA 1G7IB 3GIVB 5E2UH 3ECBB 4L1HA 1OHQA 3WE6A 1HL8A 1BFSA 2EDYA 2W8CA 4PAZA 1MFEL 3QEQE 2P5EA 4ZS6D 2OJZH 3JWDH 5C08E 3L4ZA 2K4WA 5D7JD 3NABL 3V10A 3QULA 2CU9A 2WBJA 1ZLVK 4XRCB 5E00B 4BFNA 1OAKH 2D3JA 4AIOA 1R3HA 3HNTH 3B2VL 2FYVA 5FB8B 3LOWA 2FJSA 1JZ8A 3S97C 5E08L 3MQIA 4JRXA 1CL7I 1RLBA 2UZYB 3BLPX 4L9LC 4PJGE 3WIIL 2F8IA 3LQAL 4KROD 5FK9B 1EZUA 1K4DB 3SQBB 1CICA 1JNHA 4XN7A 2EEXA 4JG5A 3VM5A 4DKFL 3ZTJG 3QDGB 5EWIH 4NWTH 4RMTA 1QHPA 5EC2A 4PIBA 2AJ3A 1XMWA 2ZX8A 3KPSB 1EVUA 1TDQA 4W4OA 2XWDA 4PS7A 3TZVC 5J1AB 3ARYA 2WJ7A 3N85H 2EVFA 1EHXA 1UZ6F 3AG4B 2IALA 1Y18B 3SJVD 4YAQA 4UAOC 4KC3B 3IDIB 1XEDA 5DO8A 1QBBA 1AXSB 2NY1D 2O5YL 2WYIA 4GMTH 4B9YA 1YPZE 3VGBA 1AQMA 1JTOA 3TT3L 4NO0D 1KYAA 3AABA 3IE9A 4NBXB 3VQMA 3KR3L 3QR1A 4B7LA 3LN5B 5E24E 4JM2B 4I8DA 4HFUL 3LZFL 5LLIC 5F9AC 1F56A 4GXFA 2XQ0A 2EEAA 4YDLC 2HTKD 2BWIA 3NIGB 4XVTH 3DECA 4J7RA 3AGWA 4QRRD 1BZ9B 4ZOAA 5GSRB 1F97A 1HSAB 3L1OH 1QTSA 2O1AA 3NJGA 1F3JB 3ZGIA 4CC1A 3AITA 3BPNC 1RV6X 5DC9B 1MW0A 4Y4FA 5EBWB 3M45A 2WWKO 3NACL 4JFXB 1SDYA 2NZIA 4PJXB 2JSFA 1G0DA 3FB5A 4NQVB 5HHPA 4MS8C 4M1DH 1EEQA 4QRQA 2DWEA 2UZXA 1QA9B 2B2XL 3HG2A 4MCNA 3N5AA 3WUWA 3B8SA 3EH1A 3FS9A 3QGVA 4F1ZA 3HI1B 2BP3A 3C5ZB 5KS9A 2GI7A 2AEQH 3NRFA 5EO1B 2ZYRA 3WKYA 3FJTA 3FUJA 1KLGB 3UO8B 5SWZE 3P3UA 4F9LC 2WZ6A 1O6VA 1F00I 1IBYA 5F88B 1D6EB 5C09E 1CB4A 4NRYA 1S7QB 4NJ9L 2EIEA 3MLVL 1FNLA 3KPLA 4K3HA 4HF5H 2PPEA 2XIDA 2EDXA 4PGBA 1UURA 2FH6A 3S3BB 1A6VL 4Z7NF 3QWRD 4LLYB 4DCQB 4OZ4A 1J1PL 1VGKB 5EZJA 4XMPH 2BWDA 1F6LL 1PYWB 1YLBB 4X98A 3WFZA 2XU9A 4F9PC 3BW9A 3MLRL 2YRPA 1AGEB 4HHAB 4TNWF 2D7OA 5DGRA 3WJLA 2AJSH 4Z76A 3P9WB 3PLYA 4DZBA 4LGSB 1C16B 4D9QE 4FQXD 1UACL 1ZGLA 3IDMB 1JGLL 5DU7A 3IDJB 2C3VB 4ZYKB 4G6MH 4JANB 4L5FH 5FYLH 1D5IL 3TH3T 5DJCA 3D39E 5DZNA 3ULSB 4BXVA 1LTXA 5E2VL 4KZDL 5GRVL 3SE4A 3MCLL 3I75A 3KG5A 3HG1D 2H5UA 1K5WA 2EUVA 2OTWB 1Z9OA 3ARBC 1P7QD 1YEWA 3MRGA 4X6FB 3ZE0F 5F96H 3EOAB 1A5FL 1LWHA 2B5IC 2O30A 1LEGB 4XP1H 2DQGH 4PJBF 5FS5A 3PP3H 3BH8A 4MCMA 1KCUH 4HT1H 4PJFE 3VAEA 3PJSB 3EG9B 1U2HA 4Y1TA 4WTZA 3NAAL 2B1AL 4WFFD 3FT3A 1G7PB 4RDQF 4PRHE 1NEUA 4OD1H 1MJ7L 5E9DD 3EOTL 5E4OA 3E0GA 4HUWA 1QWUA 2Y5TB 5HI5D 5KWYC 2V8LA 4HKBA 4X5XA 1KB5L 4ZFGL 5INCB 2H6UA 4NQSB 3CBJB 1F4WL 1GS7A 3U46B 4RGNB 4F7PB 4JG0H 5IOPB 4OUUA 3V6OC 1AFVH 3VQ2C 5DHVH 2Z34A 3VQLA 2YN3A 1JYNA 2P80A 1INEH 1MCJA 3ZTNL 4DGYL 1Y07A 3ULAB 1UM5H 3EDFA 3IBOA 3T6ZA 2PCFB 4HUNB 4XN1A 4JE0A 3MLWL 4GS7B 3RY5A 5EO0B 1WBXA 5HYEA 3NQKA 2J8OA 3L4YA 3O41A 2YKKA 2JKWA 2HLAB 1BXVA 1JRHH 1EH9A 5H37H 