1IL1A

Crystal structure of g3-519, an anti-hiv monoclonal antibody
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
219
Chain Sequence
QLQQSGAELVRSGASVKLSCATSDFNIKDYYIHWVRQRPEQGLEWIGWLDPENGDTESAPKFQGKATMTADTSSNTAYLQLSSLTSEASAVYYCNAISTTRDYYALDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody G3-519 (heavy chain)
publication title Structure of an anti-HIV monoclonal Fab antibody fragment specific to a gp120 C-4 region peptide.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2001-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1il1A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1il1A02
2OBGA 1ADQL 1F97A 3U36A 5JOFA 2NW3A 4HIIA 5CGMA 3SOBH 5TPWH 4KWUA 5DO2C 2FZ3B 5DJDA 3EFDL 2AJVL 2Y5TB 2VXTH 1FPTL 4YHKL 5JQ6L 1EBPA 1AKJB 3FO1A 1G0YR 4TNVK 1OGTA 4CADA 1QRNA 3F58L 3O11B 4R90L 5DZNA 4Z7UA 1S7TB 1QSFB 1ITBB 2YPKB 1T80A 3GSWB 4RRPG 5GGVY 1Q8MA 3K8MA 1HK6A 4GBXA 3VFSB 4JRXA 4PJ8D 3P73A 5KSUB 4D9LL 5DRXA 5HI3C 1GRWA 3STZB 5KSBA 1ZT4B 1INQA 4OBSA 2NYYD 5KVGL 2X1OA 5I73B 2VTFA 2XTJD 2AQ3A 1CXEA 1K5NB 2P5EE 2J8OA 3O3DA 5CJQL 4G7YL 3D18A 1J0KA 5FYKE 4JN2A 2ZUSA 3RWDB 3N9GL 4TVPL 1YUHB 4NGHL 4M00A 2R4RH 4PJFA 3SDAD 2AXGA 4RDQG 2UVFA 5I18L 1UM4L 1YEFL 2DQDH 4LPXA 4JHAH 2HT4D 1MSPA 4G6JL 1C5BL 2VDOH 3MUGB 3S9DB 4NC2B 1TQBC 4PJHE 2FEDC 3ZO0A 4XP6L 2MFNA 1BVZA 3RDTC 5HGHB 4NZJA 5T33H 2YC1B 3THML 4O5LL 2CQVA 5EOQH 1W72L 3IDXH 3RWFB 5EU4B 4D2NA 4ONGL 4QYOB 5F6HJ 4LPTA 1SJEA 3SGEI 1FNLA 1TNNA 3CH8A 2PW2A 1NFIA 1QLFB 3DBXB 3GMQA 3DVGA 5ID1A 3QDMB 4LOUC 2ICEA 4KKLC 1FJ1A 3OJ2C 2VXQL 1N3NA 2EDLA 3DMMD 2BVPA 1FZOA 5GS2H 1IC4L 1DBJL 3BKCL 2B4CH 2OQJB 1RURL 2Y06L 3QHFL 4U7KA 5C07E 1HSAB 3IDIB 2FIKA 4X5LA 4Z95L 5TF1L 5KAQF 3BP4B 3HI5L 1HXYA 4WI8A 2PO6C 3ULUF 5E70A 2JB5L 2DQGL 1NCBH 4CNIB 2ORBL 3HUJA 4HK3N 4NWTH 1G7IB 1C7SA 4Z77A 4QTIL 4JZJB 1LMKA 4XGZA 4G80A 5IESL 1EAPB 1MRFL 2DQEL 2GJ6B 3CVHH 3VGBA 5HYEA 4Y16C 3MLPA 4ZFGL 4Z7UF 1JZ8A 4UOJA 3MQIA 4FQCL 4PUBL 2JJTC 1RZJL 5I76A 3T0XA 4C56E 2W1NA 3P11H 4Y4HA 2HTLD 4PB9L 3KPQA 1XR9B 5KSBF 4LHJB 3S7GA 3TIDB 2HAZA 5D7SL 4HV8B 5DUBA 4ZAKB 1KB5L 1MWAH 2R1XB 4HDIA 4ZFFA 1I9JL 1KG0B 3HZVB 2AK4B 3RY6A 1AGBA 4XPTL 3RVWC 4MA8L 2P8LB 2APBA 1YEEL 4XMLL 5D1XC 3WFHA 1LEIA 2F54B 4KROB 3VH8B 1MI5E 3WIIH 4WTZG 3ARGC 4PJFF 5J1AB 4OCRL 3NTCH 4WEUD 5D6CB 3PWUA 2G75B 3BPOB 3TEUA 2BFVH 5KW9H 5T5NG 1SMAA 4U1GC 1CD1B 1E4KA 3VXSE 1J1OL 3IXTA 3BH8B 3S35X 2EYSA 2OTUB 1U58B 4LU5L 5CD3B 5CLWA 4H1LA 5L2KE 4HKZB 4FXKB 5GGTA 1EAJA 3NA4A 3OKOA 4UTBH 3WL9B 3X11A 4OJFH 3LY6A 4AIZB 3NCJH 4HIEA 1OF2A 2NXYB 2FATL 5LG1A 1LWRA 5AD0A 4RFNB 3OAZK 1J5OL 2LTQB 3OAZH 4NQSA 1H15B 4JVUA 5LCVL 1BF2A 4L4VE 4K3JH 4P2QD 4POZC 1IAOB 4WEBH 1U93B 4JPKH 1WBXA 1G9NL 1RZFH 3MRGA 4A6YB 1AH1A 3QUZC 5HGGS 2F9BT 2JELH 4QWWD 4MHHG 1MRCH 1RAMA 2YD2A 3MRBB 3KPNB 3WCYA 5I2IB 3HUJF 5EZLB 2PNDA 4ODHH 3SCMD 4BUGA 2JJWA 5IQ9B 3L5WB 5EOTA 4PP1D 4P5TC 1RZ7H 2EIDA 1J8HE 3VD4A 2ARJA 4KI1A 3EOBA 4H25B 2VDPL 2RFXB 5IFAL 1JMXA 5JA9A 2EC8A 2NY3B 1FHGA 4NZTH 4KK8D 3WEXA 3HMXH 4JFXB 4NKMB 3GMRB 1TJHL 4YO0A 2XY2A 1QKZL 3D39A 1LP9A 1FAIL 4Q0XL 3DMMA 3FO2A 1Y18B 5EIIB 2Q76A 3TV3L 2LQRA 1KEGH 3QHTC 5BMFL 5C0CD 5CD5C 1U8LA 1PG7L 4G8FB 4HJJL 3Q3GA 1EX0A 1A3RH 4Y4KD 3TNNB 4YXLL 1GGTA 3OZ9H 4L5FL 4N5EC 1JFQH 3VCLB 4I9WE 1AXIB 3L3IB 1OCWH 1JI1A 4U3XA 4XCYB 3BN9C 1LO4L 2IBGA 5I1EL 4IRSC 3ARBD 4PJIB 4CGTA 1N59B 2LV4A 2B8OT 1MCSA 1AJ7L 4HD9A 4JDVB 3DYMA 3UJTL 3VD9A 1YMMD 4QHLA 5HGDB 4QHMA 2Z31D 1K9TA 3ARFC 1WFUA 5C09E 4EI6B 1CCZA 1IFHH 3LN9A 1A14L 3GSNL 4R2GB 1F6FB 4JB9H 4BZ1H 4YXHL 1FAKT 4HGKC 2Q6WA 3P0YH 3NCMA 4PGEB 5FKPB 4TNWF 3KAAA 2VLRB 3L3HB 2QADC 3KYOA 4D0BA 2EDRA 1KCUH 5F89B 3EYFA 5C0JA 3WFCL 1BFSA 4IOSD 4JHBA 2J8UA 5C2UB 2VO5A 1MIEL 2XV6B 5C3LD 1VGKB 1DQJA 2B4CC 2HT2C 2W0KA 3CLFL 1OAYL 1MFEL 2E9JA 1OARH 5CMAA 1MH5A 1K8DB 1ZA6B 2CIIB 3LEVH 3GBLA 3M1BA 1RSFA 4FMFA 2H8PB 1MHEB 3NIFE 2JF1A 4LSDA 2GJ6E 4KJQC 3T4AB 2I07A 3PV6B 1BOGA 3FOMB 3HC0A 4CRPA 5DT1H 1RPQA 1P53A 1IQWL 3WLWC 5EO0B 5IVNA 3P9LB 5EBGA 3RFZC 4LLMA 4PS4L 1FVDB 4ONFH 1GHFH 4F7EB 1LP9F 4L8DA 4P2QA 1Z5LA 1P7QB 2R4SH 2O93L 5TDOB 3IETA 4DVRL 5D96B 3L5IA 2YXFA 1MELA 1MCFA 2Q8BH 1UZ8B 4TNVF 4Y0GA 1U8KA 1DBBH 3CX2A 2AK4E 4HH8A 5KS9A 3OSKA 3W5MA 3SCMA 4FXGB 4X8JB 1S7UA 5TDNA 4HJ0D 5I15H 1YYMH 4Y89A 5ADPL 3EJJX 5FB8B 2F54E 1KLGA 3OGCA 3PIQA 3DUUB 2VB5A 2VQ1A 1HZHH 3I9GH 1QFOA 4JGMA 4R7DB 5DGRA 1RJLA 3BQUB 5L9DL 4B53A 3DX9B 1KCVH 4ZUVA 4LCWD 3MRMA 4AH2A 4X4ME 3VXPA 3V5KA 3T3PE 4LCIL 5IMMA 4X99B 1PEZA 3TN0B 1P69B 2QKIB 5IIEA 1T1YB 3K2UH 2WW8A 2ERJB 2V2TB 1YN7A 2V5YA 5C0CA 5IVZA 3ULSB 5J1SC 3QEQD 4NO3B 2AV7B 4L3EB 3QG7L 4YDKH 3PE9A 3D1MC 4Y4KA 5TE7H 1JWUB 3QUYD 2XRAH 5IJKA 5GIRA 1RMFL 2GTZB 3DRQA 5DC9B 1S7SB 4QEGA 2XZAH 5ILTH 4L4JA 4QOKD 3P4MA 5IOPB 32C2A 5F7MC 2XACC 3ARBA 2J8UF 3H6JA 3ZE0F 9CGTA 5EU7C 5ESAA 5IBLC 4Y4FC 4MAYB 3P4OA 2A6JB 1XGRB 1WQVT 3WE6B 1BQLH 4XXDB 5E95B 1S8DA 1GAFL 4OGAD 1LO5A 1YMMA 4LFHD 1JGVH 4ZFOB 3JTTB 4XMPL 5TPWL 2Z31A 2XIDA 4IMLA 4PJ9D 2H2SD 4G42B 3GHBH 3KNBA 3ZE1E 4QNPF 5F6HI 3SO3C 4O02L 1LK2B 