3QUXD

Structure of the mouse cd1d-alpha-c-galcer-inkt tcr complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 60
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quxD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quxD02
2XNAB 4LSTL 1WV7T 4M6NL 3RZWA 3ALWA 4QXGL 2G5BB 1AP2A 5MEQA 5IG7A 3EYSH 3ARED 4P2OA 1KPRA 3QDGD 5CINL 1J8HA 3F5WB 3D85B 5I75C 2OJEB 1UXSA 3NABL 1U3HD 2X1WL 1FG9C 5J12B 3KYMA 3GM0A 4PGBA 1XMWA 1HWHB 1J88A 4OF7A 3BH9A 1OL0A 1KG0B 5DD3L 1NAML 1UG9A 5KSVA 4C4KO 5ETUA 3WIFB 1BFOA 5JZ7C 3SCMA 2V5TA 4XNMA 5I1AA 2EYRA 3MV01 1RZKH 5GJSL 4F3FB 3CLEH 5IVXE 4HKBB 1SY6H 2VTFA 5DI8A 1FNGA 1N5AA 2VL5A 2VLKB 3MO1A 4OBRA 3QCVH 2FD6H 1YYMH 4KAQH 5BZDA 2AEIT 5FO8A 4JZNA 3HZYA 4MDIB 3OKDB 2EYRB 2HFEA 3V6OA 2OSLB 4OLUH 1U6AL 5BOZG 1QQDA 4XH2A 2VH5L 3QQ3B 1UQSA 3ORJA 4XCCH 1QFWM 1AC0A 4FQHA 1S7RB 3U7WL 1KN2H 3VFSB 5IESL 5C0AB 3P77A 4PJIB 1MIEH 4GG8A 5F88B 2FX7L 3SKOB 5MEND 1V3JA 3MOAL 1DN0B 1ZT1B 3HLAA 4NQEA 4KPHL 5DJ0A 2IBZY 4K3DL 1MLBB 2VZ1A 3G08B 4P5KA 2Z91A 1T0NA 2VLMD 4PJAE 4Y4HA 2DKUA 4B0MM 4WW1A 4X6FA 1EA9C 4G6KH 1OCWH 5JPNB 2ICES 4NUGH 3GNMH 2O93L 3RWGA 3BD3A 3EO1B 3GIZH 1FC1A 4Q6YA 4TUJA 5CUSH 3HMXA 5C92A 4ZO8A 1NLDL 2A6IA 1I9JL 3BUYA 2IBZX 2DMCA 1AXIB 3CSPA 4NQCE 3V8CA 1MRFH 1PX3A 1A7RH 3ARDB 2A9NL 2A2QT 1P84J 1V3LA 4RFEA 3RGHA 1R5VB 4MQSB 3UTOA 5F72S 1C5BL 2JKXA 3U9UA 3OX8B 4J3TA 1B4JL 1WZKA 1NGXB 1XGPA 1ODAA 4MJIB 5FGSA 4Z7QF 1KNOA 1WWCA 2DYPA 3LHPH 5IVXF 3AB0B 2NY6D 1BFVL 5DFTA 5FYKD 2YSSB 3U0PA 4ALAL 2FX9H 1T22A 1EO8H 3S5LB 4AMKL 2DQDH 5C2BL 4Q0XH 5DHXB 4JQVA 1IT9L 2BNUB 4P2QD 4L5FH 4LDEB 5IW1B 1TVHA 1QFOA 1RZJC 2DM7A 3E6FA 1QNZL 4MZ3A 25C8H 1MPAL 2Y06H 3R0NA 2F53A 3MREA 4OFKA 1RVFL 4FFWC 2XWBA 1GZPA 4MA8H 4WGWB 5ACZA 3BKCL 5DT1L 4MD4A 1DR9A 1YDPA 4B7LA 4Z0XA 4OLYL 4G7VL 3MNWA 4R96A 1CQYA 5J1SC 1CLCA 4M7JL 1P5UA 1Y18A 3UPAA 1XZ0A 1GCFA 1D6VL 3G5YA 4LPTA 2H3NB 1KIPB 2MCPL 3NGBC 4MJ6A 4LSQL 3T65A 4L3ED 2ATKB 4KJQC 3UO1H 4CADA 2V7NA 5HVFB 3ARDA 2COQA 3QXDA 3D25B 2Q76A 5CKAA 3IF1B 3MV8B 1EJ6A 1FVEB 1VEMA 4M6NH 3P0VL 2B8OT 2ZUQB 2JCCB 1CT8A 5CCKH 5BJTA 2X9XA 2C3VB 2WWMD 5DJZA 1BF2A 2VDOH 1MQ8A 2CLVB 4XWGH 1QFPA 1SEQH 3D69B 2NTFA 4QRSA 1SVZA 5TQ2H 3EJZD 2ZKHH 4I77L 4NJ9L 3D25A 3VXSA 1AXSA 5LWYL 2BRRH 3CDGB 4HEME 3ES6B 1S7WB 3RGVA 5J9PB 4G6KL 1UZ8A 3VXQB 4HS3A 2NY4B 5J6GB 2VO5A 2V17L 1SEBA 3U48A 2P5EA 3ULVD 1WITA 2Q6WA 1T2JA 1S3KL 4JZJC 1QLRA 1RD6A 3UPCA 1CDBA 1DDHB 2CDEA 2ICWJ 4O2EB 3EJJX 2HFEB 3U0WH 3WFHA 5IQ9B 1ZHBA 3DV6A 2XZCH 4M7KL 4QF1A 2YPLA 2VH5H 5SX5H 1J12A 3QR2A 2AEQL 5FKAB 4Z95L 1KB9J 4CKVX 4NZTH 5FECB 4U0RB 2YPLE 4GJTB 3WL9A 2P43B 1K6QH 1BQSA 2FGWH 3KYNA 4DKAA 3U4BL 1BPVA 3LRHA 4GBXD 2BVTA 2BJML 3C6LD 3WHE0 1F02I 1QLFA 2V6HA 4XPFH 3AY4C 2WNGA 1T2QH 4YDLB 1RHFA 4J4PA 3TZVC 4ODWA 4EN3D 5H94A 2OQJA 4JHBA 3RWEB 3NCJL 1JTOA 3WKNA 3MV11 4KK9C 4LGPB 1YPZE 3QYCA 3DUUB 4RFOL 4E41D 1MI5A 4IMKA 1P6FA 5DJYA 5DWUL 5I73C 5GJTH 1YPZA 5DEGB 4M1GH 5LXGL 4KQ3L 1AI1L 2VR9A 1J86A 2HAZA 2WK2A 5FM5M 3K2UH 4E41E 1DLFH 2AJ3A 2FLRT 5JOEA 5KAQG 3DRTA 1AGFA 1L7IH 5DHVB 1UZ6E 3LN4A 5IIEB 5F9OH 3DIFB 3CSGA 2KL6A 2IAMD 4ODTL 3O3AB 5GSRA 1AFVH 3NCEB 2EDTA 3TBVB 4FZEH 1MUJB 1T0NB 4CUCA 4F80A 5CCKL 1MIEL 1QVOA 4XP6H 3CFJA 4U33A 1UA6L 3QDAA 1T83C 1I1RA 2EXWD 3UROR 3V4VH 1NGYB 4FG6D 4OD1L 5F7NC 5T1LB 5SWSB 4LPXA 1UZ6F 2IH3A 4F33B 1NFKA 1ZANL 3HMWH 2CIIB 5EU4B 2F5BL 1MUJA 2ZG2A 4PP1C 4BSWB 2OR8A 1CD1A 5GISH 4PRNB 2CGRL 5DK3A 5CLWA 2Q76B 1AO7B 3GI9H 4XVUC 4OLYH 1GAFH 4X6EB 2ZNWA 3TJHC 4YDLC 5C0EB 1D9KC 3S34L 3BPCA 4IMKC 3BZ4B 4D9LH 1N59A 5SWSD 4IRJD 4JRXB 3LN9A 3HE7C 4XGZB 5E8OA 3BWAB 4LFHD 2VC2L 2UUDH 1I1YB 2XQYK 3BPNB 3WCYA 5DMGC 2FWOB 5HXMA 3LN5B 2G75B 1PG7X 5IB2A 4LAQH 1INDL 1N0XL 3TN0A 5I2IA 3BUTA 3U7WH 1MNUL 3V9FA 4XC1L 2BVYA 2BMKA 3MLPA 2HJKB 2AP2A 5J57B 4OT1L 3RDTA 2VLLA 4P3DA 3MQIA 4IRJB 4JRXD 3O2DA 3UZVB 5SV4A 3JWDL 3QEQE 3SJVB 2WSKA 2IPKB 4XVSH 3S3JA 1M6OA 3SE8L 4JO4H 2HKFL 1CL7H 2JLLA 3A67L 4X6BA 1QFWI 2NY4D 3MRFA 2C1OA 2DWEA 4MA8L 4BQCA 1BD2E 4X8XA 3QI9C 2ITCA 1MHPH 4HIXL 5I17A 1V3MA 4AQOA 3TBSA 4PRHE 3DXAB 3HAEA 1BD2A 4WEUD 4XNZC 3RI5K 4YXKH 1KJVB 1FJ1B 1RUML 4CJ0A 2KZWA 4NUJB 5IEKA 1EGJL 1OAYL 3QNYB 1PKOA 2APTA 3ZTNL 4RMVA 2FRGP 1IZJA 1U95B 3SDAC 2VAAA 2IMNA 2PW2B 1FLTX 1NGQL 2D7QA 5J89A 1A6WH 5JMRA 1MJUH 1YMMA 3L9RB 4JPWL 2OL3H 4EBQL 4W4OA 5IJKA 1IKNC 2PUQT 1XGTB 5CKGA 4HJ0C 5J9PA 3ZL4H 1NAMH 1MEXL 2DQDL 5FDWA 3MYZA 3MRIB 3RFZC 1ORQA 2YOCA 3CIQA 2D2OA 3BP4A 1FNFA 1JPTL 4NRYB 3T4AA 1B3JA 3T3PF 5DUBB 4K71B 3B2VH 4CMHB 3O6FC 3WXVL 3CSYB 3P4OB 1NDGA 1YJDL 4XNYL 5C09D 4MNQE 2R0KH 5I17B 1TZIA 4R4BB 3HR6A 2ARJQ 5JNYA 1J0KA 3DX7A 4LRIA 2HG5A 4JFQB 1OARH 3BP7B 3RTQB 4OZ4A 3VJ6B 3G6JB 1F97A 5D2LF 4Y89A 4G7YH 1CDIA 2YD4A 3RY5A 3BQUA 3FKUS 2AJXH 1AGCB 5DTFB 2O5XH 2M1KA 3KPTA 5CINH 4PUBH 2BJMH 3B5HA 5MP6H 3C6SB 2G2RB 2Y72A 3PHQB 3NIDE 1S7SB 4PJDF 5IUSA 1YQVL 4WW2B 4K9EL 1T4KB 1AXTH 1WFNA 1ZANH 1I8KB 2H32A 3MUY1 3NMEA 4JO4L 4NT6A 1G7PB 3U82B 4YZFE 1X5JA 4TQEH 1U3HA 1VEPA 1VADB 3JWOH 1I3GH 