4Y4KC 3WL9A 1HHGB 1A4KA 1B4JL 1RULL 4JFZL 1B4TA 1NSNH 4M62H 3W56A 2X4QA 4GG8B 3CC5A 1F4HA 3DIFA 2VAJA 1JRHI 4L0PB 1EHKB 2W9EH 3WS3B 4A2GA 5E2UL 2YGOA 2OSYA 3LHAA 4XODA 4BWWA 3HR6A 2A1WL 5IB2B 3MV7A 2AXHA 4ZFFA 1MKFA 3SYPA 1ACXA 2IGFH 4G8IB 2EUXA 2Q7YA 1YEFH 5HDWA 3AXLB 3V9FA 3ZHLA 2KKQA 3HZ3A 2OJZL 2DM4A 4OJAA 3MFFB 4OIFA 5HYSA 1ZMYA 2Z91A 1OPGH 3MTXA 4DP2X 3VD4A 5DEZA 3RX9A 1N6VA 5EBLA 2DQUL 2LLGA 1E4HA 3GBMH 5FIEA 4RMRA 3AS1A 3IU3A 1OAKL 2QQKH 4HH8A 3EAKA 4U1JB 4Y16C 4ZO7A 4RAHA 3HNTL 2ARJQ 4N87A 4CVZB 4EI6B 1YMMD 3L8QA 2RGSA 4FXGB 2R51A 3V4VL 4PJGA 2FX9H 5ANMB 1T20B 2CDFB 2G2RA 5CZXC 4I9WE 4FNSA 5C0AD 5C3LD 1G7IA 1SY6A 2CCLA 2N56A 3GIVA 3ILEA 4FYQA 4F93B 2HFEB 1V3LA 4DK3A 3ECBA 3ZRSA 1MEXH 1GJWA 5AOJA 2CMRL 3HIZA 2JTYA 4XZUB 4NWUH 4NWTL 1ZPUA 2X4NA 3FXIC 1CFBA 1X5YA 3QRLA 1ZLUK 3W9DB 5A2IH 2I9TB 1KGIA 3GRWH 3KPPB 4U7SA 1SXCA 2W80C 1VFAB 2ZICA 1XCQB 3N85L 5DHXB 1MFBH 4APQC 1BPLB 5ILTH 4L8SA 4YHYC 1I9EA 4XRCA 5E00A 2HFGH 4TPRH 4GMTL 2EYRB 1JYVA 1BM7A 2KS0A 3MR9B 1A4BA 2DIBA 4YGVB 3RIAK 5FB8A 2N0MA 3SSGA 1T1XB 1MCLA 4IS6B 2FT7A 2UZYA 5D9SB 5DC0A 5J1TC 4KKRA 5FK9A 2OV0A 1K4DA 2X4TA 3EIFA 4P4KA 3FFDB 4NN6C 3GSXB 4MRBA 1CLYH 5LG6A 4TVUA 2YGPA 4IRSC 4XVTL 3D6GA 4NIKB 2WINB 2ZX6A 3ARPA 3LYRA 1QFWH 2Q9OA 1T7YA 3L1OL 3SGKC 1DQVA 2GK2A 3KPSA 5J1AA 3HMXH 3GS4A 4PRDA 1XGQA 3KJ4B 2EP6A 4Y2OB 3AXIA 3QUZD 5ICUA 2C7UB 3IDIA 4LZKA 4IIQB 4U6YB 4J8RB 4LCUB 1A7NH 3LEVH 1OALA 4OSUH 1TQSA 2NY2B 5D2NC 4WTWA 3W11C 3ESNA 1NC4B 4M1DL 3OC5A 3LN5A 5DYFA 3GMNB 3D87B 1N68A 3P54A 3UC0H 3OKMA 2AEQL 2ZKYA 3K4AA 1EO7A 1EA9C 3KHQA 1AD0B 2J12B 1BZ9A 3RGVC 1W72H 4E9TA 1HSAA 4MCYB 2QSQA 1F3JA 3SPIA 1PIFA 4B7IA 5DJ8A 1J48A 2KMWA 5TK2A 2CAKA 3GGWA 4MD4B 5D2LF 2X5PA 2VNCA 5HPOA 5EBWA 4O5LH 4HF5L 3GSUB 4JFXA 1FFTB 4PJXA 5F9OH 1ZHNB 1QPKA 2QKSA 3IDXH 1WDAA 1P4BL 4FTVB 5FW8A 1COBA 1AS8A 1L7TH 2VZVA 4XMPL 2VDLB 4ZAKB 3QDJE 1ID2A 3VD7A 1QA9A 1H3PH 3P69A 3L9RB 3MAWA 4KKCD 3BP7B 2TAAA 3HI1A 3Q06A 3C5ZA 2OSXA 2AJSL 1ZE3H 3T3ME 4PJEE 5EO1A 4S1SH 1NJ9B 1KLGA 2WSKA 4G6ML 4L5FL 2PN5A 2VLKD 1PY4A 1ZDQA 4GOSA 3VI3E 3UTSB 5F88A 2HA1A 1FRGH 1D6EA 1YYLH 1S7QA 3PQYD 2VGLM 3PS6A 3IPBA 1E9PB 1U41A 4EIGB 2VL5B 4UUJB 4AYDC 2ESVD 3FPYA 3ZYOA 1EIBA 4UNIA 3O4LB 2DI8A 4LLYA 1UT9A 3HUJF 4DCQA 2SODB 3IRZA 1U8KB 1VGKA 4L1SA 5F96L 5A2FA 5D5MB 1PYWA 2QFPA 5EORH 3ZO0A 3GMQB 4NQCE 2OMXB 1AE6H 5TK4A 4CKQA 4XP1L 2AV7B 2D0HA 2DQGL 1AGEA 1NPUA 4HHAA 4MHHI 5ICYB 1JZ2A 4A2HA 2ZONA 2BNRB 1KCUL 4HT1L 1C16A 2P49B 3KZ8A 1KXQA 3CLEH 2YARA 3IDMA 4TLUA 4WWKD 4OD2B 4XP9H 3IDJA 2C3VA 4XWOD 