1IL1A

Crystal structure of g3-519, an anti-hiv monoclonal antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
QLQQSGAELVRSGASVKLSCATSDFNIKDYYIHWVRQRPEQGLEWIGWLDPENGDTESAPKFQGKATMTADTSSNTAYLQLSSLTSEASAVYYCNAISTTRDYYALDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords monoclonal antibody G3-519 (heavy chain)
publication title Structure of an anti-HIV monoclonal Fab antibody fragment specific to a gp120 C-4 region peptide.
pubmed doi rcsb
total genus 45
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2001-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1il1A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1il1A02
3A67L 4FQPA 5INCA 1CDCA 4LSDA 1H9VA 2ATKB 1VENA 5E4IA 3T0EC 3MCKA 3RWJA 3ZDZF 5MHSE 2YRZA 3SJVB 3G5XA 1JHLH 4NP4L 1R3JA 3WS3A 1ZS8B 1G7PA 1NBQA 2FJHA 2NY0D 1J8KA 4XNQA 3UBXB 1AO7B 1DQML 3DX8B 3BUYA 2Y5TA 3GJFB 1RZFH 3O4LD 4X9BA 2FWOB 1CGSL 4LIQL 5HHPA 1VA9A 3LKPA 4ZYKA 3NMEA 2V2XB 4UI2A 1DQQB 2P48B 3KYNB 2PO6B 4KV5F 5IMKA 2Y25A 4KJQC 1MSPA 1KC5H 5FYLL 1FZOA 3QIWA 5D72L 3PWVB 1J88A 4U6VL 2GI7A 4L3CA 3EOTL 4PJ7A 4M1DH 1LDSA 4HWBH 4IRSC 3DX9A 5EU6D 4HFWB 4JHAL 3AROA 4FABH 4R4FH 4N0YH 4RGND 5J1AA 3VXRB 5I2IB 4M5ZL 2GK2A 5I76B 4IMLA 3HZMA 3DMMB 3MR9B 4OD3L 4CJ0A 2G75A 2B1AL 2F54E 4HH8A 4ODHL 4QHKJ 2KQNA 5MP6H 4OCYH 4XCYA 1KGCE 4TRPH 3W11C 4NKQB 3LEYL 4E5XB 3IFOA 4PBWD 3KR3H 3ZDYF 3RWCB 1CD1B 4NPYA 1R5WB 5T3ZD 1T22A 1WZLA 2VDML 1I1YB 2BVPB 2PR4H 3DUSB 2AAVA 1ZT4B 3E3QC 2AI0L 4IRJD 4R9HA 4JO3L 1LEIB 7FABL 5J13C 4YBHA 4X4YB 3C5ZB 5MERA 1XGPB 4DGYH 3GMMB 1JRHI 2D03H 2F9BT 4CVXB 3OJVC 4HWNA 2ENSA 3B9KC 2X44D 4MLIA 4HULB 5IROA 3G5VA 1YPZA 1CFSA 1MHCA 2C3WA 3FRUB 5E08H 2AJZB 2KZWA 4KPHH 5C07B 5ADPL 3VGHA 4XC1H 4JFDA 5SWZA 1RZKL 2OQJB 1IQDA 5EIQA 5B3JE 1U8KB 2XA8L 2NY3B 3ELAT 2WBWB 2HT2C 2P7TA 4NFBA 4EDXA 3ZE0F 3L1OL 3TBYB 2Y6SD 3GSNH 1Q1JL 4I77L 4APQD 1LO5A 2ADIA 4CMHB 3ZKNC 4IOFD 4JFXA 2V9TA 4MQTB 5I30L 1NH6A 3QEGL 5JOFB 4N68A 2R29L 5TF1H 1OCWH 4P2QB 4MHHI 4YPGA 4DN4H 5FIEA 4KHXL 3REWB 4OLUL 3L7EB 4EKXA 1BBJA 5FKPB 1LQSR 1MCIA 5D1ZB 4YXHL 3QUZB 2DL9A 3T77B 2Z4QA 1NL0H 4QOKD 4MQSB 1TJIH 5CS7A 5CFHA 1SHMA 1AQDA 3VE0B 3VXUA 1S7SA 1UEYA 2AJUL 4PRHE 2PO6C 4CBPA 5GZNC 3BKCH 3GNML 2R23A 5IVXE 4BZ2L 3X12A 5J4MA 3FFCA 1M7XA 2IGFL 2OX5A 2RJMA 2O5XH 3FT4B 1V7NH 5I1HL 3QDJB 1ULVA 2FEEI 5DXWA 1EH9A 5F7DA 5HI4C 2EDHA 3GB7B 4UUJB 1UC6A 3B9DA 4U7SA 5E8OB 1UQSA 2BNQD 1ORSB 2XWTA 3SGJC 4LPUA 1D9KD 5F1IA 1CL7I 4NCC1 2HT3D 5BS0D 1J8HD 2LE9A 3GSVA 3DMMC 2Q76A 4H0IA 4PRIE 5KSUB 4JDTH 1SBBA 1JPGB 1U8QA 3CDCA 5FM4A 1L9NA 1T89C 1JGDA 1NDGA 1IL1A 4OKVA 3KG5A 4DQOH 2XA3A 4ZS6D 4NQCB 4G9FB 1U42A 3DXAE 4O58H 1YUHB 3O6MH 2W60B 2MPAL 4EUPH 2P42B 3I84A 4JKLA 3C6LA 1LE5A 3RGVD 4X98A 2FBJL 1VB9A 2EC9T 4XNXL 1GIGL 5TH2A 2XN9E 4RRPG 5HDOA 1IQWL 3VFTB 3BGFC 3DROA 2HMIC 3TIEA 2X4UB 1N59B 5FM8A 1A4JA 3Q1SH 2A6KA 4KTDH 4ZOAA 3D0LA 2X4NA 2VXVH 4WWKB 3QFJD 2YA0A 3C2AH 3CFBA 3VD9A 4ZTOH 3QWQB 4I3SL 1JVKA 3TP4A 4FXLA 5FUZL 4JO4L 5C3TA 3GRWA 4L4VD 4Z78A 4Y4FB 2NY3C 4LEXL 3SDDD 2OP4L 2R1XA 2VISB 3IFNL 4IHOA 5C09E 4CMHC 3IU4L 4HW6A 4QXUL 5EO0B 4OAWB 1KCRL 2R4SH 2YUXA 3RWDB 4RISL 1C1EL 4NQEE 1G7QA 4NN7B 4O2CA 1T66C 1BFOB 3GRWL 3QUXB 4L8CA 4JFQB 5CSZA 2R56L 1WWBX 5B22A 4KJPC 4E9LA 4G7VL 5E00B 5EFIB 2VABA 3DBXA 5SX5K 3X13B 4U6XB 2V9QA 1JUFA 3KPSE 5D1ZC 5D2LE 5DTFA 1YEKH 3QUZC 5GHWH 1D5ZA 5D7LB 5TE6H 1NLDL 4YNYA 5C6TH 1A22B 5CJXA 1FLRL 1QHOA 1YA5A 1MI5D 2GUOA 1LEKB 3BT2H 3SN6N 4LAQH 4G8EB 5CJQL 1H3PL 3B5TA 3ZYZA 3TJHC 5IB3B 4U1KB 2B2XL 5F97E 3CSGA 4EXKA 4AY0A 3OGCA 3UPRB 4NZRL 3L95B 1MJUH 1XGRA 2DRUA 3VFMA 4F58H 4MJ6A 3BFOA 1JN6A 5ESVB 4JLRB 1DBJH 1YNKL 2CPCA 4DGVL 3HFML 4OD2A 3FO0H 4PJEB 4XVUD 3GMQA 1GGBH 3S88H 4ONOA 1T03L 1FO0B 5EBWA 3MLRH 2DIAA 1S78D 3UJIL 3C5JB 3BPCA 1EEZB 4G8FB 1CG9B 3QQ9C 1OGAE 5L88L 3SDCA 5DC4B 4F37K 2CLRA 5F96L 3BDYL 1TFHA 3RX7A 5I1AB 3AM8A 4HF5H 2CDFB 3PDOA 5HGBA 5EWIL 3K1KC 1INDH 2ZOKA 3OV6A 5DJAA 3VU2A 2AQ1A 5F1OB 4YHIA 4OGXH 4XH2A 4HX1B 3OKLB 4LFHD 2ZNWA 3PP3K 4JQVA 1A7RH 3ARGA 5DUBB 5F3HB 4JY5L 2A38A 2EDFA 3BZFB 2WNGA 4NM4L 3HC0A 4Y4FC 1T83C 3RJQB 4MNGE 4S1DC 5JHLL 3UX9B 4PJ5D 1F4XL 3HR5A 3LKSA 3MBXL 3RVTD 4YAQB 5HI3D 3HPJB 3QQ4A 5F7LB 3L5HA 4JKMA 1ZT1B 3MV8A 4JFPB 4NJ9L 1WWWX 5IR1B 1T6WA 5GJSH 1UA6H 5TF0A 4XMPL 4XAWH 1D5XA 4NN7C 3VXMA 1I8MA 3DWTA 5A2FA 3TT1H 4HPOH 4IRZL 5EG6C 4K3DL 5J56B 3NZ8A 3RA7L 1LO2H 4MJ2A 4PJ9A 4PGJA 3X14A 3ZHLA 1VGEL 1QSEB 4PLKC 2ZCLH 3SCMA 2FLBT 3V6BR 1AKJD 2F8VA 1C08A 2XQYK 1KPVB 2ADGB 4ODSH 4RZCB 2HRLA 2CSPA 4BKLB 3GSNB 3L5WA 3V4PL 3HAEA 4LF3B 1P84J 1AGFB 3I02B 5JNYB 3KYAA 4JG1H 1N5AA 3QWRD 4XP5H 1VACB 1C7SA 3P73B 3B3IB 3L9RA 4HJGA 3UTSE 5CMAB 5HYQB 4U6HB 1YEFH 1RIUL 2ORBL 1K3ZA 5F1SA 3MA9L 3OAYK 4ZOEA 1NFDA 2C3XA 3IXAA 1MHEB 1B0GB 3REVA 3LS4H 3WEXA 3WJJC 3O9WA 2BK8A 3MRGB 3SOBL 1CZ8H 5AAWA 1S7XA 2DD8L 4H1LH 5E1AB 1P9MC 1DVFA 4NKIH 4DAGL 2HG5A 4LLMA 3ZTNL 2P47B 3MRQB 1HINH 4TSCH 2X7LA 5DS8A 4QT5A 1Z5LB 1QHPA 2I07B 2R1WB 4MJIA 1Q72H 1GC1H 4I0PD 3RY6A 3MXVH 4NO0D 1MCCA 1P7QD 4JRYE 5MEND 1VFAA 3BP6A 1YNLL 1LO0H 