3G5YA 1IMHC 1NAMH 5CJOL 3GI9H 4NZUH 1BFVL 1CR9H 6FABH 3QBTB 2NY6B 4WGWB 4P23B 5J06A 5LGHL 4EI5A 3QPQD 3FONB 5F9AC 5LVEA 3VFWA 5HHXH 5F9JA 4K8RH 2C3VA 1UJ3A 3NACL 4FQXC 4XBEH 1XF3A 4I18A 4H26A 4JZNA 5C3TA 2ARWA 1J1XL 4N1CA 3VG0L 3FT3A 5I9QB 4DCQA 5ICZA 3BD4A 2VLME 4JR9H 4M3JA 3AU1A 3BPLB 1F8TH 3H9HB 2P46B 4LLYA 5KS9F 3ARSA 5DI8B 1HYSC 1IC1A 3GIVB 2BY2A 1H3PL 1X5AA 4JG0L 3OMZA 4HC1A 4DGIH 4NPYA 2EE9A 2Z91A 2DB8A 1DDHB 1U8MB 35C8L 3P9MB 4NNXB 5E2WL 1G7JB 2X09A 2WQRA 2R4RL 1I9IH 1U8IA 5I74B 3BJLA 5F3BA 2FR4A 3S3SA 2W0LA 2DQDL 3HNTH 4O4YH 4NRYA 4B0MM 4JHAL 2UZYB 1MHCB 2DQUH 4PLKC 1M6OB 2NQCA 2DTSA 2VDOL 2WBJC 3I2CH 1XCQB 4XHJC 3VDBA 3W2DH 3LKRA 4LHUD 3FFCE 5D71L 6CGTA 3VXNA 1MFNA 3E0GA 5T33L 2EYRB 2XNAA 5EOQL 3DURB 2XWJB 2R8SL 4O2EB 2X41A 2VLRE 1B3JA 3MR9B 2G60L 1CFVH 4S2SB 1JTTA 3IDGB 2BC4A 3QULB 1KXVC 3FO9B 2XWBA 3PWLB 3UDWC 2GSIB 2P7TA 1HSBB 3BO8B 3VXME 3B9DA 3TZVB 4G6AC 1NANH 1OTUC 2V6HA 4N1EA 4X5WA 3VRJB 3GSUB 4LCWA 4Q6IA 1EMTH 3GMNB 3MSPA 3TBWB 4X6FB 5I1AB 4FP8H 4YGVB 2MNUA 3NMEA 4YHNA 3KHQA 2AJXH 3EJZC 5DJ0A 4D0DB 3VXTB 1F3JA 2PR4L 1A22B 1YZZA 1CYGA 3N85L 2R1YB 3E2HC 2J6EH 3WD5L 5K9OA 1QFHA 3OR6B 4FFZL 4I77L 4NWTL 4L29B 4HF5H 3QEQA 5B39B 3VW3L 1WIUA 3QUYA 1IGIH 1HEZB 4QHUA 4Z0XA 3CVHL 1UYWH 4X7EC 3FCTB 2PETA 3VRIB 4QOKA 1J05B 1F5WA 2DTML 3HAEA 4LSSL 2VISB 5CP7B 5JNYA 4FQJL 2H9GB 2NY2B 3Q1SH 1VKXB 4ORGA 3ZDZE 1H8SA 5DRWA 1FO0L 1FNEA 1BX2A 5D70L 2M1KA 3DOSA 3EZJB 5T1KA 1PKQB 2HP4A 4AIXA 5TH2B 4PJ9A 1ZOXA 2EE6A 5DHVA 1I7RA 1G7LB 2CIKA 3MOBH 2YKLL 5CSGA 4EN3D 1I1AB 3O2WL 2A73A 1MCHA 2QQLL 4X4XB 1UH4A 3O8XD 3W9EA 3ECBB 4M1CC 3VG9B 2HKFH 3GSVB 4U1JB 4XP9L 2YBRB 1R5VB 1LNUA 4LNRB 3WIIL 2WWKT 3NTCL 3LZFH 5DK2A 1FL5A 2FWOB 2BOBA 1WBZB 2V7NB 4E41B 2BFVL 3GB7B 5KW9L 5SX5K 3V8OA 3DO7A 1G6RA 5JW4Q 3LH2H 3EIFA 1K8IB 4LLQB 4XH2A 1CGSL 1OGAD 4EXKA 3C5SA 1C16B 5H35B 3BPNC 4OLVH 4BA8A 4S10A 4KKCD 3MA7B 3T0ED 2X1XR 4CU6A 4FFWC 4DZBA 3MRIA 1F45A 2OSLA 5F9WB 4UTBL 3IDYB 4PRPE 4OJFL 2DICA 3GMMA 1I8LA 4RGNC 4XP5L 2I9LA 2VMFA 2F74B 1P4BL 1XGYL 4WGVB 3NAAL 2FCBA 4DZ8B 3T4YB 3UMTA 3QDGE 1V7MH 1SEQH 4P46B 4MYWB 4FQQA 4K3JL 3EDJA 5IBTL 4WEBL 4JPKL 4KVNL 4NN5B 1I4FB 1AD0A 2X4TB 1IARB 4C4KT 1MRCL 4LHUA 5E1AB 5TQ0H 1CDYA 2FGWH 1OWRM 4RIRB 5F3HA 1JRHH 3SKUD 3W82A 1JHTB 2HVKA 5DGQA 1OHQA 1FSKB 2GAZA 2OJZH 4S1RL 5B21A 1MJJB 4PJ7B 4LPUA 3UZEA 4M1DH 3VXRA 3MRDA 1UVQA 1RZ7L 4Y5VC 3BPCB 1ZK9A 4HZLA 1J1PL 3MLRH 4E42B 4J6RH 2HTKD 1JGEA 4YHYC 4D0CA 4OCNC 4JFDA 3MV8B 3OXSB 4K8RC 2XQYG 1QFUL 4MS8C 3PG2A 4NZTL 4FQ1H 4J12A 4R0LB 4MJID 2ZP0T 1MJ7L 3MACL 3QH3B 5DQ9A 5A1AA 3MJ8B 5JOPE 3DRTB 3IU3A 3KPPA 1J7VR 1EUTA 2IF7A 5EU6D 3QXVA 2GUOB 1AR2A 1WK0A 4X5XB 4PGCA 2YRPA 3CMOH 1GGYA 3EGSA 3QEGH 1A9BB 1T6VN 2KBGA 1HIML 5GS0D 2IWGA 2DWEB 1RUAH 1CT8A 2WLYA 1IKNC 5AUMA 2FSEA 3LEYH 1F42A 4G6KH 1A1OA 3MBED 4MD5B 3RWJA 3VJ6B 3GMPA 2R15A 5I1IL 4OFKA 4FQIH 2GTWB 4BZ2H 3QRFM 2WIMA 5CGTA 1OY3B 5F21B 1AD9A 1FZMB 1IFHL 5F1IA 1A6UH 3K80A 4JB9L 4WI5A 4BZ1L 1WWWX 3LQMA 4G8GB 4WW2B 4XCFH 4JY6B 4XTRD 3ORJA 1DVFC 3DX7B 4BFIB 2Y6SC 3S6CA 4TQEL 2KPNA 2CKBA 4R96A 1A0QH 3HN3A 3NPZB 4XNUH 1KCUL 5C2BH 3CFDB 4QRRE 1MCQA 3QDAA 3KS0H 1WZ1H 5FUOH 1FNGB 2X1WL 3H9SE 3CH1B 4XCEA 5DMJB 5HHNB 1OTSD 3B3IA 4PV8B 1J11A 1LO3L 5BW7C 1PSKL 2MWCA 1OGAA 4NQCD 2VAJA 3GSRB 1RFDH 3UPCA 4JVWA 3V7AE 3LEVL 2B1AL 4XBPA 3U2SB 3T0EA 3H7BB 1BJ1H 3P0GB 3LS4H 5MEQB 1JI2A 3F7RA 3BZ4B 1BQHG 1HHJB 1JN6A 4IRJB 4IJ3C 3BOVA 3V6OC 3PP3K 4I4WA 3K4ZA 4YFEA 3PP3H 3VFOA 1F6LL 2XN9E 3ALWA 5IHUH 2SEBA 5GJSH 5HHQB 4ONFL 3OKDB 1GHFL 4LLUB 3O0RH 1Q9WA 5ERWA 1SJVA 2R9HC 3O4OB 4NKIL 1RZIB 1NFDA 1H0DA 5EU5B 3BW9B 4K55A 5CUSH 2CO7B 2IH1A 3MJ9H 3KDMA 3MLSL 1UXWA 3HRZB 1NH6A 2BVUA 2X44D 3ZKNC 3EJYC 4EKXA 4M48L 5JW5A 1LILA 1S7XB 2X4NA 5GSRB 5I15L 3DVNA 1JTPA 1YYML 2ITCA 5EORH 4P59L 5C0EA 1QP1A 1U8NB 1MAKA 3U83A 3CD4A 5EG6C 4PGDB 5K9KA 4ZOBA 1HZHL 3NGBC 3I9GL 2AJ3A 1M05A 2BCKA 4E41E 3QCVL 2ADJB 4H0GA 4JO3H 1D5MB 1KCVL 3EOYG 4MJIA 3SKOB 2VABA 5SWZD 4ONOA 4MD4A 1MLCA 5E1HB 2DN7A 3HZMB 3ZHLA 2WUBH 3PHQA 2ARJQ 3L6FB 5D2NE 5EU6A 1MFDH 3SN6N 2ZOLB 4KUCD 3SGKC 3TCLA 1I7TB 1IJ9A 2RBLA 4MMXC 2BSRB 4YNYA 1U36A 2FO4B 2VXUH 5TE7L 5FYLH 4XVJH 1M71A 3D3VD 2YWZA 3QCUL 4K3DH 2XZAL 3CSBA 3IJHA 5ILTL 3ZKMC 2HJKA 1OSPH 1AHWC 5GGRY 4YFLI 3NA9H 5M95B 1U3YA 1YYLL 3MBEA 3UPAA 4ZTOH 1BQLL 1CFQA 1ZLWK 3CAFA 4ONHA 1ZLWH 5HDOA 3BP7A 2V2WB 1JGVL 5AZEH 1B88A 3EDKA 1ZVSB 4JO4H 1EXUA 5C0NC 1U9KA 4XXCC 4GXVH 5FCUL 3K1KC 4PJ7E 5JOFB 2QV2A 2IPKB 2NW3B 3M8OH 4RAUA 1NAML 3GI9L 3X3FL 3KLHC 4X6BB 1CR9L 1L4IA 5D2LA 5DJDB 6FABL 3SBWA 3MV8E 3KPOB 2E8ZA 3PL6D 2FL5B 4GAFB 1BZ7A 5JHDD 5HHXL 4BSWA 1EZVX 3O6MH 3LQAL 5CZXD 2G9HA 1Q9KA 1U8HA 1VPOH 3BGFC 4CADB 1R3LA 5K9QI 3JV5A 4RA0C 4DN3H 4M8QA 5E9DA 3V52L 4QRTB 4JR9L 4NQCA 4L8SA 5FA4B 1TZGL 4CU7A 4I1NB 1NAKH 4GBXB 4LSUH 5EBWA 2R0WH 1LD9A 2VL5A 4JANA 3P73B 4HH9A 1K2DA 5D5ME 2ZSWB 1I7ZB 2ADIB 2DQTL 5DRXB 1MCBA 3VFGL 1OT2A 4HIXH 3GNML 1U91A 3UJJL 2X1QA 4L8BB 2C1OB 4MX7A 3MBXL 3P30H 1I9IL 4NM8H 3D18B 2ZNWA 2CKNA 3F62A 4OGYL 4PJ5D 5C0DA 1ZV5A 1B0RB 3JV6A 2ZOKA 3HNVH 