3Q6GL 4HHAA 2E9WA 4ODUB 5ENWA 2CRYA 5I18L 4NKOA 4CL7A 4YHNB 2NY1D 1P6AB 1XGPB 1T3FB 4KJPC 3SBWA 4JFDE 2BOBB 5IHZB 4GXVL 1MREH 3ARFA 4E0RB 1AP2B 5AD0A 4P2RE 4W6XB 1EO7A 32C2B 5C0CE 4OZFH 3MTRA 5DJCB 2GYSA 1NCAL 1VFMA 1BFVH 5IHLB 1U8NA 3WIHH 3T2QA 5F9WB 2MMXA 5T1LA 2R23A 2HG5B 2HJFA 4QHKJ 1CT8B 4OQ1A 3DTXB 1UA6H 2VR5A 4FQIH 3WFDL 4KWUA 5I8KL 3ZL4L 4PJCA 5ESAB 1CFNA 4GRLB 5FA3A 1WZ1H 4G9FE 5TQ0H 4OD1H 5F9DC 3FB8A 2M26A 3LIZL 4X9BA 2P8MB 3OKMB 2DQCL 2HLAB 4F9LA 4X4YB 3WDIA 3OB0K 3GB7B 2HKFH 2DWDA 3A67H 2XY1A 4PJGA 3HE7A 1K3IA 2Z92B 4UAOB 1G7LB 4K3EL 3KPNA 4UOW0 2GT9B 1H5BC 3L3DA 3VD4A 1NH6A 3OKOB 1CDGA 3BJLA 3N9GL 3O6LL 3Q5YA 1QQDB 1TZGL 3GI9L 1ADQL 2RGSA 4XBPA 1SYVB 1QPXA 4ELME 2IAMC 3V5DA 1XR9A 4DFIA 3L5WA 1I7UB 3C09C 4Z7WF 1ZSDA 3LKPB 4JGJA 4MDIA 4OLXH 5FDYA 4XBGB 1B4JH 1H3TA 2GSGB 4UU9A 3FTGB 5F89A 4MQXD 1RZKL 3ARGA 2VDPH 3BEVB 1TJIH 2PYED 2FATH 3SJVE 3OJDA 3ZTJH 1MHCB 4FXKB 2IG2H 3MCKA 1S9VB 2FB4H 4ACPA 4PB9L 3TH3T 4JAMA 1R5WB 1R6VA 2I25N 1H8NA 4Q0XL 5L2KD 4JFED 3G5XB 4LCYA 4Y5XB 1F6LL 4PJ5D 5DK0B 3MYJB 4QRUB 2VDLH 5EC1B 1CXKA 3LEVH 3PWVB 4XNXL 4MAYB 4PRAA 2FEDC 2DJSA 3QIUC 5HD8C 4PJCE 3DSNA 3QJFB 2FYYA 3IAGC 2FO1A 3KXFE 1WBXB 2FHBA 4OZHE 3E8UL 1OM3L 4C4KT 1ZHLA 1DBBH 2CDEB 1LNUA 5I19L 4MX7B 1NUGA 1RAMA 4GW1B 4JFEB 1TTGA 4DGVL 3HI1A 1MY7A 3S34H 2AEQH 1YUHA 1DQJA 2XIDA 1S8DB 1I7TA 3IRPX 2DQUH 1KT2B 4XPHL 2P8LA 1I1FA 1CVSC 1VKXA 4J3VA 3CDGA 4RAUA 5F3HB 2FDBP 4QEGA 1JPFA 2W60A 4LHUA 4N5ED 2HFFB 2XACC 2VDOL 4QNPF 5C0FB 3WSQL 5HHNA 2V2XB 3MPCA 4IOFC 4MMXC 5DJAA 2HRLA 3CLFL 2X05A 4KGLA 4IJ3C 4JDVA 1IGTB 1CE6A 2DLGA 4P99A 5KSBE 1KXQE 2QV2A 1G7JA 3G6DL 4WWKB 4JZOB 5B39A 4NHCH 4FABH 3KYKH 1JTTA 2AJVL 2NY6C 3LHPL 4YFEA 3VU2A 4ZAKD 2IADA 3RKPA 3QXWA 4Z7VE 1CD1B 1IGCL 1D9KD 1JMZA 1UH4A 2N4IA 3N9GH 3Q6FA 3PGCA 1SEQL 1AQDA 5DD5H 1JRHH 4RQQB 2I9TB 2QBWA 3TJEH 5D7SL 5T1MB 4U05A 4TNWF 3B6SA 2F8VA 1DQLL 2A6KB 1MWAA 3I02B 3VE0B 2MQCA 3CX2A 5SWZD 1G7IB 4PV8A 3CFKA 1FYTB 5TDPA 1S9YA 2YEZB 5I76A 1P7QA 4OUOA 4RBPK 1Q94B 4Y4KD 1NL0H 4YHZL 2JB6A 4HJJH 1EEZA 3C6SA 3SDAD 1RIHH 3O4LE 4JB9L 1QSEE 3ULUE 5KSAD 4OD2B 3BXNA 3ARBB 4PIRF 3ULUD 5I1JH 1RHHA 3EJYD 2XN9D 1ZVYA 2ICCA 3OKLB 5ITBL 2V9TA 5EU6A 1FZKB 2X89D 4J4PD 3I3DA 4EI5C 3QI9D 2EEDA 4EN3A 3DGCR 3EYUH 5F7HA 4KRPD 2Z8SA 1N2RA 5KSBA 4Z7OF 2KUTA 5DD1L 5C9KA 3RWCA 1AHWB 5HYIA 4QY8B 2X4UA 3F8UB 3UDWA 3T0EA 4JFDA 4ZYKA 3EOTH 1I7UA 3CXDH 4CMHC 1NBYB 4P5TA 3TBTA 5B3JE 1CF8H 1LK2B 3QWOB 4XI5C 4GUPA 2VLJE 1G1YA 3BIKA 3ZKMC 5IFHL 4WV1C 1N0XH 3T1FB 4DKEL 5TE7L 3B9DA 4X8JA 3IB4A 4Y2DA 3GRWA 5HHQA 4M3JA 4M1GL 1R3HB 3GSVA 1OARL 4M03A 3BISA 3STLA 3W0WB 3UAJD 3ZDYF 3WN5A 3QB7C 1A6TA 2X4TB 2P8MA 1H5BA 2CKBA 3AXLA 4PJFA 4AIZB 4ZPTB 2PXYC 4OZHB 1PZ5A 2JB5H 2OS7A 5C7XL 2R29H 5HHXH 3T4YA 1BX2A 1Q9LA 2NY0B 3EUUA 1YQ2A 1XF3A 1CICA 1ZLVH 5C0AA 2F9BT 5LJYH 1VFOA 3VFOB 3KNBA 5KSUB 2DQHL 3VFMB 1JCKA 1F4XL 3C60A 5C0AE 2Y25A 4HKZB 1P69B 3MRPB 3NCMA 1KV3A 1Q9OA 1LVEA 3GKWL 4ONHA 5GJSH 5DHVA 4LEOB 4FQQB 3P4OA 4LCWE 5JHDA 3X3GL 4S2SB 3MRCA 1R5IA 3K4AA 1C8PA 1MJUL 2FCBA 4RGMB 3SJVA 1NANH 3OZ9H 3D0LB 5DEGA 1QSFB 5EBMB 4TOYL 2EDQA 3BGFC 3KXFB 1IC7H 2NXZB 2XWJA 5JMOC 1HIML 4KHTL 5L2KE 2H2PD 2Z4QA 3IFPA 4FNLH 1OPGL 3KPRA 4OLZL 3QCUL 2VDLL 5D1QB 1I4FA 1ZK9A 4RCAA 4FP8L 3UTPD 4CDHA 1H3GA 5DURB 5E08L 3QULB 3LZFL 4Q9RL 3SDYH 4JRXA 4LSSH 4ODBD 5D93B 3W0WE 4TNVK 2EDFA 1C08B 4X7DC 4Z7WA 3QPQC 3TV3L 3HE7B 1NCTA 2VXSL 2A1WH 5EO1A 4KKAC 3K8LA 4YUEH 1EGJH 2ZSVB 1I7ZB 5IVOA 2PR4L 2NY0C 4BKLA 3MNZB 2FR4A 5HDBF 4G7YL 5BV7B 1OTTD 4JJ5A 1IGFL 4X4XA 4QHKI 2WUCL 2F5AL 5CILH 4XHQA 4LLUB 3MV9B 2FIKA 4PJ9A 1A6PA 1ZEAH 3GHBH 3TT1H 2VABB 4PLKD 4M48H 3PV6A 2LVEA 3JV0A 5DR5H 4NGHH 3PF2A 3PGDB 4R7NA 3EAKA 3HA0A 2PYEE 4OV5B 2JJTA 1HQ4B 1XF5B 1ZVHA 2R29L 3WIIH 1TQCB 5ABDE 1CL7L 3P4NB 3HC3H 1A6ZA 4M6AA 1KENH 2UV3A 3OTTA 1NCWL 4Y8AA 3RWHA 1XF2B 5I1DA 3KS0J 3P11H 1HEZA 4OF0A 5FGCE 3TO2A 5JOPD 4EIGB 1JPTH 5IW3A 4GKOA 1S7VA 2WWKT 2B39A 3QHTC 1BLNA 1MEXH 4PGZA 1OWWA 4HUVA 2AXFA 4JFDB 4ZYKB 4XHJD 1WIOA 3TA3A 3SDCC 3EOTL 3LB6C 5AEAA 3VWKC 4RA0C 4G8GE 4NQDB 4Q58C 4JN2B 3W2DH 5H35A 5CLTA 2NXYB 1PYWA 1D3CA 5HHVH 3G5YB 3H9SD 4YHLL 1NEUA 3PWPA 5TFSH 1UJ3A 3VD5A 4KI5F 3ARGB 2XWTB 5C09A 4E42B 4N0FA 3CC5A 3UX9B 1MHPL 3FQUA 1XFPA 5D96C 5FK9B 2QSCH 1RHHB 3C60B 1FPTH 4KQ4L 4XBEL 4PS4L 1T0MB 4OLZH 3IDXL 4P5TC 4LNVA 5GGSY 3WO3B 2FSEB 3MLSH 1TVBA 1TMCB 3L3DB 2H26B 5EOTA 2CLRA 2NXYD 5D2NA 2DIAA 4YE4H 1U8IA 4WO4D 4XVTL 1DUYA 2AV1B 1RJLB 2YBRA 5EBWA 3Q5OA 4I18C 2AJVH 5DJ2B 1KCLA 1S7WA 1MCPL 1EPFA 2VXUH 5GSRB 5JIKA 1TZHA 4OV6F 3L3GB 1F6FB 1INQA 4AH2A 4S10A 4NJAH 2BCKB 1XF1A 1S7RA 3K81A 5MERA 4PBXA 1V7MH 1AQDB 4OGAC 4PRBB 1NGZB 1XF4B 2VN7A 4UUJA 1JWSA 2J12B 1VFBA 3LS5H 4HH9B 1N64H 4OQTL 3P4MB 4XRCB 5JA9A 4PJHA 3K2UL 4J23A 5EFIA 4RA3A 3RWJB 3RGVC 3D2UA 2MCPH 1F11A 4POZD 2X4PA 5ADOL 4FTVD 5MHSE 2BX5A 4JR9H 4EOWL 1S9YB 5AZEH 5C8JB 3L3KA 1C08A 1FFPA 4G9FB 4GRWB 1OP3H 4PJAF 4HJGA 1WSST 3BGMB 1QEWA 4JHWH 3Q1SL 2D03H 3OWEA 4JY5L 4NO0D 3UTQB 5GS1B 4IHOB 5HI3C 