1IL1A

Crystal structure of g3-519, an anti-hiv monoclonal antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
QLQQSGAELVRSGASVKLSCATSDFNIKDYYIHWVRQRPEQGLEWIGWLDPENGDTESAPKFQGKATMTADTSSNTAYLQLSSLTSEASAVYYCNAISTTRDYYALDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an anti-HIV monoclonal Fab antibody fragment specific to a gp120 C-4 region peptide.
pubmed doi rcsb
molecule tags Immune system
molecule keywords monoclonal antibody G3-519 (heavy chain)
total genus 45
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2001-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1il1A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1il1A02
3DIFB 1NEZA 2W0PA 4L8SA 2BJMH 3TPUA 4U6VL 1BFVH 2XQBH 2L4OA 3KYMA 5C09A 1XZ0B 2P24A 3PWUB 3U0TA 3JWDC 2QR0B 4D8PB 3ULUF 4XP1L 2YMXH 4YDLC 4EVNA 1S5HB 3HR5B 4LFHG 2O5YL 4TTDD 3CZFA 3VXRB 3IDXH 5AG8A 1X5AA 1JHLL 1EFXB 4ZTOL 4MHHI 2ZG3A 4R7NB 1HH6B 3MX0A 5DK3A 1OSPH 1S9XB 4PGCA 1IGMH 4TNWK 2E6QA 2XPGB 4HC1H 1NMCB 5L2KB 4GKOA 4JAMB 3PL6D 3LVEA 1LK2B 4JZOA 2AERT 4PJEB 4TVPL 3MODL 2ZP0T 3AMKA 1D5ZA 2NX5D 1S7QA 1AGEA 5BXFB 5TFSH 5FCSH 4NSKA 5BRZB 2FWOB 5C7XH 3SGKA 1KLUA 2V5SA 3F5WB 2PTVA 3MJ9L 4XVUD 1AD9B 3IFOA 1XIWD 4JY4B 3SKJH 4PD4K 4XP4H 3KLAB 2I5YH 1JPGA 5HYSB 2NR6D 3DUSA 5IJKC 4XCNA 4XBPB 1OAUH 4S0SD 4EDXB 4FZ8H 4MSWA 3ZT7A 4R4BB 3ARPA 1OARH 1QKZL 1OW0C 2IBGA 2CUHA 1A7RL 2VISB 3VGDA 2XT1B 4DGVL 4J4PC 4E0RA 5KBNC 3QYCA 4QHMB 1U3YA 4FQIL 3CPLA 5FM8A 3KLDA 3MLYL 1PG7X 3MODH 5EPMB 3CFDB 4KUCD 3VGGA 1KFAL 1PDKA 5C1MB 5E9DD 4MVBD 4DKEL 4HMEA 4HUXB 4Y4HC 5H2BA 4I18B 4OCRL 4RWHA 4X0KB 2RFXA 5I66B 3VFPA 3CFCH 2J8HA 1RFDH 3N1QC 3QRGL 5CZVH 4PLNC 1NLDH 2Y36L 3EYSL 4Q7DA 3EO1A 4IRZL 4OQTA 5CJOL 3B5HA 2BNQE 1GGBH 1OGTA 3HI1B 3QUXB 3WHXB 4L4VB 5HDBF 1MWAB 4XH2A 4QGTA 4JRXA 2XTJB 2HFFA 3HB3C 4MHHG 4UT6L 4PYGA 5TE6L 3BDXA 3DUUA 3C60B 3MYJA 3S37L 3INUL 2R1WB 5E8EB 4ZAKC 3ARGA 3T09A 1KBGH 3O6LH 3U7WH 5HGBA 2X4TA 2NY0D 5TPWL 5HHXH 1T5XB 3TF7C 4WY7L 4X5XB 3QG7L 4WO4D 3T8XA 1TZHB 3TN0B 2NYYD 4I13B 3BPNC 1RZKL 5GRVK 4MNGB 5JHDE 5JW5A 2EDLA 4HKBB 3T3ME 3BZEB 1NGPH 1MFDL 3MLTA 1JK8A 4NQEB 4XNZB 3NCEB 2F19H 4MVBC 3STZA 1AD0A 1DFBH 2Z93B 4Y16D 3VWJB 3NH7H 3T2QA 3ZSTA 3AB0C 4NBXB 5FYKH 5FKAB 5FM4A 4U0QB 4LBEA 3V6FA 1HHJA 4KVCH 4I0KA 3I75B 4X7EC 3SDXE 5FHAL 4JR9L 4FABL 1T1XA 3ZKXC 1WUNT 4NPYA 1UWEL 1YEHL 1JNNH 4P57A 2BRRH 4R0LA 4JHAL 3KJ4C 3V4PL 5KTEL 5DC4B 4RFOH 5I1IL 1J8HD 3VXRA 3BH8A 4P9HL 3E1F1 4U1IA 1IAII 1L6XA 5DQ9A 3PGCA 3QG6B 2WBJC 1XCTA 1LD9B 3DXAA 5F70A 4WWKB 1RZFL 3IDGA 5FYKE 2P5WD 2I60H 2GSGB 3EJYC 4GRLB 5CJXC 1KB5B 2OL3H 1CT8A 3VXRE 1P4LB 2CXKA 2W9EL 1NUDA 2Q3AA 4RMUA 2XI9A 1SJEA 1V3JA 1NLDL 3FO2B 3IB4A 5I1HL 3DX8A 4OUUA 1T83A 3QDHA 2MPAL 1RVFL 3P77A 3QNYB 2CH8A 3EZJB 5I1LB 5ADPL 2ZSWB 4EDWL 3OXSA 2X9WA 4PG2C 4YXKH 4A6YL 4EXPX 1NAKH 3MBEA 5T5NF 1UH2A 4JPIA 4XVSL 4GG8B 5ESQB 3BVNB 1DQTA 4F37F 2NY3B 1BAFL 4TVSa 3IDIA 4QHNB 1DVFC 1LVEA 3O45A 2ZSVA 1NUNB 2PTTB 2ZOKA 4QHKI 5SWZD 3IVKA 1XIWB 2WANA 1RUQL 3E0GA 5LCVH 1OOAA 3DV6A 4QNPF 1SVCP 4YHOL 1MI5A 3RU8H 3L7FB 4MA7L 3JSSA 3ILPA 5DLMH 4KGJA 5SV4A 4YR6B 2ED7A 3FZUD 4XVUC 1CFQB 5BMFL 4KZEH 5IR1A 4GKSB 4L3EA 2IG2L 4GUPA 4L3CB 3BUYA 1LEGB 3UAJC 7FABL 1Q1JL 3OJDB 5KJRH 3ARDA 1I7UA 1KB5H 2OL3B 4HMDA 1RIVL 2IGFH 4LVOB 2VN7A 2BDNH 5EN2B 3UJTH 2BVOA 1K2DB 4OIIH 1ZXQA 3IKCB 4YDKH 5IROC 1WJ3A 2PKDA 4D0BA 1R3JB 1YYLH 1G7IA 1LP9E 1F97A 1D5BA 1CU4H 4TSBL 5MEQB 4HWZA 4UU9B 2NW3A 3WKMH 1RHHA 4X99B 1JF1B 4Y19B 3NFSH 2WM0A 1T1ZA 4X6DF 3EYFB 1XGRA 3KLHC 3CLEL 4QTIL 4X6DB 3MYJB 1OQOA 3WS3B 5JMRA 1N6QH 4L4TA 3U4BH 5SWQB 2AI0H 2YSSB 3BXNB 1ES0B 3FRUA 5I1DA 5DS8A 3NPZB 5F9OH 4CMMA 3MLZH 3L3KA 3AY4C 4FQHA 2CJUL 4GW5A 3MUY1 3EOAA 4W68A 2PYEB 5C3TA 2I9LB 1TIUA 2N56A 5CIPH 1OSZB 4NQXA 3VXTB 2H8PA 2VDML 4PJEE 1Z6JT 4D9LH 4Z7VA 3ELAT 3BISA 3SY0B 3K7UA 3A67H 1HOCB 2EKJA 4F7MB 2BMKA 4KI5F 4W4OC 1QBBA 1HXMB 2H2PC 3DGCR 4P9MH 3S6CA 5E5UB 4JM2C 3HLAB 4UBDD 2NYYC 1RAMA 2VB5A 4G6JH 5DJAB 5I73B 4MNHB 1JF5A 3BPLB 5BVJA 5JXEC 2DYPD 3OPZH 1LEKA 3T3MF 4OZIE 2XG5A 1KXVC 3STLB 1LE5A 4L8CA 1VKXA 4QRPB 1EO8H 5HI4C 1OTUD 5I18L 4M6OL 2Q7YB 4M6AA 1FVCA 3HNVL 3TT3L 1N64H 3HR6A 3UAJD 2ZWLT 4KAQH 4UILH 5B39G 4LSUL 1UXSB 5J4MA 4IRJC 1EAJA 1VSCA 4U6HB 3RVWD 2CPCA 2ORBL 4FHBD 4DWHA 1BIHA 2MCPH 2DQIL 4IDLA 1G7MA 3LKOA 4RBPH 1CDUA 1AC0A 1T04B 1KIPB 4M48L 4YXHH 1MCOL 1UZ8B 2J8OA 2XACC 4L4TD 5TDOB 5I1GH 5LAXA 5KN5A 4ZUTB 3FO0L 5DD0L 3KPLB 2WQRA 3RUGB 1T03L 1YUHB 1FNGA 5GHWL 3HNTH 2RCSH 3K2MC 1ULVA 1DBMH 2GIYA 4L4TE 2IH3B 3GDBA 3KNBA 4LCUA 1DQLH 4ZD3H 2PCPB 5IMKB 4H88H 4JFZL 4XCCH 2GTZA 4LPWA 3FMGH 1MY5A 3ECBA 2AKRA 1HHJB 3LKOB 1GC1C 2WIIB 4L9DA 1QFUH 4BFIB 3D87B 3CCHA 4OCWL 3I6GB 3TNMA 2GK0A 4OJFL 3V4PH 4JN1L 1HSAB 4N1HB 2E27L 1RIHL 3P4MA 1D9KD 3VCLA 1V3KA 3GMPA 4NQDE 2ED8A 2JJTA 3IF1B 1YEHH 3O4OC 1UWEH 1WBXB 2I26N 1TQBC 1I1AB 1I9JL 3HS0A 4LVNC 5CIPB 5F7UA 3U83A 4KY1L 1YEKH 1T1WB 5EIIB 4I48A 4GS7B 2Y5TB 5DJZB 4QNPE 4GH7B 4XXCC 3V0VA 3O3EA 1EO8L 4YHKL 1FO0L 4LOUD 1MJUL 4KTDL 3VG9B 4YO0A 2M1KA 5BVJB 4DGYH 1CTOA 1RZ7L 2VH5L 4ZNEA 