4FFWC 4JZJB 1JWSA 3KWWB 5C9JB 1E4XI 4MDJB 4P9HH 1ZHKA 4RIRA 5ACMA 4P3DA 3OKEA 3PHQA 1KEML 5FYKE 5F1NB 1QP1A 3NCEB 1D6VL 3U7YH 4ZUUB 4PJFA 1S9XA 4G42A 4MXQD 3BXNB 5LGHH 1I9RL 1ZEAL 1ZV5A 2CK2A 2YBRB 5DFVC 3O4OB 3FTGA 4M6MH 5JMOC 4CL7A 4HHAA 2YD8A 5IVZA 4JAMB 2E6PA 2C7UB 5EUOB 3MREB 4LSSH 1FIGL 5LAXA 4L3EA 4D0BA 4X80L 4EUPB 1N26A 5CIPH 1G9ML 3NCCB 4K94C 4ORGA 2EE6A 1AI1L 4KHTH 1JTPA 1TNNA 4EQ2A 4YFEA 3WDJA 4DKFL 2EXWD 3S37L 3KYOA 2UV3A 3P11H 3DIFB 4J6RL 2AQ3A 3DV4A 2DBLH 3MLWL 4MWFB 2JK5B 4AEHH 3QIBB 1N5YH 4FQCH 5CD5C 1KJ2A 4FZ8L 5SWQA 3S35X 3B2UD 4H88H 2VZTA 3NA4A 3NIFE 5DQJA 3N06B 1QBBA 2XTJD 4F8TA 1IILE 1FYTB 5AD0B 3M17A 4CADA 2X10A 3BKMH 5GGRY 5JQ6L 2YK1L 4PJ8A 4KK6C 2IH3B 3O2WL 1C5BH 4NRZA 4U1IA 3OPZH 4JO1H 5I8CA 5KVFH 2DIJA 5E6IB 3GSUB 1U8HA 4YC2B 5ESAB 3VFPA 1YY8B 2V17L 2JJTC 3HUJF 1DSFL 2DQJL 1LP9E 1YMMB 3RX8A 5KTEH 1IKNC 2Z0BA 2C1PB 3OTTA 3I6LD 4OF7A 3MV7E 2CGRH 4XXCC 1XGTB 4QXGH 2FSEB 2AXHA 4LHUA 1I9JL 5KSBB 4PJXE 3ISWA 3DOSA 2XWJA 3ECBB 5IBUG 1U91A 4PR5B 4NO3B 4JG0H 5DHYB 4D9LH 5C6PB 5DDHB 2CUHA 3RIAF 2ZCHL 4JZJC 1GOGA 5CCKH 1K9TA 2GSIB 4ZXBB 1I1FA 2F74B 1FDLH 2ADFH 5IJVA 4PJGE 1HSBB 4DW2H 4L4TB 1Q9WA 5DJZB 1JYVA 3PP4H 3VI4E 1RK0B 5ELIA 4JJHA 1OAQL 3O4OC 1Y18B 3EFDL 4JKWA 4JPWL 3WNPA 1IFHH 4OFYD 3EYQC 1MRCL 1I1AB 1BQLL 3BP7A 3DO3A 4QO1A 4Y1AA 1HEZB 5J3HD 4QCIA 4IS6A 4OZ4A 5FO7A 1FZJA 4NZUH 4NO2A 3NIDE 2JCCF 2YPLA 1HE7A 1TJGL 2A0LD 3B6SA 2C3VA 4BQ8A 3QIUD 2VXTL 3KPPB 3TYFA 4ODVH 2EDOA 1LDPL 2X5PA 2NW2A 5SX4I 5I73B 1GGTA 5BW7A 5DVLA 1TZHA 3U36B 3TJEH 3JVGC 5A40E 2R39A 3FZUC 3LKNA 4HS3B 3V9FA 3WUZA 4ZG1A 2QQKH 2DJSA 3QIBC 3SE8L 5IJKA 3D3VD 3V52H 3W0WB 3FQRB 3AAZB 5ICXA 3ZYJA 1CFTB 3E6FB 4UDUB 3FB8B 4WW2A 1F45A 3G5YA 3IDNB 4LLWB 2V7NB 3BH9B 3MV9D 4MNHB 2VERN 4HUUB 2YKLL 1OP5K 3GHBL 5IM7B 3TYGH 1V7MH 1RIVL 2KUTA 3VWKA 3VW3H 4ZDHA 2ESVA 4WCYH 5E6IC 3U0PB 5B3NA 1PSKH 4ZD3L 4KI5C 4ELMF 1U8MA 4YHML 3WUWB 1OW0C 4YC2C 1QNZL 5E8PA 3IDGA 5IW6A 3IJSA 5EORL 5EBMB 1QYGL 5IFHL 5D5MB 3FB7B 2HVJB 3U2SB 4BSWB 3WV0A 3FCTB 5I75B 4XNZB 4O9HL 3IF1A 1RVFL 3WFEH 5C0FB 5F72S 4QHUA 3T1FB 4OLZL 1AC0A 1MY5A 5DD6B 1KACB 1CU4L 1TCMA 5DD1H 2BY2A 3E6HB 1U3JA 4C83A 1EAJA 2IFFH 3CSPA 3P2TA 3TBWB 3WHXB 3VXTA 2GCYA 2FNBA 4ZXBC 3GHEL 5DJ6B 5ERWB 3EJYD 4QTIL 4MA1B 1DFBH 2EDJA 4OCSL 5I1CH 4ODXA 4GG6B 5K9JH 3BD5A 3KYKL 4G5ZL 1HHKA 4LNVA 5HYEA 5F7EH 4H1LB 3WHE0 1C7TA 1IRAY 1L4IA 5JDSA 1QLRA 5AWNL 1I1AC 1Q38A 3HLAA 2F5BL 5KZCB 2YD1A 2R0WH 3UTZB 2XICA 4P49A 4URTB 4ZSOE 3MRHA 3UC0H 2AV1B 3DURA 4K3JL 1FBIH 5FO8B 4FTVB 4YFLI 1V8HA 3RKDC 5CEZL 4KDTA 1ZT7A 4LCIH 4WRLA 3R06B 3V2AR 4UTAH 1A3QA 3ULVF 2H9GA 3H42L 5DURD 4ZUSB 5C07E 4N0CD 2N1KA 5DSCA 5I73C 1KENL 2RR3A 1PZUB 4UOJA 3C60A 2A9NH 2VSDA 1A14L 4HXAL 5T1LB 2EZ0D 2Q20A 2DI8A 4WW2F 4XCCL 1QBLH 3FB6A 4RA3A 1NC4A 1X6LA 1R0AH 1RJZA 3OG4B 2YN5A 1EO8L 1EFXB 4X9FA 3SKJL 2DMBA 1MCEA 1PG7W 4LEOB 2V5TA 5CIPB 3H8NA 5LWYL 5CWSB 3H0TA 5BRZA 2GJ6B 1PFCA 5FYJL 3VH8B 1A9EA 3PQYA 4Y19E 2H26B 4PJDF 2IG2L 5CBEA 4M00A 4AL8L 1DEDA 4OIIL 3ULVD 4GQ9L 1IMHC 2VZUA 5DMIH 3QUYA 1NEUA 2FCBA 1F4WL 2QJDA 3MRRB 5CILH 2ZCKL 1Z3GH 3KPRD 2CIKB 4NJAH 1QR1B 5FDWB 4XCEB 1JFQH 4H26B 4X5WB 5KSAD 3ARSA 2QKIA 4GXVL 5IWLC 1MLBA 4JY6B 3DVGA 1CFQB 4KVNL 1RUAL 4M7ZB 5I75C 4XNZC 1FFOA 1ZGLB 4MLSA 1XF3B 5FGRA 1ES0B 1I7ZB 3TCLA 4PG9A 4K23H 1HQRA 1T2QH 2Y07L 4MA7H 4JKPH 5JXAH 4HKZA 5F7YC 1OPGL 3MROA 3CVHH 3B43A 5B4MC 4YDIL 5HYSA 2AVGA 2EE2A 3TC9A 5C0CE 2R2EB 4N1EA 1KLGA 3WL9B 1MCWW 4MA1C 2OZ4A 3D6GA 4CNIB 5J9PA 3GZKA 5JPMA 1KTKE 2D7QA 4KK9C 5SWSB 2CRIA 1I3GL 1YECL 5C9KA 4JB9L 4ODTH 3NFSL 5KSVB 1QBAA 1Z9SA 2APBA 4MYWB 3IB4A 2V5MA 3WO3B 1GC1C 3D25B 4YBQD 2J7LA 2M2DA 1J0KA 2DQFB 3G6DL 3SGEI 1ETZB 25C8H 4G3YH 3LKQB 1IM3A 2IC2A 4P9HC 5B38A 4YQXL 3RAJL 4HS8L 4N5EC 4L8DB 2JLLA 1MCJA 5GS0D 3UJJH 2ED7A 2AEIT 5F7MC 1AHWB 3PG2A 4PYGA 3BH8A 3TLRA 4LSVH 5IQ7L 4WW1A 3TA3B 4NUGH 1CFNA 4X4MA 1Q9LB 4FFVD 3MRCA 4M6OH 1FNSH 3T0VA 1T1YB 4C56D 3OR6A 4Z7VA 3IDJA 3PJSB 3D85D 5M94B 5ALCL 5E9DE 1O5DT 4P5TB 2EYRB 1CLCA 3LKRB 4AM0B 2OJZH 1JZ2A 3UDWA 1HQ4A 3JBG7 4MX7B 1T4KB 3RL2A 3OKOB 1MCDA 1RIHH 4UINL 4TVPL 1IAII 2FDBP 1NGYA 4WO4B 3F12A 3KPNA 4HIXL 4C54A 1W72B 4JR9H 5F9OL 3D69B 5EA0H 3BPNC 5DMGD 4M7JL 5C0ND 4C59B 2Q8AL 1NCDL 1YEGH 4NFDA 3C87A 1DCLA 2DWEB 2P5WA 2GTWB 2RQ8A 1RJCA 2BVOB 4ENEC 2EEDA 3B4NA 4UQ2A 2YHGA 1JV5A 1L6XA 1AY1H 4M7ZC 1ZAGA 4RFOH 4M8QA 5C0IB 3ARFD 4TUOB 5BV7H 4ONGL 3CZFA 3SDYL 2VZ1A 1NUGA 3MRLA 1J86A 1IAIM 2WBJC 4QRRE 2PTTB 1BWWA 4X7SH 3MRNA 3RGHA 1A7PH 3KLAB 1CE6B 4LGRB 1R3HB 2P24B 2RBLA 3R4DA 3L3JB 4GW4B 3QCTL 4OV5B 4XBPA 5E5MA 4NWUH 1HXMA 4NHUB 5EU3B 2MCPL 5HDBE 3B83A 3LN5A 4I2XB 1U3HD 1KJ3L 4MA8L 1WZ1L 5E8EA 4G8IB 5F7KC 4LCWA 1HWGB 2EDLA 3TN0D 3BZDA 1GHFH 2JB6A 1C5CH 3QO1A 2ITCB 4Z7QE 1DDHA 5DJ2B 4C57C 3HNSH 5KANI 1KFAH 2OK0H 5CZXD 4LKCB 2DM7A 5BO1L 3QEQD 5GGUA 5BVPH 4FRWA 1RZIB 2IBZY 3WNMA 2X4RA 5IK3B 2G2RB 5D7IB 1MHHA 4QF1A 5KVDH 2HFFB 5GSRB 5TJWK 2XXCB 5EO1A 3GSOB 1ZHLB 5E2UH 1MLCB 4WV1B 5K9KB 4OZHE 1AHWC 5I1JL 4OQTH 4KTEH 1DLHA 3TA3C 4P4RA 4LP5A 5T5FL 5CHNB 1B0RB 1GJIA 3AY4A 