3FB7B 3AVEA 3T77A 1KJVA 2J88H 5EBLA 4BELD 3I2CL 2VZ3A 3W2DL 3F7VA 4F2MB 2YK1H 4LCCA 5EUKA 4LEOA 3SDYL 4G8GE 3TJHC 4LCUB 3EYQC 4YBQC 2BVYA 2EH7H 4KY1H 4YHML 5T3ZH 5D1ZD 1CFVL 3W9DA 3OKEB 4TVPE 5HD8C 3O2VH 2YMXL 5GS1A 3G5XB 4P3DA 4U6YA 4P3CL 4U49A 5H94A 1PVHA 3H2WA 1OAXH 5SWZA 1E6JL 2C9AA 1SJEB 5C92A 5TF0A 3QIUD 3L5JA 4FP8L 3V6ZA 5GGVL 5L8LB 5ID1B 2OTPA 2AJXL 2ICEB 1U0QA 3RKDC 1NDMA 2DM3A 4HS6A 2X4SB 5IQ7L 2ZG3A 3D69B 2AS5M 3WUWB 1N3NB 5BO1L 1P4IH 4XC1L 3R8QA 3RVTD 1FZOB 4HF5L 1TQBB 1HKLH 3LKNA 2O5XL 4X6CE 1MHPH 2FIKB 4R97C 3RDTB 5D2LF 1IGIL 1VDGA 2D31A 4JGUA 3D3VA 3VWJD 1UYWL 2HLAA 1KOAA 1Z9LA 3N1GC 5GZND 4Z77B 3GJFB 1RIVH 4OZHA 3CFBA 4Y5YA 3BZFA 3L7FB 4ALAH 3C09C 3HG1B 3Q1SL 5I1CL 5J56B 3JV0A 5DEFA 1CLOH 3A6OA 2H3NA 3B2VL 1CGWA 1HXMA 1QFWL 1YY8B 1NGQH 4JJ5A 4PTTA 2EYTA 1M4KA 1WT5A 1KSRA 2DIJA 4EZMA 3A67H 4QY8A 4F8TA 4Y4HB 4WRLA 1A47A 3MOBL 5F8RC 5HPOA 5HTSA 1NJ9B 4POUB 4I0PC 5BS0D 4M61B 4GOSA 3GEWB 4MMZC 4W6XB 2EXWC 4XWGH 5H37G 5GS3A 3PNWA 4YFDB 1DUZA 2Z4QB 4AEHL 1OP3K 3PL6A 5BZDA 1OP3H 2NTFA 1ZLUH 3LZFL 4XAWH 3U4AA 3WKNA 2I5YL 4Z7VA 3NIDF 4H0IA 1YJDH 1KLUB 1JCKA 1M7IB 4LLWA 4W4OA 2OR9H 2CPCA 4YHIA 4BQCA 3V79C 5DFVD 3PWUB 1FIGH 2YUWA 4OLVL 3D2UA 3NIGF 2ZSVA 5A2LH 3G9AB 2E3VA 1EDQA 1VADA 3BVNB 1R3JA 4RGOH 1KJ2A 5F1NB 3WV0A 3ZTNH 2IBZX 4TUOA 1R5WA 1YPZB 4PG2A 5JA8B 3EYUH 1QSEE 1F11A 1U92A 3KWWA 3NFSH 4N9GA 3P77A 4PJGB 5ADOH 4S1QL 1YNKH 5D1XB 4PJ5A 4LIQL 4KDWA 1SEQL 5L2JA 1QBLL 4IIQA 4GO6B 4WV1A 2Z93A 5MEPA 1GYAA 4KZDH 2Y36H 1XH3A 4FTVD 3K1DA 1UCBL 3S5LA 3AB0C 3GSQB 5B4MD 4U1GB 1A4KB 3UAJC 1PY4A 5TQ0L 5KVFH 1LO2H 2FGWL 4HWNA 4KUCF 1JRHL 3P4NA 4XNZB 1NANI 2IANB 2OJZL 4X6DA 1LQSR 2BX5A 2OL3B 4M1DL 1GZPB 5D1ZA 4KTYA 1BBDL 3JWOH 3LSOA 4J6RL 4IRZH 3QIBA 5DA0B 3V5DB 1S9WA 5ANMA 1A7OL 2Z0BA 1A6AA 3I84A 2ARJB 2YUZA 4JFYA 4WU5B 4JPIA 4PJ8C 4PY8J 1DFBH 2VDRH 1CDGA 3F6IA 2W9DH 5B22A 1YEIH 1II4E 4MDIA 4YO0B 1X5XA 2I25N 3D39B 4HXAH 2XTJC 1XCTB 3QUZB 5FKAB 4NO0D 3FO2B 12E8H 5D8JH 4BZYA 5GRJL 2EC9T 3VWJA 5JIHA 3S3JA 3Q3GB 3SDAC 1VFOA 2V5RA 4PV9B 5AYUL 1W2KT 3P2TA 4P5TB 3SDXF 1QPXA 1Q94B 1JK8B 4Z7VF 1P4LA 4OUUA 2F15A 4TSCH 3CUPB 4X9FA 1MQKH 3O3BB 4S0TD 5FA3A 4JFOB 1JMZA 1B6DA 3A6BL 4LRIC 5D1QB 3MCLL 4FQIL 4NC0B 3M17A 5GRUH 4NZRH 5GZOD 5FO8B 3QIWB 5F72S 1I3VA 3ZYZA 2EDQA 4CL7A 3CGTA 2Z8VC 1X5HA 4WUKL 3ULUL 1A6UL 2BNQB 2VXVL 1F6AB 4QHLB 4CAGA 4QRQA 5BS0A 4F7CB 2BHUA 3FKUS 5DLML 3MLZH 4JJHA 4PRHA 1KFAH 2W07A 1A6TA 1EFXA 1U8JA 1ZA3A 4XNUL 3L95B 5M94B 5GSVA 5DVLA 1MCNA 5FUOL 1C12A 2PYFB 5CIPH 3FHQA 2DWDB 1FDLH 3PDGA 4Y19E 2AJUH 5A2JH 4HKXA 1DE4A 4K7FB 3BN3B 4IRSB 1UXSB 5C0JB 5KSAB 2R1WB 4U3CA 2W0PA 5D7LD 1WZMA 2J8UB 3VFTA 3TT3H 2J3SA 5J8OA 1DQJB 3DX8A 4JDTH 5C0BD 1EHNA 3TVMD 5CMAB 1IT9L 4X6DF 8CGTA 4G9FD 4R4BA 4NQDB 4WNQA 2BHYA 5EPMA 4DKEH 2YPLA 3U9UB 5DRZA 2IALA 3M1BB 5IROA 2QEJA 4Y1AB 4AIOA 3HG1E 1JTOA 2VDMH 4OGXL 1JRHI 3FN0H 5DD6B 2I07B 3O0RL 2QADB 3I02B 5CZVH 2XG4A 5HPMA 1KN2L 4I3SH 3OF6D 4HUXB 5L6YH 2X4PA 3RGHA 1DTUA 1Z5LB 3Q48A 2IFFH 3TBYA 4JY5H 1CDBA 1CK0L 2D7PA 3PJSA 5EORL 1IL1B 2OJEA 2W38A 4P2OD 4XVSH 3MXVL 3TFKD 3ARZA 1WIPA 1QHPA 5JDSA 5KS9B 1OM3H 1ES0A 4YIQA 1IBGH 1S7UB 4RMTA 4N5UA 3B9VA 1KIUA 4JO3L 5DJ8A 1NDGA 1YJDC 3PIQB 3NBNA 2YZ8A 1KXTB 3V2AR 1NCAH 3X3GH 2HKHH 3HPJB 3MRKA 4X7DC 4MJ5A 3OAUH 1MFDL 1JWSB 4ZUVB 1XZ0A 1TCMA 2ICES 3AFLA 3MRMB 4AH2B 2P5ED 3VXPB 1S3KH 1YPZE 2EDKA 3KLSA 1KJ3H 1OQXA 5FYKD 2AEQH 1IGML 5IIEB 3U46A 1MWAB 2BMKA 4XVJL 3VFVA 4JPVH 4EVNB 2ZCHL 3RNKA 1ZS8B 2VE6A 2DF3A 2XFXB 4K3DL 1RIUH 5IW6A 3MLYH 4PJGE 2FJGB 2HJFA 1OSPL 1TITA 4TULL 2BY1A 3DETC 3NA9L 1GL4B 3R06A 2D7NA 3D5OF 4W68A 1RHHA 4M5ZL 2BZDA 4GRLA 3ROLB 4Z18A 1IQDB 5K9JH 5ESAB 4HLZH 3G5VA 5JLZA 1D5BA 2IANE 4GXVL 3N1MC 4M3KB 4GKSA 1S8DB 3RRQA 3SCMC 1MCPL 3C5ZD 4ZUUB 4M1GL 1R5IB 3JWOC 4PP1C 4UOW0 4WU7B 3MYJA 5J6GA 1MJ8H 4IMLB 4FQHB 4RGMC 5IF0A 5DVKA 3FQRA 2E7LA 4UDUB 3BE1L 3KNBB 1UH2A 4G6FD 5EZOL 1P2CB 1A1NA 3C6LC 1AGEB 1WC7B 4KK8C 1E27A 3O6ML 1KTLA 3KYMA 1ETZB 3AS1A 4GLRH 3ZT7A 4OF3A 1J9CT 3SGJC 3VE0B 4EI5B 3O6LH 1JF6A 4HUVA 1WFNA 5J57B 3D85D 3BZDA 5C07D 4Y4FB 5K59E 5KG9B 5D7LA 2C3VB 3WIFA 4S1DC 4KKBC 1XF3B 3A6CH 4KZEL 1INDL 3MRQB 4LSUL 3VDCA 2EEBA 2R0WL 4H26B 1RIHH 5D93C 5C0BA 3TVMA 5DC0A 4Z76A 1P9MA 3FT3B 4DCQB 5ICZB 4HIXL 3UX9B 1A1MB 1U3HA 4MQXD 2WANA 2X40A 5E08H 2FHBA 4LLYB 1FBIH 3P30L 3PWPB 4MXQD 1TVDA 2B2XH 3ESVF 5EWIH 5J89A 2VXSH 4K3EH 3SJVE 1CTNA 5KANG 3ARBC 4WO4D 4CJ1A 3OB0K 3STLB 3OB0H 5BRZB 4C56D 5ICYB 1N0XL 5L7XH 1F4AA 2FBJH 2IQ9H 3OX8A 5H2BB 3MLWH 1T89A 5IWLC 5F3BB 2W0FA 1BVKA 1MEXL 4Q74A 3WO4C 4NRYB 2YK1L 1ZXQA 1V8HA 3VXQB 3DPBA 5JR1H 2BNQE 5JXAH 4R4ND 3ARTA 5FDWA 4NNPH 2D4FA 3WNOA 2GFBB 3RAJH 4Z7WF 15C8L 3DV6B 3GK8H 4PD4K 2RIKA 3LKRB 3QUMA 3VMNA 2A77L 2MCPH 3S36H 1GJIA 2CUMA 2HMID 4RMSA 3BH9B 3QG6A 4JKPH 3O2VL 4OQ1A 3TBTB 3P9WB 1WFOA 2ADGA 3KXFD 5DUPH 1FYTD 4EUPH 1CL7L 1NGZB 4MNHA 2DMCA 3U4BL 1OAXL 1CXHA 2E9BA 3QRGH 3GBNL 4GJTB 1NGYA 3BP5A 2GYSA 4GKNA 2BC4B 2ICCA 2K3TA 5CILL 3BXNB 2XWBB 1DL7H 3GO1H 3IAQA 1KIPB 43CAB 2ESVB 1MCIA 4GMTL 3SE9H 1LEKB 3KG5A 4PPTA 