1IL1A

Crystal structure of g3-519, an anti-hiv monoclonal antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
b'QLQQSGAELVRSGASVKLSCATSDFNIKDYYIHWVRQRPEQGLEWIGWLDPENGDTESAPKFQGKATMTADTSSNTAYLQLSSLTSEASAVYYCNAISTTRDYYALDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody G3-519 (heavy chain)
publication title Structure of an anti-HIV monoclonal Fab antibody fragment specific to a gp120 C-4 region peptide.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2001-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1il1A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1il1A02
1OPGL 2YRPA 2XWJA 5F71A 3MSPA 4GQ9L 2XQBH 3MYJB 4ZOEA 4M93B 4TSAL 1CZ8L 3BQUC 3WS6C 5B38A 4OZGA 3SN6N 4OZIE 5HGBA 1OL0A 3ZL4H 1LP9F 1Z0NA 3CCHA 3DGCR 3S34L 1BVLB 1T66C 1JBJA 4LCIH 2VDNL 3K2UL 4MA8H 15C8H 4DZBA 3KS0H 1YEGH 3JWOL 4FTVB 5JQ6L 3VFNA 1SJHA 5KS9F 1CDUA 1HHGB 3DGGA 3E2HB 3QWRA 5CINL 5GSRB 3V0AC 4JO3L 4IBLT 4QXWA 3I2CL 5CJQH 5KTEL 1GIGL 4RGNE 1HHHB 5EU7E 4DOHB 3HG1E 4JDTH 1O7VA 5JPMA 3QIWB 2XG4A 4JM2C 4X4MA 3LIZH 1N3NA 5J12C 2OL3L 4ZUUB 5DFWH 4XVJL 3EBAA 3BESR 4UNTA 1A1MB 4XB8A 4YJZL 4MNQA 2Y25A 5DJAB 1CFVH 2JTDA 3B9KD 3D2UA 1IAMA 1FIGH 5GZND 3S5LG 2B4CH 2EZ0D 4MS8C 3DMMD 4ALAH 3VFRA 4HIEB 4JKKA 1DQDH 4G6MH 1X44A 1XGYL 2YD5A 3DX8B 4K9EL 4FP8H 4Y7MA 1F3JB 3G5XB 4PBWD 4GBXB 5J3HD 1QQDA 3CLEH 1E28B 3DETD 1OGAA 2ATKB 3QRGH 1FLRH 5EWIL 2JJSC 2W65A 2Z91B 1T1XA 3GHBL 1DBJL 1JGVL 4YGVB 2EEBA 5DHYB 3AROA 3NCFB 1KCSH 4CU6A 1I7TB 1I1CA 1CXKA 3I85A 4XHJD 3CH1B 5CMAB 4YNYA 4AIXA 4LL9A 5CILL 1F6AB 3B6SB 4PIRF 4XI5C 3BEVA 5ESQB 4X6FB 4XB7A 3PDDA 4NGHH 2EC9T 1CT8A 1K3IA 2Y7QB 1FRGL 3HN3A 2MFNA 2XQYG 4LHUA 3BKYH 2HMID 1HILB 1TZHB 4LLMB 2BSSB 5FUCE 3VD7A 5CZVH 5C0BE 3GO1L 2B20A 5FDWA 4DCQB 2H8PA 5AUMA 5T3XD 3PUCA 3QDMA 4LVNC 3S97C 2ZG2A 1L9NA 2YUVA 1MVUB 3S36L 1ZS8A 5BRZD 4PJXE 2ICWI 5C0AB 4FMKA 4DWHA 3T4YA 1MWAH 3QG7H 3H3BC 2VLRE 3GRWA 2FL5B 2F54E 4GW4A 3SGKC 5ADOL 1IZKA 2MWCA 2EDEA 1MHPH 1NGYB 1T04A 5GS0D 4NQXA 4LNRB 1KPUB 5CGYC 3DVGA 4ODVL 4EJ1C 4NNPH 5IMKB 4ZAKB 4PGEA 3Q6GL 4AM0B 3CDCA 1EO8H 1KEGH 1MH5A 3LOWA 3HNSL 4UU9A 4H8WH 3DV4A 5DK3A 1CGSL 3QPQC 4EUPG 5GJSL 4LPUA 3REWB 5KSAC 4R4BA 3KJ6L 1VEMA 4NCDA 1S3KH 5F1OB 5EU5B 3UTSD 4OTXL 1P9MC 4K8RC 4UQ3B 5IB1A 3A67L 2P8PA 2DF3A 2BK8A 3CFBA 5TE6L 1CVRA 4LNVA 3W9DB 5F7EL 5CD5D 3TIDA 4JFFB 1CDGA 5DTFB 4ZTPL 4HC1L 4F7EB 3LVEA 3MXVH 1H0DB 5EG6C 4RFOL 4M43H 5SWQB 4LSTH 2E27L 2BNRD 3QDJD 4LPYA 3U2SA 1RZKL 5I1IH 1OTSD 5GRVK 4HGWA 3D39D 1CFTB 1IEAA 1HZHH 1HEZB 4YHKL 3PWPD 4KGLA 1HCVA 4W70A 1HXYB 3MCG1 4P5TD 3RUGE 2BHUA 2YRLA 3THMH 4Z7UE 1I3VA 1Q9WA 4O51B 4LPXA 2NW3B 1RHHB 1XR9A 3D1MC 1QEWB 1NSNL 5D7JD 1RUAL 3HC4L 1I1FA 4I9WE 4RIRB 1YN6A 3FHQA 4LSDA 2W92A 4LARH 1AGDB 3CVHA 4AYFA 4CVWA 5DQJB 4JFEE 5J9PA 2P24A 1Y6NR 2DD8L 4OLEA 3C6LD 3MUY1 3QIUC 4DUVA 3WHE0 1OB1B 2QR0A 2HFEA 3TH2T 4KKAD 3U4BL 3V7AE 5IKCB 3HNVH 5JOEA 3GI8L 1FE8H 5IV2B 4AIZA 4EDWH 5DWUH 5ANME 4PP1D 2CRYA 5BQ7B 1ZGLB 1MQKL 3MACH 4FQQA 5B39A 3NN8B 3BUYA 3LKSB 1A7RL 2B1AH 4C54A 4Z6AT 3ULVE 1X4ZA 3H6JA 1J1XL 4NCC2 2WBJC 3WN5B 2B1HL 1BD2E 1CGWA 3IFLL 5KSBB 1H3UA 4TTGA 4PJ5D 5JPNA 5DD5L 3FONA 4QRTA 4I4WB 1JF1A 3TIEA 1Z9LA 3SOBH 5C08D 2FB4L 1A14H 3VCLA 1MIMH 3FZUD 5FGBA 4X7CC 3LQAH 4LKXA 1B6UA 4MX7A 4PJIB 1M7XA 2J4WH 4D3CH 3MNWA 4XVSL 4RGNC 5D72H 4RMSA 2C1PA 3V0WH 3VXOB 5FM8A 3CD4A 1BVZA 3GRWH 4R7DA 2VC2L 4P57B 2WINB 1PYWA 1YMMD 4YDJA 5CP3A 1QD0A 1WV7T 4MQXC 5GGTA 1RQ5A 1YNTA 5EPMA 4U1JA 1ZLWH 5D8JH 1T7XA 5GRVL 5B3NA 1NCCL 2W0LA 4X6CF 1G7IA 4PG2C 4JR9H 3UZQA 3QFDB 4NPYB 1HHKA 2YK1H 1VFOA 1WT5A 4JZJC 3TPUA 3IDNB 2BVTA 1RMFL 5B4MC 4KI5E 4QHKI 2AK1H 4ESKA 5GS1B 1TZGL 2H1PH 3T0EA 1B0GA 3U7AA 5E00A 3HAEA 1U6AL 5TQ2L 1HWHB 4U1NB 4XCEA 2FIKA 4P2OD 4H20H 5B8CB 3BH9B 4Z9KB 4UAOB 1I7UB 3V79C 4XWOD 4HUWA 5HDOA 3T2OA 5DK0B 3OJDA 3KYNA 5C86A 5DFVD 4JG1L 5EOTB 1KNOB 5GHWL 4U1KA 1N5YH 1RZFH 4F57H 4PBVC 4M61B 5DEFA 3F62A 3Q48A 3OKOB 1R6VA 2OJZL 3A6CH 1S7QA 3L1OL 4Q6YA 4LLAA 4AY0A 2FEEL 4X6DB 3DRTA 5FUOH 4HPYH 3NCJH 1NFIB 5JHDA 3SDCC 4YHIA 1PEWA 5T1DH 3EYFB 3Q5OA 2HKHH 3E1F1 1OAUL 5IK3B 2CKBB 2JJTA 5IVOA 5DJ8B 4H88L 1CE1L 2BNQB 3P0VH 4IEFB 2QSCL 1CLZL 1FV1B 3DBXB 3CVHH 4OZ4B 3GBMH 3BYTA 2AEWA 5DVLA 1NLBL 3GBNH 5C0RL 4I48A 2W0KA 4NRXA 3SE8L 4JFPB 4MCZA 1SYVA 1ZVSA 2CQVA 1AE6L 1UKTA 3BPNB 2Z31B 1C08A 5J11B 4DVRH 4EQ3A 1B0RB 5INDA 4LCYB 1JWUB 4ZS6D 3OKKA 4HKXB 2OK0H 4ODUA 3I75A 2WV3A 4XPFH 4OLXH 2FLRT 3DMMA 5I6XB 1ZEAH 3FOLB 5AG9A 4KK5D 3BKCH 4G6FB 1JPSL 4MJIB 1KENH 3ZE2E 1IGYB 4MD4A 5FYJU 3DROB 1F2XK 3CFJA 4GRLB 3TO4C 1KSRA 1KJMB 1JGEB 4RFNB 3EDJA 5HY9B 2NY0C 3MRPA 5DD1H 1I8KB 1E4XI 2A73A 5A16A 2O5YH 3OXSB 4PJBB 4I0PA 4WI2A 3TH4T 5EUOF 4Q9QL 2VSDA 3VGDA 4H0GA 1SJEA 2CRMA 2VLKD 1HHJA 5J1SC 5C7XH 5KS9A 4W6YB 5I15L 1NFKA 3G6JB 3MA7A 4DEPB 3VWJB 1WAAF 1ZKAA 4FZ8H 4HUMB 1JHKL 3ZT5A 1CD1B 2MPAL 5CP3H 3C2AH 4DW2L 5GGTH 4ZPTA 3PHOA 1ZT1B 4J4PD 4L29A 5AWNH 4OFKA 5JIKA 1TVDA 5E99H 3K2MC 5IW3A 2Y5EA 2BY3A 3ULSA 1IC5H 1AR1D 2P5EA 1N6VA 3U7YL 2Q76B 4UTBH 2CO7B 2G60L 3GMLA 4FXKB 5EORH 5DK2B 3SDXB 