2EUWA

Structure of a ndt80-dna complex (mse mutant ma4t)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*TP*CP*AP*AP*AP*AP*AP*C)-3'
total genus 88
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2euwA00
2ETWA 2EUVA 1MNNA 2EVJA 2EVFA 2EUXA 1M7UA 2EUZA 2EUWA 2EVHA 1M6UA 1MN4A 2EVIA 2EVGA
chains in the Genus database with same CATH superfamily
2HRPL 1ZTXH 3GUTA 1BX2A 2GSIA 1H9VA 4LCWB 5FLUA 3VI4F 3G5WA 4Y16D 4DF9A 5IHWA 3C2SA 4JKWA 4BELD 4FNRA 1KUMA 4S1DD 3KJ4B 3BP7B 4TVSa 2CA4A 3VWKB 2J1XA 2CDFA 1IC7L 2V2WA 4LSPL 4QRRD 4YOKA 3U9WA 2WN2A 2J57A 4GW1A 3GSUA 4R7NA 1JUFA 1VFMA 2NQDA 1ACYH 5I0XA 2AEQH 3BRDA 1C12B 5L8JB 4YQXL 2K1MA 3JQOB 4L8DA 4FN0A 3SE8H 4MJID 3H0TA 4YGVA 1NMAH 1QFPA 3CK0H 3MRFA 4G2AA 1EEZB 1U6AH 2VLRE 4GAJL 4HX1A 5I0DA 5DQ9A 1AD0A 1SDDA 1SXBA 4LZKA 4TRPH 1Z1WA 2MIZA 3VB8A 3EHBC 3W37A 2QELA 5DD6B 2DYPD 5LAXA 4K0OA 3FRPB 4Y4KC 5KAQF 2EYTA 1XGYL 2N01B 4FNLH 1KG0B 4HOWA 2QLYA 4PJFE 3FHAA 1FZMA 3B5TA 3GSXA 1CO1A 5DR5H 5GRXG 3MROA 4JB9L 1IO4C 5BVJA 4IGBC 3JWDC 4QRPA 2W07B 3RWEB 2Y1VA 1B4JL 4PG2C 1MVFA 2DQHH 4Y4FA 5HGDA 5IHHA 2X70A 2EDKA 2BIMA 1QNIA 4PRPE 5ISZA 4O5LH 1CXKA 5D2NC 3RGVA 3SHSA 3UYRH 1FWXA 4WAFA 1MZZA 3OXSB 4J3WA 5IJVB 1PDKB 4K8RD 1LLAA 4XMLH 5B7MA 1USZA 3GHEH 2CD0A 3NK3A 2LFEA 1DBML 3WCYA 3Q8FA 3FRUA 4KJPD 4HC1L 3RTQD 1IBGH 1UXWA 4X80H 2FQFA 5EO1B 2CO6B 4D8PA 4HIHB 1IBDA 2Y5TA 4N90D 4WZ9A 4AQ1B 4HXAL 1B3IA 1QSVA 2YGNA 2ZE0A 3ETSA 2WLHA 4J3UA 3EH5B 4A2GA 4X8CA 1ZANH 5C9JA 4JY5H 3V7AE 2X42A 5E94B 5F0LB 1MRDL 3FXIC 3CMGA 2ZCLL 4J3OG 3LZLA 4EIGB 4P2OC 3LV3A 4FFVC 1HWWA 1JAEA 4Q97A 3GUFA 3HG5A 2F6AA 4CBPA 1AI1H 2R1YA 3KVPA 1BAGA 5DZNA 5M95B 3QZLA 2JXMA 3WD5L 1FNGB 1GA2A 1NFDE 2LOEA 5A7EA 2HRPH 2VQ1A 2FYYA 5I15H 5CJXA 1FNHA 3I9GL 5I6MA 4X7SH 1LJMA 4OU3A 3FQ4A 3V4VB 3O11B 3RVXC 1MLBB 3SSGA 2P9RA 4BFKA 2ESVB 3QS3A 1AQMA 3CZUB 3N1FC 4FJ6A 4IRZH 5F1NB 1B0RA 5GRVL 4FTVD 2HLFC 4XX5A 3U4EB 4XO4A 4P2RB 2JIXA 3SDAB 1UD8A 3GHBH 1FA4A 1UOWA 2DM2A 5BW7A 1ACYL 3L4WA 1A6TB 5E8DL 2X4NA 1HSBA 1MFMA 4HPOH 3IDJA 4I1RA 2FX9H 5FW7A 3SE8L 3KBPA 3NT0A 3KW8A 4BINA 3AY4A 3B3IB 1CS6A 4QTIL 3EYSL 3EO1A 2DKUA 3BWSA 4WI9A 5F21B 2VJ0A 3GT6A 4YZFE 3HE7B 5IEHA 1B0GA 3CJJA 3FU6A 4ACTA 4UV7H 1FL6B 4FNLL 1N10A 1AXTL 3MUUA 2PKDA 1MAJA 1QRNE 4XX1G 1T80A 3IMRA 3TX4A 2MNJB 5DSCA 1CVRA 4G6MH 4KI1A 3WXWH 1MCWW 2WW8A 2C9UA 3E9UA 2P5ED 2ZSWB 1JZ5A 3MLUL 2YMTA 3CVDA 5MHSE 1YN6A 1IX2A 2DQHL 3HZYB 2BOBA 3LIZL 4ORGA 3T0ED 2F18A 1BWWA 2DH2A 1EJOH 4M61B 4W4OA 1KGUA 5L7XH 1QFWL 3ILDA 1GMEA 4KROD 4N6RA 2FDBP 4MVBD 1ORSA 4XMLL 5E2VH 1KB5A 3TBTA 1T83C 2QADC 3K72B 1UM4H 4HFWB 2H0JA 1GHFL 3OM3B 3OKDB 5CWSA 1S46A 2GCYA 2FNWA 3ABLB 3D8MA 5F7LB 4HC1H 3OF6D 1GC1H 2YGOA 4ZAKD 3U2IA 2J8UB 3N85H 3S4SA 2VDQH 2F5AL 1IEBB 2ZXAA 5EWIL 1E6OH 3QIWC 4N6RB 1KJVB 4P2OD 5DEFB 2IV9A 4ZZFA 3B7UX 4PQXA 5D5MA 2O6DA 4CVUA 4PRID 4WFGD 1ZVYA 1J05A 3KWTA 1A1NB 3TH2T 1AG6A 2VDKH 1GIGH 2GABA 4RMTA 1CIUA 2F58L 4FFTA 5DCCA 3TN0C 4DTGH 3GSRA 5IB1B 3DX0A 5F93C 5G4NA 5ITFB 5CP7B 4ANUA 4DAGH 3E80A 3MNZA 5F0JB 3JXAA 2XBTA 3A47A 5CU5A 1N59B 1RZPA 3HLAB 1J1OH 3A4AA 1EHNA 3ARBB 1FC1A 4YX2H 1IJ9A 4MGXA 1RIHL 1T5WA 1TEGA 1F6AB 1HNGA 1T5XA 3KYNB 2QPUA 4TVPD 3G5ZB 4A2FA 3J27A 2IALB 1HSBB 3NJFA 4HAGA 3AXLB 1WD8A 4ZD3L 5EEWA 1D5ZA 1ID5I 3REWA 2BM3A 4NQDD 3VE0B 3WMQA 3ZDZB 4YEFA 4ZS6D 1HKLL 2X4UB 4KDVA 5ALBH 4Z7NE 1FBIH 5EB9A 2SODB 1UUNA 4X4ME 1V10A 2C9SA 1AIZA 4UAHA 5CZRA 2HT2D 3BVUA 4BRVA 1HHGA 2ESVA 4DPCX 2Y24A 5TQ0L 1VKXA 1GYCA 2QGEA 1ECZA 3EH4B 3OKKB 1K85A 5GRYA 2A83A 3OXRA 2V37A 4KVPA 1OCWL 4AIXA 2HMIC 1BQUA 4DKEL 4G6ML 1TZ8A 2XKNB 3HHRB 3ZSSA 1MOEA 4N4YB 2J6EL 1E28B 4HEMA 4XO3A 4MNGA 4LQFL 5HD8D 2ITDA 2GI7A 2NPLX 3BUTA 2PW1A 1A1MA 4U3XA 3C5ZA 5KVMC 4GSDH 3QW9A 5F3HB 2YGQA 5JHDE 1P1ZB 3X3GL 2ZAGA 2YS4A 4GS7B 3ULVD 4DP8X 2PCYA 4L37B 4LGRB 5D7SL 4D9RD 2SEBA 2YEVB 3WI9A 3QUMA 1IQWL 4TQIA 1AMYA 1CL7L 2AJVL 1X6NA 3N41B 2K8MA 4OD1L 3H9HA 3QJSB 4AQOA 2WTRA 4JY6A 4HGKC 2OL3A 3HS9A 3O9WB 4HCRA 4QOKD 4YAQA 3GKZA 4NGHH 2IDCA 4UQ3B 1EO7A 2BSBA 3IDGA 4EKXA 4YXHL 5EZIH 1KSRA 3BPLC 3KWWB 2DLTA 1XCTB 2DEXX 2X40A 3ENEA 3PWPD 1TPXB 5GJTL 5JTWA 4Y88A 5MP6H 1C8PA 3TH4T 4PJFB 1KN4L 1SY6L 4ZFOB 3ZDZE 2WZPA 2MQ0A 2UVEA 3FU0A 1UM5L 2XA8L 4JDTH 4PCYA 4LSRH 4Q58C 5C0CB 3Q44A 4LSQH 1DQQB 1U8LA 2UVFA 3QJVB 2YQGA 4RISH 1PLCA 3RBGA 2ZWLT 4F57L 2XTJE 3LZOA 4JFEE 5JZ7D 2A6KA 3CD4A 2VITA 2FE0A 1JUFB 4Y4FD 1UG9A 2HG5B 2OMZA 2WUCH 4TSCH 1JZ2A 2QVMA 4I85A 1PS3A 2OJEB 5AW3B 2WNKA 3ZE1E 3HJ0A 3TCXA 1YY9C 4DKFH 2R29H 1FFNA 2X4QB 5E6SB 4XNUH 5HDBE 2RFXA 5BRZD 1GVIA 4KK5C 4FGMA 1G6VK 3AXHA 2PYEE 3LXBA 3VSQA 5D4IA 3SOBH 4XPAH 4J5VA 2EDXA 4Z1PA 4XMKH 4U3CA 1KELH 1L0XA 4DVRL 1R3LB 5DUPH 2HFEB 3CHXA 4PJ9D 2ROXA 1U8QB 2ZKWA 4Q6YA 1WS8A 1K3IA 4K4KA 2F5BL 4AW4A 1XCXA 4JZOB 4X50A 1E8ZA 3WFEL 3Q05A 4XMUA 2BNQE 3NSCA 4Z5RB 4M29A 4JM4H 1JE6A 5CGYD 2ZPKH 3DETC 1JP5A 1WS7A 1Z5LA 4Y5XB 5EU5B 1CLCA 5D72L 5J57B 5L6YL 3I2CH 1WA0X 1IKOP 4PRAB 1IEAB 2FX7H 5HDOA 4AQEA 1CDCA 3CFIC 4A1RA 5CJOL 4NQUA 2VNCA 1OCCB 4U7KA 