2EUWA

Structure of a ndt80-dna complex (mse mutant ma4t)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*TP*CP*AP*AP*AP*AP*AP*C)-3'
total genus 88
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2euwA00
2EVJA 1M7UA 2EVIA 1MN4A 2EVFA 2EUVA 2EVHA 2ETWA 1MNNA 2EVGA 2EUXA 2EUWA 1M6UA 2EUZA
chains in the Genus database with same CATH superfamily
3RNKB 5AYUL 3LZFL 3MJ7A 1BIIA 1ML0A 2BMKA 5F21B 2ITCA 2Y3NA 3QIBA 4AGMA 4UNTA 1CDHA 2NY1C 3UAAA 1VAHA 3NYKA 1B4JH 4R4ND 4UANA 2AXFA 3VRIB 1WYJA 3GSUA 2R69A 4NM8H 2HVJA 1SY6H 3FXIC 3BKCL 1MRDH 1TNMA 2NUPB 1DLHB 4GRLD 4B95C 4CNIA 2HTKD 3RIKA 4A66A 1QG3A 5FYKL 4UTAH 1SLUA 3QIWB 2GPZA 1JP5A 3TIDA 3U30C 4NN6C 4X7CC 5IFAH 1EEZB 3MV9B 4JPIA 5J89A 4XVTH 5G4NA 2L0DA 1OD9A 3CXHJ 4P2RE 5ICXA 3JYCA 3VD4A 3OKMB 2Z3FA 3QR2A 3L3GA 1BFVL 2QTVA 1DJWA 4QXUH 4U4BA 3EYQD 3BIBX 3KPNB 4DO4A 5FUOL 3QNFA 2QBWA 2EYRA 3GBMH 1TQCC 5FOBB 1SHMA 5I17B 1AJ7H 5C2BL 4M6OH 1M1XB 4AL8L 5CJ5A 3PUCA 4J8RA 2BM3A 4OR1A 4LHUD 3N85L 4JDTL 5J6SA 4C83B 4IHOA 1WC7A 2OQJB 3QC5X 3KLLA 5KVDL 4EOWL 4I87A 2BSSB 5C70A 2Y5EA 4JZOB 1BAWA 5CZVH 2BVPA 2ZWYA 4PVLA 1P7QB 2OTPA 3FHAA 4HEPG 5E99L 3C6LC 3MGTB 4X4KA 3WNPA 1N8ZB 3K0WA 1OAUH 4OW6A 4R7DB 3GBLA 3B4NA 4D7BA 4QHPA 5HHMB 4CKQA 2O93L 5DQ9A 5K9KB 3B1UA 3QVAA 5E2UL 2BZCA 4FQHB 4HJJL 1PVHA 3X12B 4Q74A 4GXUM 1CPUA 5LAXA 3VD1A 4U0QB 1U58A 4RGMB 1IEBA 3N43F 3T4AA 1R1CA 1A5FL 1T1YB 3TPUB 3X11B 1MWOA 2RACA 2XPYA 3BXNB 3KXFB 4WEBH 1LE5B 3QZNA 3OQRA 5CEZL 1YEIH 4HS6B 1M6UA 3P2DA 4UZGA 2FO1A 5FKAB 4A2EA 2KQMA 2MCPH 1EERB 4NKMB 2VJ8A 4WUKL 5L2KD 3IMBA 1MCKA 2O6CA 3HJEA 5I6KA 1W6LA 2DEWX 1TCMA 5ERWA 5DA4A 4GSRA 3MV7B 3KGUA 3TN0A 2K3TA 2R29H 3D0LA 1JWUB 3SE9L 3VDCA 5MENA 4B9CA 3C8KA 3GXDA 1FSKB 1OSZB 2CLVB 5DUMH 1I8MB 4K8RC 3WFBH 2W0KA 3FCSB 1TVHA 2BC4A 4L8BB 4UTCA 3K71A 1PKQE 5ISZE 1DHKA 1GW6A 1IAII 1H6TA 4NQXA 3MJ9H 5F3HA 3ESMA 1CGWA 3N40P 4RGMC 4O2CB 3RTQA 5GS1B 5GZOC 4P2QB 5EEZA 1T89A 3QR0A 3TH2T 4BQ6A 5I1EL 4A2MA 1MCHA 4BA8A 1F1DA 5DJ8B 3HMXA 1UJ3B 3IMTA 2C7FA 2X1QA 2VR6A 2UWEB 1DQDH 1NEPA 4NNYB 4TF4A 3U0TB 3WEAA 3P1VA 4PRIA 3DJ9A 1M7DA 2IANB 4HIHA 3V7AG 3RZCD 1BQKA 3K5RA 4FX5A 4H8VA 4R7NB 3V55A 3F01A 1IKNC 1C9SA 1KOAA 2IQAB 1S9KC 5ICYA 2R59A 2DYPA 2EE9A 2VMJA 4YEFA 4JPQA 3A4DA 4W4OA 3BEVA 4IJTA 1MUJA 3O81A 3TBVA 2J1WA 4PGDB 1TQBC 4NQTA 4YWGH 5GS0C 3NIFE 4MGXA 3CZNA 3UL4A 3OKEB 5HP5A 1NMBH 2Y25A 2OR8A 4X6DE 4MWFB 4UM9A 3MUUA 3RB7A 1G0YR 4OCRL 5JLZA 4BQBA 2P8MA 2DWTA 1ZLUK 2VZTA 3CLFL 4AJYV 1K4DA 3F5WA 4F8TA 4K94H 2B14A 4HYTB 5E2JA 3UG3A 3HHSA 3V52H 3I9GH 3H53A 5E8OA 3IGLA 1H9DA 2IMNA 4KUCD 3MRHA 2UZIL 1KBGL 5FFOA 1O6TA 1OB0A 2DYSB 4CKVX 1OP3K 2CAKA 4OQ1A 5IVXE 2H32A 3U4BH 4D9RD 4WSKA 3L5XH 2FK9A 4HFWA 2WNGA 2D4FA 4UDTB 2NXYD 2IOMA 1OAQL 2Y07H 3FONA 4JGUA 1PZDA 3T3PB 3L9EA 2Y5TA 2FWLB 3L8QA 1P6AB 4Q0XL 2DY2A 3BEWB 5JOPE 3BRGC 2J1ZA 3GDCA 2NSMA 4DKFL 1J1PL 5JHDB 3IJSA 3FCUB 3T0ED 4ZYKA 1CYWA 1GGTA 3MSPA 4FQJL 5AOJA 2VO8A 3S96B 2VDNB 2WBJC 1C5CL 1A6VH 5CSBA 3PCYA 4LCCB 4NZFA 3NJMA 4Z7VB 2JLPA 2OZNA 3NTCL 3S35L 5CF3A 2OK0L 1EAOA 4K23L 2RJMA 2EINB 3L5JA 3EOAB 4GEIA 4Z7WF 4KZDL 4DKFH 1G87A 3FU0A 2DDQL 2QSQA 3H42L 4XO9A 3UP6A 2W60A 3O6FA 1JTTA 1ZPUA 4I13B 4ODWA 3RG1C 2ZTBA 4IK6A 2P5WD 2WN2A 2HTLD 4IMLB 2BZDA 2E6JA 2MNWA 2IGFH 4IHOB 3T09A 2NDFA 1NCBL 2XC8A 2Z7YA 3BE1L 4FQQB 4YUEH 3M1CA 1FYTE 1KGIA 4Y4FD 3MODH 4Z7VE 1J5OH 4W93A 3AREC 2CU9A 1AANA 1CTMA 1Z2KA 2F6AA 3IAQA 1DLFH 1ZLUH 5AFAA 5E00A 2OCFD 3BUQA 4UNUA 1XCQB 2WSKA 2GY5A 1DSFH 3FH7A 1UZ6E 4F20A 4R3SB 3QULA 2ATPB 3IU4H 5CJQH 3KYAA 2VMDA 2HZHA 1UA7A 3A4AA 3RKPA 1CICA 3PQYA 1EV2E 3PWVA 1T1YA 1RI8A 3PWPD 2ZOWA 3MLPA 5IMLB 2A83A 4MNQB 4NJ9H 4X99A 3ZN6A 3ENEA 4K5OA 5FKAA 4HC1H 5KYYA 4ZOBA 4DFHA 5IVXB 3DHUA 1EO8H 3IFLL 3UBGA 2UZXA 3MV7A 1GTFA 4B53A 4GAJH 2JJTA 3QARA 3ARVA 3MO1A 4MNQD 2PR4H 4HUXA 1IKNA 1XMEB 2GTWA 1JPST 5D7SH 3N1MC 5IM7A 4ZMOA 5JQIB 1T6VN 3PV6A 2WWKO 1E6OL 2VN6A 1F58L 2AJYL 2APWA 1KZQA 2D7NA 5HYIA 4W6XB 4NO5B 2WAHA 4U1IA 5JYMA 4MS6A 1DANU 2ALWA 2H3NA 4YHKH 2GJ6E 3VA2C 3EGDB 1KXQA 3RBSA 3L2NA 4B97A 2R0KH 3VVWA 3TZVC 2W0LA 5CGYC 2DQDH 4MVBD 1R5IB 1QEWA 3PF2A 1FQ9C 4ZFOB 3RDTA 3BP4A 4PY7A 5FK9A 5CSZA 4B9YA 1CQYA 2ZUVA 4KV5F 3PQYE 3T3PF 4AK2A 1IM3B 1NCGA 2YEVB 3RL1B 3SGKA 2IQAA 2Z7WA 4A2HA 5DUML 5B1JA 4NQDB 4GAAA 2JQZA 2I5YH 3MRFA 3GXPA 4NENB 5GHWL 4CSSA 1FFOB 5EA0L 4K55A 4JHBA 1CVSC 1YMMB 2H6PB 5J6HA 2WPGA 5D72L 3S2AA 3ZOAA 4M4RA 5GRUL 1A3LH 2AK4D 1G5GA 5KSVB 2MCPL 3LH2L 4JDVA 1G0XA 4K15A 3UGXA 2XQ0A 4AENA 1YEIL 2E9GA 4FDWA 3T0EB 4BEIA 2YAHA 4FAAB 2B0SH 4ACTA 4LSVL 3K1KC 4NP9A 1H15A 1DQLL 4PRPD 3AG2B 4N2GA 3HHRB 4KPHL 5FA4B 2OI9C 3ROOB 2FQDA 2QQQA 4UT9A 3UTTE 5M95B 2OMVA 2WLLB 4X9HA 2VH5H 4TPRH 3V0VA 4PJ9D 3ZE2B 3KPRD 1YC8A 5CU5A 5LG6A 2UZYB 1J11A 3LN5B 2CDEB 1CVRA 2WVVA 2CH8A 2OMTB 4ZUWB 2DYPD 3FH8A 1MXDA 2A74A 3HR5A 3TJPA 1XR9B 2X41A 4JQVA 1JHKL 2XXCB 5D8JL 1MCOH 3VRIA 1INEL 4JHAL 5B38A 3QDGE 3A22A 1HK6A 1UWXH 2BNQD 2CHDA 2E8YA 1X5ZA 1Z5HA 4JDTH 4TVSa 5CCKH 1KN4H 2CHWA 4P57B 3VWKA 5C6PB 3EW3B 