3QUXD

Structure of the mouse cd1d-alpha-c-galcer-inkt tcr complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
239
structure length
239
Chain Sequence
b'AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 60
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quxD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quxD02
1YNLL 3ALPA 1B6UA 1FYTE 3CGTA 1BMGA 4UT7L 1NGZB 2ZCLL 5ID0B 4DK3A 4OD3L 4V1DB 3DNKA 2E3VA 4NQCD 5B38A 5ACZA 1WLHA 43CAA 4ODSH 1UM6L 4X9GA 5TE6H 5CHNB 1R3IH 1YMMB 1FL3B 1WK0A 3G6DL 3PWLA 3TIEB 5A43C 5IWLC 3ULVC 4Q74A 4PLOB 4HPYL 1T03H 35C8L 3B43A 1ODAA 1BFVL 3K0WA 3G5XA 3PL6A 2DQUH 3LKQB 2OYPA 1KN2H 5DRWB 5E95B 5C0AB 2VXVL 3HE7C 3LS4L 3GB7B 1T3FA 3G5ZB 4TNVK 5C0RL 2AQ1A 4Z0BH 3VI4E 1OF2B 1UCTA 5CP3A 2R1YA 5IIEA 1T0NA 5BO1L 3WFHB 3BZFA 5J6HA 3HZKB 1NGWA 4JLRA 2NY7H 5EBLB 1QR4A 1EEZA 3ZDYF 5JOFA 2VE6A 1YZZA 2J8HA 1A22B 4E41B 1DQQA 2HVJB 3RVTD 4HZLB 3WJJA 5CWSB 2NY0C 5M95B 4W81A 5H37G 3LN4B 3TCXA 3MRLB 4PJ5D 2ZCHH 1U8QA 4LU5H 1S9KC 5C07A 1RJYA 1YC7A 2BNQE 1F4HA 5DQ9A 3RGVC 2PR4H 4K7FB 4LASL 5T3ZD 1HQRB 5EN2A 4NGHH 2HFFB 5DURB 1GCFA 2HT3D 2YS4A 1GPOH 3FB6B 4CU6A 3IYLW 1ZV5A 4KZEH 1QFHA 4KROB 1BLNB 3ARUA 4YHKL 2EC9T 5ETUB 2Q7NA 4MHHG 2BNRB 1QSED 3LKSA 5HHOD 3EYVA 3GSWA 4O58L 3Q0HA 3QI9C 1BIHA 4PB9L 1N4XL 1KF9B 4OCLC 4APQB 1KN4H 3UTZA 1UADC 1NUGA 5K9JL 5GIRA 3IXAA 3KPQB 5C2UB 1A6UL 2ZOLB 2QSCL 4Z7WB 1UA6L 2HMID 1JN6B 1T04B 1DLHA 1HDMB 5ICZB 1LK3L 5E2UH 3OGCA 3SKJL 3BRFA 4NQCA 3TBTA 4U6XA 1AHWC 3VRLF 2HWZH 4FN0A 2YN5A 4JAMA 3QNYB 4YGAB 5AG8A 4X4ZA 5FYLD 4KK8C 2CLVB 2XWBB 3MJ7B 4PJ8B 4JN2B 2GK0A 2RR3A 4LLQB 1FC1A 3DUUB 5DVMA 2R69L 2AJYH 5JNYB 2W0PA 3DYOA 3QG7H 3FQUB 4OBSA 1ED3A 1CL7H 2M1KA 4N0RA 1VFUA 1NC4B 2A83A 5F9WC 4KKBC 4M62L 1SQ2N 1F4AA 3JV4A 3CK0L 1X4YA 3O9WC 1VHPA 5TJWK 5D7KD 1ZLSH 1G0YR 2GHWB 5T1DH 4JGMA 1CE1L 4LCWB 2CUHA 3MV8A 4JFDE 1F8TH 1U3HD 2R23B 3NCYP 5D71H 1A7QL 2WP3T 3HLAB 3GKWL 4QNPE 1NBYB 2EYTB 5HYJB 4RAVB 1HHHA 3L5JA 1EJOL 4M8QA 5D70H 4LPTA 3MGOB 4XAKD 4F7TB 1FRGH 2YD5A 4GQ9H 5F70A 4LHUB 3QRGL 4ZUUA 4GKNA 1S9VB 4UIMB 4YHZL 1JPGA 4IDLA 1P69B 1ITCA 4ZFGL 3ARXA 3BGMB 5FUZL 3SE3C 3KPRB 3UP1A 1RURH 3VFWB 1V8HA 4PJ7F 1CD8A 4PJ5A 1T5XA 4EDXB 5C6TL 5AD0B 3NH7H 1I1YB 1KT2B 1KC5L 1SEQL 4M3KB 3RA7H 1ZGLB 1CLOH 1INEH 1U8KA 2IPTH 1T2JA 3KPMB 3QQ3A 4Q9CA 2P44B 5F7EH 1LK2A 2VC2L 1P2CA 4HMCA 3QFJD 4BYHA 3FQTB 2DQJL 3W0WD 4M7LT 2DWEA 3NIFF 1OQXA 5SWSA 1YEFL 4OZFA 4HS6B 5JTWA 4NHUB 3MBEB 3EW3B 4YHIB 2H41A 5I1CH 1K4CB 4KV5E 3TNMA 3VFRB 3QH3A 2DBLH 1PD6A 4R90L 3BRGC 4PJIF 5ERWB 3WNPA 5HY9A 1CU4L 4NQXB 2NXZB 3MUGA 4QY8B 5ACMA 3RX5A 5BZDA 2GSGB 1X5JA 3QIBC 4PJFA 1IAIM 2CXKA 5IB4B 2EE6A 1OPGH 1U8IB 1BZ9B 2VIRA 1QVOA 4K71C 1MFBH 1S7WB 4NNXB 4V2CB 1JZ8A 4M6AA 1FL6B 4U4BA 3X3GH 1HCFX 4H0IA 5DI8B 4ODWB 5E1AA 1XGYH 4JB9L 3SKMA 2VLMD 2IADA 4PREA 4QXUL 1F45A 3WS6A 3AMKA 4FFVC 3MR9A 1FAIL 2R0KH 1MFDH 3HZYB 3ULVD 1V3JA 5DUPH 4RMUA 1PJ9A 5F97E 3QDME 3FB8B 3MLZL 4QXGL 1MLCB 5GGSB 3EYOA 1S7SA 4KUZL 3ZYJA 3PHQB 4XCEB 3HE7D 4FXGA 4BUHA 2XFXA 2FJHA 2LTQC 3MCLL 4U6HA 3HUJA 4I5BB 1HCVA 4MGXA 2I25N 4QWWD 4YDIH 4HH8A 1NAMB 4L8BB 2BZDA 5F3HA 4JGJA 4BK5A 1FHGA 3LKPA 2F58L 3U4EA 1LD9A 3ZDYE 3O6MH 5CINH 2X4RA 2CO7B 2DWDA 3VG9C 4QRRA 1BD2D 3QDHA 3BFOA 2NY0D 4LHUG 2VXQL 3TYGH 4P3DB 1TJGH 2BFVL 4RGNC 3BP6A 1KIQA 1BQHA 2VXTH 2CIIB 1R24A 3H3PH 4FQHB 5DZOA 1R3HB 5TGBB 5IVZA 3RWEA 3I3EA 4ODXA 3OXRB 2H26A 1U8PB 1CR9L 1U6AH 3U0WL 3BW9A 3HI1A 4Z7UF 4YHMH 4IRJA 1G7MA 5BRZE 4XWOC 3P73A 4LRNH 1EK3A 3TN0B 1XR8B 1WTLA 1NEZB 4IMKA 3DVIA 4WI4A 1WWAX 3IDMB 2BY0A 3EYSH 3SE8L 2GTWB 5IF0B 1F00I 5I1HL 1BVKB 1DANU 1MCDA 4PRIE 5DLML 1WT5A 4L4TD 4UINH 2J2ZA 2BY1A 5E8NA 3MLUH 1MRCH 3QI9D 3CCHA 2R2BA 5HI5D 4ZOCA 2YRZA 5DEGB 2R56H 4LF3B 3V0VB 3MJ9A 3HMWH 3P0GB 3CFDB 5MI0B 4UDUA 1BZ7A 1OAKH 1P9MA 1F3JA 1NCDL 1SMOA 3EO9L 3ULVF 1PQZB 1UH4A 5C3LD 2GSIB 3BPNC 1RUPL 1MEXL 2SEBB 2X4OA 3B83A 2WUCL 2IAND 3VRLE 3KYMB 4KK8D 3DVGB 1KGCD 3UTQA 2C3XA 4KFZC 3HC3H 5IWLA 5I16A 2NR6C 3O2VH 1N3NA 1WZ1H 2PYEB 2VWEC 1QACA 4KROC 2OL3B 3LQZB 4G8IA 4HV8B 4R26H 4L8SC 3JTTA 2C3VB 1K3ZA 4KKBD 4S1QH 1JNLH 5EZIH 2YR3A 4HJJH 3N1MC 2FJFA 3O9WD 3NCJL 2AK1H 4AEEA 2MNUA 5DMKB 4M7LL 2W1NA 2DQEH 1FFRA 1TVDA 5SWZD 3OQ3B 2ADGB 3D0VA 1K6QH 2QR0B 5EUOA 1XF4B 3SO3B 2VUYA 2B2XH 4OF5A 1JI2A 5LGHH 3UJJH 3TBSB 3DO3A 1NDGA 1U8MA 4WDIB 3OJMB 4HDIB 2QSVA 4Y4HA 5T3ZE 3QZWB 3O4LD 1H8NA 1MPAH 5DJ8B 4PJ7E 4XPTL 1OSZA 2UZIL 5D2LA 4NZJA 5IT2H 4P9ML 4YUEL 1F90H 1FZOB 4ZS7L 5KJRH 3ZHKA 4JFQA 4NC2B 1QSEE 5HHOE 1F4YL 3RGVA 3JV6A 3LIZL 5HDQL 1E27A 1P4LA 2NZIA 4PJXA 1NEZG 5B38B 5KANG 4OM0H 5ACZB 1BBDH 5C0GA 43CAB 4A2LA 1JZ7A 1FO0A 3VI3F 4NHCL 3NIFE 4V2BA 4RAUA 4UTAL 5F7KC 3IJYB 3SO5A 3KYKL 3PXHA 1EH9A 3QPQC 4XTRC 4YNYB 4LDEB 4XPFL 3PL6B 3Q1SH 4PJIE 2X40A 3BE1H 1U8HA 3QIBD 5FYLE 1WVZA 1WCBA 2GITA 2FLBT 4ONGH 2R1YB 4NUJA 4Y2DA 3BZFB 3C9NA 2I5YL 4MHHI 5MERB 4JLRB 4UDTA 4P0DA 1EEZB 1UWEL 2VE6B 4YXKH 1C5CL 4OLVH 3V5KA 4FFVD 2IH1B 1DQQB 1ZTXL 2FGWL 3BH9A 4UIKL 4XCFL 1HE7A 4N5UA 1BGXH 2AXHA 1DCLA 