1U93A 5BRZA 1QSZA 2DIJA 4KRPD 3T0WA 3FQXB 3KPLA 2UYLA 3STZA 4WO4B 1WCBB 3HAEH 3GUTB 4Q0XH 3DI2B 2H26A 3VGAB 5DZNA 4TOYH 3WFZA 4IS6A 3H9SA 4NKMA 1T5WB 4TUKH 3WEXA 2ZSVA 2XXMB 2H2PD 5TDPB 2FLBT 3ULUH 1A1OB 1JGUH 2NX5D 3W39B 3D85B 4G42B 4O2FA 3ULVC 3P73A 5T1LD 3MRGB 4ZUSB 3JV6A 3U0PB 4M6OL 4XCCL 1QR1B 3HNTH 1BQUA 3CMOH 3WIIL 1VDGA 3OTTA 5CUSL 4KKCC 1JN6B 5MP6L 3DURB 3KJ4C 3G9AB 3MLYH 1K4DA 1DVFC 3QUZC 4OF0A 4LASH 1CK0L 4WW1B 5FFLA 3X11B 5L8LB 4PTUA 3CFDB 4M3KB 4HK3J 4F8TA 1EBAA 2FX7H 4M8QA 1V7NL 2IH3A 2XFXA 3ES6B 3QXAB 1XF1A 5C0DB 3VG9B 3AS1A 1M6OB 1JFQH 3EHBD 4JFDD 4DKFL 4U0RB 4K23H 5HYJA 4QTHB 5C0AE 2EKSB 4NNYA 4NKIL 4UIKH 3U0WH 1R0AL 1OP3K 3B43A 2OP4H 5JIPA 4ZQKA 4EZMA 1EK3A 5FV1L 4J3SA 3D39A 3VI3F 2NY4C 3CUPB 4TRPH 5E1AB 3VXMA 1S5IH 1G6RB 2VZVA 2VZ3A 1ZT7A 5HHNB 5IM7B 3LS5H 4HSQA 3R8BB 3U4EB 3T3MF 3CFIC 1YNLH 1AD0B 4KI5C 2ZOKB 4EIZC 2FYYB 4OAWB 3QZWA 4E0RB 1B88A 3QQ4A 3C60D 4ZXBA 2E7MA 1NJ9B 3PL6C 1U2HA 3HI5L 3KPMB 4YO0A 3WFBL 5FCSH 3A6BL 3MPCA 4BH8B 4IDLA 5D1XA 2EIZB 2HJFA 1KTRL 5TF0A 2FIRT 4P3CL 3T0BA 4GAYB 5IT2L 3MLSH 3EOAA 3P0YL 1AP2B 1TCRB 4CU8A 4LVHC 3LKOA 1CTOA 4JFFE 3C8KB 3PHQA 3KHOA 2XKNB 4I0CC 2K3TA 1IEBB 2GK2A 2NY2C 1FVDB 3HR5B 1XIWD 4LCWD 2CLZB 2EXYC 1CD9B 2D7TH 4EN3A 1CLCA 1JZ4A 5D7IA 3ZSSA 4U1MB 2Y4SA 2YD8A 1UYWH 4NN6B 5I30H 2QQKH 1UEMA 2NYYD 4JQXA 3VXSD 5I8KL 1DN0A 2WANA 1Q9KA 3TZVD 3L6FB 4TVPH 4KV5F 3CLFL 4ZYKB 2EDDA 2YSSA 4HEPG 5JIHA 5KG9B 1A6WL 3RZCA 1IGCL 4XCNA 5E8DH 5SWSD 5IF0A 3KPPA 4Z7VA 5E94A 4QYOB 2BOBB 4NOBA 3RAJH 2AJYL 1QKZH 5ETUA 5BS0E 4NHCL 4E9LA 1ZLSL 4WUKH 4PY8I 2R29H 3FRPA 2PO6C 1KEML 3AM8A 2YXMA 1I8LC 4FABH 4M7JH 4OZHF 4BKLB 5DRZB 1Q0XH 1BGXL 3CSPA 3TCLB 3LCYA 1OHQA 1XF5B 5JNYA 4N0CD 1XR8A 5MENB 4X98A 3SCMB 3F5WA 5IGXL 3G9VA 4J1UA 1FVEA 3T04D 3E2HC 5AZEL 1D7FA 5ISZD 2HFTA 4MA7H 4RA0C 2D0FA 4ONHB 2X1QA 3QIWC 2K9UA 1G7JB 5JA8B 3RVVD 5GZOC 4WHCA 3W0WD 2UZIL 3BW9B 1G1YA 4WDIA 43C9B 1T80A 2JB6A 4FQIH 1FHGA 4L4TA 3WLBA 3RA7L 3G04A 1MWAB 5GQBA 4NN5C 4F7MB 4LDEB 3S3PA 5IB5B 1UH4A 3MYZA 3MV11 4TN9A 2VITB 4I3GA 3MRNB 1GAFL 4ONFH 1QRKA 2DQDH 3T3PE 2YPVL 25C8H 3FN9A 4MXQD 1IBGH 4NO3A 1T21A 1U8PA 5E8OB 1LO2H 1FQ9C 5EU6A 1VKXA 3X12B 3K4DA 3ZHKA 5HI4D 3VD5A 4FS0A 2ICWA 2VDOH 1K8IB 2VDML 3GSQA 3EO0A 1EUTA 4I13B 5DJCB 2DIBA 4GW1B 1GGIH 2M8XA 2WP3T 1IAII 1QFUH 5HGBB 2D7PA 1P6FA 3O0RL 3KR3L 1MFAH 2Y5TA 1UWEL 4QLRA 2EECA 3WE6B 4JFXB 3WHXA 2IQ9H 3K80A 2NY6C 5HHQA 3VFNB 5FHAL 3SDDC 1IAIM 1YEDB 3DGGB 1X5AA 1Q8MA 1SBSL 3BGFB 3N1QC 5I76A 2CJUL 5DA0B 4O2CA 1I3GH 3NZ8B 4LIQE 4OLWH 1MCJA 4R4FL 3ZE1F 2IBBA 3HCVB 1UB5B 3AC0A 3AB0B 1QFWH 4NQCB 1NGWA 5ENWB 4LMQI 1NGQL 1TETH 3GMNA 4KQ3H 4Y4HD 4M5ZH 1UWXH 3D2UB 5AYUH 1A6AA 4P2CG 2ITCA 3BN9C 5DJDA 3H0TA 4Y16D 1MLBA 3EOTL 3K3QA 3RNQA 3MRIA 4G8FA 3MJ7A 4BH7A 2ZUQC 2BRRH 3UO1L 3MOQA 2G5BB 1UWGL 4UTAH 3PQYB 1EHAA 3H7LA 2W9DH 1F97A 1ZA3A 5H2BA 4ELME 4YXLH 1XF3A 1YDPA 3TN0D 5EOQH 4D8PA 3MV8D 4HFWA 1MFEH 2QADB 3V9FA 3VFOB 3EJZD 2AGJL 4IHOA 3ROLA 1W8OA 5EB9A 2A0LC 5LG1A 1LO4L 3GDBA 1JYXA 4POZD 5HVGB 1KTLA 1QRND 4YNYB 3HFML 3RJDA 3WKML 3MCLL 1GZPA 3VDCA 2GHWB 4WU5B 4L3ED 4HK0A 2V7HA 3MQIA 2R2HB 1OLLA 5ICYA 4KTDL 3RWCA 1CF8H 4PJBE 4XVTH 4LSUH 2IMMA 5T1MB 4QRSA 3E8UL 4LSVH 2AJXH 4NT6B 1G9MC 4ZO8A 4XX1G 5FDWB 5BOPA 1W72A 3EGSA 4NNXB 1T2QH 5C07E 4HG4J 1U3ZA 2AEQL 2K7PA 1R5WB 1MELA 1BOYA 1A7PL 3OBAA 2CIKB 5DI8A 4PUBH 2IBZX 1RK0A 3L7FB 4YHNA 1TJHL 1KN2H 3T4YB 2A6JB 4XCFL 5C0FA 3BT2H 4G3YH 4DAGL 4YQXL 4RMTA 4JLRA 4GW4B 2NXYD 4XH2B 1ZVYA 3L7EA 1OTUD 4PRNB 5F70A 4M5YL 1T04B 3NMEA 2D7QA 3O3DA 1AGCA 4F33A 3SDXE 3DVGB 1CDHA 1D9KD 2R69L 3U83A 4JFDA 3NIDF 2AP2A 1MH5B 1E4KA 5GRUL 1TNNA 5IMMB 3O2VH 3FB8B 2LAAA 4P5MA 4R4BB 1JZ6A 5JMRA 1OD7A 3QFJA 4UILH 1UH2A 4X6BB 2UWEE 1JPFA 1YEKL 3HTLX 3VFVA 3V4VL 4I77H 5IB1B 1FLTX 4KDTC 3ZTJH 1MRDL 3DI3B 3QNZA 1H3PL 1U36A 3ET9F 1YEEH 2A6IA 1FC1A 2X44D 3HRZA 3RGVB 1FIEA 3KHQA 5GRYA 1AO7E 1WGOA 5D2LE 2HRPH 3U2SB 2C5DC 4MAUL 1R24A 3D6GA 4WFHD 2CUIA 2IAMA 4HGWB 4LPCA 3QEQD 2VZSA 5I1AA 3VGBA 2V2XA 3PWLA 3BO8B 1ADQL 5D7LA 5A40E 2DTSA 4PJAA 4Y0GA 5DLMH 4KTEH 3I50H 2V9RA 3IS1X 3N1FC 4LSPL 1WBZA 4JY6A 1UADC 5E2VH 1ZLUH 3KPOA 4QHUA 1I1FB 1BBJA 1RULH 1YN6B 4OF3A 4OLYH 4JM2F 1FG2A 3ARVA 3TJEL 1RUPL 2IWGA 2J8UF 3EAKA 3OSKA 3CVHB 5HVHB 5FDYA 1KULA 5J9PB 4AG4L 3RZWA 2CDEB 2QR0B 1LE9A 3P9LB 1JYWA 3BRGC 2D7MA 4OF5A 1D6EA 3CH8A 1OSPH 3EYUH 5I75B 1WBYA 4JPIA 5FYKE 32C2A 2YXFA 4FQQB 4QRPA 2Z93B 3ISWA 3BQUD 3NACH 2Q7NA 5ABDE 3P4NA 3GMOB 4ENEC 1NGXA 2E7LC 1T66D 1FO0B 3LN4A 5JPNB 4MCYA 1JHTA 3FONB 4QRTB 2VXQL 3SJVE 5C1MB 1W72H 2NNAB 4JQIL 3BE1H 3FL7A 2WK2A 2ZUVA 3VGHA 5I18H 1T7WA 2IADB 1AXSB 4HBCL 4MX7B 2YA0A 4J12A 1KIUA 3MNWB 1ZANH 4LSQL 3OB0H 4Q9BA 2C1PB 4X8XA 4J3UA 1S9YA 1F3DJ 3S9DB 1D5BA 4JM2D 3SQOH 1L6XA 4KK6C 3OZ9H 4NM8H 1I7RB 2H2SC 1WTGT 5CEZD 4X5XB 2X1XR 1T4KA 1F02I 4C83B 3WBDA 1YNTB 5EPMB 1H3VA 1MSPA 2KH2B 4PJFA 3ZT7A 3MRBB 4H5SA 4AEFA 4NFCA 1P5UA 3HE6C 4MS8D 5IROA 4YXHL 4HJ0C 3WFHB 1TCMA 3BUTA 4XNYL 1G7IB 1YEJH 2PR4L 2UY6A 5LGKA 5D1ZB 5IW6A 1J8KA 1GSMA 4YDKH 5HYQB 1P53A 2DQTH 3BPNC 4NQVA 