2EUWA

Structure of a ndt80-dna complex (mse mutant ma4t)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
303
structure length
290
Chain Sequence
b'VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*TP*CP*AP*AP*AP*AP*AP*C)-3'
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
total genus 88
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2euwA00
2EUXA 1M7UA 2EUWA 2EVGA 2ETWA 2EUZA 2EVHA 2EVIA 2EUVA 1MNNA 2EVFA 1MN4A 1M6UA 2EVJA
chains in the Genus database with same CATH superfamily
4NUQA 1KBBA 4XBEL 1T66D 2NNAA 2HCZX 3B8SA 3NAAH 2ICEC 3IPBA 2JI1A 3OZKA 4X7SH 3MGAA 4XMUA 4M1CC 1I7TB 3QDGE 3WKPA 3QISA 1KIUB 1T3FA 2JCCA 3U0PA 1FORL 3MBXL 3ULUC 4GRWB 1N5AB 3Q0HA 3MJWA 4MMXB 5TE6L 5F21B 3N40P 2OTUB 1T22A 3P77A 3D3VD 3DMMA 3L5WB 2GJZA 4OZHB 2K6WA 35C8L 5GSVB 5D7SL 1S7TB 4FQXA 4X4MA 5E0QA 3RWFA 5AYTA 3FCTA 1WGVA 2FB4H 3QORD 3RBGA 2BOCA 2YK1H 2XIBA 1MCCA 1OGPA 2XZQH 2YOAA 1TTRA 2UY6B 1BQLL 2KMWA 3GRBA 2C1OB 3ILEA 4OLYL 1MI5A 5C6WH 4JFSA 4X98A 4KKZA 2BO0A 3O6FA 2H3NA 1UD2A 4NZFA 1QRKA 2GUOB 4QXTB 2EP6A 3HS8A 1K3ZA 3CFQA 4UQBA 2MQCA 4JPWL 4F37K 3ZPDA 2QTVA 4K3DL 5IVZB 3O8XD 3T0EC 3WY3A 1WWWX 3JV5A 4RFEB 5B4MC 3T4AB 3C5ZD 1HU8A 1RERA 5IT2L 3CC5B 1KIUA 2Y3NA 4NUGL 2V2TB 1SHWA 4IK7A 5C0AD 4DUXA 2F54E 1ZANL 3RY6C 2NCMA 1N5AA 5AAWC 4MMXA 4KMQA 2VRQA 1RURH 3U25A 5ADPH 3NVQA 3PYCA 3UZEA 3L5WA 4TQIA 4OZHA 1PY0A 4ZX4A 5FO9B 5GSVA 2VDMH 4WUKH 1S7TA 3BDBA 1IBHA 3FT4B 3Q2NA 2IGTA 3QRGH 3LRGA 3I02B 5JHDD 5FX3A 1DVSA 3V6ZB 4XHQA 3AREB 2EH8L 4FQCL 2IQ9L 1V3KA 1ZLEA 2NY4C 3BLBA 4KQ4L 4AW4A 1FZMB 2C1OA 2H4EA 1CIDA 2ZWZA 3DO3A 5DUJA 4CC4A 3HHRB 4R2GD 5CMAB 3UJTL 3NAAL 2GUOA 4NUJB 4PJ7B 4QXTA 4X83A 2SEBB 4YDZA 3FFCD 5AVRB 1DZBA 3MREB 4X7SL 3F83A 3B7SA 5IVZA 4PVBA 3BUYB 3MGTB 3ILDA 4HHWA 2MNWA 1FHNA 1WS8A 2EXWC 2WGNB 3WLBA 3OB0H 3TA3C 4RFEA 2ZT9C 4AL8H 1E4KC 1JUFB 4PWHA 2DYRB 3WY1A 1ZSDB 3CC5A 3TOPA 4KKPA 3QEGH 2RCSH 2V2TA 5DZ9A 2GSIB 4P4RB 2WK2A 2WNXA 4P9HH 4ZW8A 4UDTB 5DYOA 4MSWB 3W0WD 4UNVA 5B1CA 7CGTA 1AIZA 2AQ3A 5H2BB 1UVQB 4LCWB 4HUUB 4YUEL 5IROD 5FO9A 3X17A 2FB4L 3OKLB 4L3EB 3U46B 1N6VA 3FT4A 1R1CA 1AS8A 4JFEB 3SYOA 2XZQL 4XVUC 2I85A 3P40A 1AKJA 1WCBB 4K7FB 3V6ZA 5A6IA 3AREA 3C12A 4B27A 1X7SA 4PWGA 1MREH 1PSKH 5DF0A 3RYMA 3FU6A 3KYAA 3OJ2C 4ZK8A 5EU5B 4F2ME 4LDEB 3QI9C 3TH2T 5C09D 1D5ZA 3C9NB 4RISH 5KVGH 5F96H 1VB9A 4LVOB 5FLVA 4HSAC 5CGTA 5CMAA 3VXMD 2VN3A 1ZPUA 4NUJA 4PJ7A 5I17B 2PNDA 4XO9A 4RLDA 4F8TA 1UZ6E 2BS9A 4UTBA 1J0YA 3BUYA 1LEIB 2A9AA 4LLYB 4QO1B 5J9PB 5T33L 1GOGA 4WI5A 1CGXA 2FWSA 3K4ZA 1ZSDA 1PEZA 4W9GC 2MFNA 5AW6B 1N0LB 3NCFB 1RURL 3NCJH 4KV5F 5ADPL 2GSIA 3BWSA 4P4RA 5C0CA 1T6BX 4UDTA 1JFQH 1D5IH 4JKWA 4MSWA 2HJLA 3R1GL 2YLKA 1KB9J 3WI9A 5H2BA 1NIAA 1UVQA 4LCWA 3QRGL 3ML8A 2NXYC 2X44D 4HUUA 1RAMA 4NEHB 3OKLA 4L3EA 3U46A 5HVGB 3VJ6B 4N5ED 4GUQA 1XGYL 2AJZB 4JFEA 4P06A 3SE4C 1CGSH 4K7FA 1WCBA 3D0VB 1I85A 1H8OA 2NW2A 3KGUA 4FFYA 1T5WB 4P3DB 4NN6B 5I1JH 3W38A 1AZRA 4HLZG 4Z7UE 3C9NA 1OO2A 3G04B 5KVFE 4F7CB 1H6FA 3DV4B 1N64H 2E47A 4OGXL 1PU0A 5LXGH 5EEUA 2BVQB 5I17A 3FOMB 4KGJA 1SBSH 2VITB 1G7JB 2BOLA 4AL8L 1CK0L 1ZCRA 1DVXA 4LLYA 4QO1A 4XO5A 1LEIA 3K5RA 3QIUB 5J9PA 3RNQB 2OBGA 3DWTA 3QEGL 2RCSL 4Q74A 2AF2A 2HT3D 4FA6A 4QOKD 4P9HL 1JIBA 3ZKMD 1GPOH 3PGFH 1U8KB 1UKQA 3D0LA 3FQ1A 3QARA 4TUUA 3SBWC 1N0LA 2MNJB 2VRAA 1CMOA 2HWZH 1J88A 4ENEC 3MOQA 3LN5B 4ZD3H 5KEZA 3O0RH 4A6YH 3BJLA 3MRGB 3VYNA 1S78D 4DGVH 3FKUS 4H13C 4FYSA 3VJ6A 3VSQA 3VH8G 1ED3B 3W5NA 5KBMA 5LDUA 2AJZA 5C86A 2Z7YA 1MREL 3ETTA 2O61A 3D0VA 4G3YH 2HLEB 4JFPA 4PBXA 1OLZA 5D70H 5KVGL 3GXDA 1W72B 1ES0B 4KROD 4RISL 4P3DA 4Z1PA 1G7PB 3OLEA 5DZVA 1P53A 2GBTA 3S8GB 1XBRA 4IIQA 4PB0H 3ZYZA 4E41D 4KUCF 4F7CA 4FJ6A 3DV4A 3HG1E 4U4BA 4FS0A 1FNHA 2OULB 2BVQA 1MCHA 2VERN 5TDOB 2P7TB 2VITA 3LMJH 2AEQL 3ARWA 1NEZB 1KYUA 3OR7B 5AB2A 3RNQA 4GP5B 4IHBA 5C3TA 4PB9H 5L8KB 3IXTB 1JFQL 3VTTA 3HNVH 2H6OA 3B9KC 1IRAY 2ZYSA 4LVNB 1XQ4A 4QTFA 3UTPE 3ISRA 1DFBH 3MRGA 4OZFH 1Z6JT 1TZIA 5HYIA 1ED3A 1W6WA 1ZK9A 5I1JL 1V3LA 2EXSA 1PZAA 4YXKL 2EABA 3FQYA 1N70A 4ZMYA 1QA9B 4Y4KC 2D7OA 3G5YB 1W72A 1ES0A 3TNMB 1G7PA 4GKNB 2COVD 1MW2A 2VAAA 1N64L 4RMVA 5LXGL 4EUPH 1LO5B 1JFHA 1SBSL 1FA4A 4KZDH 5FUZL 3FONB 5TDOA 3GPSA 3LYRA 2BIQA 2OR8A 3UC0H 3PGFL 4N8PA 4PS3A 2NXZD 3PL6B 2HWZL 3U6XA 2VKWA 2YQGA 3P0YH 2AMUA 1VCBC 5J11B 2WLNA 1DUZB 1AVAA 3E1F1 4HHAB 4ZD3L 3AMKA 3NCYS 1JCVA 4A6YL 1E9QA 4NHCH 1KUMA 4OSUH 4YK4C 4U1MB 4DUVA 1OD7A 2VZ1A 3T8XB 2YBGA 1H3PH 5T3ZL 4GAGH 2NY0D 1CGYA 1JZDC 2PP7A 5I1CL 1H3UA 3AS0A 4G3YL 4XAKE 3VI4E 5D70L 4NIYE 2HTKC 1DVFD 4B9ZA 2FEEI 2C5DC 1QA9A 4GI9A 1P6AB 2XVLA 4PRPE 3WKMH 5I5MA 3KPRE 1JZ8A 1BJ1H 4PB0L 5HGDA 5ID0B 2C1PB 3HC4H 3QUGA 3SJVB 3UACA 1KBGH 1QMUA 1LO5A 3IKCA 5D7HA 4HIXL 1NGYB 3S34H 3LMJL 1MRFH 3KL0A 5CFAA 3TIEB 3FONA 3EADA 3V0EA 2DEXX 1Y0LA 4PB9L 3PXHA 5BV7H 3EOAB 3O6FC 2K3HA 5CLZA 5AOZA 4GMTH 3HNVL 2Q7YB 3PL6A 2OXHB 3TN0A 1UKSA 1FZOB 1BEYH 1DUZA 3BVNA 4HHAA 4PLJD 1HYRC 3T5WA 1U8MB 3V4VA 1D9KA 1A0QH 3CZFB 4GG8B 3MAWA 4Y9CA 3T8XA 1LEKB 4ONHB 4MMXC 