1MRFL 1WJ3A 4HV8B 3NIDF 4DPRA 3EDFA 4OQTA 4G9DB 4U3HA 1BFVH 2G5BB 4NX0A 1O5PA 4JRYB 2PKDA 3TO4B 4ELDA 3H9SA 4G6MH 1LMKA 5JW5B 2VLKA 3B6SB 4XVTL 2EIKB 2WD0A 5AW2B 3AACA 2O61B 2NZ1A 1TU2B 2C9VA 3MLUL 3PWNA 3ZE0B 5FYKH 6CGTA 4UTAL 3CSBA 3IETA 3N1PC 3W3BA 4BZ1L 5BO1L 3VD5A 3QSKB 3ETBF 4UT9H 5I17A 2X9XA 1BZDA 4K7PY 5FYJU 3ZKXC 2IAAC 4GQZA 3HS0C 3ZVVA 1I3GL 2VR7A 3C5SA 4PRHA 2YQ2A 5JIKA 2JELL 2NLJA 3BMWA 4BFOA 2CM5A 4N0CD 4QRPD 4ZMTA 2FBJH 4PG2C 3Q5OA 2R2CA 4WV1C 5EEYA 3PGDA 3OXRA 5I9QB 1J0IA 3CSTA 2A9BA 4LHUA 2WO2B 1CGYA 4S1QL 2VWEE 1A2YB 3SQBB 1XH0A 2XA8L 1OGTB 1C8QA 4KKBD 4IU2A 3BT2H 5C0AE 5DRWB 2Q0ZX 2Y9RT 4TNVK 5D1QD 3TBSB 3LPOA 1BZ9B 4Q9CA 4EPSA 3UTTD 2RQEA 4I0PB 3NZ8A 4AE0A 3GB7A 2NT0A 3KEDA 1PZ5A 1NJ9B 1F0LA 1KJMB 1F6FB 5TE4H 2JB5H 4A2DA 2CBMA 4JFYB 4WCYL 1OT2A 2WB7A 1IC7H 4OZIE 3C09B 3I6KA 43C9B 3RWHB 2BERA 4JJHA 2IDCA 1MCQA 3WS6A 4HG4J 4ZS6D 1CD1B 1P0SE 5A7EA 5I9QC 3FCSA 4QI3A 5BRQA 2RA1A 4BKLB 1QSFA 3QCUH 2VQ4A 2Y36H 4NO5A 3WTWA 5FV2A 3A4EA 3GEWB 2JK5B 4JKNA 3U9PL 1M2VA 5HYJD 2BDNL 1THAA 3HCVA 3L95B 2Q8AH 4D0DB 4KKNA 5KUMA 3E9TA 3L7FB 4WO4B 3MRDB 2IPKB 4P2RD 2Y4SA 2X38A 2D3NA 3DBSA 5DC2A 1UD4A 4PY7B 4CL7A 1X4XA 2D7MA 5DRNA 1E9PB 5L8KB 2NOYA 5E8EB 2Y36L 2DICA 1KNOA 4LEXL 1MFDL 4W9ZA 5E1IA 1MAKA 2IANA 3HFMH 3RL1A 3UAEA 1I9IL 4Q9QL 3GZPA 1RERA 1P2CA 4F7EB 5JO5A 4L4VD 5I66A 4BZ2H 1EHAA 4JPKH 4HSCX 2KYIA 2BFGA 4YGAB 4M48H 4KFZC 4MJIB 3H55A 1B2WL 1KLUA 2BVQB 4WCYH 5CMAA 4YR6B 5EPMB 3FUNA 4TQEH 1IAMA 3R19A 5KSVA 4G8GD 1MAJA 4AG4L 5I2IB 3QC6X 5KBNC 5DZPA 1IZJA 3IFNH 3ATAA 1X7QB 4APQB 3AU0A 4P8QA 3R18A 2KUTA 3D18A 3JBG7 4QEGA 1I1FB 1JFHA 1FVDB 4M7LL 2ORBL 5D5ME 4HX1A 4S1RH 1V05A 3NN8B 4BHUA 4LLUB 4OFYD 3D33A 1CUOA 1VENA 3R8QA 3CQPA 2KPWA 1CLCA 4AE1A 3PWJB 1I9RH 4X6CF 4XP5L 4Z1PA 4HFUH 3WN5C 4GKOA 2BIIA 1T5XA 3E6HB 1KCVL 2EEBA 4P2RA 4Y5YC 5GGVH 5SWSE 5C0BE 2WBXA 4YXKL 3B8SA 1LTXA 1ANUA 2OMTA 2Q7NA 2QPSA 4HF5L 4OF6A 2XV2A 2JELH 2QGBA 1D5IL 1SDDB 1IBGL 3ASWA 5L2JB 2Y1VA 3VXNB 1T04B 2XN2A 3HS9A 4FNSA 4W9HC 1YY8A 4I3GA 4HHAA 5JUEH 4GNKB 5T5FA 2A6DA 5BMFL 3OMNB 3GSRA 1VEPA 5AZ2L 4NHCH 4CA4A 1KLFA 5DEZA 1Z9MA 2FO4A 1V8HA 2G5BA 4NZUL 5CR8A 4FKKA 3CH1A 5KVGH 4RGOL 2VITA 1E8WA 5IFJB 3UJIL 3HNSL 1URIA 3QJZA 4K8RL 2AABL 4Z7VA 4KK5D 4FYSA 1QSFD 4CN6A 3P2BA 2EUVA 1OARL 4BSVB 4JFEB 2IOIA 2N59A 3HNSH 1HCZA 2X9ZA 5D4HA 4FG0A 3UYRH 1W6WA 1NGXA 3VU1A 1NZRA 1QFUH 2ADGA 1MRFH 3IGKA 5D4JA 4V2BA 1FO0L 1VA9A 5C92A 4Z7UA 5SWZE 4LLWA 5KN5A 1Z9SB 4NGHL 5EC2A 4KROC 4CMMB 5GGTA 4UDUA 5J13C 3AABA 1I4FB 2AP2A 2UVEA 3QJFA 3COOA 3ZGHA 3N5AA 2HKHH 2OP4L 2XY2A 1M7XA 4PGBA 2PYEB 4TS6A 1GJWA 4YXKH 4K7FB 3BP6B 4PRAA 1A14H 1Z9PA 4R2GC 2H0FA 4UU9A 2ATPA 4ONGH 5TK2A 1FF5A 3JWOL 5LGKA 1ZHNB 4G83A 1DO6A 2X4SA 15C8L 1JN6A 3QO1A 1YEEL 4I3RL 1FH5L 1BZ9A 5MEOA 4JG0H 1S9VB 2JJVA 3MFFA 3SDDD 2FHCA 4Z0BH 5TJWK 4RMQA 2WZ5A 4MNQA 1JV2B 5D1XD 3BSZH 5IR1B 4HBCL 3L6FB 5LBSL 5CP3H 1PZ5B 2AI0L 1T03L 5TQ0L 5BO0D 5SWSD 4TLSA 1QFWI 1SN0A 1IBFA 1PLCA 1HDMA 2V3EA 3JQOB 4XP9L 5D72H 4KHXH 1CFVH 2X1PA 1JPEA 1RULH 4AX3A 4TQEL 1RZPA 5H37G 3FRUA 1I7ZB 3DXAB 2F19L 3MCYA 2OYPA 2VXQA 1UATA 1YYML 3ABGA 1D6EA 5CLYA 1JGIA 4NWUH 3CFKA 4F8QA 3QNZB 5IKCB 4IS6B 1MFDH 1J8HD 5AOLA 1WFIA 4G6KL 1F45A 3PGCB 1IGML 1DFBH 1JPFB 2XOTA 4X9YA 5KSUB 5F7EH 3KYNA 3VVVA 3FF7A 4G5ZH 2BVEA 3VFPA 1IKFL 3DOIA 5AL8A 4MYWB 4HHGA 2R4RL 1MVUB 4TL4A 3WJJA 4X4YA 3BO8B 4R90H 3V6BR 1XTMA 4AIZA 3OVUB 2UXFA 4C56A 2ZUUA 1DCEA 2YO3A 1KGCD 1U8IB 2X10A 3PDGA 4PJ5D 4KKPA 5D7SL 5ILTH 1ZA3B 3MRFB 4IMKC 3B9KB 5F1IA 5DVOA 3CZEA 3WNOA 4UQEA 4BZ1A 2JTYA 2EKJA 4UILH 5I26A 3O8XD 1NIEA 3PJSB 4R7LA 4M4RB 3ZZSA 4NCC2 2HFTA 2NY7L 4JFHE 4JDZB 5C0IB 4B9PA 5I2IA 3INUH 3O3DB 5HHPA 1FNGA 1JPSH 4AENB 3O3BB 5J1TC 1DBKL 1PKQA 5ISZA 1FVDA 1KIUB 4DZBB 3I9IA 3LIZL 3FBKA 2YUWA 1TPXB 4KK6C 1DDHA 4L3EA 1D5MA 2PP8A 3IU4L 3IXAA 4G82A 3CIQA 1WCQA 3ARZA 1DSFL 3ARBD 3QDHA 4LSSL 1P84K 4JPVH 1UQSB 3E38A 4KRPC 5GS3A 3EHBB 2MCMA 4ZFZA 5MEPB 2A74B 2KL6A 2OR9L 1VFAA 1QX1A 1SMOA 4HD9A 5CN1A 2OZ4L 4XMTA 1Y1UA 5MEND 1K3IA 3GLAA 2X4NB 3P02A 3I3DA 3HZYB 3K2IA 4P57A 4U1MA 1JHLL 4XPHH 2EIZB 2GY7B 3VFWB 1LO3L 2C34A 2X6AA 3UP1A 2FEDC 2NZ9C 3U1SH 4I85A 5DJ6B 3LEVH 4E42A 1IFGA 5HVHC 3CVHH 3QEUA 2Z6FA 3K6IA 1JVLA 5CAYB 3NTCH 1SUJA 3FQRB 3TO4A 1ET5A 2XN1A 3BFWA 1BZEA 5HGDA 2UX7A 1E3FA 4KUZL 4WFFD 5E8PB 4BWUA 3ZYIA 4AQZA 1O7DE 2F1EA 5KVFL 4QMEA 2DJSA 1WA2X 4BELD 2XDHA 5C0GB 4Z78A 2WC7A 4LIQE 3WXWH 2BS71 4KK6D 4HUWB 2Q1EA 1NAKH 3TEXA 2X3AA 3IXTB 2FSDA 3S88L 1NC2D 4GG6B 3SYCA 1HWHB 3W39A 3BVUA 3V79C 4GW5B 3L5XL 4KAQL 5DVMA 3NG5A 5LNEA 1EEQA 3QJFB 1SOXA 5IK3B 3NT0A 5E1QA 4HT1H 2IAMD 4GRMA 5BVPL 5DS8A 1BQSA 1DSWA 3ZIMA 3BP6A 3GI8L 4P4KC 1A2YA 1X5IA 4J23A 5TPWL 1M6OB 3SCMB 3VJ6B 4ENZA 5IUCA 2P5PA 2VH5L 3GSVA 4TPRL 2IPUK 4MBOA 4K94L 3V0GA 5MEOB 2F18A 3FT4A 1G7JA 3HLAB 1OB1A 2YFOA 4NO2A 2OSLB 1NKOA 4N0UE 4CGTA 3ASNB 2R0WL 4LVOB 5GS0H 1KJMA 2ESVA 4AJWA 4RISL 5I75B 1KCLA 4ZW6A 4XP5H 5DJAA 4AIEA 1LD9A 4B7IA 4C47A 1JYXA 5AUMA 2A73B 2ODIA 2BNQB 1L9TA 3AWFA 4HJGB 4RH4A 