2HKFH 4E9WA 4ZTEA 5C8JB 4FEIA 5GZNA 1DVXA 3QSKB 4OD1L 3ULSA 4XTRD 3GSRB 1Y1UA 3RVTC 1MI5B 1M7IB 3ZDYF 4ZMLA 2JLLA 3GJEB 3LDBB 2DKMA 1KELH 4HWZB 2Y4SA 3L3DB 2FGZA 1X9LA 3CSGA 5JO5B 4X6FA 4OAWB 5JDJA 3EOAA 1J12A 3N3EA 1SVZA 4JG0L 1K8IB 3BOVA 4AE1A 1AFVL 5IB1B 1LEGA 3MNWA 3L95A 2MCG1 4LT7A 3RWIB 3MKKA 3LKQA 4LCWD 4ZMYA 1UM5L 2VLRB 3PJSA 1TTCA 3EG9A 3O3AA 4FLRA 2W65A 3QFGA 4X7DC 4AUYA 5HP5A 3RTQC 2L04A 3APNA 1OGAD 3LNGA 4M9OA 4ABWA 5HDRA 1G7PA 2JI1A 3P0YH 5EIQA 3IE4A 4YSAA 5L2KE 1JRHL 4JFFE 5INCA 2BWQA 1NSNL 3O2WH 3QEGH 4QHLB 1F18A 1JD7A 4UZSA 3U46A 3V0DA 4F7PA 3ALXA 5F0MB 4Y1AB 1SN0A 3DTUB 2W9EL 5IOPA 5DS8A 4PWGA 5CILH 4FD0A 3D85B 2NR6C 2IGFL 3K0WA 1YEFL 3LEYH 1U3HD 3CX5K 3ZT7A 1NGPH 4R83A 4UMSA 1TUPA 2PCFA 3TCTA 1S7UB 1OPGL 2JH2A 2ADYA 2ENYA 3PDGA 5EO0A 5IF0A 3DI2B 1UT2A 3GBML 1IBBA 1O6TA 1TJIH 2HLAA 4Z7UE 4UMGA 1HHGA 1SUHA 2QQKL 4JDEB 3WHE0 1UWEH 1BMGA 5D1QE 3MRIB 1H8OA 3L13A 4YJZL 4QXTB 2HT3C 4PREA 5IEKB 1BM3H 4GG8A 5IHLB 2FX9L 3CSTA 3EDKA 4MSWB 1EDQA 5FUCC 1MFMA 2Y06H 1YQVL 2WBWB 3CXHK 3QO0B 2XQBH 4DP4X 5FM5M 4KQ3H 5CD3B 5IB2A 1N70A 2BSEA 2EINB 4FMKA 4U31A 4AZ8B 4G8IA 1P6AB 4OZHE 2NY5H 3C9NB 2JJUA 4OLVH 3V0FA 3AXLA 5B38G 1HC1A 4OFQA 3V4PH 1M9WA 3GRWL 3C60C 1RHHB 5GIRB 3SBPA 1MFBL 5HJ3B 5ILTL 4K7PY 2YA1A 2FNBA 2FWOB 2YD0A 5DDHA 2HFGL 4TPRL 4IDJH 2DV6A 4U1JA 1NGZB 5HYJE 2G3MA 4CVZA 2R2EB 2OR8A 4EI6A 3VXSD 1C8PA 5DRZB 5CSZB 4NFCA 4Y5YB 5ANMA 1T20A 1MFAH 1CFNB 2XXMB 2CDFA 2VR8A 3QHFH 2HFEA 3A47A 4XP4H 4X7CC 5DJDA 4AY0A 4NB7A 1CLYL 1L7IH 1VEPA 1QSED 3L4VA 4XZUA 3ZE1B 1QFWL 3WJMB 4F1SA 4UT7H 2PABA 2I9TA 3KPPA 2OZ4H 3FSWA 1VFAA 3HMXL 2O6EA 2W1NA 4D0DB 4Z0XB 1KWGA 3P2DA 3LQZB 4BQ8A 1A7NL 2EYRA 3LIZH 3LEVL 3N43B 4RFNC 4WI9A 4OSUL 3MR9A 1PBYA 4BFFA 4YGVA 3BPOB 3J2PA 3SB3A 1T1XA 2ZAIA 3QIWD 3QJXA 4WDIA 5D9SA 4ELMB 3C75A 4F7EB 1LK3H 2VUOA 3FFDA 3UC0L 1HOCB 4ODWB 3BPCB 3GSXA 5CP7B 5BS0E 2D0GA 1OSZB 4KJYA 1ZLVH 1GMEA 3ZZQA 1V3JA 1Y6NR 4UM8B 3IT8D 1W72L 3AREC 3HAEG 1XB3A 5GHWH 4K7PX 3E3QC 5CMAB 4FC3E 1KN2H 9PCYA 2WTOA 3D05A 4Y2OA 3X1FA 2ZYIA 1RIVH 4O5LL 4GI6A 2C7UA 4BZ1L 5KOVC 5F9OL 4PTUB 4J8RA 4JGMA 5J11C 2BIPA 3IDXL 3HVDA 3T0ED 4GG6E 1L7TL 3UBXB 5CJXA 1EBPA 2OMBA 4M7JL 2XX0A 5JORA 1JGDB 4C59B 3K81A 1CDGA 2XXGA 4I18B 3T3MF 3EO0A 1TF4A 3LNEA 3AAZB 4S1SL 2YAFA 1AD0A 2FR4B 4MVBD 5F7LB 1CIUA 4QTFA 4KH2A 1ZSDB 2WBJC 5IHUH 4DF9A 3SIKA 3AC0A 4F57H 2JKJA 3SDXB 1U91B 1T6WA 1FRGL 1VJSA 5FFGA 1YYLL 4MD4A 1SOQA 4G8EA 3GSUA 3H2PA 1ZHNA 4KQ4H 3TVMA 4MS8D 5L6YH 3KH4A 2HVBA 1T1YB 4FTVA 2X2JA 4TVPH 3QORA 5B39A 4ZAKA 2BSTB 2JCCE 5EORL 