4WW2C 4W81A 3HS0A 5KZCD 4TQEL 1RV6X 1LDSA 2BSED 3DARA 5T1KB 3ARFA 4P59H 3HAEB 2CRZA 2MCPH 1TJGL 1N5AA 2QQNL 4EI5B 5I6XC 4JZNA 1VPOL 2WUBH 5HTSA 1MIEH 2BFVH 1X5GA 2IH1A 4XI5D 1LGVA 3KYNB 1RZ7H 3IJYA 4X7TA 1D5ZA 1G7LA 2C7UA 3IDMB 4RFNC 4ZFZA 3T1FB 1FPTH 3D18B 5DEFB 3FQRA 4M7LL 4MSWB 2QSVA 3VRIB 1S7QB 2ADGA 3PNWA 1MAJA 3R1GL 1A9BB 1Q9LA 3QO0B 2IMNA 5H94A 5I71C 3LMJH 3TBTB 4M1GH 3RP1A 3BP7A 3DRTB 5LXGH 2X4OA 4YEEA 4YXKL 4KROC 4J2XA 4JKMA 1QFHA 4DEPC 1QR4A 3GEWB 1ZA6B 2YC1B 2B5IB 4UB0H 3WNNA 4NZUL 2PETA 2YD9A 4HWNA 3VXUE 1CDIA 2JK5A 1IQDA 3UC0H 1TENA 3BGMA 5FUZH 1T83A 3AFLA 4JDZA 3FFDA 5F6HI 1FYTE 3G6DH 5CGYD 3S88L 1R3KB 4WFGD 5D70L 2JELL 2GJJA 2LE9A 3ZHDA 4EKXA 1JZ5A 2ESVA 5I19L 4JB9H 3VD9A 1LHZA 4KKBC 3ARPA 5J1TC 2ZSWA 3CZJA 2AJZA 1XGQA 4Q2ZA 1QLFA 2EE2A 3B9KB 1NEZG 3KPRE 2YWYA 4Y4FC 1MCWM 2V5SA 4S1RH 3QPQD 4HDIB 2X4QA 3O2WH 5KSAD 3DMMB 4G8GD 1JK8B 2AV7B 1I9RH 4HHAB 4X7DC 4IRSA 3IDGA 4K8RD 2CLRB 2X70B 1B90A 3N1MC 2VZOA 4Q9CA 5IBLC 4I18C 4OZGE 5F3BB 4I5BA 4NWUL 1DBAL 2BHYA 3HZMA 3BHBB 1GOGA 5A16B 4I0PB 4OJFH 1PY9A 1SJEB 3BRFA 4FOMA 4UDTB 1HHJB 1JYNA 3BSZL 5A2FA 1I1YB 3I6LE 4YFLF 4TNWK 5KS9B 4OZIF 4RDQG 1OAZH 1FL3A 3DTXA 5J8OA 5L6YL 3P0GB 1OLZA 2YMXH 1U8NA 5GISL 1E4XH 4X4ME 2ADFL 3PHOB 3V95A 4L29B 4ZS7H 1HHIA 4LOUC 1I7ZA 1AFVH 4AENA 4Y5YB 4U0RC 3ULSB 3OKDA 4MNQE 2XV6B 5EFIA 1JZ8A 4JDVA 1EO5A 2XN9D 2KL6A 4F9PA 4K3JH 5HHVL 4XNQB 3B2UC 3HC0A 1QBML 4APQA 1U93B 3C5JA 5BRZB 4N0YH 4PB9H 5HD8C 3KPLB 2D31A 4HFUL 3QIUD 4G80A 3DRQB 2J3SA 2NR6C 5I1LA 2H26B 3IFOB 1OGAE 4QXTA 5IHZB 1EHLH 3WFEH 5F7DB 5TDNA 4XAKD 3H9SB 2CKNA 4LEOA 1G9NC 1A3QA 2RBLA 3WEXB 4D9RE 4JO2L 4NUJA 2V5YA 4JGMA 2HG5B 5DS8B 4O2FB 2WBJD 4WV1A 1N7MH 1H5BA 3WSQH 5CJBA 2PW2B 3U79A 1KACB 2L0DA 5IJVA 1I8IB 1CFQA 3QUKB 4Z8FL 5KOVC 4DN4H 1F8TH 1PKQA 4XPHH 3VFPB 3KNBA 1K4DB 5DC9B 3U9UA 1RZIA 5L2JA 2FEEI 2MSPA 1RIUH 4PTUB 1FFRA 1EO7A 2FJGA 5HXMA 3KYKH 2XA8L 4RGND 2EDNA 2IH3B 3WNKA 3QDME 3HG1D 5I1KL 4Y2OA 4NO0D 4P23A 4OFDA 3GKZA 4JJ5A 3U0TA 3L5WA 1R5VA 3F58H 1CIDA 5L0QC 3MO1A 1ZHBA 3RVTC 2BNRB 1B4JL 3QDJB 3HKFA 4MQXD 2COQA 4NNYB 4U31A 2R1YA 5DURD 3D39B 3F65A 5CIPB 3VXMB 1IFHH 3C5ZA 4HWBL 3ILPA 4PG9A 3PWPB 1S9XA 3QNXA 1NCDH 1ZT7B 3U46A 5EC2A 5F1SA 4PJXF 3VE0B 3FQUB 4P5TB 4U6XA 1KIQA 2B4CC 5B4MD 3UBXI 4F7PA 2D03L 4PGBA 3QZWB 1OY3B 3N0PB 2EXWC 3QQ4B 5BV7H 1YYMH 1FZMB 5IBTH 5E5MA 4C55A 1ZT4B 2V5MA 5D1XB 2HJFB 3REVA 3C6LB 3C09B 5F9OL 3LKRA 4R4ND 5I1GL 3EOAB 4NZJA 1O5DT 3E6FB 3MLVH 5KVEH 3LKOB 4XMPH 4DGIL 2LTQB 4AEIL 3B9DA 2NY5H 3PHQB 5DR5L 1IGMH 5LBSL 5C0BD 3WUWA 3BQUA 2QQLL 5FGCE 1QNZL 1RUKL 2GITB 3HMWH 3V6ZA 2NTFB 1EMTL 3SDCD 1D3CA 5ID1A 4BFEA 4PJ5B 2IPTL 3NIFE 2Y06H 5D7IB 5GXBB 2PTTA 5CBAA 3ARDC 1AI1L 1B4RA 3VWKC 2W91A 3PIQB 5F6IB 5C08B 5F9AC 5C6WH 5FA4A 1QBAA 5CSZA 1DN0B 2VLRD 4MQTB 4LU5L 2YSSB 5FO9B 3RVUC 4KHXH 1MAML 4XBPB 3RZCB 4AL8H 5J7CC 4XCNB 3EO1A 3K8KA 3E3QC 3L3DB 3RUGF 4WHDA 1M7DA 4A2LA 4Z7UF 1YMMB 1HH9A 4Z7VB 5E94B 1NAKH 4FFWC 5DRWB 4Z0BL 1FYHB 5K9KA 4DZ8A 2WWKT 2DBLH 3SE4A 5IEHA 1UJ3C 2O61A 5ETUB 3AREC 3IB4A 2MQ3A 1H15A 2APVA 1OAXH 1UCBL 1T7ZA 1WEJH 3BZDA 5GSVA 4UV7L 2HN7A 3TO4D 3OKYA 1UCTA 4F3FA 2VDPH 2NY0D 3NCMA 4XP5H 5ILTH 4HIXH 2QL1A 5EO1A 2HA1A 5JA9A 1MCPH 5C6TH 3ZZ1A 5JNYB 3IXAA 1FL5A 3ILQC 1R3HA 1XR8B 3RNKA 4M1CC 4WEBH 3G6AA 3PP4L 5ERWB 3ULVF 3S5LA 3F5WB 4P4KA 5C0EA 4J1UB 1FVEB 2R0KL 4FNLL 2H32B 4M7KL 5IQ7L 4OGYL 1PGRB 4KHTH 3CVIL 4GUPA 1WTLA 5JZ7C 3UZVB 5ALCH 4AH2A 3RHWK 3CX5J 1FAIL 4PS4H 4L8CA 4KDWA 3WS3A 2OLDA 5J6GA 4WDIB 5A43C 5CAYB 4C57C 2JB6B 2DQEH 5T3ZD 5L7XH 4HIIA 4ETQB 3NAAH 3O4LD 3G04B 3F7RA 5T5NF 4I9WD 3H9HA 1ES0A 1PVHA 1SEBA 5I1EH 4ODXB 1KJ2L 4ZOAA 4L8SB 3C9NB 4TULL 4U6VL 4NO3B 1T21B 1U8PB 5EU6B 3T0EE 3K8LA 4NZDA 3QB7C 3TCXA 1TZIA 1AGEA 4PV9A 3EO0B 4UT7L 2XRAL 2QADC 3KLSA 1WIUA 4L4VA 4WU7B 4YHOH 2BNUA 5DEZA 2DS4A 1BZ9B 4R96B 1I8MA 4BFBD 3MC0A 3NCBB 4QXUL 1DUZB 1DL7H 1NMAH 4KI5F 3ULVD 5B21A 3WD5L 4UUJB 3OKMA 4XHQA 2NY3C 3VXPA 4N9GA 3ULUE 5MEQB 1BD2D 4UT9L 4EBQL 4JFOA 4KKCD 1S7SA 3G5VB 3LH2L 1S9VB 3TYGH 5E2TL 1MQ8A 2UV3A 4I3SH 1DVFD 3QUZD 4IDJH 1UA6H 1KJ3H 4KVNH 2AKRA 3P40A 2KQMA 4PLNC 1IAIH 5I76B 1OARL 2DM7A 4O2CB 5IR1B 5JHDE 1E6OH 5K9JL 4HQQL 5DQDL 3U1SH 1ACYH 3LQAC 1F3RB 3KYOA 4G6AC 5EBWA 4YE4L 2VLKB 4JPWL 1UACL 4EUPA 4E41A 3GMNB 1R3JA 2WBWB 2FD6H 3EYSL 2RFXA 3CX5K 2NY4D 3H0TB 1MLBB 3RIAK 3RNQB 5ADPH 3QPXL 2P5WA 3L95A 5DVOA 4FQLL 1AJ7H 4BH7B 5CZXC 2KBGA 4GAJH 3WMSA 3V4UL 2OMBA 2OQJA 4RGOL 1KG0B 4XAWH 1IGJA 5JOPD 5H2BB 1DEEA 3P30H 4WUUA 1EUUA 1NAMA 4KI5D 4QNPE 4D8PB 2GY7B 3ARYA 3DSFH 2OL3A 3IJHA 4YHYB 1EV2E 2AXFA 2AJVH 2R4SH 1H8OA 3PL6D 4IHOB 3ROLB 2G75A 1N4XL 3QQ9C 4PJDA 1KTLB 1U8OA 4DUWA 1RAMA 1OP5K 4CMHC 1GZPB 5CGMA 4MDJA 4FFYH 4PTTA 1LE5B 2APWA 3FT4A 5E4IA 4BZ1L 5ICYB 3RWCB 5T5NG 3UDWA 5GRXG 5K9QG 4RBPH 1NBVH 4NN7B 1BP3B 2NY2D 2YUZA 5IQ9B 3SKJL 5I66A 2EXYD 5KS9E 3LS4L 2WBJA 3EGSB 5MHSD 5LAXA 4IRZL 2EYRA 4ZMAT 5EZOL 5ACLA 1OWRM 3T09A 3WXVL 5DJ0A 4H0IA 4F2MB 4FQ1H 4JPVL 2BXZA 3PJSA 2OJEA 2AQ2A 2R0LH 2XI9A 4YHPA 3X3GH 1N0XL 3CDYA 5EZJA 5C0FB 1CDCA 3NZHL 3TBWB 