2GJ6A 1OGAE 4ZTPH 4Z76B 1TJXA 3V7AG 4PCSA 4HUMB 2D8KA 3EJPA 3N44B 2R1WB 4WO4C 4U0QB 4U1MB 4LRNL 3RP1A 3OKEA 4XCFH 3VI3B 1KIRA 4HGWA 1TMCB 5HJ3B 2OX5A 4WDIB 4LEEA 4XPGL 3H9SA 1L9MA 3TBYB 4BK5C 4AL8L 2NY4D 1VFBB 3L5HA 3VFTA 4HEPA 5CR1A 3TCLB 5E2UL 1GGCL 2JB5H 4KJYA 3AQYA 3RFRA 2OM5A 4WI0A 2YKKA 5AYQA 1O7SA 4E41A 2YAQA 5BVPH 2YPLA 4XNDA 3T0EA 3GLEA 4NLHA 1KNOB 2JE8A 5D6CA 1Z3RA 2GIXA 4EDWL 1E5CA 1TKWA 4F57H 4MTMA 5IB5A 5J4MA 2R8SH 2FSEA 3BH9B 3IDMA 3WUWG 1F3JB 1HC1A 5MEOB 2HTKC 5T3XD 3MLRL 2BLFA 2Y7QA 2Z7UA 1FJ1A 4FQQB 1P69B 2EKSA 4IRSA 2FD6H 2ZF9A 3CFCH 4MRBA 4EN3C 1DQVA 4JG9A 4GUOA 4P57A 2NYKA 1B88A 1CT8A 1WK0A 3MA9L 4P2OA 3KPLA 5FHBL 1A65A 3JWDL 4XPAL 1HZLA 4NKMB 2ZOOA 4LT7A 4G6AC 4Y1AB 5C07A 1NGQL 5ID1B 1WTLA 1FUNA 2MQ3A 3OAYK 1BECA 5C0IB 3WEMA 5L2KB 1OAKH 4KZDL 5AB0A 4FFWD 2WYHA 4XXDB 5HY9B 4L1TA 5HHNA 4FQIL 4PJCF 5HHME 2HXAA 4M7LH 1M1SA 1N8OE 4GEJA 1S3RA 2A4ZA 1KTJA 3MFFA 3ML8A 5BRQA 4K5LA 1XZWA 4YUEL 1E42A 1FH2A 1PKQE 2IIJA 2DI7A 4IKLA 4M9PA 2NY1D 2WXKA 2BJML 3N42F 4HUVB 1RUPL 4JHBA 3E9TA 3F04A 4F2MA 5IQMA 3B9KB 5B1CA 5IMOA 3GS4A 2OYKA 1U41A 3LZFL 3GSNL 2D31A 2C9XA 4YFLF 5KEZA 3F6LA 4L9LA 4FYSA 2FT6A 1XGQA 1MI5D 5ISZE 2AJSL 2ED7A 3NCCB 3SKJH 3FB7B 1A6AA 4MB5A 5SWQB 1FZKA 1G1KA 4PMEA 1RSYA 1FG9C 2K9UA 1OSYA 1LO5B 5FYKU 4X2UA 4EBQH 1PIGA 5HHMB 1M4KA 2YFNA 2DQGH 4JG0H 5E00B 4JK0D 2XPGA 2X2IA 3VXMA 4AK1A 5J0BA 2DH3A 4FG4A 2VLRD 4CMHC 4D3CL 3B4NA 4V2BA 4RFOL 2G9HA 3KJ4C 2YLHA 5HHXL 1P4IL 1HQ4B 4DP9X 1A6UH 4DP5X 3AW5A 3T77A 3HS0C 1BVKB 2VDRH 3O6FD 4G6FB 2WLMA 1UT1A 3N0AA 4L18A 3QWNA 1JJUA 4Y9CA 1CDBA 1L0PA 4JAMA 1KTRL 1HEJC 1CURA 1LILA 3D12B 3DJ9A 3HNTL 4JFDE 5CP3H 2X87A 2ENJA 3CMOH 4K23L 4NKQB 4Z7OF 4PWGA 1TTCA 5CFHA 2X4QA 3JYCA 4R4BB 3II2A 4LE8A 1KCVL 4LLAA 2XI9A 1IT9H 3GRWL 4UI2A 4APXB 3OD3A 2HG5A 2Y07H 4FXKB 5SX4H 1P6FA 4KRNA 1U3HC 2K3HA 1EXUA 4L3FA 4OSUL 3L48A 1NAMH 3U7WH 1VACA 2VSKB 3QIWD 3SKUD 4CVWA 3ZR6A 1OCOB 4L05A 5I1KL 2NX5E 3FDWA 4QOKA 3AS0A 3MKGA 2BNUB 1INDL 3HNSL 4G1MA 5DC0A 3KPSD 1KPRB 3V6FA 3FB6B 4F93B 4R97B 1YEDB 1CYWA 5L88H 2WLYA 3K2KA 5D2LB 2JK5A 2Z4QB 3VI3E 1QA9A 4LL1A 1ZGLM 5LXGH 4LLQA 4HWNA 3ZTDC 4HJTA 2RCSL 4JM2D 4U1IB 5CN1A 3IN0A 1KYOK 4Y9BA 3EOTH 1CG9B 1RIVL 1SOKA 2YFOA 5MHSD 5CINL 3QFJD 2R2HA 4P59H 2EO9A 4KVNH 4N8PA 3EOYG 4R4ND 2Y3AA 4MS8D 4YAQB 4UQAA 4EEEA 5BRZA 2XVKA 1HCYA 3U9PH 5JOFB 1Y0LA 3KYAA 1OPGH 5K93A 1DQML 1KJ2L 3IJSB 3DUSA 1GGIL 3O3AB 5DGQA 4CN1A 2YAEA 1YPZF 1W0YT 2ZCHL 5LWYH 1QSEE 1FNLA 1X4YA 3FT1A 3VH8B 5KVEL 3TP4A 2HYMA 3CHQA 3IDXL 2FSEB 4TUUA 3ZIMA 4OUOA 3LSOB 1O7DE 3GBNH 3QJHB 4HUUB 3NFSL 1OM3H 4BFNA 2I5YL 2FH8A 5JIMA 4JO1H 1Z3GL 3B1UA 4JL2A 3ZVVA 3L9EA 2VKXA 4PBXA 2YC1B 1KIPA 2R69H 4WWKB 3BW9A 1OAXH 1WIOA 2IBZY 4WI0B 4GBXB 4HZ1A 4WUUE 4CJ1A 3RVXD 5J12C 1BQKA 4B0MB 4OJFH 1GSMA 1VFBA 2IAND 3IU4L 3O6LH 4ADIA 3MJ8B 1ZS2A 3OAUL 3O2VL 2X6VA 1VACB 1SGKA 4EI6B 5JIHA 1DJGA 1F02I 2P80D 1B6UA 1D7DA 1HXYB 4EI5D 2Q76A 3DI2B 2HTLC 3RA7H 3VQ2C 4OKDA 2PWEA 2FR4B 3QUXB 4P49A 3AABA 3ZTCC 4OSUH 3BKCL 1P4LA 4UM9D 4C4KT 4HCRL 1P7QD 3X1NA 2PYEA 3P77B 4PJ6A 2FJHA 1ES0B 4JUTA 1S9YA 3HIZA 3Q2CA 4QHUA 4AQ1C 1U95B 1JXFA 3QDMB 4NQCD 4JHUA 3QORC 2VDLL 3F7VA 4X9YA 2BVTA 4M6OH 2LV4A 1QFWM 1MXDA 3BISA 4X99A 1UXSA 4NI6A 2CUIA 3MLSL 4HLZG 4WW2F 4CKVX 3FSAA 3QORB 3FU8A 4PTUA 3KGTA 4XRCA 3IJHA 3CX2A 3U79A 2H1PH 3A24A 4TVPH 4U1LA 4MMZC 3U36A 1OTUD 2XVLA 4NERA 3IT8D 1NFIA 2Q8BH 2RCSH 1ZCRA 4K3EL 4DZBA 1QVOA 2LQRA 3MXWH 4EIBA 2IADA 3KLAB 4WEUD 1ZXQA 4YHIB 1T1XA 1U8NA 2EDOA 5KYXB 4HALA 3OPZH 3L4UA 3QJXA 3U9PL 5EOCJ 4ZW3A 5F9OH 2CIIB 1ML0A 5D93B 5ID0A 1EZVX 2WO4A 8FABB 2MKWA 3E7JA 4U7MA 1JPSL 4PRPB 3SGJC 4XWOD 3QNYB 5FUOH 2AAVA 3MV01 1YN7B 2XZZA 3PG2A 3OJMB 5FLVA 1TJHL 2F74B 2ED6A 3B9KA 3SE3A 1CWVA 4QJ5B 4QRSB 2DWYA 1IGYB 1J88A 3NFSH 4G43A 4NO0D 2RACA 4G8FA 4NO5A 3WLBB 4HKXA 2F9BT 5TJWK 4XNAA 4HHAB 3QCTL 1JN6A 4MD5A 5T5NG 2VLLA 4AW7A 3AXIA 3P73B 1MCWM 4S1DC 4A7UA 1UXSB 3MRNA 5TGBA 5DO2C 4HAFA 3ESNA 3BGFC 3C60D 2ZYRA 3FQ2A 4M8RA 4CA4A 4UNVA 4A7SA 1OK8A 1TVDA 1VGKB 4M7ZB 2NY4B 2C4XA 2VMEA 4HWBH 2VGLM 3MUY1 3PE9A 4R7DB 5BOZG 4LSSH 2XTJD 5F7AA 2XV6B 4K9EH 4M7ZC 3RNQB 3KXFB 2M8XA 5CHNB 1PW3A 1R17A 3MRHA 5TH2A 3FOLB 1RHHB 2H3KA 3ARWA 4ATTA 1REIA 1VGEL 3RDJA 3W2DH 3QUMB 1D7CA 1QHPA 4I89A 3UPRB 1KTBA 2HJFB 4RGND 5A40E 5FAAA 4UT7L 3T6VA 4DOHB 5EIQA 2DQTL 1TZHB 1A7PL 1W6WA 3L9RA 2QHRL 1ZWIB 3QNFA 3BQUD 2BVYA 2VKWA 4FXTA 1RD6A 3RVUD 3FSZA 2IAAC 2UXGA 3NVQA 1D9KA 5CU9A 4LEXH 1KNOA 5HYEA 5JMRA 1CQKA 2H3NB 3QA3B 4HCIA 1DJWA 4Q89A 3CHSA 5DJCA 3UZVA 3SDAC 5CEXB 3MRCA 3FH7A 2RB8A 1WWCA 2VR3A 2WLKA 4MLSA 4YBQC 4JQIL 3JT0A 2XYBA 3CFJB 4YR6B 4J8QA 4Z7VA 2O61B 5JA8B 3MOAH 4NQDE 2QR0A 4U6VL 2OX5B 1MFUA 2NT0A 3HFML 1JVKA 2AJXL 1G6RH 3DI3B 3UAJC 1BZ7B 5ESQA 5IROD 3P40A 5JXAH 1WZMA 5C9KA 1OE2A 3D39D 4W4NA 4YEEA 5TH2B 3HBZA 5AD0B 3I02B 4J12A 2HFTA 3P3UA 1HAWA 5T1JA 1N7ML 5F7KC 3SZ6A 3QHZL 2OTUB 4RDQG 2FHBA 5F1IB 3SPHA 1XTLA 1PYWB 1L0QA 1PAZA 4OLZH 1XD0A 4Y4FB 3HI5H 1T22B 3MLVL 4X6BB 1A4JA 1UVQB 2YUXA 3QIWA 2QV4A 3HLAA 