4BQBA 2W80C 2YLHA 5BJTA 4X7CC 4LRIA 1KJ2H 3L3GB 5B1BB 3LKQB 5AAMA 4IRJA 2QT6A 2ZP8A 4NUPA 1I3VA 5IKCB 4LLVB 4NLHA 1AC0A 4G8IB 3WGVB 1EEYB 4HWUA 2AXFB 5HHME 3ZTJH 4M4RA 3SJVA 4KY1L 1NUFA 4W6YB 5KBLA 1NGYA 1TVHA 2VMCA 4CA4A 4ES8A 4P2RE 5B7EA 1OT4A 5A6LA 5D1XE 4B3VA 3UC0L 2YD4A 2JI3A 3OZ9H 3UJTH 3EOAA 4Q97A 4BIKA 2Q8BH 3AS2A 2WSPA 5E5MB 1KCKA 1QPKA 2OXHA 3U7WH 4KX7A 5DSCB 4PPTA 4OFDA 2WXLA 3BVVA 3H42L 4M8VA 4NHCL 4OSUL 3CZSA 2MKWA 4W9ZA 5HHNA 3B2PA 3WKNA 3OQRA 1IBGH 1U8MA 3T4AC 2WCSA 4DW2H 3RDTD 3CZFA 4GG8A 6FABH 3TBBA 3B1TA 4GJTB 5HDBE 4UM8A 3DXAA 1HHHB 1LEKA 1PZSA 4AQ8C 1GSMA 4ONHA 5BXFB 4EI6B 4XB7A 3L3GA 3WKML 3S2AA 5B3JE 2XBDA 4B9PA 3FTGA 1A7PH 4LIQH 2IOIA 3HC4L 1EZLA 4HJIA 3U1SL 5HVFB 5IKCA 2K8MA 3GC3A 1KBGL 2TAAA 2AXFA 1OW0C 3RAJH 3S34L 1MRFL 1TO4A 2W95A 3AREC 3LXCA 2OV0A 3VH8A 2LV4A 4HFWB 1A6UL 2IWEA 3DVNB 5BV7L 2ICWB 4KRMB 3ALXA 1SMDA 5KOMC 4GMTL 1XXDC 5DC2A 2ZQKA 5C0IA 2XV0A 5T3XE 4S1DC 1UWFA 3MNWA 1Y7VA 1OPOA 4GUCA 5D4IA 4JM2C 5IWLA 4YGVB 4W6XB 4LPUA 5DSCA 3L17A 5EWIH 3ARDC 4FA8A 1A0QL 3B3IB 4N8VB 1A22B 4XBMA 1A6WH 1UA3A 4LNRA 1ONQB 2WQAA 5C0ND 1WUNT 5MHSE 2QVFB 2BM3A 4HLZH 3CLWA 5L6YL 2R59A 1KJ2L 5KSBF 2K3TA 1I8IA 1HHHA 1QD0A 1SDDA 3O3DB 4N0YL 3VFSB 5BXFA 5B7MA 3T3PB 1TTUA 2V3DA 3CZUB 4K5MA 3D8MA 4DN4H 4Y1AE 3ULVF 2F15A 2YAMA 4V2CB 3S88L 4OKVB 3ROOB 2VKXA 4BCZA 3T1FB 2J1YA 3D3VB 5INDB 2EVFA 1JMZA 1RK1B 2OYLA 3TT3H 3H2QA 2Z64C 3LXUX 1YEHL 3BO8B 1M3JA 1Z0MA 2AQRA 2DBJA 2EIMB 2MQ0A 5KSAD 2PR4L 4KNQA 3CVDA 3N85H 2BWIA 1A7QH 4NX0A 4RZKA 4KRLB 1BECA 4HFWA 5ALCH 1UZ6F 3DVNA 3OZ9L 2MPAH 4QRSB 2Q8BL 2J55A 4LVOC 3X1BA 3U7WL 2BP8A 3H0TB 2E7HA 4MDJB 4YGVA 1WFIA 4XMXA 3B6SA 5TF1H 4BSJA 2P4AB 1QEWB 4JHAL 4DW2L 3B3IA 4OAWB 6FABL 1EDYA 1GZPB 2J56A 4Z8FL 1ONQA 3HVDA 2Q76B 3TO2B 1GKEA 4N0CD 3C5ZB 3IE9A 3VFRB 3B56A 3ME0B 4MX7B 5KVEL 2KDGA 4Y7OC 3O3DA 2PPDA 1GYAA 3GK8H 1A7PL 1OM9A 4LIQL 4AEEA 2ZCKH 4FE9A 3V4VL 3GRGA 3WOVA 3EJQA 3DOIA 2K4WA 3EYSH 4JBSA 3SBPA 4U1HB 4IRZH 1NUNB 3ROOA 3CVIH 2XQ0A 5AOJA 3T1FA 5INDA 1RK1A 1HEZB 1SMAA 4L8DB 4Z7UF 2FHFA 1GJWA 3OMIB 4YBHA 2F74B 1JWUB 2PYED 3QDGA 4PBDA 5E7FA 2YQ3A 3D9AH 1PKQE 4XN8A 2VWEE 4Y5VB 5C92A 2F54B 3HEIB 3IE4A 4NN6C 3U48A 5D93B 3L5IA 3U9WA 1ET7A 4J3TA 1XGRB 3HPLB 4QRSA 5AEAA 1KIPB 1A02N 4KO9A 3SDDB 3Q01A 3BW9B 1X5MA 1BPLB 3MLXL 3H0TA 1ACXA 5TQ2H 4MDJA 4NC1C 1I1AC 1Z9LA 2E6QA 3QYCA 1B4JL 1QEWA 4Y4FD 3QIUC 4OAWA 1XD0A 1MWAH 4ZTEA 1GZPA 2YGQA 4H1LG 2ZJSH 2Q76A 1LTXA 1QSEE 3TO2A 3IGAB 6CGTA 5KJ7E 2YQBA 5DRZA 4MX7A 5HDQH 2EO9A 5CS7A 1CGWA 4YX2H 3L3OB 1OAUL 5CR8A 5HI3C 1M2VB 4U1HA 1U3HC 4XOCA 3KLSA 4LBAA 1A9BB 1NANI 1SY6H 1UT2A 4TNWF 1HEZA 1TFPA 4L8DA 3GEWB 4BSWB 3ABLB 3LEYH 3WNMA 4U4IA 2F74A 1JWUA 2YRLA 5ALCL 3KJ6L 4UQ2A 4J8RB 1CJYA 5EFIB 5I28A 4Y5VA 1F3DJ 2F54A 4WTZG 3BC9A 2VM3A 4ONFH 4AQ1B 4J39A 4RMRA 1BREA 1XGRA 3HPLA 5GS3A 4YBQD 1O9ZA 2TSAA 3SDDA 1T5KA 3BW9A 3L9BA 3MYJB 4XNBA 5JDSB 2AEIT 5TF1L 2B1HH 1YECH 3LZFH 2D03H 2G9HB 2NY5C 3EO1B 1OGTB 5CILH 3VXMB 1URZA 1FFPB 1KGWA 4FFZH 5DVNA 3QEQD 3QJHA 4Y16C 4ICWA 3R7QA 3TYFA 1WZAA 5C0DB 5I82A 4K71B 3SCMD 1W9XA 2WJ7A 1QFHA 1OAKL 2NY1B 2VH5L 4JFQA 3JT2A 2YD7A 3IGAA 4F2MB 1E5YA 3CCHB 3GK8L 2HG5B 2ZCKL 1SLXA 5JHAA 4D9RD 5J57B 3EYSL 2V8MA 3L3OA 3PU7A 4IRZL 4C83A 4GXVH 3I9AA 1M2VA 5SV4A 2VRKA 4KY2A 5IUSA 2XQYG 3UO1L 3P9LB 1G4RA 4B60A 1A9BA 1J5OH 1L9TA 1MHCB 3RNKA 4HUKB 2GKIA 4NM4H 5FGRA 2K6ZA 4TPRH 4U7SA 4BH7B 5JW4R 5I0DA 1GCYA 2VJXA 4J8RA 4X9IA 2VXVH 3WMPA 3JWNC 4HW6A 2ICWJ 5EBGA 4WSGA 2JJSA 4C4UA 2NX5D 5D7LE 3MYJA 1OSYA 1QWNA 2Y6TE 4AX3A 3O4LD 4GUOA 4D2NA 2G9HA 1XEDA 1FO0A 2WTRB 3LHAA 3MFFB 4WGKA 3UROR 3IEAA 3VXMA 3VQ1C 1FFPA 4JFWA 5JA8B 2BHFA 4RH4A 5C0DA 4HIEB 1L0PA 2CBQA 2N7SA 2ZJSL 2QELA 4BA8A 3WL9B 1MCDA 2IOOA 2X4QB 2QKIC 3LIZH 2PO6D 3DX2A 3IVKB 5J11C 4Z7UB 3CCHA 4YX2L 2HRPL 2BIPA 3SDXB 4F2MA 2DQGH 1QSFE 5FO2A 2EDTA 3BVUA 1BSIA 4YE4H 5I74B 2PWGA 4EI5D 3CBRA 4CSSA 1SY6L 2VQUA 1RPUA 5KANI 4UCFA 5EMYA 4CADA 3P9LA 4OLUL 5ILTL 5CUSL 3LEYL 1MQKH 2IPKB 1N59A 4ZFFA 1MHCA 4LRIC 4NRYB 3OPZL 4BH7A 2Q7NA 2CCVA 2FBJH 3FQ4A 1X9LA 4KXZI 4GI8A 4ONFL 1I8LA 2X12A 4X5QA 3V6OC 3FU8A 2VMEA 4KU1A 3LPWA 1YPZE 4LPTA 5C07D 5K9JH 1JZGA 2HVKA 2GIMA 1SXBA 1W0YT 1YCSA 2B1HL 1BD2E 3LZFL 2WXQA 2D03L 3TU6A 3PP4H 4J4PD 3ECWA 5F7UA 4FFZL 5HI4C 4TLTA 2Z91B 2WTRA 3MFFA 3GMOB 3D25B 4GP8B 1O7DE 2D4FA 3GHBH 5CO1A 3DPBB 2X89D 5KUMA 4HIEA 4Q9QL 3WL9A 4WWKD 4HCRH 2H2SD 4QTIH 4W9CC 2X4QA 5GGUB 6TAAA 5FA3B 2OS7A 5BUAA 5D1ZI 4F7EB 5B1JA 3IVKA 2F5BL 3D39D 1KPRB 1VAHA 1ZY9A 4Z7UA 3OX8A 2JLPA 4KK5C 4GXVL 4O5LL 2VR5A 4YFDB 3NCBB 4L1BA 1AQHA 2BSCA 5I6NA 3K2UH 1C12B 3ULVH 3PPEA 1ZJBA 2EDYA 4DEWA 4NQSB 2C7UB 2N59A 4H1LB 4TPRL 4NCC1 3K6FA 4X8JB 1I4FB 1LO4H 4NRYA 5DFVD 2VXVL 5BW7C 5FEBA 4DFHA 2EEFA 1XF2B 4ANUA 2QPSA 4KRPD 5TGBA 4YZFE 4AV4A 4PGEA 3UGEA 3A4DA 5FFLA 4PJGE 4AI7A 2VC2B 3GI8H 4PJDE 3DGDA 1TKWA 1YJDC 1MDTA 4EN3D 2PW1B 2WLMA 4ISVB 3BUQA 5C97A 2Z91A 1TVDA 1FFTB 2IG2L 3D08A 5GGVY 2AJSH 3GMOA 3D25A 3HLAB 3DPBA 1MFAL 5A2JH 2ZYRA 3ZYIA 2PTUA 4OZGF 3ZR6A 1CD0A 1DYZA 5GGUA 5IWLC 2DQGL 