4JLRB 1RFDH 2E9IA 1RUQH 2P5EE 1XCQB 3DVNB 5GPRA 4RGMB 2GAZB 3O3DB 4G9DA 1AGCB 3QCVL 4F33B 4JPKL 4TVPE 4U6HA 3EFFA 5BRZE 3HI6L 4JFDB 3UTPE 1B2WL 4PGCA 1KLFA 1JP5A 3MRMB 5EULV 1IC4H 4HKBA 4JG0L 2BP3A 4RAUA 3CC5A 2EYSA 2F53A 2GI7A 1JPST 1X9QA 1UM4L 1U58A 2DMCA 3NFSH 4KMTH 3H9SE 1Q72L 3PGCA 4ZFFA 2VN4A 4PRID 4C4KT 4JCLA 1UFUA 5GJTL 5CJOL 2DLIA 2PO6D 5EBMA 4G9FA 5ICXA 1JPFB 5KANG 1BOGB 1VCAA 4JKWA 3VFVB 3GHEH 4DQOL 2I07A 1E4JA 3O81A 1UXWA 2P43B 3C60B 3QAZB 4G7VL 4K8RH 4HZLA 1OPGH 3ESUF 5J06A 1RU9L 3FAXA 1R24B 4XNMA 2EDRA 3OAYH 3MV01 2IAMB 5FGBC 4TSAH 1CZ8H 3DOSA 2V2XB 4TYUA 1NCNA 3P9MB 5D7LB 2V2TA 1A2YA 4PJAB 3QIWD 3J8F7 4EUPH 1IMHC 1SEQH 3HMXL 5GZOD 4RZCB 1KTDA 2VDNH 3K2UH 4JFYB 4K7FA 4JY6B 5HYJE 3GNML 3JWOH 5KN5B 1P1ZA 5JMOC 3ABZA 5JQ6H 4LCWB 1HDMA 2R23A 4MB5A 3KPOB 2YD7A 5CINH 2APBA 3D39E 3VXME 5KTEH 1GIGH 7FABH 5SX4I 1QSVA 1NAMH 4Q58C 1KIRA 3SGEI 3VXSB 3VMPA 1GGCL 1JGDA 1WT5C 2ENSA 2OL3H 3OR6A 1LE9B 3TZVB 3T0EC 1WBYB 3H9ZA 5LGHL 4FQCL 1IVLA 5F9JA 4QRPB 4H26B 2DJ4A 3OHXA 4XMKL 5DEGA 4X83A 5CLTA 3U36A 1V05A 2GJZA 1Y0LA 3FO1B 1S78C 1XGYH 4JRYD 3P4NB 4K9EH 1BFVL 2DI9A 3QWOA 1NMCC 2I26N 2HFFA 1A7NL 3ULUC 1MFCL 2B2XL 3LN4B 1M71A 3RVWC 4AK1A 1JHTB 5EWIH 1HK6A 3U4AA 2Y36L 5MEPB 2WW8A 3QULB 4WHTB 2NY6D 3BJLA 3PG2A 3GHBH 3SDDD 5A2JH 1DBJH 1CXEA 2BCKA 1XCTB 1HH6A 2RIKA 4WCYL 2APTA 43CAA 1FZOB 5CILH 3K1KC 5BVJA 5DMKB 3IDJB 4ISVA 3SGJA 2VIRA 5D7IE 5SX5K 1D5BB 3HPLB 1DBBL 2I5YL 2B5IC 2M1KA 3L5IA 2BY0A 4K3GA 1T4KB 5C0AD 1A0QH 3AUVA 1NBYA 1K5NA 3M8OH 5BZWA 3BOVA 3D5OF 3T1WA 1H9VA 1U8HB 3GO1H 5ISZB 5FXCH 3BN9D 3IXTA 1J7VR 4UBDC 3KXFA 1RVFL 1F11A 3MOBL 4OM0L 5D5MA 5E9DA 1UH3A 4ERSL 3TBYB 3EYVB 2BOCA 5IW6B 2VXSL 2FX8L 2IALB 1M1SA 4OF8A 3S36H 3W0WB 2DB8A 3IJSA 4ZUWA 1WISA 4Z7VE 3TBVA 4O00A 1BJ1J 3ARFB 3O4LA 5DUPL 5I1DA 3SDAA 1INDL 3MZTA 3O6LL 5KVFL 1D5XA 4PFEA 5ADOH 4I2XA 5IVNA 4JZNB 2A0LD 4MXWH 2WIIA 4OCWL 5I1JL 4FQHA 3VG0L 4W4OA 3LZFH 2E6PA 4ODVH 3IJYB 4X7TB 3LRSA 1D5ZB 4KUZL 3Q6GH 4U7MA 1YUHB 1CQYA 1E4WL 5IVXA 4GMTL 1X5YA 3HNSH 2ADGB 3PNWB 4YPGB 4I0PC 4O2EA 4ZTOL 1Q9OA 3RL1A 5GJSH 5H94B 5CZKA 4JREC 3KJ6H 4OV5A 3IU3A 2ITDB 2Z92A 3BP7B 2Y23A 3IVKB 3LHPL 1MCSA 4OTXH 1OAQL 4QRUB 2D7NA 4AT6A 4MQ7B 4V1DA 3IFPB 3A67H 1JYVA 2C1OB 1M05A 3IDYC 5F7EH 1DVFA 3QUZA 2CUMA 1A6UL 3FMGL 3ZKSD 3FT3B 3V5KA 4RFOH 4XPBL 4L4TE 4JDZB 2K7QA 1S7VA 2OSLA 4KQ4L 3CPLA 4NKQB 4Y89A 5E8EA 4L4JA 4G5ZL 2ESVB 3P4LA 4ZG1A 4RMRA 3C08L 8FABA 1MHEA 3PGDA 2AJZB 1XGQB 4RAVA 5EU6E 1QLFB 1KB9J 4GJTB 3MMEA 1EFXD 1NSNH 1U8QA 4CVXA 4Y16B 1T3FA 4LSSL 5BS0D 1RUAH 3HC4H 2ZJSL 5CWSB 4P46A 2WQRA 3T3PF 1K8DA 3IDGB 5KBNC 3TBSA 4DKAA 3O3EA 4JY4A 1OF2A 4MA3A 4RX4A 5HDQL 4RWHA 2YZ8A 2W0FB 4CVUA 2DD8H 3WDIA 2A9ML 1DQML 2YOCA 1MHHA 3TN0B 4WY7H 3MV8B 3QH3A 3U4BH 2ADIA 4JHZA 3UBXA 2HKFL 3GI8H 3PL6A 2GSGA 1N8ZA 4J3OC 3B3IA 4Z77A 4L9LA 1VADA 4UOW1 3TA3A 5IMOA 1FL3B 3WV0A 3LN5A 3DTXB 3KPTA 4L3EB 1VSCA 1J1XH 3IGAA 5SWZA 4BUHA 2B1HH 1OAYL 4QRQA 1L7TH 2CKBL 3MV7A 4PRBA 1HHIB 2VLKE 5DD5H 1I7ZB 5E8NA 4AENB 4ZPVB 3OKDB 4QCIB 1TPXB 1GPOL 2P48B 1XZ0B 3F7PC 3F7QA 1G1CA 5EFIB 2FB4H 4JDVB 1EZVX 1U8KA 1UT9A 2WZPD 4HV8B 4APQB 1GRWA 4MLSA 5CJXA 3FO9B 4XVSH 5HHME 5T3ZH 4Y5XA 5H35A 2D31B 2Q7YA 3FT2B 3K8MA 5F7HA 3KS0J 5C3TA 5C0NC 1F45A 4UOJA 5I1LB 2NXYB 3SKNA 4O5LL 3FN0L 4ZD3L 5TDNB 2X89A 2VDLL 2VABA 4LEOB 1CLYL 4DGVL 4X5WA 1D9KB 1NCCH 1P4LA 5TPWL 4ZXBC 3MRJB 4WW2F 4MJ6B 2EDXA 4NUJB 1KB9K 5HPMA 4QO1A 2VWEE 4K7PX 5CEYA 4WV1B 4ELMF 3BD3A 5D1XC 2UUDK 1H5BB 4ENED 1RMFH 4X8JA 5I74B 1AQDB 1FFQA 4LVOC 4UNUA 1TZGH 1N59B 3VXQA 5IJVB 4X5LA 3RY4A 1U6AH 4PRIA 4V2BA 4TVSa 2LTQC 3KNBB 4R6UA 1DLFL 5L2JB 3JWNC 4PJEF 1ZAGA 1C5CL 3NCCB 3QXUA 2E8ZA 3MUGB 4U1SA 2D2OA 1OM3L 5B3JF 4EN3C 4GKNA 4KK6D 3U0TB 3L5WB 2H2SD 3VFMA 1WITA 1ZHBB 4IMLA 5LCVL 2CRIA 4JQXC 3L1OH 4E5XA 5F6IC 3MRCA 3U9PL 3RWGA 2R1YB 4X9IA 1IRAY 3QEQB 1ZHNB 3HE6D 3GMQB 2IG2L 4HJ0D 3ILPB 4PG9B 3QNXB 3U46B 2CDFA 3RZCC 1CE6A 4JFDE 2PYEA 1IM9D 4U6XB 1KIQB 1SYSA 1OAUH 2GTWB 2ZCHL 1IKNA 1A8JH 2NXZC 1J8HA 1EDQA 4H88H 1CE1H 4OCMC 1CIUA 2QSCH 3KPSA 1T20B 1V3MA 3TNMB 1NLBH 1T0NA 1JZ2A 5E5MB 3QFJE 4OKVB 4PRAA 4G6FD 3SE8H 5C70A 3REVB 5E0QA 3WNPA 5GRZA 4M9PA 1MCKA 1AE6H 3AM8C 4OI8A 1S7TA 2HVJA 1I85A 1OAKL 3IYLW 1FC2D 2P47B 2XZCL 1A1NA 5HSFA 1UZ6E 3ARTA 4N8VA 2UWEF 4PJ8A 4HUVA 1MJUL 3TWCL 1ZHLA 3WUWB 3BQUB 3QA3A 2GK0A 5KSVA 3JUZA 3V6ZB 1JPSH 3LV3B 3P4OA 4JRYA 2X05A 2R0ZH 2O5ZL 4KROD 4FFZH 4JRWA 5C07D 5ID1B 4OGXL 1NC2A 5D7LE 4PJAE 5CBAB 1WZ1H 4NQEA 4X4ZA 2DRUA 5D2LF 4NO2A 1A64A 4HX1A 4Q9QH 1CFNA 1P4IH 5FA4B 4HS8L 4M6NH 3WNOA 4OD3L 4QY8B 5FO8B 5E4EB 2AJ3B 5I0DA 5E5UB 3HI1B 1G6RL 1KLUB 4HGKC 5I15H 5DD0L 3KYAA 1MCEA 4HAFA 3RTQA 5J12B 1M7DB 1JHKH 4KKBD 1N6QH 1IAOB 3BKJH 2BHZA 4DW2H 3MREA 1HH9B 1EA9C 1A3RH 2EYTA 2ZUUA 3DHJA 4DZ8B 2ZUWA 4Y4FD 5IEHB 2O61B 4HIHA 3ARGA 5IFJA 1H3WM 4PY7A 1LDPL 1A4JA 3KPQB 3U7YH 2G60H 4QRPE 4ZOBA 5M7QA 1MPAL 4F15B 4YWGL 4F3FB 1UKSA 3FQNB 3MRHA 4ODTL 5IBLD 5KZCB 1RPQA 1WWBX 2W0PA 1FP5A 3QJHA 1BWMA 4MNGA 3BPCB 5JUEL 4PGZA 2FHFA 4GLRH 4HZAA 4WEMB 1FL5B 3IFNH 1R3HB 3DXAA 2JJUA 3RNKB 