3QR2A 5FCUH 4BCXA 5K9KA 3Q0HA 2BRQA 5DWUL 4URTB 2W81C 2GIYA 3QFDA 1Y6MR 3SE4A 1JXGA 2GQHA 2NXYC 5DD3L 1YEDA 3GPSA 4NP9A 3DPDA 5E9DD 4CC4A 3US1A 1KBWA 4N0UE 3F7LA 1MCOH 1THAA 3HR6A 2CA3A 3VFWB 1MEXL 3TN0A 1J05B 4BQBA 1FNSH 1KENH 4W9LC 4NQEE 5DJDB 4S0TD 1ZGLA 1D5IH 3QEQB 4HMCA 3TT3H 2Z35B 3WDJA 4OJDH 3C2AL 3C6SB 3B2VL 3INOA 3ZZSA 1VZGA 3GWJA 2VTFA 2DEYX 2YHGA 3IETB 1EO8L 1FFPB 4ZXBB 2B7DT 5J5EA 1P7HL 2TAAA 1XH1A 1JNNL 2LU5A 4W9GC 1RIUL 4YWGH 1KTDB 1T89A 4QI3A 3UAFA 1X3DA 3AWFA 1CE1H 3IXTB 4LSDA 4O51A 1C5DB 3FQNA 4KH9A 2GK2A 2BVQB 1PCXA 2M2DA 3GLAA 3NA4A 3D08A 4YHLL 2OMZB 4AC2A 4A6YL 3FFOA 3LD8B 2YD9A 1BV8A 3IETA 3KPPB 4Y2DD 4G8EA 4AUYA 4DN4H 3HCVA 2GSIB 4IS6B 1MG2C 3BE1L 3QGVA 5TF1L 1ULVA 4Z77A 2MKLC 2YRLA 4ORGB 1LDSA 2ZXWB 3G08A 1FFQA 2W0LA 4U1JB 5F7FA 1GKOA 3RIAF 3HI1A 1URLA 2JI1A 5E7BA 4W9DC 5AOKA 4I7ZC 4QT5A 5JUEH 2VUYA 3P69A 5IUSA 2MNWA 3H7LA 2APVA 1G7IB 1X5FA 2E27H 1PIFA 2CXKA 4RGNC 1SLVA 4X99B 5KOVC 5FFLA 5C08D 2O5NA 1P4UA 2F53A 4RSYA 4N28A 4KJPC 2EJ1A 3BP6B 2X0UA 4JCMA 2VDPB 2P80A 4HU2A 1JZ4A 3G5VA 1PYWA 1VJSA 2Y06L 4GAFB 4U1GB 5E2JA 4A38A 2I07A 5C8JA 4Z7WB 4DFHA 2ZG2A 4NZDA 2IANA 2YXWA 3QYNA 2AJYH 4P5TA 3RIFK 1HFUA 1MWAB 2C1PA 2WXPA 3O8XA 5T3XE 4G7YH 1O9VA 1OSPH 1UENA 3KL0A 3MZTA 4AEHH 1TQTA 4AXWB 3ABGA 4ONGH 2DTML 5G2NA 4HWUA 2IDQA 3UO8B 1QFHA 2IQAA 5KBPA 4G6JL 1D5RA 1GW0A 4TSBH 4E36A 2E7HA 1FH5L 2P8PA 1JNHB 4EUPG 5A6MA 3X11B 3LH2L 4EUPA 1EFXD 2IH3A 3I6SA 3W0WE 2NY6C 2VLRB 1PD0A 3KPMA 4D8OA 2K6ZA 3LNGA 3MC0A 4M7KL 4HJSA 1RUKL 5LQBL 4PJ7B 3WG7B 2BNRA 3P11L 1FAIH 4NUPA 4LGSB 5JIQA 3FO1B 3MX0B 3EJQA 1GMIA 3V8CA 4HK0A 4NZTL 4L4TB 4C56E 1Q1PA 2NOYA 1ZTMA 1P7BA 4FMFA 3QRFM 3MODL 3RWGA 3BN3B 3UPRA 1WGOA 1RIUH 1BOGA 4P06A 4PG2A 1BG1A 2VO8A 3FOLA 1ILSA 4AXWA 4JDZB 5DZAA 5FWQA 4ZJ9A 4DEPB 5IF0A 3RY6A 3STLB 1GTNA 3B9KD 3KEDA 4F58L 4DN4L 5E1IA 3TVMD 3O0RH 3MBWB 2MOQA 2EE6A 3KYNA 3RIFF 1NOAA 2J44A 3G5VB 1NGYB 3C5JA 1U92A 4JO4L 2E6PA 4OZHF 3CCHB 1BVNP 3H7BB 3TGXA 2QGBA 4X4MA 1N59A 4M3HA 5JORB 1KULA 4K7FB 4L1BA 3IDUA 4OGYH 5BRPA 4PJ9B 2WK2A 3TEWA 3P2DA 5I5RA 1JDCA 4M6AA 3S5ZA 1NCAL 2XXGA 1F58L 1JXJA 2WSDA 3C8HA 4XN1A 1QUPA 5E2TH 2P5EB 4GUPB 3NPSC 1ZGLP 3KYOB 2BNUA 1KB3A 4QR7A 3T3MB 1XV8A 1J87A 5B38A 5DEFA 2WZAA 4BKLB 3H9SB 4DNLA 1ETA1 1B4JH 5AALA 2XRAH 3UG4A 4OIFA 4XP9H 2R2CA 2B5IB 3OKEB 4TTDC 4Z7UA 5GZOC 4N3UA 1LXMA 3BDBA 4R4BA 4JKPH 4Z8FL 1ZKAA 1UXMA 2HT2C 2ITFA 3D05A 4Q6IB 3Q6GL 2PPEA 3BRFA 4B50A 4AVHA 1BXAA 5GRUH 1MIEL 1HDMB 5C0GB 1MFBL 1Z5LB 2RD0A 3JYBA 1D9KD 4HUKB 5AL8A 1NLDL 1KB5H 3V4PA 3GRBA 5D7LE 5DJDA 1T6WA 5I16B 3JBG7 5ILTL 2FEEI 1KGXA 1NBVH 4L4VE 4XP6H 5C0CD 1MELA 2VISB 1IAKB 4ZYKA 1X5GA 3U36B 3QDHA 1QR1A 3LB6C 3DJTA 4QYOA 4TNGA 2ZQKA 2XX0A 2VLKB 3H4HA 1WEJL 3QWQB 4X8GA 4YL9A 3ZIYA 5AVWB 1JF1A 3GI9H 3MODH 4KUZH 4N8VG 4NZUH 4TRPL 3BYTA 4X4XB 3ILPB 3FU5A 1UATA 1GZPB 1OSZA 1O9ZA 1Y07A 2DL2A 4KXZH 5H94B 4PLJD 5BMFL 5EEVA 4OFYA 1KACB 2YMXH 3EOBB 5GS3A 1LO3L 4GAYB 3CLFL 4OUUB 1G7HB 3S8WA 4KHTL 1P4LB 4W68A 2W60A 4FQXD 1IM3B 4U4IA 4DP1X 5C92A 1OY3B 1JFHA 4YFEA 1N6VA 1PPIA 2R0KH 4IU3A 4S1QH 3CFDB 4PS7A 2FWSA 1MDAA 2IBBA 4Y4HD 4KK8D 1UWEH 1J8HD 2F53E 1I8KB 2HLEB 1U8CB 2R51A 5DJYB 3BN9D 3V4VA 5T1MA 1F4AA 1VEPA 4QF1A 3B3BA 1SXZA 2OPCA 5GS1C 5L2JB 3GHEL 5FM5O 1DQQA 4HFUH 2HRGA 3WKMH 2Y7NA 1YJDC 4G9FE 4V33A 5GZOA 4PWFA 3LV3B 3S3SA 4P2RE 4XR8C 5ICYB 3RHWF 3H2WA 1YHPA 2WV3A 1PD1A 4RMBA 5D93C 4QJ4B 2RQEA 1TSHA 1WFTA 3DOHA 2VOTA 3APFA 1T3FB 1TZHA 4K73A 1X5XA 1HT6A 4WSGA 2IOMA 3SGEH 1QATA 3U1QA 1IGJB 5I1DA 2JVUA 4WTQA 5HGBB 3U4BH 3OG4B 5EO1A 5IHUH 5DRZA 3SO3C 1QFWH 3ASOB 3OKMB 5I17B 2OL3B 1W72H 3T1WA 1XF3A 5FFGA 4WUKH 4BHUA 1H5BB 1P7KA 2JJUA 4HCGA 2JCCF 1E4WL 1E9PA 2UY7A 4FXKC 5GRUL 2R69A 4X7SL 5IM7B 4L8SA 3S3BB 2HT4C 1G9NH 4U1SA 5F72S 5J7CC 2FLRT 5HYFA 3LYRA 4OFVA 1A6WH 1XIWD 3RZWA 5MEOA 2XQBL 3X12A 1JGUH 2E7LC 2PWDA 3GINA 4MA1B 5DDHA 3NTCL 5ABAA 1Y6NR 5I5MA 5F88B 3ZK0A 4L48A 4GQRA 5DTFA 3DRTA 4HPOL 1LQBC 4LARH 4N0YH 3PL6C 4DERA 4YBQD 4M7JL 5CFAA 4RMRA 4A2LA 4B41A 3GI9L 4NZUL 5DFTA 2GEQA 4UV4H 1I8LC 3HBPA 3K71B 1PKQA 1J9QA 4LIQE 2NX5B 3WTUA 5AVUB 3HAEB 4KKAC 4Y9GA 1FP5A 2DDQH 3FT2A 2OYMA 4P5TD 4N8CH 4PREB 1UA6L 4X5LA 1S3KH 1UCBL 1IFHL 3O81A 2JLPA 3VI4E 1C12A 1O0VA 1TR7A 1XSJA 2XG5A 3ESUF 4K7PX 1MHHB 3PF2A 5CCGE 2FO4A 2Q8AH 3ZE2E 4U3SB 3C8KB 3UTQA 3ZYIA 2C1PB 2YN3A 3P0YL 1E50A 3DX6A 3IYLW 5AB2A 3VWKA 2CIIA 3ARPA 1KXQA 4OF5A 4KROB 2EDFA 3ZW3A 1NMBL 3IFLL 1NINA 4G3YL 4F27A 4XBEH 2ETWA 4X7CC 1RY7B 3F6IA 3LKOA 1CXLA 1DVXA 4RFEA 4HJJH 4JPQA 5CP7A 2DMKA 2QQQA 1QRKA 1RZIA 1J0YA 1YEIL 1A1NA 3LH8A 4HISA 1QABA 2B0SL 4LKCB 4MFHA 1AKJD 3PAYA 2OZ4H 3S5LA 4B53A 3L3IA 4XN4A 3QDMA 3RAJH 3C8DA 3AADB 4OM1L 5JYLA 3MHZA 2VDKL 5BCAA 3EH1A 2Z7WA 4JFOB 3S4SB 4JFVA 1C7TA 3OQ3B 4DTGL 1BD2A 4F9LC 4F92B 5FF6A 1A6PA 3DX4A 2R56L 1DQKA 4AITA 3FQNB 1XF5A 3UTQB 1UXLA 3IXTA 4KRLB 2G5BA 1CFTB 1XGTB 2J1WA 4TPRH 3FQYA 3HMXL 3QULA 4UUJA 1K8DB 1WPCA 4KKAD 3WJLC 3L4ZA 3UZEC 2WBJD 2NY3D 1HEHC 4MASA 2HVBA 3HC0B 4AE1A 3K81A 2Y7LA 1CDHA 4HS6A 