4JFFA 5H37H 4CRPA 3QQ3A 1MUJA 2BNRD 3WBDA 4P5TC 1WBYA 3QUMA 2E7LC 3ARPA 5D1QD 3F5WA 2DYPB 1FPTH 5LGJA 3BESR 2W0KA 1IT9L 5ETUA 2IALB 4YEEA 3UO1H 3FRPA 4EOWH 1XCTB 3NVQA 1ADQH 4Y4KB 4HUVA 3ROOB 3RVVC 3TPUA 4BQBA 4HK3N 4PS4L 2ZPKL 4J2XA 3PGDA 4TVPD 1ZLWH 2Z91B 4ZQKA 5E1HB 5EZOL 2XYCA 2VXQL 2EECA 3WKML 5FFLA 2N4IA 4ZUTA 5T3XL 4PJIF 4XWGL 3DI3B 2NY1D 5FB8B 3VD3A 5JUEH 2BDNL 2R2BA 2CKNA 2OI9B 2A6IA 4F7CB 4CGTA 2BHZA 5ISZD 3ZDXF 1QEWB 4R96A 5HHOE 43C9B 2FATL 3DHMA 2ZUTA 1XGQB 2ICWJ 2YZ8A 3TV3H 3RUGF 1MF2H 1R3IL 1B6UA 5H94B 5FGSA 4O2FB 4PGEB 2AXGB 5IB1B 3DSFL 4K3EL 5I8KH 1U8IA 2I26N 5EOCL 1GYAA 2F53D 4PJHA 3HAEG 4XI5C 3PWPA 4G80A 1F6LL 2VLJE 2GKIA 1AIFB 1FAIH 1KN2H 4KQ3L 5D1XC 2NZ9C 3NCFB 2WW8A 4RFEB 5FHAL 3HCVB 1T0MB 3OG6B 1WC7A 1F4YL 2NW3B 3G6AB 2L4OA 4L5FL 2DQGH 3VFGH 1T1ZB 3CVHB 4ERSL 4NQVA 4QHLB 5FF6B 3ZSTA 4M4PA 4WTWA 4G6KH 3HZVB 3KPMB 4FQLH 1X6NA 5D70H 4UDTA 4IIQA 2WANA 1OWWA 2FEDD 4DUWA 1E27A 3T3ME 2NZIA 4WV1C 3DGGA 4XVSH 3L3KB 5I0ZA 1VFBA 4XMKH 3VFSA 3U6RB 4YHKH 5GISL 1WUNT 3ARED 1X5AA 4OM1H 4AEIL 1OM3L 2DWDA 4F7PA 2GW5A 2W9DH 5I1EL 4A6YH 1S5IH 4R0LB 3CIQA 4X0KB 4N0UE 5CGTA 3W39B 4NKMA 1Q0XL 4W70A 4WI2A 3O3DA 5HYJB 2FX9H 2J6EL 5JW5B 1BBDL 2WWMC 3SGKC 1AJ7H 4H5SA 1QFWH 3O6FB 4R7DA 1H5BB 3CSYA 3MODL 1XGYL 1JPFA 5CINL 2XZZA 4RMRA 2VR9A 2OTUA 2J2ZA 1KN4L 3ARBB 1ZLVK 4BZ1L 2GTZB 3QI9A 3D18B 1OVZA 1XF4A 4I5BA 3OL2A 3HI6L 4WI3A 4Y4KC 2MFNA 1J87A 1IM9B 5IEKA 3WIIL 4LP4A 4G6FD 2NNAB 1AGDA 3RZWA 2CLZA 3X11B 5I1LA 1KIQB 5IFJA 4OCWH 4UNVA 5KVGL 1E28B 4NGHL 3P4NB 4OF3A 4G8GA 5C0AE 1KEGH 2I27N 4LVEA 3V4UH 1OLLA 1T04A 2NYYD 2YMXH 2JB5H 2X89D 3BI9X 4PGCA 3WXVL 2OI9C 4D0DB 5ADOL 4HCRL 3T0AA 5T3XD 3RVUC 2DLHA 1IGIH 2CDEA 3JWDL 3A67H 5F6HI 3WS6C 1W0YT 1INEL 1D5BA 1S5HB 4TSBL 3SDAA 2VZ3A 4NP4H 3MLUL 2VLKA 2B4CC 5EBLB 1DQMH 5HXMA 5JHDD 5I6XB 1JWUB 3FOMB 2A1WL 1CGSH 3VI3E 3QXUA 4LIQH 1Z9OA 4C4KT 3C2SA 4ZMAT 4LASL 2FL5A 5I19H 3O81A 2D7MA 4MD4A 1FZKA 3JV4A 5BV7B 4BUHA 3ARDA 3SKUD 4EQ3A 4KAQL 5FYLH 5ILTL 1NUDA 3MJ8A 2E8YA 5D72H 3KPLB 3PL6D 4U6VH 3EOTH 5TDOB 1JMZA 3KVQA 3TBVB 4Z5RB 2FGZA 5L7XL 5LQBL 5E4EC 3T0ED 3EDEA 4JHAH 1S9VB 1NKRA 3C8KB 4YFDB 4LHUG 5CKAA 1OWRM 3MOBL 2Z8VC 1UENA 2VQ1B 4M5ZH 3RWIB 3QAZB 1OGTB 4U2YA 1DBML 4WUUA 2B1AH 3WCYA 1NCUA 3NCYS 4ODHH 4R97B 4X83A 5K59F 1YY9D 5CD3B 2QEJA 4C4KO 4KJQD 1MCRA 3LEYH 3ROLA 1FL6A 4R0LC 2IMNA 3MLYL 4TVSa 5HTSA 3V0VA 3VXQA 3TM6A 2VDMH 2HLAA 5HSFA 4RGOL 2AI0H 4JO3H 4IRSD 4XC3L 3TBSB 4OLVL 4BSVB 3DYOA 7FABH 3O6FC 1U92B 3T4AB 4DKEL 3EOYG 4KRNA 3T1WA 2DQIL 1A9BB 2H45A 2ID5A 1KIRA 5BXFB 2DF3A 4Z8FL 2ZG2A 3ARBC 3VJ6A 1I3RA 1CGWA 1HYRC 2MNUA 3EZ8A 4QYOB 5CZKA 1LD9A 3MFFA 2ITDB 1FVCA 4OZGA 2WP3T 5ADPH 1S9YB 2AXFA 3QUKA 5DI8B 1RZKH 2X4OA 3W11D 1B6DA 1NSNL 3B5HA 2XA8H 3ARXA 3CX5K 1OAZH 3G5ZA 5GQBA 4RAUB 3L1OH 3VXSD 2NX5E 5IOPB 4I77H 3QXTA 5CLWA 4KDWA 2O61A 1G7MA 2BVEA 3H9SA 3LQAL 3OGOE 1RZGB 5JORA 1CYGA 2YRLA 2PN5A 4MCYB 4ZFFA 3BW9B 5I30H 2UWEB 1UWXK 3QEGH 2DN7A 2PYEB 3B9KD 4XNMB 2R29H 3IU3B 5E0QA 4OQ1A 4FNLL 1IEAB 4J3VA 1E6OL 1WZKA 2FEEL 4KHXH 1AD9B 4OLUH 3SKMA 2VITB 3I6KB 4ZAKB 2WP3O 4OZFH 3WJLA 5I6XC 4YXHH 3B8SA 2AJ3A 3D1MC 3O2DA 4L1HA 3SPVB 4E0RB 1YNTA 2HT2D 4QRPE 4B53A 4O51B 1DN0A 2AJUH 2CKBH 2J5LB 2Z92A 3GNMH 4HH9B 3K4ZA 5BV7C 3G04A 4BZ2H 1I7UA 3EYOB 3DLQR 2IGFH 3QDMB 1JGLL 1T5XB 5EC1A 5E99L 2HFGL 2EO9A 4QRUA 1RJYB 2I5YL 5I15L 5DHVA 2P8MB 3O4LB 3V0WL 3O2DL 1RZJC 4R4BA 4JFOB 3MGOA 4OGZA 3ZE2F 3P77B 3SJVD 5DMJB 3GSRA 4Q9QL 4ODWB 2DMCA 1ZANL 4E41B 3D39B 1AO7D 2BNUB 1IC7L 4HV8A 2XRAL 3QAZC 1TENA 3EO1A 4FTVE 4R97C 5E2VL 4BA8A 2PO6D 4X6DA 5GZND 5J6GA 4UV7L 5EOTB 3KXFE 5JLZB 1XIWA 4L8SB 1A6UL 4PP2A 1G9NL 2MPAH 1EPFA 3GMLA 3QXVA 4JQIL 5KAQF 1A6AB 4LLYA 3S35L 1CT8B 5IBUB 3CXDL 2FBJH 1BJ8A 3MYJB 4XNXH 5EC2B 1BQUA 4LQFL 1GIGH 4G6AC 5HI4D 1IQWH 4NZTL 4GLRI 2EXYD 3VD4A 5KOMC 3TVMB 1HH9A 3KDMB 3LDBC 1OAXL 1ND0B 2VKWA 4JFEE 3VXRD 4HIEB 4HUWA 3DMMD 2XZQL 2DKSA 4Q74A 1FV1A 4FQHB 4Z7UE 4WEUD 2DLTA 4JHBA 2ZNXA 4U31A 3RVXC 4I3SH 3PWNA 3MRFA 4HJJL 5FUZH 4JO4H 4ZNCD 3GUTA 3TZVA 4A6YB 3WHE1 5FECB 5FOBA 2X9YA 5F7FA 5GS1B 1LGVA 5HI5C 1CICB 4LEXH 1J0IA 1P6FA 4HFUL 3FO2B 2Z31B 2OP4H 4XPTL 3IKCA 3C5ZD 1N64L 1UGNA 5DVKA 3IU4H 4QXUH 1PKQA 5GPRA 4P2RE 3RL1B 2HMID 1Y0LA 4P23A 1KCRH 4JFHE 4RISH 3O3AA 4P46B 1C1EH 4DKAA 3D2UA 2AK4A 4OZIB 3GRWH 4BQ9A 5CJ5A 1WAAE 3RNKA 1QFHA 2R56H 5D9SB 1EGJA 1BAFL 1U8PA 4PG2C 4G7VH 3L3DB 3EOBB 1PG7L 4OUOA 2HJFA 1T1WB 4ZAKC 1UKTA 3SDXB 2NY3D 1QRND 3BWUC 5DO2C 1NLDH 3VXME 3MRPB 5C92A 1WIOA 1FLRH 5HHVL 2J5LC 1JF1B 3UZEA 3MGAA 1EGJL 1F3DJ 5CJQH 1H3PH 3QNYA 1UVQA 2B2XH 1KT2A 1JHTB 1T66D 2K1MA 3ZKMC 1CI5A 4NZRH 3ZMRA 4MXVF 5AUMA 5FA4A 4P2QD 4KJPD 3BDBA 4Q6IA 5DGRA 3QFDB 1T7VA 1MPAL 5I17B 1AXSA 1MCSA 5IW3A 5I1GL 1YNKH 4GKNB 1QLEL 3GK8L 3HFMH 4DGVH 3V8OA 5D1ZD 3L6FA 5D93B 3QUZD 4Y16B 2LU4A 3JTTB 1T03H 3RDTA 2VH5L 5ESQB 1FNEA 3OB0H 4I13B 5INCB 3CVIL 1B2WL 3UJIH 1UXSA 3U9PL 4L8SC 3MCKB 2DM4A 2YD3A 1JP5A 3RWJB 3TJHD 3G5XB 1R3JB 3WS3B 3QDJD 5GRJL 5L88H 3MNVA 1G7PB 2FJHB 2FH6A 3LN4A 3QG6A 4BQ6A 4XNQB 1KB9K 3DETC 3BUYB 1EEYA 2Y5TB 5F96H 