1EHNA 1NSNL 4EQ3A 3BD5A 2R9HC 3CH8A 1UB5B 5I75B 2BHYA 4J12A 5DJ6B 1H3XA 2OQJA 32C2A 2BNRE 4ONOA 3LHPL 3BHBB 3FT4B 2MKWA 2E7MA 1DQML 5ERWB 4X5LA 2DQEH 4FRWA 3B83A 3W9EB 3MXWL 1PY9A 4QCIA 4E9LA 5FOBB 4MQ7A 2AGJL 1KIPA 3MFGB 1OD9A 2BHUA 1DBML 3PWNB 1NJ9B 4Y5YC 4I0CC 4KMLB 4ZFOB 3C5ZC 3NIFF 5DJCB 4YHNA 2V2WB 2H45A 4QTHB 5J6HA 1YJDH 4R4ND 4Y4HD 2CKBB 1MWAL 1MCEA 3F6IA 4XPGL 4P2CG 4HGKC 3JWOH 3G6DH 1CFTA 3OAYH 2BVQB 1QFOA 1IEBB 4G6AD 5E2VH 2R1YA 1ZA6B 4LVOC 4LSSL 4MAYD 4U3CA 1TDQA 2WWMD 4JLRA 4Z18A 2NY7H 1DUYA 1I1YA 1N0XL 3UTPD 1U8PB 1WCBB 1IAOB 2VQ1B 3GJFK 4X7FC 5C0RH 3UJTL 1CCZA 4F7EA 3OXRB 2F54E 5CEZD 4ZXBA 3ALPA 3CSGA 3FFCD 4BSVB 2VR5A 4NO0D 1HDMB 4XPHL 5M7QA 2OR7A 2MJWA 1A4JA 5F7EL 5CJXA 2NY4D 3QO1A 2OTPA 4ZO7A 2OP4H 1CXIA 3MJ8A 1NGYB 3NA4A 1UCBL 4MXVE 3VXNA 4NKIL 4DOHB 4YR6A 2PXYB 1R0AH 4HFUH 5FF6B 1CQYA 5FA3B 1TMCB 3DVFA 4OZIB 1CTNA 4RGNB 3ARGD 4FFVD 1TVBB 3MRHB 1DANU 1RJYB 3VI3F 2R2BA 1BEYH 4RDQF 4YLQT 4ZUTA 4CU7A 5C0EB 4WUKL 3AROA 4CMMB 1UZ8A 5TE4H 4AENA 1BZ7A 4Y4FC 3D3VA 3QI9A 3DECA 5E2VL 1UVQB 3Q6GH 4FQJH 3KPSE 4NO2A 4HGWA 2OTUB 1JHTB 4HLZH 2R2HA 3P4NB 4PGDB 5BZWA 2IALA 3FL7A 4Q6IA 3P77B 3QNYA 5D1QD 4XZUB 4WHYH 3QHZH 4KHXH 3TO4D 3X13B 1T3FB 1U95B 4APQB 2IAMA 5E00B 4XMKL 4O2FB 2AJ3A 4Y0GA 3JV4B 2EDRA 5E8NB 4PRIB 4KI5C 4MCZA 1FYTE 4UTAL 2XZZA 3CLEH 3WYRA 1AHWB 4HUMB 1NCWL 4OFVA 4NO2B 4KRNA 3KAAA 5HJ3A 4UINH 5K9JH 5D6DC 1LE5B 2XA3A 4H25B 3MCG1 3FOLB 5I1KL 4R3SB 5IB3A 5JQ6H 3L5XH 1P4IL 1NAMH 2IFGA 4OQTL 4OZ4B 3TBSB 1I3GH 3MRQB 1X5HA 1BBDL 4QHKJ 3D69A 3FB5A 1KXQE 2Z91A 3SQBA 3CFBA 4YDJB 4L8SC 4RCAA 1B3JA 3JV6A 2YD6A 3KVQA 2AK4E 4OLYH 1REIA 5T1MA 5DJDA 1QSVA 1XGYL 3V0AC 3WMSA 4Q58C 3O6FC 4ZFGH 5E2UL 2AJXH 2BXYA 3U4AA 5CLWA 3NFPA 1IAIH 5ID0A 4JG0H 1BWWA 2BNQA 2VIRA 1QYGL 4P23B 5B4MD 1KEGL 4KJPD 2NX5A 4LLVA 1VEMA 4ODSH 5D93B 3TZVC 3WNNA 3OB0K 5H94B 1A0QL 2X4QA 3N50A 1QPXA 2HTKC 2PYED 3RTQC 4BFBD 3F6LA 3HAEG 3LH2L 4ODWA 5J6HB 3TJEL 4AIOA 4YXKL 2APVA 3QZWB 4LCWE 3OKEA 1QFUL 1VFOA 5F3HB 3HZKB 5LGHH 2OTUA 5DJ0B 2VOTA 1EZVY 2NLJB 4N8CH 1FNEA 5IB1B 1H3UA 5IIEB 3GRWH 2B5IB 1K9TA 4AENB 5KSBA 1FSKB 1ED3B 3GNML 4TTGA 5IEKA 2FO1A 2GTWB 2LAAA 2H32A 1PSKH 3NZHL 4F33A 2ESVD 2H3NB 4DZBA 4ELMB 1BOGA 1QFWL 2CLRA 2JIXB 2Q8BL 3U9PL 5IEHA 4FQXA 5J9PB 3SKMA 4BQCA 2OBGA 5T1DL 2EEAA 5AG9A 5KTEH 1IE5A 3N9GL 3QO1B 2DQIH 4OF7A 1KTDB 3KLHD 3S35L 1IGYB 1FG9C 3UXFA 2A83B 1JFQH 3WEXA 4X4YA 5IEKB 3DOSA 3V6OC 1OAKH 3DVNA 2ENYA 3MLWH 2B20A 4XAWL 1S9WA 4JDVB 1OGAD 3HNVH 1FFQA 2IFFL 3BZEA 1K8IB 1UKTA 2XV6B 1T1ZB 4FZEH 4MX7B 4L8DA 4RX4D 5JMOC 1TTGA 3RBGA 3BKJH 2A74B 5LBSH 1NGPL 1GPOL 3PJSA 2YS4A 4N8PA 5L88L 2XTJE 1S8DA 2EE3A 3V79C 1KCSH 3SKNB 4S11A 3C2AL 4LAQH 3NVQA 2FGWH 1IM3B 1YYMH 4GSDH 3EAKA 4JFYB 4TQEL 2F8VA 1DTUA 4RAUA 3HI1A 3N1MC 4PJIA 5FYLH 1DQQB 4H8WL 3KNBB 5DYOA 1NBVH 1Z3GL 4Z77A 1D9KB 4NQUA 5JTWA 3WIFA 1IGIH 5EU5A 4JZJC 2LTQC 3BHBA 3FT4A 4XPBH 1TNNA 4ORZC 4OGXL 5AAWA 1U8HB 4NJ9L 2QJDA 3FB8B 5F7LB 4JPWH 3K74B 5C09B 3TBSA 1GGTA 2ARJA 1D7FA 4MDIA 5ISZA 1Q9LA 5D72L 3FAXA 4X5WA 2FEDD 2PW1B 2V7HA 2VDKL 4MJ2A 3GSUB 1CGUA 1U93B 1XF4A 2JELL 4K23L 3WUWB 1IC5H 2ZSWA 1YY8B 3QDJA 1VGKA 2BVUA 4FQIH 1N0LA 3MRLA 3A6OA 1YY9C 4PRHA 4FTVB 4HQQL 1KJMB 3D2UB 5IVNA 2XTLA 3FQTB 1YN7A 2NZIA 3MRKA 3C87A 4HHAA 2W07A 5JIHA 1XMWA 1NFDB 5F7DB 3DBXA 4JO3H 1GOHA 2A6JA 5J57B 1I3RB 4PJBA 5K9KA 4X5WB 4U1NB 3H9HA 3WLWD 4RDQG 1JHTA 3BWAA 4OD1H 4DW2H 1BZ9B 1S7XB 4JKMA 3VGBA 4Z78B 5C0FA 1C5DB 1T21B 2CK0H 5KW9H 4QRRE 4U0RC 3KPSB 2OXGA 5CHNB 1MJJB 4G6MH 1KJ3L 4UT7H 4X83A 1B9ZA 3Q2CA 2L0DA 1E4XL 2A73A 3L3JB 1LO5B 2GK2A 4LCUB 2DKMA 3LZFL 3N1PC 2IEPA 3MLUL 5GRJL 5KSUA 2FR4B 3WJJC 1W8NA 3GBMH 5IM7A 3GI8L 3DYMA 4OLUL 2NCMA 1OTTC 4F15B 3Q3GA 4LQ1A 4KXZH 2YUWA 1U8MB 3IFNH 2RBLA 2W92A 4UT9H 3WO4B 5KS9A 5HHQB 3IFPA 3PL6B 1EEYB 1IM3A 4JG1H 4FFZL 4AY0A 1BQHB 3RDTB 4K7PY 1NUGA 4WDIB 5DD5H 4TSCL 5D1XD 1RULL 5KSAA 1JBJA 1RVFH 1A7OL 5TDPB 1DDHB 3VFOA 4IRSB 4P5KA 3BQUD 1JHLH 3C8KB 4KFZC 4A6YA 5FUOL 1YQ2A 4NCC2 5EO0A 2F74B 2GEEA 1OP3H 4OFPA 1G0XA 1YDPB 5L8LB 2UVFA 3KPMB 4P3CH 5KVEH 2FIKB 3DHMA 5L2JB 5D1ZD 2NY4B 3MSPA 2XZQH 1EK3A 4P99A 2RQ8A 5DWUH 4FXKB 3IGAA 2H2SD 1L9NA 1MHPL 3GSQA 3QA3A 4FQ1H 4XWOC 3RAJH 1EGJL 5GRUH 5HHPB 4N0CD 4BZYA 5D5MB 2FNBA 1ZAGA 2BY0A 5SX4I 4B7LA 1Z9OA 3MNWB 3VFMA 2G75B 4G9FA 4X4XB 1MQKL 1KC5L 1CZ8H 3SDYL 5JXAH 1WAAF 5GGQL 5KANI 5ISZB 2JJSA 5C07E 5INCA 1KJ2A 2CDGA 3EW3B 4RWYL 2CUMA 1JNNL 3EDJA 4PRPB 3BUYB 3S97C 1HXMA 1QA9B 1R5IA 4M61A 1TPXB 4D9RD 2GTZB 4AIZB 4R90H 3CVHH 3VH8A 2ICWB 4NFCA 2ADFH 5HDQL 3AM8C 5DD3L 3JWDH 4K55A 1G6RB 3TO4B 4JE4B 4APQD 2BFVL 4G7VL 2HT4C 2EDOA 2N4IA 3GRWL 3FQWA 3P30L 4UQ3B 3MBED 3MCKA 1R5IB 2IPUG 2KZWA 3KR3H 4R97B 5C0FB 2YSSA 3BXNA 3VG0L 2XTJD 5DEGA 3FAWA 1URLA 4GKNB 3OR6B 2DM3A 2B2XH 3PDGA 4Y1AD 1DJSA 3C60D 5F9WC 5C0BE 3DSFH 1LNUB 5BJTB 3I3DA 1MNUL 4NCDA 2DMKA 3P3YA 4MXWL 1QRNE 4L8DB 3IS1X 4JQVA 4PJ7F 2R0WH 2WAHA 4HJJL 3INUH 3TN0D 4TOYH 4AT6A 1EO5A 1QLEL 3ESUF 3SKUD 2YZ1A 5TQ0L 3KPQA 4F3FB 1E4XH 1UA6L 4AEHH 5CEXB 5KVDL 4L3EE 1IAIL 4BH8B 2C4FT 5IQ9A 4Z7WF 1MUJA 4P4RB 4FXLA 