4OD1L 4HULB 1U8QB 3LEYH 4JFEA 3HRPA 3NABL 1AD0A 5C07B 1P5VA 1RJYB 4YDVA 1P6AB 1UB6A 4JQIH 4KQ4H 4MVBC 2FX8H 5J9PA 4UOJA 2Q6WA 2VH5H 3Q6FA 2NXZC 2YXFA 3KJ4C 4E0RA 1R3LA 2B4CL 3TO4A 1RZ7H 3GUTA 2VDOH 5JO5B 1DQDH 1N7ML 4YHNA 4WI5A 5L8LB 1FNFA 1OB1A 4EQ2A 4P9HH 4UUJA 25C8L 5JW3L 4ODTL 4V1DD 4PGBA 5T3XH 3N85L 3B9KB 2CIKB 5IV2B 3C60B 4HBQA 3B2UC 4RGND 3RL1B 5AG9A 3O4LA 3QFJE 4X98A 1GC1H 4KTDL 3X14B 3QZWG 3W0WE 3Q6GH 5DD1H 2P8MA 1C08A 4OLUL 1F4WH 1MHCA 3OHXA 2UYLA 1DLHB 5DC4B 4BZYA 4Z7UE 4NFCA 1FPTH 1WUNT 1EAPA 2OS7A 3OGCB 3DI2B 1SEBA 4FQCL 5K33A 3K2UH 3BUYA 3ECBB 4U1IB 4U6XB 4G7VL 1MREL 2JJTC 4S1SH 3EOBB 2AVGA 4X7SH 3PWUB 4YPJA 5B38G 3CFCL 3VA2C 1JNHB 2NTFA 2HRLA 2WAHA 1PG7L 3IRPX 4JPWL 7FABL 4HIXL 1L7TL 1FBIH 2H8PA 1MCSA 5KTEH 3PJSA 5D6CB 1VGKA 3MOAH 4WV1B 1AI1H 2VLME 5CMAB 1FCCA 3MRKA 3FQXB 3PDOB 3MV8B 1RJZB 5T3ZL 5BXFA 2EIDA 1MJ8H 3ULVE 3DRTA 3O6FA 1OP3H 1NEUA 3H42H 1LO0H 3IDYB 3MNVA 4JHAL 4Y2OA 5JQHC 3RI5K 4WU5B 1IGML 3ALWA 2WLZA 4WCYL 4NBXB 3RJDA 2KUTA 2XKNA 2EXYC 3NFNB 1UWXH 3HAEH 4LBEB 3RWGA 1JPGB 3RHWK 3PWJA 5ALBH 1FIGL 4B53A 1VCAA 4KROD 4D9RD 5HHXL 1VENA 1LWRA 4ZNEA 4NQEA 5ANME 2Z8WC 1X7QB 1WEJL 4NM4L 3V2AR 1NUDA 4XX1G 5GJTH 3BKJH 3VJ6A 1BD2E 3T0VA 1U8KB 2NY2C 3R1GH 5MI0C 3MUHL 1S8DB 2FATH 1U91A 3VRJA 5D6DA 1YN6B 3GGWA 1R3KA 5DF0A 1G6RB 3UMTA 2ZP0T 3P0VL 3VXSD 1A2YB 32C2A 2FDBP 4N0UE 1DUZA 1DBBL 1RUQL 4MD5A 1RV6X 5DSCB 2AEIT 1U58B 2JB5L 1II4E 3QH3B 4PP1C 5D5MB 1EFXA 1B9ZA 1G1YA 2O5XL 3T3MF 5HDBF 1S7QB 4NZRH 1BM3L 3B3IA 5L2KB 5E7FA 5HY9B 2WW8A 3AC0A 4OZIA 3QDJA 4N8VB 5BZDB 1UKSA 1U8JA 3VFGL 3Q48A 4UT6H 5DMJB 4J23A 4L4TE 1NC4D 1FFNA 4JHZA 5DFVC 2VIRB 3LH2H 4O4YL 5FCUH 1SBSL 4NP4L 2E9BA 4M6OH 5GRZA 3VXMB 1QA9A 4UV4H 1Y0LB 4RGOH 3X11A 1G9NH 4LCWD 3GIVA 3PDGA 5HVGB 5E1AB 4XNYH 3V9FA 3SKMB 4DVRH 4ZFFA 2L4OA 4PREB 5HYJD 1EVTC 3MR9B 5D7SH 5EOQH 3VI3E 4NPYA 2CSPA 2ORBH 1CFSA 2FO4A 3RZWA 1X4ZA 4KDVA 3QPQD 3P40A 4XTRD 1R5WA 1RJCA 5GGQL 1LO4L 5BZWA 3EZ8A 1VGEL 4DJMA 8FABA 4TOYL 3QAZB 4F9PC 1S7SB 2IANE 1QBBA 5EOCL 5CJ8A 2OK0H 3KPRD 4GMSH 2XFXB 2FL5A 1NJ9A 1KGCE 4XMLH 1OP5H 4NC1C 4U6HB 3HUJB 2YPKB 1SJVA 4FP8L 5I1DA 1EO8L 5GSRA 4PRAB 1FDLL 2JF1A 1FZMA 1DLFL 1A3RH 1JHLH 1XF5A 3GDBA 4KZDL 4ZUVA 2GAZB 3QEQA 1CFTB 3CSYB 2ADJA 4H1LA 1ITBB 2RCSL 2DWDB 1H3WM 4QRRB 3ZHDA 1KTDB 4U1JA 3WE6B 4G6KH 3L5IA 3QXVA 1GAFH 5I1AB 5GS2H 3RVWC 1H0DA 3IF1A 2DQGH 2EIZA 3BP6B 1KIQB 4Z7WF 5SWZE 4D94A 5IVZB 3U7YL 1CDGA 1MHPL 1YNKL 4FABH 3BW9B 3HI1B 1C5BH 5DRNA 1KB9K 3P73B 4MVBD 4UU9A 1BX2A 4ZXBC 1E0OB 1A7NL 2NXZD 4XHJC 1A9BB 2C4FU 3QYCA 1M71B 1J1XH 1RI8A 4OZHF 4GQPH 4I0PC 3M45A 3ULVL 4KRLB 1NFDF 5GSVA 5I71B 2N56A 4LCCA 4AG4H 2XYCA 3CX2A 5I74C 5IGXL 3CCHB 4P9HC 2BC4A 2R2BB 3B2UD 3SQOL 4EJ1C 4OI9A 3MLTB 1V3LA 1IC5H 4XAWH 1SM3L 4AEHL 3NA9H 2OQJA 2XG4A 4C83B 4Q9QH 4UDUB 2MOVA 3H0TB 1GC1C 4OGAD 4N8VG 2EKJA 4A6YA 2XRAL 2Q76B 1OAYL 4YX2L 5L7XH 1AGFA 4WNQA 2P8LA 4ZOEA 3FB5B 3LZFL 4Q58C 2CJUH 2ZSWA 4LNVA 1ZANL 1OAUL 2FHFA 3GK8H 5CZXD 3QUYA 2ERJB 3IGAB 5I16B 4LVNC 1N3NB 3QHTC 1LILA 2AV7A 4M3JA 1JWUA 3C8HA 5LGJA 2M26A 3TIDA 4PJEB 5HHVH 4XNQA 4IOIA 3JTTB 4HGKC 3TT1H 1ZT4A 3T4YA 2IQ9L 4ODHH 4EDWH 5JXEA 5ICYB 2Z31A 4QTIL 3C60C 4NUGL 1I9IL 2DTSA 2Z0BA 1YEEL 4M4RA 4IDJH 3DYPA 1A4KB 4R4FL 3GNML 2ITCA 5KANI 2DM2A 2R2HB 3VGHA 4OLYH 1G84A 3L3JA 3D0VB 4P5KA 3MOBH 2AJVH 4M1DL 4NO5A 4ZFZA 5EUOB 5DJ0A 3SDYL 3FOLB 1WC7A 5LVEA 1JGVL 3G08B 3RNQB 5D9SB 4JY6A 2AXJA 15C8L 2EXYD 1Q0XH 3W11C 4L3CA 1BPVA 1KCRH 1U8MB 4U0QB 1BAFH 4WHCA 4Y4HB 3ILQC 1XZ0A 4L9LC 3HE6A 4U2YA 4XVJL 5D2LB 1R5VA 1TLKA 4PLKC 4EUPA 1YEGL 3JUZA 4V1DE 2KDGA 3WIHL 2JKXA 4HWBA 4LCIH 3JV6B 2G5BA 1RIUL 1QR1A 5ESVA 3MRNA 4Y88A 4Y5VB 2DLFL 4RGNE 4Z95L 1YMME 5C0GB 5E08L 3L7FA 4JFXB 5CGMA 2BSRA 4JO3L 4HCRH 3T77B 3TCLA 2DMKA 4JM4H 3H7LA 3MRGA 4OLXL 1QNZH 4I13B 4PP1D 5D1QB 4BM7A 3K8KA 3FO2B 1JTTA 1P4BL 4N8PA 4LAQL 2OR9L 4RBPK 3T3ME 3JBG7 4IIQA 2I07A 4UV7H 1L7IL 2EH8H 5HDBE 1F42A 4JRYB 4HBCH 4WEUD 2PYED 2QLVB 5IB1A 3RVVD 4XHQA 3VD7A 1WCBB 4MJ4A 5DFVD 4PRBA 3GSNB 1KTLA 3PHOA 4F8QA 5IFAL 4JO2H 5E0QA 4YFDB 4Y2DB 4XI5C 4F80A 2JJTA 1NL0H 5E99H 4YDKH 4UDTB 4ZUSB 1LMKA 4JREB 4S0TD 5E5UB 1AGCB 3WFCH 3V5KB 4WI9A 4LSUH 1QFPA 5KS9A 3SGEI 2OR8A 1G9NC 4G6ML 3BH9B 3ZYIA 1VACA 1UT9A 5E4EB 1JYNA 1NSNH 2DN7A 3QNZA 3EOAA 4JFZH 4LIQH 2DQIL 2XQBL 1XCTA 1XGRA 4YDVB 3QIWA 3MLPA 1WBYB 1A6VH 5J9PB 5GRXG 4J4PA 4JO4L 2VWEE 5F72S 3PQYB 1HSBA 4OIAA 4D9RE 1R3LB 3AS0A 3TO4B 1IGCL 2VDNL 2W0FA 4MNGB 1OARH 4M7ZC 5D7IA 4YHNB 4WWKA 5TE4H 2CKBB 5KSUB 2B8OT 3FO1B 5I73C 3V8CA 4YQXH 1S7VB 2V5TA 4PGBB 1MCWM 3GBMH 1IRAY 3PGDA 1OGAB 4LSTH 3RVWD 2FBOJ 2VKXA 4X98B 3HZVA 4Z7WE 4NQDB 5JUEH 5EU7C 5I18H 1NLDL 5IESH 4U1LA 3MCG1 1NFIA 2P8MB 1C08B 1CLZL 3VXSE 1ZS8A 4PD4K 2X9WA 1FFPB 4XGZB 1Q72H 1MHCB 1RMFH 1BEYL 1EZVY 1B6DA 1JPTH 4XHJD 3QAZC 3QO0A 2WSKA 3KYNA 2EEDA 4X7TB 1ZHNB 4JEGB 1ZWIB 2VRAA 4I0PD 2BVYA 4OZHE 2AK4B 3CIQA 4K07A 1AO7D 4ODSL 2Y5TB 4I77H 2CKBH 5TE6L 3NTCH 1R3IL 5DJDB 1NFDE 2HLAA 3RFZC 4MA3A 5HGHA 1QD0A 4F2MA 5J1AB 3TEUA 3S9DB 5T3XD 1T03L 