4F8TA 1AE6L 4NC1C 1SF3A 2X9ZA 3L9RA 4NN5B 5JA9A 3BP7A 4LKXA 3G6JE 3QXVA 4F33A 4XXCA 2EYSB 1NJ9A 3JWOC 1U8IB 2B9BA 4MA7H 3S98A 3CLEL 4XP9L 5D6DC 4JL2A 4AQ1B 1YNTB 4KY1H 5CCHE 3T2NH 3D0AA 5CEXB 4D94A 5DFTA 1CI5A 3UTSA 1L9NA 2TRYA 3P4LA 4PRID 4ZMTA 3SGEH 2KUTA 4DQAA 1FYTD 1PEZA 5E2WH 1IIIA 2VW6A 2VL5A 5I1JL 4UUJA 1HFUA 1KELL 4H8QA 4X83A 3O4LA 2IOOA 2Y1AA 1MREH 1U8KA 1CDUA 1XSIA 3GT6A 5D5MA 3HC2A 1OZUA 2OMXA 3CMOH 3TJEH 3QG6B 2AV7A 4N90D 2JKXA 4PJ6A 2UUDK 5ICYA 4XMUA 4KNTA 2EVGA 1TEGA 3LH2H 4NXSA 3NJMA 1EHLL 4OD2A 1AMXA 5I1DA 5C8JA 3QQ3B 5MEPB 3ALPA 4BYHA 2OAAA 4Y4FC 4FQQB 3P0YL 4NQEB 5AB9A 2GTWB 1SGKA 2P24A 4YZWA 1FN4B 3GSRA 1IQWH 3PL6C 1MI5A 1M7IA 4JFFA 3GJEA 3DARA 4U1NB 1OB0A 3ARBD 3EJYC 3O2WL 3HC4H 3QEGL 4HWZA 4UQEA 1DZ0A 2LTQB 4H5SB 1QQDB 5JO5A 3KHOA 4OAWA 1IEBB 5IWLA 2PWFA 1K8IA 1SJHB 2DIJA 1IZJA 3HI5H 1FZOB 3LN4B 2W81C 1MQKH 3PNRB 3RWIA 4X8GA 2OI9C 1R19A 2VLRA 1EX0A 3GXUB 1NGPL 4W6YB 4NDMB 1ZK5A 5C7ZA 1AIZA 1A4JB 1G9EA 3MKGA 4LSUH 1DFBH 4HAKA 5E2TH 4DERA 3QJQB 1XGUB 2Z64C 5JMRA 4H8VA 4BCXA 1TJIL 3IN0A 4HJ0C 4XX1E 1SMOA 1UWEL 2AJZB 4PJCE 3ILQD 4QHLA 5KVGH 4PP1C 2NT1A 1BM3L 5B1JA 2VXTH 3VDBA 5F7BA 3R7QA 4DPAX 3QC6X 4DFHA 2Y06L 4LPUA 4Y1AA 1OGTB 3J8F7 2ZXWB 2XQBL 3AUWB 1CFTB 2ZOOA 1KUMA 4KQ3L 1MLBB 3D85A 2ODIA 2NY5L 3M8OH 4K71B 4OLVL 3V4PL 3TEWA 3QWNA 4Y4KD 2YGVA 3CTTA 1YY9C 4CW1B 4DHLA 2FSEB 2XZCH 3WI9A 4AGQA 4IBYA 1XF3B 2VZSA 5ISZE 3T71A 4IDJL 4JDEA 2G9HB 4NLAA 2MRYA 2XWBB 3MRIA 5T3XD 3WIHA 2PXYB 4QXTA 3UTQB 3DWTA 5IEKA 5DUBA 5CJBA 1Z2KA 1MFAL 4MSWA 4NPJA 3ATBA 3WGVB 2ZP0T 3Q8BA 3QO0A 3QHFL 5T5FH 3FH8A 4XP4L 5CD3A 5E6ZA 4M93C 4AZ8A 1L7IL 3CQPA 3C9NA 4GAAA 5F6IB 4ZUTB 4KRPB 5BUAA 2Z1PA 4UT7L 2UY7B 4U6VH 3OLGA 2OZ4L 2OTUA 3UROR 5GS0C 5GIRA 4R7VA 5HD8C 1T6BX 5KAQG 1T5KA 3MPCA 4HHWA 4HS8H 2QVMA 2Z6FA 1NGZA 4L18A 3LIZL 2R2EA 3PWPA 3TNNB 5CSZA 4Y5YA 1WS8A 2LQRA 4UT9L 3VXPB 4IOFC 1CFNA 2CLVB 4PLKC 5FW6A 4FI8A 1FF5A 1HJBC 5ID1B 2I32A 1LK3L 3NP3A 2BVOB 3CQFA 2YD2A 1H0DB 4Y7MA 1MJJB 5E0QA 3A22A 3P3SA 4NRXB 2FATH 3WJMA 4LSTH 1EFXD 1OXYA 4NPKA 1QLFA 2H3XC 4Z0XA 3FO0H 3SPGA 3DPBA 4C83B 5ID0B 4HP5A 5B7EA 5LNEA 1RIVL 5EOTB 3LQZA 5DURB 3WY4A 5I5IA 3KBEA 4LNRB 4I77H 4WWNA 4GG6F 3SZKC 1NAMB 5CEYB 1F2QA 5BV7H 4EDWH 1SVBA 2G30A 4FG6C 1EERB 3O9WB 4LVOB 4MJ4A 4X8XA 1YY8B 2D7MA 1ZLUH 4ELMA 4E41E 4F7EA 3FOMB 1DQTA 1LEIB 1HOCA 1XGRB 3BPCA 4ODWA 1ADWA 1LNUB 3H9SB 5CP7A 1OSZA 4LARH 4W70A 3NIFB 3ARWA 3OJVC 1ZGLP 3BESR 2MOGA 1NCGA 5HJBA 3U4EB 4JVUA 5IHUL 5CMAA 4F57L 3QPXH 2IQ9H 4GSUA 2DMBA 1DJXA 5JDSB 1HH9B 3OV6A 2ZCHH 4GQ9H 