4ES9A 4P2OB 3QRFM 1PX8A 2MQGA 2X4SB 5HDBF 1P4IH 5AQ0A 4YE4L 3NK3A 4BFOA 1CTNA 2KLTA 4C56B 3HG1A 1B6UA 5B3JF 1C12A 2EIKB 3F7VB 1MQKL 1UXSB 1OQXA 4NQSA 2C7UA 3IMSA 4H1LA 4K15A 1FVCB 1CGTA 4I18B 4B9CA 3IMWA 3FSWA 4ANKA 3LEVH 4X8JA 3D85D 4BZ1A 4GW4B 1G6RB 4IKJA 5K9JL 3RZCA 4Q9RH 2VUOA 1XF2A 1RJLB 3L13A 3SGKC 5JORB 4Y2DD 3MLTA 4NUMA 2ZKWA 3PP4L 4A7SA 3P3TA 3Q8CA 4NSKB 5MP6L 5CEXB 5GGTH 1IU1A 2PW1A 4ISVA 3DHJA 1JGLH 1HIMH 3S37H 3VI4B 4Q0XL 4EN2A 4HCRL 4QTIL 1L7TH 4WTZA 3RWCA 4GY4A 3QJZA 3SDAB 3AT8A 3HOGA 2K0RA 4JFFE 1DLHB 4PRPB 1CYWA 3IU4H 3KPRB 5FS5A 3ALPA 3VM7A 1FO0L 1T83A 3AAZB 4N2IA 4P2OA 3LRSB 2X4SA 3K2UL 2O6DA 1SXCA 5EBWA 4PWFA 3ULVL 3OLIA 2AQSA 4C56A 1YRKA 3F7VA 1AIFA 4ODTL 1UXSA 3RTQD 4TNGA 2J5LB 2H32B 1LO4L 3MDJA 3HBQA 1FVCA 4I18A 3MCG1 2HSIA 1RZKC 5ABDE 2KZWA 3HN3A 1RJLA 5JORA 3VSUA 1KJ3L 1T6VN 1K9TA 1NPJA 4M7KH 1JPTH 2J44A 2XQYA 3GI8L 3S5ZA 3ZYJA 1JPSH 3SE9H 1KPVB 3QORC 2H9GB 3WEXB 5CEXA 1ADQA 4NO3B 1Y6NR 3QUXA 5H35B 5CJ8A 3VI4A 2F5AL 3QRLA 2NUPB 4Z0BL 5MEPB 1OP5K 2ZWNA 3SDAA 1VF5C 2WTOA 2H47C 3BPLB 3PWJB 5ANME 1DLHA 4PRPA 2V8LA 4Q7DA 1JXJA 3KPRA 5IBTH 4TRPH 3ZDZE 4MKMA 1DSWA 3AAZA 1CICD 4KH9A 1T0NB 3LRSA 4ZTPH 4RFNB 3EOTL 2A3TA 3S36X 2MKLC 2E59A 3O8XC 3EGDB 4AQEA 4U6VH 4Y19E 1SXZA 4YHPA 3NSJA 3WN6A 3CLFH 3LKNB 4I0PD 3L48A 2CR3A 3LTVA 3C5ZC 5D1XB 2ITDA 1TTAA 2H32A 4QUOA 3RDTB 1WITA 2XV3A 3OR6B 1YO4A 4U6TA 2KZ1B 5KVFL 2JV6A 2P5WE 1V8HA 2QMJA 2WTPA 2WWMD 3TJHD 5JQHC 4B9IA 1TQVA 1WZMA 3NJXA 2AAVA 5EN3A 4BZYA 1AQKH 4Y5XB 3E3QE 3QPQD 2HAZA 3RVXD 2WQWA 5FOBB 5GGTL 4XTRC 1KPVA 1LDSA 4LSQH 2YGVA 1JGLL 1HIML 2H9GA 2JKIS 4Y5VC 5CHNA 3S37L 3WBDA 4NO3A 3QR1A 4NFBA 1L7TL 2EDDA 2Y7LA 5HDBB 1WZLA 5JIKA 5H35A 4BE5A 5A2KH 1RPKA 4G6JH 2NUPA 3SDDC 1NWOA 3KM2A 2VXSL 3W81A 3VXQB 2YQ2A 3BWZA 1NCAL 4QJ4B 4TN9A 4XXWA 4R2GC 2WZPD 3V6BR 3EGXB 2DWDB 4M6AA 1T0NA 1QFUH 3ARGD 3AGVA 3QJQB 1UZ8B 3LRLA 4PI2A 4S1SH 4R3SA 3BAXA 1RMFH 5D1QE 4PY8I 4I2XE 1EMTH 2A4CA 3LKNA 2LFGA 4NPJA 2VUKA 5D1XA 1NCNA 5BQ7B 2VUYA 5IIEA 1OALA 3OR6A 2YPVA 2IAMD 3QNZB 1GGIL 1WBYB 4CDHA 2EDMA 2F8XC 4M7KL 1JPTL 2YPLE 2LU3A 4UANA 4Y5XA 5HI5D 3SE9L 4PRBB 3KPSD 2CGYA 4MQ7B 4XOAA 5AYUH 1Q94B 5D6DC 1H8NA 5FOBA 2GPZA 4BZ1L 1WZKA 1N9PA 4KHXH 3QQ3B 5ABZA 2HRHA 1AH1A 2VDNB 4AQ1C 3LIUA 4M1DH 3FSVA 4FFWC 4KNTA 3SDCD 1R24B 2JJSC 4Y1AB 4KKQA 3PS6A 2X6MA 4HLJA 4ZUUB 4TRPL 4Z0XA 5IBTL 3VXQA 1WSST 4ZTPL 4X4XB 2A6KB 4GSXA 4JG5A 4BRJA 5AZ2H 1M57B 5EOCH 3EGXA 4I77L 1B0IA 2DWDA 4HPOH 5D7EA 3UBXI 4U6VL 5DHXB 1S5IH 1UZ8A 2I07B 4K71C 2NY1C 3FOLA 5ESVB 2H3XC 2GG1A 2LLLA 2EE6A 2QADD 4OI9A 3VE0A 5IB2B 2V2XA 4Y9BA 4LEOA 2WSKA 3MLVH 2DM4A 3NUKA 4MB1A 4LSVH 3NJJA 4J2QA 5CF3A 2IWFA 3QNZA 5JUEH 2CK0H 2GIYA 1OP5H 1AQKL 3V4PB 2BVUA 1KB5B 3TXAA 3BOVA 5IJKC 4OY9A 2E4TA 4OVUA 4PRBA 4LSQL 4MQ7A 1Q94A 2QPEB 4JN1H 1KGCD 1JDDA 3BLKA 4N5EC 4OJAA 4ZAKD 1I8LC 5FYKH 3NP3A 3QQ3A 4KK6D 4J6RH 1KCVL 5E99H 4G6JL 4OCRH 4A2DA 5E6SB 1EERB 3OKKA 5FW8A 4L0ZA 3T09A 3EYUH 5J06A 2QVKA 3C60D 4U6YB 3QDJE 3CSBA 4Y1AA 4ZUUA 1ML0A 2BZDA 3MRJB 5E94B 5CU9A 4W9KC 2VLMD 1ADQL 1NBVL 4FRWA 1QFUL 4NKQB 4X4XA 2XKNB 4FI8A 3UG5A 4WI9A 3L4WA 1ZA6B 3THMH 4S1SL 1QHQA 4U49A 5GQBA 3NP4A 1TJGH 1U58B 2FLRT 4CMMB 5E1AB 2I07A 3SSGA 3NT0A 1PKQB 5ESVA 3BP5B 2E27H 4UILH 5IB2A 2YGPA 1T89A 2ZUUA 4XP9H 5B1JC 4J3VA 1R0AL 5E2VH 5C3IA 3PHSA 3HI6L 4G6KL 3EDDA 3ZKXB 5I74C 3E9UA 1MRDH 4PCTA 3GBML 3WFCH 4L9LB 1UWEH 3UBGA 5IOKA 2B59B 1KB5A 5AYUL 3TV3H 3CNKA 1DQVA 3WNPA 1YPZF 3NABH 4FL4C 1S78C 4KHXL 2J6EH 2EE0A 2OMBA 2HUHA 3HAEG 1QSEB 3DSFH 4KUCD 5DK3A 4M1DL 5T3XH 4K2UH 3FO0H 4X8GA 1ORQB 4KROC 3WJMB 3V0AC 4K3GA 3MJGX 4YH6A 4U6YA 4PW9A 2BNRD 5AZ2L 5EOCL 2EJ1A 1X5AA 5FCUH 5BOJA 2CUAA 3F2LA 5I8OH 5J12B 4WWID 1D7CA 3P2DA 1U58A 3VRLE 4CMMA 1USQA 5E1AA 1KULA 4G8GE 3QHTC 1PKQA 3MV01 4LSVL 2KDYA 3BP5A 2FNBA 4XNZB 3CSYB 4M7JH 2FLMA 3W11D 3LCYA 2CK0L 5JUEL 1KGXA 4ERSL 1M42A 3P73B 3P3RA 2FYYB 5KVDH 3CHRA 3AU0A 4HBQA 1PLAA 1XGQB 1XGPB 2CXGA 2OMWB 1VA9A 4L9LA 1BWMA 1E4XI 2B59A 2MPVA 3LSOB 2ADJB 4CILA 4F1SA 5EU4A 2VDMB 4YZFF 1IGMH 5DU7A 3O2WH 5FYKL 4TXVB 3DX4A 4G5ZH 4PJGF 4J6RL 3KDMA 5E99L 3KEDA 4GKSB 4PJDF 1IEAB 5CCJA 1QSEA 5AUMB 1H3XA 1OL0A 1V7MH 4HJ0D 1OWWA 5LWYL 1ORQA 2QGBA 3BVXA 2P1YA 1S7XB 4MXQD 2WVSA 1OHQA 4TQ8A 1RVFH 1XGZA 3BGAA 3THML 1TJGL 4UI2A 5E1GA 4BQ8A 3FULA 3NIFE 1DQTA 3O4LB 4N8UA 1OY3B 4AEIH 5HHQB 1IGIL 3S8FB 1SNRA 4FEIA 3TFKD 4JZOA 1S7RA 4JKMA 4XP9L 4DOHE 3L54A 5EEYA 4PY7B 5E2VL 1C8PA 4CVUA 1YEFH 3CSYA 1V27A 4UV4L 2D3VA 2NXZC 1BVNT 3MV8E 2ZKXA 1RJCA 2FT8A 2OFQA 3GSRB 3P73A 1MRDL 3SE6A 3T6XA 4YSCA 2FYYA 2HJFB 5D7LB 1UWEL 3TV3L 4CBZA 1XGQA 1XGPA 4OH2A 2OMWA 1R75A 3EFFB 3NABL 1E8ZA 4LL4A 3S35H 4D3CH 5BMFL 5CCKH 4EI5B 1Q0EA 4BH8A 5D8JL 5A2BA 4QDGA 4I18C 2A73B 5T3XL 2HFTA 2V37A 2NY0C 3OKEB 4K2UL 4ZBJA 5SWZD 3GO1H 4RAHA 3HNSH 5CGYD 2BVEA 1PFCA 2K7PA 4GKSA 3FO0L 5BZZA 4BV1A 5T1LD 5LHDA 4HZ1A 2EEXA 2ZUXA 1MFCH 1QSFB 2E7DA 4Y9FA 4O02H 5FCUL 3U4KA 1HESA 2BSSB 2GBVA 1N67A 5I8OL 4D94A 3POCA 5SWSE 3MYZA 2VAJA 3TEYA 4IMKA 1T20B 1HHJB 2YPKB 4O51B 2R0ZH 5DHMC 5HHQA 