3EDDA 3BQUC 4YBLC 1H15B 4OAWA 1B0WA 4NNYB 2AXGB 4YIQB 4F7CA 3D0LB 3ORJA 2P8LA 4Y4FD 4RMQA 2QKIA 2D0GA 3GBNH 2Z8WC 4E41E 3ZYJA 3T3PF 4L3ED 1LEGA 3ARZA 1MLCA 1Y6MR 1GGIH 3WUWG 1J8KA 3ZE2E 4CKVX 1NCAH 2BX5A 3MLYH 3HNSH 3RWCA 4EUPH 4MB4A 3L7EB 5KSUB 5FK9B 1AGBB 3LDBC 3SDCD 5I1CL 4OBSA 2QKIB 5FGRA 3VFNB 4U1GB 2F5BL 4LNVA 3PQYA 4OAWB 4LLAA 5F8RC 1M7IB 3MA7A 2ICEA 4WO4C 3QUMH 5EUOF 1FVEB 3G08A 5C0AB 3GHBH 2VLLB 5I8CB 5DJ8B 3QT2A 1IAKB 1R3IL 1UJTA 5L6YL 4POZD 2V7NB 3OB0H 2D3VA 4NQEE 2VL5A 4G6AC 5DJYB 5EBLB 2D7QA 4PJDA 2HVJB 3T0EE 1SVZA 4FFZH 2EDEA 4KHTH 4KK9D 4GRLA 3T0AA 4N68A 2EDYA 3MRMB 4PJ8C 4ZUUA 1GGYA 1JZ7A 3PNWB 4YH6A 3MJ7B 1F4HA 4EOWH 4TVPH 5BW7C 4JM2B 5J06A 3GSRB 1OM3L 3TZVA 2EXYC 4AH2B 4AMKH 2VDPL 4NQDD 4HDIA 2R2BB 4WHCA 2OZ4L 4ZFFB 3LN4B 2QHLA 4OZIA 4AL8H 1X5LA 4L29B 4XNMB 2NY3C 3PGFL 2C1PA 4RRPG 4CDGC 2NNAB 4LVHC 1CGSH 1CD1A 3DHJA 1OAXH 1Z9MA 5DDHB 3WO4C 1K3ZA 1KB9K 3TBVB 4J2XA 1RV6X 2VTFA 4PGJA 5FM5M 5D5ME 2A6IA 2OS7A 4WGWB 3EOAB 4QKXB 5C9JB 2BY3A 4LHUA 2AXGA 1LK3L 1V8HA 4CADA 1U6AL 1B6UA 4LGSB 4P2RB 3DV4A 3QXAB 4ZG1A 4OGAD 4G8IA 1ZA6A 5E24E 1DZBA 1OP5K 1WBYA 2YC1B 4MQTB 3N9GH 1WAAE 1C5BH 3U46A 3LQZA 1G7PB 5JIIA 4JM4L 5J1TC 3EO0A 2FJFA 1G84A 1DBKH 4W4NA 2ZPKH 4DKAA 3QRFM 3UBXI 1ZHLA 2DI8A 3TFKD 5TDPA 1H8SA 3P0VH 2QTEA 4AEHL 1OB1B 4U6TA 5JHDA 3DV4B 3QXAA 5F1SA 1D6VH 1NMBH 1E4WH 2IADB 4HUKB 4RA0C 5J8OA 2FB4H 3ARFC 3IETA 1QHOA 2Z92A 4R7DA 3SGKC 5J1SC 5C0EA 5DVNA 3T2OA 1CFSB 3O11A 4PRAA 3D39A 4NQVB 1CE1H 4O2CB 5BS0B 2VLRA 2EDJA 2X1PA 1YMHA 1TQBB 4UQ2A 3VXPA 4X0KA 5FV2A 3I6LE 3GSOA 5EB9A 4HKXA 3RWHB 3SDXA 4DKDC 1JPFB 2CIIB 1ZGLM 1N7MH 4Y89A 5CAYB 1YA5A 2HT3C 4LSPL 4LFHD 1T80A 1CDBA 3VD4A 3S36X 5I6XB 1CD9B 3TYFB 4ZXBB 1WIUA 2W9LA 3E8UL 3P4OB 3X14B 5HVFB 3SGDH 5F1NB 4R96A 4M62H 2RCSL 2YD4A 4KI1A 5MERB 3TBYA 3S96B 3V0VB 1OTSD 2WINB 5JW4N 5HJ3B 4NQCA 1E6JH 1PQZB 3SPVB 3N85L 1ZSDB 4FXKA 2W65A 3LSOA 5JHLL 1IAMA 3DRQA 3RZWA 3MV7E 3P40A 4WU7A 1W72B 3OV6A 1YDPA 1T5XA 4HZAA 3HC3H 4Y5XA 5HGDB 5DJYA 1VA9A 2GYSA 5GGRY 3JTSA 3I6KA 1BBJA 3OGCA 5DA4A 3I6GA 5I8CA 3HFMH 1S7RB 2WIIA 2Q8BH 3U9PH 1N64L 3IXTA 2XXMB 1H3VA 4HS6A 4KROD 2VMFA 1XGUB 1F6AB 2DWDA 5C0AD 1V7NL 5F1KC 1FC1A 5DVOA 3MV9E 5F9AC 1OT2A 2V2TB 2DN7A 3DLQR 3UJIH 4XB7A 2BSED 1MRFH 2HFTA 5C0AE 5JPMB 4K9EH 4LLWB 5EZJB 4F58H 3T04D 2X42A 4H26A 4YHPB 4H8WC 3BT2L 1RULH 1UWXH 3TH4T 3GUTB 5DVLA 3ARBC 1LO2H 1XGUA 3HMWH 4O51B 4GJTB 3IXTB 4F57L 4OGYH 5JDSA 3OKLB 5E8PB 2BVYA 4I77L 1S7TA 1NC4A 1J0JA 3LS5H 3O3BA 1OVZA 1P5UA 1EX0A 4PLKC 4ZO8A 4B53A 2MCG1 1TVHA 5B39A 1MFEL 1GIGL 1U8KB 3FQTA 4ONHA 3WFHA 2EDBA 1ADQL 4HIHA 1IGTA 2LVCA 4OLXH 4EDXA 4MNGA 4ODUB 1FAIL 3L6FB 4PB0L 5KW9L 3H42H 4KDVA 5GGTH 2UWEB 3ZKND 4CVZB 2HJFB 1Q9KA 2OP4L 3DWTA 5F1NA 1FV1B 3E6HA 4GAGL 1T83C 4NQCE 3FB7B 5IK3A 3BH9B 2A9MH 1NC4B 4YHNB 1I7ZA 4M5YL 4V2BA 4F9LC 3IU4L 4FS0A 1B4RA 5FO8A 4ONGH 2ZNWA 4JRXB 5A2LH 4ONFH 3BAEH 3D85A 4MD4B 2XWJA 4C56D 1NDGB 4V1DE 3HE7A 5CBAA 1OSZA 4NQXB 1H0DA 5F71A 3VFRA 4TULH 2PYFA 4NHCH 5I66A 2EIBA 3RIFF 3D39B 4M1DL 3U7AA 4PJ5B 4NKMB 3EIFA 5ALBH 2HJLB 5KN5B 4UTAH 4UDUB 2O61B 1JHKL 1WQVT 4NJ9H 3DO7A 4KZDH 5DUPL 2VZVA 3ARYA 4XMKH 3ZKQD 5FO8B 1RIUL 3KYMB 2BVPA 4TRPL 5CEYA 2FD6L 4AL8L 4UNTA 3AXLA 6FABL 4O5LL 4HT1H 2NY0C 1CDGA 4HLJA 3RI5F 1XCQA 4QXUL 2A6JB 3UJJL 5B21A 1MFAL 4U31A 1FZMB 5FYLL 4Y4HB 4BKLB 4G6KH 1G7IB 2VXUH 1GHFL 3T0DA 1H5BB 3OKNA 3FT2B 3AS0A 2HT4D 3FO1B 3MYZA 5F6HI 1QSED 3TIEA 5JA9A 2NQCA 5F21B 1LO2L 3X3GL 1BQUA 1CXLA 3SDDC 3TBYB 3DTXA 2HLAB 3WFBL 3CX5K 4OFYD 3QSKB 3G6AA 3U6RB 4OLWL 2R0LL 2VWEC 4L5FL 4QXGH 1Q94A 1YEGH 4DTGH 2H2PD 2WBWB 4DCQA 1HSBA 5BZDA 4NNPL 4U1GC 1Y6NR 5KS9B 3ZE0E 3MCLH 3CMOL 1ZLWH 4ELKB 5DLML 1CFQA 5DDHA 1CL7L 1FO0B 3FQXB 1U41A 4YUEL 5I1CH 2WZPD 3T0EA 1HH9A 2NY7L 3M07A 5C2UB 3ZTNL 1P69B 2O5XL 5CP3A 1FRGH 3CFEA 3IETB 5E5RB 3K3QA 5HYFA 1IFHL 2NZ9D 3BPCB 4I4WA 5IESH 4EI5D 2HVKA 2A6DB 4MXQC 3KYAA 3U36A 1FL3B 4EJ1C 3LEXB 1KEML 1YC8A 1YN6B 1N5YL 4XCYA 5DEFA 3ZKXB 5AZ2H 5IHZB 5I1HH 4Z7NF 1XF5B 3O6KL 4XCCL 4S1RH 1U91B 1AQDA 3AY4A 4LARH 4AIXA 4HHAB 3ARQA 1PZ5A 4JRYE 2I60L 3C09B 4N90D 1FVCB 5CIPA 1MCHA 12E8H 3WFCL 4NCC1 5ENWA 3PHQB 4ONHB 3WFHB 4U1MB 3VGAB 3SE9L 1MEXL 4GBXD 3CVIL 1G7LB 2VIRB 2VZ1A 4LVNB 3JWOC 1XGPA 1TJIH 4WI7A 3O0RH 1FHGA 5D7LB 3IFLL 1IGYA 4YDVB 3WEXB 2ORBH 3NCYS 1KTDA 4QRSA 3I3BA 1T89C 4H5SB 4F7MA 3QQ4B 2VR4A 5CWSA 2YA2A 5LKNA 1E4WL 1FIGL 5D2NB 4LLWA 2RAMA 4KGLA 5A16A 1QYGH 4EN3C 2DKUA 4Y4KA 3H9SB 5HHVH 4O2CA 5SWZA 1J1PH 4XC1L 3GHEH 3C08H 1TQCB 5I17A 3MRFB 1WISA 3Q48A 3QZWG 2YD1A 4KKAC 3SCMA 3UTZB 1F8TL 1MIEL 3REWB 4WHTA 4NZRL 1QSFE 1OP5H 4GAFB 2B7DT 4XMLH 1EFXD 5IQ7H 5I1LA 2J8UB 5JW5B 3O2DL 5AUMA 2ADGA 4G43A 2RHEA 3T0WA 4OJFH 4QYOA 4YK4B 4DZ8B 4OCWH 5JW3H 1EBPA 2B0SL 4QOKA 3OF6A 4OQTH 1AXTL 4GW1B 3GJFA 5F7NC 2W65B 3LSOB 2IALB 4Q6IB 3BKYL 1NFIB 4UOJA 3TVMA 4IRSC 2WUBL 4OZHB 5DRXA 3ROLB 2DLEA 3BE1L 1DBBH 1YEEH 3EHBD 3PGCB 5E1AB 4I4WB 3BYTA 4K3EH 3EYUH 1NC2B 2LE9A 4P5TC 1CGSL 3QRGH 5IB4B 3D18B 4LVEA 2E7HA 3R06A 3M1BA 4NFBA 3O6FD 5DQDL 4GKSA 2MKLC 3MREA 5T3XH 3BJ91 3NFNB 2EYRA 3LKQB 3RA7H 