3A5VA 5L0QC 2AP2A 4KQ4L 1A9VA 5JHDB 3W11D 4Z7IA 5L6YL 4E9YA 5C0IB 1KCRH 1XX9C 1THCA 1GVIA 3N44F 4TVPL 2JCCA 4LVEA 3UBXA 3VWJB 4D8OA 2ZX9A 4TUUA 3X11B 4DP5X 3BFOA 3Q6FB 3WTXA 2DQEH 4TTDC 2YAOA 1L9QA 3D3VB 3QT2A 2QL1A 1JGDA 2XJKA 3SGJA 4EZKA 1GYVA 2P8MB 4I18A 5KG9B 3TNMB 1KGCE 4MA7L 3II3A 2FR4A 3ZHDA 4JZOA 4XVSH 4KY1L 1ZSDA 4PJ7B 4W9LC 3T2NL 3TGXA 2RA1A 4OJEH 1E5AA 3SDXA 2TRHA 4HWUA 3ZR5A 1G6RL 2F6AA 4N86A 5GGTH 2WTRB 5BRZD 1T0PB 5E2WL 1R75A 3CFNA 4KDVA 2ZWZA 2G2NA 4LEOB 1J1XH 1PZAA 2ROXA 2WQVA 3DBSA 5KBDA 4F8NA 2NZ9C 1T1YA 1MREL 2O5ZH 1DJSA 2BSTA 4W9ZA 4ZXBA 1JHTB 3CMOL 3TJEL 1ILSA 1U2YA 3CFIC 1UFGA 1SLVA 1WBYB 4ZRGA 4WRLA 2QT6A 1F86A 3IETB 4DKDC 1U8IA 4PW3A 2A9CA 4MNQB 2BSSB 4AQ1A 1A3RH 3MRBB 1YNTA 2AJVH 4K3DL 2W0FB 3BFQG 3HI6H 5CINH 2DWDB 4R4BB 3ZMRA 4UB0H 4E5XG 5AG9A 2Y2WA 5TPWH 1PIGA 3CSPA 3VTMA 4YUEH 4QD2E 4N2HA 1KYOK 3F6LA 3HC4L 2KLSA 2AEPH 1PLCA 1JV2B 5CBAB 5F71A 4JM2C 5B3JE 2XVLA 4OW6A 2KZ1B 2XQYA 2DQ6A 3HRZB 5CGYC 1MWAH 3QG6A 1A9BB 5EN3A 3HI5L 3RAJH 4DW2H 1MQKL 3HN5A 5T3XH 4XNXL 2FBOJ 4CNIB 4D0BB 2OXHB 2Z7UA 3BRGC 4Z7VE 4HJIA 4FYRA 2OXGB 1B2YA 3QQ3A 3VXMB 5MEPA 1R5VB 3RVTD 4LSUL 3RX5A 1DFBL 5E2TL 3V9EA 5DRWB 1CO1A 4NQEA 3WNOA 2K8QA 3NUKA 1FN4A 2C9SA 3SHSA 3SDCD 1HCZA 3JWNG 4P23B 4PS4H 4U1NA 4JDVB 3FO2B 4W81A 4L1TA 5KVGL 2VXTL 3MCKB 2DN7A 5C07E 1QQDA 2H45A 1IEBA 4PFEA 2AQSA 3Q1EA 3FQTB 4BWUA 2OFQA 4XO8A 4ZT1A 2EEFA 1SJHA 2P5WE 2EIBA 3KVPA 4MMZC 3U25A 1JCVA 1FZOA 3HFML 3LN4A 1NMAH 2DM7A 2LW3A 3QCTH 4NQXA 4RNRB 3UAEA 1KC5H 2WLJA 4OLUH 1CGWA 2GJ6E 4RX4D 3RTQD 1KBWA 4NDMA 4LSSH 4GBXB 1A4JA 1UJ3B 4WI4A 1FZJB 2DIEA 3RHWF 1ZS2A 1MCRA 1XGUA 1PLBA 3CVIH 2XZCL 4TNFA 4GIOA 3HBPA 1R3JB 2BRRH 4P3CH 4AJ0A 5DTFB 4LP8A 1XVSA 2AJZA 2CHZA 2GPZA 1Z9SB 3RU8H 1N3NA 2AMGA 2UZIH 4EN2A 2D3VA 2Z4QA 1DSWA 3BKJH 5HDBE 2X3CA 1N12A 1OGTA 4FTDA 4PRNB 2NR6D 3CZGA 3H0TB 4P2YA 1CFTA 1SJEB 3DYMA 5T5FL 4DESA 1FHGA 3BGFB 4XN5A 5BRPA 2E56A 7TAAA 4U1HB 5GZNC 2ICWI 3BWSA 2A77H 2P28B 5GISH 4DAGH 4GRWE 4U6VL 2DJMA 3HE6B 3S5LA 4AMWA 4F15B 4OLYH 5AKRA 2FSEA 4HS8L 2K7QA 3FU9A 2HT3D 3EJTA 3QIUA 4PJDE 4OGZA 3I85A 4Y4HB 4F8LA 5D7KE 2XWBA 2H41A 4N0UB 5D71L 2PXYA 2HG0A 4N68A 3UTQA 2FL5B 4Z7NB 4OI9A 3O45B 1YAIA 1MXGA 3KPQA 1IV8A 1DVQA 4HUXB 2ZNXA 2IAND 1E8ZA 2V5TA 2WPGA 2WXNA 1RJYB 2BW4A 4Z3FA 3IRCA 3WY1A 3C60D 2X88A 3EZJB 3GZKA 5TFSH 2FATL 2GT9B 4LSTL 2UY7A 4UWQB 4GUOA 1ZJBA 3LRKA 1MRFH 3FQYA 5DCCA 1VZGA 3FB8A 4G43A 1FFOB 2FDBP 1MQ8A 1BZ7A 5IKCB 2R0WH 3V9CA 3ULUE 1W15A 2NX5E 1E6OH 1RERA 5F7DB 4Z3EA 2WMPB 4I77L 1Z0NA 4XPGH 3TNNA 1JZGA 1AO7B 4NEHB 