3KW7A 4P2CG 1LWJA 4HIQA 5F7YC 3C6LC 1U8PA 1HWGB 3FTWA 1S78D 5CMAA 3TFBA 2CHWA 1H6FA 1CXIA 4KDWA 2YD5A 3ZE0B 1C16B 3TS8A 5TQ0H 3O8XC 1WAAE 1BQRA 2D7NA 3GRWA 2AEOA 3CSFA 5E51A 5K1NA 3VWKC 1XHHA 5K59F 3LSOA 4OLWL 4GG6F 4HQQH 5HVWA 4LSQL 5F9WB 3CPLB 1AIFA 3GJFB 1FL3A 1R0AL 1O6SA 3BD4A 4AZ8A 2CR3A 3S34H 3RL1A 4MDIB 4MA8H 5B1KA 3VG9B 2AV1B 3W0WA 2E4FA 4GMTL 3B3IA 5J06A 5DVKA 2GK0A 5IM7A 2YKLL 2NY3B 2B3IA 3P0YH 4TM9A 5E0FA 4JY6B 2J7LA 4H2AA 4N2EA 1J0HA 3WIHA 1UB5A 4G59C 2MTAA 4FQQA 2R59A 2AZAA 2R29L 4P5RA 4LOUC 1QQDB 3QJZA 4GKOA 4JNXA 2W9DL 4NCDA 5DUJA 4HULB 5J12B 5E99L 3L4TA 2JELL 2VIRB 5EF3A 2QDWA 1CL7H 1HHIB 2AJVH 5E9DB 4HJ1A 1I7UB 5JOEA 3TEYA 2Y22A 4UZGA 5K59E 2WXFA 4HJJL 1NCOA 4PV8B 1SBSH 3BZFA 2PW1B 4HIXL 3TL5A 1YEJL 4APQC 3R1GH 1JOIA 2VLRA 1KCLA 3RI5F 5EZIL 3RAJL 3QPXL 3MV11 4OBRA 5C0AE 4OM1H 3D34A 5GJTH 4EVNB 5FIEA 4X83A 3VRJB 1CD1A 1R3IL 1PGRB 1YYML 3PUCA 3ZUNC 4HOMA 4NQXB 4M5TA 1TVBA 1JGLH 1A7OH 2PABA 4KNTA 3VI3A 3CHOA 4TPRL 2FX7L 5FDYA 3V55A 3RPIA 1SOSA 1UADC 3OAZH 3VE0A 4ECNA 3WTVA 5CJOH 2F8XC 4M1CD 5FCSH 2EEXA 1IM3A 1MWAA 3LN4B 1JPTL 4ZTPL 3NG5A 3T3PB 4IOIA 2JFCA 4Y16B 3E3QE 2X41A 3KGRA 4LCWD 5C8JB 4P2YA 3T6QC 1M2VA 4LRNH 3CXDH 2H6UA 5EU5A 1VFUA 4I2XE 4MQSB 4WGVB 5K33A 3NJKA 3U4KA 4FADA 3B2UC 2ZUUA 2O5YH 4A2HA 5F3BA 3MRNB 2WAHA 3IMUA 2QVFB 4I3RL 1EMTH 2WQAA 2OSYA 4JQXC 3CZFA 3UTTE 3SDCA 1A0QH 4PJAE 3FO0L 3SQOL 4TQEL 5BS0A 5BV7B 3GXMA 4YDKH 3B2DC 2A73B 4C83A 3C5SB 5DRXB 1KCWA 35C8L 4JFDB 3NZHH 1RQ5A 1D6VH 1NCDL 2C9QA 2H3XC 2UUDH 3GMNA 3FUJA 3WLBA 5I16A 1D2PA 4KRPC 1CLZL 4NUGL 4H20H 4S2SA 5DQDL 4CC1A 1KELL 2XPGB 3EJSA 1EEZA 3GC3A 1DFXA 3CN3A 3BUBA 3IMBA 5EDSA 2BNRE 3ZN6A 1BWMA 3TO4A 5AVSB 5J6GA 4Y89A 2I7OA 2ZKHL 3GBDA 5C0EA 2R7EB 3SKOB 2XFXA 3FB7A 3AGWA 5FKAA 3FULA 4Z23A 3S3JA 4NLAA 5I75B 4APQB 2Z92A 3E2HB 1Z0NA 4DGIH 4GLRH 3ZT7A 3EHBD 2YOAA 4GPVA 4KKBD 2R7EA 5KVGE 4YSRA 3F65A 1HZHH 5LGKA 2A6KB 6PCYA 4I0PC 3DDFA 3LEVL 2WXMA 3JWDH 2ZXQA 3O45B 2NY5C 4PRNB 1M6OA 4LHJB 2GPZA 3B7TA 2UZYB 3QEGH 5EV7A 2ZUSA 4ZNCD 1QBML 1XIWA 2MQGA 3GZOA 5FA4A 1LTXA 4MZ3A 3V52L 3FZUD 1YMMD 2GFBB 1L9RA 5GGVL 3OR6A 3Q7JA 2GT9B 3KCWA 4PFEA 3EDFA 2CBOA 1J0ZA 1YEHL 2AXFB 2BP8B 4P46B 4UTBL 5J11B 3GXNA 4AL8H 5ICXA 4ANVA 3CCHA 1XF5B 4F8OA 2APTA 2EIJB 2FBRA 4LDOB 1BD2B 1SLUA 2LLLA 2WWKO 4KRPD 4M6MH 5JW4M 4GRMA 3J8F7 4I4WB 4IHBA 4LOEA 4RETB 5DJXB 4EUPH 1S7VA 4P2QE 1DBBL 3AREA 4JO3H 4PVMA 2PXYB 5C0ND 1SNRA 4DCQA 4QAWA 3HRZC 4FCAA 4P57B 3GLDA 2AJUH 1OB1B 3G3LA 3BRGC 4PGEB 3JTSB 1N0LB 1I8IB 1E27B 3NIFB 5HYQA 5DUBB 3U4EA 1GPOH 2CMRH 3CWGA 3LHPL 4OM0L 1UD4A 4HWZB 3MV8B 4GKZB 5I73C 5EEUA 3MLRH 4K9EC 3LNDA 2FIKB 3H42L 5GJSH 4UT9H 5CN2A 2Y7OA 4JM2B 1P7QA 1SXCA 4EBQL 2CR0A 2GB2A 1UJTA 5C7ZA 2X2YA 2AK4E 2BP3A 3KS0H 1U3NA 2ITDB 1WYJA 5EF2A 3QA3A 3UZVB 2DLIA 3LKPB 3O0LA 4NP4L 3HMWL 3WN5C 4MJ6B 3QJHA 3C8KA 1KPUB 2VJXA 4HUUA 4UNUA 5DD0H 5HHOA 4B60A 1YNTB 2IG2H 3AU1B 1AO7D 4CGTA 4R0LA 3PL6D 3VH8A 4FZ8L 5CM1A 1QSFB 1BOYA 2VDRL 3NIDE 2YRPA 3ZU8A 1CN4A 1FN4B 1SJXA 4LCUB 3ZL4H 3FNKA 4JZJA 1KV3A 2Z7YA 4WEEA 4RNRB 1E4KA 4CAGA 5JW4R 4EZJA 2ZXCA 3OSVA 5I26A 2V0AA 2HSIA 1U8KB 1UB5B 3OQRA 1LE5A 3QZBA 4ZS7H 3PHAA 4H5SA 4WFHD 3WL9B 3ZE1F 1MJJA 5DVLA 4H0HB 2GJ6B 2MPAH 3BAIA 2YGVA 4XCCL 5KVGL 2A2QT 4JFXA 1QWNA 2F7RA 4RH4A 4BUGA 1I82A 1W0VB 3G5ZA 3TO2A 3GJEA 4PJGA 3BEVB 5EPMA 3JUZA 3VW3L 1JS4A 3RWHA 1JVOA 2CNYA 4JN2A 4OQTA 5KSBA 4JHWL 4ELMF 1O9WA 3V5HB 3IGLA 3P4MA 4XBPB 3VXOB 4RLDA 4WJ5B 3X12B 4W9CC 3SKJL 1F2XK 1QBBA 3RI5K 5KVDE 1WC7A 1CE6B 5FB8B 1JF6A 1S7SA 3RZCD 2FQEA 3TH3T 3UTTA 2OULB 1QW8A 3CZKA 5ITFA 3UJTH 3P0VH 4L4VD 5LBSL 4UDTA 5CIPB 3TA3B 3L6FA 2ADFH 1T1ZB 5DD6A 5DRWB 2X1QA 4JG0L 5CLZA 4MA7H 4XP1L 3BT2H 3DOIA 1A22B 2QSCH 3O6KL 3MRBB 3OKMA 5I17A 2COQA 4QRSA 4W6WB 3MRLA 4DEWA 1JYVA 4GXUM 2HJKA 3LXUX 4WW1A 3HAEG 3VGAB 5B38G 2AGJL 1XF2A 4L3CB 1A3RL 1RIVH 4TNWF 2Y4SA 4IMKA 3EGDB 2AJUL 1HU8A 4KVNL 1CIDA 3DYOA 4M4RA 3OB0H 2CK0L 4ONFH 5FYLH 5F7WC 3GZPA 3MRQB 2D7MA 1BEYH 3EH3B 4OM0H 2VDOB 2V2WB 2C9PA 1MFAL 3PU7A 1K9TA 3B6SB 5ID0B 9CGTA 5JR1H 5GJSL 3QDGE 2PW2A 4GB9A 1JRHL 2C5DC 4QXUL 4OVUA 4WU5B 2AXGA 3D25A 4HKJB 4BFJA 5AW5B 4UOW1 4P9HH 1F8TH 4QYAA 1U3HD 2OI9B 1L3NA 43C9B 4Z7NF 1M3IA 3MDJA 4HKBA 4N1HB 1JPFB 3IJEA 5GGTA 1U8LB 1HL9A 3IDXH 3R0MA 1TFHA 1YN6B 4O9HL 1E4XI 1OLLA 5GS1A 2WYTA 1GRWA 1DO6A 3GKWH 4YHNA 1A9BB 3GBNL 3ZMRA 3S0PA 3MYZA 5DD0L 3QORA 4UNIA 4XRCB 5DD1L 4IU3B 2BCMA 4PVBA 2YD4A 3PABB 4UQ9A 4R84A 3UYPA 4FLHA 3WXVL 2EDHA 4HJ0C 4NKOA 3BKMH 3CC5B 3DSNA 3FSVA 5E1AB 1M3JA 3DVNA 5AWNH 2HJLB 5CAYB 2EEFA 4HG4J 2NNFA 4X4XA 1G0YR 1DTUA 3NCYS 4JM2F 4OCSH 2EAEA 2OW6A 1UKTA 4R90H 5LXGL 1V7MH 4UF7C 1GAFL 2AXWA 1FFRA 4QUOA 4BKTC 5GRVK 1AGEB 4NENB 5EOTA 3BKCH 1PX3A 4Q2ZB 3FQWA 4HCRH 4TQHA 4FEMA 4JLRB 4WWOA 3CHRA 4D9LH 3TIDB 4HKBB 5EIVA 3VXUE 1P1ZA 3WNLA 2IO5A 2OXGB 2YD8A 1FCGA 4LOFA 4N9GA 1DDHA 4X5QA 1NZRA 4L3EB 4DP4X 2UWEF 3BQUC 2LTQC 3L3JB 4I5BA 1GY1A 3I50L 5D1XC 2TSBA 1UH4A 3MRQA 1Y18B 1LDPH 5KVEH 3W9DA 2A83B 5KANI 5KTEL 5L2KA 3NCMA 4XHJD 4YBHA 4LLDA 2VIRA 