3KYAA 1LEIB 3OF6A 4Y4HC 4FP8H 2YD3A 4JM2A 1G9NH 1QSEA 3O3DB 3UYRL 4M1DH 3C6LB 5ICZA 4KKCD 3FFCB 3GJFK 1B2WH 1MCJA 3DX9B 3O6LH 4KDTA 4P46C 1KELL 5IB4B 2M2DA 4FXKA 1CD8A 2QSQA 4IS6A 4B53A 3FRUB 3HB3C 3QWRA 4U1GB 3MV9E 5IBTL 1MREL 2NY3D 2P1YA 5DRXB 5DYOA 5EIQA 4BH7B 1QBLL 1O7VA 5L2KB 2JK5A 4YFDB 3GSQA 4I9WD 5DMYA 4FG6C 1PDKA 4OJFL 5EUOB 1WC7B 5IBLD 4XI5D 3VE0A 5CWSA 1PQZB 3GIVB 4BZYA 4OGXL 4KZEH 3EOBA 4PB9H 1KJ3H 2G60L 2Z35A 1T5XB 5C0ND 4TYUA 5IB3A 4HUMB 1RURH 4PP1D 1CDUA 3KPRB 2OP4H 1Q0XH 3M17B 4I3GA 5D7LD 4XCNA 5HDQH 1XGUA 2E9BA 3IYLW 2R2CA 3FFCE 3IDXH 2YKLH 5FF6B 1BLNB 2YMXH 3OG4B 3GBNL 4Z7UB 5JO5A 4QOKA 5D7KD 5DRNB 2BVUA 2QHLA 1ZTXL 2IBGA 2NTFB 4QRSB 4N1HB 3HI1B 3MJ9A 3L3KB 1F4HA 3VFGL 1ETZA 1FCCA 1V3KA 1NC2D 4LHUG 1NGWA 4XP4H 5HYQB 4OKVA 5JW3L 3G6JE 5IROC 3ULUL 4JJHA 4U6XA 5E6IB 5EUOE 5ICYB 4MSWA 3IT8D 3OAYH 4X7TA 3GI8L 1YEIL 3RU8L 4HKJA 3S35H 3PDDA 5C0RH 4WFGD 3VFMA 2WLYA 4FRWA 1HXMA 5GSVB 3FQTB 2R9HC 4E5XA 2ITDB 3MV9A 4U0QB 4XNUH 3T09A 1KTRL 3MFGB 3RY6A 2DDQH 3C5JB 2X44D 3D39D 1LO3H 4ELKA 4OZFG 5F3BA 3VGBA 3GMQA 3RL1A 1RJLA 3VGAC 3L3IB 1KC5L 4OZHF 3RTQD 1CGVA 4NM8H 1AXSB 5IF0A 3DXAA 1ZHLB 1XIWB 1R0AL 4NGHL 2FZ3A 2NNAB 3LPFA 3ZE1E 4Z7VF 2FATL 2MHAA 3ZE2F 3PL6C 5A43C 1IM9B 4ODVL 4UZGA 1IGML 4OM0H 4PG2A 1BBJA 3CDCA 2B4CC 2R8SH 4RGOH 1JHKL 4WWKC 3VXSD 4DGVH 4HXAL 5H35B 2F5BH 1QLEL 3PWPB 4LAJH 3VMOA 4YHPA 2D31A 5KVDH 3K2MC 4XX1E 5CJQH 3QPXH 3PV7A 2BNQA 1HYSD 2P5ED 2ERJB 3I6GB 4OCRH 3VDBA 2GJZB 4LLQA 1K9TA 4Y5VB 2LU7A 1AH1A 1G7PA 4JDZA 3OKNB 4G9DB 3RNQA 3UJJH 3JTSB 5A3IC 3UBXI 4RSVA 4GG6F 3TBWA 5BCAA 1TPXC 3EYOA 2NW2A 4XMKL 1V8HA 2Y5EA 1U8KB 4K8RC 4XNQA 5ITFB 2HT2C 3HRZB 1HCVA 1YEHL 2A0LC 1G7MB 1IKNA 1MNUH 1WBYB 1KYOJ 1LDPL 4LU5H 5E8PA 1JHTA 5IFAL 3GMNB 3VXNA 3TYGH 3D18B 3I02A 4PJXE 2FZ3B 2NNAA 4I3SL 1I8IA 5T1KD 2XV6B 2YWZA 3MGTA 4JDTL 3KVQA 3WUZA 5C07E 3GKWH 3LRGA 1A4KA 2D7OA 1G7MA 2F74A 3THML 1EHLL 3HN3A 3X3GH 3MRNA 2QADB 4AEEA 3Q6GH 4AENA 1DE4A 2P4AB 2EZ0D 2X1XR 4FQLL 4Z5RB 4I0PB 4F7CA 5FGBA 4JFDD 2GJ6D 3PXJA 4HW6A 1KPVA 5B38A 4P5TD 5ILTH 3EGSA 15C8L 1ZT4A 4FQXA 4IDJH 5IM7B 4DZ8A 4ZMAT 1RURL 1IE5A 3PJSA 4LLAA 4QTHA 5ANME 2BVQA 3MLRH 3VJ6A 4JLRB 4HWZB 3CC5B 3GSNB 3HKFA 1YPZB 5DRWA 2AW2A 4JFPB 3RWCB 5FUCC 1L9MA 4JHWL 4ZFFB 3LZFH 5E94B 1KN2L 1FBIL 5CGYC 4P4KB 3TO4B 5KZCD 3BRDA 1JYNA 1RZJH 1S7SA 1OT1A 5DQ9A 4DFHA 1H0DB 1U8JB 3O81A 4LKCB 3C2SA 5IMKA 3TYFA 1UADC 5DJDB 4O2FB 3V52H 3QHFL 1G7JB 1JK8B 1S7VB 1KIQA 4P4KA 3UTZA 2EEBA 3P2TA 3MR9A 4U1IA 3FRPA 1P84K 4YHKH 2Q3AA 5IQ9A 5HGDB 3TGXA 5I0ZA 4PBVC 3A6CH 3M45A 4LCUA 3QIWD 3RZCB 5FB8B 5TDOA 1KCSH 4LP4A 1GRWA 2ARWA 1NGZA 3L3IA 1SJXA 1UCBL 4O58L 4IRJA 1TCMA 4UBDD 4W4NA 2HLFC 4DUVA 3SKMA 4QHUB 3VFOA 2D9QB 3K0WA 1VA9A 1GOFA 4JM2F 4M7ZB 2R1XB 1UH3A 3HRPA 1CXIA 5LKNA 3T4YB 4K8RH 2P47B 3QZWA 1PBYA 1O5DT 3O8XB 3BEVA 4Q9QH 4J6RH 5ESAA 5FA3B 4IOSD 2IGFH 1I9IL 1PY9A 5K9KA 2E9IA 4MQXC 1G9NL 1QO3A 2EECA 3TESA 4N0UA 2RCSL 1BOYA 1ZS8A 5HJ3A 5DEZA 1WAAE 3U4AA 1T7VA 1AD9B 5DUML 1Y6MR 3OHXB 5DJZB 4JQIL 5C0FA 3VCLB 3NIGE 2Q8AL 2BP3A 4X99B 1I3GL 5D2LE 2J88L 5E6YA 4LSVL 2BC4B 5CMAB 1F13A 4OJFH 3W82A 1GOHA 1JWSB 2GIYA 2Y7QB 4G8GD 5GGQH 1CFTB 3TEUA 1WGOA 5HD8D 4NN5C 2OK0L 5BV7H 4N8CL 3BHBA 3O4LA 4PS4H 5DD6A 4HCRA 4Y4KB 5CWSB 1ONQB 2Z8RA 4L4VE 3AS0A 3DMMA 3T0EE 5CP7B 1JYXA 1CXFA 2Y1VA 1M7IA 5C86A 2FB4L 4XMLL 3H9ZA 4NQUA 4XCNB 1OTUD 2VLJA 3SDDA 2VE6B 4GS7C 3CXHK 4HGMA 3PWUA 2R2HA 4RFNC 2C7UA 4YX2H 4QHMB 5HDBE 4HX1A 5F7MC 1AO7A 5IB4A 3ULVC 4GW5A 1OAKL 1P9MA 4CRPA 4X9GA 4NKOB 4KKNA 3WIIL 4DGIL 4JFQA 4F7MA 5E6ID 3L7EA 2GI7A 4MGXA 2FJHA 4NPYB 3IJYA 3BGAA 5AYUL 4P23C 1DBAL 4QTIL 1F6AA 2Z0BA 4PRPD 3QAZB 1W72H 3TPKA 2DRUA 2FX8L 2YS4A 1KJMA 3MJ6A 5DQDL 4CU8A 4WW2F 1UJTA 4BSVA 4PJXB 5ITFA 3TBYA 1DBJH 1LEIA 4AK1A 3VG0L 3NZ8B 2Y36H 3N1PC 4BK5A 4S0TD 2C26A 4KJPD 4LASH 5MERB 2FLBT 1FL5B 4Q9QL 3LH2H 2E7LA 2R4SH 1NMCC 4PJBF 3W39B 4KI5C 5D1ZA 3CLFH 4XB8A 4R90H 1I8LC 4WUKL 4XPTL 1NPUA 3ARWA 5EN2B 4C56E 4LCCA 2P45B 2I07B 4P9HC 4PJ7B 4QRPE 3T3MF 5CP3A 1I8MB 1BREA 4NJ9H 2R9HD 3RWDA 4J3XA 4WWKD 4R7DB 3IGAB 2BNRD 2IQAB 5DLML 4XVTH 1BEYH 3T0XA 5GSVA 4NO0B 2J6EA 1BFTA 4OD3H 4CNIB 5DD0H 4HS3B 2HFTA 4LCCB 4N0FB 3MODL 1GL4B 1Y0LB 2W59A 4V2BA 4P3WA 4APQB 5J6HB 2A0LD 4BELD 3JV5A 5FK9A 4JFFB 4NDMA 2KQNA 4EUPH 2VLKA 3MO1B 4H8WC 5K9QI 3CD4A 7FABH 1ZXQA 3ROOB 3FL7A 4H25B 4LSTH 1MRDH 1FSKC 4G6JH 1HHJA 4HS6A 3PL6D 3LKNA 5BRZA 3L1OL 2W9DH 5BJTB 3MRFB 2VDRH 5DYOB 1UB5A 3VXOB 4EVNA 1U8QA 4GRWH 5CHNB 5AUMB 5I8OH 3TYFB 4FZEL 4Y0GA 2DIJA 4XVJH 3O6KL 1HCFX 3T3PE 2QEJA 1KCUL 3EYVA 3MLXL 5FGRA 5ADOH 3S96B 1IAIM 4OT1H 1DQTA 3TF7C 5DJXB 1A6AA 1T2QL 5HYJB 2VXQH 3OB0H 3VXQA 3DARA 3MLSL 2P7TA 3U0TB 1C12B 4FFZL 1X4ZA 1Y18B 4F58H 3DNKA 3HE7D 3GMQB 5D72H 1M05A 1NDMA 2YD6A 3RL1B 2V5SA 1E4WH 4KUCF 2HRPH 5GS2H 2B1AH 3RPIB 1YMMB 2XI9A 3L9RA 2IPKA 2EICA 3M8OL 1UB6A 3HG1D 4XXDB 5H8DA 2AERT 2XY2A 3NABH 1QRNA 3D2UB 3BIKB 5E5RB 3HI6H 4DTGL 4HX1B 5DVOA 5I74C 2CR6A 4PREB 4APQA 2EH8H 4QXWA 4X0KB 1A7OL 2PYEA 4YEFA 5GS0D 3HAEB 