5F72S 5BV7L 4EDWL 2ZCLH 3VXPA 5D7IE 4E41A 3E2HB 3QUML 3ZE0B 3GM8A 5ID1A 5DD0H 2BVOA 3PDOA 4IU3B 2VLME 3CD4A 1N59B 1FP5A 3OXRB 5IFHH 2B59B 5AL8A 3NOIA 4NO2B 3IU4H 4LARL 4PJBB 1MJJA 2EXSA 2VDRH 1IGTA 3IBEA 4H1LH 4PP2B 5MENA 4B0MM 4TUJB 2X87A 1SZNA 1WBZA 4CU8A 4MNGE 3QPXL 4OCXH 5ID0A 2O5XH 1W0VB 2IOIA 5CU5A 2EIKB 5EOTA 1WD8A 2ZCHL 3BQUC 2DMGA 1YNKH 5EHFA 4HUVB 2LT9A 4NHUB 1OQOA 4XZ4A 1KCRL 1TQCC 1ZY9A 5DMJB 1NAMA 5CEYA 2OL3H 1I8MB 2QKIB 1JGEB 1Q1JL 4WW2A 5BQDA 2DQEL 3O9WA 3Q01A 4WNSA 1YY8A 4AKQA 2DYPB 2VJ0A 5DZLA 3HNSH 3CBRA 4Y19E 4JFDE 3FOMA 4MX7B 4YBQD 1LEIA 1ET5A 4AK1A 3H9SA 3SODB 2HT2D 1ZXQA 4XGZB 2ZXEB 3QZBA 1ZLSH 1JOIA 2WYZA 4XVSL 5TDPA 1ZPLA 1A1OB 4NQDD 1EJOH 4MKTA 4O58H 4OY9A 1EO5A 4W9KC 1K3IA 1L5GB 1MIMH 5JDSA 1HH9A 2DQCH 4FXGC 3CV5A 3N06B 2VTFA 4HK3J 1J1XL 3R8BB 5JHDA 5H2BB 2GUYA 3GBNH 5C0IA 5I19L 3EYFB 4LCVA 3U83A 2LU5A 3WXWH 3X11A 5JTWA 3Q6FA 4P3WA 3ZMEA 1ET7A 4S0SD 3D3VA 4CN6A 5AKSA 2RHEA 3DMMB 4PSPA 1KENH 2ZWKA 4LKCB 3TNMA 2WBJD 1O75A 2LVEA 2Y9RT 4QRUB 1AY1H 1A3RL 3VFUB 2KQMA 3KWWA 1ZT1B 2AJVL 1MJ8H 2G5UA 2MH4A 3HS0A 4PJ7A 3HI6L 1V7NH 5CINL 4UB0L 3U30C 1ZS8B 2E7LA 2YAPA 1WGVA 5SWSA 4KKAD 1AQKH 4YUEL 2K9FB 4W6XB 2HG5B 1LO2H 3CJJA 4WIQA 4HUUB 2KPWA 3M1OA 4LEOA 1SJXA 4MJIE 2AEPL 2ENSA 4P9HH 2EYTA 3Q5YA 3IN2A 4S0TD 3BKMH 1DVFB 1JHTA 3VDAA 1MWAL 2FT8A 5GGRY 3RAJL 3SBQA 1WBYA 4QXWA 3GZPA 2P4AB 4J3OH 4IRJB 2VW4A 2AJXH 3D4YA 3FU5A 1CG9B 4N0CD 4NNPL 3IETA 3O8XB 5IV2B 1FNHA 1PW3A 4K3EH 5HDOA 3CZUB 1WC7B 1LM8V 2BSSA 5JZ7D 2WIIA 3MRBA 1BVLA 1GPOH 4P04A 1WISA 5B8CB 3L3OB 2DWDA 1CF1A 2ITFA 2N7SA 3IMRA 4R4BA 2Q76B 5J06A 4IIQC 4Q9RH 1MPAL 3L2LA 1NBYA 1OOAA 3V0WL 5E8DH 4PS4L 2NY2C 4XOCA 4Q2ZB 1JV2A 2YGNA 1R46A 5CBAA 5CBEB 3U9UB 4IGBB 1AC0A 3F7RA 1NTDA 3ABZA 1O6SB 2P5WA 3F7YB 4KVPA 1A9BA 5BJTB 3QCTL 1MCWM 1NMAL 4K55A 1KC5L 2Z92B 3LS5L 4OLUL 4WY7H 4CNIA 4D0BA 2OXHA 3ZDWA 3PJLA 1Q72H 1RIUL 3QDME 3OBAA 4Y4FD 3V8CA 1NBVH 4BINA 2OXGA 3UZQB 3PL6D 4YK4B 5DQ9A 1R5VA 3VXMA 1HJCA 1UD8A 3ULVD 5DRWA 2RQ8A 3CVIL 3EJYD 4W9EC 2R29L 2BRRL 4J3UA 2VKWA 3H7LA 4P3CL 5MERA 4P23A 4JDVA 2PF6A 2R7EB 2UUDH 3FO2A 4NERA 4X6CF 3RU8L 2FJUB 2UZIL 3MCKA 1W80A 5DVMA 1UKSA 5HDBF 3BKJL 4WHYG 1CGYA 4S1QH 1VZHA 3FQTA 5LWYH 2AXGB 4TLSA 1OCZB 3NSCA 2ICEB 3O6FB 4RNRA 1SEQL 4NZTH 2FHFA 4QLRA 1BCIA 2A77L 5GISL 2BW5A 3BZ5A 5DS1A 4GBXA 4DAGL 4GRWF 1UJ3A 1AQDA 2NNAB 1FZJA 43CAB 3AM8A 5E8PA 3LXCA 2X6CA 4IU2B 4NAJA 4OLYL 1BSIA 1R3JA 4PP1D 2AW2A 2VR4A 5DTFA 5D2LB 4F58H 4ATTA 5ESQB 3ZX1A 5DD3H 3QXAA 1S7WB 3IDUA 4LHQB 2P8LB 1UD2A 5KJRH 4HKJB 1UD4A 1Z9SA 4IDLA 