5GRJH 4ZG1A 1LWRA 1I8LA 3DGCR 1GCFA 3L3OC 4G5AA 4NKIL 5EBLA 4PLJD 5FHAH 3QEHA 1WG3A 2WXMA 3D3VE 1NMAH 2X6MA 2C8NA 4TVPD 2UYLB 3W9EA 4P05A 4L1BA 4RMBA 1AGEA 1PBYA 2IAMB 4TNWK 4N68A 3DJTA 4K3GA 4N9OB 2HVBA 2GC7C 5DD0L 3ZMRA 4PRPB 3T71A 4HH9B 3JZ7A 4LP4A 2ZKYA 2OTWB 4NS0A 1MCDA 1AIFB 3GJFK 3OJMB 4JG5A 4F3FA 3UJJL 2P5EA 1TTRA 2VDKL 2HKFH 1J9QA 5ALBH 3FCGA 1AFVL 4Y4FA 4BCXA 1NPJA 3VO0A 1J9TA 3QXWA 1KFAH 4EI5B 1ZGLM 4XN8A 3MRGA 3FO9B 3BVDB 3BCDA 3K46A 4A7GA 4YJZL 2Y6SC 4KQ3H 5AWNH 1JTPA 4YS4A 3TEYA 3L4XA 5IV2B 3SE8H 5EOCJ 2C1PA 4KDTA 4NN7C 4OCSH 3O3DA 3N1GC 4RISH 3EYFB 2AITA 1HHIB 3Q6GH 4Q56A 2WQWA 2HJKB 5DZVA 4XNDA 3QEGH 4L3CA 5GGQL 4Y88A 4GXFA 4L8DB 4MRCA 4N6QA 3GT6A 5ID0B 2CA3A 2EDTA 4LLUA 5IG7A 2P8PB 4E2OA 5C9JB 3GI9L 3IXAB 1M7IA 1B3IA 5FYLE 3NEOA 1U30A 1GHFH 1NCNA 2XETA 2PABA 5F7LB 4RFEA 4MHHG 5L6YH 4LLYB 2R1WB 3QAZB 2D9CA 4YHLH 1GZQB 2JH2A 4PJ6A 1N6VA 5DTFB 4EI6A 2X4QB 3P9LA 4GKZB 1YEWA 3W82A 3GRWL 2BSDA 2X7LA 4OBRA 3ARGC 4M8QA 4L0PB 4A6YH 1Q9OB 1NDMB 3C9NB 4HJ0D 1T04A 3N85H 4LCWB 2J8OA 4YDIL 4M6OL 2EO7A 3AJ7A 3ILQC 5DHVA 4BYHA 3OPUA 3QG7H 5E0QA 3IFOB 4MDRA 5E2VL 3BKJH 4O2FA 2L7EA 2HWZH 5DRXB 3TJEL 4ISVA 1NMCB 1TMQA 1PPIA 2RTTA 3WNKA 4KHTH 2WCSA 5J3HD 3N0PB 3C6SA 5AZEL 4DUWA 4BSVA 1FFTB 2VISB 1I7RA 3QNXA 1C5CH 1VCAA 4A67A 2MPVA 1UB6B 3FUEA 3T0EE 4Z78B 4H4NA 4W9FC 4PWFA 3P3UA 1JHTB 2I07B 4W9LC 4V2CB 4PMEA 4ZOEA 2VXSH 3ARGB 4YL9A 1L4IA 1CTNA 1EXGA 1BLIA 4N26A 4ONFL 1XVSA 1J8KA 2OXGB 1ECZA 4MJ4A 1VPOH 1DVSA 1BVNT 3GXIA 4KTEL 1S5IL 2K70A 1P7HL 3S9DB 5HGHB 4PJFF 2EYTA 2HJLB 1M71B 2P1YA 3BAXA 4A38A 1WP6A 3Q6FA 4U6YB 1RZGA 1D5RA 2JJTC 3FB8B 4QXGL 2B1HL 1ZTXE 1CF8H 3GJFB 1Q94A 3TEZA 1FL6A 4NUJB 2XT1B 1T22B 3BMVA 3PPSA 4PJDE 3VFRA 5FHBL 1CD8A 4HUCA 3ZE0F 2VOTA 1U93B 2J4WL 3MFFB 3VXPA 5E51A 2JCCF 3UZQA 3KCPA 1Q9LB 2BXZA 3BQUC 4M5YH 3Q5YA 1G7LA 1NC2A 3F2LA 2GHWB 2JCWA 3NFSL 3CU7A 1BFSA 4IRZH 2LT9A 3LSOB 1E4KA 3GSQB 5BUGA 4ABUA 3DXAA 4KJPD 1GR7A 2CG9X 2ZOLB 4OBSA 1H8OA 5EBLB 2LQRA 3ZDXE 3K5SA 4NM4L 3QQNA 1AI1L 4F15B 5EZLB 4DOHB 1I7TA 2P48B 3JUZA 4N0RA 4I4WB 3ZW3A 4R90L 4ZQKB 2AQ2A 4XMVA 3GLZA 1TSRA 2VQUA 3TBYB 2IWFA 4JFDA 5F7HA 1T83A 4K9EH 5IF0B 1VKXB 1CDJA 3DX8A 4F9PC 3RDTC 4AYDC 1IT9H 1CLZH 4FZEL 4P49A 4KTGA 4PJGB 1DFBL 4N3TA 1X5JA 4M6MH 2NYKA 3NFPB 4BFIB 4F3FB 4FFWD 3O2DL 2EXYD 4U1KA 1CG9A 1TQWA 3JXAA 4PGZA 3TNNA 1YEFH 1YMHA 1SNRA 5DWPA 2JCCE 1U3NA 2K7PA 2KLSA 3P11H 3REWB 1IGFH 3SKOB 3DI2B 1YHPA 5C7ZA 1IGTB 5CEZE 3H2PA 4X50A 1CXKA 1LYQA 5IB4A 1DP0A 3MU3A 3FOMB 4YQXH 2X12A 1B0GA 3K4DA 4JG1H 5FOJA 5GXBB 1BP3B 3BPCA 3V4VA 4J2XA 3B9KC 2EDXA 4RLDA 5IWLC 1HZHL 4GUOA 4EUPA 2P5ED 3TYGH 1ZSHA 4LQ1A 1NQBA 1FDLL 3Q5TA 4LSQH 3QORC 5IQNA 4RAHA 1XV8A 4MHHI 5FW7A 2E9JA 1NSNH 4PJBF 3MBXL 4EN2A 3LNEA 3ULSA 1B3JA 4I3RH 3R7RA 5KS9F 5D2LF 3TFKD 1IX2A 3MRJA 4IU3A 4N2LA 4YSPA 3KR3H 5K39B 1BECA 3S37X 1Q72H 4P3CH 3FHEA 1P4UA 2HLFD 3U7WL 4ZFZB 4OFIA 3SDCD 3MGOA 3O8XB 5IHLB 1KG0B 2P46B 5CJOL 5JPNA 1FLTX 3LIZA 1IU1A 1Q38A 1E3ZA 1J9SA 4U3XA 3WHE1 4FFWC 1LO0L 1RK0B 2VLJD 3ZMEA 3K7UA 1UFGA 3HZYA 2F7IA 4DN4L 1ACYH 2ZX7A 4ONHB 2B5IB 4NERA 4X7SL 5C0AD 1MVFA 5F1SA 2F0CA 3QPXH 2JJSC 5HI5D 4UMGA 1PZUB 4OCWL 4KZEH 4JVPA 4X5XB 3FUJA 4JZJB 4J5VA 4GSUA 1P7KB 4GP5B 2F8VA 3TNMA 3K8KA 5DZJA 4K8RH 3CHOA 1SYVB 2DWDB 3CFDB 3KYMA 4J28A 2XG5A 4UQ2B 4I7ZC 4OJFH 1SJVA 1QUNB 4RGNC 4DFIA 5JXAL 1SYSA 1FN4B 1FNEB 1B4RA 4L37A 1F4YH 3MLRH 2EH7H 3DYOA 4KGLA 4X6DB 5FXCH 4YX2L 3WLWC 4Y4KD 5D71L 1S7TA 5HYFA 5FM8A 3MUY1 4LBEA 5B4MC 5I24A 3IRCA 4O2EB 3X17A 5J12C 5I8OL 4NM8L 2YQGA 5CILL 4ORGB 1YEJH 2V0AA 3RKDC 5GRYA 4B0MB 4XMLH 4FKEA 4JFXA 4IGBD 4L4TB 3V8CA 2V2TA 3LEYH 3O0RH 2AQPA 4XXDA 3H9SE 4CVXA 4HJEA 5AOZA 2F15A 3V0HA 1KEGL 5IB5A 2DM4A 4Q7DA 2JLLA 5H37A 4DCQA 5ADOL 3RGVD 4MA7L 2YWYA 1N12A 3HE7A 3KBEA 3L3HB 1U8NA 5I8OH 2WXGA 5IOPA 2E47A 1KJVB 4HWBH 3RVWD 2CLZB 5JW3L 3MLVL 1LQBC 2FWUA 2WYTA 4NXKA 5E6ZA 1R75A 5AEAA 4U6TA 1T2QH 2BINA 3JV4B 3LQAL 4OIIL 1KTBA 4WIQA 5FO2A 3ZMNA 5F9JB 3K74B 4ZMAT 3MUJA 4LSRH 1JS4A 1OF2A 5DK3A 4TN9A 2VLRE 1B2WH 2A73A 2EEFA 5DMIH 2BY3A 1AD0B 1YEHH 4JY5L 4C59B 3SDCB 1IB5A 1FVEB 2HKAA 2QQKH 3HS0B 4GQRA 4YHZH 1U2HA 1I9IH 5T3XH 1I7TB 1ZEAH 1TTFA 4ZQKA 2YUZA 4KI5F 2WLHA 3IGAA 1XO8A 4N0UA 1HSBB 5D96B 4LVHB 2ILLA 3V8OA 3WY4A 4WV1B 1EXUA 2WO4A 1PYWB 3WIHA 4WWPA 2EDMA 4MRBA 5EDSA 3EDEA 4QWWD 1RFDL 1KULA 4OJEH 5B1AB 3LZNA 4NKOB 5JZ7C 1ZJBA 5FGSA 3OGCA 1KYFA 4GBXC 1YEGL 5C0CB 3UZEC 4HWBA 2DLIA 5C0JB 2ENPA 4ZTEA 3ULUH 5EDXA 5DO2C 5FS5A 1U8PA 1C08B 3QWRA 1MNNA 1IGTA 3EKCA 2DQHL 4YDKH 1G9NL 3KPSE 4DAGL 1MH5A 3TT1L 1GRWA 5EEVA 3EO0A 3TO4D 4OLWL 5ABZA 2CDGA 3NPZB 4XVJH 4DO6A 2BOBB 4H0IA 3BPCB 2VGLM 4L9DA 3V4VB 2EH8H 2QKIA 1HHIA 1HNGA 4CC4C 1ONQB 5DD5L 1KXQE 4AMKH 4L4VE 1CFNB 2GJ6A 3TVMB 3GMQB 2K1MA 4XMPH 2VZSA 3OMIB 5BV7C 4IKLA 5AW0B 4N2FA 2P8PA 2DH3A 5HDWA 3TIDB 3BVWA 1IEHA 5AVZB 1A7RH 2AXHA 1JPGB 1REIA 1EEZA 3BVNB 3FZUC 3MV9A 3QK0A 1A7PH 1J86A 1UJTA 2BCKB 4GO8A 4IRSC 4JS7A 3TA3D 3W2DL 4GW1B 5FX3A 2VLKE 4TNFA 4LDCA 2FDBP 4OIFA 5H37H 2ID5A 3UDWC 