3BDYH 3KHQA 5HHPB 3LKPB 4XHQA 1FO0L 4NSKA 4ZYKB 3TVMC 5I0DA 4RDQF 5F9WB 1RHFA 2GITA 5EWIH 5IMKB 1Q8MA 2V2WA 1J1PL 1ZA3A 5DEFB 1FZOB 3QIWB 4PJAA 3FO1A 3NIGE 3RGVB 4PRNA 4L3CB 4K8RL 2H32A 3LSOA 1EZVY 4PJ7B 3MGTA 2AABL 4NQCD 1IARB 4G9FD 4X7FC 4JY5H 3DX9B 4KMTL 5B38G 4NM4H 3S98A 5EB9A 4PJFE 3QQ9D 5DRZA 4BJLA 1CICC 4MNQE 4WDIA 5JHLH 3V5KB 1F4XH 5D7SL 2Z31C 3MBXH 4DVRL 5J1AB 5EOCJ 1ORQA 5FK9A 4IMLB 3HZMB 1EVTC 5D7KD 2G75B 3QR2A 2E27L 4NJ9H 3VWJA 4KUZL 4IJ3B 4P46C 4XMPH 5GGTA 4HT1L 4XCYB 3CXHJ 3IGAA 2LAGB 2P46B 2RAMA 1YEHL 5ANMA 4IRZH 4PRPE 4K94L 4JRXA 4K3DH 4NPYB 1T22B 2E9WA 3RA7H 3CFEA 5AYUL 4EEEA 1VGEH 4JQXC 1J9CT 1CFVH 3GFUA 2BSTA 3ZKQD 2AJSL 1Q0YL 5MERB 1X5JA 4Y4FD 3PGFL 4PJCE 2W0FA 4S1DD 5GGTL 1A3LL 3ZYOA 1JZ6A 2VXUL 1FG2A 3V4PH 1FP5A 5L2KE 1YPZB 5FA3A 1A21A 1CFSB 1MHCB 3HG1A 2EYSA 2A74A 3QEUA 3KPQA 2BSRA 5SWZB 1IQDB 4Y5YA 1T7WA 1T2XA 1RIUH 2BRRL 2ORBH 3UYOD 4Y5VA 2B7DT 3MA9H 4PJEF 3U9UA 2BERA 1E4XL 1MWAA 2P7TB 4V1DE 4EDXB 3D87B 4K9EC 3VRLF 4PLKD 2FRGP 3SOBH 1LO5B 1CD0A 2ADIB 5D93C 4Y16C 2DD8H 2GK0A 5D7LD 4JFXB 3T0XA 3WIHA 3RI5K 1XF5A 4DAGH 3F7YA 3WNKA 3ZTNH 3QXAA 5F7NC 4XMLL 4OSUL 4XTRC 5DC9B 3T04D 3CLFL 5AZ2L 3HRPA 4YPGB 4L9LA 1YDPB 4GS7C 1MWAL 1OY3B 2AQ2A 1YNLH 2PNDA 1BBJB 4M5YL 3CZJA 2P44B 2DQUL 2YC1A 1XEDA 1KEMH 2Z4QB 1D6VH 2VDQL 1AQDB 3VXUB 1FCGA 4PJAF 4CMMA 1S7SB 1KG0A 4P48A 4Q2ZA 3VFWA 1I9RH 1ZEAH 2R23B 4H0HB 4EN3A 3X12B 3CH8A 3V8CA 4HXBL 3FFCB 4NC0B 3QIWC 5H8DA 1UH4A 2F54A 4GQPH 4I0CC 4PPTA 4X6EA 1FIGH 1UM5L 2Y72A 5F7DB 1HWHB 4KQ4L 1QSFD 4LAJH 4X80H 5D7JA 1UQSB 3SO3B 1WWAX 1G9MH 2XWTB 1U8JA 2A6JA 4FFWD 5F1IB 4NHCL 1AI1H 2AS5M 4YDLC 3GSVB 2Q76B 2ED8A 1U8QB 1INQA 3NH7L 1JGDB 4DKFH 4DCQA 1NDGB 4IJ3C 4NYLA 3S37H 4I3GA 1IL1B 4OKVB 2BFVL 1SJVA 1U3YA 4J6RH 2JE8A 1H15A 5DFVD 3MLWH 1FNHA 2P8PA 1IGYA 1WCBA 2D9CA 1A2YA 1AR2A 4FZ8H 3C6LB 3Q6FA 1LE5B 3O41A 4ONFL 1G7JA 5TH2B 4Z0XA 3DROB 1P5VA 3PWUA 1FSKB 4BZYA 3TIEB 4LRIA 5BOZG 2W59A 3FRPG 1A4JB 1JYWA 2A6KB 1DBBL 4MB5A 2EC9U 3D0LB 2X4NB 5JQ6H 2YK1H 3HS0A 4GBXA 4MJ4A 5IROC 3O2WH 3CFBB 4MXWH 2W07A 1C16A 4FHBD 1GL4B 2UZYB 3S5LB 4QY8B 1YC7A 4Z78B 4Z7WE 5CD5D 2V17H 4Y89A 1PX3A 2HJLA 1DSFH 2DQJH 4KH2A 1ACYL 1QSED 2R1XB 2XKNA 4GRMA 4IHOB 5D2NE 1AD0B 1P4BL 5LXGL 1I9JH 2YR3A 1G7QB 4O2CB 4PRHA 4HUNB 4KK6D 3BZEA 1XR8A 5HPMA 5IVXA 3CFJA 1JZ7A 2ZSVA 4K07A 4L8CB 3L3IA 5F3BA 5CSZB 4MMZC 4YGAB 1P1ZA 2FIKB 2VABB 3DBXB 2ZCHH 4B41A 3BGMA 1MCNA 4POUB 1JUFB 3DPBA 1PY9A 5DTFB 3EYSL 1D5ZB 3B5GA 4GW1A 4YHPA 1BFTA 5MHSD 4YNYB 3C9NA 4KJWC 1BMGA 1IZJA 4MB4A 2GUOB 5EDXA 1OAQH 1TPXB 3EFDH 4JPWH 4YUEL 2CJUL 4OTXL 2DJUA 1MRCH 3Q3GA 1BQLH 4FS0A 4WFHE 1CTNA 3OGCB 3BP4A 1E4KA 1HNGA 3DXAA 1IAMA 3SO3C 4MJ6B 1JN6B 2OR7A 1MIML 1TJGH 4OD2B 2IPUK 3FN9A 3RNQA 2XN9A 2PTUA 4GAGL 3GMQB 2VXTH 3RTQA 1LDPH 5EBWB 4NCDA 5BZWA 1A6TA 2HKHL 3BPCB 3SE8H 3ULUE 1SJEA 5B3JF 1CR9L 3EYQD 3NCBB 2H8PA 3C6LC 4WU5A 4I8DA 4X4XA 3GO1L 3SDCB 3MNZA 3WSQL 4WTXA 3VDAA 2CLRB 5I1IL 5GGVL 3RFZC 5FUCE 1CXEA 1FSKC 3A6OA 4JCLA 5C08E 3PDOB 5HGBB 4XBGA 2RFXA 3ULVH 3E8UL 1KYOJ 4AIZA 3KPTA 1MFAH 2YKLH 4IDLA 1BZ9A 3GHBH 2ZOKB 2Y7QA 5DJAB 2GAZA 5C09A 1RIVH 3BPOB 3G6JF 4YHIB 4KMQA 2VLRE 3BRDA 2FGWL 4YHOL 1PEZA 4NQEA 3ARGB 1IAKA 3NABL 4ZD3H 4YHMH 3QG7L 2FECI 3FZUD 1QNZH 3QIBD 3HC0B 5HYIA 3O8XA 5EORH 5C70A 1QYGH 5E7BA 3HR5B 3LKSB 4BH7A 5IFHH 3QQ4B 3Q5OA 3TT3L 3KPSA 1FYTD 5D2LA 3MV8B 5IUSA 4O9HH 4F15C 1RVFH 5IVXF 3RWGA 3JZ7A 1D5XB 3IRZA 3U7AA 1I8MB 1J1OH 4OLZH 2IPTL 4LVNC 1CU4H 1DP0A 2IPKA 4GUPA 2BSSA 3IFLL 3WLWC 4XCNA 5E6ID 3BZ4A 1GGYA 2I9LA 4PJ9B 3X14B 2NTSP 4KI5D 3RKPA 3SCMB 2XZCL 3WKNA 2I24N 3GHEH 5HGDA 1C08B 4QTIH 1YMMD 4OCSH 1VERA 5CJXC 2YEZA 3L5WB 3HAEB 3KYKH 2GFBA 1TPXC 1N5AB 4OUUA 4IBLT 5AWNH 4GAFB 3BVNA 5GIRA 1MCFA 3FHAA 5DFWH 4HJGB 3L9RB 2F5BH 4JVPA 1BIIA 4MQ7A 3WNNA 4K3JH 5AAMA 1NFDB 5HJ3A 1S7UA 3MA7A 12E8L 5CEZH 1BF8A 3IXAB 4NNYA 1NGXA 1SY6A 5DJCA 1OGAA 3REVB 3WEXB 4FMKA 3O9WB 4DKDC 3S4SA 1R5VA 3L5XL 1S7XB 4ZXBD 3H42H 4PRDA 2P5EE 1DVFB 1I8LA 3HB3C 2HG5B 4LLMB 4L4TD 2APTA 5FOJA 1VFUA 5GGSA 1FFRA 4D2NA 2X7LB 3OWEA 4PJBE 1KENH 4QT5B 5DS8B 4MJIB 4R2GB 1RFDL 4NQUA 1A14H 1AQKL 1BD2E 1D3CA 2XQYG 4HXAH 4PRID 2Y36L 5KS9E 2G60L 4XCCH 4KK8C 1VFAB 4MHHG 1I1AD 1SY6L 4RCAA 3BP6B 1JWSB 3SDCC 3VXOA 3UZQA 1UCBL 3UTTE 1ZHKB 4RIRB 4P3DB 5KG9A 2QL1A 1EO8H 5CJOL 3RKDD 3SKJH 3AM8C 2Z93A 4I9WD 4MNGA 1S9XB 4G42B 2XG5A 2IANE 5LWYH 2E5EA 2HA1A 3FTGB 3V6FA 1KTLA 5FYJH 3BPOC 1RSFA 4MVBC 5ABDE 4HHAB 2IG2H 1REIA 4L8BA 5IVZB 2BXYA 4AL8H 4GQ9H 5LAXB 3ARGC 3IFPA 3MV01 4X6CE 3N1QC 2EEBA 4L3EB 5D5MF 4D0BB 1F4WH 2P1YA 2ZCKH 2HFEA 3K80A 3NGBC 1SEQL 3OKKB 1MREL 4M02A 5EOQL 4QXWA 3W0WD 1W8OA 4ORGB 5TFSL 3GSWA 3HNVL 4GXVH 4KVNH 3RQ3A 1RUAH 4ZUVA 1BOGA 5DK2A 2WIIA 1CGVA 2JCCB 3K2UL 1XAUA 1R3KA 3KYOB 2ZZUT 4LBEA 3LHPL 1FGVH 2GQHA 3DV4B 1F58L 3O4LE 1AR1C 3STLA 2Y07H 3ZKXB 1KJ2B 3W5NA 4FXKA 5SWQB 1VEOA 1OPGH 4PJ9C 4YDIH 2VB5A 2BOCA 1ITCA 3I9GL 5DQJB 3SCMC 3UTSA 4GG6F 4Y0GA 4U1NA 4NO5A 3NACL 4PP1C 5JA9A 3M17B 4CADB 3GMOB 1YMHA 3SGDH 4XPBL 5EU6E 4PJ8B 2VR4A 1BF2A 4NRZB 2IBGA 4U1IB 1I3GH 1YECH 5I8CB 4RGNE 4JB9H 