4GG8B 2P5EA 4ACPA 3G6DH 4NQDE 1GZQA 1CIDA 4DJMA 5IKCB 4Y1AE 5E8DL 2FBOJ 4OUOA 4KI5F 4GG6E 1RIVL 4YXKH 2R29L 1EGJA 1GGIH 4PG9B 5DMGD 3QUYB 4OZGE 5F6IC 4QHUB 4K71B 1PDKA 1CLOL 43C9A 1U42A 3BHBB 1NGQL 3LN4A 3AY4C 1AR1C 3LKPA 3L7EA 3RUGE 4PJHA 2J2ZA 3A67L 1KTRL 3NABH 3AAZA 4ORGB 4U2YA 5DRWB 1AKJD 3HI6L 3T0VA 3C5ZA 2QSTA 3E2HB 3HR6A 4I48A 4LAJH 5T1KB 1VFBB 1FIEA 1I7RB 4LKXB 2CIKB 4ISVA 1GC1H 5KANI 4KMLB 3WLBB 3IXAB 4IDLA 3FQUA 4PJCB 2A73B 4WJ5B 5IK3A 2GY7B 1NCCL 2WAHA 2DI8A 1O5DT 4XVUC 1N6QH 3EO1A 3ESUF 1LNUB 1YJDL 5J7CC 3DVIA 2XA8H 4U1KB 3D85A 5K93A 2OR9L 5GGSY 5C07A 5DK2B 3O6KL 3RPIA 1FIGL 2R2BA 1FNSH 3F5WB 3DO7B 1G6RB 3S37H 3U1SH 5F44A 3QDHA 2YS4A 4XH2B 4X80H 4RGOL 4UOW1 4M4RA 3L3DB 2F19H 3C5SB 4APQD 1GOFA 4W81A 1PBYA 5DXWA 4I9WD 5KVEH 4P2RE 3V4PL 4DAGH 2A83A 5C0FA 4TYUA 5JW4M 1A7BA 3MRIB 5ADOL 2OSLB 1YNKL 2DKUA 5EU3A 1FNHA 2DM7A 1CFBA 3L3GA 2PKDA 3IJSB 4C56A 4Z7QE 2H6PA 4J1UA 2XZQH 4OGAC 4KZDL 1T6WA 1XF5A 1Q72H 4JY4B 3R4DA 1PX4A 3SE4A 1ZEAH 5KVFL 1XF4B 4FQQB 1IC5L 2OI9C 4DKAA 4NRZA 4YK4C 4MCYB 4EBQH 1ZHBA 2H32H 5ACMA 3ZKSD 4MA3A 3MO1A 1OTTD 2P45B 2G2RB 1MOEA 2N7BA 3JWOL 5F3HB 4P5MA 3IFPA 3QDMD 2HVKB 3QPQC 5DSCB 4RGNB 3VXRB 1E4JA 3MRDB 1UVQB 2IG2H 5JORA 2UY7A 4HZLB 1FFRA 2KKQA 4LASH 3UBXA 5EU7E 3RKPA 4JFDB 4F57H 4XNQA 3Q5OA 1DFBL 4GQPH 4PJHF 2YSSB 2VDRL 3VXSA 5MENE 2MHAA 2W9DL 1YEIL 3RWCA 3IGAA 4NKDB 3RHWF 4NQUA 1AP2B 3GZKA 5IFHL 4OLZH 2CDGA 3TBSB 1ZLSH 1JPST 1NCDH 1XGPA 2GJ6D 3KLAB 3NFNA 3LKQB 3EUUA 4WW1A 3PWPE 4HUUB 5GS0H 1YEGH 4PGCB 1X9QA 3T1FA 4M02A 1IRAY 4MQ7A 1CU4L 5F7LB 3SHSA 5BRZE 4Y5VB 5KOMC 3E6HA 5T1DH 4PY7A 1CLCA 5BCAA 1T3FB 2GITA 4TSCL 4L4VA 4OI7A 1H3TA 1MQKL 1NUFA 1CT8B 5AUMB 2FZ3A 4ZAKD 4PD4J 2IFGA 2Y5TA 5H8DA 3UYRL 5ALCH 2AK4D 1GIGL 1AKJA 1OAKH 4EIGB 4CVUA 1AD9B 3ARPA 2F54D 4KROD 3ARDA 5TE4H 3MLZL 1A02N 1PY9A 1J8HA 3O11A 3FHAA 1GSMA 2JJSC 3O2DH 1S7TA 4YJZL 2YPKA 3GSWA 1BEYH 5LBSH 4K07A 2BXZA 4YPGB 3VFSA 3HMWH 1CBVH 1A7NL 2CKBB 3LPFA 2GT9B 2VIRB 5JW3H 5KSUA 3AROA 4EEEA 1AC0A 1ZT4A 1AFVH 3RGVC 5HGAB 2ESVE 3GSXB 3PGDB 1KN4L 3TT3L 1I85A 2BOCA 4JDTL 4RISL 1IM3B 4HXBH 1JPFB 3B9KC 3RWDA 1AGDB 2YHGA 4APQA 4ZYKA 4HC1L 5DWUH 2NXYD 4PGZA 1QUNA 3O6FA 2VDML 2P8MA 4JKMA 1BAFH 1RJYA 2VN4A 3Q6GH 1OD7A 5CZVL 5HVHC 4JFFB 3MRNA 3MUGA 4I3SL 4KK6D 2R56H 2X5PA 2OZ4A 1KCSL 1BHGA 2NLJA 2X4QA 4GRMB 4QKXB 3WSQH 4N68A 4Q97A 3H42H 5C09A 2FO1A 1Q9WB 3LPGA 4GW4B 3EOAA 2YC1A 1H0DB 2BRRL 3RWFA 4EN3C 2LABA 5EU4A 5IGXL 4J8RA 1ZLVK 1ZLVH 2OP4H 3O8XC 5HI4D 4GRWH 4XVSL 1GC1C 2N7AA 3QXWA 2NY3D 2VLKE 4PJCE 4RNRA 1OM3L 5FUZH 3DVNB 3BUYA 5D7JC 5C0EB 3ULVH 1Q9LB 5J9PA 1RY7B 5B8CC 5K9KB 2B20A 3MRFB 1NCAL 3IDIA 3X3GL 2AJ3B 2QLVB 4MGXA 2BCKB 3V9FA 2VLMD 3TNMB 1DZBA 3OAUL 5CJBA 4CNIA 4DWHA 1DANT 2VABB 1NLDL 4M7JL 4LGPB 4JZJA 1S3KL 4J3SA 5IEKA 2AI0L 4ZUTA 3K8LA 1KJ3L 1LDPH 4X8XA 4YHPA 4PRBA 4H0HB 2GJ6A 5EU6B 4JPVL 3H3BC 5E7FA 1MCCA 2WV3A 1MFAH 1VEOA 3BZEB 1QR1A 1RUPH 5MI0B 2OXHA 2H1PH 3ALXA 1JE6A 5DHYB 3MLUL 4M6AA 2D0HA 1M71B 3NGBB 2VKXA 5HHOE 4X7SH 4JO2L 1XR9A 2YUVA 3TIDA 4XCCH 4E5XA 3IAGC 3WFBL 5K9JL 1TZHB 4ZAKA 3BKJL 1DCLA 1CE1H 2GCYA 4R2GD 2R1XA 1X4XA 3MBEB 2AJYL 2FH8A 2IGFL 3ZL4H 4HHAB 3EHBD 1F2QA 2F53B 2VLJE 3HZVA 2AK4A 4O58L 3ILPB 1CFSB 4HK0B 3HAEG 2P8LA 1JIBA 4LSTH 1EXUB 2F54A 2PCPB 2VLRD 3VH8A 1RUQH 4O2CB 2HTKC 4ZOCA 1MF2H 3W0WE 5A16B 4RGNE 1G9MH 2G75A 4ZS7H 3GMLB 2M26A 3KPRB 4HLZG 1BF8A 2WZPD 1KBGL 1SY6H 3FOLB 1N5AB 4X4MA 1EA9C 3O6LL 2HG5B 4M9OA 4ZO9A 4OIBA 3BH8A 1BQSA 2OTUA 5CD3A 3S4SA 4HQQL 5IHLB 2G9HB 1B4JH 1Q9KB 2P8PA 3A6CL 4HKZA 5SWSB 1LGVA 1RIHL 2CLRB 3G6JB 4DUVA 4M8QB 5E9DB 3OXRB 4L9LC 2IPUK 1J18A 1TQCB 2LU4A 5GS0C 4AIZA 1AE6H 3CFIC 5EBWB 1KTDB 1EHAA 1FBIL 2CUIA 1Y6NR 2VL5B 1MCWW 1L9NA 4JANB 4HH9B 5EWIL 2VXSL 4KRNA 1SYSA 1H15A 3CZFB 3LIZL 4KQ4L 5IHZB 1U91B 1IAOA 4NQTA 2VR5A 1U93A 1P7QD 2MKWA 3RQ3A 2IQ9L 2D2OA 3UJIH 1HQ4A 4HBCH 4HJGB 3KPNA 1DBAH 3BGFB 4KTDH 5C6TL 5I2IA 2R2EB 1EPFA 5JR1L 4QXGH 3BMWA 3WDHA 1V3JA 4QGTA 3T77B 4JKKA 1KJVB 2AEWA 3RAJL 1AIFB 3L5WA 3NIFF 4HCRA 3GK8L 5EBLB 1E0OB 4L8CB 3F7VB 5I71C 2EDHA 1IAIL 3S36L 3WNNA 4LCCB 4H25A 2RFXA 4YC2B 2MTPA 3QFDA 3BQUD 4XAKE 5DUPL 5DUML 4ZUSB 3BI9X 4UNTA 4LHUG 1A7RH 1OTSC 1F90H 5GJTH 3TN0D 1Y18A 5EIIA 3BKMH 4OLEA 3T2NH 5INDB 4OV5B 3CFJA 4P3DB 4U6YB 4WFGE 4K94H 3DO3A 1N5YH 3SE9L 4L3ED 4NM4H 4F58H 1T21B 5IB3B 1PYWA 3MGOA 3CXDL 3QFJE 3H9YA 3TNNA 4EUPG 3G6DL 1CG9B 2VLLB 2HT3C 4DK3A 2A9NL 4YXKL 1X5ZA 1G7HA 4HK3J 1GGIL 3OKNB 4MAYD 1F00I 3WIHH 1JGUH 4JFFE 5F71A 1Z3GH 1WTGT 3T3PF 5HGDA 2D7OA 4Y5YB 4EI6A 4ETYA 2HLFD 4LAQL 4B7LA 3EO9H 3I50H 3NABL 5DEFB 3VFUA 2ZG2A 1X5LA 2X9WA 4YHLH 2X4RB 4JJ5B 1GGBH 1IGFH 3EDFA 4GLRI 4PTTB 2NY6D 4NBZB 4P23D 4Y5XA 1X5GA 2A74B 2EKSA 2VLRA 3LN5A 3QHZH 4KPHL 2ZJSH 3UYOD 4MCZA 1WGOA 4R4FL 5F9OH 1GC1L 4KMTH 4R97B 1G7QB 3MRLB 3VXMA 3V6OE 3ULVC 1CVRA 1MRDH 4QRSA 1J87A 4L4TE 1OP5K 1KF9B 3PNWB 2NY0B 4GKOA 5IVOA 5JOPD 1K8DA 3C9NA 4N0CC 3WUZA 3OKKB 4P5KA 1QACA 3SDXB 2V9RA 3V7MA 3VFRB 5I1LB 1L0QA 1FNSL 4OLXL 4Z7VB 4JQXA 1MHEA 3S37L 3ZE1F 4X80L 3T4AA 2GK2A 2P42B 4UB0H 2VDLL 3PV6A 4HS3A 4YHIB 4I5BB 