2V5SA 1VPOH 2H8PB 2PF6A 4GAFB 4LCWE 4WW2C 2DQUL 4WJ5A 1KN2L 5HYJE 2YEZA 1G0DA 3DX9A 3DRTB 3O6FB 1S3KH 1LDSA 1FZKA 3D69B 4Z0BL 5IW1A 4JRWA 2ED8A 2MQCA 4QYOA 1ORSB 4YZFF 3CU7A 2P5EB 2NY7L 2WBJC 1G7PA 3G04A 2CR3A 3IU4H 5E7BA 4G8GB 3KPRE 3LHPH 4F7PA 4UOW1 1J0YA 5ABDE 4MS8D 2HN7A 2P42B 4NN6B 4F7CB 3SDDC 4F9PA 3C60D 2V6HA 1Z9MA 4LU5L 4P2RD 1C7TA 1JHKH 1LE9B 4ORGA 3VJ6B 1T7WA 4GBXC 2EEAA 3HN3A 1XGQA 3GSRB 3VFTA 1VADA 2PR4L 3VGDA 3VRJB 3MV7A 4NGHL 1WAAF 1R3KB 1L9NA 1GPOL 1FNEA 1ZA6A 2MKWA 32C2B 4KZEL 3VMPA 2AJUH 3MREA 4MD5B 1OP9A 3W11D 5IMKA 2MHAA 4ETQB 4ZO7A 3SBWC 1CBVH 1WGOA 1F5WA 2XZZA 4HS8H 4MYWB 1EFXB 1TDQA 5ADOH 2FHBA 3UCRA 4BQCA 1KN4L 3B3IB 2GTZA 3QDJB 4PLKD 1EDQA 4XXCA 3BZEA 1IAKB 1NCNA 1U8JB 2I9TB 3G6JA 3LAFA 2ADIB 3GJEA 1FVEA 3FRPA 4HT1H 4ZXBA 2YD8A 4QT5A 1B0GA 4JPVH 3O81A 1GGYA 2D7TH 4S1DC 5E2UL 1RPQA 4GKZB 3MCKA 2VUOA 1EMTL 4Y4KA 2HWZL 1CLCA 3VWKB 4OCWH 2G2RA 3JSSA 4ZFFB 2AEPH 3UPCA 4NPYB 5FCSH 3BVNA 4M4PA 4J3SA 1NMAH 2FO4B 2GJZB 2AJYL 1GL4B 3SCMA 3QWQB 3QG7L 1MJJB 3RQ3A 1G6VK 1CL7L 5KG9B 1DL7H 5BZWB 2NY3C 3H9SD 3D2UB 2IPKA 4K94H 1UQSB 4LKCA 2J4WH 1CGXA 5HHPB 3LKRB 3TGXA 1NJ9B 1I9EA 2Z91A 1ND0A 3CH1A 2VAAB 4KKAC 4OM1H 4P23A 4J7RA 3LOWA 3MLVH 1ZLSL 5T1DL 5GSRB 1EERB 4JE4B 1F8TL 3RDTB 2P47B 4OD2B 1FP5A 5D71L 4XI5D 3PF2A 3VXRA 4ZDHA 1XF5B 4CU7A 4AL8H 3BH8B 2X5PA 3PHSA 3QEQB 4H26B 2DTMH 4I18B 5D70L 2ADJB 5F1OB 4X83A 1FRGL 1N5AA 4H1LB 3NGBB 3NBNA 4YDLC 4U1JB 4NZTH 1HEZA 4LPCA 3ZL4H 1RURL 2BVTA 4NO0D 1BJ1J 1TCRB 3D3VB 1PKQA 3U36B 4WWID 5D1QC 3TH4T 3NH7L 5DRNB 1MFAL 5F44A 3RA7L 2LE9A 4KY1H 1CLOL 2EDJA 3WHXB 4MDIA 1INEL 2IPTL 3F12B 5F7EL 1D6VH 3BZ4A 5L6YL 3BQUC 3D5OF 7CGTA 1JUFA 4QHNA 5GRYA 2P8PA 4JDVA 4D3CH 3SJVD 4E5XB 3D6GA 1P6FA 2BHUA 3VXMD 2WWKO 2HTLC 3JV5A 4B50A 2BC4B 4JREC 5I1CL 1CXEA 1ZKAA 4L9LA 5HJ3B 2AJSH 4I9WD 2DBLL 1QFWI 3IU3B 4N0FA 5GS2D 3P30H 1UXSA 3CJJA 3TO2A 1JWSA 4PY8I 5FOBA 3O11A 1EUUA 1OPGL 4NJAH 1A7OL 1LQSR 3WO4C 4A6YB 5L0QB 3CH8A 3GHEH 3ARGC 4JKMA 4WNQB 1MFBL 2P8LB 2ZSWB 4J3TA 2X44D 3X3GL 2PYEE 1XGYL 1Y6MR 3FB7A 1A1MA 1BF2A 3BP7A 4NOFA 3VGBA 2H1PH 4K2UH 2R0KL 1MFDL 5DUPL 3GRWH 4WFGD 2J6EH 2YOCA 5FGCB 3H2WA 2A2QT 2VDKL 3V52H 4D0DA 1ZT4B 3T4YB 1OVZA 1C5DA 2Z31B 4HFWA 3BEVA 3B6SA 6FABH 4K3JH 3X3FH 1IM9D 1N26A 2ITCB 5C9KA 2X4UA 3F7PC 4YDIL 3L3JB 5CFHA 4P5KB 1FORH 5T1LA 5DJ0B 1DN0A 4YZFE 5F1NA 4K7PX 1IL1A 2CLRA 5D5MF 3O6ML 3QDGA 5CINL 3OMZA 3F7YA 1XH3A 4L3CB 4WFHD 4N0YH 4H1LG 1OLZA 3O3DA 2AQ3A 5E8DH 4PJDF 3TYGL 2BVQA 1Z5LA 2QQLL 3QUMH 2F53A 2FH6A 1WFOA 2VXTL 3SDDD 1F4XL 3H3PL 2G75A 4Z6AT 1XF3B 4EUPB 5ICXB 2XA8H 1U6AL 2EDRA 4GBXD 4YHML 5D8JH 4JFFB 3P9LA 4R7DA 5ESVB 5F8RC 4BSVA 4LRNL 3H7BA 3B5HA 5I1EH 3OBAA 5B3NA 3EYSL 1WAAE 1I1AB 4QHUA 3VFPA 3VW3L 1OT2A 4UINL 5I8EA 2DD8H 1KFAH 3MLUL 1MRCL 3MRBA 3MV9A 4IIQB 2I07B 4D8PA 2D03L 2R56L 1X5FA 1FNGB 1LHZA 3D85B 5DJZB 4LARH 3HMWL 4EVNB 5IB1B 2HVKA 3KLSA 1AO7E 3U30C 1T7VA 4KRMB 5C7XH 1OAKL 2FRGP 2I9LB 4PRBB 4OUUA 1BECA 3DXAD 3I85A 3PGFH 5ITBH 1R0AH 4S1DD 5C0CD 5T3XE 3CU1A 1L6XA 3TFKD 4FMKA 5M94B 1MWAA 3DX6A 3S98A 1T20A 4X6DA 3HC3L 5J12B 1T2QH 3S96A 1L6ZA 1VACB 2UUDH 3O2VL 3V6FB 1KEGH 1X3DA 2VDLH 1WZ1L 4JKWA 4XX1E 3K2MC 5I1IH 2NY3D 4J2XA 3ARQA 3EOTH 4R26L 4P5TB 3OKMB 4S1QL 5F7UA 3QNZB 3AXLA 4WW2A 3T4AA 1JNLL 1VEOA 4PJGA 5DGRA 1OQOA 4HJJL 4RX4A 2RQ8A 4KKAD 4EN3C 1XCTB 1XGRB 2AK1L 4L8CA 4K94C 3QIWB 5I8KH 5K9OB 1IM9A 1JZ6A 4OLEA 2DQEL 1HSBB 2FJGA 4RIRA 4E9LA 5E56A 3IDNB 5D7IB 4WWKB 2WBJA 1K6QL 1AD9A 3I2CH 4JZJA 1LGVA 4P2RE 2B2XL 3WJLA 1XGUB 3WMSA 5LGHL 1GHFH 3UJJL 1UH3A 1BHGA 4X6CF 4GRWH 5IEHA 1MPAL 3S7GA 3I6GA 4U1LB 1NFIB 5C8JA 5D1QD 5IT2L 3VFNA 1F90L 1AXTH 3DUHA 5FGSA 5A2KH 1KPRA 4EUPG 5KJRL 2D31A 3QO0B 5DD6A 3KYNB 1KG0A 3BQUD 3BXNB 5IHBA 5IM7A 4U05A 3SDXF 4X7EC 1B88A 5D2NA 5JLZB 2ZCKH 1UG9A 1KCLA 3LPGA 1BBDL 4OM0L 1A0QH 4K7PH 4PJEF 1JTOA 4RFOH 3U0PA 2X9YA 1G0XA 1WZKA 4XNMB 2HLAB 3T0WA 1RAMA 4MA3B 3ZKSD 4I18C 4F2MB 3DROA 4IHOA 3LB6C 1H3TA 5I19H 3NN8A 2OTUB 3Q1SL 4WJ5B 2XV6B 5JPMB 3BE1L 1JVKA 5DVKA 1JWMB 1UJ3A 1KEMH 4EI5C 3DSFH 4JCMA 3DX9B 4P57A 3DXAA 3TZVC 1A1OA 4LEXH 5FYKH 1FZKB 4FHBD 4ONGL 5KSVA 4QYOB 3JXAA 4ZS6C 5EBWA 5FYJU 2EDQA 3H9SE 3KLAA 4OT1H 5DFTA 1G7PB 4YXKL 5IB3A 3PQYD 4OLVL 3F5WA 4ZSOA 2PXYB 5E6YA 4MXWH 5DK0B 3TYFA 3UTPD 4AIXA 1XGPB 1D9KC 4KJYA 3L5WA 3GKZA 2C1PA 5DDHA 4K8RH 4B7LA 1H8OA 4P4KC 2C1OA 3TJEH 1HHKB 1I8KA 5DZNA 3ULSB 3LEYL 3T0EA 2A6JB 5GGSY 4G43B 1JCKA 3FKUS 4ORGB 5IHUH 4NQDD 3UX9B 4MJIA 4JQIL 4KQ4L 1TQCB 5C9JB 1XGQB 2FX8L 3C6LC 3EGSA 3VFTB 1W2KT 3X13B 2VH5L 4EKXA 1LO2H 3DTXA 3MV7B 4QLRA 1RZ7L 3PV7A 1OL0A 1JF1B 2VDOL 3PIQB 1DQDL 2LFGA 3PP4H 1FNEB 1ZA6B 3RJQB 5L0QC 3MREB 4AQOA 3FONB 3KPNA 4P9HL 1WBXB 3U9PH 4LVHC 4GLRH 3QFDA 5T3XL 3IKCA 4JJHA 2AK4D 2R0ZL 1OTUC 3O6KH 3WNNA 4PJDE 4NZDA 1IKNC 2GTZB 4RA3A 4L3EB 1GC1L 1MLBB 3Q6GL 5GGUA 3SJVE 5DD1L 1NBQA 3G6JB 3GJEB 3VXME 4B5EA 1FVEB 1F4WL 4OI8A 1B0GB 4KKCC 1FPTL 5FECA 1JV5B 3BQUA 4GRLC 5KSAA 4CJ0A 3K2UL 3MCKB 3LSOA 4I9WE 1G9ML 4P4RA 4S1SL 4X7SL 2CKNA 1ADQH 2G2RB 3HA0A 3BD4A 4JHBA 1Z6JT 