1AGEA 1U8HB 3NFSH 4XXDA 3ZDZE 1QBML 2P49B 1PGRB 4HC1A 4KZEL 1K8DA 3G6DH 4JRYA 2IH1B 5B4MD 3O9WC 4U3XA 2X4SA 5E6YA 3AC0A 5L2JA 4YQXH 3EDFA 3RAJH 2W9LA 4HS8H 1GXEA 5T3ZE 3V4VL 1DVFC 3UEZA 1L7IH 2XWJB 5IQ7H 4R2GC 4KK9D 3RY6C 4PY8J 4M48L 5DVNA 2YRPA 4HC1L 1JPSL 3BYTA 4HZLA 3VFUA 5L8JB 4LSTL 5KZCD 4HLZH 3I2CL 5ALCH 1KJVA 4WGVB 1NBYA 1I1FB 1OAUL 3F8UB 3N85L 5FYKL 1DANT 5DQDL 5IJVB 1G9MC 1Q9WB 4Y5XA 3MLSL 1H8OA 4UINH 4TVPH 1FGNL 1QA9A 4N5ED 4QTHA 3W81A 5HHMD 5ACZB 4HBCL 3BP7B 4Y1AB 5F9OH 4OBRA 4N0RA 4M7JH 1YN7A 4KMLB 1J1XL 3ZDYE 1H3XA 1WTLA 4IS6B 4QCIB 1BWMA 5T1LD 4OZ4B 2VXSL 1NCDH 2Q8AH 2IEPA 5FO7B 3Q5YA 1FZJB 4LDEB 1A6ZA 4NO2B 3S36X 3EJJX 2YPLB 4GG8A 2H41A 2FHFA 3B6SB 2C3VB 3VFRB 2A77L 1EFXD 1W72L 3TYFB 5IHBA 5JDJA 1OAKH 4LSPL 1EBAA 2NW2B 3SDYH 1TZHB 2GJ6D 1I9EA 3HC4L 3LKNB 4QOKE 4I1NB 3ZKXC 2OMBA 4HIHA 2BY3A 2D0GA 2HTLC 5ICXB 3QCTH 4B7LA 2D7TL 4GRLA 3ZT6A 4WW2B 3ZE0E 3NAAL 3VFNA 2QBWA 1WZMA 2MCPH 3G5YB 1K3IA 4Z76A 1LP9A 1CK0H 3WDHA 4ENED 1KJ3H 4MA8H 1WZ1H 5B39A 2CH8A 4PJ8C 1U95A 5D1XA 3P9WB 3MV7A 2W65A 2BNQE 1K5NA 3VWKB 4ZDHB 2ESVB 1FORH 5BS0E 1J8HE 2XPGB 1M6OA 4PJXA 5EU4A 4OLEA 2WBJD 5E8PB 3IDGB 4NOBA 5BO1H 5GRYA 2MQCA 3IJSB 3TNMA 5IW6B 3HTLX 4TPRL 2LVCA 3U4AA 4QHKI 1W0WA 1LEGA 2X1PA 1KELL 4W6YB 5C2UB 3IF1B 4QHUB 4DEPB 5I1JH 2YUVA 1F3DH 5IGXL 5SWSD 5T5FH 4M7LL 2J4WL 1DL7L 2HYMA 4PGBA 2O5YL 3S34L 2HKFL 3QFJE 4C83B 2KKQA 4XPHL 3QNXA 2Q6WA 2GJZA 2IBZX 2GCYB 3VXTB 2W91A 4FMFA 4WEBL 4JE4B 3VGFA 3VGAB 1O7SA 4N0FA 4ODXB 1CLOL 1FLTX 4L4VE 2BXZA 4RRPA 1HHKB 1I3VA 1IT9H 5IT2L 3O0RL 5JDSB 1OSPL 4W68A 1QLRB 2MSPA 1RULL 4FZEL 3HLAB 3CUPA 4GMSL 5MEPA 1LMKA 3TA3D 3U0TA 4Y4HA 3GDBA 2X9XA 3MRHB 4PS4H 3DURB 2ZPKH 5EZOH 1ZT7B 1T21A 2VXQH 3WKMH 2OMNA 5T3XH 3A0OA 3BJLA 3STZA 4XWGH 4P5TD 1EMTL 1RV6X 4Z18A 5JW3L 1PEWA 5DWUL 3EGSA 3AS2A 2BDNH 4KY1L 1H0DA 2QQQA 3P4LA 3GM0A 3AU1A 5DSCB 3MRDA 5BW7C 1LWRA 2ATKA 3V5HA 2UVFA 3QHFL 2PW2A 4LLUA 2FATH 3K7UA 4MZ2A 1MI5E 3QDGD 3RVVD 1PLGL 3FB6B 5TE4L 1JMXA 1KXVC 1NC4B 1M71B 1OD9A 1RJZB 3DSFH 1X44A 4K3EH 4KVCL 4WW2C 4NRYA 5JXEA 5EOCH 1YEEL 5HYFA 3U83A 1KIUA 1ZKAA 3SY0A 3H0TB 1M7DA 4PJXF 5BRZB 5CGMA 2AGJL 3BP5A 4KQ3H 1A9EB 1S8DA 3PQYB 3VWKC 4J3SA 3CH1A 5CBEB 5FHAH 1NBZA 2UYLA 3BMWA 2DLGA 5TPWL 1F4YH 3KS0J 3QUYB 1VDGA 3RWFA 5D7IF 4NKOA 1A0QL 2B4CL 4L5FH 4P4KA 5F88A 3EO0A 2Z8WC 1U3HB 4JDZB 5EO9A 5E70A 4ERSH 4R4NC 5IESL 2QKIB 4PJGF 1MLBB 1HHGA 3DVGB 3U7WL 5DQ9A 4HDIA 1FFOB 4XI5D 3S96A 5F8RC 1BZ7A 4XP9L 3TCLB 4DEPC 4PG9B 3ZTJH 1X4XA 2ENYA 2NZ9D 1HQRB 5GISH 5T5NG 5CSBA 4AEIH 4HKZB 1OM3H 3S3JA 3MROB 1UG9A 5I1EH 1IEBA 5HYSB 4CDHA 1LEIA 1V3MA 4J23A 1Q0XH 2ZP0T 1R6VA 4ZSOA 3NCMA 4XP1H 2J6EH 1KLGB 1BBDH 2F58L 3VGAC 5J9PB 4U05A 3RU8L 1JYXA 5JOPD 4P2OA 2EIZA 3MODH 1XGYH 4XAKD 5JPMB 5CINH 2V9RA 1NCWL 4U4BA 3RY5A 1QSVA 2J88H 3IYLW 2A6DA 4BZ1H 1KN4H 5C07A 4PJ5E 5SX5H 3F58L 2OQJA 3HI6H 4LDLB 2BNRB 4GXUN 3WIIH 4M4RA 1ZVSA 4KDTC 5DJXA 1HH6A 1OAYL 1IM3B 5KVGH 4WUKL 2X41A 4NGHH 5B38B 4K7PY 3ALXA 4RX4D 2WWMD 5JOEA 3BH8B 2DYPD 3WXVH 4WW1B 5ADOH 4HCRH 1MIEL 1UXWA 3C60C 1CFNB 1SYSA 3BISA 3I6GA 4Y19A 3JWDH 3MRCB 3WE6A 1KIPA 2W0PA 5CP3A 3OR6B 3GI9L 3VA2C 4U1LA 4Z7VB 1INEH 5M7QA 4Y4KD 4TSBH 1V05A 1OP9A 3IDJB 1A3RL 2EDBA 1IC1A 2IBBA 1BM3L 3TO4A 3MLUH 2V5SA 3MLTA 1CLZH 4GKZA 1CVRA 3EKCA 3VDBA 3NCJL 1HQ4B 4GKSA 2A1WH 3LPFA 2ZKHL 3RL2B 3SE9L 4LASH 5BOPA 1NGYB 3F12B 2DM3A 3KPNB 1MCPL 3WD5L 6FABL 32C2B 4KAQH 5ILTH 3ARWA 3QUYC 3M8OL 3RVUD 2ZSWA 1KBGL 1I3UA 3BHBA 2P5WB 3GJFH 4LMQE 5L7XH 5LQBH 2VZOA 4UQ2B 1JV5B 4JZNA 1JNLL 3T08A 4XBEL 4P57B 5MENE 1F00I 5C0CA 3MOBH 4Q9BA 3ULSA 4TSAL 5DLMH 3U30B 3NN8A 3MJ6A 5ICYA 3VCLA 1F42A 1VEPA 1DBMH 3FMGL 3CZFB 3MUGA 3MRLB 4AK1A 5J6HA 3QJHA 4HIIA 5EU5A 5BZDA 3MRNB 3MC0A 2X40A 2DJ4A 5IHZA 1RZJL 3GMNA 4YIQA 5CBAA 4XBPB 3RY4A 3MLYH 5E5MB 1HXMB 1FNAA 3I85A 2RB8A 2R1YA 4RGOH 2X4UA 3LN5B 2PUQT 4XC3H 4HZAA 3H3KA 4OLVH 2NQCA 4EDWL 2G9HA 3K4DA 1QFOA 4LCWB 4WWKA 1X5GA 1Z0NA 2COQA 4DKEH 4IDJL 3EJZC 2DQIH 1TQBB 3OF6A 1FL3B 2JB6B 4Z8FH 4WFGD 3QO1B 1DDHB 1GGIL 2ZUVA 3VG0L 4W4OA 2P8LA 4JN2A 5GGUB 4W6XB 3AFLA 5DRWB 1NSNH 2EDTA 9CGTA 4XP4L 2X4RB 4JFYA 2NY6B 1MHHB 4QF1B 5HYJD 5E9DA 5EO1B 2Z35A 3RRQA 1LK2A 3RWDA 1JWMA 3O6FD 1KB5A 3HR6A 2BRQA 3LQAH 1NGZA 1BFOA 2XTJE 3QUXA 1DLHB 3TWCL 3Q6GL 4P4RB 1RY7B 3ARBD 4HS6A 4NM8L 5E00A 4JFFB 4L4JA 1HDMA 4FNLH 3QQ3B 1IM9D 3VFOA 4U6XA 1E6OH 1MUJB 3VMOA 1WBYB 1KB5L 5HHXL 3TO2A 2OTWA 3F5WB 3UDWC 5LGJB 4CVWA 4X8JA 1J5OL 1BFVL 4IMKA 5ETUB 1U93A 3KNBB 1KULA 1U6AL 2J8UE 3I6LE 4HUVB 3TPUB 2ARJA 1JGLH 1ZOXA 3PGDB 3A6CL 5E99H 1HIML 3HNTL 1X4ZA 2HFGH 2OYPA 4QRRA 4ZQKB 1QFWI 3BE1L 5HVGB 4JGUA 3OJ2C 2I5YH 5I15H 1F3RB 3O2DH 4ZUTB 4F33A 2XKUA 5MI0C 1GZPB 1V3KA 4Q9QH 4S11A 2QSCL 3ARRA 5IQ9A 3U30C 1IC7H 2R2BB 2XRAH 5TQ0L 3DRQA 1ROWA 2A6IB 2V7HA 1Y6MR 4WU7A 4FP8L 5E2VH 4UV7H 3CK0L 5HGHA 2DKUA 5DHVH 3T0EB 1A6UH 1DUYA 1CDBA 3DRTA 3ZYIA 1G9NH 1R3LA 3MBEA 4HWBA 7CGTA 3OJDA 4JQIH 1J7VR 1RZFL 2AEWA 3HUJE 1Q9KA 4DOHE 3D48R 1QFWM 3VXPA 3S35H 1U8IB 1XCQA 1I75A 3CXDH 4PJHB 1P4LA 4LQFH 2H2PC 4NZTH 3WNLA 4AMKH 1KC5L 4XGZB 1N6VA 2MOVA 1TQBC 