3IK2A 3E0GA 1JGEB 3FCGA 4KDTA 1ZLVK 3K2MC 3SDAC 4BWUA 4R6UA 3KLHD 2BHZA 5I1HH 1TT6A 4G83A 4PWJA 1EO7A 3VCLB 1I3GH 5JNYB 1RZJH 3N43B 4PY7A 1J1OH 3IN2A 4WWKB 2B2XH 2ZUQB 2WNWA 3P4OB 5KVDL 1QUPA 2WLYA 4LPYA 1CFNB 4JFDE 4RX4A 4EVNB 1BD2B 4MAYD 2D3JA 5D7LA 4L48A 1UWXK 5GGRA 4M9OA 5I6KA 2BX5A 4U1GB 2XICA 3EFFA 1IGML 1YEDB 2J5LC 2VSCA 4CNIA 4R7LA 3O2WL 3H7BB 4EI5A 4G5ZL 1NFDF 3QG7H 1CQYA 2AEPL 3TVMD 2CCWA 2A73A 3X1EA 2R1XB 3VXSD 4H2CA 3OKEA 2X5PA 5I24A 1V7ML 4PJEB 2BOBB 1MPAH 3RX8A 4JR9H 2AVFA 2OZNA 5C0BD 1WFOA 1H15B 1QSFA 3ISWA 3CFMA 1OOWA 1RVFL 4L8SB 1NC2D 3D4ZA 5HYJE 1A3RL 2RBLA 2XN9D 1TIUA 3FTXA 2AV7A 3CMGA 1VKXB 4DK6A 3KBEA 3ZDZF 3JV0A 3BFWA 1T20A 3HAEB 4KNSA 4EN3B 3LQAC 4APQD 3NSCA 1HHJA 2YPKA 4IGBD 4O51A 3GBNH 3LNGA 4ZUTA 2WNKA 1U4EA 3D48R 3OKYA 2FRGP 2ZXBA 1JGEA 4QRBA 1NANH 2XUWA 4CN1A 1YEFL 5B39G 3N0AA 3BPLC 1C5BH 5I6PA 4XXWC 1M7IB 3VCLA 1N12A 4G6ML 3MJ9H 3T08A 5I1IL 1YPZA 1IGYB 3P4OA 1YNKH 4FLSA 1N6QL 4RFNC 4YQXH 2N0KA 5L0QC 1CFNA 2VJ8A 4JRLA 4EVNA 1BD2A 2O5YH 3TF4A 1I31A 3S35L 3MA9H 2WXOA 5EULV 43CAB 1NBZA 4JQVA 3VFMB 3E8VA 5D1XC 1FDLH 1YEDA 3RDTC 1G7MA 3ZE2E 1KN2L 1U30A 3GO1L 1S9WA 1BQKA 4G11A 3FN0H 3KXFE 2F68X 2R1XA 3O6MH 4ZOCA 1WWCA 3OVUB 1MFCL 2BOBA 4HJGB 2NNRA 2CDEA 1IM3B 5AKVA 4XXDA 1ZLWK 5IBUB 2HA1A 4PJXE 4W9HC 4NQTA 1Z9PA 3ARFD 1O6VA 4O02L 1H15A 2IF7A 4X6CE 5DO2D 5DRXB 1MAJA 2AQ2A 5ESQB 3AC0A 3QUYB 4M93B 3HW7A 3FC8A 3HAEA 4PM1A 2FVNA 3QXDB 3FO1A 5I1HL 1I3GL 3WY2A 1RZJL 4MS8D 2WV3A 4NQXB 2Z92A 2B2XL 4OFIA 5F7MC 5C7ZA 1TYRA 4NCC2 1A21A 1IGYA 5I26A 1G4MA 4LOEA 5E03A 4PJGA 1SUHA 2ZXQA 3X2QB 4HUCA 3ULVD 5D55A 3QG7L 3G6JE 1FNSH 43CAA 4OTXH 3RJQB 5C0NC 2B39A 2PXYD 5L2JB 1MFDH 1PCXA 1J7VR 2FO4A 5CSGA 4H88H 1MPAL 2VDPB 4DGUA 3MGOB 4JFFB 4MZ3A 1JHLH 3WTTA 2OSYA 3HRZC 2GJ6D 5G5DB 4KOCA 1IM3A 3U2SB 2NPLX 5HGHB 2P9RA 2UX7A 2Q2LA 3G5VB 5DRXA 3ELQA 5ESQA 4L2YA 1UWXH 3QUYA 5KSAC 2Y07L 4IU2B 4BK4A 4ALAC 4PSRA 3GBNL 1E4HA 3I9IA 3HUJE 1N18A 1EXUB 1C5BL 4F93B 4HIHB 4UYQA 5J4MA 1AQDB 5E8OA 4NQXA 3BMWA 1YNKL 5J13B 5IFJA 4H8WC 4YQXL 1IVTA 1HL4A 3HC0B 4P0DA 4TYUA 5GS1C 5BUPA 3DJ9A 1S9VA 2O5YL 3QWOB 5I6XB 4KXZH 3MA9L 5C2BL 1IE5A 5BS0D 1CICB 1P84K 1R33A 3MRCB 4W9DC 4QI3A 4P8QA 5EEXA 1V3MA 4H8PA 4X4ZA 2JE8A 1VFAA 3FN0L 2EECA 4LB8A 2M83A 3O6ML 1O75A 5L2JA 3PDDA 3KLQA 1E5ZA 1F2XK 3VFTB 1JRHI 5ANMB 4AKPA 4JVPA 3MGOA 4JFFA 4CAGA 2WXIA 1F86A 3S7GA 5G5DA 3IJEB 3U2SA 5HGHA 4UWQB 4JFVA 1LWJA 3G5VA 3W9DA 4X80H 1SXNA 4Y19B 1W0VA 4CU7A 3GF8A 1N6UA 3K5SA 4IU2A 3VWKB 1SHSA 2XWDA 4M7LH 3CXDH 4UIKL 2EYRB 1HL8A 2BY1A 3MKKA 3VGAB 2HJKB 4BYHA 2P5WB 3SPHA 4YDLB 4YSSA 1EXUA 4HIHA 2BDNH 1AQDA 3SD2A 4HQQH 4L1SA 2GK2A 4PV1C 3RVTC 3V0DA 3HC0A 2WYIA 1ZLWH 2VIRB 1I7ZB 3QWOA 3TEXA 4GP4B 3GWJA 1CUOA 5CIPB 1LL1A 4GRLD 5GGSY 1KTCA 4BCXA 3MRCA 1FNSL 3SHSA 3ARGB 4PGJA 4OTXL 3GMLA 2X70B 2VWEC 5F44A 1MFDL 3HHMA 3HR6A 5B39B 4TUOB 1NBCA 1Q9KA 4H88L 2CPUA 4WWNA 1V3JA 2CJUH 4X5XA 5DFAA 1JHLL 3TA4D 3RJOA 2EYTB 3VFTA 2NDGA 5F7AA 1YMME 5ANMA 2IAMB 3VGBA 4AIEA 1G1OA 1CBJA 2RAMA 4L9LC 4DVRH 3IJEA 3STZB 4LLWB 3DDFA 4JG0H 4LAQH 4BHUA 3QHFH 3I6KB 3C6SB 1TZGH 3FF8A 3CE1A 5D1QB 4Y19A 4I2XB 4NM8L 3ILQD 3UMTA 3CV5A 3O11B 1SLUA 4M5SA 3VWKA 3JBG7 4A7TA 1TEYA 1YNTF 3GT6A 2EDRA 2EYRA 3PF2A 2HJKA 2VLKD 2P5WA 2XWEA 2AI0H 4OGAC 4YWGL 3Q48A 5B1KA 3S0PA 3VRLF 4HWEH 4FOMA 4YBQC 2F53D 3IGFA 4CVXB 2YPLB 3AQYA 5F6HJ 1U3JA 3D30A 4LHQB 5I71B 2VIRA 1AXIB 1WQVT 5CIPA 2X10A 4WFHE 2AEWA 3UDWA 1ZE3C 3K6SA 4XNZC 2QJDA 3TBVB 5B39A 4TUOA 2K45A 2OR7A 4WUUE 1LDPH 1I9RH 1YY9D 1TF4A 1M2OA 3O2DH 1CXFA 2EYTA 5C08D 2X9YA 4Y1TA 3LZRA 1L9QA 2Q86B 3S3PA 5LGJB 2QSVA 3QHZH 2VDOB 3OF6D 4FQLH 3STZA 4B5EA 4X80L 4FQHB 2N0MA 4GT7A 4AGOA 1JI2A 1RFDH 3Q13A 2R1YB 3C6SA 3SODB 5D1QA 2WKLA 3K72B 3UTTD 4M7LL 1AMXA 4TUKL 4UT6A 3DHPA 4G70B 4I2XA 4LESA 2OMXB 2EDXA 3O11A 5HP5A 5DGRA 2BDNL 5FGSA 4HQQL 4XNUL 1NEPA 4POYA 5BZXA 4DQOH 4LVHB 4AG4H 5SX5H 3X3GH 2EUZA 1MJUH 1P2CB 2YPLA 3Q8EA 4IMKC 5D7IE 3W37A 1TEGA 3LRMA 3ZU8A 4F8OA 4KDTC 4ADGA 2FT7A 4PJIE 1TENA 4FLOA 4OZIE 2F2HA 3N1FC 1AC6A 1UH3A 3UGXA 4ANWA 2CJUL 3TBVA 2IDQA 2MNUA 2CDFA 3EAKA 2NNFA 3MRBA 2PO6C 4YHNB 3QDJB 4NB7A 4P9HC 1OM3H 1VGEH 4P2QD 4KNUA 3TX4A 1FIGH 4JG0L 4LAQL 5AW8B 2A9CA 2Q86A 5LGJA 4XN2A 4EI5C 1SJHB 5HHOE 1TZGL 1U8PB 2CWRA 5DJ0B 4FQHA 1E6JH 1YEIH 4AYDC 2R1YA 2J8UE 5T5FA 2VDPL 4OFVA 2TRYA 3K72A 3Q9QA 3NTCL 4HCIA 5CU5A 2OMXA 4N90D 2V7HB 2AI0L 3QPXH 1ETB1 3EYOB 4GSDH 3LN4B 1J0ZA 3F8UB 5JOPE 1RHHA 5EF3A 2MTPA 3BAEH 4P59H 2VZOA 1KXHA 2XA3A 1CE1H 43C9A 2P26A 4ZNEE 5BPPA 4PIRF 3CSPA 1F00I 1ZHKA 3IRZA 3GBLA 4UQDA 1L5GB 3VM5A 4AXWA 2BNRB 4J4PC 2AP2A 4HWBH 1U95B 1A7BA 4XP4H 4IMLB 4U0RC 4Y8DC 1IILE 5I15H 1LDPL 2HTLC 1I9RL 2CBTA 2H2SC 2ZUQC 4WWKC 4ZOAA 3O2DL 1SOQA 2X6VA 5IUCA 4YHNA 3GTNA 5KYUA 4EZKA 1E4WH 4JZJC 3DX7B 3QDJA 5E1HB 1ILUA 1GGUA 1A9EB 3ECBA 4P57B 4XNXH 3MV9D 3IJSB 3QHZL 4FQLL 4RSYA 4U1GC 1GAFH 4NHUB 3OJVC 1QHOA 4JM0A 4JQVC 3MPCA 1RFDL 4K5PA 4FMVA 3JVGA 1SF5A 1BJ1J 1CFMA 1SJHA 1J8HE 4P2RD 2AANA 2VNCA 3KPTA 3RVUD 3A4FA 1HOCB 2B4CH 4UM9D 1RZPA 3BWUC 5FYKD 4F7PA 