1JGDA 4S1DD 2UWEB 1FL3A 4CVXB 4CW1A 4FQCL 1BWWA 3MLZH 4RISL 1UKTA 3BDYH 4F2MB 2PF6A 3GSXB 4O9HL 5IGXH 5IMOB 1CFQB 3LH2L 4MXVF 1X5FA 5E8DH 2YRPA 4YWGL 1X5GA 2Q86B 4B50A 2L7UA 3QO0B 4FQJL 3FQRA 5F96L 2R8SL 1KGCE 1NJ9A 4MD0B 1JHTB 4PJIE 5DC4B 2MTPA 5DFVD 4JJ5B 4EJ1C 1JWMB 4YAQB 1T04A 5FOBA 1FO0B 2DM4A 4NWTL 3E6FB 3RJDA 2C4XA 1ERNA 2HJKA 1FVDB 2A6IB 3QUZC 3GO1H 5D2NE 4P46D 4PRPB 5DD0L 1EXUB 3B9KA 3VD7A 2YPVL 3BRFA 5KVGL 4PV8B 1A22B 2X4NB 3IFNH 1GJIA 1QBML 2PR4H 1AC6A 4MS8D 2I27N 1CF8L 3TBYB 4WU5B 5DRXA 3BN3B 1E4KA 3MBXL 1TJGL 2I60L 3MBEB 3I3BA 3OGCA 4XNZB 3FO9A 4NT6B 3PWJA 4I2XB 4JRYD 4XAWL 3QSKB 1P9MC 4D8PA 5EO9B 4JZJB 5DR5L 3LKRB 4PJ7E 3I2CH 3CMOL 2BSED 2X1PA 2XZZA 2WV3A 3HR5A 2ZOKB 4PLNC 1CDJA 4Y1AA 4YGVA 5DJDA 4DVRH 3EOAA 4CVWA 1VGEH 5DURD 1A9BB 4IBLT 1BZ9A 4PJBA 5BVJB 1DBKL 4GRWE 4RNRB 5D72L 3OXSA 4TUKL 4UAOC 5F9JA 1BEYL 2JIXD 5GRUH 1DVFA 3ARBD 2H2SC 1T03H 5IT2L 5GZNC 3EJYC 2NX5A 3RVTC 1GGBL 2YRZA 3QFDA 2A9NH 2Q6WB 1W72L 1QNZH 2AJSH 25C8L 1YEIH 1I1CA 2Y06L 3PXHA 2KZ1B 1PKQA 1EXUA 1U92A 3V95A 3G9VA 3V4PH 5A2IH 3U46A 2F5AH 5CILL 1A47A 1N6UA 2C3GA 1M05B 4TSAL 3OQ3B 1AHWA 1LO3L 2C3HA 4Q6IC 4I3RL 2JELL 3D69A 5FO9A 4CAGA 3LEYL 2JJTC 2ZWLT 3FQXB 4UDTB 2ZSWA 1OTSD 2D9CA 3LAFA 2I5YL 4Y16D 4JM4H 6FABL 1OD9A 1CG9A 5EU6D 1WCBB 4LBEB 5L7XL 2B1HH 3I75B 1KPUB 1UQSB 3BSZL 1WLHA 4HWEL 4MB3A 4NQCD 2HRPL 2R1WB 2PYFB 1KT2A 1OAUH 1CTOA 3U30C 3M8OH 4L4VA 4MJ2A 1KUMA 5GS3A 1IM3B 3K80A 5D7JC 5BW7C 2OR9H 3WFHB 3TO4C 2CUHA 3JV4B 1OHQA 4OGYL 3TCLA 4OQTH 4KGJA 1IGYA 3BP5B 5F1NB 4XBPB 1KIQB 2IG2L 1SYSA 1KEMH 3X14A 3VXUE 1WBXA 2C5DC 5EPMA 5J06A 1NGPH 1TVHB 3LSOB 1MCKA 3DHMA 3QCTH 2V2TB 2CDFA 1A1OB 2WP3T 2Z8WC 1T1ZA 5H2BA 1S7UB 4KKBD 3D39E 2ERJC 3BYTA 5TH2A 4ERSL 3SDCA 1II4E 2OTUB 3L3OB 1KB5A 2D0HA 2E27L 1RZGA 2J8UA 2VYRE 4PJFE 3W0WA 3MV8E 3BAEL 3UJTH 4NQEE 2NY5C 1RPQA 1J0HA 2F8XC 3O4LB 3MA7A 5GJTL 3GMNA 1ONQA 5DLMH 5JDJA 1A6VL 3EGSB 2D7PA 4LCIH 1BWMA 3DECA 2X70A 1HQRB 2WANA 3WFCH 3HAEH 1A6UH 3TVMB 2GY7B 2FL5A 3O41A 1OB1B 1QBMH 3C8DA 3NAAH 3VFRA 4OCYL 1A7QH 3HZKB 4JFHD 2P8LB 3V79C 4MYWB 1G0XA 3BMVA 1E28B 3SJVD 4JDZB 2MQ0A 4ONGL 4BZ2L 4FS0A 3S9DB 4N8VB 3B3IA 5IVXB 3R4DA 4RISH 3OKLA 4M3KB 3VFNA 1MCHA 2Z31B 4MD4B 3HC4L 4K7PY 3TT3H 1FLRL 1FG2B 1X4XA 1J87A 1ZA3A 4L4TD 4UNUA 3QQ9C 1N2RB 5KSBB 5ADPH 3D1MC 1YEFH 1DEDA 1OD7A 3O2VL 5D8JL 4F37K 1R3KB 2FX7H 3O3AA 2WW8A 5CEZH 2BDNH 3OB8A 3D18A 4PLKC 4KK8C 2FJFB 5KOVC 2VZVA 3ARUA 3HC0A 1YEEL 4XCEB 2YEZA 2DLHA 4I4WA 4GUPB 4NO5A 3B2VL 1KCKA 2P5EE 4M4PA 3IF1A 3MV8A 4OFDA 1YECH 2W92A 4LCUB 2WZPD 3FT4B 3N06B 3KPQA 1MCFA 3CMGA 3QEGL 5AD0B 3LQMA 4EN3C 1OAYH 5A1AA 2P44B 3LPGA 4IRSA 2EKJA 2OR7A 4Z76B 4PJFF 3V6FB 2G9HA 4PJGF 5MEPA 1BFOB 3ARZA 5T33H 2J1KA 5KVFH 4N68A 4P23B 4P2OC 1CYGA 3IDGA 3DVNB 5I1LB 1EFQA 4HMCA 2C3XA 1NGPL 2IPUK 3O3EB 2ZZUT 4FTVE 4LQ1A 3DMMD 3GMPB 2K9UA 4WNQA 4K3JH 4WY7L 3WD5L 2B5IC 3FQNA 5IJKC 4BH8B 4YX2L 2XICA 4Z7NE 4XPTH 3LEXA 1U9KA 2VLRD 3V6ZB 1Y6KR 4JFYA 3D85A 2YRLA 2HLFD 4ZFFA 3JWDH 5DFVC 4PV9A 1UM5L 5EU5A 3V7MA 3VDCA 1XIWA 3D5OF 4LCCC 4NC1E 4Z7NF 3B4NA 1KSRA 2IH1A 3FMGL 3DV6B 2NZ9C 1VERA 5SX4H 4YDIL 3DMMB 3QUZD 5HGAA 4JKWA 4S1RH 3O45B 5DQDH 3EDKA 4B5EA 1U8NB 1GGBH 1IEAA 3MA9H 1NBYA 5EZOH 5D7JB 4HAFA 3O0RH 4EI6B 2BK8A 1QVOB 5F7FA 4Y88A 5MEQB 3RZCA 4Z77B 1N3NA 3ULUC 1TJGH 4PREA 4G42B 4Z7OE 3ARRA 5D6CB 3X12B 2Z9TA 2O5XL 1BMGA 4U1KA 5ICXB 4GKNA 2YUZA 3PWPE 5EPMB 4TUJB 4EDXA 4JHZA 4CN6A 1ND0B 3KHQA 4G6AD 3HNSL 3O6ML 1EMTH 3MLUL 2Z31C 4OGAD 5EC1A 4DEPC 4JPIB 3O2WH 5FYJL 4LVEA 2YKLL 4RAHA 5CGMA 2VXTL 3RVWC 1CI5A 2H2SD 2NW2B 5EOQL 4DK6A 5I73B 4X6DE 4JFOA 3Q3GB 2XKUA 5A16B 2UYLB 4XPBH 2AVGA 5ESVB 4RGNE 4M4RA 4XH2B 4P9ML 1RJZB 5JIHA 1JGVL 2IPTL 3BGMA 3TFKC 4HCRL 2YBRB 5EBWB 2Y36L 5I1IH 4W81A 5K59E 1REIA 5HBBA 1BGXH 2X4QA 4BZ2H 1OTSC 4QTIH 1Q9OB 4KTEH 1G7HA 4UTBH 3T4AB 3O4OB 4HJJL 4PRNA 5L6YL 1FO0A 4WU7B 1V5JA 2DBJA 3D0VA 5JR1H 2PTTA 4NO0A 4N1EA 1AGBB 5DJ6B 4J7RA 2HTKD 4ONFL 4URTB 5FYKH 5J12C 4RZCB 2VQTA 2I5YH 3U2SA 4C56B 1FAIH 3B9VA 4XPFL 4W70A 3SE4A 1JGLL 4P2YA 2WINA 3VH8B 4U6TA 2QJDA 5E9DA 3QEQB 3ZKQD 5I74B 1IAIL 3VFTA 4U6HB 1TQBB 2BRRL 2HWZH 3HI6L 4CMMA 3U30B 4EEEA 4I48B 4JREC 1EUUA 2AV7A 2HA1A 1PVHA 3PDGA 2B4CH 2NY2C 2PCPA 1A6UL 2ZUYA 2R2EB 4JFXA 5C0GA 1A0QL 2BSTA 5ESQA 4I0PD 4JPVH 1E4WL 3I9GL 3WIHL 1A6ZB 1FFNB 3QDMA 4XT1C 3RJQB 4P5TB 5E2UL 5I1LA 1OAXL 3EO0B 1F4YL 5D1XA 4YWGH 3WSQH 5K9OA 2O5ZL 1N4XL 1T3FA 4IOFD 1LHZA 2VAJA 3U0TA 5D7LA 4Y16C 1TJHL 1Y6NR 3IDIB 2ITCB 3S7GA 1Q1JL 4Z6AT 5JIPA 1AO7E 3BP6B 3QUKA 5CGTA 1DQMH 2FIKB 4PJ9B 1FVCB 3MYJA 4JANB 2APXA 1KCRH 2NY6B 3QPQD 2ICWA 2DQIH 3MROA 1OY3B 4J3OC 1FN4A 2W9DL 4ZUTA 4ENEC 4EVNB 2FO4B 1G7QA 4LF3A 1XGUB 1U8MB 3RDTB 4BZ1H 2EIBA 4R8WL 4UV4L 5JXEA 1FNGB 2MJWA 4PJHF 4D8PB 1DQQB 1TPXB 2EKSA 1WTLA 3T77A 2LU4A 2PKDA 2VISB 5IV2A 1FRGH 1IGJB 2WBJB 3IXTB 3BYYA 1JPSL 4XP9L 4R0LA 4MAUL 4ZFGH 4YHOL 1NDMB 43C9A 4ZD3H 2XWTA 1QEWB 3F5WA 1OGAD 4ZS6D 3RIAK 3D39A 5TE4L 1D5XB 1T4KA 2NY1C 3EFFB 4JN2A 2Y7QA 5AAMA 3SPVA 4DQOH 4LVHC 1IQWL 2AI0H 