1KCSH 4M6NH 4G7YL 5C97A 3DBXB 1XF2B 3L17A 2NQCA 4YDVB 1KG0A 2WQUA 4KH9A 4G8FA 3WEBA 4IHBA 1LEGB 5E08H 5FOBA 4I1RA 4FZEH 3AAZB 3IDIA 3FQUA 4Y1AE 1NDMA 1PKOA 1UA6H 3MRIA 3LAFA 5C6TH 5AKRA 4C83A 2Y23A 1E5BA 1OW0C 2NXZC 2F2HA 2OQJA 3Q8CA 4JQIA 2AC0A 3UZVB 3E8UL 3ZKNC 1ZGLA 2ZAIA 4OAWB 3UC0H 1DBJL 4M5ZH 5EBMB 4Y5VC 2FATL 2R2HA 4YE4L 1KACB 3QZBA 4OZFA 1YNTB 3HOGA 3L3IA 1MCSA 5C07E 5IHHA 2KI6A 1RIUL 4I2XB 2YAPA 1RAMA 1B6DA 4UCFA 2ZOUA 5B8CB 4R7DA 4RVBA 4UQDA 4OT1L 4XC3L 2HFEB 4ZO6A 3AXLB 3EFOA 3IGUA 3S3JA 4Y19A 3ZUNC 3FFCD 1WIPA 5I8EA 3FN9A 1QUNA 1A7QH 7PAZA 3TPUA 3T2LA 3X11A 1IM3D 1JZ7A 3B2VH 4Z7NB 1JK8B 3LD8C 2R2BB 1G7MB 4HLZG 1WFJA 2DQGL 3ML9A 4LBEB 1JERA 4PJAA 4IBSA 1U3HA 1BLNB 3AITA 2J44A 4YHPB 2CBOA 5JMOC 4NOFA 3TN0B 3CFBA 5EBWB 3LKOB 3C6EA 3EYVB 2FIKB 1JZ5A 4WFHD 4M00A 4PBVC 2NSXA 2IFGA 3K2MC 1I8MA 4QOKE 1UVQB 4BCYA 2VUOA 1EGJL 4I0PD 3ZPDA 2WQSA 4MD5A 5JA9A 5K5YA 2FZ3A 4NUJA 1NCWL 1RLWA 3BKML 5D1QB 4NQXB 4M56A 4QHUA 4XCCL 2APFA 3FJTA 4LLAA 4RNRA 1GGIH 2FNBA 1UXWA 2OPCA 2A0LD 1MHCB 2ZNWA 1J88A 3A6CH 1FC2D 1F11A 4YHIB 3EFFB 5A2KH 5HYQB 4LU5H 4NNYA 2Z91A 4O02L 3NIFF 2R83A 1XL4A 4FFYA 5CBEA 3TN0C 3VCLA 2F58L 4IBLT 1AZCA 2FWSA 4FFZA 4R26H 5IVOA 4TL5A 1L6PA 2Z93A 3X3GH 1NFAA 35C8H 1PNDA 4NQEE 3P4NB 1WK0A 2V2WB 3ALPA 1NTDA 1BXVA 3KYKH 3S5LA 3JSSA 1RMFH 1SHXA 2YS4A 3HI6L 3LRMA 1VEOA 3BIAX 1HXMA 2NXZB 5BZWB 3N2JA 5I28A 5DI8B 4JFDB 1QLFB 2Q8BL 2DL2A 3MRKA 3OHMB 5F89A 3DROB 3RTQC 4EBQL 2NZ9D 2DAVA 2G60H 3FQTA 1CXHA 2X4TB 2DIEA 3GPSA 4Q9RL 1E7UA 2ZNXA 2YD1A 1INDL 3C5ZB 3LKPA 4M03A 3SBRA 3EGSA 5FO7B 3QUZD 3V6FB 4CADA 2P5WB 5J6GA 5ALCH 3U0PA 1PNCA 4U6XA 5AOKA 2Y0SA 1OM3L 2IANE 4DQAA 1QATA 5E8OB 5EH1A 1E6OH 2YGOA 5LCVL 3KJ4C 2UY6B 1NGPH 3L3JA 3FQXB 2CXKA 1M7UA 5KSBA 5B39G 2DLFH 3QRGH 4GFTB 4KZCA 3SO3B 2WQAA 2W9DL 3BOVA 3GLEA 3VWKC 4H40A 5BVJB 5FB8A 4Z8FH 1CFSB 4P2OC 1E27A 2WANA 5TDNA 1IO4C 3D4CA 1GC1C 5I1CH 3PP3H 3IVKA 2DJMA 4QHNB 4AXWA 4HC1L 1WS8A 1R3HA 3HG1A 5DSCA 1XF1A 5BQDA 1ZXQA 2QMJA 3TVMA 4BFNA 4PJHF 4KRNA 3GHBL 2P80A 3FCTA 4JKLA 1V3LA 2W9DH 3BZFA 3IJ8A 4S1DD 3S3DB 3S96A 5KZCB 2H7WA 3MVSA 4KI5C 2AJVL 4JGMA 3RWJB 2AQRA 4AM0Q 4WHCA 2J6EL 1XF5B 1G9EA 4FI6A 1LE9A 3KM2A 1M3IA 1IM9D 2Q3AA 2COVD 1BF8A 1S7SA 1RZQA 1F8TH 3GK8L 3JV0A 4L3EE 4LCWE 5J56B 1LEGA 3BQUA 4ZAKD 1S9XB 1E3XA 4EBQH 5DD0H 5E2WL 4LAJH 3FUMA 5KUKA 4JRFA 1R3JA 2C5DC 1GS6X 3GTVA 2DQUH 3F00A 3MRRA 3I75B 2FL5B 4G7VH 3V5DA 1RPKA 4FGMA 1DJGA 4PHZA 3SODB 5E6YA 4AI7A 2R2HB 1SJEA 2ZCKL 1DBAL 1EVTC 1S8DA 1W80A 3NH7H 4NZTL 1NMAL 2C7UA 2OW7A 3CSGA 5IHZB 4FI8A 3L7EA 4CMHB 5IQOA 3NSDA 5D7IA 1ZV9A 2IH3A 4L5FH 1N6UA 4R3SA 2FX9H 2Q6WB 4JVUA 2N0MA 2XJKA 3UC2A 4NHUB 1AYOA 5FCSH 5HSFA 4MJ2A 5EUKA 1IJNA 3DARA 4M1GH 4P5KB 1QHQA 3BZEA 1A6ZB 5IMMA 3RPIB 3L4WA 4DESA 4X99B 1G7MA 1SLXA 5I1KL 3D9AH 4X0NA 1KIQB 1GGIL 3D2TA 3D3VD 1U3HB 3TV3H 5C0ND 3HBZA 3OKNA 5D70L 4PRHD 4ZQTA 3BDBA 2FNWA 4U7KA 1JZ4A 1XB6A 1FAIH 2R51A 5I6XC 43CAB 3W11D 4LSUH 3VXMD 4ICWA 1R5WA 1W72B 4X8GA 5BQ7A 5DVNA 1A0QL 1BJ8A 5IM7B 4DNLA 5E23A 4LK4A 1WHOA 1KBGH 2I24N 2PW1A 2UZIH 4HT1L 4JL1A 3U6RA 5DHVH 4DCQB 3NIDE 2BRQA 3SIKA 4CILA 4UUJB 5D1QA 3ZTDC 5JQHC 4PJIA 1NEZG 3SE4C 5JPMB 1JL8A 1BQLH 4OVUA 4KJWC 4E68A 2F8XC 2O6FA 5ANME 3OAYK 1NC4A 2CLZA 3K2UL 5CZKA 4U1SA 2W0FB 4UQ3A 3QDJA 4JFZH 3TYFA 4DP2X 3TM6A 3FQ2A 5F3BB 3AVEA 3GJEA 3LVTA 4R83A 5T1MB 2DLHA 1IBHA 2RHEA 2Y7LA 5F9JA 3C8DA 2WZPD 4BUGA 1N5YH 1AP2A 3MACL 3GXTA 1MWAH 1NCAH 1ES0B 1G9ML 2CDFA 3O0LA 1M56B 3KXFD 5EUOF 1RLBA 4EIBA 4XO5A 3PL6B 1NWPA 3EHBD 2IWEA 4GRWB 4LKXA 5E6RB 4GAYB 1NPNA 5DJ2A 1T3FB 3JTSA 1C12A 4RDQF 1WTGT 2IXQA 1YMMA 5AW4B 3GBDA 1EHKB 4N0UB 2E7LA 1S7XA 1L3NA 1LO3H 4HUVA 1YLBB 4HJUA 5F89B 1UM5L 3SD2A 2AEWA 3VGDA 1IBZA 2LV4A 3BLBA 4CUCA 4MMZB 1DQVA 4HZLB 4IKJA 5CINL 1DSYA 4MA8L 1KGUA 2IO5A 3GS0A 1GIGH 4P4KB 4G2AA 1UM4L 1KZYA 1WAEA 3F84A 4XRCA 2UZPA 3EGSB 1WZKA 5FO7A 5AD0A 1BPLB 3MJ8A 2EDEA 2R2EB 2WXLA 4OM0L 5C09A 1FZJA 2XRAH 5CIPB 4AQEB 3V0VB 3FHQA 4LSSH 4ELMA 2YA1A 3QDME 1CE6B 1IE4A 1XH3A 3IJHA 3I6SA 5LWYH 2X4PB 2CDEA 2ZUYA 5MHSD 3MKGA 4H8WL 1A7NL 3B9KD 1IL1B 4DP5X 1KBBA 4AC2A 4JKKA 4XGZA 1LEKA 3A3YB 4K7PL 2ZUTA 3ZZLA 2GCYB 3EO9H 5TDNB 5B38B 5SV4A 5DD5H 2J1KA 1RUMH 4O5LH 4OF5A 4S2SB 5ACZA 3FRPB 1OKEA 2KC0A 4PY8J 4TM9A 4HV8A 4XVJL 4F57H 4LASH 1OV8A 1EJ8A 3MRLB 3QJXA 1DANT 1GKEA 1KXTA 3CVBA 3DRTB 4XWOC 5ISZD 4MXQC 1JCVA 4FXGC 1VB9A 2GKIA 4X2UA 5DD6B 2H2SC 1HE8A 1CR9H 1FWXA 2XWJA 4YHNA 5EU5B 4RMUA 2F53A 2YGQA 2YIHA 5HDBF 4B9GA 4EN3B 2EQDA 5E2TL 4BK5C 2YRPA 2AK1H 1XF5A 4PWIA 4KTDL 5JW4Q 2VXTH 2A6KB 3QO0A 3FU7B 4AQ8A 2R4RH 5E56A 1TZHB 2YOCA 1OGAA 3BQUB 3ZKND 1AZZC 1IKFH 3FFDB 4H1LG 1S6NA 3FT3A 4HDIA 3KG5A 3Q2VA 2VDRH 5ESVB 5GSVA 4Y16C 3VX0A 2GSGA 1TFHA 4AQ1A 5E94B 4V1DD 4XPAH 4J27A 5JHAA 4QGTA 1S8DB 2D7TL 1WBZA 3C2AL 4XBEL 5I5MA 5I1GL 1AZBA 3VD3A 1MJ7L 1S7WA 2W07A 3L9YA 3PWPA 3D87B 4JCWA 1SQMA 5D7IB 3ULVL 4PHXA 2B1AL 3WNIA 4H8UA 3SQBA 3W38A 4KMTL 5HGBB 2HVKA 4G80A 3H7BB 4XE5B 4LSRL 4RBPH 4F93B 3OKOB 1H6UA 1AGCA 5IJBC 4CVWA 3FSWA 4OIIH 1PU0A 