1TQBB 1A3RH 3UEZA 5CUSH 4MQXD 4ELMA 3QFJE 4HIHA 5GSVB 2V6HA 4ZUSA 2KPWA 3NGBB 4XP4H 4N0FB 1HI6B 5IJKA 1JK9B 3PWJB 5EU4B 4ENZA 4MNHB 5IW1B 2ATAA 3ROLB 1ASOA 5JO5A 1V7NH 2PPCA 4ZMAT 1UA7A 1NPJA 2RR3A 3F58L 3V4UL 1LMIA 2YR3A 5JR1L 1UUSA 3REWB 2WZ5A 3K6FA 1RUML 4ZAKB 4UDTB 1IARB 3IF1B 3TVMC 1WCQA 3O6LL 3QRLA 2AQ3A 2J1ZA 4QXUH 4PSPA 4XVSH 4LIQH 1MCPH 5DHDA 3QNXB 3VVVA 5C09E 1RZJL 1G9HA 1NPUA 4RX4D 4OF3A 4PV9A 4DKTA 2UWEE 4A63A 4B3VA 5JHLL 3EO9H 3B7YA 3ULUE 4RMVA 1KDJA 1KT2A 3TJEH 5CCKH 5C70A 5DD1H 1P0SE 2VXUH 4FQHA 1N6QL 4Z7WF 4NBYB 5FK9A 4B9JA 2R15A 3MBWA 4OFQA 3FTYA 3EJZD 2K7PA 4MB3A 4GG8A 5DJAA 6FABL 1X7SA 1CFVH 3DGGB 3HC4L 3CSYA 4ZBJA 2OJZH 1T7ZA 5A3IC 4FP8L 3WKQA 1UB6A 2YD3A 4MYPA 4Z7VE 5FO8B 5D5MB 3ARED 4NQEA 2OKMA 4RNRA 4J39A 4O00A 5F6HI 3ECBA 1MUJB 3DKHA 5IB4A 5E8PA 1OAJA 1AR1C 5E6UB 3SDDA 1QSFA 2JKLA 4K2UL 5AAMC 4CSPA 1MRCH 4R3SA 4HJGB 3MRDA 1AHWC 3QHFL 2AMUA 2VZTA 1WUZA 2A9AA 2GBUA 1IC4H 3VGFA 2AP2A 1XBRA 4ZFGH 2UZIH 5FW6A 2D03H 4PB0H 3W2DL 2DQEL 4JAMB 5TD4A 3CQQA 3BUQA 2AK4A 4BSWB 1EV2E 3BIKA 4LSTL 4Q8BA 2IF7A 3DV4B 2RQ8A 3BPOB 4UT7H 4A66A 2ZCKL 3PV6A 5JDSA 1KXTA 4AV4A 4JL1A 5I5IA 3PDGA 4JANA 1UASA 1ONQB 1RZKL 3Q2NA 1YYLH 1ZA6A 2H0PA 5FYLD 3QQ3A 1HCFX 1HQ4A 3ZKSD 4JJ5B 5LGJA 2H1LM 4W9IC 3U9UB 4EI0A 2BW4A 4I0CC 4RVBA 3TU6A 4Q0XH 2ZUYA 1JHTA 4PGEA 5IOPA 3SCMD 2XN2A 4DO6A 1OZUA 4JVWA 4E9SA 4K5OA 3UTSA 1RULL 4XP4L 2I07B 5IK3A 2OMUA 3KLSA 3FHQA 1ASQA 2HJLA 5LAPA 5ABZA 3NZ8B 3NDZE 2AQTA 5I1CH 1QSED 2AV7B 3AVEA 2LR4A 4LEBA 5ADPH 2VZVA 2RFXB 3HFMH 4RDQF 3S2CA 3D7PA 4GQZA 4OVVA 5SWZD 5JXAL 4PMFA 2F53B 5DC4B 3NJIA 4LCYB 2YPVA 2E75C 2YWYA 1QWUA 4XC3L 3T8VA 3EBAA 1T0MA 3GBML 5D71H 4N5EC 2B2XH 2BSEA 4FQ2L 3DK2A 5F71A 4FERA 3VFGL 1QFUH 4YHNB 1ZT7B 4YL4A 4XOBA 2GC7C 4E9XA 4KWUA 5FGCE 1D6EA 1YPZE 3F7RA 4H0LC 4R2GC 4ZTEA 3MLWL 3LRKA 4LSSL 2B08A 4PS4L 2V8LA 1THCA 1WO2A 1DR9A 2VQ1B 1TEFA 2FO1A 3FUKA 5IT2L 2I9LA 5DJAB 3COOA 2VW4A 3VX0A 1KWKA 4DK6A 3I6GB 2F7IA 3VGGA 3S9DB 1QO3B 1AHWA 2FB4H 4IRZA 1JTTA 1CFVL 3HC4H 1MCKA 1H6TA 5DVOA 3SPGA 5JW4N 3EDKA 4KUCD 3KHQA 4B5ZA 2WY3B 3GZQA 5EU7E 1DQJA 2DQTH 3I3DA 5CJQH 3FN9A 3MA7B 3WS3A 3PXLA 5I23A 2VZUA 1XD1A 1N68A 3BAEH 3EYVB 1R19A 3ZQXA 3LKQA 3EGDA 4BH8B 2QTVA 3MV9D 3S36H 5I1IL 3WTWA 1B9KA 4GG6B 1OWRM 5FYKL 4AWJC 4XCYB 3US0A 3PIQB 1LEGA 4P48A 1URIA 1OPOA 2BMKA 2IDUA 2RALA 1CGYA 4KC3B 3TWYA 5C2BL 1E7VA 3D30A 1GOHA 2D2CC 2X88A 3O6FC 5ENWA 1JPST 1MFDH 3BDYH 1QEWB 4D7BA 2Z8RA 4JKKA 1EFQA 4LSTH 2V9UA 3FUNA 3QXAB 3HN8A 3Q5OA 1NBYB 2BSCA 2HLFD 2ERJC 3IDMB 2KQMA 2DEWX 5TF1H 3P9WB 3MREA 4ZMVA 1QA9B 2Q20A 1OKEA 3B2PA 1UKQA 3L3JA 3NUKA 3VD3A 2QDVA 3QQDA 5DRNA 4JS7A 3BT0A 4B27A 2PCPB 2HN7B 3OR7B 3WTSA 3SDCC 4OLZL 4PRIB 1GGBL 4H4NA 3WKYA 2R1XB 2OR7A 2IDFA 4HGMA 1P6WA 4UNTA 4WEBL 3WJMB 5D55A 2FJGA 3DARA 1LD9A 5DWUH 2UXVA 4B9KC 1MRFL 2H2PD 5ADPL 1RK0A 3UBXA 4HGWB 1S9XA 4PJAF 1NH6A 1XCWA 3P02A 4AM0B 3WJMA 3II3A 4LPUA 3GFUA 3I75B 2NQCA 1ZHBB 4D2NA 5TF0A 2NY6D 4GIAA 1HX0A 5JHDD 4QGTA 2Q3XA 4HETA 3TA3D 1A25A 1EK3A 2AQ2A 2LU3A 3L2MA 3DTUB 3HZKA 3TF7C 3HZMB 5AAWA 3BPLB 4F33B 1O5DT 1XFPA 5H37H 2HH0L 3CC1A 4NKOB 2OMYB 2KKQA 3QQXA 3ULUF 2YRBA 3ARBA 4OZGF 4OLYH 1W8EA 3PABA 1AXSB 3NZSA 4YHLH 4XPFH 2WLIB 5GSRA 4ATWA 1ID2A 3FRPG 4IMKC 4MD0B 3MV8A 4KRMB 2UV3A 1SF5A 2WQ8A 3VXSA 2PO6A 4HKZA 3VFSA 4IGBD 1RUKH 3GTNA 1BFVH 1ZVSA 4WWKD 4NJ9L 3BAEL 3TOPA 4JFWA 4M7LT 1CDUA 4GKNB 3HE7D 4TNVF 4NZTH 2AXGB 2IDTA 4HKJA 2NY7H 3MV7A 3WTYA 3I3EA 4HS3B 4I18A 4L4JA 5IQ9B 2CNZA 1U9KA 3MGOA 5LLIC 3WHXA 3JVGA 3D9AL 4TVPE 3VFRB 3VUAA 4JHAH 2P47B 1BQHB 4NZRL 1TJGL 5EBWA 4JRLA 3MA7A 3O2WL 5IQOA 2OCFD 1JDAA 4IU2B 4MAYA 1KB5B 3TBTB 3JZYA 2AEPL 3PJSB 1ZOXA 5EA0L 3MLZL 5J13C 1E3ZA 3CVCA 3CUPB 4JFUA 3DVIA 1Q9KA 1VA9A 2OS7A 4JDVB 2XLLA 3HZYA 3BLPX 3OKOA 4RX4A 4G42B 4NPYA 5IMMA 2DBJA 3DJZA 4KXAA 1IGTA 1JTPA 3G04B 1A4AA 5BRZE 5T3XL 3BC9A 5DK0A 3FQXB 4LBEA 3TV3H 3EDDA 3PPEA 5BUGA 2ATKB 2LGNA 1A2YA 1ZAGA 2K70A 3G6DL 3T0WA 3U0PB 3UTOA 1ET5A 2G5BB 5KSAA 2HX8A 3V5HA 4NNYA 1TZGL 1L4IA 1T2QL 3DIFA 5DU7A 3FFDA 5HVFB 2F54D 8FABA 5KJRH 2IAMB 5AVXB 1ZT4A 4L9LC 1Q9LA 3FQUB 1IMHC 2N7BA 2DJMA 3ARBC 4BQCA 4EN3D 1BF8A 1XXDC 3MV7B 3QUZB 3VXTB 3LXAA 4E41E 4CBZA 2IADB 3KLAA 4RGMC 5AYUH 5BZWA 1JSYA 3STLA 3WL9A 1MCIA 3VFOA 1E4JA 4F7EA 1UEMA 2WSKA 1BOGB 3POCA 1DJZA 1YLBB 2HH0H 5E9DE 4NYLB 3V0AC 2I9TA 4Y5VA 5KJ7E 2L7JA 3WN5B 3CZFB 3SJVE 5GPRA 1YMME 1I9RH 1YMMB 3LKOB 2CUAA 1NMCB 3TEXA 2A9NH 5DMIH 1MCCA 2PMZA 4NHUB 4IK7A 3NBNA 1BEXA 4A2MA 4B9YA 1TZIB 1JZGA 1M2VB 2VAJA 2NR6A 4Q9RL 1LHZA 3O2DA 1MXGA 4A2DA 5HHVH 1F6FB 3KG5A 1NBQA 4JO4H 3AT8A 1A7QH 3VU2A 3NP4A 5I1HH 1QLEH 4FABH 1UTDA 1CQYA 1KDIA 4PGCB 1BFOA 5FYJE 2GKIA 1PFOA 3SDAD 1CD1B 3PDOB 4A7GA 4JFHE 1W2KT 3CBJB 1NDMB 4TSAH 2FT8A 4UQDA 1FHGA 5A7BA 3WY1A 1CGSL 1BVNT 3QQDB 3ABZA 1ORQA 4PRBB 4LCCC 1F6AA 2E6QA 3F85A 2ITCA 3AG2B 3ETTA 1YCSA 5F88A 25C8H 2BSED 4Q56A 2N4IA 2W94A 2WTOA 1QZ1A 3QO0A 3MUGB 4KQ0A 1AZNA 1BQHG 1DP0A 3A4FA 5DDHB 3LB6D 4LVHB 1DLHA 1XH0A 1RZFL 3TBWB 3Q6GH 3TV3L 4R9HA 1U8JA 4U33A 