3VXRB 5DJAB 5JXEA 1EFQA 3K6FA 1HXYB 3TBVB 3H0TA 1QZ1A 3AFLA 1BQHG 3FUKA 3TBSB 1N0XH 2JKLA 1O7DC 4U1HA 1HYSC 2YWYA 3S35H 1U6AH 3AJ7A 5TFSL 5D7HA 4BQCA 4JY4B 4K7FA 1JK8B 1MRFL 3LDBC 4YX2H 3L9EA 2ADIB 5E7FA 5FCUH 1ID5I 2R0WL 2V3FA 4JKNA 5TGBB 4AEFA 4Y4HA 2BNQD 3ZO9A 3T6QC 1E6OL 2VDMH 4JJOA 1PKQA 2BH0A 5D1XB 5IWLC 4PW9A 3B56A 4XPGL 4I88A 2B7DT 4Q9BA 1WLHA 2ZCLL 3O45A 3HUJB 3MRJB 5EU6B 3UXFA 2F74B 1WA0X 1JCKA 1DN2A 4CU6A 5DD0L 3K4ZA 1OTSC 4HUXA 2ZAGA 5IFHL 1DQLH 1RJYA 3G5XB 3VI4F 1OP3K 2BCMA 2NY7L 1QI5A 2VDRL 4CUCA 3FU8A 5GS0D 1ZLWK 2GT9A 5HD8D 3ZQXA 1OARH 2AK4E 4YL4A 2EECA 1IEHA 4UQBA 3FHQA 3OX8B 4U0RC 4OCXL 4PRHB 3IVKB 1FFOA 2O5XL 3CC1A 2NYYC 4OFIA 3IGAB 3RZCC 5IBUB 2QGBA 1YNKL 2APXA 2HJKB 4L4TB 3ZDYB 1Z5HA 4IOFD 5F7DA 2P80D 2WMPA 3WKQA 3IB4A 1AO7A 3FFCE 3KXFB 3LH9A 3IEAA 2OL3L 1PPIA 4WGWB 3EJCA 3B9KB 3MOAH 3N2JA 5C0CE 5C7XH 4HBCH 3B7RL 3HNSL 1XF4B 2AQNA 4IU3A 4KJPC 1N59A 1BBJB 3HE7A 3VYPA 3BUTA 4PJBA 3RWCB 3MRDB 3ZPDA 1S46A 4ANKA 3G5YB 1ZLSL 3TFKC 4PP2A 3BIKA 3HC3H 3MUHL 2A9BA 3I2CH 4FG2A 4TUJA 4FA7B 5I1HH 5DRXB 1EJOL 3DSFL 4KI5E 4O58L 5IK3B 5IIEB 2JCWA 5DQJB 3JWOH 3LB6C 2ZD0A 4NQUA 1MIML 1E28B 1W0VA 4XN8A 2DQCL 4HUVA 3AQXA 4PJIE 4NHUA 3VFRB 3T0XA 5GS1B 4C54A 3N6YA 3GBNL 2PYEE 4FG6D 1ACCA 2I5YH 3MV7D 3WXWL 1KB5B 3OZ9H 3APFA 1I8MA 2QKIA 1JGEA 3WXVH 2WLYA 2DYPA 5J8OA 1W8OA 3PRZA 4P2QB 4I13B 3SPVB 1A1NB 5HHQB 4HIIB 4MX7A 2Y23A 1C8QA 2YBRA 4BCYA 1W2KT 2OX5B 4F7MB 4GY4A 5JOPD 2CO7B 3KMDA 3VSTA 5DRNB 2NDGA 4XGZA 4TN9A 1U8HB 4HJUA 5FDWB 1AY1L 1CYWA 4KVCH 1MJ8L 3OZKA 2CWRA 4GKSB 1A1OA 3F7LA 1V7NL 3MNZB 1J9QA 1IKNC 3ISRA 4L2YA 4WSJA 3ZY7A 1FPTH 5LQBH 2CD0A 1L5GA 1AQKL 5BNXD 1LO2L 4P5MB 2EZ0D 2PO6B 4DP6X 3M1BA 1J9TA 4P9HL 4WV1A 5H2BA 4O2CB 1ZAGA 1MCCA 4TTDD 5DA4A 2YPLE 3EYFA 1DTUA 5CGTA 1A6TB 3QZMA 4KZEH 3BKML 2J43A 2CJ3A 3MJ6A 4PGEB 3QHZH 5EZOH 2EDOA 3DRTB 1A3ZA 3TXAA 3WEAA 3DMMA 2AJXL 4LKCA 3T0BA 1GGYA 4X5WA 3VNZA 3K6NA 4FNTA 4K3EL 4M7KH 4ZPTB 1NFKA 1JN6A 4K9JA 4N8UA 4QRUA 5KVEE 1H6FA 3VFUA 2QQNH 1ND0A 1ZT1A 2E75C 2VR3A 3T09A 1GPOL 4WKZB 1EZSA 4JQXA 5F0JB 3SCMB 4CJ1A 2K7PA 2XT1B 1JVLA 3DOHA 1ZS8A 5KSBF 4Q9RL 3B37A 2NMSA 4L0ZA 5E8DL 4HUUA 2G3NA 3GMOB 3UZVB 2KLTA 1U8JB 3C5XA 6FABH 1OEZW 3QDGD 3HVNA 3B2XA 2PCPB 2MIZA 3PUUA 3V4VB 2X4RB 1ZT7B 3LRMA 3KPSD 2DMHA 4JFOB 4WY7L 4X4XB 5IV2A 1YN6B 1I8AA 3UC2A 3V8OA 1FO0H 1Q72L 5CLTA 1BX2B 2OMTB 3ZL2A 1WC7A 1NBVL 3WUWG 4TNVK 3KWTA 4FLHA 2Y7OA 5CCKH 3RNQA 4PV9B 3T77B 5B8CA 3L3OA 2AK1H 1XD1A 2Q76A 3MLPA 4Q6IB 2AQTA 3NQIA 1SFHA 3PWUB 4JM2D 4XMZA 1LL1A 1ORQB 5AALA 4Q2ZA 4WEEA 