5I1AA 2E86A 4AGLA 2AW2A 5TQ0H 3ZQ9A 1WBXA 3LS5H 3RIFK 3C6LA 2W65B 1E28B 4N8CH 3SDAA 3BUIA 3BKCH 3MKKA 3ME0B 4UOJA 3SYPA 4MA7H 2V7NA 2CK2A 2ZAHA 3QPKA 5G55A 2XN9A 1KEGH 5CEXB 4BUQA 4DKEH 1IFRA 1WFTA 3GMMA 2GIXA 1BVLB 4BZYA 3QJSB 3FU3A 1SJXA 2OP4H 2HKHL 5C07B 2BFVL 2AV7A 3KNBB 4HWEH 1UVQA 1UKQA 1DUYA 4OD1H 2FZ3B 2LAGB 3WKPA 4QXVA 1KDJA 3RYMA 1UT2A 3CZJA 3UMNA 4DUVA 4ONOA 1JGUH 1WRFA 2W0FA 5F1NB 4AKOA 4WO4A 3TYFB 1F11B 4YHIA 2V5TA 1UZ8A 2AEOA 4H1LH 4P5MA 4R96A 4OJFL 1NDGA 3SPHA 5EO9A 3STZB 2V5MA 5E8EA 2GYSA 5EORL 1T66D 4OZGA 1H0DA 1NGWA 3MLTA 5C0AA 4PVBA 3IRZA 3MCG1 4IBVA 3LYRA 1XF4A 1ZHBA 3T0EC 5GJSL 2IPTL 2PTTA 3LCYA 3MV7E 2CKNA 1R5VA 5DU7A 1R3IL 1YY9D 2MEJB 1P84J 2AANA 3PXJA 4WLCA 5I6XB 3DWTA 3L3OB 3LNHA 2AMGA 3SKMA 5JUEL 2WTRB 1J9RA 1AS8A 3B9EA 5EHFA 1DZBA 1RQ5A 3I02B 4PJ9A 3SJVA 3D1MC 5AVWB 4DQOH 2NNRA 4HX1B 3WFCL 2XBTA 4HF5H 2XZCL 1U8CA 2AK1L 4ZXBD 1IAIH 4AQ1C 3QIWD 3ZZQA 4KJYA 5IGXL 1QZ1A 3D25A 3MJWA 4ALAL 1AOZA 4GMSL 4G8GB 4ODUB 2E9WA 4PRIE 1HCYA 2ZWZA 3WFHB 2YPKA 3L3JB 4GSQA 3FN3A 4BQCA 5HHXH 1RSFA 5B1BB 2L3BA 3RGHA 3DJZA 4ZTOL 3FRPG 4M9PA 1FO0B 4AVHA 1K4CB 1G7IB 3ARWA 2E7CA 4LSQL 3QHZL 3O6KL 4JR9L 3QDGB 4KITB 2HXAA 3MRPA 3AS0A 4QHNA 5DWUH 3ARBA 1JOIA 1HILA 4PJHB 3MRLA 4M7LT 4YQXL 5IEKB 2ZYRA 3VE0B 2ZKMX 4IDJL 1BXXA 3ZTNH 4ETYA 3AROA 4BZ2L 4JPIB 2XRAL 4JPSA 3L54A 4IRJC 4ZO9A 2XTSA 5CLWA 2ZQKA 3KWUA 1WAAF 2FGZA 1D9KA 3NFNA 5EIIA 1SDYA 4ILDA 1UWFA 3ULUD 1NCOA 1QSEA 2CO4A 1A9EB 2PMZA 4P5TD 4M93B 2HG5A 4PW9A 1ET7A 3M1OA 3K72B 3VXRA 2K3HA 4MS8C 3VXQA 1Y7VA 1UM5H 2G2RA 4R4BB 1M1XA 3O45B 1TO4A 3ARRA 4Z7OF 2GSGB 3NACH 3H9HB 1KWGA 3DX2A 3UO1L 5E94A 3ZTJG 5CGYD 3CHXA 3GSNH 3QUHA 4DP0X 1A1MA 1I4FA 1WBZB 3QUKA 1Q9WA 2EZ0C 4NUQA 2NCEA 4PCTA 4QGYA 4IOFC 2W38A 2ICES 4B9JA 4PREB 4WI0B 3U2SA 1TCRA 1VJSA 2AJXH 1G9MH 2E75C 5FCUL 4PRAB 1DN0B 1YO4A 1ZT4B 2BNRA 3T0WA 3Q9QA 5GJTL 4N2BA 3N1FC 2VL5A 4E5XB 2VE6A 1Q0EA 1VGKB 3MRBB 3C60B 1ZTXL 2PWFA 3NJLA 3HBQA 5DZOA 2FR4A 4XH2B 2PP9A 4NC1E 3QBTB 5KYXA 3DDGA 2C4XA 3SQOH 4EZLA 1EZVY 4L0ZA 2CUAA 1A6ZA 2BVTA 1LILA 3OM3B 4J3OD 2XWZA 2MCG1 4B5ZA 5IMMB 4LOEA 1UENA 2OYLA 4Q52A 4PS3A 3C6LB 5J4MA 5F7WC 4NKMA 5T1LD 5F7DA 2JFCA 3DIFB 5FHBH 3K6DA 4PI2A 4PB9L 2VR4A 3RY4A 1CFBA 2E46A 1UD5A 4LCUB 3KDPB 4R4FL 3L9BA 4EKXA 1R0AH 1U8KB 2ITFA 4S1QH 2WJ7A 5G2NA 5IW6B 1DVTA 1QEXA 2ZCLH 3HMXH 1QBBA 3KYOA 4XXWA 4QXGH 2NCMA 4HZAA 5MERB 4EVNA 1LJMA 3L9RB 4POZD 4WW1B 5CR1A 1QNZL 3AGWA 3TV3L 2HRGA 4IS6A 4NZ8A 1D2PA 3VI3E 3D9AL 1A4CA 1KBWA 2EDNA 3BESR 3RTQB 1S7UB 1I3GH 1MCIA 4MNQE 1MHPH 4J3TA 2X6BA 4UBDD 4AQAB 4NPYB 5EUOB 1F2QA 1AHWB 1XSJA 3V4PL 5I1DA 6FABH 4AGOA 3GXMA 5L2KA 4R96B 5D7KD 4Z77B 1MDAA 5JIMA 1MVUA 3RUGE 1KPUA 1MHHA 3MN8A 3HA0A 2B08A 4PI0A 4BWWA 3EH1A 1WBYB 2ITDB 5AZEH 4WVRA 3EXLA 2RD0A 2GUOB 5GZNC 2FQFA 2FLBT 1ZHBB 4RGNE 4ETQA 2DYPB 5IUSA 4MNHA 4GAYA 5DJ2B 3IPBA 2BX5A 2FJHB 2KMWA 4G7VL 3ESNA 4ZS7H 1NOFA 3BKJL 3O11A 4KY2A 5IB3A 3QG7L 2BY2A 4M7JH 1OM9A 4FMFA 1KY7A 4OVVA 3SKMB 5I19H 2WTRA 1AQKL 4HCFA 4JRXE 2C3WA 3CDCA 5KG9A 2D7PA 3BLKA 5I6PA 5L88H 1OP5H 3B9DA 1ASQA 3GKWH 4DZBA 2NR6A 4TOYH 4DPCX 2YXVA 5D8JH 1WPCA 4XNBA 5AD0B 2EVGA 3GSOA 4ZAKA 1MJ8L 1MJJB 3B83A 3UXFA 4BRVA 1J5CA 1LO5B 3HZKA 4N0CC 2E7MA 1TKWB 3BH9A 1SF5A 2D3VA 3MLXH 4HXAL 4OD2B 3UAJC 4BH8A 1BZQK 5E4IA 1BEXA 4Y4KC 3RZCC 1ZXKA 2QADB 1P5VB 1N67A 4U1HB 2AEPL 5DJZA 1H3PH 4GO9A 3ESUF 5CIPH 4O4YH 4KKZA 3BHBA 2B0SL 4FFYH 1JSYA 4R8WL 1XGUA 3QEQB 4OF0A 4DGIL 2IC2A 4QRTA 4Z7WE 4XTRC 1M4KA 4JFFA 2Y1ZA 2HMID 4ZXBA 4QRSA 4YO0B 4G6FD 1VFBA 2BZ7A 4U1JA 3EYSL 3NP3A 1KJ2A 3WE6B 4F7PA 5J9PA 4X8JA 4PYGA 4UTBH 1T1WA 2VJXA 3RWGA 5HYJE 3O3AA 5F88B 5AW1B 2EADA 3P9WB 4XMKH 2I5YL 2EDJA 1DQIA 5IREA 5L8JB 2HYMA 3APNA 5A2CA 2PR9A 4B27A 1FV1B 4UWQB 1D9KB 3O3EA 1P9MA 1BEYH 3MBEC 4MS8D 5ALBL 1AKPA 4P9HC 5DUBA 2WTPA 1BGXH 3GSUB 4XR8C 5A40E 2HT4C 2AV1A 2HVJB 5FYKE 2W60B 3O6FB 5C71A 4GRWF 6PAZA 3FT3B 4HDIB 2DM3A 4L4VA 5ESVA 4JN1L 5GSVB 1FPTL 4KQ0A 3ATBA 2LGNA 4JPWL 2VB5A 2Z8WC 3IWUA 5K9JH 3KYKL 4WSJA 1F6LL 1UC6A 4POUB 1BM7A 2FIRT 2VW4A 1CXLA 3K8LA 4HLJA 1RZJL 4KOBA 3ARDB 4LLDB 2ICWI 3VQ2C 1ZHKB 4G8GE 9CGTA 2E5EA 4WWKC 3M6DA 1NFIA 1XCQA 1JNNH 2EKSB 3ZT7A 3TS8A 1DN0A 2BNRB 1RCYA 4MZRA 2FJUB 2LR4A 3OAUL 2ICWA 4LDLB 4IKKA 4P23D 3V4PH 5D93C 4QWWC 3AW5A 1MCNA 5K1NA 1GXEA 3WNMA 3IFLH 1NWOA 3BJ91 4N3UA 5T3ZH 4P2QE 4PBDA 3NA9L 1FZKA 3SBPA 3ALWA 3NCCB 3BKMH 2UZXB 3E8VA 3APMA 4Y7MA 3QIUB 1JYWA 3MXWH 5HI3C 3GUTA 4LCUA 2NW3A 4GY4A 3GS4A 3BVVA 2CXGA 1BQHG 2BSRB 2HP4A 3H3PL 3HAEB 4PVMA 4XNYH 3DX9B 1XXDC 2AV7B 1JZEA 3KNBA 5J11C 1AACA 1SXBA 1U58B 4LE8A 2K8QA 1F56A 3T4AB 3HG5A 1A21A 3ARFD 1YYLL 3F05A 1BZ7B 1JWSB 3EGDA 3S88H 3B2VL 1TJIL 4HS6A 3N04A 1YYCA 1YEDB 3ECUA 4ICXA 2EVHA 1HC1A 3BWAB 3BZ4B 4UT6L 1WZ1H 3EBHA 2DDQH 1USZA 4ZFOA 1XAKA 1GA2A 2CR6A 1T20B 3ZYZA 1CDBA 1WFMA 1R17A 2WLYA 2F8OA 3GMLA 5CLZA 4UTBA 3U1QA 5LJYH 2AJXL 1Z0NA 4RCAA 4F7TA 2DTSA 3LKNB 4LF3A 1BVKB 4IBYA 3U36A 1DYZA 4YXLL 1OSZA 2CLVA 2R8SH 3CVCA 3DX7A 3HNVH 3O6LH 2D7OA 1R9FA 3A47A 4NENA 5FF6A 1TPXC 