3ILQC 1OAXH 1A1NA 4WHTA 2XZQH 4NZJA 1WC7B 1OT1A 4OZHA 1M7IA 4RAVA 1WEJL 5GGRA 3VXNA 2AJYL 5C0BD 1NANH 4D9QD 2YPVL 4HJJH 1MCBA 1DLFL 4L29A 4Y2OA 4OI9A 3PL6C 2NY6C 4R3SA 1QLFA 2XQBL 3D3VE 5J0BA 4HFUH 2R69L 2UWEF 4UDTB 4XPTH 4IIQB 2EDYA 1E27B 4G6AD 3DGGB 1EJ6A 1N64H 1NDMA 1VFBB 3VFSB 2BZDA 2VAAA 5EU7E 4HG4J 4MJ5B 4NBYB 4Y8DC 1A5FL 1MEXL 2DWDB 3AY4C 4F7PB 3MV9E 4QGTA 4NKMB 2O5ZL 4J3XA 1BAFH 3MRMA 3MUZ1 3O3DB 3RVXD 5GRVK 4NFCA 1XT5A 2WQ8A 1EHAA 4UQ3A 1PG7H 4RZCA 4H5SB 1IKFL 4R7DB 3CSYB 1DEEA 3V6ZA 4YJZL 2VUOA 4MAYA 1JPFB 5HI5D 1AGFA 3I02A 5JNYA 4IOIA 4FG6C 2A9ML 2OTUB 1G7LA 3MOAL 3QI9B 1XF4B 1S7QA 4I5BB 3B3IA 4X5LA 5C1MB 2IQAA 2ZUXA 2ZUSA 1EGJH 5IEKB 1AGDB 1U9KA 2CLZB 1MAJA 2WIMA 5DK0A 5IFJB 2PYED 4ETQA 5HHOA 1NUFA 1B0GA 4P59L 1CIUA 5HDBF 3K0WA 1QACA 4LPVA 2HN7A 3G08A 4WI5A 4K2UL 3CPLA 4ZFZA 1MPAH 3INUL 4G8GB 4YXKL 5I1GH 2APXA 4ZAKD 1QLEH 3GK8H 3T2PA 1T04B 1TTUA 3QCVL 2VLJA 4PGCB 4U1GB 2ZUQB 3EOAA 3TPKA 5DO2D 1A6WL 4TNWK 1OQXA 1TVHA 2CDEB 2VH5H 2R8SL 4LSRL 4M61A 4ELME 2DBJA 3CVIH 1B2WH 2D2OA 1HXYA 4TUJA 3U9PH 4F9PA 1D5BB 2SEBA 3QDMD 3SDAB 4U1HA 4K9EL 3RZCA 5GRJH 2NPLX 3ZKMD 1CDHA 1VKXA 5F89A 3BSZL 4KC3B 1FO0H 4OZHF 1U8LA 4GW5A 5LGKA 2FL5B 3BGAA 3D39D 4E41D 4NUJA 3VRJA 1BZQK 4MD4B 1FZKB 1J1PH 3ARDB 3MUY1 3TNNA 4GRWH 3MJ8B 1MCKA 1ZK9A 4K8RH 1YJDL 2BVUA 3W9DA 2AABH 2EDKA 4KMTH 5FV2A 1U58A 1QFUL 4N0UA 1BQSA 4OGYL 1KOAA 4JVUA 3CX2A 3V7AG 4S1SL 1F4HA 2DI9A 5D7SH 4DVRH 5JO5A 5ALBL 3DETD 4IIQC 2PCPB 1O0VA 4OZIF 4X7TA 2E27H 2ICES 4KUZH 4HWUA 3TVMD 1ZE3C 2H32H 4HT1H 2BHYA 1MRDH 3U1SH 4BK5A 1X5HA 1YEHH 3PWLA 3ROLB 1EZVX 1FL6B 3SDXF 4RWYL 4HMEA 4K94H 3V0AC 4P5MA 3V0VB 3F6LA 3VXQB 4U3HA 5AYUH 2HLAB 1L6ZA 3LPWA 4GAYB 3EYVA 5E8DL 3ULVE 3BGFB 2AJSH 1H3WM 1Q0YH 1FC1A 4GFTB 1HN1A 1K8IA 3PGFH 4GXUM 2YD7A 1K85A 5BJTA 1CICD 1F3JA 2JIXA 3KPRE 4M62L 5IMMA 1KIRB 1A3LH 4LGPB 4AEEA 2Z31D 4S1RL 1P5UA 3P0YL 5C0AA 4O2EA 2BOBA 2VXUH 3QI9C 1I3RB 3BUTA 4I0KA 1XF2A 1MCQA 1P84K 5DA4A 5KANG 5FKAA 1LD9B 3MFFB 4P46D 3OKMA 4OZGB 2AXFB 1BEYL 3QUKB 2X4OB 3JWDC 1G6RA 5C0GA 5B21A 1G9EA 2BRRH 3U4BL 1QRNB 1IGFL 3G5ZB 1IGML 5E2TL 1OQOA 4NQDD 1E4XH 3PGCA 1JIBA 3IDUA 4DTGL 2O61B 5EBGA 3H9SB 4U1GC 2ZUQC 5JORB 4PJDE 4YZFE 2BC4A 4WY7H 4ZFFB 3TF7C 1G6RL 4OSUH 4XMLH 2G5BA 1GOFA 3CLFH 1Q9OA 4M9OA 2A83A 2OLDA 5AZ2H 3SDAC 2GSIA 1MWAH 4UAOC 2XY1A 5F6HJ 4Y2DA 3CD4A 4M5YH 3HZKA 5CGYC 5B39G 4GKOA 4G9DB 2DQUH 3NTCH 2AJ3B 4I4WA 3QPQD 2BVTA 1P69B 1YNTB 2FHCA 1M05A 3MV11 2VDQH 1OB1A 1DN0B 4KKNA 3JTSA 2Z92B 5I9QB 4PJ7F 5JW4Q 3ARDC 3G04B 1HHJA 1I7UB 4Y16D 2HVKA 4HXBH 3S9DB 2C4XA 1BVLA 1C12A 3HI1B 5EC1B 3QA3A 1RUQL 3BKJH 4XTRD 4K7FA 3CDYA 1UM5H 4ZUWA 4QRUB 5DHVB 4KQ4H 4OJFH 5FYLD 4R4BB 3MGOB 3VFVA 3V79C 1B3JA 3HHRB 1AXTL 3GSRB 3KPPA 4C56E 4NHCH 4HV8B 1AP2A 5GJTL 1A1MA 1BGXL 3NH7H 4EI5A 3RIFF 3EO1B 2DQTL 3P4OA 5IVOA 1PQZA 2BFVH 5DJ8A 4X6DB 3CFDA 5J6GB 4X99A 4B50A 4DK6A 4PV8A 4PP2B 3QIWD 5FCSH 3GMLB 1H3UA 5CP7A 4LLYB 4LMQI 1T0PB 4ZPVB 3EZJB 5HGAA 4ONFH 3BH9A 1OLZA 1YPZF 4LCUA 3GI8L 4KROB 1NGPL 1HH9B 1F11B 1I7TB 4TNVF 1DBBH 2NX5A 3ABZA 4HUWB 3QNZA 4ZO9A 4X8XA 3LQAC 3H9YA 4PTUA 3Q48A 1QSZA 1IGTA 2DTSA 1ZVYA 3PWNB 2FO1A 3MRFB 1J05A 3GUTB 3TZVB 1R24B 2IQ9L 5FOBB 3MO1A 2EICA 3FQNA 4YHNA 1WGOA 2ZG1A 3U2SA 1ACYH 2Y1VA 4PFEA 3VI3F 3IKCB 4KDVA 4R7NA 1Y0LB 1P4BH 4KXZH 1HHIA 4P23B 5LXGH 3O3AB 4QRPA 5F21B 2EH8L 4YXLL 3D2UB 2AK4B 5IIEA 3RNKB 2PXYA 1U8PB 1NGWA 3TBWA 4LK4A 4LLVB 1I4FA 1K2DA 1WSST 4JFDD 3N9GL 5DJ0A 5DJ6A 5SWZD 2F19L 4EBQL 4N9GA 2HJFB 2JJSA 4QHMA 3WJLC 4DWHA 2FO4A 3EYSH 1XGUA 4JGJA 1K6QL 3BRGC 3V5DA 3QEQE 4ISVA 4XPGL 2X1WL 5I9QC 3FQWA 3T0WA 5IV2A 2BP3A 4YUEH 2VL5A 2CJUH 1UVQB 2CXGA 1PDKA 3TH4T 4FTVA 1KT2B 3OKNA 3WXWL 3KXFA 5AUMB 1G9NC 5FA4B 1CZ8L 4Q6IB 4F7EA 2KPNA 4PGDA 1MIMH 1AXSB 4WJ5A 4NC1C 3S36L 3QPXL 1T80A 4YDVA 3L6FB 1VPOL 3I3BA 2D0FA 2BNRE 3C8HA 3S3SA 3OJMB 1RHHA 3VXUD 1FL5A 4KJWD 3RDTB 1FNEB 3KS0H 1QVOA 3BJ91 4N8VA 4FXGA 4JFEA 5C3LD 3T3PF 1XIWC 1QSFB 2AKRA 3FL7A 2HKHH 3FFCD 4GRWB 4Z7UA 1CR9H 3MNVB 4WI9A 2BCKA 3OX8A 2IAMA 3LN4B 3GO1H 1QZ1A 4RBPH 2EXWC 3WSQH 1CF8L 1EEYB 5I1IH 4YEFA 5CWSA 1TLKA 5GGVH 3QB7C 2ICEB 4CW1B 4NSKB 2EIEA 4KROC 4TVPE 5FO9A 2GITB 5F6IB 3E8UH 4EZMA 3QEHA 4PY7A 1ZA3B 1CGXA 5I16A 3BN3B 4PJAB 4P2RA 3MRRA 4NN6B 4PRNB 1PYWA 2H32B 2FGWH 3LSOB 4YHOH 3MGTB 3NABH 2NY7L 3TZVC 3QG7H 3BEVA 5EIVA 4MSWA 4FA8A 1WAAA 1GGUA 4MZ3A 5ISZE 4RFNB 3C6LD 5DRZB 3K74B 3QYCA 4WDIB 2DDQL 1WBXA 5FGCE 3GMPA 1ORQB 5FK9B 3BO8A 4UT7L 3BWAA 4Q9RL 4HPYL 3VWJB 2YSSA 4P23C 3K4AA 4PREA 2F53E 1N5YL 4FQCL 2YD9A 3VRIA 2ADJA 3MACL 3IGAB 1BX2A 3HE7A 3ZKSD 1WLHA 5FYKU 2IPTH 3U4EA 5ANMB 5SV3A 3SKNA 1XR9A 3IFLH 4JRXB 1OOAA 4AH2A 3CFEB 3ARTA 4BFIB 3ES6A 3LQZA 3DI2B 4PJIE 2BSTB 2XZCH 3AXLB 2C4FU 2EKJA 3GSXA 2W0FB 3LPGA 4JO1L 2VWEC 1DUZB 1FG2B 3T65A 2VE6B 3U46A 5FA3B 3D9AL 3ZDXE 3ZT5A 3HG1B 2EYSB 3QEUB 3KPQB 3RUGE 1CCZA 2BSRB 3IS1X 1EHLL 4Y5VB 3OSKA 3U9UB 3WLWD 4Q6IC 12E8H 1FH5L 1MWAB 1KTRL 1KCKA 3QO0A 4M1CC 4YDJA 1YYLL 1EIBA 4S10A 2R2HA 3BQUA 5E24E 1NAMA 1QO3A 1KCUL 3L5XH 5I8EB 3V6OE 2GK0B 4P2CG 5JR1L 3KLDA 1XF5B 5DJYA 3F7YB 4YWGL 