3FCSA 3V0WH 4BDVA 4X7FC 1EGJL 5D96C 5TE6L 1PLGL 1PBYA 1AHMA 2WNXA 5J9PB 5FA4B 3VFOB 3BH8A 2QMKA 4MDJA 2A9MH 5DMKA 5AW6B 1BJ1H 2VWEC 3F8UB 4PJIE 4NQSA 1A9VA 1FO0L 2G2NA 3BUYA 2F8OA 4NWTH 1B4LA 3FK3A 1KIQA 1WF5A 1IEBA 1KEMH 4UM9B 1K5WA 1RV6X 4NNPL 1Z66A 2J8UA 3LCYA 4RA3A 4AEIH 2B39A 2IDSA 4UYPA 2BVQA 1FC2D 3W9DB 3DUUA 1FYTE 1Y18A 3OVUB 2B20A 2WJ5A 2ZKMX 4UU9A 4R5VA 4KUZL 5E6IC 3AU0A 1D5BA 1BAFH 4M5ZH 1NBZA 4O4YL 4M02A 3WSQH 5HI5C 4TMPA 5FUZH 1ORSB 4M1DH 2R23A 2UZPA 5GS2D 2MPVA 1Q0XH 4GJTB 4O58H 3FN3A 3CE1A 4OLUL 4E42B 4TOYL 2XWEA 3TZVD 2G30A 2CJSA 4KKQA 4R4FH 1DJXA 3VWJD 4XWOC 3VFWA 5DJYA 4Q9RH 5GHWH 5EU6B 4X5RA 1E2WA 5HDWA 2HMID 5JW5A 1CGTA 1WISA 5ES4B 2XZAH 5I8KL 4W9FC 5L9DH 4JFYB 4P4RA 3RDTB 2YO3A 4J1UB 4K8RL 5DLMH 2NW2B 4FQ1H 5C86A 1A9EA 2YGPA 4CADB 1ZEAH 1WVZA 4UMGA 1PY0A 2X1WL 4FFZH 1AXIB 3L16A 3NZ8A 2JJTC 3ZGHA 3OZ9H 3UC0L 1DCEA 1OL0A 4LHUG 5IHBA 3MRKB 3UTSB 4AGQA 4HF5H 4KZEL 2A4CA 3D3VE 1R9FA 4NKDA 3OMAB 5I9QB 4H7VA 5IJKC 1E4KC 2ZSVA 2XXMB 2Q8AL 4NUJB 4ZTOL 1S7RB 3QFJB 5DUML 2R0ZH 1CC3A 3U4BL 4K3JH 2H6PA 3AWEA 3MJ8A 1B6DA 1U33A 1IB5A 1JPFA 2IPKB 3IJEB 1T7VA 1TQWA 4RGNB 5DJ0B 2UYLB 3SBWC 4KTYA 3VXMB 4ETQA 1YJDL 1HXMB 1C1EH 1IGCH 4X7EC 3WJLA 4BV1A 4CN4A 5GZNC 4OZFA 2D3VA 4MXVF 1KN2H 4EZMA 1D5MA 5C0GA 4WWKA 4FXGA 1J0KA 2BVOB 4KFMA 2CGYA 2DQMA 5LNEA 2WBJB 1NBZB 2RGSA 2ARWA 4MMXB 5B22A 4Z7OE 2W59A 1JGUL 1G9ML 5AZEL 3SDCD 3PV7A 5IZ7A 1MFVA 4NWTL 1ZWIA 2GJJA 4ZAKC 2KHAA 1BMZA 5E9DA 5E4AA 4RRPG 1VADA 2FWLB 1GY2A 1UWXK 5ERWA 2D31B 3BSZH 3MCKA 2CH8A 2A1WH 1MUJA 4ZS6C 3O41A 2H6OA 1I1RA 3IJSA 3ZJAA 2VYRE 1XR8A 3ARRA 3HC3L 2CR6A 4N2BA 1HQRB 4G82A 3PS6A 4HPYH 4PRIA 3V6OE 1DQDH 2HFGL 4WFHE 1OARL 3UIZA 2P44B 3DHUA 3R19A 4HJ0D 2JTYA 5IVOA 1AMXA 2ZCZA 3WNMA 4GYBA 3ARGB 5KN5B 4GY4A 1MHPL 1P5UB 3C09C 3IFOB 4Y2DA 5AL0A 5HGAB 2CGZA 2JJTA 3QO0B 4DSYA 5F7UA 2DIBA 3GHBL 3FO9A 3V0HA 1KCUH 4UAOC 2EO7A 3EHBB 4GMSL 1ADQH 2H26A 3MUZ1 3QUYB 3RKPA 3ZRFC 5HYJB 5HDBF 3QZWB 3QEHB 3VGHA 5T1DL 2EXSA 2HFFA 5LJYH 5E1QA 4JE4B 1K3ZA 1S7WB 3IRZA 3S3CB 4XAKD 1NDMA 1F41A 4WU7A 1AH1A 4ZT1A 2X0WA 1W91A 1A8JH 3QIBB 5CSGA 1INEH 4OLWH 1OWWA 3W39A 2F53D 3O6ML 5B1BB 5CBEB 3H0TB 1KLGB 1NGPL 1BFSA 3QIBC 4AY0A 1IGJA 4OB5H 4XNZC 5D1QB 4ELMB 3VFPA 4S1RL 5IOKA 5ERWB 1Q90A 4KAQH 3QHFH 2ZP0T 4XPHL 4RIRA 3RUGF 4XNBA 4FLQA 4ZX6A 4OTXH 1ETB1 4HVBA 4G70B 1D2OA 3ZUCA 1EJOL 2EC8A 4C55A 4F9PA 2XBZA 4U6HA 4WO4D 1FAKT 3S6CA 4H8WC 4M5SA 4JRYA 1DDHB 3QEQE 4WTXA 4HW6A 1TSRA 4DUVA 1NEZA 2YPKA 4EZKA 2R56H 1NDGA 3QXWA 1SJEA 1AD9A 2X1PA 3JWNE 3CSPA 3TBYA 1HH6A 1RLBA 3DETD 5L4IA 2YXVA 2QQNH 4DPRA 1G94A 2DKSA 1KYFA 1IBYA 2I60H 1G9MH 2AQRA 2ZSVB 2E4TA 4H8WH 1BCIA 2ILLA 2C7FA 1VCBC 2P42B 2G3XA 3BSZL 3GNML 1CD0A 1ZVNA 4JG1L 4JRXD 5A2AA 5SWSA 2ADJA 4LCIL 4F7KA 4N9OB 2EUVA 1FPTL 1RK1B 2O6PA 3IBEA 2VR7A 1KWGA 2EDLA 3WUWB 4X42A 2VDKB 4LLMA 4ZFFB 4ZO8A 2XTJC 4GQ9H 4YNYB 1RZGA 1FZKB 1GZPA 4QRRE 3NIGB 3LRHA 4PJ5E 3MOBH 1DVFD 3IGKA 4L1LA 2QT6A 4R5XA 2L7EA 2FO4B 4YSCA 1MN4A 5DI8A 4AYBA 4KKZA 1DLFH 4IBSA 2K3TA 1R47A 2C3VB 2Y36L 4GBXC 1SJMA 3GMRB 4K5PA 4NFBA 2X4TB 1BPLB 1DE4A 2N59A 4IJ3C 5A2KH 2RA1A 2FYVA 1IBHA 3TVMA 3LPWA 4TL4A 1IJNA 3CXDL 4JDVA 1BZOA 1AR1D 4AOFA 2H1XA 3DX7A 4OAWB 2OMNA 3QXDB 3K71A 3O3DA 4A2EA 4CC4C 5JZ7C 1USQA 2VDPL 1DL7L 4OCYH 4V1DB 2DI9A 3RWJB 4U6XB 4H0IA 1L9PA 1TCRA 2VQ4A 3VMPA 2OJEA 2V8MA 2YQ3A 4AVKA 4R3SB 4F8PA 1D6VL 1NCDH 3VFRA 1JZ8A 2C9VA 4A7QA 1CLZH 3F00A 4U6TA 1VEMA 2CM6A 5AVTB 2DQIL 3DECA 2YD7A 4PRHA 4QRAA 3W56A 1FCCA 2OP4L 4P2OB 4F7MB 1BW8A 2VN4A 2XDHA 2P48B 4GSDL 4WU7B 1PG7H 3MNDA 4JFEA 4AYGA 3U2SA 1Y0LB 1AZRA 3INUL 3PP4L 4Y1TA 3VD4A 3BFWA 1WP6A 1JCKA 4NRYA 4PJ9A 4DAGL 3HRZA 3KH4A 1J5IA 3G9AB 2X5PA 1J1OL 1I9EA 1UVQA 3QIWB 2ICWB 2HT4D 3AROA 4HS8L 2DB8A 3KWWA 1JFQH 5K9JH 5KSBE 5DF0A 4KTDL 3ZQ9A 2YAOA 4MQXC 4PRBA 2YIHA 2RTTA 3BWZA 3NACH 2WSPA 1ZHNA 2XUWA 1NKGA 3AACA 1T4WA 3VXRA 3UG3A 2NXZC 5BUPA 4B9GA 4PRIE 4WFGE 4PAZA 4PN6A 4XP5H 3GF8A 3KPQA 5HD8C 5E7FA 1FBIL 4PJDB 4L5FE 4QF1B 3O41B 2EDEA 1KJ3H 3SYOA 1INQA 3NDYE 2VM9A 3RWGB 4GKSA 1LO2L 3SODB 1GTFA 4CGUB 5LBVA 3RILA 1OP5K 4GW1B 5KZCB 3O4LE 3TXAA 3R0NA 1KJMA 1BZ9A 1NCBL 3M8OH 1CFSA 5CEXA 3N5AA 2H4EA 2JCCA 3IFNH 4E41D 4U6XA 1GPOL 3LHPH 4PJIB 5GRWA 5HDQH 1CB4A 4R83A 4DN3L 4DT2A 1KCSH 3OKKA 4ZMWA 4YO0B 4XNUL 1S6NA 1EWHA 5M94B 4NYLA 2VR4A 4FQXC 5FYLE 3MN8A 4N2AA 1TQCC 5DUBA 1J1XH 5J13B 3BXNA 5DI8B 15C8H 1F42A 4N2DA 1U21A 1DBAH 4PRDA 1ASPA 2GG1A 3KXFA 3HMWH 3NCJL 3V0EA 4NZFA 3KR3H 5FYJU 1HVXA 4XMWA 4DVRH 3GXIA 5I5JA 2OXHB 4XZ4A 4W1TA 4FHJA 5F3FA 3HN5A 1JZ3A 1QFOA 3WU1A 2VDOH 4AE0A 5JPNB 1AIFB 3GJFA 4LCCB 3FFDB 1BPVA 3WDIA 4CADA 3ET9F 2GTQA 3WS3B 3INUH 5EO0A 3MBEB 2B9AA 4DQOH 4JGMA 1SLXA 3M17B 5TGBB 3ARYA 5MI0B 3HZVA 1KGYE 1BYPA 1E4XH 4LHUD 5KVDH 1Z7JA 4U31A 2RMNA 5EF0A 2YEZA 2Q6WB 4LSRL 1IGTB 5E8NB 3EF7A 4JPSA 5D2LE 3LMJH 4UILH 2ZNXA 1U8PB 4X5PA 1BF5A 2FHFA 4AMKL 3D25B 2FATL 3HC0A 5D7JD 3O45A 5BQ7A 3L4YA 3C60B 4AEFA 4X7TA 2OMVB 4PJXA 4BQ8A 4X4YB 4LF3A 3IS1X 2LFGA 3E38A 5AOMA 5I8CB 1J5CA 2AAAA 1OAYH 