4Z5RB 2P5ED 4JY4A 3RZCA 4DVBA 3S4SA 2W91A 4G8GD 1FBIL 5T1KD 1C8PA 1LEGB 3WL9B 5KTEL 2NQCA 1TCMA 4EOWH 5B8CA 3F6LA 4QRUB 4HK0A 1CDYA 5AYUH 2Z91B 1ND0B 3MOAL 1AI1L 3SGKA 1M7DA 5BVJA 5DO2C 4X6DE 3MA9H 1MJ8L 1NCCH 3ARGA 4WFGE 3DGGB 3VXRB 3H42L 4ZOAA 1LO0L 1EIBA 3ZKXC 1JPFA 4ZTOH 1HSAA 3PUCA 2W38A 4HK3J 3P77A 5I15H 5ALBL 4RZCA 1BFOA 1TXKA 2W65B 1I1AC 1YNTB 2B0SH 1PKQB 4BSWA 3ARFA 4W6XB 5JIKA 1DQMH 4EN3D 5I6XB 1S78D 1UENA 4Z0XA 1HHIB 3WV0A 4ZPVA 3RWFA 3QISA 1JF5A 4WFHE 5GJTL 1IAOA 1CG9A 4MDIB 1DN2A 1P5UA 1LP9A 3DV6B 3R1GL 5A1AA 3JVGC 2FATL 3KPOA 4KH2A 1X5HA 2VLRA 5DJ6B 3UO1L 4QHNB 4XZUA 3MYZA 3HRZB 1M05B 3FT3A 4L29A 1J87A 2VNCA 1JGUH 4HK3N 1HKFA 4YHPA 5BOZG 2QEJA 2ZUWA 2WQ8A 4K3HA 1J9CT 4XWGH 5INCA 4JVUA 2FIKA 3WEXB 4X6CE 3L3IB 1P7QB 3BZDA 2E7LC 4N0FB 4NZRL 4MA8H 4XNUH 1UXSB 3W2DH 3ZTJG 2NY6C 2VN4A 1EGJA 1TZHB 2Z8SA 4UT6L 1TZIA 3QHZL 4LRIC 5LQBH 1L0XA 3O11B 4R3SB 3D2UD 1VEPA 2V7HB 5FCUL 3LH2L 4X0KB 4HG4K 4M6OL 1A02N 1URLA 4UV4L 3CDYA 3OX8B 1Q9WB 2YPLA 4RGOL 4XBGA 1G9NL 2XN9A 3SDXE 3RDTD 3TESA 4XNYL 1PDKA 3FB7B 4DVRL 4RDQG 4PJEE 3BP7B 2Y06H 2C5DC 5D7SL 5EOQL 3MODH 4JZOA 2HT2C 2ORBL 3V0WH 2YD6A 3KPSB 3NCFB 3LB6D 4XBEL 4MA1C 1JF6A 4Y5XA 1NKOA 5C0CE 4D0DB 5I9QC 1M6OB 3H9ZA 3RBGA 1C5DB 3FN0H 2CGRH 3MRCA 3N1QC 3T65A 3BT2H 4HFWB 1HWHB 1WSST 3BEVB 4TSCH 2OK0L 4GMSL 5TH2B 3RWIA 4XMLL 2OSLA 1EHLH 2E5EA 3VGAC 4EI5D 1BVLA 3KGRA 3D3VD 3TZVD 3ZT5A 4PJHB 5DEFB 4M93B 4LSPH 4ZS6D 3UTSA 1A3RL 3EFFA 1JHLL 2VISA 2YUXA 3SE4A 1IL1B 3SY0B 1LVEA 3D39B 3QDGB 1W72H 2AS5M 3F7YB 3DLQR 3O3DB 4P2QD 1D9KD 2VSCA 4M5YH 4MZ2A 4G6KL 4MQXD 1GAFL 1QO3B 4P4KD 1E6JH 1Z5LB 2DQGL 1G7IB 1MOEA 2G75B 3HS0B 3WLBA 4P46C 3L5XH 3ZE1E 3L3KA 3E2HC 1FVCA 2EH7H 4K8RC 3EYUH 2XWJB 1KJ3H 3OKEB 5H2BA 3MRJA 4FABL 1C5BL 1WQVT 5F9OH 1RZGA 2DL9A 4BSVB 5EU4B 2JIXA 3RY6A 5IG7A 4DZBA 3SQBA 4GKSA 5DVOA 2UWEB 3QB7C 4GXUM 4OCXH 3VFPB 5CIPB 4PLNC 1P1ZA 4IJ3C 4Z7VB 5F8QC 1DQJA 3P9MA 4AG4L 1LE5A 2NNAB 4JRYE 4JY5H 4MAUH 1OTUD 4LPYA 3MA7A 4D8PB 4RWYH 3BPOC 1IC5L 4XAWL 4ZAKC 2PXYC 4AJ0A 3NA9L 4EIGB 2FYYA 4Q9QL 2BRQA 4M5ZH 3TVMA 1AP2B 2IG2H 2Q7YA 4OUUB 3ARWA 2ESVA 4KKCD 2DYPA 3LS4H 3AM8C 5L7XL 3TA3B 5ESAA 2PW1A 5ESQA 2F9BT 1WZMA 2EE9A 4GAGH 2CJUL 1EVUA 2J8UF 3R0NA 1CGWA 3HC0A 3EIFA 3GK8L 4O9HH 3UJIH 1MWAB 3DX6B 4XP9H 2X4SA 3OKNA 3OXSA 4R8WH 4W4OA 2WWKT 5KOVC 4HUKB 1QKZH 3LY6A 5HHVL 1YYLH 3EKCA 4OFYA 3TT1L 4EDWL 4ODHL 3T4AB 4WHDA 4UBDC 1TZGH 4LPXA 4XB7A 3PQYE 3IDUA 1QEWB 4L8CB 5DO2D 5F3BB 3MRIB 4IDJL 1A4JA 4JM2C 4MNGE 5JIIA 3QQNA 3UTPE 3O8XA 1AKJB 2FJGB 4RIRB 4OLYL 3HI5H 4WTZA 3MOBL 3U1SH 2AJVL 2X4NA 4OAWA 4NO3A 5HHNB 3VFOA 1OGAE 4JZJB 5IMMA 2CDGB 3OJDA 2YSSA 1FSKB 4Y7MA 2KKQA 4F58H 4WUKH 1Q0XL 4D0BA 4CAGA 4NQDE 1YYMH 1C7SA 1KCRL 1U8OA 1ZE3C 5DUML 3TJHD 4TUKH 1I1AD 1BAFL 2Z35B 2B1HH 4EIZC 3QUZA 2J6EA 2L7UA 3NFSH 5C8JB 2NLJB 1CIUA 2DF3A 1VFBB 5C08D 2LQRA 5DJAB 3C6LA 3CXHJ 3OPZH 3VH8A 4LCIL 4NYLA 3VDCA 5DD6B 5BVPH 5C1MB 2AK4E 3D85D 2VITA 1ZVSB 5IM7B 4RFNC 1QFWM 1T83C 5BQ7A 4PR5A 3WUWB 4OB5H 4X99A 1NCUA 4PJCA 4YPGA 2VERN 3U0PB 1TTGA 2XPGB 4HCRL 1N59B 4MLSA 4TUJB 4HIIB 1A21A 2IJ0C 2YA0A 4WENB 4JM4L 1KJ2H 3MRRA 3S34L 1QNZL 2QQNH 1ZSDB 5J6GB 5FF6A 3HNSH 4LHQB 4UV7L 2EH8L 1D5BB 2NY6D 1U8NB 4FQXA 4HBCL 3UTTA 4DKEH 3MLXL 4HMEA 1K2DA 1CICA 4MA7H 1CXLA 3N9GH 4P5TD 3TLRA 4P57B 4PTTA 4FQ2H 5A2IH 2P5EE 1T1ZB 1W0VA 4GRLA 3I6KA 3GJFH 4JO2L 4JDTH 3WHE1 3PNWA 4G8GE 5FO7B 4OKVA 5I6XC 4L4JA 1NL0L 3KLAB 1FGNL 5E99L 3RIAF 5DT1H 5SV3A 1N5YH 3Q2CA 3WFCL 2XG5A 3F5WB 4NKMA 4Y0GA 4LSUL 5DRZA 5LG1A 2ZPKH 4XH2A 5TF1H 3TYFB 3M17B 3D25B 4KJYB 3L5WB 4I4WA 3G9AB 1UZ6F 1CGUA 5CSBA 4XVUC 4KU1A 1NSNL 2XXMB 4RMRA 3ZDZF 1T4KA 2ZUUA 5A16A 1G7LA 2ILLA 3NCYS 4JFZL 4LIQL 5ALCH 1C12B 2ZSVA 5BMFH 3GMNA 4MJIB 2P5WB 1A6VL 1YEKH 1QQDA 1TETH 5BW7A 2VZOA 2C7UA 3DTXB 5FYKD 4Y1AD 1OARL 2NMSA 5CD5C 5TE4L 2YKLH 4YQXL 2YRPA 2Z9TA 3B9EA 5E5RB 3U46B 3QFDB 2X4TA 3GBML 3MRHB 3W9EB 4HUVA 4LSTL 5F7LB 4MMZC 5J11B 1B2WL 4P46D 5JUEL 4K8RD 5I18L 5IESL 5GGUB 1JYVA 1CXHA 3CXDH 1CD9B 1SJEA 1OWRM 1Q72L 1RMFL 4TVPH 5FECB 1JPTL 2G9HA 5DR5H 1FFOA 2QSTA 3K46A 4GS7C 4NKOA 3LSOB 4DKDC 4GRWF 4GLRI 3MLSH 5EBMA 3O2DH 1BJ1H 4I77L 2CKBL 4C58B 5JIPA 1N2RA 3ET9F 2VQTA 3MFGB 3CSBA 3NTCL 3B4NA 3QUXC 4NQSB 4JY4B 2BCKA 4DVBB 3BWAA 2V7NA 2D2OA 2E7LA 4ZAKD 1VPOL 2PXYD 4FTVA 1F58H 1QHOA 4GAYA 2ZG1A 5B8CB 1NGQH 2KL6A 3IFOA 1U95A 5SX5K 2X41A 1IEBB 2YK1H 4GSDH 4HH9A 1C16A 3ARVA 4IOFC 4JRXA 4XNZB 5C09B 1S3KL 3L1OH 4I1NB 1N6VA 3VXUA 1JPFB 2J8OA 4I3SH 4RMTA 5EFIB 1HSAB 3O3EB 1CWVA 2H9GA 2J8UE 3IU4L 1OCWH 2ZKHH 2APVA 3IS1X 2D3VA 3LHPL 3LQMA 4HC1H 3P77B 5J13C 2VQ1A 3D3VE 4KXZH 4RZCB 1BFOB 3B8SA 3MLWH 5EORH 4CMMA 2ENSA 2FH8A 3BJ91 3FFCB 1YN7A 4QEGA 5DHYA 1MCNA 1Y6NR 5CP7B 4UBDD 2HJKA 2NW3A 4UQ2B 1JHKL 5HYFA 1CR9H 4CNIB 1IAOB 1CG9B 4P2QE 4ENED 2YD9A 1LP9B 3V4VH 2AAVA 1QLEL 3G6AB 3KPOB 4B41A 2VLRB 5KBNC 2H6PA 4XZUB 4WI3A 3NCBB 3FT3B 4PRHA 3GM0A 2LAGB 2AJUL 1IZJA 4HPOH 4ONHA 2VLLA 1CBVL 5INCB 4I48B 3U0TA 2FIKB 4HS8L 5BOPA 5ADOL 3FQRA 2GIYA 2BHZA 1U3YA 2LU4A 4ODUA 3V5HA 