3CFTA 4XMTA 5DFVC 1T7WA 2W9DH 2RHEA 1KB3A 3EYOA 3LN4A 4AG4L 1EHLH 4L8SC 3X3GL 3MUJA 4EOWL 2IH3A 3UTSD 5E51A 1ITBB 2H1PH 2YHGA 2IDFA 3GZQA 1JWMB 1BFTA 1IGFL 1T21B 3S8WA 1L5GA 3ZIYA 4LEXL 3ULAB 5D5ME 4EN3C 2D7NA 3Q43A 5E08H 1U95A 3P0VH 1UC6A 2ROXA 5J56B 2UVEA 4IMLA 4WSKA 3Q3GB 1MWAB 1T04B 2BS71 4ADIA 4AQAA 2IOMA 1OM3L 3ZYOA 1VGEL 3PGDB 1NOLA 1AO7E 4F92B 1Z7JA 1FIGL 3DX7A 2RTTA 2XRAH 1A9EA 4AGLA 3PGCA 2X2IA 3IJSA 3ZDXE 5FO7B 1OAYH 1SLVA 1YEIL 3NIFB 2FE0A 1YNTA 3HFFA 3ZT5A 4PJXF 2G3NA 3ARYA 2X4NB 4X6CF 4YAQB 2ZXGA 4PMFA 1BIIB 4DOHB 1F0LA 1JVOA 5DD6B 3QPXL 1NL0H 5IB5B 4GSDL 5T3XD 4PRIE 2EUWA 1OOAA 1X5JA 3BAEL 3G5ZA 4TV3A 1A7NH 3TCLA 4JFHE 3MNZB 1CE1L 1XVSA 1IIIA 4I3SH 5T1LB 5ID1B 3ZKQD 5IP4A 1FPTH 3AXIA 4YC2B 2HFGL 3QUYC 3ZK0A 4FFTA 4M93C 1LGVA 1MW0A 1NEUA 2H6UA 1BVLB 1JWMA 1T21A 1AANA 4P48A 2BH0A 3H2WA 1IJ9A 1EHAA 5GRWA 1YY8B 5FYJU 1D2PA 3CX5K 2ZOOA 5I15L 2QR0B 2DQEH 4MRCA 3UC2A 1HL9A 4LPCA 4KI5D 2V5RA 3Q3GA 5LUMA 4MJ4A 1T04A 1E4WL 2AABH 5E7BA 4IM8A 4EIUA 2XV2A 1ROCA 1WA1X 3D07A 4XNXL 5H4YA 3PGDA 4GINA 1E2WA 3ENEA 1GAFL 3S96B 4NT6B 2KQMA 4YPGA 1FZJA 3PWLB 1FFNB 5SWSB 5DUMH 5FO7A 1PX3A 1CYGA 4AYMC 4H5SB 1MNUH 1WPCA 2OMYB 3OMNB 4MJID 2B4CL 2W9LA 4HKBB 4YAQA 4KDVA 3M17B 1L4IA 4KO6A 2W9DL 3S9DB 4LBEB 3UADA 5DD6A 3ALWA 3VXSB 5IB5A 4S1QH 3UCRA 1EHLL 3MV8A 2CJTA 1BF8A 4JY5L 2G60H 5IHUH 4RMTA 3HUJF 4X9GA 4GS7B 5CJQH 4MCYB 2H1PL 5C0BB 5T5FL 5ID1A 1DSFH 3NCWA 2XN9B 3TT1H 1BVLA 4HJTA 5E08L 3V9FA 3P0VL 2OPCA 1M7UA 1Q9OB 4IBZA 4E2OA 3NFSH 1YY8A 4IOIA 4Z7NE 3LOWA 3GMMA 2ZWLT 4APQB 4IGBB 3KNBB 2QR0A 2PP8A 1PLCA 4PWEA 3HA0A 3HG4A 1GS7A 5I0VA 3ORJA 4LRNH 2W92A 5CP7B 5I6XC 1KBWA 4JY6A 2YGOA 2XRAL 2OZ4A 1LO0H 1ZIBA 3HG3A 4YBLB 1PZUB 1CICC 2DL9A 3RZWA 4HKZB 4IQHA 3V7MA 1OAYL 4NT6A 4RA0C 1NGWB 5LNDA 3W57A 3PWLA 5LBSA 1IVLA 4LE8A 5SWSA 4DKAA 3BSZH 4LL1A 2E7BA 1CLOH 2BFVH 4WGVB 4XHJD 4E68A 4H5SA 2VLLB 1VFMA 5DUPL 2OMYA 3GRWA 4JGJA 5JW4N 1NL0L 4HKBA 3M17A 3TJHC 2WWMC 4WTXA 4BK5A 1A7NL 2Z31B 1QBLH 2C3HA 1OT2A 2KZKA 4PG2A 2BIOA 4JFDA 1GGCH 1SF3A 2LR4A 2DQMA 3S3SA 4JHBA 4MCYA 5I1DB 3QPQC 3RVXC 4XMWA 5A2CA 2HN7B 5T5NF 2XN9A 2ZOLB 5F7BA 3ZE2B 1R3HA 4GIAA 1Q9OA 4YDLC 3VGAC 2DQEL 3KXFB 4JHUA 1K85A 1E4XH 1Q0XL 5DHEA 5IQ9A 2OAAA 4Z9KB 4Y0GA 4YDMA 3SBQA 2YIHA 3KNBA 1MCKA 1G9NH 3VWJB 5IV2A 5G2NA 3VI3E 4QRFA 5CP7A 2J5WA 1B4LA 4X6CB 2B15A 5HYJA 1M05A 2PWHA 4W9IC 1KGJA 3LHPH 3ZE0E 5DUML 3MI6A 3LKOA 2E5EA 4HKZA 3ARGC 1H8SA 1NGWA 1PG7L 1MUJB 1XHHA 2EIEA 4KKCD 1CD1B 5A16B 3HI1B 4KTGA 4DVBB 1FWXA 2J21A 1DBMH 2VLLA 2VXTH 4LVEA 5F72S 4DF9A 4YSPA 1YYMH 2IAMC 1DP0A 5BO0D 1J8RA 2G60L 1LP9E 1G1KA 2GTZB 5IHUL 3IAGC 2Z31A 3B83A 5CJQL 4NENA 4R4BB 3TWCL 1I9IL 2GJ6B 4R8WL 1BGXH 5FK9B 3B2UD 3L9RB 1DSFL 5HI5C 4I1PA 5D1QC 3TT1L 1XAUA 2GY7B 2W07B 1GMEA 3G6JB 1T2QH 3CPUA 1NTDA 2ZOLA 1MCEA 4NQCE 1DN0B 4Q8BA 3VAEA 3KXFA 4R97C 1G7QB 1KFGA 2GAZB 2YD2A 1M9WA 1U4FA 2F0CA 4LRNL 3MACH 4GFXA 3NA9H 1AZCA 2W59A 5K33A 5F1OB 5F88B 1AR2A 3SDCC 3VWJA 4KO5A 1QI3A 1OARH 3MRNB 4PJXA 4ZXBB 2CLZB 3A6BH 4X6CA 5I71C 2XCMC 3NIGE 4TSCH 3SQBA 4DP6X 1FC1A 1BFVL 3BSZL 3NJFA 2BFVL 3FHAA 4L3AA 5F93C 1MUJA 1U8QB 1CD1A 2GITB 5DDHB 4N2OA 4C47A 2Z9TA 2QADC 1EAPA 4ANVA 4D9LH 1K3IA 3MLSL 1QBLL 2NT0A 2J1WA 2DLGA 3BX7C 4YSDA 2A9MH 4GBXD 2R15A 1BBJB 3C08H 2WINB 3I75B 4R4BA 1QFWM 3DV6B 3QGVA 5FK9A 2VSKB 4YL9A 3L9RA 3Q2VA 2ZX7A 2Y5EA 2WWNA 5BVPH 4KJQD 4U7MA 2W07A 3G6JA 1RSYA 1Z9SB 2DQJH 4ZUWB 2ZUVA 1E4XL 4IK6A 4ZAKC 4JS7A 4NYLB 3MBWB 1DN0A 3R4RA 4KK6C 4GLRI 1G9NL 3QYNA 1G7QA 1TZAA 1B0RA 3OHXB 4PJIF 4LVHC 4AOFA 4OZIF 4G9DB 1X5ZA 3C60C 5F88A 1XZWA 5B21A 4FCHA 4I0KA 4ZXBA 4DERA 2CLZA 2G30A 3D51A 2GC4C 2ICCA 2DEYX 5E8PB 1LM8V 1BXAA 1U8QA 2GITA 5DDHA 4IS6B 3BQUD 1NKGA 2VXTL 1JV5A 4P5TD 1K6QL 4PP2B 1JAEA 2JKTM 3RILA 3NFPA 3UEZA 1H3GA 2J8UF 1YAIA 4RQQB 2FATH 4IRSD 5LBSL 1A1MB 3SKNB 2YZ1A 2VW6A 4ILDA 3DGGA 1BGXL 2YXFA 2WINA 4UQAA 3M07A 3I75A 3JVGC 3CN3A 3GRWL 1JZHA 2NR6A 4R90H 1GZHA 3RIKA 2J4WL 1T2QL 3T4YB 1U8NB 4DHLA 5DT1L 4DP9X 4IOSA 4CU8A 2Y2TA 2OL3H 3ABGA 4KDWA 4A2LA 3LVEA 3HE7A 3CJJA 3MBWA 3QO1B 4NYLA 3MACL 4WFFD 3NA9L 4BELD 1RK0B 3L3JB 3ZUCA 1YMMB 3BJ91 3OHXA 1OARL 4G9DA 2AQPA 4MD5B 3ZO9A 2HT4D 2D31B 5AAPA 3CZNA 1YMHB 3QNXB 2GHZA 3RGVD 5HPMA 5E4AA 2NRDA 3T6VA 2WKGA 1RUKH 4N8CL 5E8PA 1UD3A 5HGGS 2EDEA 4AGMA 4D9LL 4L8BB 4I85A 1VPOH 1ID5I 4PP2A 5KSVB 1UJ3B 2A9ML 1UJTA 3NPSB 3C08L 5L8LB 2EEBA 4RQQA 3K74B 3SKNA 1A1MA 2BSED 2E6JA 3DIFB 3CQQA 3MO1B 3NJGA 4U3SA 4Y5YA 1JVKA 1C5CH 4XC1L 5D1ZD 3B7YA 3QQ4B 1FZKB 5BVPL 2ISDA 2F7RA 3T4YA 3VD3A 1U8NA 4EQ3A 2NY6B 1SZNA 3CXFA 3EDKA 2IVFC 5A2IH 4WUUB 5DVMA 3QO1A 5T1KD 4HJ0C 2X38A 1G9ML 5E9DD 2QHRH 3L3JA 5LGYA 3C8HA 1XH1A 1YMMA 2CO2A 4HPYH 1AHWB 5EU7C 4MD5A 4MXQC 4HDIA 4L37A 1BVZA 2D31A 3MA7A 1HH9B 2P24B 3HIZA 1YMHA 3FZUD 3QNXA 1EHNA 4FLQA 2VR6A 2CPCA 3IF1B 4CVZB 1E67A 3B37A 4BINA 3TFKC 3ZDXF 4Z3HA 3QXUA 2EUXA 4XMZA 3FUFA 4L8BA 3WDIA 5IMKB 5PAZA 5BZWB 2FATL 1M7DB 5KSVA 3T8VA 1UJ3A 1BF5A 1O7VA 1U91B 4Z6AT 4GUPB 1RUML 2YWYA 4ZUSA 1S9KC 5D7IB 1HWWA 3V8OA 5M94B 4R90L 3F64A 5FKPB 