1DLHA 1QO3B 1IGFH 1P7KA 5I16A 4P3DA 1AO7D 1YEGL 2MHAA 3O3BB 4P4KB 5C0EB 6FABL 3NH7L 1A4KA 4GT7A 2I25N 1KYOJ 4MYWB 4GUPB 1HNGA 2NLJA 4LPWA 4EQ2A 4PV8A 4M6OH 2HH0L 4WFEE 3RPIA 4AH2B 2O93L 3OF6D 4TTDC 3QDAA 4O02L 3WIIH 5JLZB 5DJ6A 5CUSH 4LOUD 5LGJA 5MP6H 5I2IA 1U92B 1TITA 1UM6H 1G7PA 3O41A 4HIIB 4PJFE 1URLA 4XNUH 4LVNB 3FO2A 1CFVL 3B2UD 5DF0A 2CDGA 1KT2B 4CNIA 1ES0B 2VYRE 2B4CL 5HD8D 2B39A 1TXKA 4L8BB 4GKSA 1HQRA 2NR6D 1I9EA 3QXDA 4P5KA 1G6VK 2FJHB 2IPUK 4EI6B 1R0AH 4HWEL 4PV9B 2H41A 4JCMA 4YHYC 3JVGA 5FYKD 4JVWA 2BNUB 5F7FA 4U1HB 4Y5VA 1G7QA 1T7YA 1U3YA 3OKMB 1JGLH 2ZG3A 2VWEC 4NO5A 5TDOB 3VXPB 3KLDA 4G6KL 5E1HB 3I6GB 2VDQH 2GTZA 4JFOB 1CXIA 3T4AB 2XXCB 1INEL 5DRXB 4NGHL 5KSAB 4G8GB 5C8JA 3SJVD 5C6PB 2BVQA 4JN1H 5MEOA 3QCTL 5HBBA 2AKRB 1NCWH 4F7TA 3HI5H 4HIJA 3W2DL 3WFBH 5FOJA 3GSXA 3A6BH 35C8L 4U2YA 1DBMH 2DQFA 3WL9A 2PNDA 3GJFB 5T5FH 3IT8D 2V5RA 5IT2H 4OZFA 3P0YH 2VTFA 5EOCH 5J13B 3OMZA 3RVTD 1KYOK 2FECL 5D7KE 2Y9RT 4J3WA 4E41B 1R3JB 1QA9B 2WLZA 3OQ3B 1PFCA 4Y4KC 5FO7B 4RWYL 5GGUA 2RFXB 1U0QA 1TVHA 2Y07H 3S4SA 2XWBA 3BAEL 4RGMC 3TP4A 5HYFA 2ESVE 1WC7A 1ED3B 4F80A 5DD3H 1DEEB 4WUUB 1NAMB 5I8KH 1G7HA 4H25B 4OIIH 2D4FA 2EEDA 1E4KC 4NM4L 4F7CA 1KEGL 2EXWD 5D1QA 2YHGA 2OL3B 2XN9B 3V6OA 5MERA 3IJHB 2AXFB 4H8WL 4FQXA 4FFVC 1A6WH 2G75B 3S35L 4PJDB 5FM5M 1IGCH 1REIA 2XWTA 1MCOL 1IC7L 2ZPKL 1S3KL 4LCUA 4MDJB 4PTTB 1RZJL 2ATPA 3AU1A 4EEEA 1A6ZB 5EC1A 1OP3H 2AJYH 3PWVA 3KVQA 2QQQA 1NQBA 1ZLSH 3HZKB 4PR5A 3DIFB 4P3WA 4OZGF 1S9WB 2WBJB 4G43A 4OZIB 3O8XA 1IEHA 2E7LA 2IAMC 3PHSA 4CVZA 5K9QI 3GB7A 5FHBL 1BGXH 3ARDD 5D9SB 3VWKD 1OP9A 1JUFA 3PJSB 3ZE1E 4PD4J 3ZSTA 4IOFC 1CFBA 1AD9A 5IW1A 3FQTB 4UOW0 3ME0A 3O2DL 4HJGB 5EZJB 3VXUD 1J9CT 1GH7A 2GIYA 3LEVH 3IDIB 1J87A 1YY8B 5DRNA 1GOFA 3ARZA 4HXBL 3D25B 5F88A 2AQ1A 5IGXH 1ONQB 1RJYA 4RGNB 2KZ1B 3RVUD 1FYTD 1NCAL 4NO0B 1MFBL 3UTZA 2Q6WA 1T2JA 1IT9H 5FYLL 3V6FA 4Z78A 1CFSA 2ICCA 3HLAA 4ELKA 1A22B 4GMSL 4PGCB 2W60A 4FFWD 5ID0A 3VFWA 5F93C 5IWLA 2EYSB 1OTTC 2E7HA 3I02B 5AYQA 2PTVA 5DURB 1T1WA 1FJ1A 3KPRD 3ARED 4M62L 4MZ3A 1MHCA 3LB6C 5J1AA 3WIFA 2FBOJ 4Z7QF 4QXGL 3W81A 4K94L 3RA7H 4QRRA 1G0YR 3PGCB 1LK3L 1ND0A 5DWUL 5ACMA 4G9FB 5E24E 4PJCA 1TVBB 1IM9A 3MACL 2MKWA 3I84A 2V6HA 5FB8A 2YPVH 2B1AL 1K4CB 2CXGA 3IF1B 2RJMA 4OCSH 5GGRY 4K7PY 3RKPA 5F1IB 4X0KA 1T1ZB 1UJTA 2W9LA 1F58H 1UXWB 2CLVA 1QSFD 3ILQD 1PKQE 2GEEA 3JBG7 4M1CD 1K9TA 1W0VB 2VDMH 1U95B 4HZLB 5KANI 5JO5A 4S11A 1HOCA 2UVEA 3I6LD 2ED9A 4W6XB 4HK3N 4JANB 3QWRD 2FJFB 3KYMA 2IPKA 4PJEA 4OZFH 5JZ7D 4ZUVA 3F7VA 1JWMA 1KN4L 1KFAL 2V2TB 1X4XA 1A2YB 3O0RH 4D3CL 1RJZA 3KR3H 3WNMA 2H6PA 4K71C 4K7FB 2DM3A 3IETB 3QDHA 1P1ZB 2MMXA 4ZUTA 3GRWL 1L0XA 5C0BB 4Z95L 3ROOB 4ZSOA 4MNQD 4WFHE 4HMCA 4OKDA 2AJSL 3SDCB 4PD4K 3QDGA 2PTUA 1SBSH 2CMRL 2CJUH 5IROC 3RI5F 4CDHA 5I8OL 1J0YA 4R4FH 2AVGA 4LKCA 3F12A 1JGDB 4Z5RA 2AV1A 2KKQA 1ADQA 1OVZA 5D7SH 2R2BB 1OGAD 1NGQH 3ARFC 4KI1A 1PJ9A 1WUNT 2QADD 2IPUG 1BZ7A 3BPOC 5BZDB 1PG7X 3PV7A 4OFYD 3OHXB 3QQNA 3IRPX 4XC3L 5DEGB 4P2QA 4D9RD 2GJZB 5AEAA 1Y0LB 5SX4H 1NC4A 3SGEH 3QG6A 3UO1H 1X7QA 2NY3D 1UWGH 3QWOB 5IB4A 1EXUA 3MA9L 4J6RH 2P8LA 4PRPA 1F4WL 4Y4FA 1YYLH 2EDYA 4KZEH 4OGAD 2AXJA 4LHUD 1N5YL 2F58L 4F58L 3TO4B 2YPKA 1HH6B 1LO4H 43CAB 2OTPA 2JJVA 1MJ8L 3HFMH 3QEHA 3MCLH 4ISVB 3QDMD 2F74B 2VIRB 1KBGL 3EDEA 4G6AD 5T1DL 1KCUL 4KTDH 1GGBL 3BVNA 2HKHL 4QOKD 1LQSR 3E8UH 4OGZA 1J0KA 5I8CA 1RJLB 1T83C 4JEGB 2VERN 3NIFF 2WSKA 2AEQH 3OJMB 1WFNA 5CZXD 4ORGB 1NDMB 2BOCB 3BGAA 2Q86A 2F5AH 2BC4B 2YD3A 4R97B 5DJYA 1A7PH 3RUGB 3I3DA 4Z7UB 4ZUWB 3OR7A 1UZ8A 2GCYB 1QBLH 4DVRL 1TJHH 3GBLA 3O4LB 5I1DB 1BVKA 3SDAB 4L5FL 5C0IB 1D5XB 5EN2B 4YQXH 3RWFA 4DAGH 1GC1L 1BAFL 4LPTA 5DJ2A 3MGTA 4OLVH 1HNFA 1BQLL 5ESVB 5DMYA 4LMQE 4M5YH 1CTNA 3K46A 3TO2A 4XPFL 3QQ9D 4HJJL 3I6KA 3M17A 2R69H 4IRSC 1VEPA 4MJ5B 5HHOA 5BV7C 4UQ2B 1KENL 3CIQA 5BJTB 1NFDF 1FO0L 1HCFX 2EH8L 1VACA 3PDOA 4U1IA 1LNUB 1CLOL 2X40A 2BXYA 5GRUH 4J7RA 5DD1L 1PQZB 3L3IA 4O2EB 4LQFL 1KCRH 2O5YL 4Q74A 2VXTL 2JCCF 3O11A 5HVWA 4OV5B 2EDTA 1VEOA 3QJFA 3L5XL 1ETZB 1X6NA 4LGRB 1J5OL 5I1CL 2R8SH 5IVZB 2NY5C 4LLVA 5IFAL 1YEKH 4AT6B 4V1DB 3T2NL 4U1LB 1TJIH 3V4VH 1DUYA 4WFFE 3MROB 1MRDH 2FBJL 3LN9A 3GMMA 1YQ2A 4LLQA 3RRQA 2ZG1A 1H3PH 3BP6A 1DVFB 1SHMA 3BYYA 3QUZB 4MGXA 3NA9L 5F97E 4CBPA 1PSKH 4CMMA 3VGFA 3R06A 3V5KB 3MFFA 2BY2A 2J8OA 3MGOA 2VR9A 1S7VB 1GGTA 4MAUH 2VLLB 3CPLB 1DQLL 4F9PC 2CXKA 5E8EB 1EEZB 5IEKA 2YRZA 1BQHB 2E9WA 4APQC 3NTCL 5EORL 1ADQH 4MD5A 1ZWIA 8FABB 1FZKA 4LSPH 4MDIA 4RAVB 1HKLL 4HKZB 5DT1L 3MMEB 4Q0XL 3V7MA 1QPXA 1T3FB 4WRLA 4KJQC 4NKOB 4L4VE 4KGJA 1EVUA 2FR4A 1RURL 3TJEH 5ICZA 1RUPH 4XZUB 1K8DB 1NLDL 3TBSB 1GXEA 4GOSA 4J3TA 1OF2B 4TUJB 4YK4C 3RWDB 3ULUL 4AG4H 4BFIA 3RL2A 4WV1C 4U6TA 1MHHB 3MGAA 3R8QA 4OD1L 2FATH 1OT1A 3T77A 3VMOA 1DSFL 3JWDL 2ADIB 3UBXB 3PL6B 3U82B 1FFNA 2GSGB 1LO5A 1VFMA 3B3IB 4FRWA 3UZEA 3VFGL 1VADB 4Z77B 4NP4L 3TA3B 1FZJA 4DFHA 3MLYL 4BQ6A 5FKPA 2F19L 4HKJB 4IRJA 4LASL 1Z5LB 4YDIH 3ARBA 3L3GA 4Z7WA 5SWZB 3RWIB 1A7QL 1QSEA 4LVHB 4U3CA 1T0MA 5F8QC 4P23C 3V0VA 4M8VA 3KLAA 