1TZIA 3FO0L 1I9RH 2F19L 2Q1EA 3JSSA 3D2UB 2O5YH 1QPPA 4QRUB 4DAGL 1VADB 1MIMH 3P9LA 4I0PB 1OPGH 3MUJA 2VNCA 4UIKH 4F7EA 5FHBH 4TUOB 1R5WB 1J0HA 4IS6A 3KWWB 1P7QA 3LAFA 1I8MA 3PP4H 3W81A 2RCSH 4HKJB 1NBVL 4NP4H 5CCKH 4L3AA 5ISZB 2VN7A 3CIQA 1Q72L 1CXLA 5D72H 4WI2A 3V4VH 1CGTA 1ZEAL 2F53E 3MUHL 4L1DA 5IB1A 2Z93B 1PQZA 5JXED 4X8JA 5MEPB 1NL0L 5HHMB 1XIWC 5FB8A 1XH3B 4CVXB 1CDJA 1UZ6E 2RAMA 2EDJA 4IMKC 3S5LB 2AGJH 3DUUA 2DD8H 4KMQA 4ZSOB 3OPZH 2BVQB 2V17H 5DFWH 5JUEH 3P4NB 4R7DA 1PZUB 1G9MC 1RZKH 3TZVD 3KPRE 4Z9KB 3BQUA 3MOAH 3DX9A 4JN1H 3S34L 4X6DB 3MRPB 3S97C 4LIQE 3RWEB 3G9VA 3LSOB 5HYSA 3OL2A 4OCSL 2ILLA 2D3VA 3TN0A 3QIBB 1T1YA 4UV4L 4MA7H 3RL2A 4F57L 4KDTA 2YRZA 3SDCA 1WIOA 5SWSE 1FYHB 3SQOH 3DHJA 2IMNA 3G6JE 4URTB 1QYGH 2AV7A 5CSZB 4ZPVB 1U2HA 4ODTH 4NQXA 1VHPA 1EFQA 2FB4L 1QSZA 2GTZA 3TH3T 1S7SA 2AEPH 1WTLA 1JPSL 4PRPA 2A38A 1JL8A 5GS0L 1YEGL 3RVVD 4C57C 2FX8L 2AJZB 4L3CA 2XN9D 2NY2D 2K7PA 4G3YH 3QAZB 5GGQH 5A3ID 5ITBH 5T1DL 3QDGA 3S8WA 3I3DA 3WE6A 1C1EH 4OQTH 4XXDA 2DDQH 5E2VH 1SVZA 3RWHB 4M93B 4LSRL 1S9YB 3JTTA 1NCTA 1IKFL 3DTXA 1P4LB 1GVIA 1IAKB 1T0MB 1DQML 3WJJC 1I1AD 4YDJB 1F4XL 3M17B 2NY4B 4P23A 4Q9CA 2NXZC 4DUXA 2AJVH 5TE4L 4MNQE 3FONA 3ZSTA 4JRYB 4ZXBA 3N0PB 4QRPE 3O2DL 3VA2C 3ARVA 3KVQA 3V0WL 3WXWL 4E41D 3WS3A 1ZWIB 1NCUA 1JJUA 3OJVC 4QRQB 3HMWL 3F58H 5DURB 4PRHB 4PJXE 2D0FA 3IFOB 1EFXB 4P4RA 3ZDZF 3QIUC 5GQBA 1L7IL 4K94C 3FT4B 4UTAL 5GSVB 2WP3T 1VFMA 4OFPA 5HGBB 3BEVB 3QWQB 3TA3D 1EEZA 1DE4B 3RVTC 1K3ZA 4D9LH 4XZUB 1X5FA 2BERA 2A1WL 1U8MA 3DROB 3P9MA 4NNXA 4MQSB 1G7JA 4PGBB 5DWUL 5CJQH 4M9PA 4G7YH 4ZQKB 1W0VA 4M8VA 3JUYA 5GZNC 1HHGB 1JGDB 2X1PA 4P46D 3N9GH 4LEXH 3HE6C 4WWKC 4NNYA 4R4BB 4UDTB 5HJ3A 5EPMB 1KENH 5L8JB 1BAFL 2YPLB 3Q6GL 1M6OA 2IALB 4E0RB 1XCQA 1YEFH 2R56L 2V5SA 5CJXA 2O26U 5AEAA 3WSQL 5BQ7A 1RU9H 2CSPA 3H42L 3WJLA 4CVZA 3BGMA 5JXEA 2BVOB 3DURA 1OAUL 2XWJA 3MR9A 4CN1A 4S2SA 3RIFK 5AAWA 3GMOA 4WHYH 2E7CA 1IGTB 3QULA 1ZTXH 3MV8D 3PWLA 1HN1A 4MVBD 3THMH 1HSBA 3BO8A 1W72H 2AXJA 3ZLQC 3TZVA 4QRRA 2C7UB 1EJ6A 3TBYB 5FUZL 3VRJA 3VGAB 3GSUA 2W60B 3GMNA 3FTGA 3TBWA 2I60L 4X6FA 3W39A 5I1AA 5CGYC 4YGVA 3SDXE 3NCYS 5JDSB 3TPKA 1ES0B 3VXTA 2XG5A 2VXQH 4U1NB 5DJ8B 3QDJB 5B39A 3BKCH 1PKOA 2Y06H 1RURH 2EO1A 5TF1H 4Z95H 3EO0B 3HI5H 3MRKB 1HEZA 4MJ5B 2JIXB 2JB5H 3EAKA 1H5BA 4HWUA 2ORBH 1J05A 1XZ0B 4PJBB 4QTIH 3RVUD 5CP7A 1MFAL 2X89D 1RUPL 2H9GA 2XN9A 4Z7WB 1IAIM 1CD0A 2Y72A 3QWRD 4N8VG 1A21A 3VFPA 4PJAE 3RNKB 4X7SL 4ZS6D 5IW6B 1TFHA 5ISZE 2OMBA 3AS2A 5DMIH 3IKKA 1RZ8B 4FQCH 4PUBH 1A2YA 1RZJH 5CSBA 1PKQA 4XCCL 2DBLL 3WDIA 5B4MC 3R06B 2RQ8A 2YD8A 4G8GD 1CXKA 1I1AA 4EDXB 4GRLB 1BBJA 4HIHA 4ZSOE 3ECBA 3D87B 5D7KE 5FK9B 2YBRA 5FYLE 1R5VA 4KU1A 4LNRA 3BESR 1RUQL 3ILQC 1RZKC 5HBBA 4U6HA 1D5BB 1ZVHA 2OR7A 1MF2L 1J0YA 1EZVY 1G9ML 4F15C 2V7NA 4MA8H 2CRZA 4E41A 1YEEH 1ZT7A 3GB7A 4Z7NE 2YOCA 4LLQA 1SY6L 1NQBA 4Y2DD 3HFML 5ELIA 1R24B 5CS7A 5BV7B 4WWID 3DYPA 1N64L 5D2NA 3KYMB 3NPSC 3MA7A 3TA3A 5DDHA 2ED7A 3C60C 2EDWA 2ZG1A 4KGJA 2AP2A 4HUVB 3QT2A 1QLEL 3CU1A 5IBUB 2BSTA 1KJ2L 4IRJD 2UYLB 4UT9L 3WIFB 1AE6L 5LJYH 3QUXC 4HT1L 4L9DA 5F96L 4RGMB 4P46A 5LXGL 5DEGA 1U3HB 5HDQL 1CGXA 1WFTA 4IEFB 2VUYA 1I4FA 4R6UA 3C6LB 4KK9D 4LQFL 2X4TA 1UB5A 3UJIL 4HBCL 1TDQA 5E1AA 4ZFZB 3CDCA 5LCVH 1JHTA 4QXGL 1JPTL 1A3LH 1MJJA 4PJ7A 2W0FB 4WI4A 3SGDH 1UFUA 3BPCA 2DJUA 4E42A 4JRYE 5EO1A 5D93B 2EKJA 1TMCB 2PTUA 3IJYB 1Z0MA 2HFEB 3MV8A 3OXSA 4HWEL 1DR9A 2OK0H 5FDWB 2UUDK 3NCCB 4R0LA 3QH3A 2HN7A 3QUMB 3SE3A 1I7UB 2EDTA 1A7RL 5IFAH 1F90L 3DRTA 5GJTL 2ZUQC 1ADQA 3T2NL 2GUOA 4G43B 4LL9A 1MVUB 4K94L 2JB6B 4X5XA 3KJ6H 1N5YL 1CS6A 4Q0XH 5AWNH 3V8CA 2NY1B 1PJ9A 1NGYB 2EC9U 3BP5B 1FG2B 5J3HC 5A40E 1A6ZB 1A9BA 3WO4B 5D5MA 1I1FA 1OVZA 2DWEA 1QSED 4N0FB 5BMFH 1FGNH 1KPUA 1PG7H 5T3ZE 4GAJL 5KOVC 3FZUC 2X89A 1UC6A 1Q0YH 4YXLH 2P24A 3LV3A 3QWRA 4L5FH 4K9EH 1GZQB 5E6ID 1S7QB 3J8F7 1JGUL 3WIHL 4DEPC 2VOTA 1YN6A 5I1EH 2GTWA 2VZUA 4MA1B 3PWJB 1OLZA 1FFNB 3QNXA 1IEBB 1EHLL 3IYLW 3EO9L 3I50L 1AXTH 3UJTH 43C9B 3ALPA 1T1WB 1DBKH 4G8GA 3GGWB 4WW2A 4YHLL 3DX7A 4BFIA 3L1OH 4ZDHB 4BKLA 4YZFE 3DXAE 5HHVL 3P4LA 4P2OC 3VMPA 3GSNH 5TGBB 1AXSA 3CFDA 4QXTA 3WHXB 4YXHH 5F9OL 5EZJB 4NC1C 5DC4B 1FNGA 5HHNA 4LP4A 3CH1A 4JM2C 1MRDL 4GS7B 2OM5A 3KPTA 4PV8A 1R0AH 3VXUB 4Y2DA 4RMRA 4JCLA 5CP3A 1LE9A 3GSRA 3QJHB 3VFMA 4XPGL 1MIEH 3FQUB 3MJGX 3QDJE 4WFHE 3U2SA 3CLFH 3LEXB 3RWIB 1D6VH 1NBZB 4FABL 3PQYB 4X4YB 5IT2H 3EO1B 1TXKA 3E1F1 2IBZY 1N0LA 4G6ML 3VXOB 4UB0L 2DMBA 1TPXC 5C07B 4X6CA 1HHJA 3WFEH 1IGCH 4PJBE 5DJXB 4QXUL 1SJHB 2Q7YB 4UQ3A 4Z7WE 1L0XA 1MIML 5HHQA 4X9IA 2DQIL 3LVEA 5EU5A 3BW9A 2GJZA 1IVLA 1T83A 2WINA 5CBAB 2A83B 1A9EB 5IM7B 1IM9B 5C0FB 3HRZA 4YDLB 5CCKL 1Y0LB 3GRWA 4OLUH 2H2PD 2EDDA 2IADB 3BGAA 1CICC 1H3UA 2H6PB 3L3KB 2VITB 5D5MF 1WVZA 4D9RE 5FAAA 2XPGB 2V17L 3RA7H 4B5EA 1AGCB 2H41A 2ADJA 2XT1B 1D5MA 1ZHBB 4U1IB 2DL9A 1EEYB 3SKOA 3MO1B 2YEZA 4OD1L 3ARYA 3QJFB 4MD0B 1MPAH 5HHPB 1QNZH 3OKYA 4NO5A 3IFPB 1MI5B 3L6FA 4MA7L 5L9DH 4N0UB 3U0TA 1QBML 2ZOLA 4LNVA 4RDQF 1XF2B 3SQOL 3P0VL 1I7TA 5JORB 4BQ9A 