3WFDH 5HJ3B 5EOTA 2IPTH 4PJIB 4FNUA 3QQ4A 5JHLA 1FZKA 1MY5A 5KS9E 1ERNA 2L04A 3VYPA 4QPEA 2OL3L 1OSEA 5CJXC 3MTRA 3VFGH 4LZKA 4WO0A 4ZMTA 1N5YH 3QWRA 3BIKB 5AKSA 5DRNA 3NCYP 5IW6B 1HX0A 4WUUA 2BP5M 5EU6E 4OD3H 1D6VH 2ZOWA 4QR7A 2F9BT 4YC2C 2CLRB 3HTLX 1HZHH 5BRZD 1AHWA 2FK9A 1FUNA 1I1YB 1JRHH 2EDFA 2EC8A 5PCYA 4Z78B 5HY9B 5HHOB 5AD0B 2HYMA 3IDYB 3QC6X 1HH9A 4LEEA 1N3NA 1RUKL 1NINA 4P23B 4Z77B 3IF1A 1HI6B 1U2YA 2PYFB 2YD1A 3ET9F 4XCEB 3RPBA 4CVZA 1F6AB 1S7UB 2KYIA 4AYBA 1VPOL 3QIBA 3KLHC 1R6VA 2EC9T 4XNMA 1E28B 3KE0A 1DDHB 5IMKA 5BZWA 4Z3TA 5KBPA 4GQ9H 1M7DA 3QA3B 2UY7B 5IGXH 1U91A 4MB4A 4GUPA 5L2KE 1FCCA 4PJHE 5D7IA 5EC2B 5DZPA 5DMGD 1OCCB 5FKPA 2DJ4A 4HGWB 3SDYH 4K3JH 2FSEB 4PJIA 5HHPB 2AK1H 4OZIA 3K2IA 4ONOA 4HX1B 3TVMC 4MJHA 4BK5C 4LCVA 1RZFH 3AS1A 5F1KC 3T0WA 3BIKA 3CIQA 5IW6A 2WVVB 3CQFA 1GJUA 4RWYL 5CP3H 3A24A 3GXMA 4GS7C 4Z7NF 5A40E 2V0AA 3QFDA 3K4DA 3OC8A 2CLRA 2ODHA 2D9CA 4DH2A 1ET8A 1I1YA 1X7QB 2A4EA 3UTSB 2PR9A 4Z78A 5HY9A 5HHOA 2OYMA 4ZQKB 1NDMA 1LEGB 3FUHA 4G7RB 5I9QB 3OKDB 4P23A 4APQC 4Z77A 4LQFH 4IGBC 1HI6A 4XCEA 4K3EH 1RZGA 4HIQA 1F6AA 1S7UA 1UCBL 4GG6E 4M43H 2J8OA 4E9XA 2ATPA 1WDAA 1E28A 1LNUB 1DDHA 3WCYA 1FC2D 3FT0A 4YBLC 5DCCA 1CE6B 3QA3A 2UY7A 1HNYA 2UWEB 4CUCA 1E4JA 5D7JA 4ZNEA 3ARBD 1A65A 3WFDL 5EC2A 5AVUB 3ETBF 3ULUE 2V2WB 5D5MB 2KQNA 3DJRA 4HGWA 3RX9A 3ILPB 3QP3A 3S5LG 3RWHA 2FSEA 4M02A 4P3CH 4JE4B 4JQIH 4AYSA 1TJIH 4HAFA 1R34A 1NLDH 1FL6B 1FNAA 2HX7A 4OD3L 1D6VL 4KVCH 4PHZA 3UBHA 1NBYB 4KXBA 4XAWL 2Y6SC 3DTXA 4JPVH 3R4DA 1NMAH 4JKLA 1HZHL 2YXWA 1LO3H 4NZTL 4DIXA 4DP8X 1NMCB 1JRHL 2NW3B 4CKQA 4Y4HD 4DK5A 1A8JH 4WNSA 5JZ7D 4Z7QE 1WFTA 2E74C 4JY4A 3QWNA 3VI3F 2HH0H 1X7QA 5KTEH 2UXFA 1J8HA 4MHHI 1LEGA 5TK4A 3OKDA 4PV9A 5F89B 3GHPA 3ZE0F 4PRIB 3SGJC 3VWJC 3SY0A 3VA6A 4AQOA 1WH0A 4WHTB 5IW3A 1S5HB 2WMPA 4MS8C 3OL2A 3IKKA 3T0EE 2WWOA 4W4OA 4HUVA 4N5UA 1UQSA 1GZQB 4UNIA 4N4YB 3IFLH 4DZ8B 4H8QA 1RIHH 1JF6A 3EGSB 4PMEA 1LP9F 3SDYL 5GGSB 1IFHH 1HCVA 4K3JL 2B3IA 4NWTH 2V2WA 2XHNA 5D5MA 1KOAA 2D8KA 2AK1L 3EH3B 3GLDA 3U2JA 2RIKA 5ISZD 4NJ9L 3MZGB 1RZFL 4MNGE 2PXYC 4OJFH 4QYOB 5ECGA 1XSJA 5INCB 3EXJA 3QAQA 3OQ3B 1KCRH 1YN6B 1FL6A 3VDBA 1I7RB 1QNZH 1KSRA 1YHPA 3FRUB 2F08A 3HZVB 1NBYA 1AO7A 1NCWL 1WAAE 3QCUL 3W39B 3I6LE 1FNLA 1ZVNA 3ARXA 2LLGA 2HLFC 4M62L 2L3BA 2ZNXA 1F1GA 3AJ7A 1PF3A 4NOFA 3ZL4H 1CU4H 3GD1C 1CF8H 5F89A 4M43L 4QKXB 1XF5B 4PRIA 2O30A 4HISA 4KKRA 4CSZA 1S5HA 4LSPL 4ZXBC 5BUGA 1LJMA 2VLRD 4MYWB 1SM3L 5FYLH 4DZ8A 5AL8A 5J6SA 4R5XA 3RHWF 3EGSA 1HSAB 1K4CB 1B2YA 5GGSA 3HKZA 2VDRB 3P3UA 3ATEA 4JQIL 4P3CL 3MRPB 5AVSB 4YGAB 1OSZA 1TJIL 3DURB 5INCA 4QYOA 4X6FB 1RULH 2Z0BA 4F33A 4I9WE 3LY6A 5HD8D 3V52H 1FH5H 3WFHB 2ZG2A 1IM9B 1LO3L 3FRUA 3M86A 1K4DB 1QR1B 4M7LT 2NR6C 2ZXAA 1EUUA 3GS4A 2NQCA 3W39A 3LPPA 5AB1A 2HH0L 3U36B 5KTEL 1BVKB 1FE8H 1A3LL 2ZAHA 3HE6B 2JJTA 5HYSG 2VN6A 4ADJA 5J6HB 5EOCJ 3VTMA 2JB5H 4EBQH 4NLAA 3V0VB 3GXFA 1BM3L 4N0UE 1VFBB 1FNGB 4ZI8A 5DA4A 1XF5A 2AQNA 3UCQA 1X3DA 5MENB 4TOYH 3FF7A 4LFHD 2IAND 3IFLL 1U8IB 4LSTH 4N2EA 3PABB 3R7RA 3HZKB 4NWTL 1UA6H 3SKUD 3TH3T 2Z4TA 2FECI 1SQ2N 4N2GA 1HSAA 1K4CA 4PRNB 3SZKC 2XZAH 8FABB 3AGWA 3MRPA 1KCRL 4HJJL 3UAJD 2R4RH 3DURA 4Y2LA 5FYJH 3RB7A 4X6FA 1CLYH 3FYIB 1QNZL 2G0KA 3Q44A 1A4BA 3FB5B 3WFHA 1G5AA 1IM9A 1K4DA 3SZ6A 2C3VB 1QR1A 5AOIA 5LG1A 3ZE0B 3CFCL 2ADFH 3GMRB 3DKHA 4JRYD 4G8GD 3U36A 1DBJH 1EVUA 1JTOA 1JZJA 2F19H 4NQDD 5DURB 4KMTH 1CU4L 2NLJB 1CF8L 2O5ZL 3HE6A 2P3YA 2DYPD 3MODL 2GBUA 1KCSH 3T0VA 4ZQTA 4QNPE 3IFNH 4F27A 3V0VA 2ARWA 4DCQB 5TE7H 1BP3B 1FNGA 1Z9NA 2G9KA 3PV6A 4LGRB 3VXPB 1INQB 3MU3A 3QR0A 2RJMA 1GGBH 1D5RA 4UV7H 5TPWH 3PHOB 3IAPA 5DRWA 5E95B 5IHZB 1WICA 1U8IA 3RUGE 2CNZA 1XGUB 3PABA 4L05A 4P4KB 3S3CB 4DN3H 3HZKA 3LZQA 5IVXE 3ARZA 4YHIB 1BJMA 2UUDK 4XP5H 5AKRA 4PRNA 4BZ2H 2DRUA 4ODWB 3CU7A 4NQCB 1SRDA 2ZG3A 1RULL 2D2CC 1OGAE 1UJ3C 3BAKA 1UA7A 3GSOB 1FH5L 1W2KT 3A5VA 4L4TE 2AK4D 1B6DA 1RUQL 5EZOH 1KJMB 1YQVH 3GSNB 3T6ZA 3GLAA 4OJCA 5JO5A 3NIGB 4GBXB 3ZY7A 2A99A 3GXTA 2C3VA 1H8LA 3JZYA 2XTLA 3NJKA 5LDSA 1QFOA 2ZYIA 3IGKA 1ECZA 1FE8L 3EHBB 4I5BB 2NT1A 1P1ZB 1NCCL 3C5XA 5F7NC 3S5LA 5DK2B 3H55A 3RHWK 4AIZB 4C58B 2VR3A 2DEWX 1QR4A 2JB5L 3A0OA 2NLJA 3ABMB 3AZUA 1SXAA 1DJIA 4ABWA 3EF7A 1ZHLB 4XNDA 1IJNA 1LP9A 4GAYA 1RUAH 1AHWC 5GPRA 3VXPA 4DCQA 4AM0B 4LSTL 1INQA 1U8JB 3DARA 5TQ0H 1TSHA 4L1HA 3DO7A 3PHOA 3GS0A 5IHZA 3G3LA 4JFYB 4JHWH 1UA6L 3UPRB 4P2CG 4GW5B 4P4KA 4Q14A 1KWGA 1CPUA 1VEPA 4YHIA 4HZAA 1NGPH 3AITA 3WS6A 1PIFA 2R4RL 4ODWA 5DWUH 4NQCA 1XCTA 1B4TA 5EIQA 4KWUA 4PW4A 2W0KA 1CLYL 1J9CT 2D7MA 3TBCA 3K80A 3BUBA 4P5TB 3B7UX 1KDJA 3GSOA 2K9FB 2DQIH 1KJMA 3GSNA 4M3HA 2DQ6A 3RI5K 4X99B 2PP9A 3RWHB 1MW1A 5IY5B 3CH1A 2ADFL 2FQFA 3PWPD 2ORBH 4WFEE 4I5BA 2F19L 2Y7NA 1FRGH 1P1ZA 2RQEA 2EDKA 5DK2A 1OTSD 5FWQA 3SKMB 4AIZA 1KCSL 4HT1H 2JIXD 2R69A 4QT5B 2CHNA 3IFNL 4FKHA 1ZHLA 2N1KA 3NCCB 5IMOB 1JXGA 3KDPB 1GGBL 4UV7L 4DQAA 1ZV9A 4HIJA 5I16B 3ZQWA 3QXVA 4AM0A 4JJ5B 2EVGA 3BESR 3SN6N 1WE5A 3KM1A 5DJ8B 2LW3A 1A6VL 1P4UA 2WLHA 2X1WL 4JFYA 3DX6B 