3E8UH 3UCQA 2B9BA 3LEVL 3NABH 1Y18B 4ZAKC 1GGBH 2HSIA 4XB8A 3S4SA 4ZXBC 4Q0XH 2RMNA 2KS0A 1MY7A 3EYFA 2DI9A 4PP1D 4QRQB 5DJCB 1I9JH 3QJOA 3X1BA 3IDXH 4PRNB 1E4WH 1CD9B 4JFPB 1H3VA 3GMOB 4QYAA 1KCSL 3HJ0A 3E2HC 4L3ED 1H3GA 4MDIB 2CRYA 1UD2A 3W2DH 1I1AD 1U8LA 1CXEA 2YWZA 1TKWA 4ELME 1A47A 2UZYA 3LN5A 4UI2A 2DIBA 4W9JC 5H4ZA 1MW1A 2FD6L 5LAPA 2R1WA 1U42A 4Z76B 2LU7A 2QLYA 3UGUA 3LIZH 3RRQA 4I18A 2K9UA 3QHZH 3A21A 1YPZA 2VLRD 4MWFA 1DBKH 4PJXA 3QUXC 4AV5A 1N6QH 1NIFA 3INUL 4ZTPL 4YO0A 2GJJA 1K4DB 3F5WB 4Q6IC 5I82A 4LEOA 3OBAA 4OZHE 1MLCB 5F9OH 2E8ZA 3RILA 1YUKB 32C2B 5HHXL 1T1WB 3POCA 4F2FA 2DMHA 2V4LA 4E41E 2J88L 1MI5D 2DQMA 4JFVA 5LXGH 1SXNA 4HWUA 2PO6B 2DS4A 4Q2ZB 4Z7QF 3S36X 3UABA 1DVFC 2ESVE 3CC5A 3O3EB 4M7KH 2HX8A 2K45A 2LVEA 4Y4HB 1TENA 5I74B 3PWNB 2QELA 1A4AA 1QOKA 1IJ9A 2FYYA 4JK0D 3FONB 3EBIA 5DGRA 3O45A 2WO3B 2DD8L 1PLBA 3RLSA 4HGKC 3WEMA 4OUUA 4ECNA 2I7OA 3HB3D 1MCPL 5HGAB 4ZI8A 2BIPA 2P44B 3SO3C 3GNMH 4XPTL 4GKSB 2Y1YA 4MB5A 4ABQA 4FI7A 2IWKA 4QTFA 5EU6B 5TE7H 1UOKA 1ECYA 5AW5B 2N1TE 4E9VA 1CGXA 5IROD 3GBEA 3U2SB 4DW2H 2HT2C 5AZUA 3CQQA 1SFDA 4GP4B 1JF1A 4R5VA 3AADB 2VL5B 1U8OB 1OSPH 4P06A 1CFVL 4OH2A 4KHXL 7CGTA 5FO9A 4G1MA 5TH2B 2OL3B 4KY1L 4G8IB 1I8KA 4P2CG 1NIDA 1NLDH 1JGUL 2JIXA 4KK9C 4M43L 1NGYB 5D2LE 5CN2A 5K93A 1HH9A 1J0YA 3GXUB 1URLA 5DJ0A 4F92B 4JG0L 3JWDL 3CN0A 2E7HA 3NCWA 1TNNA 1PY0A 5EOCH 2BFVH 1TF4A 3MRQA 2NW3B 4HJJH 2I60L 2C3VB 1A14L 4UAOB 2O4EA 4J8QA 3ZO9A 1G6RH 3ZR5A 2IALB 4UNVA 4NC1C 4OZIB 3QULB 4GUQA 4QRFA 3PXHA 1ZE3C 4P9MH 4RGNB 3QRBA 3O4OB 4QHLB 3V0DA 1QBMH 4WW1A 3OR6B 1OAYL 4X9GA 3QUXB 4NZRH 4OLEA 3ARBC 2HTKC 3LS5L 4AMXA 5IJKA 3NJHA 3D2UB 1LXMA 4AGNA 3QH3A 4Y2DD 3DX8B 4GIPD 5C07D 2A74C 2PNDA 3QCVH 4NP4L 2RH0A 4AYMC 4GJTB 5MHSE 3BSGA 2A6IA 4LP8A 5D1QC 4NWTL 4QR7A 5I1DB 2YUVA 3GBML 4KMTH 5IBLC 4OTXL 4YDZA 4LPWA 4KRMB 3UACA 3GMLB 3AT0A 5FW8A 5LGHH 2VLJB 1JZ2A 3B9VA 3FBQA 1QBLH 4PJDA 2FEEI 4GS7B 2VAAA 2VN4A 2K4AA 1CGTA 2FEDD 4U7SA 4N8PA 2ENQA 1FVCB 1AXIB 3LMJH 4C54A 4MNHB 4RGOH 3T6WA 1RP8A 3P4MA 3N42B 1IC0A 5KBDA 4AUYA 2MHAA 3D34A 3EH3B 4U1IB 2XZAH 2PO6D 1IV8A 2Z31A 4PP1C 2OYKA 3JWNE 3KLKA 1VRSA 5JORA 5L7XL 2YAQA 2B77A 1FLRH 3KXFE 1CXFA 1X7QA 2FVNA 2X3BA 1ZDSA 3VFVB 1UGKA 1F2XK 3ULVE 1SY6L 3T4YA 4Z95H 2V7HB 3T6QC 4BRJA 1B4JL 1TYRA 2DN7A 4BXVA 1MPAL 1MJJA 4JANB 1J9CT 4MAYA 2P45B 2WGNB 1BFOB 4OKVA 4YGVA 4JW3A 1K8IB 2JQMA 2OV0A 2ZJSL 3AG3B 3QXTA 5E70A 5HI4D 3WJMA 2XV3A 4BCZA 1ZGLP 3VH8B 4DGVH 3QT2A 2BO0A 1FFOA 1T83C 5EC1B 3DIDA 1J48A 5EN2A 1BMZA 3QHFL 3JT0A 1IC5L 4S1RL 2F7OA 1RUML 4O5LL 2Q76B 1YPZB 4JDVB 2W92A 1XEDA 2PCFA 1A4BA 4L29A 1YY8B 3IFNL 4Q6KA 2NR6D 3LQZB 4PCKA 4ONHA 1KT2B 4PW3A 4UAOC 3HKFA 1AO7E 4WW2F 2VDPL 1JVOA 4NKDB 4X8JB 4XPGH 3ABKB 4GG8B 2VZ1A 1WA0X 3NOIA 4K5MA 3WXVH 3MMEB 2AXWA 1QFWL 4APQD 4F37F 1FA4A 3CGTA 1PAMA 3TNMB 4XAWH 4Y2DB 3BQVA 5EEUA 3EIFA 1RJZB 5D7KE 4UT6A 4HQQL 2J20A 5E9DE 3DSFL 2J1YA 5E5MA 5D2LA 1HXKA 2O6EA 1FN4A 3A24A 4NKQB 4PD4J 3B2UC 3EJCA 4EDXB 4E9XA 1OOAA 4K9EL 4RGND 2AJUL 1MWAB 1XAUA 2ICCA 2DBJA 1FCGA 4MDJA 5CD3B 3PY9A 3LY6A 2YQ3A 2Q10A 3H3BC 2HAZA 4Q14A 4XBGA 1G1YA 3RZCA 3ESVF 1KTRL 2RALA 4OLXH 5LXGL 1H8SA 3QQ4A 1H6EA 3U46A 4IBWA 2EXWC 3AT8A 3ZTJH 2E27H 5JW5A 1ZIBA 4WI9A 1BWWA 2QQLH 3NFSH 4UU9B 1IGCH 3F12A 1Z9LA 4PUBH 3SKNB 5JHLL 3L3HA 2CSPA 4G1MB 5TH2A 3AFLA 2ED7A 4UOQA 3HI5L 4YSSA 5HVWA 2A5UA 1NCUA 2OMUB 3VSUA 4HGWB 1FFNA 1KCUH 5IB2A 1K2DB 5IR1A 4IIZA 3PL6D 2ADFL 2RBLA 1EEYB 3D69B 2XQYK 1X6LA 4X7FC 1E67A 5IVXF 2NUTA 1PZ2A 1HFUA 3JV6A 4XWGH 2J73A 3UROR 3MRQB 3S36L 1ACXA 3MYJB 1ZK5A 2GB2A 4FD0A 4NO3A 5JOFA 5KAQG 1Q0YL 1XCWA 1WIOA 4QY8A 1BQHB 1F6AB 5GRVK 4EDWL 1BMWA 5GGRA 1RK1A 4ODSH 3OXRB 2XQYA 4QRUB 4AK1A 1KGJA 4P4RA 1FAIL 3VXTB 1NLBH 2XWBB 5KJRH 3FTVA 5KSAC 3OR6A 1ZLVH 5L4MA 2BH0A 3T3MF 4FNTA 5B22A 3UBFA 2B3RA 2BHUA 3HN3A 3O4LD 4ZJ9A 4AEIL 3CDGA 3SE6A 4O51A 4HKBB 5F0MB 4WK4B 4HVBA 1JWSA 3QH3B 2E6QA 5DQJA 3GB7B 4Q4IA 1U95B 3DK0A 4ZPVB 4EAEA 3VXUA 2XWXA 3OG6B 1WAAE 3IPEA 3JWNC 3O2VH 5FGBA 3MLYL 2L7JA 3MLUH 5I16A 4DPAX 1T1XB 2A9NH 1EZLA 5F93C 3TZVA 3VDBA 2YAMA 3VNYA 3II3A 3SGEH 1OVZA 2VDLB 4G6ML 4YXHH 1NINA 1CD1A 1N9PA 2CQVA 3GGWA 3MLSL 1PG7L 4YHML 3S97C 1TZGH 1U2YA 2HA1A 4XOCA 4MZ2A 4X4MA 1WZ1L 3MNDA 3P4MB 2PLTA 3VTTA 1NAML 1S7RB 4KO7A 2V3FA 2O6DA 3CH8A 2NTSP 1ULVA 4HK0B 5ECGA 2GUYA 4ZFFA 2EDQA 3GQFA 1N0LB 2BOBA 3ZL2A 2LTQB 3V7MA 5DJCA 3O3BA 5F3FA 2V7HA 4LCCC 1PZCA 4HWZB 5HJ3B 4XB7A 3GMQA 1JHKH 2AMUA 2I7SA 5D4QA 3RJQB 3WSQH 4K2UL 3SGDI 3VFGH 3NA4A 2VMFA 1YECH 3QEQD 2QHLA 4I2XE 1BD2E 4DGYL 3QDMB 4H0LC 4OKVB 2ZUSA 4ZD3H 5F6IB 2HJFA 2H4EA 4YK4C 2WP3T 3WUZA 2XQBH 3V6ZB 4K5PA 3ZQWA 3CZGA 4YBLB 4A6YB 3GHBH 1VF5C 1X5LA 2IAMC 4G8EB 4FQ1L 1ZLSH 4IK7A 3K91A 5DHXB 2I25N 5MEPA 3BSHA 4OZFH 4TRPH 1SJHB 2B20A 3HUJF 4C56D 4G8FB 2YARA 1MI5A 2X28A 1VZHA 1IGJA 2NY4D 3LKQB 5GIRA 5DYOA 5EUOE 4APXB 4X6CE 1G1CA 2LTQC 1G6VK 1XT5A 2ODHA 1GY1A 3ECWA 3K2KA 4TNWF 3ZE1F 2H6OA 4FQCL 1MLCA 2EVJA 5DURD 3QUZA 3SE4A 3EH5B 5EA0H 1HIMH 4OZFB 4UV4L 1TUPA 2FX8H 2EDYA 