1F2XK 1QYGL 4LCIH 2BSRA 2FEDD 3S35L 4EIZC 3TGXA 3IFLL 2FO4A 1KB5A 3RDTD 4XNQB 5GRXG 5DZLA 5F7WC 1QSEA 3VXSB 1CIUA 2AEPL 3BWUC 2MHAB 2X6MA 5DJCB 1XGTB 2NR6C 4YK4B 3QG7H 3DGCR 5L2KB 3IGAB 2QSQA 4MXQC 4PJDE 3BWAA 3HG1D 3GKZA 2CDGB 4G3YL 4WO4C 1XGPB 1CGUA 5ITBL 5E6IA 3HLAA 4M7ZC 1C1EL 2NPLX 4OQTL 2DDQL 4LLVA 5E2VL 4LOUD 5EA0L 3IDNB 1DEEA 4XPHL 1ZVSA 5I1KL 4J4PC 2D0GA 4EQ3A 1HWGB 5DK3A 1KJMB 5FM5O 4ZD3H 1GAFH 4L4VB 2IPKA 1MHHB 3QQ3A 4XMPH 4HLJA 2DJ4A 4RFOL 4X6BA 4X6CF 4X7TA 1A8JH 2BNUB 2CDFB 2Y07H 4GXUN 4ZO8A 3KPOA 4CU8A 2HMIC 2AKRA 2V9QA 1EK3A 2FL5A 3CPLA 1Z9OA 4O02H 2YA1A 3FN9A 3L5HA 5CJOH 4MXWH 1S5IH 3INUH 4P9HH 1BFVH 1ZANH 4LKCB 5I1GL 2DLGA 1NGWB 5LGHH 3ARDB 1J8HB 4YE4H 2YD4A 4G8IA 4KHXH 2MQCA 1FRGH 4NN7B 4QRTA 5FA4A 4HMDA 5JPNB 1BGXH 3NACH 3I6GB 5GGRB 2QHRL 2YD9A 1KPRB 1J1XH 4ORZC 2WM0A 3VG0H 2ZSWA 2QR0B 1I7ZA 2ADIA 2A2QT 2AQ2A 4I0CC 4NSKA 5ACZA 5JZ7C 1I3RA 1NKRA 1DN2A 5I0DA 1XFPA 4JFEB 3ROOA 4L8BA 1FFOB 2C1OA 1FORH 2BOCB 3JUZA 3RVWD 4MAUH 1H3PH 4K9EC 5D1XD 4JG0H 3ZDYE 2GKIA 1RULH 5DMGC 1B0RA 35C8H 4LEXL 5E2WH 3T65B 4APQB 4YR6B 3FB7A 1CLYL 4ZYKB 1KENL 4O9HL 4EUPB 1X7QA 4AZ8A 4ODUB 3VD3A 1BECA 4LVEA 4A6YH 5FHAH 2EH8L 4F2MA 4NJ9L 3O6FB 2P8MB 4F7MB 2VKWA 2QTEA 1AO7E 3BMVA 2CMRH 1T03L 1RU9L 3QEUB 3MV01 3DX6B 1RJYB 4F9LC 4LCUA 2IAND 4OZFH 3RGVB 3ISWA 3OGOE 3MRNB 1P5UA 2W9EH 3X12B 2NLJB 2X4QB 5D71H 4Q9RH 3OKEA 5C09B 1DLHB 4XX1G 1ZTXL 3EOAB 3G5XA 2L4OA 1G0XA 2EXYD 3B9KB 1Q0XH 2R8SH 3G6AA 4D8PA 4J8RB 2G60H 1N7MH 3VXUE 2DMKA 4W6YB 1HH9B 3MV11 4Y19A 2GK0A 1B0WA 1K6QH 4POZD 2X4SA 4RNRB 5FIEA 3CSPA 3D69A 5F7EH 3TIEA 3ZZ1A 3BUYB 4JDZA 3D39D 3WUWA 4WHYG 5JTWA 3PQYE 3QUZD 5J9PB 25C8L 1TJGL 2NY5H 4HWBA 2AABL 2C4FU 3T08A 1U95A 3RDTA 4ETQB 2PR4H 1JUFB 5FYKL 3N85H 5IFJB 3RZCC 1L0YA 3WD5H 4D9QE 4FFZH 3BISA 3GJFA 2NTSP 4I77H 1OLLA 3L7FA 4P5TD 3HS0B 4HIJA 5IEKB 1NMAH 2XKUA 3HG1A 4ZUTB 3VW3H 4HUKB 4YHPB 4GKZB 4PRBB 3WFDH 3T1WA 1EGJL 3LQZB 2DTMH 1YY8A 4LSSH 1JPGB 3BIKA 5DMIL 1QR1B 5D1QD 4FQJH 4UQ2B 5D7JB 3QIWD 3JV4A 4RZCA 5F9DC 2BNQD 1FO0H 1NJ9A 4HUWB 4PRIB 5BZWA 5D70H 1K85A 4M61A 3N1QC 5CD5D 4NT6B 4PLOB 4E5XB 3MGTB 2Z4QA 1CXFA 2GCYB 4BM7A 4QO1A 2YKLH 4WHDA 4N5ED 3O2WH 1CF8L 2QQLH 1KC5L 4HGWA 4Y16A 5CINH 4Q58C 3TJEL 1LO0L 3MRHB 4XP9H 4DW2L 3U48A 1KLUA 4IRSD 1M7IA 1TTUA 4TTGA 4N0UE 5KSAD 5FOJA 4NQEE 4YX2H 4ZNEE 3BT2H 4KRLB 3GJEA 3BVNA 1CGSH 1O7SA 5E8EA 5F1NA 3SKMB 5HVFB 1YPZA 1UH3A 4NQDD 2BDNH 4ENEC 3S4SB 2X4UB 1RI8A 3ZT6A 2P8PB 1NGXB 1RK0B 2L7JA 4Y1AD 1S7RB 3UTPD 4PJGA 1U8PB 4R9HA 5D1XA 3JVGC 1LK3L 4CUCA 2QADD 1RUML 3FQXA 3ARGA 5LAXB 3O9WC 4XP5H 1FL3A 3MNVB 3SPVB 1CGVA 2BP3A 3ME0A 1P4BH 1XGYH 2W65B 3NAAH 5GS2D 1BIIA 3I3BA 1SYSB 3GSQA 2HT2D 1A4KA 4NHCL 1KCKA 1IGJB 5IBTH 2ZPKL 5KJRL 4KVNH 1CDCA 3RPKA 2XQYK 2IANA 2XQBH 1A3LL 2OL3A 1HQ4B 1GZPA 2Q3ZA 1FQ9C 1NGPL 4U6XA 4KJQD 3V5DA 4P9HC 2OK0L 4M5YL 1LE5A 2KQNA 5B38B 5BXFA 5ID0A 4S1RH 4U6VH 1HYRC 2BHZA 1O7VA 4KFZC 4Z6AT 1J1PH 1HE7A 1ZSDA 4WU5A 3IT8D 1LEGA 1QFUH 3REVB 1SM3H 4WFEE 3QFDB 4NIKB 1AGFB 1MJ7H 3MACH 4WY7L 3KJ6L 5AWNL 3CCHA 1XCTA 3QUZA 5FKAA 1CLZH 1URLA 1HCVA 4JFEE 3FRPA 3CFJB 3D0VB 4KJPC 1KTKE 4FNLH 4JFQB 1FGNL 2NXYC 1FVEA 4UI2A 4PV9A 4P5TA 1PYWB 3E8UH 3MGOB 1Q0YL 2LTQC 1QA9A 3AXLA 5IUSA 1Q94A 2HFFB 1HIMH 1JK8A 3SJVA 4DN4L 4K9EL 4J3OC 3MMEA 1ONQB 3CUPA 4NKQB 4JG1H 2KQMA 3KPLB 4Z5RB 2KZWA 3O3BA 4BK5A 4JM4L 3UZVB 4JFOA 1HHKA 3S96A 3IS0X 5D1QA 3VA6A 1G7HB 3TM6A 3QIWA 5FO8A 5EFIB 1I75A 5I1IH 1DEDA 1AXTL 2BNQA 3PWNB 4Y8DC 1DBKL 3M45A 1F6AA 1YPZF 2NX5E 3KYKH 4Z78B 2NCMA 4F7CA 4WDIB 4UIMA 3L1OL 5FXCH 5LWYH 4LSPH 3FFCB 2ZUVA 4X9GA 1KACB 4M7LT 5GPRA 2ED9A 3BYTA 3L95A 4PJGF 1DUYB 2NY3C 3PABB 4NUJB 3VFUB 5IW1B 4EDWL 1FL6B 4H88H 2YUXA 5GISH 2PYFA 4XNXH 2DWDA 4TQEH 4Y5XB 4EI5D 2EKSB 4K7FA 3ZSSA 1R0AL 3LN5B 4IRSA 1UXSA 1FH5L 4K2UH 5DQJA 1S7WB 5IBLD 4MCZB 4Y4FD 1U8QB 2R1WA 5KSAA 5JIIA 3DUHA 2NY7L 2VWEC 1UKTA 3HRPA 4WUUE 2EZ0D 3VXMB 4UILL 4IBLT 2PTTB 4HUNB 4TUKL 3NH7H 1KPVB 3JWNC 4PBWD 2NY5C 1YQ2A 4QRSB 3QXAB 1LO3H 1E6OH 1D6VL 3ARFA 5IT2L 4MHHI 3U9PL 1PSKH 4HFUH 3C9NB 5L0QC 4P5KB 2FX9L 4NQDA 1WUNT 3WFEL 2B1AH 1IGCL 3U9UA 3PWPD 4FQLH 4Y1AA 4OV6F 4GG6A 4BQ8A 5DD6A 5IMLB 5BRZD 1MCKA 4HS3B 2QQNH 2X42A 1TZIB 4Y7MA 3I02A 1MCWM 1F3DH 1CXIA 4OZGA 3SGDI 2I9TB 4F9PC 1NEZB 1FP5A 5K59F 4HUXA 2OZ4L 4OLUL 3RUGA 4NKIH 4PRIE 4IS6B 3BUTA 4R2GC 4U2ZA 1ZHLB 1A7QL 1I8MB 1QG3A 4YDVA 3MLSH 1IL1A 1VCAA 4M48H 2ICWJ 4X6EB 1HYSD 3FN3A 4GAYA 5IB1B 1PQZB 3CVHA 1AY1L 3RA7L 2CRYA 1HILB 2J5LC 4P59H 1FE8L 5J4MA 2YWYA 2Y25A 1MPAL 1QNZL 4GQ9H 1DANU 1DN0B 3HPJA 4IHOB 3U7WL 5E8OB 3QCVH 1JWSA 4PLKD 2ESVD 1RVFL 1QLRA 1L6ZA 1KUMA 4AYFA 4RMQA 5I1HL 4XHJD 5HYSB 4PGJA 3FQTB 3WYRA 4OSUH 1MCJA 1MWAA 4U1HB 3RL2B 1ACZA 4ODWB 1RD6A 3SDCB 4EVNA 1ZS8A 2XFXA 4U0RB 2DLIA 2FJGA 4ELMB 3KJ4B 1XIWB 4P2RA 4NQXB 3WHE0 1DLFL 5GHWL 1PFCA 4CMMB 3ARQA 3UYPA 4KDVA 3QCUH 4PRPB 5F8QC 3TT1L 4G6AD 3ROLA 1IQDA 3FRUB 5T1LB 4L3CB 5JDJA 1MY5A 2X05A 1YYLH 2HJLB 1MREL 1JF5A 5DD3H 1FN4B 3BD3A 3QDGB 4OF5A 4ZD3L 3T0WA 4ZUUA 1R5IA 4P4KC 5T1KD 5BOZG 4WU7A 1EO8H 4MLIA 4FQHA 3TBVB 2Y07L 4UDUA 3DTXB 5I66B 