4EI5B 5IB2B 2CDFB 1EH9A 2BHZA 4ODHL 1KJ2L 3OR7A 3TT3L 1XH3B 4M93C 1A2YB 4XCYB 4X5LA 3SKJH 4GQPH 3O3UN 1XCQB 5ID1A 2UY6A 4FQPA 3L5IA 3QUKB 1OGTA 3BKJH 3DX7B 5CEXA 3FQRB 5C3LD 2XFXA 3GSUB 1I1AA 4DAGL 1A2YA 1MI5E 4XCYA 2EYTB 4DUWA 5EBLA 3REVB 2ZCLL 2V5YA 1A5FL 3DETD 1G0YR 2XYCA 4KKLD 3WS3B 4QWWD 1F3DH 5INCB 2AQ2A 1T5WA 2DQEH 3VGAB 4KVCH 3STLB 3BD4A 5EZOL 3ZZ1A 5C08E 1JFQH 1PGRB 2V2TA 1JNLL 1NCCH 5TF0A 3T3ME 1S7TA 2CXKA 1MSPA 3GFUA 3UAJC 1QYGH 4DZBA 2CK0L 2UZIL 3CFJB 2ZUSA 5INCA 5IFJB 4JRWA 2CDGB 4ZUUB 3F6LA 4UQ2B 3BGFB 5JNYB 1AR1D 1YJDC 2BZDA 5FKPA 1UACL 4KDWA 4H20H 1IM3A 2ADIA 4C58B 3WFBL 3EOAB 3QNZB 3PP3H 3QDGA 4JFFA 3LEXB 4HKZA 4G9DA 3RNQB 2DMKA 5D5ME 4WFEE 5FYJE 3QUXC 5FV2A 4YDVA 5KVEL 1J05A 1WT5C 4RX4A 1UYWH 5CEYB 1GGYA 5IT2H 5EIIA 3CXHJ 2ESVD 1MCCA 3QNZA 3GJFB 4L8CB 3TO2B 2D4DA 4NN5B 4PBWD 2H3NA 3WNOA 5E94A 1BZ9B 4PJBB 1HKFA 1U41A 2MSPA 4KH2A 4YHOH 2J88H 3RUGB 2YXMA 3FAXA 1FFNA 3MODH 1U3ZA 4MCZA 5GRXG 2XPGB 3ARBC 4EDWL 4G5ZH 3NACL 5I8EA 4JCMA 4CGTA 1VACB 4PJXF 5E95B 3BH8B 3L7FA 5JDSB 1A4JA 2VLME 5C07B 3F12B 2R1WA 4NFBA 3RQ3A 4MNHA 4UQ2A 5GGVL 3GK8H 3W5MA 3IVKB 5DO2D 5I76B 1OLZA 2WINB 4ZTPL 3FQWB 3AROA 1HILA 4LBEA 4Y5XC 4KUZH 3WKMH 3DTXA 1F4XH 4NP4L 2VAAB 2CLRB 4WFFD 1NCBL 1QOKA 3QEGH 4G9FA 5INDB 4QXGH 5ISZE 3GHEL 4GBXA 4F2MA 3JWDC 4P2QE 5C0IA 1UVQA 1CLZL 1IC4L 1EBPA 3GMMB 1FJ1A 5I0DA 2DQEL 4ZS7H 1D5IL 1MJ7H 5I18H 3N85L 3VWKD 3ARYA 1A0QH 3EYUL 4ZAKC 5SV3A 3CVHB 2D3VA 4LDOB 3U6RB 5F9AC 5C0IB 3WXVH 1PKQB 1FLRH 4QT5A 3IS0X 4Z0XB 4LP5A 3SE9H 4LIQL 5I1JL 3MLZL 4OGYH 4PG9A 4WFFE 4ZNEA 5C0BE 4XXCA 5JR1L 1GGIL 2AEPH 3OPZH 4KHXL 3U6RA 4ELMB 4RQQA 3E3QC 1KPRB 5CP3H 5AAWA 4ONFH 4PGEB 3AMKA 2LAGB 3RNKA 2VRAA 4ODVH 3P9MA 1I9EA 3IKKA 1U8OB 3QCTL 2F53D 2R0WL 4PJEA 2GUOA 4C56D 4QF1B 1R24B 4OCWH 2NX5E 1HHHA 1JV5A 3GMPA 5CD5D 2DYPB 1FYTA 3E1F1 5TDPB 1F45A 1JWMA 1OTUC 3T2OA 1UH2A 3NN8A 1KFAL 1O0VA 4NKIL 4FQ1H 1YEGH 5DJ8B 5INDA 4DCQB 5CJ8A 4R4BA 5DJAB 1Q9LB 2MNUA 4IS6B 3OAUL 3IJSB 5C0EA 1DTUA 4ODXA 1YEEH 1AKJB 5DRZA 4UNVA 1L6XA 4NSKB 1FSKB 4TTDD 2IANA 3K8MA 5CD3B 3FJTA 1KTLB 4BKLB 4LCWB 1ZLSH 1BOGA 3BESR 4PB0L 4OAWA 2X6MA 5ESQB 2DI7A 5LQBL 3NBNA 1YUHB 4NOFA 2DM3A 2LTQB 3BKMH 3QXTA 5GHWL 4PRPE 1CE1H 5GIRA 3IFLL 4BQ8A 4XAWH 5SWSA 3AUVA 5I1KL 1Q1JH 2VQ1A 4LVHB 1FV1A 3W9DB 4JFZL 4HEPG 5SWSE 4H26A 5GRYA 5HY9B 5EOCH 5IFAH 1PG7H 2NW3B 2ADGA 3T0AA 3C8KB 4YDIH 3DYMA 1EHNA 3L5XL 4OM1L 4Z8FL 1GGTA 4OM0L 5T5NF 3VH8A 1MCBA 1DL7L 4PRBA 3AGVA 1ETZB 1MCLA 3C5ZC 3RY6C 4I77H 4Z0BL 4HCRH 3V0AC 2DD8H 4R4NC 5HYQA 3GJFA 2O61B 4Y19E 3RDTD 2DKMA 4I48A 3QDME 4N90E 4JEGB 4WUUA 4HT1L 5EH1A 5JHLH 3PGFL 4UDUA 5AYQA 5TFSL 4KK8D 3O6FB 1UM6H 1CDHA 1C16B 1MPAH 5C08D 4MAUH 4OCRL 4ZFGL 3ESVF 1PJ9A 5GRVK 3MGOB 2RHEA 1HINL 4WO4B 2VDNL 4RZCA 1L0YA 3ZKXC 5J56B 2FJHB 2DQUL 3LKQA 1N5AB 1CLYH 1BJ1H 4KK5D 4YZFF 3SE3C 4NWUH 4L4TE 1CCZA 4HHAB 1KENL 2YSSA 3EYSL 1KCVL 4KKCC 1QLRB 2F54A 3VRJB 1X5IA 1XEDA 3G04B 4LLMA 4OF6A 3MZGB 5DQ9B 2AJUH 3CDFA 3Q2CA 4LKCA 3WD5H 2F54E 1NFDB 1JBJA 5BXFA 3V0VB 4K94H 5BZWB 1LD9A 1AJ7L 1BM3L 3TO4A 4MMZC 4NKDA 3DO3A 2IMMA 2FWOA 4R97B 5GGTL 4IOIB 3TA3B 4O2EA 3EO0A 1Z5LA 2V2WA 3IETB 2GSGA 2KDGA 1UGNA 2P5WA 4EIZC 3QIBB 2AKRB 4JKMA 1F42A 5B8CB 2R23B 4JPIA 1IZKA 5LWYH 1GC1C 1P2CB 3OSKA 4HQQL 3K1DA 4U1KB 4RAVA 1T1XA 5ECJE 4KDTC 4YLQT 1C5DB 2CSPA 1F5WA 2VLKD 1A64A 1D5MA 3NACH 3LV3A 43CAA 3RTQC 4OFYA 4EI5A 2FO4A 1K5NA 2R56H 3MRMB 4F57L 5JW5B 2XZCL 4Y5YB 3O4OC 5FGBC 1DQJB 3RX5A 3KWWA 4FXGA 2CUIA 4MJ5A 4I3RH 1CFBA 3RWFB 4GKNB 3VXSE 1HK6A 1HH6A 1NGXA 4ERSH 5JW4R 2XA8H 3L5XH 4OM1H 5A2LH 4X6DB 4MX7A 5DJ0B 4BQBA 5DS8A 4Y5YA 3EYFA 2XOTA 3MRQA 5TH2B 4FQXC 4U3CA 2NPLX 2H26A 5EOTB 4HBQA 4X0KA 5E9DD 4DUXA 4MCYB 1NMAL 2W0PA 1FL6B 2ED9A 4GSDL 2BOBA 5BMFH 2PXYA 2ADFL 2C1PA 3SGEI 4MDJB 2VXUL 4YBHA 3UCRA 5DK0A 3QULA 4PTTA 5JORA 1DQLH 5ACZB 1OF2A 1U6AH 4NO3A 5I15H 1MVUA 2AK4B 4O51A 4KFZC 4HPYH 4LLYA 1AI1H 2DOCA 1ZGLP 2XXCB 1NANI 1BBJB 1HSBB 4NRYA 1FAIL 3P0YH 2JCCE 3MXWL 1OF2B 1JHLH 4WI6A 1KEGL 4KZDH 4ODWB 3MRDA 1I1AC 3QDJA 3EOYG 3LQAL 1JZ3A 1DL7H 3AY4A 1QLEH 1GOGA 3BXNB 3T8XB 2OL3A 2AK4D 1KCRL 1MQKL 1B88A 4WGVB 3OAYK 3GNML 2W0KA 3G5VB 5C0BD 4DWHA 4P0DA 1HYSC 3PGDA 3ROOA 5F21B 2J6EL 1BVLB 3MRQB 3CFKB 4OV5A 3WJLA 2YC1A 4HQQH 5IMMB 1RJZA 1EV2E 3B9KD 3U46B 3QIUD 4OCYH 1LP9F 4X7SL 1TDQA 3HTLX 1INEL 3CVHA 3P0VH 3REVA 2ADGB 5EORH 1YMME 4FA8A 4HIIA 1A6WL 5T5FL 4K8RL 3ELAT 2V7HB 1NGWB 4G43A 4Y4FD 2XN9E 4Y2DB 1E6JH 5BS0D 4HC1A 2QR0B 1KELH 3PWNB 2VR4A 2Y5TB 4KROD 4R4FL 4M00A 3HNVL 4MA1C 3RL2A 8FABB 1QBAA 5F7EH 3DSFL 2VITB 4L1DA 3ZT5A 1BZQK 2XZAL 2Y9RT 4WI8A 4Y4HD 2EIDA 1WWBX 3AMLA 3TN0C 2XTJD 4L8SC 5E7FA 4XP4L 1I8KA 2HVJA 3V7AG 3HUJA 1OLLA 4N0YH 4ORGA 4BZ1L 3GJFH 5DRWB 4NKQB 3VXPB 3EYVB 2ZCLH 4PJAB 4IHOA 1FNSL 2NXZC 2X4SB 5ENWB 1KJVA 2E9JA 3L7EB 3ZYJA 2DLFH 4NZTL 1JN6B 1CGUA 4TN9A 2IJ0C 2CH8A 4IIQB 1U8KA 1CGSL 1R3IL 4ZS6C 2W9LA 3I50L 3RX7A 1I85A 1HOCB 2E7HA 4JN1L 1HIMH 3SGKC 4OB5H 3UTZB 4F7PB 1U2HA 3QHFH 3SDXA 5GGRB 4BA8A 4YPGB 1CFSB 1J8HD 3V5HB 1C1EH 