4HUKB 1QA9B 3FQRA 3KGTA 3LB6D 1DJHA 2L04A 2PO6A 3ARDC 3IKKA 2XG4B 3MOQA 2CZNA 5LBGA 3AXLA 3EFOB 4ZSOE 4FXLA 1A9BB 1CDCA 4JN1H 1U8JA 2YBRB 5KW9H 4HCGA 1KIRB 3U7YL 1P53A 4AV0A 1SDDA 2X1OA 3GIZH 1C5BL 4P2YA 4R84A 3UADA 2MTAA 4OI9A 1LEIA 2NUPA 4HP5A 2ERJB 1XGRB 5E6SB 2R2BA 1VIWA 4O02B 2A6DB 2YHGA 4UF7C 5A7BA 1S4IA 3ZE1E 2AJSH 2OAAA 4H5SA 3UJTH 1OLZA 2AQ1A 1Q4NX 5GZND 2Q86A 3LEXB 4TQ8A 5FHAL 3CH1B 4DP7X 5E9DD 3VWJB 1GZPB 4R26L 2L4OA 1J8SA 2QL1A 5DS8B 2F58H 4ZO8A 3OR7A 2G3NA 4O02H 3SCMA 3OKMA 4F7CA 2W9LA 1N70A 4KK5C 4PQXA 1R47A 1TETH 2HT3C 2ZKXA 4RWYL 1X4YA 2VDLL 5A1AA 2QQNL 4FFZH 3HLAA 3NRPA 4G8IA 4U1LB 3ELQA 5ITBH 1EIBA 1MHCA 1LWJA 2K9FB 4I5BB 2ZP9A 1NCWH 4FC3E 4H25A 5TE6L 2PF6A 3C6LD 2Z91B 3D50A 12E8H 5CBEB 4NO3B 1HU8A 2CRIA 4YFEA 4DZ8A 1YN6B 2XYBA 1I75A 1PGRB 4NZJA 3ZDWA 5D7EA 4JDEA 5HDQH 3WSQL 2ZUXA 4K7FA 1ZT1A 2Z93B 1S7VA 1WF5A 2EYSB 2P28B 3O6FD 5TQ2H 3SDXA 1DBMH 1P4BL 4UM8A 3WFDH 4N0FB 4FL4B 2X4SB 5I30H 3MODL 2D3JA 2IAMA 3DECA 4N28A 2X05A 4TUKL 1AS6A 3DGGA 1L9QA 2JKLA 4LZKA 3T6XA 1NAMH 1JV2A 4JCLA 3MRKB 3L6FA 5CGTA 3F7RA 3MI6A 3L4UA 4JRWA 2D4DA 2VDMH 2OMBA 1ADWA 2MPAL 1PG7H 5GGUA 4FLOA 3OB8A 3FQ1A 4LLVA 1RKRA 2X6CA 5I76B 5MENB 4LL9A 1P4LB 1HEJC 2ZCZA 3QUZC 3KGSA 4P5TB 4YE4H 3MLYH 1MCFA 4HBQA 4G43B 4U6VH 5F0JB 1FVCA 1UB5A 2UY7B 5BS0E 3HG1E 2K6WA 2R1YB 3FU6A 2NNFA 2GSIB 5BV7B 5BW7C 2ERJC 4YDJA 2VDML 5IKCA 4LVNC 4OGYH 1QRND 4N2IA 3PGCA 1TLMA 3CFNA 4RA3A 4LNRB 2XLLA 3IE9A 2ZXAA 1LDPL 2E74C 5DGQA 1MFAH 4P9HH 3TTSA 1I1AC 3C5JB 4LL4A 3RX5A 5FC9A 4HKZB 3VWJC 3AU1B 4MQ7B 4D9QE 4JQXC 3G9VA 2NPLX 3P54A 1S7QB 4R0LC 3ET9F 5GS1C 4DHLA 1YMME 3BWZA 1NOLA 4FFVC 3FO1A 3CHRA 3UTSA 1D5BB 1I8IA 4TQHA 1A7PL 3UAJA 1CURA 5LUMA 3T04D 3BJLA 2JCCA 2XVBA 4G6JL 1MREL 5HHNB 4JRXD 3B9KA 5F1IB 5FWQA 3TIEB 5HVHB 2NY4C 4YN3A 1LMIA 4AMKL 1IGYB 1NCTA 5I18L 5DTFA 4KKAC 4DK6A 3US1A 3VH8G 4JDZA 5C0IA 4NI6A 4OZIF 1UXSA 1IGJB 4NPJA 4U33A 1KYOJ 3AY4C 1LO2H 1MFCH 1HQRA 2PCFB 1AE6L 4KXDA 4OLWH 1WHPA 2QQNH 2JE8A 4NNXA 4TULH 4RWYH 3TA3B 2P80D 2F53D 4QJ4B 1RU9L 4ELMF 2A3TA 4HS8H 5C0BD 1I3VA 5IFHL 1ILUA 1OGSA 4MQXD 5FCUH 1G9NH 4OSUH 2E27L 4YDKL 3NCJH 2H6UA 3RU8H 3KPQB 3HUJA 1FBIH 4ISVB 1YC7A 2FQEA 2G75B 4GKNA 1UQSA 2ATKA 4WWKA 4XC1L 1AZNA 3V6OE 4MMYB 1RJZA 1O9ZA 2AJSL 1DQML 2RGSA 1SEQL 5D6CA 3H6JA 2X0WA 5F7EL 2BJMH 1DJXA 5CZXC 5L0QB 1AC0A 5D1ZC 3FN0L 4PJEB 3JUYA 3L5WB 3Q1EA 3WS3B 4FLRA 5I8KH 4LP5A 2WBKA 3DX4A 4YFDB 4FABH 4U1MB 1NMCC 4ZMXA 5GRVL 2DQEL 2YD0A 4WJG3 2OMWA 1ZEAL 4XBGB 1ZY9A 2NRDA 4NWUL 3RZCB 5J13B 5T33H 1B0RB 3LEXA 2FGWH 2EXWD 43CAA 1WWAX 2WUCH 5DCCA 2IF7A 3HPJB 4XE0A 2EDOA 3WENA 4U6YA 3U46B 5T1LB 4UV4H 1LGVA 3OR7B 2WK2A 1LNUA 3F7VB 1PD1A 1IC4H 4LNVA 1T22A 4I1NB 2R29L 2YPLA 3EOAA 3LQAH 2E3VA 2DTML 4FG6D 4L23A 2NTFA 4P46C 6PCYA 5JPMA 1NBZB 4HBCH 4ACPA 3QZMA 3KJ6L 3INOA 4WUUE 1FFNB 2B5IC 1HNYA 3NESA 2X42A 5IB2B 3EZJB 3DO7A 1QSEE 1R34A 4H20L 1TFPA 4DGVL 3TT1H 1A5FH 4Z23A 2NUTB 3D4ZA 3ZDZE 3QFDB 3QXAA 4NRZB 3O0RL 4ALAH 2WOYA 3F7LA 2WZPA 3VUAA 4QY8B 3ZQXA 1BQHA 1F6AA 5F1KC 4BFEA 1ZVSB 1IAIL 2ZXDA 2VC2H 1KTCA 2DWXA 2M83A 1G4RA 3B3BA 3PAUA 5CZXD 5SWQA 1ZVHA 2AS5M 5DQDH 4IQHA 3NUKA 2X2UA 3BZDA 1T3FA 2ZCHL 3IF1B 1G5AA 2ZXGA 3BCFA 3MLWH 3FT4B 3QUXD 4LOFA 2M2DA 3IKCA 4L8SB 5IMLA 3OHXC 2EH7L 5BUAA 1JJUA 1XFPA 1JUFA 4QHMB 2E0PA 1RURL 3G6DH 4G3YL 4W4NA 3G5YB 4PJGF 5IVXA 3Q8AA 2QVTA 4X7TB 1OARH 5ANMA 2D0HA 5GJSH 1ZHLB 1TZGL 1E4JA 4U1KB 1T1XA 4MJ5B 4NN7B 5D1QE 3DX3A 1PFCA 4NXSA 3BQUD 2YRLA 5EORH 4OCWH 4ELMB 1G4MA 4OTXH 4PWJA 5D1ZB 4HJIA 2EDFA 2ZOOA 2BXYA 2GSIA 4I48B 1QLEB 4UIMB 1XL6A 2D03H 4EJ1C 3ZDZF 2H26A 3B5HA 2Q9OA 1B4TA 1D5IH 3G5ZB 4N2NA 4ZT1A 4EUPB 1QEWB 5DDHA 4NN6B 1ESOA 4HETA 4HKZA 4XAKD 4HH9A 1WVZA 3PPEA 4Z3FA 4L8CA 1WZAA 1S7QA 1KXTB 1AY1H 3RFZC 4ODVL 4KH2A 1WGOA 4JREC 3NGBC 4Z3GA 1D5BA 2VR3A 5C0NC 1KYAA 4MXQD 3RGBA 4MB1A 2PXYC 3FS9A 1AQDB 1J5HA 2VW6A 3EJYD 3LZFH 1DJIA 4V1DE 5IW3A 2EDRA 3G04B 1YNLH 3OKKA 1JGDA 2P4AB 3QJHA 2H6PA 5J6HB 1A8ZA 2QR0B 3L2LA 3QUMB 4XVSL 2VWEC 1X5AA 1UXSB 4A7TA 2CE6A 4AG4H 4APXA 3LZPA 1N3NA 3BP5B 4X83A 1HAWA 1CL7H 4P5TC 2HJKA 1GS8A 1WITA 4PUBL 1AYRA 3WY1A 1OEZW 1A65A 3HG3A 4E36A 1HCVA 1U4FA 3OX8B 5JR1L 3RWDA 3P11L 5F0LB 2D7TH 2TSAA 1QA9A 3G08B 3QZWG 5F44A 1MFBH 4XNXH 4O9HH 2GAZB 2QVKA 2YK1L 4L1SA 1D5XB 4LLYA 5AB2A 2DWDA 3KYMB 5ITFB 1XR9A 4AYGA 3V95A 4EI6B 1LK2B 3L1OL 2X7LB 5I1AB 3IJ7A 4L37B 3RWCA 2WGXA 4Z3TA 1A3QA 2PCXA 1U41A 1MCBA 3WKYA 3U1PA 1SMDA 4KKLD 4MJ6B 1MFEH 2ZUQB 1VFUA 3D85A 1FSKC 2ESVD 4O2EA 3QXDB 5IMKA 1Y6NR 2A6JB 3PWUA 4PAZA 4GLRH 2B8OT 3BUBA 3GBNL 4U49A 4KK8C 4JRYA 2FE0A 1A1OA 1GZPA 3WXVL 3ZT6A 3H9SB 4GOSA 1SRDA 4TNVF 4JVWA 4GLRI 1BVLA 2BHFA 2Z4TA 5C07A 3F7VA 1GPOL 3C6SB 1EJOL 3W37A 2MOGA 2G5UA 2XVGA 1XBDA 1F4HA 3AG1B 5EOTA 3WIFA 3QHTC 7FABH 1TJGL 2VJ0A 3QG6A 4WO0A 1F3RB 3CXHK 3IN2A 2HX7A 4RAUA 1HZKA 3FO2A 3GMNB 3X3FL 3EO9L 5E6UB 4Y19D 3VXMB 3U83A 4JQIH 2J4WH 1HESA 3SPVB 5F9DC 2H47C 1JF5A 2CR0A 3AM8A 3D09A 5GPRA 2APVA 1QQDB 2GEEA 3C5SB 3JV4A 4PRHB 4C4UA 3ZRSA 4H25B 3OLDA 3VI4A 4MJHA 2ZF8A 2DIJA 