5FCUH 1TVHB 1P2CA 2DLFH 4LCYB 1AGEA 1WC7A 4GG6F 1BREA 2IC2A 4MXWL 1S5IL 3INUL 4P9HL 3X3FH 4F7TB 1ETZA 5T3XH 1NCNA 1ZANL 3ZYIA 4OZGF 4CMHB 3VE0A 2BJMH 4YE4L 2ZCKL 4ZXBB 2C3XA 2ZUYA 4KHXL 1FRGL 1B6UA 4Y4FA 5KG9A 1BGXL 3LQAH 3WS3B 3RUGF 2ERJC 5E5MB 3HR5A 3MRQA 4OIIH 5MENA 1QZ1A 3VH8G 4UUJA 4IOFC 4P4RB 3V52H 3O45A 2MPAH 3GUTB 1D6EB 1TZGH 1ROWA 1A1MA 4O2FB 4UNUA 1FORL 3MOQA 3PWPA 2PXYC 3H0TA 3FAWA 1EEZB 3AS3A 2DQTH 2D7TH 4M1CD 4MAUL 3VFGH 4P48A 3GNMH 3STLA 4Z0BH 1RULL 3F6LA 3UJJH 5BRZA 4MAYC 3VI4E 5ICYA 4X98A 5DVOA 3HMXA 4GUPA 1C5DA 3MBXH 5DF0A 5H2BA 4FQXA 1W0VB 4A6YL 5E0QA 5FHAL 4OGYH 1ORQA 1OAQL 3VXQA 4AEEA 1PW3A 2CMRL 2DQFB 4J3TA 4NNYB 5HJ3B 4NQCE 5KZCB 2GFBA 5E4EC 4Q2ZB 3DV6A 2P1YA 2DLTA 2W9EL 3MLTA 2NY6C 3ZDXE 1WJ3A 4QT5A 4Q9RL 5BQ7B 3BH9A 4WI9A 3HA0A 3BDBA 3SDYH 3OB8A 4CVZB 3BGMB 1DQTA 3TBTA 3X13B 1RUKL 1Q0XL 3FQNA 4RGND 3VXRD 4YHMH 1NGZA 1A6PA 1N7ML 3GMOB 3T2QA 3BXNA 2YMXH 1WLHA 4JFDD 4OZFG 2WBWB 4Z7QF 5HXMA 5I9QC 4KUZH 1K6QL 4BH7A 4P3CH 1KIPA 3HE6B 2AVGA 4QRRB 4WWKB 3JWDC 43CAA 2OTWB 3BPLC 5F7EL 2ESVA 1NSNH 4LQ1A 1LEKA 4DOHB 1E6JH 3FTGB 3H9SB 2WBJA 4GG8A 3W39B 5C9JB 2NY5L 4WTWA 5DRNB 5GGVH 3V5HA 5DQDH 4PJEE 1CD9B 3MRJA 5IQ7H 4RAVB 3CNKA 5IKCA 2CLVB 5BO1H 4XC1H 1PG7W 2C1PA 4GRWE 1VGEL 3EYOB 1E28B 2O5XH 4PG9A 1BMGA 1NMAL 5AZ2L 3WFDL 1V3KA 3QZWB 4K8RD 3UDWA 3W11C 3QO1B 3BHBA 3BSZH 1H5BB 3C08L 3ULVE 4LLAA 1BQHA 3RIAK 2GEEA 3BDXA 5J13C 5CJXC 5DD1H 2XN9B 2ZKHH 5I1CH 3VFPB 3B2VH 5H37H 1HCFX 1QFWH 3MZGB 2I27N 1N6VA 2VH5L 1A2YB 2X7LB 3T3ME 1VFBA 4OM0L 4LKXA 3ZE2E 1MVFA 4F33B 2VLKA 3IXAA 1G7MA 1QOKA 3WLBA 1YQVH 4QGYA 4PJCA 4WJ5A 1BBJB 4HIHB 2B5IB 5CINL 1MY7A 3SKJL 2B7DT 4J7RA 4MB5A 4AEHH 5C0IA 4U1KA 2D7MA 4GFTB 4I13B 4U6HB 4EOWL 1I3UA 1EEUA 1BM3L 4AENA 4WFGD 4YX2L 3F5WA 4OBRA 1ZT7B 2I5YH 3BT2L 3IDUA 4KRPC 3TH2T 4M6NL 2RHEA 5CEYB 1B2WH 3QFJD 1HHIA 3L3DA 1N2RA 2BDNL 5EO9A 2UZIL 4LBEB 5D2NB 4ELME 2FRGP 2Y7QA 2HH0L 1ZGLP 2VSCA 4NDMA 3OTTA 5MERB 5IG7B 3TA3B 5DDHB 3QNYB 2NY2C 5F70A 3IVKB 2K9UA 5TE6H 3IJSA 2BSTB 5JHDE 4JRWA 4JFFD 5HHOA 4F15B 2LE9A 4S1QH 4YLQT 1A3QA 4JY4A 4LIQH 1QBLH 1TTGA 2EIBA 3RWGB 1XF4A 2EIZB 5DEGB 5HY9B 4ZMAT 3CDFA 4MCYA 4YFLF 2VLJA 4MJ6A 2XQBL 5DD5L 4F7PA 1UB5B 4U4BA 4NOBA 1UCBH 2J12B 1JWMA 2MMXA 3CZJA 5GGSB 2G2RA 5EN2A 2BNRB 1MLBB 4HPOH 3VG9C 3C60B 1QVOB 2JK5B 4JREB 4OTXH 1QBBA 5DSCA 2IAMC 4U6VL 3B6SB 2P5WB 1VFAA 1BBDH 1EIBA 2JJVA 3AM8C 5EO1B 1JYWA 3QUXB 4OLYL 5CJ8A 1L9MA 1SM3L 5HDBE 1A7OH 3LQAC 4MJ4A 3IDMB 2R9HD 2YSSA 3DSFL 5IB2B 5FM4A 3QI9C 1YY9D 2HN7B 5ESVB 3E3QC 4NKDA 3QA3B 1CLZL 1AP2A 1T5XB 3BIBX 5F9WC 4XRCB 1M7DB 3EJYD 3TBSA 3ZKND 3KLAA 3IDYC 1WZKA 2O5ZH 3SDDC 4N8PA 1KIRB 1T1ZA 5IVXB 3LKQA 4HUUA 1HINL 1NAMA 4FNLL 5D4QA 4WENB 2Q86B 5T1MB 4PJCF 3E8UL 4Y5VA 5TFSL 1R6VA 5D5MB 1I1FB 1T3FA 3OJDB 5GRJH 4I2XB 2W9LA 3BAEH 4JG1L 3OG4B 1KPUB 3F7YA 4YQXH 4AG4H 5AYUH 1BJMA 3GSOA 1T5WA 2DKMA 3P40A 3K81A 1NUDA 2P24B 4ZFOL 3LV3B 5FF6B 3TYGH 3C6SB 4DVBA 3BRFA 5HSFA 2ZUQB 4TVSa 2F53D 2ICWI 1JYVA 1YN6B 3WXVH 1BQUA 1TENA 3KYKL 3N1FC 4ZTPL 3A6BH 4LSVL 3MCLH 4HFWA 5JQHC 2QSCL 3CMGA 4V1DB 3QNXB 1I1YB 1YNTA 2COQA 5LWYL 4JE4B 4KKAD 4LSPL 3KR3L 3ULUH 4WUKH 1HI6B 4M6MH 5KTEL 2VDNL 2VXVH 4M7LL 4MNGB 3U30B 5C9KA 2Q7NA 1HH6A 1H3VA 3KPRD 3MCKA 4YPGA 4H88L 3AREB 1YMHA 3MRRA 5GISL 5DLMH 3ZKMD 4XNXL 4BKLB 1IKNA 4PRDA 2GT9A 2VIRA 3K2MC 3FB5A 4R8WL 1AXSB 4FFVC 4K2UL 2WLZA 4NCC1 4QXTB 5HGAA 2UV3A 2K7QA 3GSXA 3NZHH 2FH6A 3PGDA 2DJSA 4DOHE 2F5BL 3DVFA 5E7BA 5SWSD 3JWDL 3NH7L 3MROA 4HWZB 2KDGA 1IM3A 3IFNH 1E6OL 4POYA 1OQOA 1T20A 1MCOL 4Y2DB 5E9DD 1JPFA 3QFJA 4HFUL 1LE9B 4NCC2 1AGDA 5EUOE 3VFMB 4N90E 1W0WB 1S7VB 3HB3D 4MDJB 4FQLL 3KLHD 3RVUC 1IT9H 1JF1A 4C58B 4NOFA 3H9ZA 3EOTL 2XYCA 2YA0A 1S78D 2QQNL 4X6CB 1W72B 1CE6B 2R0LH 3S88H 4JFFA 4UQ3B 4GRMA 4OGXH 3VWKC 1DQLH 3MV7B 3E6FA 3TO4C 1X44A 4GW4A 4XB8A 4C55A 1RHFA 2AV1B 4MJ2A 5BW7A 4M43H 1UWGH 3MZTA 1KN2H 5JMOC 2GJZB 2WINB 2J6EA 4CVWA 3C87A 5D6DC 2A0LD 5EC2A 2YD6A 3MNWB 4BQ6A 1JV5B 2WWMC 4XWOC 2ENYA 3UTSB 5DYOA 4QRPD 4DFIA 1CK0H 3VMOA 4JVPA 2IJ0C 1Q9LA 3V6OA 3GHEL 3MXVH 3OV6A 2JCCF 1OW0C 1REIA 5SWQB 3OKLB 2P48B 4L4TA 3MRFA 4JKLA 1KULA 4GQ9L 1T2JA 2R69H 4LVOC 4J3UA 3TNMA 3TWCH 1HOCB 1U8OB 4AJ0A 2YEZB 3CX5K 5JHLH 4FTVE 4KRMB 1DQQB 4NO5B 3LCYA 4XP4H 4OSUL 1T0PB 4OI8A 3U0TB 4LVNB 3TJHD 4IRJC 4YBQD 1CICB 3BZEA 1NLBL 2CGRL 5HYFA 1V5JA 4TSBL 1IGMH 5DHYA 2J8HA 1KB5B 5DR5H 2PUQT 5HD8D 1A4JA 2ZCHH 1JZ3A 1QSEB 4UV7H 3DGGB 3V7AG 5AG9A 3QQ9C 3LS5H 5B39G 2AQ1A 4KK9C 4JZOA 1I3GL 3BWAB 4TULH 1TZHA 1UA6H 2DQCL 2ZUWA 5FYJH 3N50A 2GI7A 4ODSH 5E6IB 3HLAB 3EZ8A 5DD3L 1KELL 4HHAA 3K74B 3NCFB 2F53A 4M5ZH 4LLVB 5KSVB 3ILPA 4X83A 1CFSA 4HK0A 2C4XA 2R0KH 1DEEB 1QEWB 2BNRE 3SGKA 1QRKA 2PCPA 3RTQC 1EO8L 4O2CA 5ENWB 2EIEA 5I6XB 5A16A 2DLFL 1MCPH 2P5WE 4CW1B 3BRDA 3QQ3B 4M1GH 3CFCH 3HE7C 3GMLA 2WIIA 3KPRA 4Z7OE 5T3XL 3P3YA 4X7TB 4YEEA 1OOAA 2NY0D 5BOPA 3FOLA 2BJML 4X0KB 1N5AA 5ABDE 3BE1H 1AHWA 2AKRB 2HG5A 3CPLB 5EZOH 4JQVC 3SO5A 5SWSA 4OIIL 2CLRA 2V9TA 3G6JA 1IEAB 5F93C 3DLQR 2E9IA 4G8IB 3OXRA 5IVXE 2MPAL 5ICXB 2D03L 3Q0HA 5F7KC 1T04B 4M7KL 