3TJPA 2ICWI 3L3OB 3P54A 4F15B 1BZQK 2VDNH 5T1LB 4DKFL 2X9ZA 2GCYB 4E9VA 1X5KA 4LPXA 1P2CB 4MA7L 3VFNB 1MFCL 2W9LA 7PCYA 3N1GC 5KBKA 1ZK9A 5J6GB 5CBEA 1A14H 4HAKA 3RY4A 3VNYA 3KGUA 4YHIA 1KXVC 2WXHA 5D2LF 5FYJD 5I1LB 4MDJB 2CCLA 2BOBB 4YDZA 1WBYA 4ZQKA 2FQDA 1WBXB 1QSFD 3PRZA 4C83B 4ONFL 5FYLL 3EXLA 1J11A 3ARQA 3SDCB 3F64A 3NA9L 2JJWA 2WLIA 4QLRA 5GSRB 2VDNB 5IEKA 3VWKD 1AE6H 1E5BA 1ZJAA 2HT3C 5D7LB 3F7VB 4JM4L 1TQCB 3DV4A 1U8IB 1AFVL 1B0GB 1B2WH 2YAPA 5IB5B 7TAAA 1U95A 3TC9A 3BLKA 4XN7A 1HEZA 4WNQA 3OV6A 3BKYL 4XXCA 2W5PA 3GSOB 4Y16A 1CGVA 1KBBA 3UAAA 4AYMC 2CGRH 3GKWL 1UEYA 3NJMA 4WK0B 4XOCA 2MCAA 3BZDA 3MRIB 1VRSA 3VXRE 1BHGA 2VXQA 2ZOLB 1SHXA 3ARTA 3BVXA 3QUXA 4GIOA 3CFUA 4H5SB 4P2RA 2IBGA 3ZE2B 2JKNA 1HXYA 3LN9A 3K2MC 3AT9A 3SCMA 4U1KA 1V3JA 3BKML 1E8XA 1F13A 2DM3A 2XZQL 5I1JH 5I24A 1LD9B 3UTSD 1A8ZA 3G5YB 5I8EB 1OGPA 4ELKB 4YXKH 2LE9A 2P5EE 3EYQD 3AU1A 2BCKA 1MCJA 2G3NA 1BD2D 3CSYB 4PGZA 5IBLC 1JHLL 3KPOB 3Q06A 1DVFA 3LMJL 3Q9PA 3D50A 3FUIA 4Z95L 1HJCA 5JHAA 4AMKH 3F7YB 3GO1L 5CSBA 5IB2A 5KSBF 5IEKB 2Z93B 4QXVA 1AACA 1F6LL 2FVNA 5DMGD 4Z7UF 4X9FA 2WQWA 3AB0B 4WSJA 1ZT1A 2YUVA 1BGXL 1E9PB 2Q3ZA 3ULAB 2X4RB 4H8PA 3CVHA 8CGTA 5FPIA 3FT0A 4QDGA 4KVCH 5IW1A 4PYHA 2QV2A 2BMKB 3VA2C 1PDKA 2WGNB 4N2OA 1LWHA 1R3KA 1HESA 3QISA 1TJIL 4DP7X 3ATAA 5HI3D 3W0WB 3RTQA 4RFOH 4HLJA 5CUSL 3TZVC 4LDLB 4GG6E 2X7LB 2FECL 2OAAA 1LK3H 1KTDA 2P26A 1TTRA 2H2PC 4YH6A 1RUAH 3D3VD 4UAOB 1YNLH 2E7LA 2Z3FA 1MFEH 5E2WH 4ZMXA 1AE6L 1JWUB 1GYAA 3I6GA 3DX8B 2MRYA 2YXFA 2DJUA 4F5CE 3CMOL 4K23H 4LIQL 2VLJB 4I1PA 4CN6A 5F6IC 1AD0B 1I7RB 2I24N 5CZVH 4R90L 3I9IA 1IGYA 4W6YB 1G0DA 1KCVH 4UDUB 1WZ1L 5FR3A 1GAFH 4KY1L 1TIUA 1AR2A 1DE4B 2HKHH 3DX8A 3N43F 3RY5A 3QWRA 1GKEA 4KHXL 1BZEA 1OP4A 4X6EA 4IU2A 2WWNA 3H54A 1I75A 5I1KH 1GCYA 4Y4HC 3MBEA 1BP3B 1V5JA 3FONB 1JBJA 4Y5YB 2OJZL 5DD5H 4N1CA 4A55A 4HPHA 4J3BA 4YNYA 3NCEB 1XT5A 2JWYA 1FRGH 3BUDA 4HOXA 4TUJA 1KIQB 4MNQA 3DSNB 3W3BA 1R3KB 1MW3A 1RK1A 1T1XB 1U8NB 3O9WA 1N9PA 4KJWC 2NXYD 3I50H 4AEEA 5IFAH 4S2SB 4Q9CA 2X2HA 4PIRF 3MLPA 2EE3A 1OE3A 3H9HB 2JIXB 1NFIB 3V5DA 1HNFA 2OTWB 4Z95H 1I7ZB 5J1AA 1AANA 3IJHB 2NY2D 4NBXB 4P59L 4ZYKB 3MXVL 3FPYA 3FT4B 1S8DB 1KYUA 2QQKH 1ESOA 3VACA 3QJQB 3N43B 4H40A 5EU3A 3SJVD 4U0RB 4DZ8B 2FLBT 1MIML 4IBTA 3UDWA 1LWRA 3F58H 4LFHD 1KEGL 2ICEC 3NMEA 4LRIC 2W1NA 3MRCB 5AKVA 4HHWA 5JIPA 3GLZA 4N87A 3V6ZB 1ORQB 4Z7WA 2ZICA 5DEGA 3I6LE 2CK2A 2PYEB 3QHTC 4DJMA 3P30L 1ACXA 1A3LH 2XKNA 2FGWL 4XO9A 3WLWD 3QVAA 1EX0A 2EE0A 1TJIH 4APQD 2XICA 1OK0A 1S5IL 3ETBJ 3G5YA 4KI5C 3R8BB 4UTBA 4DO4A 2P24B 2KZ1B 2P4AB 3FJTA 1KLGA 1UXWB 2E9IA 1RUQL 4WO0A 3K46A 3MRBA 3MV7D 2FJGB 3GMLA 3NJGA 3JTTB 3QG6A 5F9AC 2J55A 3T4AB 2YQ2A 2X4UA 2RIKA 3L13A 3N1MC 3U6XA 3KYOA 1ZE3C 2XJLA 5DRWA 1T1ZA 4KQ3H 1BIIA 2VZ3A 4JFZL 3RVUC 3UJIH 4AENB 2HFFB 3BFOA 3BW9B 1I3RB 3IU4H 2A77L 5HGGS 3VAEA 3D4YA 5GIRB 2Z8VC 2GW5A 1H0DA 2B2XL 4CSSA 5CZVL 5DJ8A 1KT2B 4AVJA 2NSQA 5J6HA 1MRCL 5EC2B 1JK8A 4ODTH 7FABH 1HHIA 5LDSA 1H8SA 2EP6A 4WO4B 3MJ9L 1K8IA 4JN2B 4PV9B 4Y19E 4ZO9A 3P2BA 5B3SB 3TT1L 2WYIA 5FM8A 1JGEB 2ROYA 1ZSHA 3BH4A 4Z3TA 5C0BA 5FOBA 1KC5H 2EDTA 2X9XA 3KLLA 3FUFA 1DJHA 2R2EB 1KEGH 5CS7A 2CBPA 3U0TB 1OPGL 2B4CL 2CJUH 2EXTA 2AMGA 5PAZA 1H8OA 5CJQL 4NC1E 3O4OC 4M1GL 5HGBA 4ZUSB 1D7BA 1ZRUA 4QXWA 1HWHB 1BXXA 4U6YA 4ZI8A 1F3JA 2ZX9A 4LRIA 4L8CB 2APFA 1YN7A 3CPLA 4M00A 4P5SA 1ZV9A 1ZHKA 3TBSA 3PYCA 1LO0L 3KPTA 3MXWL 4HK0B 3PGDB 4PJ5D 3ULVC 3QUYD 1EH9A 1HN1A 2B3RA 3MNWA 5D2LA 3D33A 3B9DA 3G04A 4X7TB 4X4YA 1MCDA 1KPRA 4HJIA 4RGOL 1EUTA 2KQNA 3DIVA 2IH3B 3DSFL 3LX9A 3PUUA 4U3HA 5E9NA 5GGVY 3TPKA 3DGCR 4EPSA 4LCVA 3SBPA 2W9EH 2K45A 2WB1A 4FYRA 3L3HA 4AIOA 4WF7A 1MLCA 5E6ID 1WT5A 3CQFA 4IKJA 5DA0B 5EOQH 1A3LL 1NEUA 4FQ2H 3IJYA 5IIEB 3FTGB 3FU7B 3HE7C 2A6DB 4MAYB 4ZPTB 2FGWH 4P2RD 4DK5A 2PLTA 4WWKC 4W70A 1FE8H 4CMMB 2MOVA 4MB1A 1GH7A 1U8OA 2GSMB 2BOLA 1G7HA 3MACL 2FZ3A 4XB7A 4QHMA 3OWEA 4LU5L 4B9IA 4BFIB 5H94A 5TDPB 4IKNA 4HS3A 4I18B 5HI4C 3TNMB 4MNQE 1FDLH 4Z6AT 1MAML 5ICXB 4XHQA 1PZAA 1FLRH 4I18C 1F4YH 1Z5YD 3RJDA 3CXHK 4J1UA 1PJ9A 3SDAA 2CLZB 2Q76B 2YAFA 4HXBH 12E8H 2A6JB 2Y23A 3VXSB 1ADQA 4N1EA 5HJGA 3VQ1C 1TO5A 5C3TA 2Q8BL 4ICXA 1I1AB 5I19H 2NCEA 2EDWA 5KWYC 1ZDQA 4W9ZA 1IGFL 5T8IA 3PJLA 4PG9B 3UC2A 3TN0D 3APDA 1M6OB 3UAJA 2FHCA 4PR5A 4IS6A 1CF8H 1WZKA 1B2YA 3VA6A 4CMHB 1SEQH 5C0RH 2VR5A 4OLYL 1RXLA 1PY9A 2OCCB 1RMFH 5TQ2H 2VL5A 2QKIA 1BBJB 2ZIDA 4K3GA 4F5CA 4M43H 1MG3C 1QNZL 1TJMA 4UU9B 3O3BB 2DIJA 1XSOA 5FUOL 4HJGA 2QEJA 2BIHA 1A7BA 1AQDA 2XG5B 3AQZA 2WYZA 4OCWL 4N6QA 1RK0B 3UBXB 4BK8A 3QO1B 5DC2A 3HZ3A 1UWFA 2BDNH 2DQCH 5EZOH 2A0LC 3DUSB 3HB3B 3LEXA 2VQUA 4PJDA 1C9SA 3QIBA 4ZX4A 4FQCH 3IMVA 3N40P 3O2DH 2G5UA 3DGGA 2YD6A 1AKJB 3SDXF 3T0EC 2YD0A 1AYRA 2R2BB 3FN0H 1LP9A 3EGSA 4K71C 4IGBB 4N0UB 5CJBA 1MRFH 1AHKA 5DRNB 5DYOA 3UTTB 1MHEA 3S5LG 2AJXH 3QS2A 2ICES 3M1BA 4Y19B 5JORA 2QSVA 4EF3A 5K9KB 4F9PC 3D3VA 4UOQA 3SBRA 2GSGA 5EC2A 5F89B 4GRWE 3H85A 3I85A 4QRPB 5EOQL 3KL5A 4ZOCA 1NBYA 3KL3A 1WFIA 3A0OA 2VDMB 