1E27B 1DQDL 2PW2B 4MDJB 4XHJC 5DHYB 4HWNA 4C4KO 4R0LC 32C2B 1QLRA 4IJ3B 2C3VB 1YMMA 4DCQB 1DN0A 3HI5L 3QI9C 3X17A 1OPGL 5EPMA 3L3OA 4NM4H 5ICZA 4QY8A 3SOBL 3UPRA 3MV01 1NBYB 1XEDA 1S5IL 5BV7C 3AREB 3QJFB 1OARL 1QKZH 3QB7C 1NBZB 2HTKD 3DX6A 4Z7UF 3HG1A 3QXDB 4DTGL 2FL5A 3IDXL 4I48B 3HUJB 1OGAB 4NRYB 1NCBH 5GISL 3SE3C 1I7TA 4Z7WE 4JGJA 4XBEH 2D7TL 1IGTB 5FO9B 4BKLA 2ZCKL 4I1NB 2VLRD 3UC0L 1T4KB 1KN2L 1PKQE 4EIZC 3VDCA 4CVWA 8CGTA 3MGAA 5CKAA 1HHHB 1MCFA 4MJID 3C8KA 1X44A 3O3AA 3L1OH 1GHFH 1SMOA 4ZYKB 4PJAF 3QIWD 4ZS6D 2ICES 5FYJU 2DQDH 2NY5H 3VA2C 3K8MA 5DRNB 4YHMH 1NCAL 1QLFB 3UJJH 4WV1C 1P4BH 3G5ZA 3FQWB 5K59F 3GSNH 5EZLA 3ME0A 4BZ2H 4OLZL 2NZ9C 4POUB 4LSRH 3N0PB 3UTSA 5GS3A 2Y6SD 4PY7B 4NKOB 4KDTA 2Z8VC 5IF0B 1HKLL 4LPYA 3Q5OA 2XWJB 3KS0J 5T3ZH 4K3EL 3GSVA 3QDGA 3RVUC 4UIKH 1J0IA 4YPJA 4H5SA 3L3GA 5KVDH 1J7VR 5HYJE 1Q94B 1S7XA 3HAEH 4Z7VE 4LRIC 3U82B 3WO3B 4C54A 3BWAB 4QXWA 1ZLWK 1CU4L 2AV1B 2D31B 4NNYA 2UWEE 3MXWH 4LNRA 35C8H 3ET9F 5D96B 5H8DA 2H1PL 3CH1A 3PWVA 4TUOB 5DHVA 4P2OB 3V5DA 1UXSA 1GOFA 3MJ7A 2C4XA 1MF2L 5HVHC 1WWBX 4N0FB 5DK2A 5CGYD 1AR1C 5EUOB 4YGVA 4FTVD 1ZSDA 4XMLL 3TEUA 1TFHA 4M7JH 2P44B 4YX2H 1WSST 4FQXC 4OKVB 1FZMA 5E00A 3WUWA 5MP6L 4HXBL 1IZJA 1RZ7H 3O6MH 4JR9H 4HUUB 1L9MA 1MCWM 2R29H 3DETD 1I7RA 3B5TA 2AV1A 4XCYB 5DEFB 4MNHA 1B6DA 2GY7B 5IMLB 3P9LA 1AC6A 5IT2H 4GG6A 5MEOA 4WI6A 3MCKB 5J0BA 3O2WH 1OP9A 5C07D 1KV3A 1ZGLP 1A1MB 4K8RD 3NN8B 2HJLA 4HPYL 4U1SA 2EYSA 2NXYD 2W9DL 5EZJA 1M7DA 3UTQB 2R0ZL 1A7NH 5B3NA 4EN3B 3W0WE 3W5MA 2EKSB 1FSKC 1S9XA 4PGCB 5HPMA 3P73A 2E9WA 2E27H 1JGVL 5EA0L 5E08H 1D6EA 5EWIH 2GJ6B 1WTGT 3HUJE 2R2EB 2NY1B 3KPRA 4RAVA 3MRGA 1HWHB 3SDXF 4D0DB 4OB5L 5CCKH 4MWFA 1QA9A 4M61B 1FQ9C 1IGJB 1E4KC 1CLOH 2P24B 3PWUA 4AYFA 5I9QB 5IMLA 4MD0A 1ACYH 3O41B 2ID5A 2APFA 3QHFH 3EBAA 4OF8A 4K94H 2Y9RT 4N8VG 3JTSB 5D71H 1IAOA 3NA9L 4KJQD 4ISVA 4OD3L 3W9DA 2YD7A 1EJOH 2WLYA 4Y5XB 4XNYL 1MCCA 2XKNA 2FBOJ 4DQOL 3MPCA 3K4DA 1WBZB 3IAPA 2Y36H 1GH7A 3FO1A 5CD5D 1CFTB 4NFDA 5F9WB 4G3YH 2OTWA 2P46B 4NO5B 4ODVL 2QQLH 5AAMA 4JG1L 1BM3L 4JHAH 4NUJA 3IU3B 4OZFB 3PUCA 3BZDA 3CH1B 3BSZL 3G6JA 3IFNL 1JRHH 3IFOB 3NIFE 3E2HC 4LHUB 4WENB 3W2DH 3CCHB 2VXVL 4KAQL 4JZNB 4ODSL 4UILL 2BZDA 3WLBA 3MA9H 1MREL 2NXZC 4PJCF 5E6ZA 1CL7H 1IM9D 1A7RH 1S7WB 2X70A 5L0QC 4M62L 4GQ9L 3BPNB 3CDFA 2Y72A 5FYJD 1T2QH 1YNTB 4RFEB 1Q0YH 3RVVC 1AGFB 1LEIB 3KGRA 2AEWA 4RA3A 2D7OA 5BO1H 2FBJH 3NH7L 4DW2L 2H41A 4KUZL 3ZZ1A 3DMMC 3GMNB 3VDBA 3O6ML 4WHDA 3RUGF 3S35X 1I1CA 3MROB 1O7VA 4WU5B 5JXEA 1AH1A 1A6UH 5E6IC 1E28A 4HH9A 4AIZA 3UP1A 2XQYK 4HUXA 5CJQL 4ZPVA 3S98A 3BVNA 2F5AL 3CXHK 2NY6D 1YEJL 2WWKO 3OJ2C 4JQXC 5F3BA 4NOFA 3KPOB 2ITDB 5BQ7A 4WTZG 1F58L 3DI3B 1ZHLB 1RMFH 1MVFA 3E6HB 4IS6B 3MRRA 3PQYD 3LQMA 2Z35A 4WFGD 5HGDA 1SJHA 5I74B 2HJKA 1T66C 3VXOA 1IGML 4HT1L 3L3DA 4L9LC 4JANB 4Q0XH 1UENA 3E3QE 4Q74A 1RU9H 3EFDH 4PBWD 1LD9A 2DQFA 5CZVL 1MCNA 2XNAA 2A77H 3B9KD 3MA7B 2F74A 4QF1A 3VXSA 3MZGB 2GJJA 4I3RH 3BMWA 4NHCL 4KKCC 2BJML 1TZGL 2ICWI 5EDXA 4Y4FB 1J11A 4OI7A 4X98A 3CZJA 4YHZH 3AS1A 1BOYA 4NZUH 1F58H 1JWMA 3KPSD 3OHXB 5HYJB 4YHPA 2JJWA 3EFFA 2CLRB 2AABL 3CFIC 4UBDC 4IJ3C 3UDWC 1D9KA 3DURA 4NN6B 5E2JA 1N6UA 1KT2B 5KVFH 2D2OA 4WW2F 3T0VA 2M26A 2AJYH 2K9UA 3T08A 3SGJA 2OZ4A 3V6ZB 1NCBL 2VAAB 3GK8L 3MV9D 4L4TB 5SWQA 1FZKA 1FAIH 4CRPA 1HHGB 1CF8H 2AV7A 4O02L 4EI5A 4XPHH 5GJTL 3RJDA 4M3KB 2PXYD 1T7VA 2IFFH 3FT3B 4PJHB 4ZODA 2C3XA 2EDQA 1BVKB 5EZOH 1SHMA 3B9KC 1IKNA 5EC1A 2X4TB 2P8PA 3B3IB 3MRLB 1FGNH 5D1ZB 3PWJB 4NRXA 2GJ6D 4PBVC 2JJSC 1A3LH 3IKCA 3GI9H 4G8FB 4QXTA 3P9MA 1F4YH 5EN2A 5B22A 2QQNL 5DFWH 3QEUB 4P5TD 4N8VA 3G6JE 1DBAL 4KJYB 2XA8L 4PS4L 1BQHG 2DM7A 4HWEL 1QFWH 2WSKA 4PRIE 3ZYIA 5DSCB 2EH7L 3BUTA 4FQLL 5I16B 1XF2B 5C0DA 5IFHL 1J10A 2X40A 1RZFH 4N0YH 3OR7A 4BM7A 2UWEF 4YHLH 2LTQB 4NN5C 43CAB 2E6JA 2NNAA 3J7HA 3QUYD 5KANG 2DYPA 3G9AB 4NWTL 1D9KC 3WSQL 5I30L 5F7YC 4HKZB 4JB9H 1RJLA 3HZMA 5E8DH 1G1CA 1HZHL 3WE6A 3ZLQC 4JKPL 5E08L 2V9RA 3LH2H 4FQ2L 2EH8L 3TO4C 2VQ1A 5IQ7L 1BREA 4JLRB 3RWJA 5CGTA 4KK6C 4HKBA 2CGRL 3P9WB 4FABH 2XTJC 5I1EL 4PJXB 4Y1AB 3LB6D 2IPKA 5J13B 1I9RL 1EA9C 4HXAL 3LRGA 4GW1A 1SJEB 1LP9F 2YA1A 1WZ1L 5SWSB 1JPTH 5IVZA 2Z35B 2F58L 3QNXA 1XFPA 5ICYB 1QLEH 2CIKB 2BCKA 1VHPA 4BFGA 3SJVB 4AG4H 4LGPB 2AXFB 1AQKL 4DN3L 1FLRH 1ONQB 3L5WB 4ZNEE 2WMPA 4H20L 3T1WA 2VLMD 3MRFA 3TJHD 4HMCA 1PGRB 3RWGA 2I07A 2DQHL 1OAZH 2A1WH 1A6ZB 3WFDL 3RWDA 4ODVH 1RI8A 4JGUA 1BFSA 1P4IH 5GRXG 1KG0A 2F53D 2KKQA 3NGBB 2EYRB 3GJEB 2FB4L 3RQ3A 3PXJA 2R4RL 3CC5A 4LLYB 1A1NA 3AC0A 1MI5B 3GMQB 3MR9A 1V3MA 4PJ8A 4WI4A 5J89A 4PY8I 3D25B 3GB7B 2EH7H 4XHQA 3V7AE 1A5FH 1UGNA 3ZDYF 1ACYL 4IRZH 3O6KH 5D96C 1SJVA 3DTXB 4HBCH 4YHIB 1INEL 5F6IB 2JF1A 3E6FB 3B9KA 5HVHB 5I76B 1CGVA 1A7PH 5I6XC 3CDGB 1MRDH 1J0HA 1FFPA 4KQ4L 1NFIA 4FQXD 5ESAA 3ZKMC 3EYQD 5C3LD 1W72L 3PWPB 4UDTB 3MJGX 3BGMB 1EGJA 2DIJA 5HYSA 4ZFZA 4BFEA 5E4EB 2D0HA 2PO6D 3IF1A 5CUSL 5EBLA 1SM3L 1A14L 3MV8A 4WCYL 3T3PE 1T22B 4HG4K 4YUEH 1FH5L 3S9DB 1ZWIB 1UVQA 5TGBA 4Y5VB 4U1HB 2J12B 1WZMA 3M8OL 1U3JA 3MV9B 4NKIH 1CICC 