4KPHH 1TO5A 4P23C 4PCYA 4XP5L 5HYSB 1C08B 4BZ2L 4GW5A 1A66A 1UCTA 3PV7A 3BAJA 2XY1A 4XRCA 5F9DC 3L7EB 4LT7A 4XC3L 5LO7A 4Z3JA 2H26B 3NDYE 5D4HA 1I8AA 1HNGA 5EZOL 1YQVL 5CEZH 3QZOA 3QPKA 5GS0L 3WAKA 1K5WA 4OLZL 2ARJB 5DEGB 2FJFB 3TF7C 2WO3B 5EPMB 1L3WA 1UADC 2VO8A 1KEML 2EO1A 4F1ZA 3V0IA 3RVUC 4Y88A 4NRZA 3SKMA 2UUDH 4M6OL 2JNZA 1J1PL 1WV7T 3GNMH 4XWGL 4QT5A 1HYSD 3QQXA 3FQXB 2WWKT 4HC1H 1RUAL 1UB5B 4WW2C 3GSVA 4B7IA 5IMOA 3ZTDC 3VD9A 5TQ0L 1UD8A 3L5HA 4WFGE 4PJ9A 3VSVA 2EE3A 3L3KB 4GG6F 4JJ5A 4AC4A 2WD0A 4FABH 4QXUH 4OB5L 3VFOB 4ZMZA 2Y36H 4N2KA 1KZYA 2I9TA 5C0FB 1AR1D 4MDRA 3BPNB 1NGPL 3L95B 5HYSA 2X4OB 5DWUL 4OF5A 3SKOB 2B0SL 5EEWA 1KN4L 3RU8L 2JQMA 3Q5YA 3L7EA 3ULUF 1H9VA 2R7EB 1LO2H 1ND0B 2H26A 4F7KA 3A67H 2E8ZA 4UOJA 1PS3A 1THAA 2DQIL 5D7KE 3D2UA 4HWZB 3TIDA 2XDHA 4YOKA 3TFBA 2YD0A 5DEJA 2R29A 4GRWE 1UATA 2ORBL 4JDVB 3HN8A 4CW1A 4ATWA 3BT2H 4JO1H 1FRGL 5LGHL 3MKGA 2VMFA 3FCSB 5IBLD 2V9TA 4K23H 3C2SA 4HT1L 3UP6A 3ZE1B 1ZXKA 5TK2A 1J48A 1GS8A 1BZ8A 1PNDA 4Z7QF 1FP5A 1L9MA 4OFPA 4MRBA 4B9FA 2BJMH 4AE1A 1NCUA 1SJVA 3UH8A 4D8PB 4F91B 1SJEA 3MRRB 3FQXA 2HFEB 1UB5A 4UQEA 4N3UA 1TQSA 3QZLA 5J0BA 2YUVA 5AVQB 4R96B 1CLVA 2AJUL 1XR9B 4KPHL 4MA7L 1UEYA 2OX5B 3ATFA 3KZ8A 1JYNA 2JXMB 1CXEA 4LCYB 4UTAH 5KS9B 3VFOA 4QD2E 3IAQA 4PRDB 1WTLA 3BI9X 4GEJA 2DLHA 4UQ3B 4XVTL 4YDJB 1ADWA 3L95A 4OJYA 2X4OA 1EGJH 1DEEB 1SDAB 2O5XH 2WUBH 4HUWA 4UU9B 3SKOA 3KGTA 4AWJC 3ZRFC 3QS3A 3BVTA 4KI5C 4UAHA 5F6HI 5CEZL 4NKIH 1ND0A 5EU6B 3E2HB 3ZOAA 1OK0A 1PL3A 4XNQB 1MJ8H 1T7XA 2VW7A 1MCBA 2LFEA 4HWZA 3DX9B 2EILB 3HG0A 4FQJL 4GLRH 4D7BA 1WT5C 1T5XA 2BVTA 4KAQH 1AHMA 2OCCB 3GJFB 1B88A 2EDJA 5GJTH 3R0NA 4JDVA 3FQTB 2E7MA 2Y7MA 3K81A 1ASOA 4RRPM 3WD5H 1C7TA 2I9LB 3FCSA 2CO4A 3QUMH 3V0JA 1S7SB 5CZXD 2QSCH 4YEEA 2AJXH 3GNML 3H53A 4L1LA 1J5HA 2E46A 4HC1L 4BQCA 4QHKI 3GBEA 4G5AA 5DJ6B 4D8PA 5HJBA 3MRRA 4U7KA 1FI8C 2HFEA 4LHUG 4OM0H 4W1TA 2G75A 5D2NE 3ARTA 4PJHB 4JDEB 2QDWA 4FABL 2ALWA 3RKDC 4E9TA 3WG7B 3LZNA 1WFUA 1XR9A 2Y36L 1XIWB 2JJTC 3EBIA 2OX5A 2BWDA 2JXMA 4LCYA 5KS9A 1NAKH 2X6CA 4PRDA 2CD0A 4YDJA 3BWAB 1MFEH 4UQ3A 4A55A 1VACA 2F8IA 4BFRA 4NQVB 1LO2L 2WAQA 1DEEA 4UU9A 5C71A 4NZDA 5CSZB 1WBXB 5EU6A 3OAWA 3QDMD 3R8BB 5FHAH 2ZF8A 4XNQA 4CMHC 3KBPA 4L4VE 1RU9L 2V3FA 3BT2L 2VM9A 2EXYD 5I8KH 2P5ED 4K23L 2XACC 4A68A 5ACLA 3PFQA 4F9LC 1P5VB 2I9LA 1WF5A 3DDGA 1BLIA 1S7SA 5I0WA 1MY7A 4L3CA 4QAMB 1ZSHA 5C8JB 2BJML 1R5IB 2CKNA 1LE5B 1QSVA 4J12A 1K72A 2VZ3A 4ODVH 1H19A 2PTTB 1AHKA 3PDOB 4MNQD 4A2HA 1URLA 4N2HA 1A3QA 5DJ6A 3VXTB 4O58H 2LABA 5DD1H 2ZUWA 1DJXA 5ICZB 4PJHA 2IBZX 1OAXL 1Z2KA 1HDMB 4JDEA 4F8NA 1AYOA 5CZKA 2QVTA 4KXAA 4Y4HB 1ZGLB 1XIWA 3HE6C 3EO9H 2Z8RA 4X7EC 1QSZA 4U2ZA 1T6WA 1O7SA 1CVRA 1EGJL 2O5XL 1Y1UA 2WUBL 3C8KB 2ESVD 3VGGA 1VFOA 3EYQD 2QSQA 3BWAA 3HB3B 3N40F 1HXMB 2Y9RT 3ZDYE 4NQVA 4ZPTB 2F7OA 4LP8A 4NKIL 5JW3H 1U92B 4WAFA 1UM6H 3W82A 1GGTA 1WBXA 5EBLA 3R0MA 4QGYA 2Z35A 4KAQL 3H85A 1UOLA 4FNTA 4WEMB 4ZS6D 2BW4A 3KLLA 1MNNA 1SHMA 5GJTL 2VXQA 4Z7QB 5CKAA 1ETA1 4PJFE 1P6WA 4PJBE 4KKCC 3VDAA 2YXMA 3WD5L 2JKWA 3QUML 5CGMA 3N1MC 5IHHA 3KLDA 3S5YA 5I23A 2QSCL 2Y0SA 1P5VA 2JKLA 4NO5B 4L9DA 3IJHB 4UUJB 3QZBA 2ATAA 5C8JA 2BSBA 3H3PH 1LE5A 1R5IA 3MLWH 4I48B 3T0EB 4GG6A 2AJVL 3X3FL 4HMCA 1D7BA 1BZOA 4OM0L 3T3MB 2PTTA 1TTGA 3PDOA 4H8UA 3H9HB 3WU1A 1KTLA 1XSOA 3D87B 1FNFA 2BY3A 3B2UC 2ZSVB 4QNPF 5ICZA 1W8EA 1BBDH 1HDMA 2YRPA 1QBBA 4CSPA 3L81A 1NCHA 1NAKL 3X11B 3F7PC 3PQYE 1MFEL 4PTTB 5D2LE 4MNGB 4EZLA 2Z7UA 4PP1D 4YZWA 3RUGF 3C8KA 4O2CA 1E6OH 1HXMA 3MXVL 3ROLB 5IVXF 2H2PD 2IEPA 2AZUA 4G7QB 4TVPH 5FHAL 3P9MB 3QIWD 4ZX5A 3MZTA 3FNKA 4JN2B 4P4KC 5E2TH 1G7HA 4IIZA 2NY4B 5GZNA 4IEFB 1NC4B 1PLBA 1TEFA 5GHWH 5I8KL 3WS6C 4UBDD 2ZAIA 3HC2A 1HILB 2PCFB 1JZFA 4R7XA 1D3CA 4TTGA 2VZSA 1PD1A 1S8DB 3QZPA 1IKOP 3HMXA 5AOLA 5C9KA 1BXXA 3DIVA 2BVYA 2KLRA 4AZ8B 1JMXA 4ODVL 3IJHA 4NS0A 1X6NA 5E23A 5DYFA 3UBXB 4I48A 3T0EA 2VXQH 1H3WM 1Z3RA 2JK5B 3VA2C 4GBXC 5DD1L 2J3SA 3TA3B 1JGUH 3H9HA 3Q5TA 4G7SB 3CZLA 3CHQA 2BMKA 3HR5A 2DI7A 5G4MA 4PJ5D 2ZSVA 2EDLA 3CD4A 4JLRB 4PRHE 1MCJA 3EO9L 3FH8A 1GOHA 1LMKA 4NNXB 4Z7VE 5DJAB 5LCVH 5TDPB 3RY6A 2Q9OA 2GCYA 1JPFB 3X11A 3N5AA 4PTTA 5LB1A 4MNGA 1QKZL 2VSMB 4DTGH 2DDQH 3IDJA 5JQ6H 1MELA 2A6JB 1AZNA 4FTVD 4JMNA 5DQJB 3ROLA 1HE7A 4JMXA 4LHUB 3GZOA 2ZZUT 5MEOB 3VUAA 4XMLH 3P9MA 1KZQA 1WAAA 1SHXA 4LEBA 4LLAA 3QO0B 4G43B 4K9EC 3VXUD 3N9GH 1UOKA 1MCOH 1NC4A 4IEFA 5MENA 3LZOA 1G9EA 1A4AA 4ACPA 5K9KB 5GRVK 1JN6B 2PCFA 3ARQA 3BQUC 3ZKND 5J1SC 4WHYH 1S8DA 4P5TC 1F90L 1TQBB 3MLWL 4N0UB 2BPBA 4G8FB 4U1JA 5FR3A 2EVHA 4POZD 1WBZB 2Y5QA 5A2LH 3C6LD 1JNLL 3NMEA 2IGFL 1SBBA 3CFJB 4OCWH 3RWJA 3UBXA 1QYGH 2JK5A 5CCGE 3GQFA 2O72A 1J10A 3TA3A 5IM7B 1JE6A 1OHZA 1DBBH 3KEHA 5IEKA 3PUUA 4JLRA 4B53A 2K8QA 4JGUA 2PN5A 4NNXA 5TDPA 3L08A 2A77H 1E6OL 4QHUB 1OLLA 2WN2A 5E5UB 3NGBB 4XXCC 2VCOA 2WCPA 2A6JA 5DQJA 2WBWB 2ZNWA 1DE4B 2OR9L 3BLPX 4FEMA 1Z3GH 4LHUA 3BEVB 3K1DA 3FUKA 2O4EA 2WO4A 3IMVA 4MCZB 3ABZA 4XH2B 2APVA 4FG6D 5E2TL 3SY6A 1TYJA 5FYLD 5GHWL 4OIAA 3RGVC 