1WFUA 3C8KB 1E4XI 1TZIB 2XQYK 4Q2ZA 3R8QA 4IS6A 5AAWA 5B3JF 2J3SA 4HT1L 3M8OH 1I7ZA 3ETBF 5GS1A 2D7TL 3SGJC 4XBGB 3BPLB 4MNQD 3ROOA 2AEPL 5FGCE 5EIVA 2YBRB 1VFOA 3BESR 5CS7A 5JR1H 2D4DA 3EOYG 1NC2A 1NMAL 4CGTA 1Z0NA 4LSVH 4ZAKA 1DL7L 1FSKC 1A6TA 4K94L 5MEOA 3D9AH 2QADB 2J4WL 1UJTA 3QO1B 2OSLB 4QTHA 4OM1L 1BVLB 4UNUA 3MLVL 2QSQA 5CBEB 2VDRH 1UM4H 3AM8A 2AKRB 5JHDB 4U49A 3UTSB 5EOTA 3QXDA 5LKNA 4WO4A 4AL8L 3RUGB 2DTML 1Q38A 3VRIA 1W0WA 3HPJB 3QEHB 3LQAH 5IOPA 4Q6IA 1EEYB 4FXKA 1J8HD 1N0XH 3SKOB 4NZTL 4OV6F 3NCCB 3RPIA 4XVUD 1DEEA 1UZ6E 3ZL4L 3MXVH 2IH3A 3ARBA 1MCJA 5CBAA 1KPVA 4Y4FC 5BJTA 3ULUH 1UXWA 1FVCB 3WXWH 5E00B 3ZDZE 3BPCB 3LKOB 4UILL 1P7QD 5EIIB 4IM8A 4JM2A 1JHTA 3SDCA 1RZGB 5IG7B 3P2TA 3DO7B 1A64A 3AAZA 4YAQA 3RWJA 4KY1L 5B39A 4BQ9A 3OR7A 4NC0B 4NBYB 1D6VL 4MD4A 4PJ9C 5JQ6H 2ADFH 5CD5D 4D3CL 5DC9B 2PKDA 5C08E 3DV4A 1DQJB 2E9WA 1LE5B 3UJTH 2H2PC 2F15A 2P7TA 1OHQA 4JFYB 3MA7B 2AJSL 4LNRA 4I3GA 1F6AB 3S3SA 3KPSD 5IMLA 4X4XA 3P30L 2FYYB 3D0LA 3QIUA 1BQUA 1BP3B 2NYYC 2Q7YB 4OFPA 3WNKA 4NJAL 2DYPB 1LEIB 3TF7C 4GG6B 3GHEL 5ESAB 3IJHA 1SJHA 3ESVF 4YR6B 2X2YA 4KJPC 1KYOJ 5ITFB 1RZFH 4GRWE 3QUXD 1P53A 2X4SB 2ZUQC 5EC2B 3OKNB 3RVUC 3BX7C 3OXSB 4K2UL 5IB5A 1I8IA 3HG1B 4OV5A 2K7QA 3GRWL 4N5EC 3T2NH 1EV2E 2J6EL 3D39D 4LLMA 3SGDH 2ICWA 1RD6A 1J0IA 4R7NA 4RMVA 4DUVA 3TH2T 1YEDA 1T22B 4OFIA 4YJZL 4KDTA 3L6FA 1GGIH 5CD3A 3L3OB 2XZCH 2VL5B 1BFSA 2IQAA 2F54D 6FABL 1A4JB 4K3JL 3X3FL 4IOFD 3QDAA 5INDA 1T6VN 4CRPA 4D9LH 3O8XB 3HMXA 4CVUA 1U3JA 3QEGH 1UM5H 2NX5D 1FORL 4Z78B 2X4NB 3EO1A 4UQ3A 2EDHA 4OAWB 3IKKA 3VFOB 3OJDB 3CFBA 4D0BB 1J8HA 1U8OB 4N0YL 5E8DL 3LV3A 2FX7H 1QSFB 3QUML 1RIVH 3QUZB 1A5FH 3P4OB 5HYSA 1YEHH 5FYKE 1Z3GH 4Y1AE 2O26U 5IHLB 2W0LA 3QA3A 5L88H 2K3TA 4PJBA 3RWDB 2EE3A 2XA8L 3WS3B 5ECJE 2DLTA 1UWXK 3VH8B 5D8JL 1MFCH 2VITB 4K23H 3GMQA 2VLKA 3KR3H 3BEWA 3NAAH 5I1EL 4YDJB 3O45A 5FA3A 1T0MB 4X99B 4PJCB 5CZVH 4YPGB 2V5RA 5DRXA 1Q9OA 3TA3D 1RHHB 4GH7B 5C0BD 4FFZH 2O61A 2PTVA 1IJ9A 1ORQB 2NXYB 2VYRE 2DD8L 4WUUA 1BZQK 1KFAL 2BNUA 2OTWB 1IAII 1QRNB 2ICEA 5C71A 5L2JA 1DBAH 5FF6B 1J0ZA 4P48A 4AY0A 3DIFA 4FQXB 4G9FA 4PJHF 5I2IA 1HKLH 1MRFH 1MI5B 4LARL 1K2DB 2HFEA 1CICB 5C7XL 5GGTA 1TITA 3EBAA 4DN4H 3GSQB 2APWA 4XMPH 3UYPA 4GG8A 4PJAA 1W0VB 5B3JE 2Q3ZA 3HCVA 3PGFL 5ITBL 3PABB 1R0AL 3PNWB 4OKVB 3KYOA 5E6IC 1ACYH 3WNOA 2VZ3A 1AKJD 5MEPB 3WN5C 1XGTA 3A6BH 4NQTA 3ARRA 3D48R 1VFAB 1T2QL 3HKFA 3WFBH 4I4WB 1KEGL 1XFPA 4MCZA 2VDLL 3KXFA 1NMCC 4P2CG 4P59H 5I1IL 2VZSA 1I4FA 3EOTL 3S97C 1T4KB 2E8ZA 1NKRA 5A16B 5KN5A 3QXAB 4J3XA 4QF1A 2ZSVB 3VDAA 3GMNB 2UWEF 5I8KL 4RNRB 1EZVX 3SDAC 1QQDB 3C5SA 4P2OB 1RZIA 2FB4H 3KWWA 3ROLB 4Z7VF 3MTRA 2X4QB 3EO0A 3BD5A 3LRGA 5J3HD 4WTZG 3VCLB 5ADPH 4XPBH 2K9UA 5FYLH 3I2CL 2IC2A 4TULH 4LLWB 4QRQA 2DLIA 2X4TB 4HQQL 5K9KA 1GHFL 4KAQH 1JGDA 4YK4B 3BPLC 1Z9SA 3LQAC 5C0IA 4HUVB 5IQ9B 3SOBH 1ZVYA 2EKSA 3KDMA 1Q1JH 3ARTA 5EU6A 3TBYA 4MX7B 5HGAA 2J5LB 4Y4FD 1M1SA 1EO5A 2BK8A 5D93B 1UWGH 4YLQT 1GGUA 3TT3H 1VB9A 1S7TB 4QHMB 1AXTL 5FDWB 3ULUC 1ZT1B 2BVOB 4HEME 5EC1B 4XNXH 1A3LH 2G9HB 4U0RC 3VH8G 1FFOB 4PY7A 4PJ9D 1TENA 2V2TB 4GAJH 5TDPA 2PNDA 2QKIB 2B1AH 2ZCKL 4ZQKA 4Z7QF 1A0QL 4RFOL 4OLZH 5C0BA 1KNOA 1KIPA 3EDFA 2H2PD 1ZT7A 4POYA 3BWAB 2BP3A 2V7NB 3SKUD 4GXVH 1NCBH 4N9GB 2FD6H 2JB6B 3FN9A 3TPUA 2LABA 4FTVB 3K1DA 4L4VB 5E8PA 3O3AA 5I19L 1K8IB 1R5IA 4GAYB 4Y16C 4DKAA 3LRHA 1ZHKA 3IFOB 1FZJA 4MNQE 3QPXH 2OJEA 1W8NA 1GOGA 2NYYD 4HH9B 1C16B 1KEML 3ZZ1A 2XICA 2ATKB 1UYWH 3DSFL 3IB4A 1MIEH 4LEXL 5FYKL 4TVPD 1S7UA 3E6HB 2NY1C 2P5WD 1HILA 5EZLA 4OT1L 2H9GB 4U6YA 1T7XA 2L7JA 4RQQB 5IKCA 1PBYA 3RVUD 3SPVA 4FQPA 4MXWL 5FEBA 4N5ED 1MJ7H 4K8RL 4CMMB 2NZ9C 2CK0L 3QXWA 3TJEL 3FT4A 4MAYA 4NKDB 2VABA 1YN7B 4BH8A 3V7AG 2FWOB 2HJKB 3THMH 1T1YB 3OAYK 4LVOB 3DMMC 5JZ7C 5IHUL 3C6SB 4KK6C 5ISZA 2R0LH 1DZBA 3ARDB 3FZUD 3OKLB 5IR1A 3QEUB 1LO2L 1JE6A 2H6PB 1DFBH 4O51A 4CMHB 2CO6B 3PP4L 4BKLB 5J7CC 4LSRH 4R0LC 3AREB 2MKLC 4U6TA 3U9PL 3GMOA 4J6RH 1SY6H 3U0TB 1FYTA 4F9LA 2IAMB 2J88H 3FQRB 3O6KL 3DVNB 2AEQH 4Y4FA 1M7IB 1QBAA 2Q8BH 4ODUB 2AXFA 3EJYC 4Y5YB 4PRDB 5EZOH 4Q2ZB 5D1ZA 1ZGLP 5GS1B 3LRSA 4PJ9A 3IS0X 5C09D 1ADQL 3KPSE 3ROOB 2RAMA 1L4IA 1QPXA 1IZKA 1QTYT 5EIQA 3VMOA 2ZOKB 4BQ8A 1NC2B 2X42A 3ALXA 2JCCF 4LLYB 1CGVA 3RVTC 5JPNB 3IAQA 4ELMB 1NGYA 4LLUB 1A6TB 2HLFC 3BYYA 3STLA 3R4DA 5MEOB 2P46B 4GKOA 4EOWL 3VGGA 4PJHE 4QRPD 5AYUL 1RUMH 3FFCD 1GJIA 4TSBH 4Z8FH 1J8KA 3MA9L 2V2WB 3G9VA 5FKPA 1NCCL 4XPHH 3D39E 5EOTB 1FV1A 4Y19D 2BOBB 4WO4B 4ZUTB 3H3KA 5E6ID 1W0WB 1CFVH 4ZTOL 5IOPB 5IROA 3WIIH 4Q6IB 2HT3C 4LDLB 5F6IB 1XIWC 2PO6A 43C9B 4X6EA 4FXKB 1H3UA 4GXUN 2F54E 3IFPA 1RZKH 4DZ8B 3CC5A 5I15L 2BNQA 4KVNH 4ZOBA 1MCEA 3RPIB 1DEEB 1CGYA 4MJ2A 1JPSH 2IH3B 3ARBB 2NX5E 1KPVB 2B0SL 5CBAB 5BJTB 1IBGH 5GJSH 2B5IC 2I26N 1HQ4A 1A14H 4U7KA 1DQML 1KOAA 5GGRB 1OOAA 4J3WA 3SDCB 2UWEE 3RWJB 3PWNA 3SDAD 1HN1A 3BKYH 1I9JH 4C56D 4MD4B 4HIJA 4NIKB 1V7MH 1TJIH 4Z7VE 3B5GA 3RL2A 2GUOA 1CDCA 4YHYB 1JGUL 1JGEA 3DV4B 4G6FD 4YIQB 4XWGL 2R0WH 1LO5A 4HIEB 4HC1A 