3HE6B 4FQQA 3C09C 3CFEB 2Y06L 3FFCE 1OGTB 2OK0L 3JVGA 2R2EA 1EJ6A 3OPZL 5GJSL 2XA8H 5I8OH 1HEZB 1DEEB 3NAAL 4EXKA 5T5FL 4XI5C 2FH6A 5L7XH 4OCNC 1G9ML 3KXFB 4WVRA 1SQ2N 1XR8B 4IBLT 5E99L 2ZUTA 2ATKB 2DBLH 3VXUD 1B88A 2WQ8A 3PWLA 2FSEB 2OQJB 4BQ6A 5IBTL 3KYOB 4B0MM 1S8DB 3TPUB 4XNQA 4GMTH 3OXRA 5LGJA 3MOBH 3L95B 5DUML 3AGVA 4K71B 1MHEA 4IDJH 4JFFE 3QNZB 4OKVA 2VQTA 3KPQB 4H0GA 5DO2D 3AU1B 3O9WC 1HCFX 4QRRD 2CDFA 3TNNA 3RVTC 3CXDH 3WFEH 1DBBL 1FJ1A 2DQUH 4Z5RA 1YQVH 5GGSY 3MJ9A 1IC4H 3RWFA 1IKFL 4DFHA 1J5OH 3V8OA 5BVPH 4TULL 3GSNL 4R2GD 3NBNA 3VCLB 1PG7W 3BKYH 1JZ6A 5HPOA 2V2WA 4X6BA 3AXLB 1X5YA 2EYTA 4HK0B 1QO3A 4S2SB 1MCSA 4Q9CA 1ZHKA 1KCRL 3HC4L 4FG6C 4DGIL 3TVMC 3QUXA 3WHXA 3KPNB 3BP4B 2HH0L 3SY0A 3BX7C 3CFJB 1D6EB 1RZIA 4PJ9C 1F2QA 3DMMD 3TO4A 1YMHB 3D39D 4PJ5E 3MFFB 1RU9L 3ARXA 3D85B 4PIRF 3KPLA 3V5KA 3OZ9L 2AJZB 4ELME 3L5WA 1ED3A 5C07A 4V2CB 3QISA 2VZTA 2ZCLL 1X5IA 2G5BA 4Y5VA 1FN4B 4RMWA 5E7BA 1INQA 2QSTA 4XP6H 3O2VL 1CLYH 1HIML 4NJAL 5CILH 4P4KC 1KPUB 2Q8AL 4YFEA 2X4NB 3RPKA 3CDYA 4OFKA 2NW2A 4CN1A 2PN5A 4GAJL 2BRQA 5MEQA 3HZYB 5TH2A 4U1LB 1MELA 3QWQB 1E6OH 4HEPG 5HYJD 4NN5B 3BT2H 1FFPB 4F9PC 1J0ZA 3RDTD 3OAZK 2GUOA 2QSVA 2ZUSA 1A2YB 1JMZA 2BNQB 3EYUL 3DVNB 4QTHA 4ZTPL 3BQUB 4PJGF 3K2UH 3BP7A 3RWIA 4U4BA 3GSNB 3V2AR 4OBRA 4M8QB 2P5EB 3EOTH 5C08A 3KJ4B 1D5ZB 4L3CA 1QPPA 1A7BA 1Q38A 1S7UB 4OZGA 4XP5L 3C6LC 3U1SL 4I0PD 5IR1B 4M7LL 1BFOA 1EVTC 1OAKL 1UFUA 4YHYB 2DQCH 1X7QB 5CS7A 2VABB 2XICA 2GCYA 4LSVH 2X1XR 2G5RA 5I9QC 3SE8H 4QEGA 5EWIL 4YWGL 3X3FL 1UH4A 3NCYP 4QRTB 4TUKH 2SEBB 1U8OB 2CKBH 1CFSA 1AE6H 1NC2A 2EO9A 2EDFA 3FN0H 3BD3A 5DD6A 3AVEA 5I15H 5IIEA 2V2XA 2Y5EA 2D4FA 1HHKB 3ROLA 2EYTB 1GOGA 1L0XA 3QUMB 4Y8AA 5H35A 3O3AB 4U1NA 3MCLL 1PAMA 5DUBB 1JZ5A 1PSKL 5I18H 1PBYA 3T4AB 2LABA 1U42A 1LQSR 5SX5K 1VESA 4L5FH 4PG2A 4NRZA 4F15C 2VKWA 3VRLE 3J8F7 1R3JA 4XMPH 3HA0A 2LFGA 5FCUL 5IHZA 4LOUC 5L8JB 4NQCB 2MOVA 1RK1B 4P46C 1HHKA 2YK1L 5EA0H 1RZGB 4YHIA 3LN9A 4UT9L 2ADIA 2VXUL 2W9DH 3HPLB 4LP4A 4JFXB 3MV8D 1CLYL 1HIMH 4QY8B 4ZO6A 2XWTB 4X7SL 4Y2DC 3GO1H 5B38G 2H9GA 3MNVB 1W8OA 1QNZL 2BMKB 4K3JH 3H7BB 4URTB 1HINH 2CDEA 5ALCH 2O26U 5EFIA 2IH3A 2ATPB 4QRRB 4UB0H 5EUKB 3T0BA 4MLIA 4QRSB 2H3NA 4J8RB 2FJHA 3VD9A 3RIFK 4FP8H 3RWIB 4YEFA 5ID1B 3OJVC 4FQQB 4JFYA 1H15A 4XTRC 3FQNB 5CSZA 3SQOL 4D9RE 5IG7B 4H1LG 4HWUA 3DGGB 5CLTA 3STZB 4TSBH 1A64A 4EBQL 4Q9BA 3PNWA 4P9HC 1M71B 2DLGA 4WW1B 5JA8B 2E9JA 4AT6B 1S3KL 1XGRB 2CRZA 3TH3T 4OIIL 3C5ZD 3FTGA 4D0CA 1JF1A 4Y19A 2R2CA 3EJYD 4M7ZC 2DLTA 5IFJA 1N59A 3X13A 4APQA 4GRWH 4RZCB 1IC4L 3X12A 3CSBA 3PWPA 2I27N 3L5HA 4PV9B 3TA3D 5I1JL 3OX8B 3GGWB 1FE8L 3I2CL 4U2YA 1OAXL 2JCCA 1A6AB 3L3HA 2HFFB 5C0BD 4Y4KC 1PD6A 3TJHC 5C70A 2V6HA 2BOBA 4OZFH 4WI8A 1IT9H 1KT2A 3BW9A 1R24A 3G5XB 4MA8L 1OW0A 3SO5A 1PYWA 3RGVA 5C7XL 2IAND 2FHCA 5IHBA 2R56L 1OPGH 4V1DB 3HC0A 1F4XL 3SE4A 4LK4A 3LB6C 4MD4A 4HKXB 3RWHA 1VFBA 3QEHB 4GXVL 3CFBB 4YDJA 1MQ8A 2R1XB 1G9MH 2DICA 2Z91B 2HA1A 4OZGB 5BRZD 3QQNA 1ZHBB 2X4UB 3GSXB 3ZYOA 5CGMA 4M8QA 1RZ8A 4JFEB 5ACZA 2Q6WA 4OCXL 1I8MB 4XBEL 4M93B 1EVUA 1CICA 3I2CH 5KSAD 2YPKB 3C2SA 4LAJH 1GGCH 1ZKAA 1CDYA 2AQ3A 3QHTC 4M5ZH 2X5PA 4NRXB 2VXSH 3VH8G 5D8JL 3L3DB 4U6VH 5E8NA 4L1HA 4GQPH 3RI5K 3RNQA 4PV8B 5SWSA 4M7KL 3MLWL 4WW2B 2DJ4A 1AQDB 5H94A 1NDMA 5D7KE 4WEBH 1MAML 2CO7B 3QUMA 2E8YA 1KULA 4KI5D 5FGCB 3SQOH 5JW4Q 2VDNL 3EO9H 4PPTA 1RUMH 3C6LB 4MWFB 3T0EC 3GUTA 3TT1L 2CK2A 2ILLA 4NP4L 4I2XE 3MQIA 1INDH 1SY6L 4U6XB 4M7LH 4LU5L 4BSJA 4QCIB 1E4XI 1ZMYA 2GI7A 4HAGA 4J3SA 4U1JB 4UAOB 1T7ZA 4PB0H 2OR9H 1F4WL 2YUVA 4G80A 2WV3A 2PXYA 3QUYA 3CFJA 4LASL 1GL4B 4K3JL 5IOPB 5AZEL 4ELKA 1BVLB 4JFFB 3H7BA 5CD3A 1M6OA 4YBQC 3G5VB 3VRIB 2HRPL 4TVPD 4X9GA 1CS6A 2XWTA 2E3VA 2P43B 2AJVL 3BGFB 1KJ2B 4PB9H 5B4MC 3O45B 3EYOA 5B38A 3CFKA 2MFNA 2DTSA 5HHOD 1WV7T 4MCYA 2J6EL 5FUZL 4NUGL 3U2SB 4QF1B 3O0RL 5JQHC 2AEQH 3MLXL 4XCEA 3IU3A 4ENED 5E2TL 3QUKB 3S5LG 3RWFB 1A6TA 1XAUA 1FJ1B 1E0OB 3HRZB 1EERB 3Q1SL 5BV7H 3HZYA 3VJ6A 2F8XC 3RY5A 12E8L 3RGVD 1MJUH 2YN5A 4KTDH 4H1LH 1B0RA 5FYKU 1P4LA 2JLLA 3VXMD 3WS6C 5EO0B 4LARL 2VLJE 4YK4C 5DVMA 3IDYB 1IC1A 1QEWA 5FM5O 2HMID 2H32H 1KLUB 1T1YB 5MHSD 2E7LA 3MRBB 5AZ2L 5BCAA 5K93A 3S5LB 2YKLH 5DQ9B 1S9KC 2VDNH 3EO9L 3V6ZA 3DO7B 5TF1H 2JB6B 3RNKA 4XPTL 4E41A 5FOBA 1ORQB 1JGDB 3I9GL 4FQ2H 5B8CA 5SWZE 4YNYA 1N8ZA 4GOSA 1AJ7H 3SE3A 2WBKA 1ODAA 2DQTH 2DTMH 4HV8B 5DZOA 3RVTD 4LSVL 1HH9B 3ZDXE 1HILB 2C1OB 3JXAA 5C0CE 1VFAA 1U0QA 3NACL 4I18A 3MUGB 1A1MA 4XP5H 3QIUB 1GCFA 3KPSA 5C0IA 2X4PA 5F7KC 4X98B 1ES0A 2HRLA 5C6WH 1LO4H 5E4IA 1BECA 4WWKD 5FDYA 1Q9WA 4WFEE 4R26L 1MSPA 1QVOA 1RZJH 3QWOB 2A2QT 2W59A 1FV1A 3D0VB 1PEZA 3VFTB 4NKDA 4G5ZH 4LCIH 2LVEA 5IVZB 1P9MA 5GGSA 3HMXH 2GUOB 4KHXL 3LKRA 4WFED 3T4YA 4BA8A 4X7TA 3X3GH 5B3JF 2BVQA 3U0PB 3SKOB 1H5BA 3SO3B 3GSQB 1SYVB 4GAJH 3O4LD 1S78D 1OGAA 4NRYA 1ZT1B 4GXVH 5MHSE 1JPGB 4P2QE 3V0WH 4NJAH 1F3JB 1D5XB 3WJJA 4JKWA 4CNIA 2Z8SA 4WWID 4E42B 2ADJA 3U2SA 3PP4H 3L5IA 5T5FH 2ITDA 2JCCE 3BO8A 2XFXA 1R3HB 1NGXA 2GQHA 4XGZA 5GJSH 2APBA 2DD8L 3F12B 4XAKE 4P4KD 1IM9B 