3GSRA 4WUKH 3BP7A 4QCIB 4YO0B 4HUWB 5CBEB 2FHFA 1FFOA 1P4IH 2OBGA 1FORL 1G9MC 4JAMB 5B3JF 1RMFL 3MXVH 1PFCA 1W8OA 3CH1A 3SGDI 3SKNA 1CBVH 1J8HE 4KKBC 5EBGA 3FQXA 5C07D 4NQCA 5BVPL 3IVKA 4Z7QE 3K4ZA 3NPSC 2UZIH 1VB9A 5KZCB 2VXSH 4YEEA 1D9KA 4JO2H 3O6FD 4HDIB 3IXAB 1EX0A 4LSRH 4V1DD 1FO0H 2X2YA 1IAKB 2EIZB 5J11C 1CQKA 4YHLH 3FRPG 3GSOB 3RIFF 4HMDA 3O11A 4XXDA 1J0IA 4G80A 2OMBA 4G6JL 4DJMA 3AU1A 3I6GA 2R2BA 2CJUL 3H0TA 4L3EA 1ACYL 2W65B 1U3HB 2RCSH 4MNQA 1NCBH 2PTUA 5KJRL 3ZYZA 5FUOL 2FBJL 3GSWB 3RIAF 1A02N 4YAQA 2CQVA 3AB0C 1S8DA 4NCDA 3P77B 4ODXB 2XZQH 1IEBB 4YHYC 5F88A 3HC3L 2KKQA 1D5IH 1A14L 1VSCA 3QJHA 2J2ZA 4OZGE 4OAWB 4Y19D 5FIEA 4JQXC 5LXGH 3BN9D 1MCWM 3ECBB 2OLDA 4CADB 1J0JA 4OCMC 3QJFA 3S88L 4TQEL 1G9ML 3UJJL 1TZIB 2EDRA 3IDYB 4M6OL 3DXAE 3KYOB 2FECL 3T0ED 3OGCB 1R24A 3RPIA 1BVKA 4KTYA 1UWGL 2IEPA 1YY8B 1U8HA 2X4OB 2DYPD 1JMXA 3MUZ1 1TCRA 1BJ1J 4YIQA 1K6QL 1DUZB 2FGWL 5JW4M 5KSVB 3NFPA 3U4BH 5DGQA 3O11B 4ZUWB 4Y4FB 3B6SB 3STZB 1RV6X 2XG4A 2YPLD 2O61A 2DQFB 1L7TH 3NIGF 1H3XA 3VXTA 3QP3A 2X4RA 4K55A 1YN6A 3FO9B 5DQJB 5F1OB 1B0RB 4XWOC 4OCWL 3GDBA 4M9PA 1NAMA 3LQAH 4YR6A 1A3LL 2YD8A 1AHWC 1NBVH 4Q6IA 5KANG 1TCRB 2LFGA 4GFTB 5EDXA 3THMH 3VXMB 5DSCA 5E00B 5IK3B 1KF9B 3MLYL 4YBQC 4OZIA 4P23D 2ICEA 3ALPA 3WE6B 4M61B 2H41A 3BPCB 2C3VA 4GMSH 4NP4H 1LEKA 5SWZE 2E7LC 2F53E 1N3NB 1Q72H 4E41A 5HYFA 2R4RL 4K9EC 3LKSB 5F8RC 4Y8DC 4JPKH 1CFTA 2AJSL 1V7ML 1G9NC 5C09E 3FO2A 3BKML 3GMMA 5GHWH 2CO6B 4MJ4A 1CZ8H 1FIEA 3VXRA 1KJ3L 2G60H 5HGGS 2XWJB 2H9GB 2PW1B 1SEBB 1CLOH 1ACYH 3ISWA 1BHGA 1ZLSL 3T08A 1WJ3A 3BD5A 5HGAB 4UQ3B 4UILH 1RZ7H 5FO9B 4XPGH 4KTDH 2VLRA 5DEFB 3LEYH 2NQCA 5EFIB 1U3YA 3UTSD 3IKCB 3V52L 2ZCKL 4PGCA 3FT2B 4DGIH 2X4RB 4PRAB 1CXLA 4ZFZA 2HVJB 1HNFA 4RAVB 2EC9T 4MVBC 4ELMA 1OWRM 1A3QA 4LPVA 3ZKNC 4YHKL 4ZXBD 2AJ3B 1VENA 1KLGA 3GI8H 3PDOA 1G6RH 4NUJA 5IEKB 2WBJA 3D0LA 4M9OA 2VB5A 3DVGB 2UWEE 4WWID 4JZNB 2D0GA 3OJ2C 1QRKA 2OR9L 3MRRA 1P7QD 1JZ7A 1ZLVK 4H88H 5C08A 5BXFB 3MCKB 1RIUH 4P3CH 5IHUH 1LO0H 1X4YA 1DFBH 3WNKA 4KROC 4G3YL 4PJIA 4YBLC 3F7VA 4NKMB 1KC5H 1BD2D 5EU7E 5GS0C 4EUPG 1QKZL 1KCUH 3MLXH 5E6ZA 1T80A 3M1BA 2DLIA 1JK8A 1A21A 3QQ3A 3GSRB 2VDMH 3DGGB 1VGKA 1MJJA 3PQYB 2VDNH 1M71B 1DANT 1WUNT 4MCYA 1HDMA 1AJ7H 1UM4H 3TN0D 2XTJC 5EO9A 5I1CL 3QUMB 3WHE1 4X6FB 4FMKA 1FQ9C 1NMAH 1EFXA 5DXWA 5IG7B 1W0VB 2OCFD 2I07A 4PJ7A 3UJTL 3KLAB 3TBVA 2XQYG 3ULUH 2DM2A 2AXFB 2CXGA 1EAPA 4HK3J 2K3TA 5IVZB 2IQAA 5GGQL 3QUMA 1ZKAA 3ULUF 4JY6B 4ONOA 4HF5L 3KYKL 4S1QL 3KPSB 5EIVA 5BV7L 3HS0B 3V2AR 2HJLA 4DW2L 4KI1A 1OAKH 2R0KL 2VZOA 2DL9A 4D0CA 3Q3GA 3HZKA 4Z5RA 4TULH 1OAZL 1XCTA 4WRLA 5HYJD 1QYGL 1GHFL 2X4UB 32C2A 3EZ8A 3SGJC 3UZQA 4UIMB 3VXUA 5E9DB 1N5YL 4OZFA 4PLJD 3N1FC 4EN3B 4U7KA 4NM8L 4PRID 4S1SH 4GAFB 1JN6A 5KSAC 4TSAH 1R3IH 2VL4A 5B21A 1QP1A 1XZ0B 2P5WB 3BJ91 2JELH 1FZMA 5E2TL 1YEHH 3I84A 5C0AD 3RVXC 5F70A 2AABH 3HZMB 4HSQA 2LAAA 4LGSB 1RUPH 1NBVL 3FCTA 5C70A 1MWAL 3TH2T 1T6VN 3V5HA 2P48B 1ZT1A 4WU7A 2WIIB 1B90A 1X7QB 5DA4A 1TQBC 2NMSA 3MACL 1JRHI 4KV5F 5FM5O 5IB1B 3FO0H 5DDHA 2XTJE 3D3VB 4DTGH 4HXAH 4NDMB 5E1HB 3PHSA 2BVPB 5FA4A 5FHAL 3RAJL 7FABL 1YNLL 1SJEB 3MFFB 2C4FT 1ZMYA 2OYPA 3S4SG 3WNLA 1BFSA 2V2WB 2DS4A 3IETA 4M6ML 4DZ8B 5I1HH 1PZUB 3HE6A 4H5SA 2APWA 4L8SB 2LTQC 4G8IB 4QHMA 4V1DB 4R2GC 3MGOA 2WWMC 3VXME 2CK0H 2P42B 3E3QE 5DQJA 1E6JL 1JPGA 3KPRD 3SE9L 3ARFD 1Z0MA 2AK1H 1GXEA 3ARVA 1FNHA 4XPGL 4XMKH 3WNNA 1WISA 3BH9B 1OGAE 1MFBH 3P0GB 3ARSA 1H0DA 3B9AA 4MXQD 3KPLA 4L3EE 5GGTA 5BRZB 4TUKH 3WNPA 5HHNB 4HBCL 2W0FB 5T3XL 1QO3B 5CBAB 1TZGH 5C0DA 4M93B 5JQ6H 3OF6D 2YPVH 4PJ8B 3BN9C 3TZVA 4HIIB 1F00I 4MJIE 5M95B 1IEAB 5TE6H 4KRMB 3BUYB 3TBWB 2NLJB 4ZG1A 1E0OB 2XG5A 1D6EA 1MQKH 3MRDB 1NGYA 1A7QL 3MNWB 4R96B 3D0VB 2XA3A 2ZOLA 3LPWA 4M8VA 4PB0H 1JZ2A 5B38G 1BD2B 3CGTA 5L8KB 4PRDB 2CUMA 3KYOA 4NSKA 4QWWC 1KEGH 4PJ8D 4HIEA 4Y4HB 2EYTA 1TENA 4LCWA 5JHDE 4IRSB 2XTJB 1OSZB 2NZ9D 4NFCA 3HC4H 1JNHA 5J11B 4Z7WB 4JO1L 1FORH 5DI8B 2EH8L 4HPYL 2OL3B 4JFZH 4OLEA 5D6DC 1DBKH 5A2KH 3S5LA 3AM8C 3ME0A 4FQCH 4DKDC 1G6RB 4KKAD 1K8IB 5B4MC 5T5FH 5L2KA 3QJHB 4PJ5A 4YR6B 1LEGA 1ZHKA 5EC2B 3MRJB 1HQRA 1VFAB 2VN4A 1XAUA 1J1PH 4UT9L 1YNTA 3IJHB 3TPUB 4L3CB 2V5MA 1KLUB 3PWPD 1AKJA 1KN4L 1TNNA 4YNYB 3SO5A 1ZA6A 1N8ZB 4OI9A 3O3DA 4GRLD 4Y7MA 2YD2A 2X1QA 3O9WA 4HWNA 3EHBD 3HZMA 4MDJA 4TPRL 2DI9A 1JTPA 4WJ5B 2VERN 1X5AA 4R4ND 3T2NH 5EA0H 3HZVA 1BIHA 2ZUUA 3L3OA 2BNQE 5LGJB 4JHAH 4M1CD 3V0WH 3NCFB 3VRIA 5KVGH 4PYHA 3CVIH 1H3PH 4P2OB 2Z92A 3MRNB 1R3KA 3PP3K 3WS6A 5T3XD 5E4IA 4LNRB 1DE4B 2NW3A 3UJIH 1U2CA 1GGIH 2AEPL 5I1GH 4GKZA 4GBXB 4WDIB 5LVEA 1FDLH 5DEFA 2WQRA 4XVUD 4YJZL 3RKDD 3E8UH 4PFEA 1OM3H 4HJGB 4LSUH 1WVZA 5GRUL 4H1LH 1E4JA 3OX8A 1NCUA 4JKKA 4WFED 1EHXA 4Z0BH 2CK2A 5FYLH 4U1NA 4IRJC 4WHTB 3DWTA 4LHQB 3VFPA 2QHRH 1QRNE 2ESVA 3WO4B 1TITA 4PJ5E 2ZPKH 5C07A 3KGRA 4E41B 1EEYA 1HOCA 4ZAKA 5TE7H 5HHPB 3TNNA 2XRAL 5E24E 1MCSA 3O3BA 4PY7B 2X7LA 3SDXF 3JTSA 1OVZA 1YN6B 2AV7B 3G6JF 3NCYS 2Y4SA 4X80L 3QFDB 2ED7A 3DMMC 3P9WB 4GQ9L 