5H8DA 1B0RB 1LMIA 1EBAA 4HPOH 3U9UA 4IGBA 5DF0A 3CSFA 3DX9B 4S1QL 3ATEA 5CKGA 5LWYL 2DDQH 4LCCB 3F7YA 2DJSA 2BHYA 5I2IB 3EBGA 5BJTA 2APBA 1TSRA 4FQIH 1DVZA 3CFTA 4NZTL 4OFPA 2Z92A 2YD5A 5I9QB 1UXLA 5CM1A 3BVTA 3RBSA 3Q2WA 1M05A 3B83A 2HN7B 5A3IC 3EJQA 3SN6N 2WUCH 1FIEA 3K91A 3T8VA 3RY6C 3UZQA 1I8UA 5GS2H 4Z7WF 5E6IC 1E67A 3NJIA 4OF8A 3BAIA 3DGGB 5KVFH 3KW8A 2KZBA 5FYKE 1J9RA 5AD0B 3MUUA 1URLA 1FGVL 3W0WB 1JPSH 5DD3L 5I8EA 5GS0H 3UJJH 1TXKA 3A67H 4WGKA 5KJRL 4M4PA 1ESOA 3C5ZD 5FGCE 2DB8A 4NN5C 3QG7H 3RVXC 2UXGA 2JTDA 4F3FB 2F9BT 3WS6A 4P2OB 2AXGA 1UB6B 3O6FA 1X5KA 2ICEA 3KWVA 4W6WB 4FS0A 1E4WH 4AQ1C 3S35L 1U6AL 2LABA 3T3MB 4WNQB 1MY7A 1GKEA 1V7MH 4EF3A 2NNAA 43CAA 3DIVA 4IU2A 1LO0H 1NLDH 1EZLA 1UCBH 2YMOA 3N0PB 4MD0A 4YX2L 4Z7OE 5IB4B 2X6VA 4WTZG 5FCUL 2R1YA 4PJAE 4XO4A 2NZ1A 5D2LA 2AHIA 5FYJU 2YR3A 2VDML 2YLKA 1S7WA 4V11A 5HDLA 4KBPA 4BH7B 1KDIA 4LOUC 2F7OA 4IOSA 3VXRA 4PJ5B 4X8CA 4DVRH 1DN0B 1FSKC 3PV7A 4JQIA 5I1AB 1AXTH 4XO9A 2XUWA 3TBVA 4HC1H 3CK0H 5EU7E 4JCMA 2X0VA 1ZANH 2NQDA 3K2IA 5GZND 1DQLL 2R1WA 3TBSA 3DX0A 5KBNC 2XKSA 1TQBB 3BQVA 5LHDA 4G7YH 3STLB 3QH3B 2NY4C 5DR5H 4G8GB 1OARL 4X9HA 1OOWA 4JY4A 4YSCA 1JK8A 5E4IA 4CVUA 3PPEA 4UQ3B 1ZDSA 1P7HL 4JUTA 3NBNA 4LASH 1O9WA 3BVNA 1S9YB 2ADIA 3HZMB 4YBHA 3U2SB 4RIRA 1UENA 2LTQC 4UIMB 4G2AA 2JVUA 2PPCA 5D1XA 3S37X 3NK3A 4EI5C 3X3FH 5EEUA 2FEEL 5EU6A 4C4KT 4WFHE 3HUJA 3MRJA 5IVOA 2WXQA 3MOAL 1CVSC 4KDTA 4N2GA 4KXDA 5C7XL 4HBCL 3MOBH 3S8WA 2VAAB 1GYCA 1SY6H 4DIXA 2JKSA 2WXPA 3G5XA 3F6IA 1T5XB 5K9OB 4KKBC 1NC2A 1YYCA 2YSTA 3HC3L 3I2CL 3Q2VA 5I1HL 1XCTB 1TZ8A 1DVUA 3DA0A 1R4XA 1NCTA 1TTAA 1WTGT 4PJ9B 1UD3A 4RGND 4TQ8A 4AI7A 1XH1A 1QATA 2ZKHH 4GQPH 1KJVB 1YEGL 4CRPA 5GGVH 4XWGH 3PYCA 3IGAA 5H94B 4PJIA 4N1CA 2HJKA 5FYLE 5HYSG 4L4TA 5IUSA 3CFEB 2Y0SA 2I5YL 1WIUA 2BP8B 3KXFA 3OZ9L 5SX4I 5C6PB 5FECB 1FL3B 2HYMA 3FK3A 3B9KA 5D70L 3WXVL 1DBBH 4WI7A 4L1LA 1ROWA 4K71C 4UCFA 1A6PA 1N6QH 3OLDA 5DHVB 2WLNA 3MRDA 3RWCA 3UTTB 2MKLC 3AWGA 4FKKA 1WFMA 3G5YA 5BVJB 3WGUB 2C9RA 1ZTMA 4H25B 5IK3A 5LQBL 4O2EB 4TLKA 3ALWA 4TKWA 5DQJA 2A0LC 2PXYC 1KCLA 2Q20A 5KZCB 3VFTB 2IDCA 1SJMA 3VFRA 5GS1A 2A7BA 4WNJA 3I9AA 4NFDA 4X6DE 2BSED 1FFRA 4XNDA 2JE8A 1KB5A 4HPYH 5EUKA 4KZEL 1KEMH 3CPUA 4LHJB 3WSQH 4EPSA 3ZHKA 3QHZL 5EZOL 5BPPA 4P2QA 3SPVA 1KIRA 1A1NA 5HHQA 4HDIA 4HIIA 5F6IC 4L48A 2OX5A 4R7DB 4LBEB 5F1NB 2CO7A 3RUGF 4M7KL 5DRNA 3SJVB 4ANXA 5C0JA 1U8HA 2CR0A 1BP3B 2QQNL 3NCCB 2R4RH 3VG0L 5JQ6H 1E3ZA 4GKSA 3KWXA 3VFNB 3MNZA 2LLLA 2R23A 2WOYA 5KYYA 4YSDA 3SDAB 2IV8A 4B97A 1E4JA 3RL2A 4NP9A