3MV7D 4H26B 4GG6E 5J9PA 5GSVB 3QH3B 3S4SG 5IP4A 5IROA 3VWKB 3PDOB 3MLPA 4HIEA 1JCKA 2HH0H 3UTSB 2FR4A 2PYEA 4RQQA 3P0GB 5J1AB 1DQQA 5JLZA 1DBJH 4EZMA 3NN8A 5H2BB 1IMHC 1SM3H 3LD8C 3O9WB 4HJGA 4JRXD 4YHZL 2XFXB 1MFBH 2V5YA 4HPOH 1ZGLA 1KENL 4N1CA 1XGTA 4RGMB 1DVFB 1T89A 4DK6A 3LV3B 3ARSA 3AAZB 2NY0B 2KPNA 1IKFH 2HT2C 2JJTC 1JMXA 2L7JA 5FEBA 4HK3J 3T0XA 3B5GA 5F7DA 5KZCB 5DMKB 4RMVA 4KK6D 4ACPA 2UWEA 2A77L 3PDDA 1CVRA 5FUCC 5FO9A 4NT6B 4NZDA 15C8H 2IJ0C 3BDYL 5AWNH 4K94C 5F96L 1JGLL 3DUHA 4KK5D 2OMBA 5E9DA 1NPUA 1H3PL 1UKSA 2VLLA 2XKNB 4ODXB 4WUUA 3C5JB 3DARA 1FVEA 2D9CA 2VAAA 4P2RA 1OTUC 4UZGA 2R4RH 4HJJH 1YYLL 5MEPA 2K3TA 4BFIA 4Y2DD 1Q9WB 5GZND 1U2CA 3WFDH 4YDKL 1K4DB 3LEYH 1VACB 4K3DL 3TWCL 2ATPA 5DHYA 3UX9B 4JFPB 2AEPH 5A2JH 4R6UA 4MXVF 5D7JD 4Z7OE 3HC0B 2NXYB 1FVDB 1SBSL 4G5ZL 4MJ5A 3RGVB 3S3JA 1ADQA 5BOZG 1LO5A 3MRCA 2F58H 4ZSOB 4LSTH 1T2QL 4HKJB 1G7MB 1KB9J 3VFWA 1I75A 1MREH 5F9JA 1XH3B 1C7TA 1B0GA 2CGRH 5MENE 3HZKA 4GRLD 3C8DA 3DIFA 4U3XA 1CG9B 5IVXB 1H8OA 2HFEB 3X12B 5KG9A 2GW5A 1BFTA 1HNGA 1UYWL 3MRKB 2QADC 1R5VB 2LU4A 1HZHH 1GGIL 3IJYB 5EUOA 4G6FB 3ZDYE 4BSWA 4GS7C 4PTUA 4HCRH 1E6JL 4XCEB 4HKJA 4PJIE 2HVKB 5MERA 5E9DE 5HHMB 1FZOA 4H88L 3O9WA 4JFZH 4XNYH 3REVA 4MA3A 3X14A 2W1NA 3RZCB 1XGQA 2IC2A 4JFED 3IDMB 7CGTA 5I17B 1CI5A 3L3OB 1TVBA 4LSTL 1VFUA 4ZTPH 4G8GB 1W2KT 1D5IH 4QRRA 4O58L 2FIRT 2G9HA 5IJVA 5E2WH 4JHBA 2YEZA 2I24N 3QXUA 1V7MH 4NQTA 4JJHA 1BP3B 2VXQH 1CIUA 3OSKA 5FUZH 3RY6A 5BS0E 4YAQA 3BEVB 1HDMA 3LEYL 4JHZA 3SDAC 1RY7B 3QFJB 3IDMA 1ACZA 4M1CC 2Y25A 1OY3B 2JB5H 4PGEA 1WGOA 4HFWB 4AM0A 1I85A 5IB1A 1DCLA 5JOFA 1RUPL 1NMBL 1MAJA 3KYNA 1AHWA 4MSWB 3IJSB 1IEHA 4PLKD 1FAKT 1X4XA 3U0PA 1JPST 2EIZA 4PLJD 2R29L 5IFJB 3VXOB 1KIRB 4LSPH 2ZUYA 1T4KA 2UUDK 1WEJL 4HWZB 5IMOA 4PJXA 4Y1AA 3W9DB 1X6LA 3ULUC 4D0BB 1XGYH 3VW3H 2F54A 3LV3A 5KVFL 4GAYA 2DB8A 1QVOB 3QWOA 4JFEE 4R2GC 3VGAC 4LLDB 1MJ8L 1AGEB 4CAGA 5JOFB 2MWCA 1WC7A 3EYVA 4HQQH 1BZ7B 4KRLB 5DRWB 5F7FA 4JCMA 1OAQL 5BRZE 2NX5E 5EORH 5TDNA 4WGVB 3RVWC 1LK3H 5ICZB 4X6CB 5KSVA 2SEBA 4DVRL 1G7QA 5HPMB 3UDWA 1HQRB 3IXAA 4M1CD 2X4OA 3DI2B 1J1XH 5GIRA 2DQUL 5DO2C 5DZLA 2UYLB 3CXDL 2AVGA 2X09A 4MD5B 1A47A 1OF2B 5F96H 3SDCC 1NL0L 5DJ6A 2GSIB 3U4BL 2DMBA 1GGUA 1BIIA 1N6QL 4PGBB 1UM5H 3BO8B 2HTLC 3PGFH 3QPQC 1VCAA 1U36A 3RWEA 2M2DA 3VXMB 1QFWM 5IB3B 3LEVL 3MOBL 3FB7A 2DMCA 5IK3B 3ARDC 4F7EB 3AREC 4F8TA 5J3HC 1TTUA 2E6PA 4I3SH 3DBXB 5C86A 5EBGA 4NN7B 3VMPA 5E95B 5D5MA 1JK8B 3WBDA 1NCUA 3EUUA 4NGHH 4KK9C 3WXVL 3FO2A 4PY8J 4YDLB 2CKNA 2QEJA 2XIDA 1BVKA 5CJQH 4C57C 5L88H 2VL5B 4QT5B 4MB3A 5LGJB 5IVXA 4AQ1B 2H6PA 1R0AL 4MYWB 1DVFA 1XH3A 3NCCB 2AK1H 5L6YH 2BVPB 3JUYA 4IMLB 3W0WA 5IB2A 1Q0YL 5JUEL 1MCLA 4D0DA 3VFVB 4QHUA 5D1XB 2NY3D 1N5AA 4XVJL 4LLQB 1DN2A 5IVXE 1UADC 5JZ7C 5LCVL 1R5WB 4RGND 3PDOA 4FA8A 2VUYA 4EOWL 1MCRA 1A7QL 1Y18B 3V0WL 5GSVA 2RR3A 5KAQG 2ICWA 4ORGB 5C2BL 1CE6B 5TDOA 3TESA 1F6AA 2DWDB 1UWGL 2FHFA 3FB5B 4KVNH 1GRWA 5T1LD 1A4JB 1MWAH 5D72H 1K3IA 3OG6B 4M9PA 5D1QB 1L7IH 4PJ9A 5EOCH 4X6DE 1RZJL 2VISA 4JN2B 1KACB 1KELL 2DKSA 4OKDA 5B3JE 4DFIA 2KQMA 3NA9H 4OD3H 4YGAB 4GBXA 3QUML 1EBAA 1J0YA 3O2DA 4ZUWB 1G9NC 1P53A 1QSEA 3W39B 3LKNA 4C58B 5HGHA 3RFZC 4NT6A 4X9IA 1KPVA 3GO1L 1CVSC 4X7SH 1YEDA 1YJDC 2EIEA 2PYEE 3TFKC 2H26B 3GMPB 1CICD 1KJVA 1NUFA 2DQTL 2DTML 3ZDZF 4WWKC 2X2YA 1YN6A 5BRZA 3ROOA 1XIWC 4WDIA 3BIKB 4JKKA 2FX9L 4NNXA 4ETQB 5EULV 3G5VA 2FX8H 3VRIA 4AG4L 3RL1A 4LPXA 3IFPB 3IRPX 3CK0L 4RAVB 5IHLB 5FO7A 1MIEH 3QEHA 4KUZH 3PIQA 2GJ6A 2F8OA 4RMRA 4G8EB 2E5EA 1S78C 4G7VH 4OQ1A 2DF3A 1FZJB 1H0DB 3G5YB 3DMMB 1FNGB 3GHEL 5KZCD 5C71A 1DP0A 1WZ1H 1MCQA 5J6GB 3DJ9A 4PJFF 2V2TA 2W91A 5TDNB 2V9TA 3D85D 4ZOBA 1KCVL 1JP5A 4P2QA 4NO3B 3MV9A 4KRPD 3UBXB 4ETQA 3T77A 1ZLUH 2B1HH 3CFDA 1LP9B 1IRAY 2FX8L 1MNUH 4XC3L 4S1DC 1ERNA 1KPRB 4XNZC 3IFLH 43C9B 3K1KC 5F1IA 3WIHH 1JNLL 3GIVA 2EDKA 2AJVH 3C5ZA 1KBGL 35C8L 1AP2A 5I1KH 1WAAA 4ODUA 5CBEB 1PG7H 4DQOH 5AD0B 4HF5H 2NX5B 4JDVA 3DRTB 3ZKMD 1YNKH 2ZOLA 5GGRB 3ULVH 1F3DH 3D9AL 2HYMA 3NZ8A 4MJIE 2GFBB 4NHUB 5HDQH 1CDCA 3NIDE 1GZPA 5IW3A 5ILTH 1I8MA 5FDWA 3TV3L 3ZYZA 1KUMA 5EZIH 5JO5B 1NKOA 2ARJB 1RZ8B 4PS4H 1S7QB 2FJHB 1A7OH 1BVZA 1KEMH 2VR9A 2X4PB 5EU3A 3TBWA 4NZTL 3QIUA 4RWYH 1C16A 4I0PB 1IBGH 5IOPA 3HE6D 3GSOB 1FFOB 2E7CA 2G9HB 5IJVB 1A0QH 5C0DB 4K2UH 3D69B 2ZJSH 3RY4A 5CJ8A 2PTUA 4BQ9A 1NCCL 1TJGH 4YZFF 4N5UA 4OM1L 5DR5H 2ADIB 1QLFA 5KSBF 5ACMA 1HNFA 5GJTH 1A3RL 5CJ5A 2DAVA 4HFUL 1WICA 2BP3A 4FZ8L 2D7MA 3UEZA 3FFDB 4KROB 2XY1A 5FGBA 5HHMD 3MRMA 5TQ2L 5DQJB 2OXHA 4ODBD 2Y7QB 4Z76B 2G60H 1UM4H 1B0RB 1SEBB 4WU7B 5C6TH 4PRID 3ARTA 1X3DA 1J1OL 1BX2A 5CEZE 4HZLA 4JPVH 1AO7B 4OLEA 2FZ3B 4K71C 3QIBB 3F7YA 1EEZB 1ZS8B 5FOJA 1NBZA 1UXWA 4JY6A 1MFAH 2YD8A 1FP5A 2R15A 5GRJH 2Y07L 5B38B 3JWOL 1U92B 3MRNA 3QEQA 4C59B 5F9OL 3OJDA 3DURB 1P2CA 4DVBA 3U0WH 1YEFH 3N1GC 4WI2A 5T3ZL 2FH8A 4L8BB 1HOCA 1CR9L 2EDWA 1R3KB 5GIRB 2X1OA 1HQRA 3DNKA 3H6JA 3BE1H 4HAFA 4DZBB 3OKMB 1CXHA 1S7UA 1G7QB 4ELMA 5L2KE 4BUGA 3WDHA 1A4KB 2HFGH 1MLBA 5HHOB 25C8H 4JRWA 3MV11 4QHUB 4LPCA 1U3ZA 4GSDL 