4L8DA 4OZIB 1S5IL 5C3TA 4PJCF 4P3DB 1BQUA 4YDJB 4G6ML 5AWNL 5DD6B 1GC1H 5EUKB 4XZUA 5JTWA 3G6DH 1X7QA 2A6JA 3TVMD 1DZBA 3V0VA 4RWYH 1PG7L 5E8EA 4AYFA 3QWRD 1B4RA 3RZCC 1CD9B 4ETYA 5A40E 4I0PC 2CRMA 1SJEA 5C9JA 5J8OA 2XN9A 4PP2B 5DK2B 3TP4A 1U93B 5FO8B 3T77B 1CU4H 1FO0L 3DX8A 1F3DJ 4TVPD 3RGVD 3WHXA 4HT1H 5CIPH 1EERB 5B38B 3MRPA 3BZFA 2GK0A 3C2AH 5AYUH 1KIRA 3BQUC 4HZLA 1UWGH 1LMKA 1J11A 4XX1G 1JIBA 2C3WA 3BWUC 2GJJA 3QIWB 4HIHA 1HHGB 3OKKA 5C9JB 4WW2C 1ED3B 4P9HH 4HJ0D 2X4SA 1JPST 4FNLL 2FD6L 3QFJE 3WYRA 3WBDA 4N8VA 5IVXA 1K8DB 5HPMA 2BSRB 5MI0C 3SN6N 5HHXL 3GSOA 1S9VA 4Y2DD 3ARTA 4NN6B 3Q1SH 5I8OL 3NA9L 4OTXL 4JKLA 3OAZH 3PG2A 4O2CB 5ELIA 4L29A 5AZEL 1EZVY 5L0QC 4NZUL 3JWNC 4NRZA 5KS9E 3U79A 3AREC 2EC8A 4HWBH 5DD1H 3SGKA 4OZGB 3VI4E 4I1NB 1KTDB 4HZAA 1FIGH 2YR3A 4S0SD 3E6HB 1M6OB 5E99L 2GFBB 3HI5L 4N0RA 1JL8A 1OB1A 5ICXA 3VFRB 4ZFOA 1DFBL 3KLSA 4NQDE 5GRJL 3TNMA 1JFQL 4U0RC 1OW0C 1T1WB 1I7ZA 4G8GB 2R69H 4PYGA 4U1HA 4JPVL 4Z76A 3DXAD 4AIXA 1VFUA 4LCIL 5IB3B 3OMZA 3STZA 4KRPB 2DIBA 4MHHI 3V0WL 3LQAC 4L8SA 3KJ4C 5EIIB 1H3WM 4M62H 3ZE0F 1MRDL 4X9HA 3PDOB 4NCC2 4K7PL 4PLOB 4U1LA 1S78C 5JXEC 2H32B 4KJWD 5IGXL 4KAQL 3P0YL 1TFHA 5EU6E 2SEBB 2IQ9H 2NY2B 4MXQC 3DLQR 2KH2B 1P1ZA 4X6EA 4OUUB 3T8XA 5I8KH 1E27B 1T22B 2R15A 5C0JA 2BHUA 1WZLA 4U1LB 4OLWH 3R8BB 2I26N 4YUEL 5B8CA 1NBZA 2NY5H 1YMHA 2BHYA 1I1YA 1K2DA 3MUGB 3ZDYE 2EDHA 1U8LA 1HHJB 4HS6B 2PO6D 2P7TB 3SY0B 1HILB 5EWIL 5DUBA 3AXLB 1RZ8A 1K5NB 3MRMA 3NH7H 5EA0L 4DOHE 1QACA 3T0BA 3DX6B 1FPTL 3O6MH 1D6VH 3KPQB 5F9WC 5FHBH 3W11D 1T1WA 5TPWL 1A9EA 1KYOK 1MCIA 4PJ9C 5ID0A 3MRLB 4LSQH 3QAZC 4G7VH 4K71C 5FYKL 4I0KA 1EUTA 1QLFB 3WJLC 2A9ML 2Q8BL 3MROB 1H3UA 3G6JA 3R1GH 4BFGA 3IU3B 1NCWH 1F11B 1AD9A 1SQ2N 4P2RD 4M5ZH 4AM0B 2E6QA 5IB5B 3I2CL 1FDLL 5KG9B 1C1EL 4LVNB 4CVXA 1R0AH 3HFML 1AIFA 2HWZL 3OKMA 2YA1A 4I3SH 4ENED 3GSXA 5IMOA 3AREB 1MI5B 3KG5A 2W9EL 1A6TB 1TETH 2GEEA 1Z3GL 3V6OC 1DDHA 4AM0A 4YQXH 4NWTH 4AH2B 3I9GH 1BQHA 5D1QC 3WNMA 5BO1L 1Q0YL 1VGKB 2P5WD 1FZJB 35C8L 3HMXH 2NY7L 1HWGB 1M4KA 4U1JA 3L5JA 3U4EB 1F4AA 2Y6SD 5L2JB 4LSPH 4BH7A 1I3UA 4LLDA 1UJ3C 3LDBB 1TTUA 1S3KH 2WIMA 4OZGF 3IU4H 5DT1H 2YUXA 4BYHA 1HSBA 4X80H 5HY9A 4RGMC 3I6KB 4JY5H 3BE1L 1HDMB 4QXTA 1QFUH 1ZHBB 3BO8B 4HC1H 3QI9B 5DHYA 5IFJA 4GLRI 1JZ4A 3RVVD 5HHME 3TNMB 3MJ9H 1OAQH 3CX5K 1NCNA 2K1MA 4NKMA 4O5LH 4QRUA 4XPAL 5J13C 2UYLA 4NQSB 1Z9SA 4QXTB 4OZHA 3FFCD 5DHYB 3GSWA 4ZFZB 2GK0B 4D0DA 3VXUB 4BK4A 4ZUVB 5B39G 1EAJA 5D5MA 4LKXB 1D5ZA 5I1IL 4OGXH 4KZEL 5E8OB 2R0ZL 2EZ0C 1FV1B 1MF2H 2CLVA 1HHHB 2R2EA 5C0GB 1ZT7A 3S8WA 3A6CL 2EC9U 1FZJA 3WFEL 5FHBL 3L6FA 1N26A 1RK0A 3CH8A 3H9SA 4QRRA 3LOWA 4MAYC 3V4PL 3SKJL 5J6GA 2QSVA 4BJLA 3H2WA 4K7PH 4QY8A 2QQKH 3UYRH 4UDUB 1RIHL 2A73A 4OSUL 5TGBB 3B5TA 4PJCB 1FBIH 4YE4L 3MUGA 1URLA 3PL6A 3H7BB 4QT5B 3T0EC 4X6BB 1MHHB 4WV1A 2EDYA 4PR5B 1BAFH 1JNJA 4KKLC 1A1MA 3QUML 2CKNA 5TE6L 4XCFH 1OCWL 1U91B 2DL2A 2HVKB 3RVWD 4CU7A 4QXUH 3DJ9A 1BQLH 4NKIH 3VFUA 3S36X 2BSTB 4X6CA 3P4LA 4PJEF 3DI3B 3OAUH 2AXGA 3O9WC 1OAXH 3E2HC 4M61A 5J3HC 2ADJB 5HGBA 1IKFL 4V1DE 1L9NA 3VWJD 3MV7E 1KCSL 3VFTB 4JO2L 3IJYB 4RFOH 2EDJA 4LSRL 3HG1A 3RAJH 4MXWH 4XGZA 5T1DL 1K4CB 3P9LA 5JW4Q 4IOIA 5D71H 2J8OA 2QKIA 5D7IB 5F7UA 2BNUA 3M07A 4FTVA 3C60C 3N1MC 4GO6B 4LAQL 1K8DA 4LLMB 5IW1A 4S11A 5J1AA 1L7IL 2P24B 1YA5A 3PWVA 1IAOA 1N4XH 1U8MA 5JQ6L 5GGSB 2O5YH 4K94L 4AQ1B 5C7XH 2RFXA 4O00A 1RVFH 4XCEA 2AEWA 2A77L 2CIKB 5TDNB 3VMNA 2X4QB 1FNEB 2CKBB 3FN3A 1S7XA 1BJMA 2EXYC 3ARPA 4HIEB 1PZ5B 4UT6H 3NZHL 5BO1H 5IHBA 3JSSA 2HT3C 2DDQL 1U8IB 2OQJB 4KRLB 5TF1L 1A6VH 4L8DB 2ZP0T 4AJ0A 3GSVB 4TTGA 4K2UH 5JA8B 4J3UA 4MVBD 8CGTA 1ZOXA 3KYMB 4TVPL 4MB4A 3DV4B 4GRMA 1JF5A 1A3RH 1ZVSB 1RIUL 4NQVB 4P3CL 3BRGC 5D2LA 3EO9H 4X8JB 1OP5K 4JVUA 5DMIH 4WTZG 3GK8L 1BZ7A 1ZWIB 4LLVB 3I6LD 4X9IA 3QFJD 1CLOL 2DQIL 3R1GL 4WI9A 5IWLC 3LV3B 43CAB 4N0UB 4U4BA 1P5VA 2RBLA 1WICA 2VMFA 1L0XA 1C7TA 1UKQA 2Q1EA 3ZKMD 2BY2A 1VFAA 1NGQH 3MLTA 4G6FD 4Z8FH 2EIZA 2PO6C 3AS2A 3ZSSA 1IT9H 4UINH 3FONB 2V9RA 1LE9A 1OP9A 2J8HA 3D3VD 4KY1H 4YQXL 2F15A 4F7PA 1L6ZA 4YPGA 3WMSA 3TZVB 3BKJL 2ADFH 1R3JA 1MJ8H 4GXUM 3U1SL 1T1ZB 3EYOB 4ONHB 5TE4H 2A1WL 4GOSA 4TTDC 4DOHB 1EO5A 1P7QB 1OAZH 3W9EA 3WXWL 3PJSB 4QTHB 3HR5B 2W07A 4Q7DA 5EZJA 2JK5B 2QSTA 5KVFL 3EHBC 5EULV 5I16A 1QKZH 1YEDB 4KUZL 2F58H 3GM8A 3PWUB 5E2JA 3WKML 4CJ1A 1QSED 3H42L 2GTZA 3Q6FB 2A74B 4U7SA 2I9TA 1I75A 1H5BB 3GRWL 4UIKL 1NSNH 3TVMA 3TN0B 5CEZD 3FQNB 1YYLL 2VXQL 3CK0H 4LMQE 4YGAB 1G6RA 4L3EB 4WI2A 1JI2A 3FB6A 1EJOL 4MWFB 1ZT4B 1H15B 5I1GL 4R90L 2V17H 3O3BB 1TLKA 3QQ4B 1AXTL 1CL7I 4R9HA 3UDWC 3LS4L 2O26U 1PX4A 1L0QA 4MLSA 3W11C 4D9QD 2NY7H 3BFOA 2Y6SC 1HH9B 2F19H 5I75B 5GQBA 5J6HA 3G5ZB 5CZVH 4ZFOL 3WFEH 5I1HL 4WTZA 5FUCE 1S5IH 2EEAA 3OJVC 4I18A 4MXWL 4N5UA 4MD5A 3BKYH 1NC4D 1V7NH 2LE9A 3NA9H 2R56L 3HPJB 2VLRE 4LPWA 1W0YT 1HKLL 3L95B 4M5YH 4PJGB 5F6HI 5L6YH 4AEHH 4NYLA 1A7NH 4HKXA 4PJFB 4ZOAA 1XIWC 1BP3B 3DPBA 4KXZH 2FNBA 3O8XD 4NBYB 2FYYB 3GHEH 3VA2C 3ZSTA 4R2GD 4CVZB 5KN5A 