3RDTC 3W2DL 3PXHA 1JGEA 2D7NA 3FONA 1RFDH 4M03A 3GBML 3DX7A 1AQKH 4HIJA 2Y36H 1A47A 4OIAA 2G60H 4XT1C 4L9LB 1X5KA 1SY6H 4K8RC 2O93L 1NFKA 1FFNA 1NAML 1UCBH 2YC1B 4OCXL 3FQUA 4I48A 2CD0A 5CJOH 3V7AE 2JJUA 4RDQG 1Z0MA 4CMMB 1KG0B 5DT1L 5F6IC 4Q2ZB 4MNQA 1NCNA 2BJML 1S7WA 5L0QB 2VDNL 5KVEL 5KOVC 1LO3L 2F54B 5JW4R 4NN6C 2V2TA 4X6EB 3NA9L 2E9BA 2KDGA 4UU9A 1MFEL 3ESVF 3OB0K 4R90L 5I74B 1U2CA 1MFDL 4OGAC 5D7JB 5T3XE 5HDQL 4KK8D 4PRPA 4RFNC 4XB7A 5I71B 4GJTB 3UTPD 1U8JB 5EOQH 1MREH 2A6JB 5TFSH 3HNVH 3SDCD 2OXHA 2FX7L 5I18L 2M8XA 1INQB 2ICWI 1H8SA 3VWJC 1EJOL 3SE3C 4DCQB 4NYLB 4PJCA 3DO7A 3K2UH 4POYA 4KRLB 1IC4L 5JHDE 3O45B 2FJFA 2QQNL 2VDRL 3LHPH 1AE6L 4FQJL 1H15B 2FR4A 2ATPA 1F58H 2P8PB 1F4AA 1IGYB 1WCBB 3ESUF 4OD1L 3S97C 5L2KA 2E6JA 4MVBD 1WT5A 1UJ3A 4XNUL 2XFXA 3T0DA 1HK6A 3Q6FB 5D6CA 4HGKC 3O41B 3ARGD 3I9GH 2C26A 1G7JB 2DS4A 4Z0XB 4KGJA 3PWUB 3NACH 5DD0L 4OLXL 4V1DA 5CEXA 4XPBH 2ITCA 3HS0B 4GBXB 1PX4A 3MV8D 1KJ2L 2W1NA 1NFDF 1C16B 3VXMD 2FBOJ 1QBMH 4Y5YC 3R8BB 3G6JB 1G1CA 4Y5VC 1NC2A 4KZEH 5GSRA 2HJLB 4J4PA 4PJ9D 1ZLVH 4RSVA 1N7ML 3EFFA 2ZUYA 2XKNB 3SCMD 4GRMB 3PIQA 2N7BA 5K93A 3C6SA 4PP1D 3V4VH 3MLZL 3ARUA 2CXKA 4U6YA 4RMUA 4PRHB 3RBGA 3BZEB 4PBXA 1XR8B 5HPMB 5IVXB 2ZSVB 3OAZH 4M48H 3L3IB 5F3BB 4HC1H 1JPSH 1P1ZB 4L9LC 3DTXA 1HZHL 2F5AL 1UYWL 4PJFF 2JKXA 8CGTA 3LRSA 3BGMB 3I2CH 4OCMC 2WINA 2M26A 3NFPA 3NPSB 5IB4A 1OAUH 3QRGL 4U0QB 2VLMD 3N85H 4GSDL 4GW1B 4YHPB 5FYKH 5DQDH 1K4DA 3C9NB 3O9WD 3MLSH 4FQXA 1LK3L 5D4QA 5L0QC 4EN3C 3IETA 4PRIB 1FGNH 2JELL 5K59E 4HBCH 1DVFD 1SBSL 3DVNA 3JSSA 1TITA 1G7HA 2PW1A 3VXSE 3EYFA 3E3QE 3Q3GB 3WMSA 3OXSB 3GKZA 4JPIA 3BP4B 2VO5A 1J1XH 4MJID 4R2GD 3ZL4L 3DXAB 5I74C 2HT4C 2VXSH 3MLVL 5D7JC 3A6BL 4R26L 2VLLA 5I71C 3SHSA 2GY7B 3SBWA 5BMFL 3EYUL 5I1DA 3CMOL 3WNOA 3RNQB 3BOVA 3C8DA 1W72H 4NRXA 2OJEB 3EDJA 4LSPH 2NTFA 4F8QA 1WIUA 4H25A 1S7VB 1QBLL 4NWTL 1A6TB 3HC4H 5H94A 1SJEB 2AXGA 1EV2E 2H8PB 4WU5B 2OL3A 4X4XB 2PF6A 2LU3A 2H2SC 3HRZA 4Z7NE 2CUIA 3MNZB 4L3ED 2D7TH 1D6EB 2LTQB 4FN0A 3NAAH 4Z7WA 1G6VK 4E42A 4LRIC 3MXWL 1H8NA 2NY2B 2RFXB 4XBGB 3RIAK 3MMEA 4D94A 4QRQA 4GBXC 4HKJA 2Y7QB 2APVA 4KKCC 1SYVA 2GAZB 5D2NA 3SJVE 2E7BA 4D8PA 4PRAA 1N4XL 1RU9L 4JFZL 2E9JA 4JHZA 2OL3L 3LKOA 1E0OB 5CILL 1AO7E 2IPUG 5CUSL 4NQEB 1IAKB 5IF0A 3PE9A 1NQBA 2LV4A 1U8OA 3HE6A 3O8XB 3WFBL 1N0LA 4TPRH 3S37X 2J1KA 2HTLD 5AG8A 4BH7B 4BFBD 5HVHB 2VJXA 1A4KA 2VDPL 3E0GA 4AQ1B 5IB5A 1KELH 3KPSB 5D2LB 3QCUL 1OP3H 3FQXB 1HCVA 4BFGA 1BHGA 4YBQC 5I1KL 4PJ8D 4OI7A 2IPKB 3CAFA 4GUPB 5HHQA 1CD8A 4M7LH 1EO5A 2BSSB 2J4WH 1DL7H 2NXYC 2O5YH 4XCNB 3BZ4B 5TGBA 2VN4A 2ZOLA 2I9LB 1FHGA 3S34H 3VXRE 2Y5EA 2XI9A 2HKFH 2AW2A 3ZE2E 5DRNA 5T1DL 3B2VL 4XPHH 1H5BA 1CQKA 3NPSC 1DZBA 5HGDB 1WFUA 1NC2D 4WEBH 5J11B 4MAUL 1CLOH 2YEZB 4U3CA 5DZLA 2GFBB 4KZDL 4EUPG 1S9WA 4OUUB 5IT2H 3O0RH 1RK1A 1OSPH 4LHUD 5T1KA 1RULH 3BVNB 4FZEH 5GIRB 1VGKB 2APWA 2JTDA 1R5IA 2XZAL 3CCHA 4GMSH 1E4KC 1BIIB 4Z6AT 4MQ7B 1T5WA 3GKWL 5E56A 2A2QT 5HJ3B 1S7UB 3MA7B 3AS1A 4NNYB 3K2MC 1NGXB 5DJCB 5E5RB 4A2MA 1OF2A 3S4SB 1R5VB 4WI6A 4JM2A 1RJLA 4DVBA 5HHMB 1EMTH 4PRDB 5JW3H 3LY6A 1ZTXL 3RTQC 5DWUH 4KY1H 5GGSB 2QHRL 5C08A 1PVHA 3ZHKA 1TDQA 2DB8A 1KUMA 3ULUL 3QHFH 2VLRA 4Y1AD 3VD7A 3M1BA 5CZVL 5DC0A 3VXOB 1PLGH 1ZWIA 5TE4H 2LTQC 5KG9B 4FQIL 4KVCH 2E7HA 4O02L 2BVQA 1N2RA 2Z93B 4MNGB 1MFCL 2NY2C 4JJ5B 5T33L 2YPLD 4JVWA 3HPLA 1J11A 4JR9L 1FVDA 1HCFX 2AGJH 4P2QE 1KTLB 5HD8C 4LCCA 4L8BB 3BPNB 3BD4A 3UTQA 2DLFL 2RCSL 5TPWH 3IFPB 4Z5RA 2GHWB 1A0QH 2B4CH 3WIFA 1CDYA 2HFEB 3O8XC 4QHNA 4O00A 4P0DA 3GSWB 4J8RA 4XHJC 5HVHC 5IESH 2B5IB 1TZIA 5IFAL 2EDDA 4ZUVB 3U7WH 1BOGB 5DK2B 2B39A 5ID1A 3QDJE 2WIIB 1KCVH 1R3KB 1WFNA 4XP9H 3TIDA 1PY4A 1SVZA 4LBEB 4F3FA 1TTFA 5ITFA 2WBJB 3STLB 3VWKD 1PW3A 4HMDA 2ESVD 3IDYB 2FIRT 2M1KA 3KYMA 2BOCB 3IJYA 2CK0L 1TTGA 3UTSB 1I85A 4U1NB 2ZUWA 4NO5B 2F58H 5J11C 5IBLC 1YMHB 4NQCE 4R4ND 4G9FE 1SMOA 3RU8H 1C5CL 1NCAL 5DEZA 2AK1L 1NCWH 2R0ZL 1YN6A 5GRVL 1UB5A 1CTOA 1WFTA 2P5EA 2ILLA 4XXDB 1AGEB 5AZEL 5DI8A 1UM6L 3F58H 5D7KE 5AYQA 3I50L 4PJBA 3FN0L 1P53A 1JNNL 1BD2A 5KS9A 3OHXA 2OZ4L 1K8DB 4JRYB 1OAYH 1F8TL 4NT6A 2D7PA 2X4SB 4PB9L 3MRJA 4WUKH 4X5XA 5FM5O 5L2JB 3ARYA 4QNPF 3UTTA 1VFOA 2VAJA 3GSQB 4Z77A 3T4YA 2GSGA 1I8LC 3LRGA 5FXCH 5CEZD 2YXFA 3NOIA 2WLZA 2UY6A 1WCQA 2IJ0C 2IANA 2R4RH 4WNQA 2B8OT 3KJ6L 1MIEH 5A1AA 4OFDA 4HZLB 3VFUB 3PV7A 4MD5A 3FT2A 3GI9H 3NPZB 3ALWA 4S0TD 4F2MA 2QR0A 5MEQA 1A3RH 5HY9A 1UZ6F 3RHWF 4X6CA 3P0GB 1KJVB 1GZQA 3ZO0A 1NBYB 1BM3H 4GMTL 1ODAA 4K7PX 4BFEA 1V3LA 4Q97A 2PYFA 2JJWA 1MNUL 4X6FA 3CFCL 3NCJH 4NDMA 1F5WA 1N0XL 4Y5XB 4HH9A 4EOWL 2ZKHH 3SE9H 4QTHB 1DANU 1MCPH 3WD5H 4KK5C 1B4RA 2K7PA 4C55A 6FABH 3C08L 2ARWA 3QDGB 4YX2L 2IF7A 1YN7B 4JY4A 4RQQA 1YQVL 3C60D 3M8OH 4ODUA 5D7LE 3OKDA 3O4LA 2N7AA 5FYJD 5INDA 1CFBA 1H3TA 3F62A 3IJHA 2B5IC 4GG8B 1NC4D 1BJ1H 4LVHB 4XBEH 2AV7B 3WFHB 3P4MA 4TSAH 4HGMA 5FGBA 3IXTA 3DECA 1X7QA 1C5DA 1WK0A 3AS0A 3FMGH 5FAAA 2WLYA 3PV6A 5EU6A 5BRZD 3FO9A 3IVKA 3PQYD 3DVIA 4OF0A 4LLDA 3H9HA 3IDYC 5DK3A 4HIHB 3PNWA 1RZJH 1DQLL 1HSAA 4S2SA 4PJEE 3QUYD 