4PRBB 3UMTA 3ZDXE 1I1AA 2VXUL 5E8NB 2VXQH 3NPSC 3WYRA 1T22B 2NY2B 3K4ZA 4JQIH 3TVMA 3K81A 2BMKB 4E41E 2OCFD 3NABL 5FA3B 2N7BA 1ZTXL 1U8KB 5D93C 3N50A 4XC1L 2FWOB 4HBCH 4PJ9A 3U48A 3C5ZC 2P5WE 4LSQH 1FVCA 4TRPL 4BFGA 3FO0L 4GW5B 5H35B 2Q7YB 1QYGL 4YZFE 3LS5L 4Y2DA 3R0NA 4WUUE 3SKNB 3OV6A 3DJ9A 4Z76B 3PF2A 3TJHC 3T0ED 4MQSB 1YECL 5TFSL 1KPRB 2HT2C 2VABB 1I3RA 2Z4QB 5HGDA 3BP4A 4YXHH 3SBWA 1X5ZA 4XNYH 4PJDE 3CSYA 5HPMB 1S78D 2PR4H 4OIBA 4X9GA 1GGYA 4PREA 2P42B 1RZ8A 4QNPF 2R9HC 4JY5L 3W82A 4JO1L 4OUUB 3ULUD 3RVWD 3AREA 3OKEA 4TQEH 2EE3A 3GSNB 4LEXH 5E8PB 2BX5A 1ZGLM 3MLSL 1QLEL 2VL4A 4PRIB 1A6VL 3INUH 5JDSB 2PO6B 1UG9A 3R0MA 2OR7A 2QQNH 1VPOH 2IEPA 2P46B 5F89A 3VXNA 4UMGA 4D0CB 5E6IA 5BO1L 1S7WA 3JZ7A 5JHDD 1WZMA 2XZAL 4P9ML 4NBZB 1QSFA 4UINL 1VGEL 4M7LH 4WIQA 4IMLB 5GRJH 1T5XA 4E5XB 3R1GH 5T3XL 4MHHG 3RWGB 1WJ3A 3VFUA 5E4EC 1X5XA 4UBDD 5D71H 3HAEG 1R3LA 4YXKH 3P4MA 2EH7H 2CDFB 1AQKL 3BZ4B 3MJ9L 3W5MA 4NRYA 2PYEB 4WVRA 2BSRB 5CEXA 5EU3B 1SYSB 4H0HB 4NZUH 5DMGC 4G6JL 2F53E 4WWKA 5TF1L 1FFPA 3PGFL 4GSDH 1ULVA 4BQ8A 4NN5B 4F9LC 3SE4C 4MB3A 5GS0L 3TESA 4ZFGL 4FQ2H 2YEZA 1WFTA 1YMHB 4G9FE 3S88H 1KGCE 3BJ91 2JELH 2Y6SC 3KPNA 4GRMA 5I19H 4F15C 4E42B 4HWBA 2Z35B 3VFTA 1RK1A 5DUBA 1D6VL 4FABL 3UTQA 4N0UA 1YJDL 4KJPC 1CGUA 3EOYG 4I0PD 4OFYA 4N8VB 5GGSY 4HWZA 2VE6A 4PJ8B 4HUVB 1FDLH 1JHLH 4NOFA 5C0JA 2Q1EA 3NBNA 1OGTA 1S7RA 3QA3B 2GK0B 3P4OB 4JRYB 1JPTL 1N64L 4P4KC 2QHRL 5A2IH 4F8QA 3LAFA 5HYIA 5HYSA 5D2NA 3HZVA 4NWUH 4MVBC 1QZ1A 2NY6B 4NO2B 5L9DL 3LEXB 4HX1B 3P11L 3SDDB 3S96A 1MLCA 4RMWA 4XPTH 1FGVL 4S0SD 5I17B 3BSZH 4PRHA 3JV4A 2EIDA 2P5ED 3D3VA 1EERB 4FQIL 4J8RB 3Q1SL 3RWEA 3TPKA 2D7OA 3OXRA 5L6YH 3K4AA 1KB5B 1C5DA 1HN1A 4GXVL 1JNNL 4TUOA 4TVPD 1QLRA 5FKAA 1J10A 4YR6A 3UTPD 4GO6B 5DXWA 2ADFH 3MREB 4QOKA 4YH6A 1Z9OA 4NKDA 2OR8A 2EYTB 2C3WA 1JL8A 5FV2A 1IBGL 2VQ1A 4JRXA 2NZIA 5IFJB 4MA1C 3UAJC 4JN2A 3MRKB 3H9SD 3EZJB 4WNQA 2VDOL 2ZUQB 2LVEA 1PY4A 5HHVH 3RKDC 1QBMH 1B9ZA 1R5IA 3MRHB 3I9GL 4PJHA 3NFPB 2CGRL 3TFKC 4HFUH 1NGPL 2Z8SA 1S5HA 2ORBH 1Z2KA 2HJLA 3DUHA 4CGTA 3L3OA 3PWJA 3HB3C 2I9TA 1C1EL 4RQQA 1MFAL 3DXAB 1DLHB 3D9AL 1AIFA 4P3DB 2FSEA 2QKIA 5CBEA 2OTUA 2CH8A 5EBLA 2MHAB 4JHWL 1GZQB 2Z8RA 3FRUA 1A4KB 4JO2H 4ODHH 4KUCF 3CMGA 1U8LA 3M1BA 1YPZA 2UZYB 1XGTA 4OD2B 3RPIB 2X4SA 4OI7A 2F8OA 5DJ6B 2BSTB 5I2IB 4HXAH 4JFQA 1WWAX 3WJJA 5HYJD 5J13C 2MKLC 3O41B 4NDMA 3EDFA 1QFWL 2YZ1A 1ORSB 1I75A 1TETL 4KQ3L 4D9LL 2XY2A 3FO2B 3JWOC 3KXFE 4FXLA 5D7IF 4M5ZL 3VXMD 1WBXA 5D5ME 3BP5B 2CDGB 5E9DE 4LLUB 1A9EA 1BMGA 5I1KH 2H3NA 4WI6A 1YEIL 4GKSB 1HQRB 3PWUA 5E7FA 3DX7B 5C0ND 2E3VA 1HI6A 3H3KA 3H2WA 5D4QA 3BEWA 5T3ZE 4UTAL 1B4JH 3O4LE 3D0VA 1NBZA 2W9DL 4S2SB 2WBKA 1P7QA 4RFEB 5DMJB 4R9HA 3DPBA 4I2XE 5AD0B 4ZXBD 1MUJA 2LV4A 4HWBH 1G7QB 5EZIL 2F5BL 4Z7VF 5D1XD 2FO4A 2FHBA 2Q20A 4NO5B 1TTUA 4XCYA 3GSOA 4CADA 4R2GC 4KUCD 5IVXE 1NFDA 2D03H 4CW1A 1U3JA 4KMQA 1EFXB 5FOBA 3LQMA 1KJ2A 5BS0B 2VAAA 4K9EC 3UDWC 1EIBA 1Q1JL 1RIHL 2YD4A 2BVQB 5J6HA 1CF8L 3OKLA 1NUNB 2IFFL 2VDKL 3QXWA 2JCCA 3S6CA 3Q5YA 1AH1A 4HIJB 3N9GH 4LSVL 3GSXB 5C09A 4JZOA 5DD6A 2ZOLB 2DQFB 4V1DE 3MJ8A 4W68A 5EO9A 5F9OH 3WL9B 3QIBA 4EN3D 5I1GH 4ORZC 1T2QL 1HINL 3C5SB 3EO9H 4OZFB 4CUCA 5L2KA 4B7IA 4M00A 4DGIH 4AEIH 4QHMA 1N26A 2VR4A 5DR5H 3D87B 1DE4A 4K3DL 5GGUB 5IHBA 1KN2L 1F13A 2JIXA 3ECBA 1H3GA 3X14A 2QQLH 3BT2L 3QZWG 1QNZH 1RUKH 3S4SB 2XWBB 3DV6A 4LQ1A 4Y8AA 4WI5A 3RZCD 1T89C 4QHKJ 2IPTH 2DN7A 2L7JA 3RWJA 4PYHA 1AI1H 5EDXA 2NXZD 3L9RA 4F7CB 1KF9B 2AI0H 3MLTB 4XPGL 4L3AA 1TQBC 4LU5H 4X6EA 1JPGB 4CN4A 1MAMH 5IG7A 1P4BH 2OMNA 2XWTB 5EUKA 5KSUA 5JOPE 4LCUB 1TTFA 4JVPA 3MBEA 4NYLB 3OPZL 3HC3L 3QISA 2ATPB 4Z0BH 3AU1B 3UTTA 4BSWB 4JKLA 5EC1B 4OV6F 3WDJA 3P3YA 3PWVB 5KW9L 1YEEL 4K3HA 3OWEA 4I3RL 1UCBH 3G5ZB 2X4RA 4UV7H 3H3PH 4G43B 3O8XB 4R4NC 2HT3C 3V5DB 5SWZE 1ZLVH 4CVZB 3JTTA 2EE6A 4O9HH 3QXVA 3S37L 3WO3B 1LVEA 1U3HA 3MV7E 1AD9B 4H1LA 4XPAL 2V5TA 4KTEL 2FH8A 2MJWA 4PLKC 3V52L 4HLZH 4NCC1 3PP4H 4FTVA 1I9JL 4L4TD 5MHSE 5F88B 2OZ4L 2R0KH 3T65A 4FNLH 4P2RD 4M7KH 1H8NA 5IQ7H 2DLTA 4OGYH 4L1HA 1RHFA 4FG6C 1RULL 3WXWL 3V6FB 1CFSB 3GJEB 3HLAB 4ELKB 1BEYH 1FAIH 2W60B 5ID0B 4G8EB 5E56A 5EU6D 4ZNCD 1XH3B 1FJ1B 3W11C 4ZUUA 3HE6B 1MHCB 4XP4L 3QUML 5J1AB 1MRCH 2DDQL 1NGZA 2AK4A 2DI8A 1S7UB 5F3HA 1MCHA 3WO4C 1IM9B 1Q94B 4WW2B 3O6FA 4MMZC 5FB8B 1KJ2H 1EEUA 4HIEA 4ELMB 2AEPH 4TULH 4U6VH 4GRWH 3DX8A 3DSNA 3QQ3A 4X7SL 5IJKC 2VKWA 2CLVB 1RD6A 1C16A 4PRIE 2ATKA 5DJXB 4UT7H 2XRAH 1HOCB 2Z91A 3BE1L 2WUCL 3VRLE 3GZKA 1MRFL 2JLLA 5LVEA 1HWGB 2X4PB 3DX6A 2IPKB 4PJEB 5DHYA 2DQHL 4ZUVB 3F7VB 1JWMB 3WD5H 3JXAA 4TTDD 3SGJC 3S36X 1ZANL 3B6SA 5ESQA 4UT9H 4X6FA 3CGTA 4EBQH 2YA1A 1K2DB 5I71B 5E2TH 4ZUTB 2FECI 4NM8L 1A6TA 4JHAL 1OSZB 2WP3O 1HILA 1TZHA 3CU7A 4NRZB 5CD3A 5HGHB 4KROB 5DHVB 5C07B 4LPVA 4DVBA 1WF5A 1F4XL 3GIVA 4DCQA 1OARH 2AABH 4EOWH 2CIIA 1G0DA 4HQQH 2XG5A 5GGRA 5HHMD 2PYEE 4CDGC 3Q3GA 2P7TB 3F12B 4Z5RB 4R97C 1JMZA 2AV1B 4JPWH 5CP7A 5C9JB 1J8HE 1UACH 4LLDB 4OFVA 5CJ8A 3T2QA 3NCYS 4W4NA 4ZDHB 3HMXA 3KPSE 3EYSH 4PLJC 4JFHE 3SDAC 2DOCA 