3IDGB 4WI7A 1O7VA 3VYPA 3TO2B 3BHBB 3MAWA 4H88L 4IRSC 1DVQA 5A1AA 4NRYB 2BOCB 5DXWA 4I77L 1IKNC 2N7SA 2UY7B 2H0FA 5T3XH 1XAUA 1T04A 2F15A 4LAJH 3NRFA 5K39A 3V0FA 3MACH 4E9QA 4EIZC 1X5JA 1MCFA 1SDDB 3MLVH 1RZQA 5AAMA 3EKCA 3ROLA 2LLGA 2ZNWA 4LLYA 4PY7A 4XNYH 1IAMA 3R8QA 4GT0A 3OPUA 4UANA 1U8HB 1X4ZA 4W4OC 5I6LA 1AQDB 2NY4C 2X9WA 4APXA 1WFJA 1MCOL 2G75A 2P52A 3IVKA 1N5AA 1NEPA 4B0MM 1T83A 4OF6A 1WE5A 3FO1A 2AITA 4D94A 3O9WD 1MNUL 2QJDA 1BBJA 2F0CA 3OJDA 5D1QD 5EULV 2Y5EA 3JV0A 2D7QA 3VXQA 4H8HA 2A74B 1VFOA 5FGBC 1F3DJ 3TYGH 4NZRH 2DLFL 3ZKXC 1HINH 3D69A 2J20A 5EU3B 5ESVA 4LLWB 3EFDL 1Q1JL 4AGMA 2Z31D 1XX9C 1U36A 4Y1AD 3HG2A 5B8CC 2P28B 3ARFD 2OZNA 3P3RA 3BE1H 3T0DA 3MRHB 4PY8J 5CHNA 4XCNB 2APXA 2Q7NA 3CSBA 3PWUA 4MKTA 4WK2B 5SWSE 1N7MH 1FORL 2FBJH 4C4KO 4XVTH 2E7DA 4R7DA 5HYSG 2IANB 3NP3A 4TNEA 2AV7A 1WFNA 1JMXA 4WHCA 5DJXA 5AOLA 5IWLA 4KO6A 1DQLL 1E6JL 4FNTA 2MCPH 3FH5A 1M71A 2E9WA 4JJOA 4LEOB 4PLKD 4PJHF 2YOCA 1V54B 1D9KC 3SD5A 1JF1B 2WOBA 3K7UA 4IDJL 4AQAB 4XVJL 3U25A 2AANA 2YA1A 3QT2A 3QUMH 1BAWA 5LCVH 1LE9B 4JZOA 5FO9A 4UINH 1X44A 5FECA 3CZSA 1R3HB 2OL3H 2LU7A 1YYCA 4KKLC 1MEXH 3SYPA 5C09B 5BV7H 3V4PB 3D2UD 4HS6B 4E42A 1Q0EA 5IBUB 1IVTA 3VD7A 1AZUA 1JRHI 3HCVB 4KXDA 4BD4A 2OR9H 3MLYL 4UMSA 5I8OL 5A6IA 1EO8H 1XGRA 3LNFA 3MNWB 3ZDXF 5A3ID 1ZTXL 1I9RL 1IQDA 3EYUL 1XGPA 2NXZD 3T0BA 4P3CH 1PG7W 1SHWA 4M4RB 3WFHB 2AVFA 3DOSA 4JMXA 1IC7H 3K72A 3Q6FA 4U6YB 3CFEB 4PSRA 2QPFA 3MGOB 2CBMA 4N26A 4UTAA 1UACL 1OAUH 4WFFE 4FMVA 4PRHE 2Z35A 3KE0A 4NQED 2DKMA 3GS7A 3NJJA 4L3EE 4NNPH 3HBGA 4XWGL 3UTSE 3SDDD 4N2KA 2WGXA 3WIIH 4CDHA 1FNEB 4GUCA 5HYJA 2DM7A 2YPVL 2GTWA 1XIWC 2ZP8A 5F3BB 4G9DB 4TXVB 3P4MB 4LL4A 4XBPA 3ZDXE 1FL5A 2XX1A 4O58L 1B3JA 4NN7C 5I0YA 5IB2B 2DF3A 5T5FA 5KVFH 4PVNA 1ZHLA 2XV3A 5EUKA 4TS6A 4F33A 3ARGA 4NT6A 4NN7B 4I2XB 3H56A 3DXAE 4G7VL 4XODA 2JI2A 2AJYL 4JGNA 4Q4IA 4YHZH 3F05A 2OQJA 1MJJB 1Z9LA 4FQXA 5EO9B 2PTUA 4KX9A 1UOLA 4OF7A 4OF0A 4MNHA 1S9XB 4OLXL 5F1NA 4XOEA 2V17L 1ZEAL 4PB9L 2ZWYA 4HK3N 3GB7B 4HUNB 5GSVA 1ERNA 1CZ8H 4Z7UE 5GS0H 5I0WA 1EGJH 4P4KC 1K2DB 1PZDA 2R1WA 2NX5A 4PJ5B 1PKQB 1YRKA 4X80L 4WWPA 3IAPA 3L95B 5DS8A 4BSVA 2A9ML 2ZOLA 3BGFB 4WK4B 5FV1L 2QMJA 3OX8A 4FQPA 4I5BB 5H8DA 4HXAH 1M7XA 4WUUB 4ODUA 4XMVA 5T1KA 3SDYH 2BSSA 2FEDC 3N40F 3EAKA 5LHDA 4XP9L 5E4IA 3NJLA 1ZDSA 4NHCH 4JPKH 5HXMA 4OD3H 1OALA 2E7BA 3NRPA 4DZ8A 2WP3T 1QTYT 1SFDA 3CLEH 2E46A 5FHAL 5AZ2L 3H55A 3FQWB 3WN5A 1NM9A 1O7DC 2NY6B 3OG6B 5GGUB 1HHGB 2D0GA 3CNKA 3RGVD 4FXLA 2VN3A 4P3CL 3ISWA 3ZPDA 5I82A 1Y6KR 3JVGC 3ELAT 1XF3B 4GEIA 4F58H 3L2NA 5HBBA 1EEYA 2ZZUT 1NC2D 1NGXA 2OMTA 2XBDA 1S7VB 1COBA 3DJSA 4CNIA 2IVFC 3WE6B 2OSLA 4M1CC 4TL5A 1J5OH 1N64L 1XXFC 1CLYH 1O6SB 4AZ8B 3PQYE 3EF4A 2HTLD 3IXAA 3WFBH 3RWEA 1YPZB 4WTWA 2KDYA 3QUZC 5DZ9A 1J5HA 4ELME 1QMUA 4ANXA 4L4TD 4G7RB 1A2YB 3L1GA 5CO1A 3B1TA 2APSA 1KXVA 4XN8A 3P73A 1PZ3A 3F7KA 1W0WB 3PWVA 2HFGH 1QO3A 2XTLA 1F58H 1LO3H 3ESPA 4FZEH 5CMAB 2QKSA 3WLWC 4Z7AA 4OGZA 5F7DA 4KHTH 3WXWL 5FM5M 1EFXB 2EIBA 5H2BA 3OLEA 3UP6A 1L3WA 4PHXA 4GI9A 2B1OA 5DUMH 4Q74A 3W81A 3L1OH 4JFHD 4J7RA 3WFZA 4Y19D 1WBZA 3WNOA 4ES8A 5C6PB 3MBXH 3M17A 5FS5A 3T2PA 5C2UB 2W60B 4A37A 1YJDH 2NY2C 5I66A 4Z3IA 1ZLUK 1OW0C 3U46B 2I32A 1KN2L 2QGCA 4Z0BL 5C71A 5D2NE 3SE3C 3PP3H 4LKXB 1GYUA 3UMTA 2MFNA 1GGYA 2OMTB 2YARA 4ZFZB 5D70H 1K4CB 4GKNA 4S1RH 3WV0A 5L4MA 3T77B 2EDNA 2EDYA 4J4PA 4MSWB 1ZT1B 1F4XH 1EVTC 2G9HB 2VZ1A 4EN3B 4TYUA 3SKMA 5JHDA 3RL2A 4HWBA 4LPTA 4OFDA 4WUKL 2PP9A 4GSUA 3ARFA 4XE0A 3HG1E 1ICTA 2ITCB 5BXFA 1WA1X 3KXFE 3P77A 4TLKA 4YX2L 4IK6A 4ADJA 5T3ZL 5C3LD 3IDJB 1LP9E 2OMXB 2NZIA 1D5XA 1RJZB 3EG9B 3FKUS 1GJWA 1R46A 1RURH 3MLXL 1ZHBA 1G4RA 4QO1A 3ARDD 4N3TA 3DX9A 4H8WL 1K2DA 2WZ6A 4Z7UB 5C7XL 1PL3A 4AQ8A 1LK2B 1ADQL 4QHLA 3DTDA 3PHOB 4KNQA 5C6TH 4PREA 1BJMA 2N56A 2Z4TA 1A7NH 3QJFB 4M7JH 3ZX1A 3T3ME 4KGLA 1TTFA 2M83A 4R0LB 4NN6B 4ZDHA 5D1ZD 2R1XA 1T4KB 4KTEL 5GGTH 4KMTL 5KYYA 3AXLA 2NY0C 4LVNB 1QI3A 2VC2B 4B3EA 1KXQE 1NFDA 1H3GA 4QKTA 3LS4L 3NAAL 1UA6H 4I2XA 2NY0B 4DKEH 5DTFB 4L3AA 4LHUA 5I71B 5FGSA 1QTSA 4KAQL 4KKLD 4MAYD 1I7UA 3GGWB 4ODHL 2WWMD 3ZTJH 4X5XB 2XVGA 3E8UH 3K2UH 2FIKA 4ZW6A 1Z5HA 1UZGA 5D1XA 3UYRL 4Y5VB 2WWMC 2EDDA 5K5YA 5DK2B 3ISRA 3WMSA 3ESVF 2Y3NA 5D7SH 3U2SB 4JDZA 5HPMB 5EUOE 3IB4A 5JO5B 3E6HB 4XBEL 3QZWG 2ZX5A 4OD1H 1WAAA 2FEJA 3GIVA 4F37K 2NY0D 2ESVD 3CFEA 1XQ4A 2W91A 5ABDE 3ARFC 1YEIH 3EYVA 4KFZC 4KPHL 2BS71 2IQ9H 3W11D 3VD2A 4PBVC 1BYOA 4JG1H 1F4XL 2NNAB 2BRRH 2D73A 5A2CA 5JPMA 4PD4K 3MROB 3D51A 3PCYA 4KK9D 2G0KA 4KZ0A 3KH3A 3ULUL 5CLYA 4L3EA 2WD0A 5H35B 4I9WE 3MTXA 4TV3A 3ROOA 1NM4A 1VB9A 3S36X 1W15A 3F2LA 1JXKA 1F3DH 5AAPA 4XNXH 4G43B 1M05A 3X11A 4P05A 4NM8H 4JLRA 1L9QA 4HS8H 4MXVE 4GQQA 3QG7L 5K9JL 2ZX6A 3PJSA 1AGEA 4NENA 5EOTB 4P5KB 2VDQB 4R7NB 4FXKA 3T6XA 1AKPA 2JKIS 2UUDK 4R26H 4LCYA 3UTPD 4BZ1H 1FL6A 2IFGA 3W38A 1T7YA 1SLWA 2VERN 4XP5L 2BVPA 1I85A 2PR4H 1A64A 2FUQA 3I9AA 3QUXD 1IBFA 4M48L 4BRJA 3TURA 4RAVB 3VXPA 1BX2B 2DN7A 2B5IC 2BXYA 3EXJA 2ITEA 3BP6A </