1SVCP 1J1OH 1RZFL 5JDSA 1XGQB 4NC2B 1X5YA 2I24N 3QUMH 5F7EL 2JB6B 1RZKC 2QQLL 3C2AL 4HK0A 4HPOH 3LY6A 1RZIB 1YN7A 5EWIH 3LKOA 2CR3A 3R8QA 1IGYB 2DQCH 5KTEL 5ILTL 1YC8A 4X7TB 4UTAL 2FBOJ 3UTTE 1FGVL 1W72A 3P30L 3FHQA 5KSBF 1K4CA 3P9LB 2K7PA 5CSBA 4ZSOB 1UJ3B 4KK5C 3JV6B 3BVNB 2CLZB 4C57C 2GKIA 1DLHB 4WCYH 43C9B 3I85A 4MAYD 5HI5C 4LARL 4UTBL 3VXRE 3BDYL 1Z9MA 2P46B 4RGNB 4E9LA 2MPAH 4OCSH 3OL2A 3HZYB 5E8DL 5GGRA 1LILA 2ARJA 5ISZD 3OKEA 4RMWA 1BQHB 3K8KA 5IW6A 2CO7B 4AIOA 5FDWB 2R2HB 3U9PL 4EQ3A 3H9HA 3CK0L 5IEHB 4PY8J 2IC2A 2X70B 1AQKL 5J3HD 1YEJH 1QHOA 3MBEA 1DN0A 3CH1B 3CZFA 1J1PL 3U2SB 2FH6A 1KG0A 4LPYA 3ZE1F 4ETQB 1F2XK 1D6EB 4YXKL 5IBTH 4A6YL 4U1GC 5EU7C 1G6VK 1T5WB 2ID5A 3MV8D 5FEBA 3QQNA 4X4XB 1QFUL 4HC1L 4UIMA 2AXJA 5KS9F 5E99H 3ZTNH 2F74B 1JGDB 4Y5YC 3H9SB 3QIWA 3S3PA 4IMLB 1QR1B 3ARXA 5I1KH 5F6IC 3MJ9L 5FYKU 1I9RL 2VC2H 4XC1H 5BVJA 2CJUH 4LL9A 4HWUA 3D9AL 3KPSE 3ARQA 4Y16A 3D48R 5T3XE 3RVUC 5F1NA 1U3HC 1P7KA 3VW3H 4OFVA 3VFWB 1K2DB 3GBMH 3GGWA 3HHRB 5JIIA 3ROLA 4UIKH 4PGDA 2ZOKA 2DI8A 3HRZA 4CVUA 1MFBL 3QHZH 1HHKB 3WLWC 2BXZA 5L0QB 1NBZB 2WLZA 3SE8H 1RQ5A 3RVTD 4KJWC 1R3LB 3JVGA 1MFEL 4FQ1L 1LO2L 1T7YA 2YZ8A 3HMXL 2GQHA 3MX0A 1Z0NA 3GUTA 2ATPB 1GIGH 5DJXA 2OXGA 5C0NC 4Y1AE 3H7LA 2G75A 3B5GA 2VITA 1X9QA 2Z35B 3PQYE 1OAUL 4UT9H 4NQTA 3CFBB 3ILPB 1HINH 2BRQA 3CZFB 5DUPL 5CD5C 3OKYA 2NY5L 4F57H 1JNLH 1NCCL 3MGAA 1FYTE 1A1NA 3L1OH 1T6WA 1IFHH 3HUJE 3BPLC 2WIIA 5HHPA 4YHMH 4XRCA 5IR1A 3S37H 3HB3D 3SO3C 3VXUD 5T1KB 4F9LC 4PUBL 2VDKL 3I75A 3B43A 3UYOD 3SO3B 1G7QB 4JB9H 3P73A 2GJ6E 4M43L 1X3DA 1YY8A 1GC1L 2BERA 4R7DA 1UXSB 5D96B 3U36B 5J0BA 4JFXB 1GYAA 2G9HB 1A3LH 1AR2A 4R3SB 5IMMA 3T04D 2A83A 4ZPVA 1NUNB 3ARFC 3Q0HA 4UT7H 4HLZG 1RUAH 2DTML 1DBAH 3ULVL 4CBPA 4MSWB 5F7KC 5HTSA 4XAKD 5DD3H 4R7NB 2Q7YA 3V5DB 5DZLA 4RFNB 5GIRB 3FQTA 3U1SH 4E5XB 3WS6C 3SHSA 4EDXB 2OI9B 1EVTC 3FAWA 3CXDL 3SQBA 5F8QC 3RWGB 3DGGA 3RWHB 1QBBA 2YPKB 4WCYL 1RY7B 4MA1B 2A6DB 3PIQB 4G8FB 1BF8A 2G5RA 3C8HA 3DROB 2J7LA 1ZLWH 2AJXL 3REWB 3ULSB 5C1MB 4D0DB 1QSVA 1CVRA 3IJSA 1IJ9A 3HLAB 4NQEB 2NY2D 1AGBA 5DJ6A 3S37X 5DRZB 1L7TL 3V4UH 1J8KA 3AU1B 3T2PA 3GMOB 3QO0A 1YQVH 1NQBA 4H5SB 4H20L 4U6VH 1Q9KB 3CFCH 5E1AB 3VWJB 1MHEB 2E27H 5F1SA 4NM4L 2X09A 4RWYL 3V5KB 5CJOL 4J4PC 1GIGL 1IEBA 5CJ5A 3DIFA 4Y2DC 2DQHH 3A6BL 4Z7WE 4H1LB 4GMSL 2C7UB 1SM3L 3HI5H 3S36H 5E2WL 2BOCB 3SOBL 1DSFH 2CDGA 4LQFL 2HT2D 1S9WA 5B4MD 2VDPL 1YDPB 4J12A 4F7MB 1R5IB 5T5NG 1CFSA 1EVUA 5GS1C 2X40A 2XWBB 3MXWH 3GMLA 4RGNC 2VLJD 3DX9A 1S7UA 4FMFA 4FQJH 5F96H 3BZDA 4JRYB 2O5YL 3SDAB 4RWHA 3FO2B 4QLRA 1NUFA 5D1XD 1IEHA 1KXVC 3DRQA 4G42A 1XIWD 1BAFL 3DURB 4HH8A 5IMLA 4UINL 4ZUTB 2BVQB 1J0YA 5CJBA 4D0CB 3MA7B 2W38A 3SQOH 4NZUH 3LIZH 3F7YA 3NPZB 5CEZE 4OBSA 5L8LB 1SY6A 4EXKA 5FGCB 4F7CB 1T03L 5ALBH 5E08H 3IFNL 4HF5H 4P2OD 5D1XB 1A3RL 3ALXA 2LU3A 4WW2A 1UC6A 5EU4A 4OZIE 4RAUB 3NIFE 5F3HA 2R2BB 1JWUB 2R4RH 2ZSVA 4ZOEA 1S7QA 1XF3B 4WFHD 1IILE 2YZ1A 4MD5B 1MCRA 3KJ6H 2DKSA 3SCMD 1T0MA 2WM0A 3VGGA 4YHML 4KJYA 5F7DA 1LK2A 3O8XC 1HHIB 4U6HA 1XGYH 3T1WA 1UCBH 4LK4A 4O58H 1XH3A 3D9AH 1PY4A 3X3FL 3TT1L 2NY3B 2Q8BH 3WN5C 4XNXH 1PSKH 1JZ5A 4P5MB 5JLZA 1JF1B 1NFIA 2XKNB 1UEMA 4QOKD 5DVNA 4KY1L 1OW0A 2ZG1A 5EOQH 5I2IB 1LO4L 3GMRA 4JG1H 2XN9B 1MFAH 5DZOA 3VFVA 3SCMB 2J6EH 1CG9B 4M02A 3LMJL 2XTLA 3IXTA 4HLZH 3TCXA 3CSBA 4NC0B 4MJID 1NLBH 4NQCB 1G6RL 2GTZB 2QADD 2WUBL 5FCUH 3DSFH 2GTWB 3RWJA 3I3EA 1IC5H 2A77H 3JUZA 2G5BA 1AE6L 1HNGA 1NKRA 1KEML 3WIHA 1DVFD 4CNIA 2ILLA 4BQ6A 4ZQKB 1IFHL 1T89C 5IM7A 3JTTB 3JVGC 4EUPB 3H42H 2OM5A 4NOBA 5DC9B 3W2DL 1QSFD 4K2UL 2VXVL 1B9ZA 2ADIB 1FL6A 4PTUA 3F62A 4EZMA 2B20A 4YDKL 3BQUD 4KQ4H 2QKIB 2IFFL 4XBEH 4AG4H 4DVRL 3KHOA 1AGEB 3MLYH 4W68A 4A2MA 3EDDA 4WIQA 3QUXA 3G5ZA 1CICC 3FONA 2AAVA 3KDMB 1FG2A 5LCVL 3LD8C 4UMGA 1IGTA 3HFMH 1IGIH 5IK3A 1HSAA 3NCBB 3TJHD 1RJYA 4AT6B 3O45A 1Q72L 3HPJA 3TIDB 3P30H 5F7LB 3DBXA 4KRPC 5JOPE 3NFSL 2QQNH 4ESKA 5DD5L 1EGJA 2IPTH 3MRBB 4F8TA 4ONGH 1NAKH 4R2GB 3SEPA 5HGDA 1XF4A 4PGEA 5CEXB 1JGVH 5H2BB 3DBXB 5FO7B 2VLJB 2EDLA 3DV4A 4GRMB 5AZ2H 5MENB 3R06B 2K7QA 4QHNB 4X6DF 5D7LE 2VSDA 1N5YH 4YIQB 4HUKB 3FB6B 3VI3F 4QRRE 2LQRA 2UZYB 4JR9L 4YHPB 1EHAA 3IDGB 4WTXA 1I4FB 3FQWA 4KXZI 5GZOC 1KLUA 1FL3B 3EFDH 5GGVY 4FQ2H 1ZA6B 2WQ8A 3FO1A 2HTKC 1EK3A 1FGNH 1YEDA 1R3LA 1CBVL 3GIVA 4NNYA 5B22A 4LGRB 1LEGB 1ZHKB 3QDJB 5KJRH 1GPOL 1MFCH 2W9EH 2VOTA 3G04A 4ZO9A 3S88H 2HN7A 1S78D 1G9MH 4ZODA 5C6WH 4NO5B 4MCZB 1WAAA 4H88L 3FO0L 1NUDA 4YFLI 4K7FA 3SOBH 1PKQE 1CZ8L 5FHAH 3LCYA 3WUWB 1U36A 4AEFA 4LQFH 3MRHA 5FV1L 5K9JH 1EJOH 2BVEA 3V6OE 1GH7A 4WHYG 1NDGB 4K3JL 4WY7H 4AL8H 2GJ6A 4D9LL 3QDMB 4MNHB 2MPAL 3ARGD 4U6YA 1HHKA 3GIZL 1XGYL 4ZFOB 4XP5H 5IKCA 2ADJA 4WEBL 1R3HA 4F7EA 1IM9A 5D71L 1T1XB 2ZCKH 4HGWA 2V9QA 2FJFA 3KYNB 3GBNH 5HI4D 1JF1A 1NFIB 2OP4L 4NQED 4X7CC 4U6VL 4H25A 4LARH 5JQHC 1N0LA 2X41A 2QQLH 4DN3L 2NTSP 4PGCB 5F1IA 3O6KH 4M5YL 4LSSL 4OKVB 5T3ZH 1RU9H 4JLRA 5KTEH 4S1RL 2PW2A 4X4ME 5ALBL 3MBED 2IAMB 5F44A 1I7TB 4QXUL 1A9BA <