1MPAL 4CU8A 3RTQA 1EIBA 4HUNB 2FHBA 2X89A 4ZUUB 1RIVH 2IGFL 5AEAA 3FT2A 1MOEA 2F54B 4HGMA 3JV4A 4JJ5A 4KMTH 4YXLH 5JDJA 1KN2H 3A6CL 1JPSH 1FFRA 1QG3A 3V8CA 1U91A 3W81A 3VG9C 3KDMA 5EU7C 2EE9A 3M8OH 4ODTH 4YHKH 1JUFA 3SDAD 4F80A 3OR6A 1OP3K 1FH5H 1IGIL 2IANE 5TF0A 3ALXA 5C6PB 1UEYA 3CLFL 1E28B 1A14H 4HH9B 3VFNA 5C9JA 5CUSH 1AGBA 4KRPC 4R97C 4NO0B 1GXEA 4U33A 5F88B 2DRUA 2YRZA 2YEZB 1TJIL 1X7QA 3O8XD 1R3LB 3KWWA 5DRZA 1T0NB 4GRWE 1BWMA 1KG0B 1BFOB 3FN9A 2JIXA 4V1DA 2XWBB 5EU6D 3D18A 3BYYA 3GM8A 5HXMA 5FKAA 4L1DA 2APXA 2Q3ZA 4F7CB 4JREB 3UTPE 4N8VB 4LMQI 4ZPTA 3UZVB 5GZOD 2ADJB 3QEUA 4P49A 1AI1H 3ZO0A 1F3JA 5LQBH 2MTPA 3I6LD 3AFLA 3FKUS 1T03H 2DBJA 2BCKB 3QQ3A 3NACH 3MUHL 5ICYA 3TIDB 1JYWA 3PWJA 3ZHLA 3W39A 5IMOB 1DSFH 4HUWB 3QUXC 1UC6A 3MBXL 3WIHL 1QR1B 2MCPL 2Y7QA 4FN0A 1XF5A 1NGQH 3MO1A 3NCMA 4IEFB 2NXZD 4WWKA 5E56A 5CP7B 4KJPC 3ULUL 3GIZL 5FHAH 1MH5A 1Z2KA 2N7AA 3JTTB 4MJIA 2J4WH 4MAUL 2OL3A 3WD5L 1GVIA 4CJ0A 1MY7A 3MGOA 2XPGA 2KH2B 3S34L 1X4ZA 4IRJA 5D9SB 5JPMA 4XI5D 4O00A 1QRKA 4ZOEA 1DEEA 5C0NC 3T0EB 3VGHA 4N8CL 3FQXA 3WJLC 2VDQL 4F2MB 2NY6C 3JV6B 1LE9B 2FLBT 4YX2L 1S5HA 3DX7A 5C09D 1KLGA 1FL5A 3QDMB 4JKPH 1UZ6E 3G9VA 5IUSA 2A38A 4ZFFA 1GYAA 3A67L 5D5MF 2ZG1A 4X4ZA 1FC2D 3UCRA 2HT3D 3SDCA 1HWGB 1OHQA 4HS3A 4KRMB 3O6LL 4DN4H 4PLJC 1T22A 2J7LA 1KCLA 5DD1L 2BSSB 1B4JL 4CNIB 3P9MB 4G9FE 3TZVD 1JN6B 5EOTB 3K8LA 3QO0B 3H9YA 2OI9B 4LASH 1I8KB 1VERA 2E9IA 4U1LA 4PJGB 1EHXA 4S1SL 3VXUA 4LEOA 3RY6C 1TZHA 2N7BA 4W6WB 5TE7H 3TN0A 1EZVX 2ZPKL 4DEPC 2C26A 1LNUA 4PJ5D 2GK0B 2VZOA 5F97E 1EFQA 1F4YL 1F45A 4RBPK 1ORSB 3KPOA 1EH9A 4KRPB 5EO1B 1OWWA 5KAQF 3FQUA 3LPFA 2F9BT 4MQ7B 3VI3E 2WIMA 3UTOA 1WFOA 1U6AH 3EOBB 5IMKA 5HY9B 3KXFA 3L1OL 3GMOA 1IL1A 5FA3A 4U05A 5JNYA 4F9PA 3UYOD 1CFVH 4XVJH 4UINL 3G04B 1A6WH 1FDLL 4YNYB 3IS0X 4NNPH 4U6XA 1C16B 3Q5YA 1JGDA 1JV5B 2APTA 3GK8H 5BV7B 1DEDA 1MCBA 2CLZA 5TQ2H 2R4SH 1TJHL 2DD8H 3DROB 5GS0H 4GLRH 3EYQC 4CVUA 3I6KB 4CMHC 5KS9F 3PP3H 2DDQH 1F90L 5DVKA 1UQSA 3DRTA 4ZFZB 2IPTL 1YN7B 1AY1L 4PJ8D 2VLKA 4LSSH 4PRHB 1KNOA 2HMIC 1K8IA 4N0FA 5DK2B 2YC1A 3FOMA 4Z0BH 1A9EB 3O4LB 5E94A 2PR4L 4K8RH 2QHRL 4QRPA 3QUKA 3WHE0 2CJUH 3STLA 3MLZL 4ISVB 1JGUH 3R1GL 4PJBF 1W0VA 5HBBA 1WZKA 4PJHE 1UM5L 3D3VE 4YC2B 3U7YL 5E7FA 2HN7B 5TE7L 1BIIB 4MD5A 2FO4A 1II4E 2AJZA 1Q9OA 2PF6A 2ERJB 3EDKA 3RP1A 2YD3A 1KGCE 5F88A 1U58A 5K9QG 4IM8A 4Z9KB 3G6JF 4FOMA 5DD1H 1QBMH 1A21A 4NQVA 1R24B 3WLWC 5IGXH 1DQMH 4NC0B 3SE4C 4EBQH 1CLCA 4HDIB 3L3KB 3MGTB 4PP1C 4MJIB 2JB6A 2X70B 3HC3L 2C7UB 5I1DB 1RUAL 1ZLSH 4OSUL 4KQ4H 3RVUD 2NLJA 1F6LL 1NCTA 3D5OF 2A9ML 4IOIB 5GGUB 1MFCH 1TZIB 2XXCB 4HWBA 4J1UB 1KJVB 1DVFD 1FPTL 2ITCB 4F37K 3NTCH 1I1FB 1FO0H 2MHAA 3NABH 1RK0A 1A6PA 1HKFA 5C8JA 1QZ1A 1D5BB 2ICCA 4JJ5B 2ADGB 1C1EH 4EEEA 5BV7L 5I71B 3AB0B 1RUQH 1N7ML 4XCFL 1I9EA 1JN6A 5EOTA 4NKDB 2V9QA 2JB5L 2W0KA 3O3BB 1RZKH 1NGZB 5IBLD 3DSFL 2XKSA 4XRCA 3QFJA 4ODHH 4WY7H 3DETC 4LRNH 5TPWH 4LP5A 2B4CC 1IGCH 2YPLB 5IHUH 3RBSA 4MQSB 3WSQH 1LK2A 4JZOB 4LSQL 4ZAKB 2VH5H 4JAMA 3PABA 3S37H 1SBBA 3QDGB 4EIGB 2D4DA 5DURD 3V4VH 4XNMA 3AM8A 5J11B 2AJUL 3GMOB 3EDFA 4LCCC 4UIMA 1A6VH 4HIJB 3ULUD 3VI4F 4R3SA 4J23A 1TTFA 4HX1B 3K80A 2P5ED 3UROR 4XHJD 1INDL 1T04A 3KYKH 1RFDL 1N5YH 3F7RA 3CFCL 2J3SA 4LCWB 4M48H 1WCQA 1DLHB 4CBPA 1RK1A 3NPSC 1X4YA 4L8SB 3VD3A 1IEAA 1D5MA 1KIQA 3KDMB 4YFDB 1S9YB 1A3LL 4IMKC 3IT8D 1MCDA 1BQLH 1DSFL 4P0DA 1WIOA 4WW2A 4Y16C 2P42B 1A7QH 2WNGA 1FG2A 4C4KT 1LO0L 3MOAH 1SJHB 3VJ6B 4IS6A 4JQVC 2ENSA 1CXFA 4UV7L 4BZ1L 1MHPH 1HHGA 1A6TB 4F7TB 1WFUA 1QFWI 5CZKA 5DJXB 3SDDA 4OZIF 4JFHD 2WINA 2BSSA 5FYLE 5AYQA 3RZCD 1Q9LB 4QXGL 1RJZB 1OAUL 2QSCH 2R0LH 1PZUB 8FABA 1T2JA 3CJJA 1C5CL 3V4UL 3EO1B 3K1DA 4J8RA 1MFDH 5J13C 5JW4R 5E5MB 5EUKA 1QLRB 4HULB 3L3GB 2Z9TA 3T2PA 3VFPB 2X4SB 1KCUL 1MRCL 3BFOA 1JTPA 3OR7B 4I9WE 1IM9A 4NKOA 4G6KL 2VLRB 4LSUH 3VFSB 1M4KA 4H1LA 4XP6L 4UAOC 4IRJD 4JQIH 2GTWA 5DEZA 4N1EA 5EU6A 1U8QA 4HWBH 5I2IB 2A0LD 6CGTA 5ECJE 1U3HB 3EYVB 1KJ3H 3ARUA 5E1AA 2QADD 2ZCHH 4CVXA 2GAZB 3O9WD 4UIKL 4ODTL 5FUCE 1ZVSA 3MLTB 5I73C 3WNMA 3BPOB 1NCDH 5C0JB 2MSPA 4PR5A 5DMIH 3KPTA 3QJHB 4J7RA 5GGSB 2YPLE 1CT8B 1HHIA 5HI4D 1IGFL 3KG5A 4LGRB 1CG9A 4YHML 4WV1A 4CMHB 1EPFA 4XPAH 2DS4A 4JFDE 4NC1E 4ZFOA 4P23A 1OQXA 2DQGL 5JORA 4FNLL 4XT1C 1OAYL 4WIQA 3VFUB 4B41A 4O2EA 4L4VA 5JR1H 3AMLA 4OF5A 1KB5L 1WZLA 1IQWL 4FG6D 1VFAB 1T7XA 3UTTB 1G6RA 4A2LA 1P9MC 4EUPA 3DPBA 5DRZB 1I4FA 4UB0L 3EOBA 4QTIH 4M6ML 4MAYB 3ILPB 1MCWW 4P3WA 5BZDB 2OZ4H 4PG9B 5DF0A 5F8QC 4NNXB 1UKQA 2HN7A 1EHLH 4MA7H 1ZHKB 3IAGC 3H9ZA 5GSRA 4AMKL 2WUCH 4RRPA 5HYSG 1GZPB 5TFSL 1NEZB 1NMAL 2Y1VA 3HI5H 4TSAH 3ALWA 2H26A 1AD0B 2PXYC 2ZOLB 2JIXD 4Y16A 3HAEB 5DRXB 5E4EC 1J1OH 5C92A 3LIZL 4LEOB 1ZT1A 5J12C 1HYSD 5IMMB 1WTLA 1J86A 4PV9A 4RNRB 4PJFE 1KNOB 2J5LC 1LHZA 4OUUB 5DQDH 4G3YL 1K6QH 3P11L 3BKJL 4JCLA 4C55A 2FJGA 5B39B 1SY6A 4K9EL 5DMKA 1X5JA 5ILTL 3L95A 4XZUA 2CR3A 1D5MB 1KIQB 1K8DA 1T5WB 2R2HB 1RUKH 1INQB 5D1QA 5BMFH 2NY1D 4G6FD 4GQ9H 4Y5YA 4X4ME 4OGAC 3WD5H 2QBWA 4XP9H 1JRHI 4U1IB 5CSZB 3MA9L 5C0IB 4HCRL 1UACL 