5FO8B 3VU1A 5DTFA 4D9QE 3BFQG 4G1EA 1KGUA 2JCCF 4DNLA 1AXSB 3QI9A 3PXLA 4UT7H 4NP4L 5AG8A 3TJEH 1JN6A 3C09C 3CVHB 4P5RA 1LLAA 2ZOKB 4MA8H 4N0UA 4G8FA 2YJQA 2VXQL 3UTOA 1WBZA 4Z3GA 2AK4B 3E9TA 3CFJA 2GHWB 1XH2A 4KJPD 4MTMA 1T4KB 4IW4C 1KEGH 5IM7A 5LCVL 2YKKA 1R5VB 3RFZB 3V6OE 2DLFL 4Q6IB 4A39A 3FFDB 1RJYA 1MZZA 5JQ6L 4TMPA 2VLJD 1FCGA 3DA0A 4HJUA 4QHUA 4L4TB 3GM0A 4K55A 4EIGB 3I2CH 5EV7A 2AHIA 3V4UH 3ZKSD 2XSKA 3VFVB 1DE4A 1R5WB 3ULUL 3UYRH 1EEQA 4X6BB 2FX9H 5T1DH 3ZZSA 4MCZA 5A7BA 2Y2YA 4XH2A 3UPAA 1MCOL 3VMOA 4WI0A 4PLNC 3JV4A 5FO8A 1XH0A 1YEGH 1ZGLP 1T7ZA 1KTRL 2WC7A 3FT2A 2H3KA 3OSVA 2MOQA 4GRWF 3LEXA 3MV7E 3IBEA 1SFHA 2Q2EB 3SKJH 3QFJD 2BZCA 1P7QD 5AW9B 3SEPA 5CLYA 3CVHA 5FYJD 1I9JH 2ZOKA 4OCWL 32C2A 1S3KH 1QYGL 4OZHF 1AGCB 3Q7JA 3LS4H 1XSKA 2WQRA 1AP2B 4F9PC 1IUZA 3QJVB 2L7EA 3L3HB 3RUGA 1DBBL 4F15B 1EA9C 4ZFQA 3VQLA 2IH1B 3LPGA 3N1QC 4PY8J 1DUYB 1XO8A 2EIDA 1TMQA 2B1OA 5IVXA 1R5VA 3M1CA 3RFZA 2A77L 2XJKA 5JTWA 4DGYH 3B9KB 3FFDA 4P46D 2GYSA 5ERWB 1OGAA 4LLDA 2JIXB 2PPAA 1Z3GL 1LHZA 2EO7A 4L4TA 1CVSC 2C9AA 3FUDA 5D4JA 2OSLB 2UXGA 5KWYC 3VFVA 2FQEA 5FM8A 1R5WA 4X6BA 1TZ8A 1MVYA 3VO0A 3MBXH 2V6HA 4OKDA 2I5YL 4W9JC 3KPNB 3W5MA 3OXSB 1OB1B 3QJSB 4Y4KB 2R2EB 1M1XA 4UT7L 4M03A 1RZIB 3TJEL 3KAAA 7PCYA 3HNTH 4AJYV 1G94A 2Y1ZA 4MA8L 5JR1H 5D7SH 3NH7H 5GSRB 1HHKB 3E2HC 3L3IA 3P9WB 4HIIB 3WUZA 4J2XA 2JVUA 5AVWB 4MQXD 3FJTA 4CRPA 5EO1B 1BYNA 3BP6B 4OD1H 3NBNA 1I3UA 2HX8A 3L3HA 2YAQA 5DMGC 2ZCHH 3Q05A 2IH1A 1DUYA 3ETSA 1IBZA 5L4FA 2YR3A 2CGRH 3B9KA 3U30B 4G6FD 3IJ7A 3V4UL 2WBXA 4U1NA 3UYRL 1OV8A 2FX9L 4X4YB 4PJ7F 3W9EA 2I24N 4TTDD 4PJAB 5F8QC 2OSLA 5L7XH 2ZAGA 1PMYA 1XIWC 2VDQH 3NJIA 2X9WA 4S10A 1ZANH 3ZVVA 1J0JA 1CQKA 1YEGL 3KPNA 3BKMH 4HULB 4PREB 1QLRB 4KZCA 4Y4KA 4A2GA 5KBKA 3MN8A 2MCAA 1PZDA 1RZIA 3SKJL 2GB2A 4YLQT 2DS4A 1I9JL 2OTPA 3K0WA 1OP4A 4U1LB 1OWRM 1A4KA 2E3VA 3S3JA 3WV0A 5GSRA 1HHKA 2QHLA 2VE6B 2FHBA 1AE6L 4UZSA 3LS4L 1FYTD 3IJYA 2EH8H 1WHOA 1WTGT 3V95A 1WJ3A 2D7PA 2ROYA 1EAQA 1NPUA 2AQQA 5JXED 3H9SD 4KQ4H 5EO1A 3ARBC 3BP6A 3CZJA 1ORSB 3T3PE 4FXKC 3H3BC 3M7OA 1F13A 3TBTB 1SFDA 1CDJA 2X41A 2BLFA 4G72B 2I25N 4DGYL 5FF6B 5AW7B 3JWDH 5GRVL 3D3VE 1MVUB 3OGCA 2I27N 4KVPA 3L1GA 3MOAH 4WY7L 2C7FA 4W9FC 1YYCA 1H0DB 3GXNA 4RMUA 4BKSC 2XBZA 3G6AA 4V11A 1SLWA 1SPDA 3ZHFA 1I7UB 3T2QA 1HHIB 2X6BA 1WWAX 3DI3B 3FU5A 4Y4HC 2ZOTA 4E0RB 4JAMB 1X5XA 4UOW0 2YUZA 2XZCH 2OJEB 2FIRT 4B5ZA 2WIMA 3HB3C 3HNTL 5JIMA 1QLRA 5JR1L 4QRRD 3NH7L 3L4CA 4YUEH 3E1ZA 5EEVA 3O9WB 1XAKA 3EFOB 1F4AA 2XWXA 1LMIA 3NZUA 2QGCA 4A37A 2BNQD 3HJ0A 2XTJD 4W81A 5CEZD 2XXMB 3SYQA 4M5ZH 4MZIA 5GZNC 2H41A 2Q6WB 3V2AR 2C9XA 4OD1L 4YL4A 1JZ7A 5ETUA 2ZCHL 4I1NB 3ZHLA 5C0AE 7TAAA 2DH2A 3TBTA 3MNDA 4LU5H 5HDWA 2CGRL 2YAHA 1F11B 2YSSB 1F4XH 2FECL 3ESVF 1MVUA 1KTDB 2B4CC 4TF4A 5BVJB 1TQWA 1U3ZA 1CB4A 5D2LF 5ITBH 4IBYA 4NDMB 1I7TA 1PLGL 5JHDE 5L7XL 4KVNH 3VGHA 5T33H 2VDQL 3IGUA 1HHIA 3QUZD 2Q3ZA 4KH2A 2EXTA 4M5YL 4E0RA 2VR8A 4JAMA 5FWRA 3BKML 4TLKA 2OTUA 2X6AA 1N0XL 4FJYA 2B5IB 2OJEA 4WW1B 3EBHA 3R1GH 4HH9B 3GKWH 1NCIA 2ENYA 3FFCE 5F3FA 3O9WA 5EUKB 4Z7WE 5D2NB 1XGYH 1BX2B 3ML9A 2R23B 3QDMB 4FFVD 3CX5J 2Q6WA 3EKCA 1NEZG 2UY6A 4BGDA 4DSYA 1PG7X 2X4PB 4XPFH 3D69B 2HKAA 4XPGL 3N41F 1FF5A 1E0OB 1QNIA 3JWDL 1DSYA 1Y07A 1N68A 4ODBD 3CLEH 4UB0L 4JM2B 2PPEA 3MOAL 3W0WE 4OGXH 1F11A 2YSSA 1RZ7L 4NXSA 3KWUA 1EO8H 2Z4QB 1T4WA 3ARDB 4Z7VF 5BVJA 3RLSA 5HD8C 1PPIA 2TRHA 2VYRE 2J1XA 1CK0H 4EZMA 1DJYA 1KXVA 3T4AA 1X5GA 2C4FT 4N6QA 4L4VB 4JNXA 3ZSSA 2WXJA 4AQ8A 2XZCL 3AQXA 3QJFB 5DVLA 3T77B 2BP0B 5K9OB 3WIIH 3LZPA 4ZMOA 1OAQL 2MTAA 1FHGA 4L5FH 5C09E 3JWNG 4HZLB 4FZ8H 2WLIB 3HS0B 4HH9A 1JNNH 1JSYA 2Z8VC 3VXME 5FOJA 1QUNB 3I02A 3X1NA 1OW0A 2ZX8A 3MBED 4M5ZL 1HAUA 5EUKA 2ZICA 5D2NA 3MUY1 1BX2A 5AWNL 2R23A 1JWSB 3IN0A 3HI5H 2IH8A 1FZMA 2X4PA 3D69A 4LU5L 3WTWA 4RGOL 4FDWA 3ZDYB 1F4XL 1TQBC 3T71A 4WKXA 2SEBA 4F7TB 4JM2A 3MREA 1B4RA 2CGZA 1A1NB 3IGLA 4ZMNA 4XE0A 2HLAB 3MGTA 5ITBL 2Z4QA 3ARDA 1F02I 4JE0A 4KVNL 2AEQH 4DESA 1ZT1B 1II4E 2VN4A 1JUFA 3I9GH 4FHJA 4V1DD 4NQED 4NAQA 3D06A 1BMWA 3Q2CA 3K8MA 4L4VA 2BCMA 4PJFB 4PJBB 2ZG1A 3QW9A 4CGTA 1EXGA 4KKLD 4ETYA 3APNA 4XMPH 3T77A 2BP0A 2HPOA 5K9OA 5AW2B 2XWBB 3GKWL 1NSNH 3NGBC 5JIPA 4AIOA 1KYOK 1WLHA 4M48L 2WLIA 2O6PA 2P80D 4M3JA 4BDVB 4PBVC 2CH8A 4MJJA 1KYAA 1QUNA 3TEWA 5F3HB 3MRLB 5D96B 3CZGA 2XG5B 3N0PB 1XT5A 3Q2WA 3QIWB 3US0A 4XPFL 4YXKH 1JWSA 2OI9B 1LWHA 25C8H 5EU5A 4QOKE 2RALA 3SDXE 5D2LB 3PQYB 4EIBA 4U6HB 4JRXD 3CLEL 3D5OF 2W0LA 4TVUA 4RMWA 5LNGA 1ULVA 1EO8L 2C3WA 3IJ9A 4ZW6A 4BE6A 2WM0A 3H6JA 4HJSA 4DT2A 4F7TA 3ABKB 1I1AB 4R26H 1KLFB 2HLAA 5FUZH 1L0QA 2L8AA 4KHTL 2QLVB 4QKTA 4OFYA 2IIJA 2ZE0A 1J5IA 3TWYA 1V55B 1EZUA 4YSTA 3RFZC 4Q6IC 4PJFA 4XB3A 5AYQA 4PJBA 5E4IA 3WIIL 4L5FL 2R0WH 4QIRA 2E75C 4UTBH 4FZ8L 3WTUA 5J6GB 3IWUA 4R4ND 4WSJA 3VXNB 1NGZB 1JNNL 1UH4A 2WANA 1UFUA 2DKMA 1U3HB 4U1KB 4E41E 1OVZA 2COQA 1AFVL 4BDVA 4JFTA 3FN3A 3N41B 3VACA 4XPBH 4K73A 5DXWA 5T3ZH 4ZX3A 4OQTA 2OKMA 5F3HA 4G9FD 3MRLA 5I1CH 3HI5L 5TE4L 3QQNA 4PRHB 2XG5A 1T5WA