1CG9A 3BH8A 1BZ7B 4JHBA 3WDHA 5TGBB 3H7BA 4FQLH 1XGRA 4OCYH 4ODSL 5IMLB 4W4OC 2GT9B 1ORQB 1KPUA 4LNRA 5FYKU 3V4UH 4N5EC 4PRPB 4RGOH 4Y4FB 1RZ7L 5I1HL 4ZAKA 2AXGA 1IL1B 1BF8A 1FPTL 2HFGL 4PJ7F 3OAUL 5F44A 4Y19A 2UWEB 1VFBB 2YPKB 4MZ2A 1N4XH 2VLJA 5FYJD 4I18B 1AGFA 3I3EA 4ZODA 3REWA 3VMNA 4JRYE 5DVNA 4CN1A 3O3AB 4EDXB 5JR1L 4H1LH 3HE7A 5EO0A 4NQEE 4UQ3A 1UZ6F 2C3HA 1NCBH 3BVNB 1AO7B 4X99A 1VGKB 5TQ0L 3EOBB 5D2LB 1TLKA 4M7ZC 3Q6FA 4Y4KD 2C3VA 5MI0B 1MEXL 1H0DA 5SWQA 1CD0A 3LSOA 5FUZL 2IQAA 4KRLB 4IRZH 1U42A 4NQSA 4PJAF 5EZOH 4OFPA 2B8OT 1JTOA 4OCXL 1MI5A 5INCB 4WI3A 1LO0H 3WXVH 3G6DL 4XT1C 2Q86B 5IB3B 4JPVH 1CFTA 2JKXA 4KAQL 2W9EL 3QNYB 4YGAB 4A2MA 4ZFOA 3ARXA 2YPLA 1P69B 1BVKB 1N0XH 3BKML 5FK9A 3X17A 3RWFB 1ZSDA 3B8SA 5DJ2B 4NC0B 5CGTA 4O51A 4ONGL 4FFVD 1RHHA 2HTKC 1QEWA 3TO2B 1QG3A 3FTGA 1FFOB 3QCVH 4N8CL 3SPVB 3QFJD 3I6KB 4P46C 1H3TA 3RY5A 5T33H 1I9RL 3HI6H 3RDTA 5HHOB 3M45A 1B2WH 2A6DA 1E6JL 1UM5L 1VACB 3PDOB 5DQJA 4G8IB 4IMKA 1IGTB 4MNGE 1A7BA 4JG0H 1DQJA 1YNKL 1UM4H 3DXAE 2WWMC 1Q72H 4NJ9L 5IKCA 2DLHA 5GJTH 5IV2A 3QJFB 5CJOH 4L9LC 3TA3C 4LLVB 1ZGLA 2IAMD 4PB0L 2HWZL 1I1RA 1DUYB 3QEGL 5C0CA 3LKSA 1OAZL 2I60L 1EAPA 4DQOH 3GMMB 3BZFA 3G08B 4UZGA 5D7LD 1FSKC 4M4RA 4IOFD 3BMWA 3MLWL 3SJVB 3WN5A 4PP2A 3BZEB 1E4XL 4CMMB 1BIIA 5KSBA 3R06B 3QHTC 4QHLB 3ZKXC 4S1SL 1RU9H 2HJKB 4I4WA 4XP1L 1NUDA 4K7PH 4AEHL 2FH6A 1OP5H 4R3SA 2XA3A 5BXFA 3MOAL 3MRDA 3BPLC 5CJXC 5L0QB 4PJIA 1MCNA 2R1WB 1ZWIB 3EDDA 4UIMA 4Y5XC 4GKOA 2D9CA 2J1KA 2OI9C 2G9HB 3HMXH 3IDXL 3VXOA 4PJFF 1OTTD 3GNMH 3LKNB 3C8DA 4B5EA 3LB6D 1ITBB 3IAQA 2WINA 1XF2B 4XX1E 2YD2A 3X13B 1JRHL 1EHLL 2R15A 2FR4B 4QRPD 3TF7C 3PABB 4BFIB 1GGCH 1FL6A 3O6KL 3QFDA 4LRNL 1TFHA 4NPYA 4U1GB 4LSRH 3MODL 3IDNA 3S37X 3FFCD 1UC6A 5TE7L 3TNNA 5GS1A 3IKKA 5IFHH 1CVSC 1LO5B 5LGHH 4FQCH 5BMFL 4DN4L 1FZJB 5DFTA 5FKPB 1VFAB 4XMKH 4OT1L 4IRJB 3QUYA 3ARBB 3L3GB 5B8CA 3BH9A 4Z7WB 5E08L 3ETBF 4NJAL 4S1DC 3BI9X 1Z6JT 1BFVH 1QSEB 5H37H 1T0MB 3KYKL 4F37F 4WFED 1A7NH 3V0VB 1KPVA 1MFCH 2B2XH 1WFUA 1UXSB 1WIOA 3VI4E 3WIHL 1KNOA 3QI9A 2Y36H 4JO4H 2DWDA 1T7VA 3TVMB 4M61A 4R26L 2DICA 2NW2B 1N0LA 1U41A 3VH8B 1HYRC 1YA5A 1M4KA 4PJ9B 2DLFL 1C7TA 5JXEC 1F5WA 3B5GA 4WCYH 3ARQA 1EEYB 3ARDB 4X6DA 3VWKB 4LLYB 1M7IA 3T8XA 3MRRB 1MNUH 4CL7A 1NFIA 1DBBH 2C4FU 3OKNA 4K3EH 2I5YH 3VXUB 3EYFA 1IKNC 4U3HA 2DQUL 2HLAA 5FIEA 5IK3A 2CKBA 3ARFD 3V6OE 4P2RA 1J05A 1DP0A 1FYTB 1X5FA 5DJ8A 2BNQA 4RISL 5HGDB 2M26A 1RVFH 5JW5A 3MOBH 3DBXA 4OCRL 2X1OA 4ERSH 2E6QA 4PREB 5ITBL 1U9KA 4JFZH 3R4DA 2DBJA 3NFNA 1UJ3B 1TTGA 1I85C 3KPRB 3AREB 5F1NA 5DUPH 1INDH 5KVFH 2XWJB 1IKFH 4DK6A 5KVEL 4XMPL 3UYPA 1K85A 4TPRL 4S10A 4HKXA 2L7UA 4PJ8C 4L8DA 1IGML 4OCWH 5I1JH 1T0PB 3RWHA 3S3JA 3VG0H 5B38B 4OZGB 3FOLA 5E6IB 2HAZA 4N1CA 3CCHB 4MJIA 1FNGA 2WMPA 4GRLA 3RIFF 1QSFB 1E4WH 1JGEA 2ZKHL 4DZBB 3UYRL 1K6QH 1T5XB 4ZTOH 5DUMH 4HAGA 2WAHA 1SJHB 3OXSA 5D7KD 3WFCL 2A9NH 4EVNA 4YHLH 4GG8A 1BIHA 5CJ5A 3LHPH 1BM3L 1OAQH 3P4MB 5JPMB 1IQWL 1V7MH 3TT3H 4NRYB 2J2ZA 3G6JA 1N3NB 4RRPG 3RTQC 5CEXB 2ESVD 3Q5TA 3VWJA 2APFA 5DO2C 2L4OA 4MNQB 4U05A 1ZT1A 4OBRA 4XPBH 5F9WC 3ARGC 5F7YC 4QRRE 2YEZB 4KQ4H 4KZDL 1GVIA 3VFRB 5K59F 3EYOA 2X4NA 4IRSD 4ZNEA 4G5ZH 4GRMB 5SX5H 5DK2A 1QQDB 2ICES 5C0GA 3T0AA 1RK1B 2HTLC 4G7YL 1OGAB 3UTQB 3FQXA 3AGVA 3ARSA 3EW3B 4WO4A 2W65B 4M4PA 1WCBA 1T1XB 3GI9L 3C6SA 5L88L 4IJ3B 2GJ6D 2VE6B 3LDBC 3LD8B 2F8XC 5FGSA 3W9EA 1OGTB 4BJLA 3JV0A 3NPZB 2DM4A 2NY3B 3BEVB 1T5WA 1YQVH 1BX2A 4PJEE 3LEYL 1DBKH 3V4PL 5HYSB 5LWYL 3DUSA 1CT8B 3HZVB 3TV3L 3W39A 3IAGC 2A9MH 4ODBD 4LHUB 3GK8L 4G42A 5B3JE 3MRGA 3U0PA 1KELH 5ALCL 2VOTA 2C4FT 3S96B 2R4RH 1MLCB 2VZTA 1BJMA 1HYSC 1JN6A 3VXRD 4NC2B 4PRHB 2EDKA 2H8PB 5C9KA 3JV4B 4ZSOE 5AUMB 5HHPA 3D3VB 1VFUA 3QDGE 4N1HB 3QDMB 1DEDA 2X10A 3DUUA 3OXRB 4P9HH 4APQD 1C5DB 2GW5A 3CFDA 5FKAB 1ZS8B 4TUOB 5D96C 3QP3A 2QV2A 2DIAA 2CKBH 4X9HA 4QOKB 3ES6A 3QXAA 3BXNA 4Y4KA 5C0DA 2QEJA 5GGSA 2FNBA 5E2UL 1GPOH 4QTHA 2EKSA 4CKVX 4KJQD 4YC2B 1RSFA 4NQXB 3QO1A 1NMBL 1EH9A 2HLFC 3JVGC 5B22A 4P2QE 1OCWL 4P99A 4PGEB 1CR9L 4YHOL 4Y5VC 4LFHD 1J1PL 4PJHB 1G6RA 5HHNA 4PRPE 1DL7L 4UU9B 5IM7A 2HJLB 3DV4B 4PJGA 3L3OB 5F96L 3PWJB 2I9TB 3FN0H 2H9GA 2NMSA 4RQQB 4ZD3H 1AD0A 1AIFB 4DKEL 2ZOKA 2FSEB 4UT6L 5CBEB 2OTUB 2YS4A 4PJ7A 1CLYH 5TPWH 3FRUB 4CMHB 2RCSH 3MLPA 3M1BB 1NJ9A 4R0LC 1DN2A 2P8PB 3NIGE 4HS6A 3CFBB 1KCVL 4BH8A 4P23D 2X4TA 1E6OL 3B9VA 3TIDB 3TGXA 2Z0BA 1ACYL 4GAYA 1AP2A 3ZKMC 1T03L 4NDMB 1DLFH 2R2CA 5FGCB 4NC1E 3SY0A 2XKNA 1KLGA 4O58H 1XGPA 4FQJL 1IEAB 1WBXB 3C5ZD 1J18A 1FVDA 1K8IA 4XTRC 1A9EB 2KZWA 3ZTNH 3PP3K 2H3NB 1V3LA 5CEZL 2LQRA 4LFHG 4HG4K 1Q9WB 3TT1H 1HI6B 4K07A 3BEWB 4U1MA 1XR9B 4D2NA 2NCMA 3BWAA 5DGQA 3TJHD 4RMQA 3DNKA 4XAWL 1NBZB 1PX4A 5E7BA 1P7QB 5JHLL 2HT2D 5D1QC 3V6OC 1L9MA 4QGTA 3DSFL 3VW3L 4FQXC 3T0DA 2IG2H 1BBDH 2Q3ZA 2MNUA 4ZYKA 1W0WA 2P24B 2FO4B 3DX9A 5HHOE 2R9HD 4XCYB 3GJFK 3GSOB 2HFEB 4CADB 2ZCHH 1NFDB 4CW1B 3C87A 5FOBB 2V17H 4AIZB 3CSGA 2VAAB 4QYOA 4YFDB 5J6HB 4NQUA 5JW4Q 4JAMA 3OKLB 3B9AA 5B39B 2ZZUT 4YAQA 3BUYB 2JCCB 4OM1L 5KVDH 1NBVL 1L7IL 