2XY2A 4GRLB 2DQHL 3SQOL 3VFNB 3VRLE 4GO6B 1KNOA 1EXUA 4CUCA 3KDMA 4Z76B 1LP9B 4FFYL 4EDWH 5B39B 1QSFE 3WDIA 1U95B 5D1XB 4FQHA 4IDJH 1NCBL 2Z8RA 1G7IA 1MAKA 2W65B 3MV7B 1K5NB 4G7YH 2I60L 1MJ8L 2NR6C 4NQTA 1QFPA 4IRJA 1GGIH 4PJXB 1M6OB 5E95B 1L0QA 3VG0H 5EU4B 1BJMA 1VESA 1TETH 5FDYA 1P6AB 5GS1A 3LRHA 4MMXC 3TNMB 5J57B 4FQLL 4XP4H 2XIDA 3BDXA 5T1MA 1W0WB 1S3KL 1J0JA 1LEGB 4DJMA 4P3WA 5E7FA 3ZE1F 4I3RL 4N8VG 2IWGA 5T3ZL 5L6YL 4CDGC 1RURH 4PJGB 4I18A 4WFED 3PABA 4Z7VF 4U1JA 1CDJA 3TWCH 3EJZD 3Q6GH 2X2YA 2YWYA 3MYZA 3CSBA 5DD3L 5C6WH 4NM8H 1XFPA 4PGBB 2X05A 2NY5L 4ODBD 3JUZA 4P99A 1C8PA 4APQA 5MEOA 1QQDB 1MOEA 3QNXB 2Q6WB 3UTOA 3VH8G 1GGCL 5JW4M 3RVWC 4P2YA 4WENB 5L8LB 4N0FB 1KB5H 1T3FA 3AMKA 5HHXH 4LARL 4N90D 1QKZH 4Y5XC 1QTYT 1J5OH 2CDGA 1BFVH 1VADA 1FVEA 2VZSA 4P3CL 3DUUA 1U6AH 1ZGLP 3D0VB 1QSEE 3CUPB 4UIMA 5MEPB 3U0TB 4Y4HB 4ZPTA 5K9QI 3QUML 5JPNA 3A6CH 4QOKA 1HIMH 3HNTH 1Z9MA 3O3UN 1G1YA 1KPRA 3BE1H 5L8KB 1T21B 2GT9A 4FFZL 4HWEL 2UZXB 3EHBC 1NAKL 3STZB 3RJDA 3GJEA 4LVHC 5D8JL 5EN2A 1I8KA 3EGSB 3F7QA 1H0DB 4YBLB 5TQ0H 1WWCA 2X70A 2EH7L 3AU1B 2OR9L 4AIOA 3MRDB 3V5HB 4FP8H 2BNQA 2PW2B 4LLUB 1SM3L 1D9KA 3CK0H 5BS0A 1J8HA 5C0JA 5K9OA 1S7RA 5F8QC 5J06A 4GRLC 4G6ML 4LNRA 4NRYB 3JWOL 2P5WD 3DNKA 1BIHA 3QWOA 4HUKB 3SY0B 1GOHA 5I19L 1YY9C 1W2KT 4YGVA 1M7DB 5DEFA 3BP5B 2E3VA 1DQTA 1S8DB 3CH1B 1CGTA 4TULH 1YEIL 3OR7A 3RGVA 1HYSC 1NBZB 2UYLB 4Y8AA 4J7RA 1WEJH 4CU7A 5DUPH 4J1UA 4U33A 1MQKL 1JE6A 3RWFB 2AJYH 3DYPA 4NKOB 3EW3B 4P4KB 5F88B 2YPVH 1B0WA 1A7OL 3EO0B 5EO9B 4TTDC 1ACZA 5E4EB 1DLFH 1EK3A 3LEXB 1KCSL 3V5KA 3QFJA 4DN3L 1DE4A 5TDNA 1HHGB 2NY4B 3X3GL 2QTEA 2XQBH 5DQ9B 4HDIB 3DJ9A 2R69H 3CFKA 5EUOE 3S96B 4JEGB 1BZ7B 3D5OF 5E94B 2H2PD 1D5MA 4LCWD 4RWHA 4DZ8A 4L4VA 1BOYA 5E8NA 3UBXI 3UYPA 3ILQD 1WV7T 4J3OC 1A5FH 1MEXH 3SDDA 1IEBB 2O5ZH 3SEPA 2GYSA 4ZSOB 1UB6A 3MLPA 1FNLA 1IKFH 1TZGL 2XOTA 3PDGA 3BYYA 1MCHA 4XPFL 4AT6A 1OSZA 4P2OB 4PBVC 2EIZB 2NY6D 2BVYA 2D31A 1CXFA 3F65A 3H3PL 2MKLC 1TMCB 2VZVA 4NC2B 4UT6L 2A6DB 2A9MH 4ONHA 3MOAH 1HKLL 5EZLA 1UT9A 4Y4HC 1FYTE 5E03A 1OAZL 5GS3A 2HLFC 5L9DL 1ZVSB 4JFFD 5DYOA 5DJXB 1HH6B 1Y6NR 4P59H 1KCLA 1MI5A 4K2UH 4OZFA 4LCYB 2PTVA 4R8WL 2AP2A 3INUH 5E2WH 4YXKH 3STBA 1RZ8A 4KI5E 3L3HA 1UACL 4YBLC 1NJ9A 2CKBA 3QCVH 3G6JE 3Q0HA 2Q1EA 1UXWB 1A6WH 1SYSB 3I6GB 4FG6D 2NMSA 2R8SH 1YMME 4Y19B 4LSRH 1MAML 1YDPA 3WE6B 1KIPB 4TOYL 4PJHF 4U1LB 3GBNL 4LLAA 3L3OA 1V3JA 3IDMA 1U8NB 4K9EH 4YLQT 2DAVA 5JXEC 3TO4B 3O6KL 3MLTB 5KSBE 4GKZB 43CAA 5ID0A 2CKBL 4GKSB 3BSZH 3QDHA 3MOQA 4CAGA 3DV6A 3NZHL 3OZ9L 2C5DC 1NBVL 5TQ2L 1HILA 1YZZA 2ZSWB 2YPKA 4P4KC 2IADB 1MH5A 3BHBB 3EIFA 4L4TE 5DJDB 1YJDH 2EXYC 4YR6A 1JNJA 2I25N 3WFZA 1QFUH 4JZNB 4OGYH 2NY4C 5IBTL 3UYRL 2CR3A 4S1SH 3FHQA 4HWZA 5C0CB 3ULSB 1OL0A 1JRHL 3PWPD 5ALBH 3NN8B 4OD3H 1II4E 5ICYB 3VCLB 1JI2A 6CGTA 1VFMA 3MUGB 2YA1A 5J6HB 5C0BB 3QJHB 4HIIB 5EU5B 1JCKA 3BN9C 5BZDB 8FABA 4I9WE 3CXHK 2B1HL 5IHZB 4PJ5A 4YO0A 3GMNB 4YIQB 5CBAB 4RWYH 1MVUA 4HKXA 1JHKL 3C5ZC 1ZSDA 2R1YB 3PWJB 3FQTA 5E8DH 3EBAA 5EIIB 4D9RD 2ZJSL 4JN1L 4P2OC 1RI8A 2G9HB 1J0HA 3LDBB 4M62H 5JIKA 1BLNA 3ZZ1A 3W0WE 1CDUA 4S1RH 3P0YH 5FM5M 1ZLSL 3QXDA 2R2CA 3MRKA 4FQQA 2XV6B 4FQ2L 4KJYA 3UMTA 5C0EB 1AKJA 3S5LA 5LG1A 4QY8A 1ZHNA 3TH2T 4WFFD 1S7TA 4CVZA 2P8LB 4JN2B 1BEYH 4YHYB 5F7WC 5IB2B 2O26U 3U4BH 4JFYB 1IGFH 1IGMH 5E2TH 2VOTA 4KRMB 3F7VA 1AD0A 5E9DB 2AERT 2Z35B 3QWRA 3HI5L 4H8WC 1Q1JH 1LK2B 1JWMB 1HOCA 1KB5B 1ZA6A 5GZOC 5GRZA 4DTGH 4JDVA 1I8IA 4F37F 4O5LL 1NGZB 3CGTA 1NANI 1EUTA 5KW9L 4HS6B 5EUKA 1IVLA 1G6RH 2FIKA 2X4TA 3QI9D 5D5ME 1HDMB 1LVEA 1F6AA 3VFOB 3L3GA 3TO4C 1T0NB 2VRAA 1MELA 3H7BA 3TO2B 5D71L 2OTWB 1CL7L 3C5SA 4I0PA 2J8OA 1A1OA 5F9AC 4F9LA 4X8JB 4NO0A 4HEME 4M6AA 1P7QA 3TCXA 4G8GD 5MENA 1U93B 2AJXL 3ZKND 5I1HH 2ARJB 4HKBA 4QRRB 3QHZL 1RUQH 1MJ7L 4GG6E 4NCC2 2NLJB 3T0BA 2J8HA 1DBKL 3T2NL 2KQMA 3CC5A 3SDAD 4F33B 2UUDK 4OCNC 1AXTH 2VLKD 5CGYD 3QRFM 1X5XA 5IQ9B 2E8ZA 3MNWA 5GJTH 1JNHA 4U0RB 5GRUL 3DRQB 1BGXH 4FOMA 4PGZA 2V7HB 2DQTH 2GEEA 2KL6A 1UKSA 4WU7B 4OM0L 3ARDD 1NKOA 5HGHB 2PETA 1DUYB 3DRTB 1R3LB 3MBEB 3OJDB 2E9IA 1T2JA 5HHME 1Q9KB 4K55A 3VXPB 1XCQB 5GGQL 3HZYA 1P4LB 4U1MA 5ICZA 3IDIA 3GJFK 4WWKC 3GI8H 5C8JA 2VMFA 1NGPH 4OZGF 3IAQA 4YHZL 1A1NB 4WHTB 1XZ0A 4ZS7L 4OZHB 4WUUD 1M7IB 4RAVB 5GGRB 3IKKA 3VXNB 2X1QA 4M93B 1J10A 4W4OC 4WHYG 4M7KL 3AGVA 2YN3A 5ITBL 4YHYC 3P9LA 2QSVA 2IQ9H 4L29B 2GJ6E 2DTML 4R3SB 1QLFB 3ALPA 1D5IL 2EKSA 3IFNH 3BEWA 4OF6A 2CLVB 4NQXA 1AFVL 4O4YL 1CXLA 1NDMB 3QUXC 4QXTA 2VAAB 4YXLH 2EH8H 3AUVA 5C0DA 4H20L 2L7UA 1CFVL 2J8UA 1MCWM 2CR6A 4NQDB 3MRMB 1Z6JT 2XNAA 2LU7A 3N9GH 4UQ3B 3P30L 3VMNA 2F19H 2WBKA 1VHPA 3LMJL 4EBQH 2RGSA 4DZBA 3DUHA 1N3NA 1DEEB 3V6ZB 4MAYB 1K6QH 2H6PA 1FZMA 3HN3A 4IMKC 4IOIB 1N8ZB 1LO4L 4XPGH 4JO2L 1G7LB 1S7QB 4NKDB 3UJTL 3H9SD 5F9JA 2IQAB 5DK0B 4OCRL 4OT1L 4X6BA 4ETQB 3FKUS 3WXWH 5HHOB 1BVKA 4UNUA 4ZO8A 3MZTA 3WYRA 1AGBA 4RGMB 3UROR 5SWSE 2HN7B 3G08B 5GSVA 3CPLB 15C8L 4ZFZB 3MJ9A 3HUJA 4OFYA 3VD5A 2X4QA 4Q0XL 4PY8I 2NXZB 4X6DF 3S36H 3QPXH 4U0RC 1P7HL 1P4IL 4RNRA 1VPOH 2VLJB