4LNRB 1DVFA 4MA8L 4K3GA 4FQ1H 4LAQH 2YN3A 4X4XB 4XNUL 5GHWH 3W2DL 1T5WA 3ULUD 5E8EA 4ZPTA 5GS0H 5LQBL 1X6NA 1UEYA 3B5TA 4WHYG 3L3DA 3IJHB 4PGCB 1SJHB 5I17B 1BVZA 3MUZ1 5IBUB 2FIRT 5JHDD 4BFGA 4Z7QE 5DJ2A 1RHFA 3AY4C 1JNJA 2Y06L 4OCNC 3MODL 5T5FH 1I8IB 3MO1A 3V0WL 3JV0A 4PY8J 3QQ4A 4JFDA 2XA3A 4LLMB 4OZGB 2APTA 4R7NB 4PRPD 4Y16D 5MEND 1AY1H 4YC2B 3V4UH 3L6FB 5FGRA 5CD3B 2CGRL 3BT2L 1X6LA 4TSCL 2IQAB 1MF2H 1FC2D 1EHLL 1MCCA 3SEPA 5FUCC 2C3WA 3DUSA 3ZKNC 1FN4A 4RFEB 1RULH 3BHBB 3BN9C 4LSPL 1A3QA 3QWOB 2NY1D 3EO1B 4UQ3B 4JQVA 3WN5A 2DBJA 1H15A 2E8YA 3AFLA 3G5YA 4NO2A 1I1FA 1W72L 1FLTX 1JI1A 4M5YL 3V6OC 3M1BA 4F7MA 1Q94A 3CVIH 1RUKH 1E6JL 2NZ9D 3LD8B 4FQQB 4NRXB 2YD3A 5H37H 4JZNA 5FXCH 3QA3B 3L5XL 2XTJB 2EH7L 4PJBB 2Y07H 3KPLB 1G7HB 3EYUL 4OZ4B 1KJ3L 5IFJB 3B8YA 1G9EA 3CVHH 5JZ7D 2JJSC 1G1CA 2CRZA 5F9OL 1XEDA 4KK6D 4OGYH 3EDKA 4OTXH 5H94B 2PCPA 2A6KA 4YFLI 4U1MB 2BSSB 3O45B 2Z8RA 9CGTA 4OIBA 3RWHA 5EZJA 1E28A 5DRXB 4OCXL 3WKNA 3FTGA 1NUFA 2A6IA 3ULUF 3DHMA 3V6ZB 1XF2B 3NZ8A 3G5VB 2H32A 1MVUB 4JY5L 4MAUL 4NZUH 2ICEB 1I7RA 5L2JB 4E42B 5D7JA 4JO1H 3P4MB 4RWYL 5FIEA 3QJFA 3DIFB 4G9FB 2WANA 3EJYD 4NN7B 5HVHC 3AB0B 3IRZA 2HFEB 4HD9A 4J8RA 3RUGF 2X70A 4M5ZL 5D1XB 2IG2L 3IJSA 1KB5H 1RZ8A 5AUMA 1DUYA 3C5ZA 3IAPA 4LVOC 4OF7A 2N4IA 1A9EA 3QDMA 4HWZA 4QWWC 4GAGL 2D4FA 1CTNA 1FGVH 3QG6A 3S5LB 3GMRA 4O9HL 3UJIL 3MFFA 1A6ZB 2F74A 3PP3H 5IBUG 3QCVH 4G6JH 4XP9L 3U6RA 2A6DA 5CLTA 1NGXA 4R8WL 4XPAL 1A6AA 4BELD 2GT9B 1QKZL 2JCCE 1MUJB 4TVPE 1YYLL 2HLFD 5HPOA 1I4FB 1YUHA 3AREC 3E3QE 4Y16A 5I1JH 2P5WE 1AQDA 4PGEA 3UROR 3U9UA 4P5MA 2GY5A 2R15A 5EU5A 1WZLA 2IAMC 1TZGL 1QSFD 4M7JH 5DK2A 2YHGA 4PGDA 3O0RH 4X5WA 1CT8A 1RZIB 1OSPH 4Y5YC 3TNNB 3KWWB 1NMBH 2R1WA 3HI5L 4QOKD 2XT1B 2GJJA 3V5DA 1IQDA 3EO0B 4KRNA 3U1SL 5FO9A 5CJ5A 5D96B 1XIWD 4QRQB 3L9RB 1UH2A 5E9DB 4LCYA 4F58L 4WUKL 1YY9C 1JGDB 1NH6A 2BSED 5C0IB 1YYML 5BRZA 2WWMD 4EXKA 4TUKL 3KDMB 3MACH 4G80A 2VZUA 4X9HA 3TBYB 5HGAB 3BN3B 3CDFA 2B1HL 1RZKC 1F11B 3U79A 3NFSL 2D7QA 5HI5C 2YUZA 4GG6F 4CW1A 3DMMA 3HNVH 1QRND 1JFQH 1MY5A 5TQ2H 4PRIA 1KENH 3OPZL 5BVPL 1RIHH 2XY1A 5E2TL 1YDPA 3WXVH 4IRSC 5TDPB 4OB5L 1CF8H 3ZE0F 4HXBH 1EJ6A 1YEJH 4ZQKB 3PWPB 5BV7B 1EMTH 4GW1A 1CZ8H 2RGSA 2OI9B 4QO1A 2E6PA 1KJ2L 2FR4A 1OGTA 3MRQB 4BQBA 2QQNL 1UKQA 3I50H 3O3AB 3HNSL 5JW4Q 4W6YB 4GW4A 3OTTA 1ROWA 4QHLB 5C09E 1ZMYA 4DKEL 3UC0H 1D5XB 4MA7L 5MP6H 3N9GL 4HUXB 4FQ2L 4ZYKA 1S7UB 2VLJD 4JDTL 5GS0C 4JDZB 2BY3A 1HILB 1FNAA 5F7DA 4Z18A 5C6PB 5DT1L 1N5YL 5IK3B 2ED7A 3S5LG 4QRPE 3DX8A 5HHQA 5BV7H 2ZPKL 3SPVB 1E6OH 1WFTA 5TF1L 3FFCE 5IJKC 2OZ4L 4TRPH 5GZNC 4MAYB 2VABB 4Y19E 2YA1A 1Y18A 3I84A 5IVXB 2BJMH 4MQSB 4OCRH 3PE9A 1EEUA 5EUKA 3I9GH 4ZO9A 2A1WL 2I60H 5ALCL 1ONQA 5BMFL 3S37X 3R06A 3O3BB 5FA4A 3ZKND 5ISZB 1YEKL 1MFAH 1VA9A 5IR1B 1TETL 3BN9D 2Q20A 3BP4B 3O4OB 4O51B 4AT6A 4LLVB 4S10A 5L6YH 4HGWA 4YBLC 4XXDA 4AM0A 2YKLL 4PJ7A 1P7KA 4Z7NF 4H88H 4Q7DA 5E1HB 2AV1B 3GMOB 4LPWA 1CE6A 1FYTB 1QSEA 3I3BA 5HHOA 1JMXA 2CR6A 4C56E 4JANA 4MCYA 1H5BC 1OD7A 4N1EA 4NT6B 3CXDL 5DGQA 2CDFA 5D1ZB 4O2FB 3P4NB 3H9YA 4L4VD 1HZHH 4TVPL 1J5OH 2X4PA 3AROA 1ZVHA 5SWQB 4HS3B 1VKXA 4QKXB 4HJGA 1A7OH 3LRSB 3JWNC 5DR5L 1MCKA 1O5DT 3U2SB 1TVHB 2CRIA 3IXTB 3UEZA 1FAKT 2OXHA 1F6FB 3MLSL 1CFQB 3O2DL 4DEPB 4PJIA 5BS0D 3ULUE 5I0ZA 3GSXA 4HLJA 1SBBA 2DQFA 5DHVA 5T1MB 2DIBA 3STLB 4JHWH 3VWJC 2MQ3A 4MDJB 2FEEI 1F58L 2VDKH 1NGQL 2K1MA 4G8FB 4U6VH 5JHDE 5D7LB 2YUWA 4MWFA 1HI6A 4R97B 2YK1L 4GSDL 2QHLA 4F15B 3RUGE 3K3QA 5F96H 3OV6A 3QHFH 4U1HB 4UI2A 4NOBA 3RIAK 1GZPA 3L1OL 4NQUA 1U3HA 1BBJA 4KMLB 4PRPE 5MENE 3RTQC 4I3SL 4R4BA 3AY4A 1UACH 4X6EB 1OCWL 2ZKHL 4J1UA 1JK8B 1CLYH 5A2FA 4O2CB 4HC1L 4NSKB 2BNQB 3O41A 3MLWL 5JDSB 3ARED 5EORL 2QQLH 3T3PF 4X4YA 1HHGB 1F4XH 1WJ3A 1EHXA 2IAMD 3IDJB 4AEFA 3WIFB 2VSDA 2ZUTA 1HNGA 3S3PA 4U1SA 2UUDK 1TNMA 1TTFA 2ICES 3GSOB 2BRRH 3V4VL 5FM4A 4HIJB 5HYEA 1U8LA 3MRFA 3MLYH 5D1XC 3QFJA 3RIFF 4ZTPH 3NFPB 5KVFH 1NAMH 3F65A 3KHQA 1UB5A 3W0WA 1JGEB 2MPAH 4HPOL 1YY9D 1GGCH 5SX5H 2E9IA 1I75A 2GJ6B 5F89B 1RK1A 3VXPA 3VW3H 1S7XA 4Z7UA 1LO5B 1YJDH 3GMPB 3QULB 3LPWA 5FO8A 4Z77A 1DVFB 1RK0A 2YPVL 3T0BA 1JMZA 4TYUA 1P7HL 5EG6C 3MROB 5IJVA 1T5WB 2D03H 1J11A 2XKSA 4GG6E 3PXJA 4ZPTB 3MGTA 2A38A 3S37H 3TP4A 1CDHA 1WFNA 5HDLA 2AERT 2IMNA 1B4RA 3M8OL 3L3DB 3VFVA 2EDWA 4AH2A 1SYSA 4IRSD 4XCYB 1Q9LA 3I02B 4NCC1 3BUTA 3ZE0E 3I6LE 2XWTB 3HG1E 5A40E 5DJ2B 2GFBB 2W9LA 4K9EH 3GMMB 3GMLB 4OF6A 5JR1L 1VESA 3GZKA 5IW6A 5D4QA 4U1KA 1U36A 1JRHI 3N06B 1YPZB 4JFDB 3FQWB 2Z8VC 4KK5C 3QRFM 4LSVL 3C09B 4KK9D 4PTUB 2EYRB 3D9AL 4NM8H 4DTGH 4KJWD 5HD8C 2Y72A 4MSWA 1I3GH 1IM3A 1CVSC 5I1KH 2IMMA 4LQ1A 3DUSB 3HE7A 2VDRL 1UM4L 1KCUL 4APQC 4U7MA 1FVDA 5GS0D 5DFWH 1P84J 5E94B 1Y6KR 2MCG1 5T5NG 2NCMA 5ANMA 3OKYA 3LQAL 4NO2B 4MJ5A 4DK6A 1QSFE 2D9CA 2Y7QA 4OQTL 1E4KC 1N0XL 3M1BB 5EPMA 4HKBA 4F7MB 1HXMA 5GZND 3DX7A 1BD2A 5BV7C 3MXVL 2Z93A 2F19H 4QOKE 4M9PA 2OI9C 4JZNB 3ULUL 3WXWL 2A74B 4CN1A 4J3UA 4PJ8C 2OL3H 4L5FH 4NDMA 5GRJH 3E6FB 4N0UA 2DMCA 2PCPB 1TPXB 1X44A 3AVEA 