3KPRB 5I15L 4UTBL 1A22B 2P8MA 2UV3A 2WBJB 2D9QB 4RQQB 3RUGE 1HILA 1N3NB 5DT1L 5D2LE 5IB5B 3QPQD 4HV8A 4OCSL 5FA4B 1NAKL 4JREC 2QQLL 3B6SA 4LCCB 1MRDL 3MBXH 1TNMA 3VXNB 3CZFB 3EOYG 3B8SA 3UPCA 3LRSA 2DQJH 5IBUG 3MRQA 4Z78A 1Q72H 1VGEL 4R4FL 4U1KB 2D7PA 3CPLB 4YBHA 4BH7A 1EJOL 4YIQA 2AJUH 4P5TB 3MO1B 2X41A 4LHUD 2G75A 4HF5L 5GGRA 2V5MA 3GNMH 4NUJB 3C6SB 2J1KA 1IEBA 5E9DB 2R39A 1Y6KR 4GKZB 4Z7UE 1FFNA 5IV2A 5MP6H 4ERSH 3OL2A 3SPVA 3HS0B 1YPZF 2MQCA 4TSCH 4JHWH 5HI5C 5HI3C 1CFNA 4GBXB 2KDGA 3HHRB 1GJIA 5K9QI 2NW2B 5J11C 4P23C 4UV4L 5HHOE 1U8IA 4D94A 3FO9B 4XC3H 43C9A 1G7HB 4XWGH 3TN0C 1DDHA 2R1WA 5E8EA 3VFOB 5H35B 2Q8AH 4L4VD 3OTTA 4MD0B 3FONB 3O2WL 5BXFA 2V2XB 1TPXC 4OV5B 4H0HB 3B9VA 3SDDD 2P4AB 4RIRA 4LLUB 4KMQA 1R3LA 2C9AA 1NCNA 4JY5L 3GJEA 2OR9L 4XVTH 4KKCD 2F15A 4ZMAT 5CJOH 2NXYC 4KDTC 1N4XL 2VLKE 1T6WA 4I2XB 5E2UH 3H0TA 5BS0D 4KJWC 2BSRB 2EEDA 3RHWK 3KJ6H 1IQDB 3MRPB 3VFVA 4JO3L 4PJEF 2QR0A 5C08B 4PRPA 3FONA 5DT1H 1ZANH 2VJXA 3WS3A 4S0TD 5JO5A 3JZ7A 1TXKA 5D4QA 4WJ5A 3G6JB 1AKJB 4K23H 2JELH 5CINH 3O3EB 1D5XA 2P7TB 5A2KH 2IBBA 5I8EB 2CXGA 3EO0B 1JGEB 3IKKA 4YHLL 1EGJH 5GRUL 2HFGL 4XP9L 3FCTA 3QCTL 1VDGA 1YMMD 2IPKB 3CMOH 4KK5C 4PD4J 5DFVD 4Y19E 4HIHB 3HUJA 4JPKL 4M00A 3KYNB 1L7TL 3QNZA 3HG1B 1NEUA 1G7JB 3BD4A 1S9WB 2V7HB 3MLSH 3PWVB 4IDJL 3V5HA 3SCMD 1AKJA 1JZ8A 3FQNA 4JDTH 4LSRL 4IRSA 2OJEA 4XNXH 2VO5A 3HB3D 1LGVA 5KSAB 3CSYB 3UO1L 1BHGA 4U7SA 1HXYA 4EI6B 3JUZA 2CIIA 4MZ2A 1P7QA 4HJ0C 3Q6GL 2CLVB 5FYJL 5DI8B 1JV5A 2EXYD 3BEWB 4LDEB 3PL6C 3S7GA 2VDRL 2X1WL 4P2QD 4OLUH 1K4CA 3MXVH 4P2OC 3UYPA 4HC1L 3STBA 1HH6A 2DDQL 2WBJA 4JO2H 4M4RA 1GPOH 5IB4A 4JDTL 2E7LC 3ESVF 3QEQB 5JUEH 2C3GA 4QHNA 1MJJA 2WW8A 2OK0H 4G42B 1T21A 2QSCL 1R3IH 1L7TH 3QULA 4GG6B 1HQ4A 1NL0H 3QUYC 3L3HB 2IMMA 4N9GA 4OF3A 1C12A 3OKDB 2EE6A 2XQBL 4M1DH 3QNXB 1U8NA 4OT1H 5T33L 1KYOK 4Z95H 3ZT6A 3RIAF 1X5ZA 2CSPA 5EC1B 1W72A 3WXVH 1ZTXL 2XZCL 4KWUA 2X9YA 4PR5B 5FHBL 2R8SH 3SO3C 2NXZB 1UM6H 3S3SA 4WW1A 1CD0A 4MJ4A 3QXDA 2KZ1B 3GMRB 4XPTH 3GSUA 5TF1L 3OKYA 4K3GA 1CICB 4Z7WB 3V7MA 5GS2D 2JJUA 3BP5A 3TV3H 4OZFG 3TBTA 3T0ED 3QDMA 2Z31B 4PRBA 3CXHJ 3ULVC 4RGNE 4RFNC 2NY2C 1I9IL 3U9UB 4N5ED 5GRYA 5JIKA 5GRWA 4PJDE 4U2ZA 1P7QD 3IAQA 3QDMD 4C56B 3ARBB 5FYKD 5IVOA 3UTTA 1PYWB 3KHQA 4PJ7B 1RMFL 3V6FB 3H9SD 3CSYA 3BP5B 3KPPB 4LIQH 4JFXA 4OGYL 2BOBB 3JBG7 2OJEB 4IIQC 1PKQA 1YEJH 2YRLA 5D93C 3TZVB 3GKWL 2DLFL 1CGYA 5IQ9B 4G8FA 4QXTB 1A6UL 3NCJH 4KKLC 5LBSL 2B1HL 5ITFA 2VDQH 4YFLI 5D7SH 4K7PL 2P48B 1WEJH 4U6HA 5TH2B 1MCIA 1ZLVK 3QUZC 4NRZB 5D6CB 5F72S 4WEMB 3VGFA 4QOKB 3BMVA 3P2TA 4J4PA 3H2WA 2J4WL 2YA0A 4HXAH 5AUMB 3NTCL 2FX7H 1FIGH 5GGVY 2XN9B 3FFDA 1M71A 4XAWH 5A3IC 5EBWA 5TJWK 5DEGB 2XRAL 3G08B 3WIIH 5F89A 5D2LF 4NQSA 2X05A 2BHZA 5D7IF 5GGVL 4ZPVB 1M7IA 3X11A 4E5XB 1JFQL 2BNUB 3V9FA 2CKBL 2H2SC 4XWOD 5D2LB 3MC0A 4OIAA 4UIMB 4PJ5A 1RURH 2DYPB 4NKQB 1AKJD 4RX4A 2A6IB 2B5IC 1HE7A 4NM8H 2NY5C 5A16B 3CVIH 3CUPB 4QRPD 3TC9A 4LLYA 3SBWC 3QWRD 4Z8FL 5DC9B 1KTLA 4RGOH 4FQXB 1DR9A 2X4OB 4HBQA 3CU7A 5DI8A 4KH2A 3WFCH 3GFUA 1DQLL 1AI1L 4JM2D 4AZ8A 5CFHA 1EMTH 3N1FC 3BWUC 1NCWH 3M1BB 4K07A 5GGTA 2VLME 5GHWH 1KELH 3ARED 3F7VB 3ARFB 4AEIH 2BNUA 3U7YH 4AH2A 5EIVA 3F65A 4W6YB 5I1GL 5LXGL 4CW1B 4X6EA 2OJZH 3GSRA 1MCPH 1G1YA 1HYSC 1JGUL 1CYGA 4LLDA 2VZSA 2CIKA 2AQ1A 4ODHL 4AK1A 3RRQA 3IJYA 3LKNB 4KKBC 1FFNB 4Z0BL 3TA3A 2ZNXA 1IC7H 4XCNB 3KXFE 4Z0XA 2CQVA 2WP3O 3EJZC 3WNKA 5ACLA 1FGNL 4PJAA 1C8PA 4X5XA 5TE4L 3RZCC 3QAZB 3T4AA 2V7NA 4ZOAA 3ARGB 2UZYB 1QTYT 3LZFH 3MLUH 1D6VL 3KXFD 5LG1A 4O5LH 4LLMB 2HP4A 1Z0MA 1R6VA 4PUBH 3QG6A 2AKRB 3VRLF 4S1QL 5JXED 2VC2L 4LL9A 3IRZA 1F3DJ 1RJLB 3HZMB 3QFDB 4MQXC 3VFSA 3A6CH 2EC8A 1FZJA 3S36H 2GKIA 4LDOB 2AEPL 3FRPG 5T3ZD 1M7DB 3UTQA 5D1ZC 3MUJA 3GSWA 4YDIH 1K85A 4AJ0A 5C0RL 2EECA 1ORQA 3QCUL 4L8BA 5AYUH 2PETA 1S3KH 3MNVA 5FB8A 4KKAD 3WLBB 4GLRI 1HXYB 5EO1A 2IF7A 4MJ6A 1VEPA 3T65A 4YDIL 4KV5F 3RKDC 2FYYA 4QT5A 5MI0B 3T1FA 3MV8B 4L3AA 1DUYB 1I1YB 5IVXF 4WRLA 5DJXA 2R1YB 4JPWL 4HS8H 5AD0A 4ZFOL 1DE4B 1QUNA 1P84K 5T3XD 3MLRL 3JWNC 4OGXH 5D7LE 4ZUWA 5ALBL 3FCTB 5EBMB 3QHZL 4LDLB 1MHHB 1FGVH 3O3DB 2AGJH 3ARBD 4Y2DA 4P2OA 3V5DB 5ITBL 4W70A 1KB5A 3LCYA 5BJTA 3MRRB 5T3XE 4JFQA 2FYYB 3ZE0F 1JWSA 2VE6B 1FNSL 4FQJL 1IAKA 1C12B 1W0WA 4LKXB 2CRYA 5KVGL 4PRPE 4MS8D 2VDLH 5D2NE 2IPTH 2UVEA 4OTXH 1YC7A 4MMZC 3QDGD 3MGTA 3BJLA 1CE6A 5LVEA 4HIJA 3HMWL 4GRMB 4PRDB 3H3BC 5C6TL 1U8OA 3B6SB 5FCUH 2IAMD 3UC0H 5KJRL 4P57B 4R0LB 1ZVYA 2D0FA 4MA1C 3HUJF 2I9LA 4U1JA 5E8OB 4RFEA 4Y5VC 4G7YH 4R26H 3I85A 1MCJA 4ALAH 3PV6B 3RNKB 5J3HD 1ONQA 3QCVH 4LCWD 1ZEAL 2VL4A 1HCVA 4FMKA 3RTQD 5EOCJ 5CEZL 2YRPA 4QRQA 3V7AG 1KTRL 1MAKA 2BNQD 4NM4L 2ZUQC 3HG1E 4LCYB 1CXEA 1IZKA 2QV2A 1I3RA 4I77H 5F9DC 3QUZB 1QRNB 3TO2B 4MX7A 1UJ3B 5CBEA 2V5TA 3BIAX 4XPGH 1AP2B 5D2NC 4KQ3L 1KXTB 2AW2A 1KSRA 4DK3A 4LCIL 4PRNA 4BQ8A 4F58L 5K59E 3AS2A 1NGWA 4PJCA 4CW1A 1NFDE 3VFTA 5LWYH 1A6VL 4J1UA 4LCYA 3ULVL 3QEQD 4P2RD 4HKZA 4QRUA 4J3TA 5HGAB 1ZLVH 2GHWB 1EEQA 3B9DA 4WUUD 4O51A 2WUBH 3VMOA 1TENA 3QXVA 4PG9A 5I75C 1B2WH 2X7LB 2FSEA 4I5BA <