1PZUB 2P49B 3O8XC 2UVFA 3QIBB 1ZE3C 4XBEL 1OAKH 1NL0H 3FFCA 3SKOA 3KLHC 1LD9A 3A6OA 5FYJH 5L2KB 5DRZA 2XZCH 1JF1B 3TIEB 4LRIA 2YKLL 3DWTA 3TCLA 1DE4B 1XF5A 2P8MA 3VCLB 1MJUH 3TWCH 4KJWC 4XWGH 3ECBB 5MENA 2EE9A 4LKXB 1DJSA 1RUQL 3SCMA 2O5ZH 2UUDH 5C2UB 5A3IC 4MNHA 3MRFA 3RU8L 3RWJB 4R7DB 3B4NA 5DMGD 1PYWB 4YDJB 1J0HA 5AZ2L 1G7JA 4HS8H 5IWLC 4U1JB 4OD3H 5E6ZA 3BW9A 1MAKA 43C9A 4TSCL 4X6EB 3FB6A 2Y72A 1G6RH 1JZ7A 3NVQA 5IG7B 5DD0H 2Y6SD 1HHKB 4F7MA 3TPUB 5EUKB 3WUWG 2N1KA 4WWID 5KSUB 3BD4A 2Z8WC 3O3UN 3KG5A 3MRNA 4HCRA 2YD6A 3MLXL 4XMLL 3T0EB 1B0GB 4JGUA 5E00B 3UTTB 4OB5L 4KJPD 3QWQB 1FN4A 1KTKE 4XCEB 2FIKB 3X12A 1LDPH 3QEUA 4K8RL 4HUWB 5GGVL 2X4RB 1V5JA 4P4KD 3OJDB 1IARB 1MPAH 1NMCB 2ZCLL 5DJCA 4YWGH 4ODTH 4Z7WE 4GW1A 4U1KB 2WWKO 3JTTB 3MBXL 1QSEE 4WFFD 4YUEL 1GJIA 4MVBD 4CJ1A 5E2JA 2YBRA 1U3HB 5JUEH 2ZNWA 4H1LB 2BVOA 3UP1A 1SEQL 1JE6A 1FNAA 4R90L 4Z7NE 5F6HJ 2XPGA 3MR9A 2XT1B 1BLNA 1PG7H 3WE6A 4JFXA 1QFWI 6FABH 4ZOCA 3TH3T 3NH7H 3T65B 4MAYC 3OGCA 5JHDB 4LVEA 4OCNC 1YEDA 4YHIB 1QUNA 4P48A 5H8DA 1AXTL 3ZDXF 4BQBA 2E5EA 2HH0H 1MOEA 4O02H 7FABL 3NZ8A 1NAML 4U3XA 1QFWM 5JW3L 1NUGA 3HCVA 1FNEA 4OSUL 1UB5A 4R7NA 2FGWL 2DQJL 4KXZI 3OAZH 3QT2A 5CCKL 3UAJD 4NQCA 1NGZB 5ENWA 2AK4B 3O2DA 5ALBL 3E3QE 1R3IH 4I48B 4NRXB 5F3HB 4L4VD 4YZFF 3RKDD 1RIVL 4MCZB 1SYVB 1ZVSB 1RUMH 1KCKA 2R1XA 1C08B 2NY1C 3O6FB 3TFKD 4KDVA 4M6ML 3SQBA 5INDB 3OKKB 3QQ3B 2G5BA 1PW3A 3HB3D 3PQYA 4ODUB 3I75B 1C16B 3OL2A 4HWEH 3DHMA 3LQZA 4PJDF 4L1DA 1PEZA 2W07A 1KIPA 4DGYL 4MD4B 3VFOA 3CFJB 3NGBC 5GIRA 3DX6B 1O7SA 2G2RA 4KKNA 1L0QA 3MRPB 3ZDYE 4HH8A 3F7YA 4G6KH 2A73B 1MCRA 1QSFE 2DYPA 2I24N 2X1WL 1INEH 1KC5L 2EIEA 2GJ6A 3DYOA 4WU5A 1VB9A 1Y18A 4JREB 5LQBL 1QFOA 2R2HA 1A6TB 4UV4H 3VFSA 4EIGB 1MY5A 3QCTH 4E41D 3QUXA 3K7UA 4WJ5A 5CD3B 1QVOA 1A0QL 5T1MA 4NC1C 3W2DH 3M8OL 5MI0C 3MA7B 4NT6A 3U7WL 4DVBB 35C8H 5DQ9A 3GIVB 4XBGA 1JZ3A 2CIIB 2P5WD 3IDYB 5GGRB 4NNXA 4ZPTB 1OWWA 3Q3GB 1A5FH 1I9IH 1GHFL 1R5WA 5CP7B 3VXRA 1UKQA 4WUUD 2CIKA 2P5EB 5JW4N 5CS7A 3L7FA 4RWYH 2R0WL 1CG9B 4YDVA 2A6JA 3BH8B 3GMLB 4Z7QE 4KWUA 5BVPL 3H7BB 4XH2A 3ZE0E 3BAEH 4HCRH 4M9OA 5BOZG 4PRNA 4HGMA 1XGRB 2UYLB 1UEYA 3STZB 4MXWL 1PLGL 5F21B 1YC7A 4X4XA 1MF2L 3LZFL 1C5BL 4R2GD 1KJVA 4BM7A 2AXGB 4N0UE 1SMOA 4NM4H 1WZKA 4IS6B 3RGHA 4NKMB 1YEHL 1N2RA 3HUJA 3N85L 2B0SL 2ZSVB 3V8CA 4Y19B 5IMMA 2AJUL 5FCUL 1SVCP 3FB8A 2VLJB 3CFKA 2FCBA 1AGFB 3S35H 3P73B 1MCOH 1Z3GL 2AAVA 1IC7H 2HYMA 5D6DA 3JV6B 2ZPKH 5EH1A 3BMVA 3EJYC 4X6BA 2FO1A 3HE7B 5D2NE 1RI8A 1F4HA 5EO0B 4Q7DA 1RZJH 2D4DA 1KXQE 4GXUN 4YBQC 5DZOA 1ACZA 4X99B 4Q9RL 3Q6FB 4B53A 2C3VB 4PRHE 3RGVA 5JXAL 4HPOL 3D3VE 3LSOB 5J89A 2IQAB 4AEEA 4M8QB 2HVKA 4NQSB 2XFXB 2CK0L 2YWZA 5EIQA 1MI5B 1F00I 1TMCB 2XTJC 5FHBH 3QCUH 5HYJB 4QOKE 3BO8A 2WNGA 2IFGA 4ZFOB 3O2DH 2YPLB 2F53D 5FK9B 4JRXE 4ZQKB 1ZSDB 4HXBH 2W38A 1WLHA 3FTGB 1NCAH 2A38A 2IANA 4J3VA 4G9FD 1MFBH 1KGCD 4LGPB 1IGIL 3RDTB 5FYLH 4PJHE 3OJ2C 1A3LL 3WFDL 5KVGH 4K55A 2A6DB 4GMSH 3BX7C 4NZRH 4ACPA 1DQJB 3GSRA 4U1GC 3MUZ1 4WY7L 3LRHA 2CDEA 4M62H 3BDYL 1FNSL 3P9LA 4ZXBB 4QXGH 3FQWA 2KQNA 4K94H 4YO0B 1AY1L 1LK3H 5D6CA 4TSBL 2RGSA 4IRJC 2HT3D 3ARBC 4LVOB 1YPZE 4Y1AA 5C0CB 5J57B 3SHSA 2Z93A 1EAPB 3BZFB 2MOVA 5JORA 4AQOA 3GMOA 4PP2B 1E0OB 2Q8AH 3O6ML 1L7TL 4C4KO 4PLKD 1BIIB 1FO0A 1I1AC 1SM3L 1RZGA 2PCPA 3TVMC 3TM6A 2NNAA 5HYEA 3S3SA 3V2AR 3LPFA 4EN3B 2VB5A 4MJ4A 3F6LA 4PJ9C 4R3SB 4FG6D 4DK3A 12E8H 5BXFB 2IADA 3MRDB 1KN4H 1AXSA 1KFAH 4UIMB 2VLME 4PGJA 5EU7C 5T3ZL 1QTYT 4HT1L 5E5RB 4CU7A 4KPHL 4Y2DC 5E2WH 5IUSA 1LMKA 4Q97A 3W11D 5C71A 1Q9KB 1I7RA 4Z95H 4X5XA 5D5MF 2PUQT 4JGJA 4C83A 2AJSH 1SQ2N 2FX9L 1WVZA 3B5HA 3MRBA 2CMRH 1HSBA 1CXFA 3W5NA 3SBWC 4PGDA 2XTLA 5IF0B 1GOHA 5I8OH 3KPPB 3WFHA 2R56L 2XZQL 3B2VL 2NXZB 1FL6B 4DUXA 2ZUXA 5D1ZA 1NFDE 4QTIH 4F9LA 4X80L 5HYQA 1MCIA 1DTUA 3TNNB 2J6EL 2NTSP 3L5JA 5IIEA 4GRWE 5T1KA 3ULVL 2JCCE 4XC3H 3QUYB 3IKCA 5C09E 5IVXF 4EI5A 2JB5H 5M95B 4A6YA 5E6IC 4DN3L 3MA9H 1F4WH 1KPVB 3IDMA 5L2KE 3V5HA 3T1FA 3QI9B 1T1YA 4X98B 2DWDB 3D18A 3Q2CA 5IB2A 4MSWA 3VRIA 2F58H 4HUXA 3O45A 2MCG1 4F58H 1A9BA 3QO0A 2P44B 3TBTA 5FUCC 1GCFA 3KXFD 1FNLA 1MJ8H 3BRDA 4FMFA 5E9DD 1M7IB 5BW7A 1KBGH 3T8XB 2CR6A 3OKNB 3AAZA 1KCUH 3CX2A 1GGBH 3NCYP 1ZA6A 2YC1A 5HDBF 2HLAB 4L4TB 3WLBB 4WWKC 4PLJD 3SDAD 4HH9A 1J05B 4P2RB 1QFPA 3B5TA 3VDAA 3BN3B 2DMKA 5JW5B 2PXYC 4NUGL 4U33A 2CUHA 2YUWA 2Q8BH 2A2QT 2VISA 3MLUL 1R3KA 4N5ED 1SJVA 5EOCJ 3NFNB 4LCCA 5DMIL 1VKXB 2IF7A 3UJTL 2C26A 2I9LA 1FGNL 1EPFA 3AS3A 5F1NB 5HHXL 3UTTE 2ICWB 4L5FH 1HIML 3GSQB 3WLWC 1GC1H 1BAFH 4PPTA 4LP4A 3GIZL 3B9KA 1BQLH 4IJ3C 4IOIA 2VQUA 4WI9A 3QRFM 3LD8C 4L8DB 1EEQA 4HDIA 4HJJH 2MQ0A 1CL7L 3RWHB 1JK8A 2ED8A 2AV7A 4JKPH 4K2UL 2J5LB 1F90L 4HHAA 4V1DD 1FNGB 2R0ZL 4BZ2L 1FO0H 4FFZL 2EH8H 4OQTL 2CLRA 2X70A 2Y5TB 5D2NC 4OGAC 4XXCA 1UB6A 1CLOH 3CFCL 5F3BA 3WHXB 1JI2A 3I3BA 1WZ1L 4WHYG 5HHQB 4LQFH 3BHBA 1LP9A 4OQ1A 3BWUC 2VXTH 2VSCA 4EVNB 3OG6B 1P4IL 4FTVE 3MZGB 4M6NL 4GG8B 3L5XH 4UDTA 1J5OH 1P2CA 1T6WA 5I1CH 1I1YA 5IFAH 4BQCA 4N90E 3T2NH 1WIPA 1C7SA 4KC3B 1CICC 4NIKB 2FBJH