3LVEA 5GZOC 4YBQC 4Q9BA 1HINH 5JQ6L 1ETZA 5FV2A 5EZJB 2ADFL 3ILPA 1ZA3A 3FTGB 5HGDA 2OTPA 2A6IB 2PTTA 4ELMF 1HXYA 1Q9KA 4X5XA 4Z7NE 1QRNE 3NZ8B 3JWOH 4KPHH 3UJTL 2H32B 4L4TA 3PWLB 3MJ8A 2CRMA 1MI5E 1D5MA 3SGEH 3QI9A 3WO3B 5DWUH 3QJFB 3BOVA 4XPGH 4C54A 3G5XB 3HPLA 4J8RB 1RZ8B 1BF8A 1T3FB 3C5ZB 3T1FA 1A9EB 1H3GA 4K55A 3WIHA 5IIEB 4I3RH 1IGYA 1T0NB 3GMRB 5EULV 1AHWA 1RZFL 4NN5B 5J6HB 1NGWB 3MFFB 3IETA 2IANA 1O0VA 3C87A 5JOFB 4F7EA 4YHOH 2A6DB 2FHCA 1NGXB 1S5HA 4AK1A 1A6AB 1REIA 3DURA 3T2NL 1INQA 3BP5A 2VLJE 1YUHB 1F2XK 3BDBA 3VWJD 3U7AA 2E7MA 5KSBF 4PGEB 4RGMB 3U9UB 5F9DC 1IGFH 4P5MB 3ZDXF 1GGIL 5EO1A 3MBEC 5DK2B 2XZCL 5JW4M 3CDGA 1HH6A 4GFTB 2CQVA 2DKMA 3O9WA 4D9LL 2EDXA 4D0CA 3KJ6H 3W81A 4DFHA 4OGXH 5EA0H 2W9DH 1UM5L 3QEGL 5DQ9B 2HTKC 3OKDA 3DRQA 4RRPG 5SWZA 5EN2B 3RTQD 5FO9B 5CP3H 2WBKA 3MLRH 4X6BA 4LCYB 5FUCE 5GRVL 5BRZB 2IFFH 3LKSB 3EYVB 3MJ6A 2FX7L 3GSWB 4KVCL 2R0ZH 1SYVA 1RIVL 4M02A 3SE3A 1A5FL 1YEHL 1Z3GL 2VB5A 1LNUA 1YMMD 3HHRB 3UTZB 3T3PE 5L88L 4FQLH 3B9DA 2PUQT 3GIZH 5GIRB 3IXAB 2HRPH 4PRIB 4XCNA 3V6OE 1MFCL 4K23L 2EDLA 4JQXC 3KR3L 4OGAC 1YDPB 3NAAL 4R97C 4TN9A 5D1XD 4F15C 5JOPD 5C0AD 1KCVH 5CZVL 4NQCB 3TBTB 1G9MH 4OZGF 4DOHE 4H5SA 4JAMB 1IE5A 4FFZL 4L4VE 3VXTA 5CZXC 1B4JH 4JFOA 4HX1A 2GK0B 3ZT7A 2O93L 1WBZA 4HUUA 4LSSH 3MRMA 2GQHA 3PGCA 4F3FA 1DBAL 1ED3B 4RAHA 3IDIA 1YJDC 3KNBA 4E41D 4FA8A 1HKLL 3S88H 1MRFL 2A83B 4ZFOL 5BS0E 1PZ5A 3KVQA 3JV4B 1E4JA 4DN4L 3QIBA 4HLZG 4XMPL 3CVHA 4NFBA 4ZYKB 2X10A 5FKAA 5FGBC 1HHHB 1ACYL 2X89D 1I7TA 4M8QB 1A6PA 3A6BL 1I8LC 3TN0C 5ILTH 2BOCA 3TH3T 3WFBL 4ZUUB 4GKNB 4K9EC 5DURD 4KK5D 4P59L 5EO0A 2DJ4A 4MD0A 2BNRD 5HD8D 1TQBB 4PJ5B 1T5XB 4LLDA 2ITDA 3PV6A 3R06B 5FA4B 3UPRA 2EDNA 3I3DA 1BQLH 2ARJA 4APQD 3QCTH 1YY8A 1Z9OA 2FB4L 3QQ3B 4AT6B 1LK2B 1P2CB 3ELAT 5ADPL 4OFVA 3UO1H 4XPBL 4PJ7B 1P7KB 1U92A 3K8MA 5FYLL 4KGJA 4TULL 1MHHA 2DWEB 3WNMA 1NGZA 5SWSB 5ID0A 1CYGA 3QWRD 4KAQL 4OZFB 4V1DA 3MMEA 1CGSH 1N64H 3PWPD 3SOBL 4NJ9H 1Q1JL 2APFA 3TNMB 4JANB 4MCYB 5CHNA 2LU7A 1UWGL 1YMMA 1RFDH 1FL3A 4PJ8D 2CDFB 3TIEA 3TT3L 4JKPH 4WGWB 2VDQH 1JPST 3MUGB 2X4PB 4XNXL 3RVVC 4PJFB 1A3LL 3QHZH 4BUGA 5CILH 5GZOD 3KPTA 3UAJC 4YBQD 2DQCH 1QVOB 1UVQA 4PUBH 5DRWA 5JA8B 5LJYH 4GAJL 4IMLA 2B1AL 3GB7A 4AQ1B 4OLZL 4ELME 5I75B 1G6RH 2IADB 3BKCH 4KDWA 5DHVB 3WFHA 4Q97A 4I2XE 4GXVL 3HZKA 1NCBL 5EBLA 1X5AA 3JWOC 2FD6L 4XBEH 2V17L 4M8VA 3SO3C 4YXHH 4ZMAT 2IBGA 4LHUD 4WTXA 1AE6H 2HVJA 5DA4A 3QPXL 1HI6B 4HZLA 3EYOB 3FRUA 2EDKA 1LO3H 4FXGB 1UYWL 2FJHB 1MIEL 1S9XA 4WU7A 1U3HB 2VAJA 5F3HB 5J4MA 2O5ZH 4R4BB 1TPXC 3LKPB 2ED9A 1LD9B 4J1UB 3U4EB 4K7FA 2X4RB 1MJ7L 2R9HD 2EDBA 3FB6A 2D7OA 3REWA 1I1RA 4X4YB 4L8SA 1BQHB 5KSBE 1R24B 2YMXH 2OJZH 3MBED 3CDCA 4X9BA 3THML 5DD5H 3ZDXE 2UVEA 3RWEB 4ODXB 2H26B 1EUTA 1VEMA 1QFWH 4MXVF 5SV4A 3LEXA 4IRJB 1G7MB 2R0LL 1PG7W 5FV1L 2HTKD 2VR5A 3MRFB 3ZSSA 3PL6C 1DFBL 2HP4A 1WICA 4Z7WA 4UB0H 3W39A 1PYWA 1JN6A 4LSRL 2E7BA 3KLHC 1HDMA 3VXSA 1MRDH 4DGYH 4BJLA 1YMHA 1I3RA 3VXPB 1A7RH 3JWDH 4J6RL 4LKXA 1SY6L 5HTSA 5E8NB 4NN5C 4OZFG 5LAXA 2J88L 5FO8B 4Y8AA 3BDXA 2AEQL 3QNYA 2Q8BL 4LPVA 2XWBA 4JVWA 3VD9A 1NCTA 3MJ7A 4JN2A 3UXFA 4OZHA 5JNYA 2W07A 5EZOL 3WJJC 3MGTB 3FQUA 4MQTB 1BZ7B 2PETA 1KLFA 1F3JB 1NFDA 3CZFA 3VFVB 3IT8D 1NC4A 5D7LD 4AH2B 3NCEB 3VG0H 3WLWC 2X4OB 5ELIA 4LCWA 4MNHA 4OZGE 4HAGA 4HHAA 3OAYH 4KGLA 3UTQB 3HLAA 5IVXF 5IW6B 1NBYA 2RIKA 2EYTA 5HYJA 1G9MC 4RAVA 2KH2B 2VQUA 3MGOA 3OB8A 4F7TA 2D0HA 2N7AA 1J0HA 4MS8C 5E5MA 4G8IB 5F7WC 3CSGA 2OXGA 1S9VA 4UIMA 4QGTA 5AWNH 3B9KC 1RUML 1IM3B 3MJ9H 3BGMA 3HE7B 3KPRA 4TSBL 2FJFB 4Z8FL 2FBJH 4O02H 5I8CA 1FVDB 1NGPH 4XPHL 4EDXA 5AD0A 3BGFB 1I1YA 5ANMB 1CFVL 5KVGH 3OAZH 1GIGH 2P43B 1ZGLA 3WIIL 4MJ5B 2GKIA 2XKUA 3TN0D 2Y7QB 3TM6A 3KPMA 1RZKL 1QUNA 2UY7A 1HXMB 4KVNL 2ZUSA 1BIIA 2NY0B 1JPSL 1NDGB 3GJFK 5DUMH 4MXQC 2GJ6D 1IBGL 4HS6A 5GJSL 1NCAH 4YBHA 1A14L 4YHIA 4NDMB 1BQHG 1OSZB 3CX5J 4FFYH 4N0UB 1K4CA 1A7PH 3BKYL 1YEIL 2HJLA 3KS0J 2D0FA 4JFQB 1I9JL 3RGVB 1E27B 1P4LB 4NQXA 5JXAH 4QY8A 5DJXA 3ILPB 2GSGA 1V7ML 1TJIL 1ZA3B 4PJXB 4WV1C 2PTTB 1C1EH 1Q9KB 4X5XB 1FO0B 5HHMB 5IBLC 1PW3A 4NNXA 4L4TB 3IDYC 4RAUB 2R0WL 4KJQC 3S34H 3IVKA 3QI9B 4TTDC 5DI8A 4ODWA 4H25A 5JOPE 5C0AE 4FQ1L 5GHWL 3ARSA 1UCBH 3FHAA 3HZYA 1WISA 1BOYA 5T5NF 1T21A 4ONFH 5GS0L 3T1WA 1U8HB 3MLXH 1SVZA 1NPUA 4FMFA 2P45B 4JQXA 3UAJD 4BSJA 5LBSH 2D9QB 1TQBC 2GITB 3PHQA 2W92A 1IGYB 4NUJB 1AHWB 3C9NB 5I1LA 1FGNH 4E41E 3EFDL 3IETB 2IANB 1S5HB 1ZHLA 4MMXC 5T5FL 1FO0H 1INQB 1EHAA 2PW2A 1A6WH 2WBWB 3BP5B 4OF8A 2CMRH 2BDNL 1AY1L 3S8WA 4N1HB 3AS1A 3V4UL 5F9WB 5F7NC 5EO1B 2VTFA 1U41A 4JFEB 1HH6B 1U0QA 1MF2L 1AD0B 1IT9H 3O9WB 5TDOA 5JMOC 4NCC2 1UB6B 5KVDL 1V7NH 1JZ3A 1RULL 2OP4H 2MSPA 2EECA 4X7FC 3DRQB 2Q6WB 3Q6FB 1U8PA 5E9DE 3U7WH 3GSNH 4E0RB 3W5MA 2R2EA 2UZYB 4HZAA 3GUTB 2BNRE 3INUH 1OB1B 1XR8A 1NEZA 4UUJB 4UAOB 1CN4A 2GTWA 5IF0A 3CVIL 1RUKL 4M6MH 1BVKA 1D5ZA 3O4LB 1LNUB 1B2WH 2F8VA 2P4AB 2XZQL 3WS6C 2Y07L 1A1NA 1OAXL 3CVHL 4X6FA 3FT2A 3L7EA 2FZ3A 4OGYL 1T0PB 1S7RA 4OTXL 4MXVE 3OHXB 