5AALA 2DQIL 3FMGL 1JGVL 1ZANH 2EYTB 2HJLA 1CDGA 3WS6C 4Y16A 4NN5C 3FTYA 1YN6A 4N22A 2CO3A 1FZOA 3SSGA 2CBQA 5KWYC 3PABB 5CEYB 4LARL 1D5ZB 4PTUB 2XFXA 3MV9E 1S5IH 4EIUA 1OGTA 1AY1L 2WXPA 1ZT7B 1FNSL 4NQCB 5IB1B 2IH1A 3P77B 4MA8H 5EU3B 2QPFA 5J1AB 1MW0A 4GQ9L 3RAJL 2NY6B 4JLRA 3IGAB 3GWJA 4WK0B 4WTXA 4BJLA 4X5WB 4BFBD 4KVCL 3ZL1A 4FZ8L 4I0PA 5CS7A 1J1OH 1GGBL 1MCJA 2NQDA 2NX5E 2L7UA 2W0PA 3W9DA 1N59B 3IDYB 2GIMA 1UZ6F 3OKDB 4YH6A 3RFZA 3SJVB 1WZMA 2J6EA 3UERA 3WTYA 2OL3L 4LLVB 1S3RA 4YXLH 2BWIA 2R1XA 3I6KB 1L0XA 4KHTL 43C9A 3FQWB 2CM6A 3UTSE 3RWHA 4D0BA 2OLDA 2ZOLA 4JO2L 4K7PX 4TSAL 4XZUA 5HDOA 5IQMA 1A9VA 1U8PB 4QNPE 5EZLA 4IM8A 5DS2A 1Z9OA 4L4TE 4PRDA 3X14A 1WD9A 3HE6D 3DYMA 3OGOE 1PX4A 3EO0B 5D5MB 4DH2A 3RIFF 1MIEL 2CHZA 3UAJD 1BQLL 4A6YL 5ACMA 5I5JA 3VM7A 4JHAH 4IIQB 1ZLWH 1RPUA 1E43A 1MQ8A 3LQMA 5BS0A 3QUYC 4WUUB 1SJMA 2AEIT 1QBML 1EBPA 3HZVB 1O6VA 1GYVA 3H3PH 3O2WH 1QABA 4WW2A 1MQKH 1AQHA 1DEEA 3MHZA 4KJQD 4WO4C 1HJCA 3ERXA 1L9SA 1GS7A 4P2AA 4P4KD 3WU1A 1U36A 4HJSA 4F80A 2JCCB 2PW2A 3FQ4A 3VM5A 2CRMA 1JZHA 3E2HB 4EO5A 2UXGA 3OKKB 5I1LA 2DJ4A 4DEPC 2YFNA 1KELL 3NA9H 5AKVA 4PGJA 4M5TA 1T0MB 3VXRB 3OV6A 3ETSA 3M86A 3PGFL 4AL8C 4M43H 1R46A 3U4AA 2MQCA 1MSPA 4I88A 4L5FL 3NN8A 2QVIA 4PJEE 2BSCA 4F8NA 5I1IH 4DP1X 2GTZB 1OQXA 2VQTA 4M1DH 4YZWA 3US0A 2UXVA 3QI9B 1A1MB 3BAIA 5MP6H 4PLJC 3VFSB 3L3IB 3CVIH 4KDTC 1P7BA 3Q48A 4XHJD 1MAML 1OE3A 3UJJH 4XPTH 5T33L 5C7XL 4MMYA 4DUXA 5HVFB 5D5MF 5L4FA 5E2WH 5BZZA 1BD2B 1OY3B 1QNIA 2DQEH 1OTUC 1XXFC 1KB5L 5KYXB 1AGFA 1PMYA 5I8KL 3VXNA 1F8TL 2F08A 3WS3A 4BFGA 3ZHKA 4HHAB 2IV9A 2E4TA 5F97E 2V9TA 5GS0D 2WTOA 1BLNA 5DRZA 1BJ1H 1EGJA 3BC9A 4PYHA 3NIGB 4YBQD 5BOPA 1L6ZA 3CG8A 4XC1H 5CGBA 2K0RA 5A6LA 4P5RA 3LX9A 1GVIA 2FIKA 4K0OA 5DEFB 5DFVC 2AGJL 5BW7A 4AEEA 2XXMB 4QRBA 4MAUL 5E6ID 4NAMA 3M7FB 5C3TA 5BRZA 1U92A 3QPQD 2XN0A 2YD3A 1XGZA 2UWEE 2H2PC 1Y0LB 3U2IA 3G6JB 1QACA 4HCIA 3QG6B 1CK0H 1SYSB 5AOMA 1N6QL 4NLHA 1FNEA 2D2OA 1IAKA 3E7JA 3ZHDA 4PJ7F 5SWZA 4JQXA 1TTBA 1SVCP 3LRGA 1WEJL 2QZ5A 3SPVA 4AQAA 3OAZH 4PCSA 4NPYA 3ATFA 3MROB 4QNPF 3X1GA 2DLFL 3QRGL 5C2UB 1Z9NA 3Q3GB 3QJRB 4F8OA 5E9DB 1NGPL 2DKMA 2P47B 1NFKA 2NYZA 1HKLH 1MREH 4XP1H 4Y9BA 3VCLB 2G2PA 4KKCD 3ARFA 4J12A 1MW3A 3GKZA 4FXKA 4NBYB 5G5DB 4PJCA 1NBQA 4XVUD 5SWQB 4OF7A 2FJHA 4DT2A 4YLCA 3KPLA 5J1AA 3QRFM 1U8NB 4P9HL 3SY0A 1OW0A 3VG0L 5DI8A 2F5BL 1OQOA 3NRFA 4LVNB 1Q90A 4XCNA 1FHGA 2K7QA 1YPZE 4PJIE 3I2CL 3ZJAA 3SDXE 5KZCD 3JYBA 1Q0XL 1HYSD 3T2OA 4U6VL 5BRZE 3V6FA 1HS6A 3APDA 4LQFL 3FRUB 3UAFA 4IKNA 4R0LB 2ETWA 2W80C 3OSVA 3IK2A 3SOBH 1OLLA 3OJDB 4TTGA 4U1NB 2G2NA 1RVFH 2EO1A 4LU5L 3RVVD 1GTNA 1DE4B 5D1ZA 1BAFL 2NY4B 3U1SL 3X14B 5AVUB 2IPUG 4IOFD 3KE0A 1QHOA 1NICA 3EDDA 2QSCL 2NY0C 2DM7A 2JXMB 1MHPL 1R3LA 3Q2CA 5CO1A 3VGAB 1XGUB 3TBBA 3ZU8A 4TUKH 1PYWA 3CXFA 3KYNB 3IVKB 2WCPA 3ALXA 3ZE2F 3QDMD 4MZIA 1BVOA 1RIVL 1FIGL 2MH4A 3TA3C 1TYJA 4XCYB 4X8XA 4BFFA 4R4FH 3RWGB 2GJ6D 1CU4L 3QQ3B 2YMXL 4P2OB 4RWHA 2QGCA 3MOBH 3RWJA 1F1AA 1OOWA 1J12A 3L45A 4PWHA 3NRQA 3ZKXB 4HU8A 1EHXA 1ZJAA 3LZRA 3IT8D 3W0WA 2V9RA 3CU1A 5DMKA 2CDGB 3MREA 4RESB 1ASOA 1HE7A 5ITBL 5GS2H 4RZCA 5DK0A 3WTTA 2A77H 1HYSC 3VGAC 2OMZB 4JHWH 5L0QC 2JNZA 4PJ5A 3BPOC 4XMWA 3MLZH 1IBYA 4IEFA 3PDOB 1UYWL 1R3KB 3V5DB 1DDHB 1OAZH 3FT2A 3HN5A 3UPCA 1BX2A 3AS1A 3GYRA 1A4KA 1LK3H 2IDUA 3IGFA 4FE9A 3K6SA 3ARDA 4LQFH 2FH6A 4B5EA 3H9YA 1G9HA 3UBXI 2FQGA 1QRNB 4FNUA 2K6ZA 5T3ZE 1FZMA 5I1JL 4PU2A 4X80H 1QFHA 1BW8A 2FX7H 2X4RA 1FE8H 3KEHA 3WOVA 1DQDL 5IP4A 5DYFA 5KBKA 5AW7B 2EIDA 4P99A 2F5BH 2OSXA 5BZDA 3TA4D 3MRCA 3EG9A 2K8MA 2HG0A 1SM3H 1AAJA 3KGRA 1UG9A 3EJZC 5HDBE 5JDSB 2XPZA 3W5MA 4K73A 2NDGA 1LM8V 1XZ0A 3D39E 4ZW7A 5CU9A 3MUGA 5ESAB 1CDYA 2P24B 3B1TA 2J56A 1FUNA 1DVFB 4OLVL 5BQ7B 4XMKL 2C9RA 3VMOA 5B8CA 1YPZF 3HC4L 2HFEA 3PS6A 3WIIL 4G1EB 5IIEA 3FTUA 3KVDD 1SXCA 5DUPH 5KVFE 4HPHA 4LOUC 5EOTB 1WQVT 3HZ3A 5DT1H 4DPBX 4P59H 4W70A 1G0DA 2ZG1A 5F71A 4WEUD 2KZKA 1NUFA 3F83A 5FYJL 4DGIH 1NC4B 1EAQA 4KGJA 4TUOA 2F7RA 3LXUX 4M7ZB 2FB4H 5F3BA 2CJTA 2WKOF 2WLIB 4I9XA 1QQDA 5I5IA 4PJBB 4FP8L 4MAUH 1T20A 3CUPA 4FKHA 4HMCA 5G4OA 1WA1X 2XQBL 1NL0L 2WWMC 5FYLL 5AB9A 1OAUL 4WU5B 4JFWA 2CDFB 3THML 1O7SA 4DGYH 1RUAL 5E99H 3SDCC 1OTTC 3U36B 4FXKB 2CHNA 3DX7B 1MJ8H 2HLFC 4PJCB 2M1KA 5EMYA 4JZNA 5CZVL 4QIRA 4W1TA 4BSWA 3H54A 5IZ7A 2EVIA 4DN3L 4EOWH 3A6OA 4PIBA 3VI4E 5KVDH 1Y18A 1G7QB 2W9EL 3BH4A 4S1SL 1TEFA 3LRLA 2KHAA 5ELIA 3AWGA 1UXWB 3CLEH 3LZLA 4QRQA 1QKZH 1DQQB 2J43A 4U3SB 1W91A 3VFMB 2DF3A 1EHLL 5E9NA 4ZS7L 4BH7A 3OKDA 3RFZB 4JFPA 1JXKA 4ZMNA 2VRQA 4GBXB 1JYVA 1T80A 1L0YA 1UH2A 5GGSY 5GS2D 5GGSA 4YZFF 4YXHL 1JGLH 4MLIA 4HJGA 4QUOA 3TVMD 4ZMWA 1MN4A 2TSBA 1UCTA 3WLBA 5JW4M 4YHYC 4XO4A 3ARED 2JI1A 2OX5A 4NZUH 4QDGA 4TLKA 3IJHB 2F7PA 1T2QL 1F4WH 3F6LA 4WWKD 1ETB1 2JMRA 4U4IA 1KIPA 5F7NC 3M1BB 3TESA 4E0RB 4XGZB 3BLPX 3IM1A 4PWKA 4AV4A 3UPRB 1ADQH 4ZNEE 1XSKA 1VSCA 3FRPA 1D9KC 5A2FA 3DI3B 4MLSA 2GBAA 1D2OA 3GMRA 4LEOB 1YN7A 2ED6A 4LESA 3LKPB 2FCBA 1G7HB 2P5EB 3LEYL 1GAFL </