4XXCA 4XVTL 3D2UD 1WWCA 2JKXA 3NCYP 4GW5A 1INDH 4KZEH 1GGCH 2VR4A 1KTDA 1QR4A 4I0PD 4DUWA 3CDGB 4H1LH 1CD8A 4NSKB 2D7TL 2EXWD 2ZCLL 4I2XE 3CZFA 5ACZB 5GGTH 1I3RB 2W91A 2FEEL 5IHZA 4Z0BL 3RIAF 3VI3E 3ROOB 8FABB 1P7HL 5C0RL 2GSGA 4OZIB 3FJTA 4TNWK 1D9KC 1L7TH 2FX7H 5I8EB 2X10A 5ISZD 2APTA 4HJGA 1JHKH 4K7PL 5FGBC 3WS6C 3QQ4A 2R2EA 2I26N 1JNJA 3WN5C 1N0XH 2R2HA 3FL7A 4XPBH 1AIFA 1X7QB 5HHMD 4V1DE 4L8CA 1MEXH 3ULUC 5FYLD 4G9FE 4MNGE 5IJVB 1J86A 15C8H 4YHZL 4QRPA 4ZUSA 2V7HB 4AMKL 2A77H 3KS0J 4BJLA 3QIBD 2CLZB 4PJXA 5INDA 4OV5A 4HX1B 4KUZL 5F88A 5E2UL 1CL7H 4XT1C 2Q87A 3G6AB 2HYMA 4D8PB 1NSNL 3U4BH 4GBXC 5CAYB 2H26B 3GBNH 3T0DA 1T21A 5IB3A 5CILH 4WHTB 4Y19B 4UMGA 2GK0B 1CG9A 3Q2CA 1BJ1J 5DQDL 3UAJD 4G5ZL 4OIAA 3AMKA 1UZ6F 2VLLA 1FCCA 3LD8C 4GMTH 2VL4A 3TIEB 4JDZB 1E4XH 1HNFA 1C7TA 3OKNA 1JYNA 1U95B 1XGQB 3GSNB 4RBPK 1WEJH 4H20L 4RBPH 4Z8FL 2DYPB 4NC1E 5E8DH 1P7KA 3BSZL 3ZKXC 2R29H 3MV7E 1NMCC 4D94A 4HIJB 5DD1L 5F1OB 3UTZA 2ZKHL 2CXKA 2AK1H 1VFUA 2RB8A 3G6JF 1RV6X 2H2PC 5IEHB 4PP2B 2X4RA 3BIKB 2VDKH 1MQ8A 2NY4D 3BP6A 1PD6A 2A74A 4H8WH 3JV4B 5GRVL 4RZCB 4WHCA 1T66C 4JRYD 3UTSE 1PZ5B 2JE8A 2XA3A 4U1MB 1G7QA 3HI6H 3MRLA 3IB4A 2PO6B 5BZWB 1YQVL 2DQJH 1D5ZB 4Q9BA 3RZCB 5CBEB 5DURD 4PRHD 4BK4A 1EFXD 4NFDA 3OKKA 3CX5J 1ZLUK 4J3WA 3SDXA 3VFRA 5I1LA 5IR1B 3KGRA 5IV2A 3WBDA 4AL8L 4FZ8H 4JLRA 4HGWB 4Y16B 1NCCH 3MJ9A 3B2UC 3MYZA 2FEEI 5FO9B 1B2WL 2DBJA 3BX7C 4I5BA 3O6KH 3WNKA 4JFHE 1DJSA 3R8BB 4QRUA 3GJEB 4I0PA 5T3ZD 5E8EB 3KLDA 1KCRH 5BJTA 4LP5A 5I1JH 1NC4B 5GRWA 5TE6L 1GGUA 2YPLD 3PV7A 5GGUA 4PJAA 3V4PH 4PJXF 4LPYA 4HKJA 4HUMB 5ISZA 1ZMYA 4DKFL 3FQXB 3ARGB 3GRWL 1F4WH 4Y4HC 1FL3B 1T0NA 1HQRA 2APWA 2X2YA 4CVXA 1SYVB 4O51A 1BIIB 4XCNA 4ZSOA 5I19L 4HPOL 1TNMA 4LK4A 4G9DB 2BVQA 3DXAD 1IC5H 3SE8L 3G5ZA 4OTXL 2ATPA 3RY6C 4N8CH 3MRPA 3H3PL 1G0DA 1UKQA 3RWEA 4H5SA 4U6XB 5A43C 2XTLA 4IOIB 4S11A 3UC0H 3I75A 1JNHB 3BEWB 5LKNA 4LF3A 1LE5B 5BXFB 5ID0B 3O9WB 3MJ7B 3QDJD 4JCMA 4WFHD 5CSZA 4ZPVA 1ZSDB 1ZT1A 5KVDH 1X5YA 4OAWB 4XNYH 4X7FC 1FNFA 1LEGB 2BVTA 1E4KC 2JIXD 2O5ZL 2Q8AL 1UWEL 2HA1A 4GH7B 2NYYC 4I3RH 1V3LA 3CCHB 4UT7H 2AJZA 4BQBA 3L3JA 5IFHH 4HS8H 5IMOB 5CEZD 5F7DB 3C2AL 1J0ZA 3VU2A 1QFWI 4OZIE 5FV2A 3BAEL 3KXFE 1FYTE 1WBYB 3RWHA 4YQXL 1S9YA 2DI9A 4AG4L 1FVEB 1CU4H 5F1KC 1SEBB 1WAAE 1QA9B 3AXLB 1K4CB 1R3HB 3SJVB 3TYGL 4PJ8A 4K7PX 4LRNL 5E94B 1IAKA 2HT4C 3MMEB 1T0MA 4XNZC 2J1KA 4GRLD 4YDJA 2IH3B 3WXVL 1HHKB 3S96B 1BOYA 2P4AB 3BDYH 2AXFA 4FQ2H 4D9RD 4JRYA 3CK0L 3UYRH 4M6ML 1FFPB 3KPSB 1GIGH 1ZAGA 4IDJH 3QEHA 2EXYC 1MCDA 1ZWIA 3T2PA 5DJYA 4YHOH 4R26L 4UIMB 2O61A 4PJAF 3SDAA 3IFOA 4PR5B 2WQ8A 1XEDA 4KI5D 4QCIB 5CEXB 3FT4A 3DETD 5BVPL 3NZHL 5KAQG 2ZUXA 5T5FL 1F13A 1B90A 5HGBA 1A7NH 1X6LA 3BEVA 3RNQA 2EO9A 3DMMC 4LRIA 3IFNL 5GRZA 4XZUA 5DQJB 3O81A 3DROA 2LU7A 3T2OA 1KN4H 4PGBA 3VD7A 4OZFB 3UTTB 4AM0B 2PW1B 4XPAH 4ZQKA 4XP1H 5EBMB 1HHGA 4RISH 5J0BA 1JGDA 3U7YL 3ARFB 4GW1A 1U3HD 4UDTA 4HC1H 3LMJH 3PF2A 1QSFE 2R0LL 3S88L 3C6LD 4M4PA 4Z7NF 4ODVH 4E0RA 5CKAA 4QXWA 3PXHA 2HFGH 4AEFA 3V6FA 3V0AC 2D7QA 1AQDB 5D1QC 1DQLL 4GG6B 3QIWC 4YDIL 2XY1A 4M43L 1UWGL 4OZGB 2HTLC 4F3FB 2BVOA 4S1DD 3VFNB 3MJ6A 1KCSH 4KKBD 4H8WC 1PLGH 5DJ2B 1K3IA 1IGTA 3RUGB 1GCFA 4UNVA 3DXAA 4AT6A 1JHLH 5DJ6A 2BRRH 4AY0A 5L0QB 5HI5D 5IGXH 3V0VA 1AQKH 5B3NA 2C7UA 2MJWA 4YDVB 2W60A 5HVGB 4HMCA 5E8PB 4OF8A 3O4LB 1BZQK 4GAYB 4HPYL 2R69L 3CVHB 1TETH 5KSAC 3TWCL 1H8NA 4U1NA 4LGRB 2ED8A 2NY1D 3QDJA 5JHLL 4JHWH 5LGJB 4QF1A 3UROR 3EO0A 4XP4L 1MJUL 4HWBL 2JIXA 5C0GB 3DARA 1TJIH 1ND0A 1FO0B 1QLRB 1NLDH 3ES6A 4QLRA 4PJBA 4M7JH 4PRNB 3U6RB 1U2CA 2AI0H 4Z7WA 4UAOC 4P2CG 1U6AL 5CWSA 5DJZB 5FEBA 3HKFA 5DR5L 3I85A 4KV5E 3QDME 4XMKL 3WUWG 4UV7L 2ICWB 2R0ZL 3LS5L 1RZ8A 2J5LB 4XHQA 4Y2OA 5M7QA 2CDEA 3EW3B 4P2RB 4NKOB 3HAEH 3MLUH 3DWTA 5FO7B 1UA6L 4OCWL 5FYJL 4G7VH 1AO7D 4ODSL 2Z8WC 4LDOB 4JO2H 4EDXA 2R0KL 4JAMA 4JPWL 4QWWC 3WFBH 5FK9A 1ZHKB 3BKJH 3MREB 1UQSA 2X70B 4KK5D 4RFEB 2AJYH 2IGFH 4O58H 5DHVH 4D3CH 5CHNA 3CFCL 2A6KA 4U7MA 5C08B 4NHUB 3MV9B 3VXUD 1R24A 2AJSL 3FMGH 1KBGH 3PQYD 3TPUB 1AR1D 3LKSA 3X14B 2EECA 5HYQA 3RVXD 1G6RH 3MRCA 3B83A 5IHBA 1GH7A 2UYLA 4HQQH 1OSZA 3CJJA 4YZFF 3HR5B 1GGCL 5MENB 4D9QD 4TOYH 1CFTA 5EZIL 4UUJB 4P4KB 2V2XA 3NFPB 4Y4KC 3O45B 1YECH 4K23L 4PJDA 3MLVH 5GGTL 4FOMA 5IJKC 2E5EA 1E4WL 3D48R 3SO3B 3JXAA 4NUGL 3C6LA 1PAMA 4PLNC 3H0TB 1IM9D 1IAMA 1L7TL 2FX7L 5DHXB 2Z92A 4RMWA 4ZFZA 1LHZA 1JHKL 3LIZH 4KQ4H 4XVUD 3IAPA 3SGJA 4G8EB 1FV1B 4FZEH 5IMKB 4PRAA 4X98B 5E4IA 5E00B 4GUPB 4H1LG 3DYOA 1C5DB 4XPBL 1P84K 4KVCL 4HEME 4FQXB 5FOBA 4XC3H 2DRUA 1UT9A 1ORQB 2Z31C 3HPLA 5C6TH 2OL3L 4PJBF 3IJYA 2HFEA 3KPSE 4WIQA 1NEUA 5DK0B 4UT6H 4HKBA 4GAGL 3B9AA 2B1HL 3MLXH 1ACYL 1T1XB 5DS8A 2VRAA 5I30L 1AC6A 1I7UA 1IAIH 3MLTB 4R7NA 2PXYB 3BYYA 4QT5B 3F65A 1XT5A 4EI5C 1MI5D 1MUJB 2QQKL 2F5AH 1UM5L 5I0ZA 2MOVA 4G43A 1DSFL 1MVUA 5DUMH 3FQNB 1UJ3C 2EZ0C 2JB6A 4XPFH 4NQED 5KN5B 1BVLB 4K3GA 3OR7A 4I18C 5IWLA 5C0AB 1CZ8H 1FG2A 3G04A 1A6ZA 3SOBL 3TCXA 3D25A 3AS0A 4BH7B 2HRPH 3UTTE 1H3XA 5INCB 4N0FA 3VXSD 3CSYB 2VXTL 4Q7DA 3QWOB 5E4