2UYLB 2XACC 4LF3A 3PWPE 5AZEH 3K8LA 3PL6D 1EAPB 4K3EH 4L3AA 1SEBB 3BUYB 1YPZF 1FYHB 3QQ9C 1J0KA 3KLHD 1PQZA 5AZ2H 4MZ3A 2GSIA 2CLZA 2D7PA 3VXTB 3L3HA 4HX1B 4NZUL 2SEBA 1GGBH 2NTFB 3PGCB 4F3FB 5HVWA 4UTBH 2LV4A 3KYMA 4JO1L 4R4NC 3JWDC 1SHMA 4JR9H 3PJSB 2R2CA 2PYEA 5H8DA 1VGKB 3LQZA 1FNLA 3MRKB 1KB5L 1NAKH 1ZHBA 3IAGC 2WINA 4YWGH 1KPUA 5BXFB 4K71B 2KPNA 4LGSB 2YWYA 3MNVB 5C07D 1FGVL 3WLWD 1S5IH 5DMKA 5TFSH 3F7VA 3QCVL 4G6JL 4IMKC 2XKNB 5IVXE 4GT7A 2CD0A 3RWGB 4L1HA 3PWJB 1XF4A 5EO0B 5I1JL 2AJXH 4MD0B 5JOEA 1WT5C 4NQEB 5IVNA 3TBSA 3B9KD 1T6WA 4WGVB 5I71C 5J1TC 4M7JL 1IFHH 5DS8A 1MSPA 3PV6B 3UPRB 1BWMA 1ZLVH 3H6JA 3O0RL 4HDIA 4CVZA 2LTQB 2EEBA 1YY8B 5DJ8A 1OSPL 4TUOA 4JVPA 3O6LH 1NMBL 4U3XA 1HYSC 1QLEH 3S6CA 1U91B 1FZOA 3GGWB 5IQ7H 1U92B 4DQOH 3K4DA 3CZJA 1V05A 1MHHB 5E70A 1DUZB 2VDMH 3MMEB 3VG9B 2Q3AA 3MACL 1T7ZA 1MAJA 4X4ME 4MXQD 1CTOA 4RGNB 1UC6A 3U83A 2ERJC 3DVFA 1WAAA 4KHTH 2VZTA 3FQNA 3IJYA 3HNVL 3BKML 4OZIB 1JFQL 4FG6C 2DKSA 5TQ2L 2K7PA 2X05A 3T04D 1M7XA 4YNYA 5GGRY 1KENL 1X5GA 2EIBA 4J3OC 4UNVA 1FFNB 1RIHL 2HJFA 5I0DA 2DM3A 3WXVL 1UVQB 3ZE2F 3H9HA 1QA9B 1CF8L 4IMLB 4HXBL 1YEJL 3X11B 4I0PA 3GIVB 1KXVC 3MV8D 3TFKC 1CZ8L 5ID1A 4OJFH 5IBLD 1AO7A 3BGFC 3MX0A 5MERA 4KJQD 1CFSB 4TTDD 1AGDA 2HAZA 5D7LE 4AYFA 3I50L 3NMEA 4G8EA 1R5WB 2IH1A 4J12A 3OKKA 3ZKMC 4KRPB 4FZEH 8FABB 1HH9A 3FRUB 3UC0L 5MP6L 2ID5A 2FL5B 2KZ1B 4Y4HC 1S9XB 2HT4C 4G5ZH 2JLLA 4WU7B 5I1DB 3BPNB 1PKOA 1FZMB 2F8OA 2XZAH 5B22A 4ZUVB 4H8WH 4ELKA 1ZEAH 1DBMH 5BV7L 1E6OL 4Y5VC 2Y1VA 1QFUH 5GGVY 5JO5A 1HNFA 1MIMH 4TRPL 3REWB 4LQFH 1EEQA 5T33H 1H0DB 3IF1B 5SWSD 2EIZB 2MMXA 4L8SB 4TNWF 3ZYZA 2DDQH 2BJML 3B9KA 4OCRL 2VXSH 3I9GL 3LDBB 2I60L 3AS3A 2CIKA 5IV2A 3C60A 3QXTA 4P2RA 4UILH 3RL1A 1RVFH 3LEXB 4UU9B 5L2KD 1BX2B 3X14A 3AUVA 3DSNA 3CPLA 1PAMA 3W39B 2GJ6E 4GRMA 3VD4A 1PYWB 1QHPA 4H88L 3VXSB 2WMPA 1YMHB 1I3RB 3EDDA 5GSVB 4M43H 3ECBA 4LKXB 4Y2DC 1TNNA 4U1IA 4H1LH 5LAXB 3EOBA 4LCCB 1YA5A 3PWUA 5C70A 3T0AA 3HAEA 3MJGX 1KTKE 4OZHB 2H3NA 3CD4A 1JNHA 3VFSA 2OQJB 1QSZA 1HZHL 5E4EC 4DUXA 3MRDA 5GRVK 1NFDB 3CZFB 1J5OL 4BZ2H 3GSVA 3TWCH 5D6CA 1QBMH 1AGFB 4WV1A 1MQKL 5CMAA 3QQ9D 3FQXA 1YPZE 3PDOA 1RJZA 4MNHB 1D3CA 3TBVA 4HHAB 3QUYB 5B4MC 1CCZA 3TO4C 4WU5A 2AV7B 4ACPA 1JWUB 4R4ND 5LGJB 4OLWH 1FE8H 4OI7A 4XP1H 5E5MB 3TIDB 1TVBA 2A0LC 4JHWL 4UAOC 4XNQB 4IOIB 4JPKH 3H9SA 3NFNA 1CFNA 4LBEA 4QRRD 4U6VL 3RX8A 1FH5H 4GW5A 3ZMRA 3HB3D 1JZ4A 1MCPH 5F96L 3VXOA 5I8CB 4TTGA 3QHFL 4MB4A 4R6UA 1X7QA 4A6YH 1CD0A 1PVHA 4JFHD 4IRJD 1WF5A 4NO5B 4ZFZB 1UACL 1WC7B 1CLYL 2H2SC 4JY6B 1MCQA 1S8DA 12E8H 1YN6A 1BIIB 1MAMH 1G6RA 3IDXH 1CDJA 1A2YA 2XIDA 3P0YH 2MWCA 4PJFF 4NO0A 1XZ0B 3HE6B 2V5MA 3MXWH 3SE9H 1I3VA 5DSCA 1U58A 3E8UH 1R5VB 2L0DA 5D5MA 5F1KC 3O3UN 1WIOA 3LS5L 1S7QA 2HJLB 2BRRL 5L2KA 2G5BB 1QR1B 1LDPH 1HYSD 3MRNB 2W0KA 3KJ4B 4N8VA 4PJDA 5DJXB 2QBWA 3MLYL 4ZTPL 5J89A 1NAML 3BI9X 5KVFL 3GO1H 4KHXH 3SJVA 2MPAL 2CH8A 3L7FB 3O6FC 1GGCL 5C92A 3U4BH 2BSRB 3VXMA 3TCLB 1Y0LA 1YJDL 3IVKB 3MRGB 1OY3B 4H25B 5HI4C 3B2VH 3HUJF 4LMQI 4U31A 1XR9A 4FG6D 1CI5A 1T21B 3S37L 3KYAA 4NN6C 4EUPH 5JW4N 2R8SH 2UVFA 1MH5A 4XP4H 1KTLB 3PHOB 4O5LH 4HWBH 4AENA 1FJ1A 3RKPA 1JIBA 3ZE2E 5I1LB 4ODVH 4H0GA 3QJHA 2YPKA 1X5LA 4HGMA 1S9WA 4K9EL 2W9EH 3NIDF 4NKIH 2YWZA 4KTYA 4PRAA 1ZHLB 5DJCA 5KS9B 1WWBX 1Z0MA 4OF0A 2GAZA 5D6DC 1FCGA 2PW2B 3PDDA 5FHBH 1CFTA 3CSYA 5K9QG 1QZ1A 4JJ5A 3RPKA 1K8DA 3ZKMD 5C07E 1KTDA 2A73A 4NM8L 4D2NA 4DTGL 3WE6A 1MNUH 2D7MA 3OB0K 4WI2A 3EOAB 5I1AA 1I3GL 1CD1A 5I1KL 3T0DA 1KBGH 2OX5A 3K74B 5TDOB 4FQJH 4Y4HD 2HT4D 1EPFA 2FEDC 4TQEH 1S78C 3ARPA 3IFLH 2X09A 5MEQA 3EJJX 2R2EB 4PBVC 2W0FB 3EDEA 2C4XA 1FIEA 1VDGA 3UTOA 3RGVD 1FLRH 1A9BA 4U1GB 4H8WC 1M71A 4HQQH 1G7QA 3PGDB 4QRSA 3NACH 1F02I 4LSQH 5HHMD 1D5ZB 2E6QA 2F19L 3VWKC 3HZVB 4HMDA 1YC8A 3FAWA 4HFUH 3SDDA 1A1NB 2A9NH 4WRLA 4PGJA 2OL3L 4L5FL 5JHLH 5JMRA 5GRJL 2PTUA 4X6FB 3FT2B 3L7EB 1ZS8B 2FZ3B 1S7RB 3MLTA 4GBXA 4NQCE 5JORA 4KRPC 2NY2B 2AJZA 3MQIA 4JRYD 3RIFK 4LP4A 4C83A 4XC3H 3OGOE 1HINL 4X6CA 4WY7H 3H0TA 5F21B 2Q76A 5FUOH 2CLZB 4OCYH 3RDTC 3JWOL 3L3HB 4KPHL 2WUBL 4Y2DD 3FB5A 3NZHH 3SBWA 5HGHB 3CAFA 4XVSH 3OG6B 4FNLH 1FNHA 5DWUL 1U3ZA 3OAUH 3IGAA 5F9AC 3C08H 3NGBC 3FOMA 3SDXA 4Y89A 4XPGL 3MV8E 4YEEA 1ACZA 4RA0C 4PJEA 5E2JA 2YEZB 1ZHBB 4MLIA 2WINB 1KPUB 3EYFA 5EUOF 3HFMH 2JJWA 4JFED 3LDBC 5ICYA 5IW1B 5C0CA 4I3RL 1OTTC 3QT2A 2NY4B 1A4KA 2CXGA 3F7VB 3P11H 3G04B 4YHOL 2R2HA 5B4MD 5FM8A 3T8XA 1AH1A 4F7PB 3TO4D 4DCQA 2IF7A 4PJ5E 5D2LF 3FOLA 4HCRA 2A0LD 4MQXC 3G08A 5E2VH 3RNQA 5D9SA 2HN7B 2CK0H 1IGFL 4RMQA 4LCCC 5DS8B 1NANI 3HI6H 1OGAD 2V2XA 4CVZB 1T1WA 4PJXF 4N9OB 3KJ6L 4TUOB 3T08A 4OGXL 4XVTH 5EA0L 2W9DL 1VADB 5SWSE 2Q87A 3UZQA 4JG1H 3OKOA 3MLRL 3AMLA 3FO0H 2H2SD 4Y5VA 3CSPA 4M1GH 3T0XA 5D5ME 5IMKB 1N6UA 1PX3A 2IFFL 1DQTA 2MHAB 5HGBA 5L2KE 2M2DA 4JPIA 1IGIH 4G3YH 4JFXA 3QUYC 4RSVA 4CBPA 3T77A 4PJFE 2M8XA 3FQNB 4DGIH 4FQLL 4ESKA 4G7YH 3GIZL 2HRPL 2XNAA 5D1QA 3BZEB 4X80H 3V8OA 3FO2A 3RKDC 4ZXBB 2HJFB 4QT5B 4JRYA 2X9XA 5JXEC 1D6EA 2Z31C 3H9HB