2EUWA

Structure of a ndt80-dna complex (mse mutant ma4t)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*TP*CP*AP*AP*AP*AP*AP*C)-3'
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
total genus 88
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2euwA00
2EVJA 2EUXA 2EVFA 1MNNA 1M7UA 2EUVA 2EVHA 2EVIA 2EVGA 1MN4A 2EUZA 2ETWA 2EUWA 1M6UA
chains in the Genus database with same CATH superfamily
3LS5H 3H6JA 3EJJX 2XUWA 1SQ2N 4PCSA 2XZAL 5IFHH 4MMYB 4W9KC 5L88L 1HNGA 4OLXL 3HZYB 3EO1B 2VRKA 4N2BA 4Z3TA 1OTTC 4HWZB 4HH9A 5FV2A 5IEKB 4YXHH 2IAAC 5JNYB 2XN9B 3FO2B 2J21A 3WIHH 1YEJH 3HI1A 4NUJA 4LBEA 3CN3A 5DFAA 1KFAH 2OI9B 3BUIA 1A66A 3L1FA 2OL3L 1KWGA 5HHOA 3S88L 1I82A 5L4MA 1KC5L 3M86A 2NDFA 3VFSB 4M6AA 5KG9A 3L4ZA 4ZDHB 1OQOA 2QDWA 1HIML 2R4SL 1FPTH 2MEJB 3C60A 3GB7A 4MXVE 1A7BA 1CTMA 1XL6A 2NX5A 2ZX6A 4QXVA 1SEQH 2IQAB 2NY4B 4P5RA 1V3KA 4NRXB 2E3VA 5IJDC 3FT3B 3QR2A 1K9TA 1QO3B 3QEHA 2DQGL 4NZTL 1BW8A 3KCWA 2R51A 3B2UC 3VXTA 1JS4A 5DA0B 4NRYA 4ZAKD 3HFFA 3HMXH 3NAAL 3N50A 1I1AD 2A9AA 3DARA 4YGVA 4XP4H 4E9WA 3U4AA 1TFPA 3L3KA 3PL6D 1YEKL 5B8CB 5IHWA 2NW2B 1F90L 3E1F1 4OGYL 3FTGA 4G9FE 2YAHA 2IANA 3ARFA 1OP9A 5TTRA 2J1XA 1L5GB 3UAJC 4ZFGL 4LIQL 3TT3L 4HXAL 3G9VA 4YGAB 3GZPA 1SXCA 4WSKA 4XNXL 4HJSA 1A6WL 4PJ8B 3VGEA 3RX5A 1CYGA 1QFPA 5F97E 1E43A 2GJZA 2ED6A 5B1BB 2VMFA 4WU5B 2X40A 4O02B 4ISVB 3QZBA 5F9OH 3ROLA 1DEDA 3HC2A 2CK2A 2WCSA 4HX1B 4IRSA 4N0CD 4HC1H 2WSKA 2GUOA 3HAEA 4FYSA 5DD0H 3MCKB 3N42F 1BF2A 3MLUL 3QPQC 4UIMB 2IGLA 2I27N 5E1GA 5E2UL 4MS6A 5D71L 4M7JL 4NQDE 1YO4A 1OAZL 4UM8A 3V6OC 3IDNB 3W2DL 5BW7C 3FQUB 1A1NA 1OD7A 4BA8A 2G5UA 2GBTA 3U7WH 1CIUA 5CBEB 2KDGA 1GMIA 4YDZA 1OGPA 4GG8A 1H3TA 3NJHA 1EZVX 4HUWA 3N04A 5T33L 4LCYB 1E9PA 2VERN 2I9LA 4TNEA 4J1UA 5IMKB 3HI6L 2J72A 3TEWA 3O4LE 4OY9A 4YIQA 2NOYA 4FYRA 5F89B 2JLLA 4OZHA 4TNWF 4LVNB 1T0NA 4RGNC 2A6KA 1F4WL 5DI8B 1K4CB 4IHOB 4MZIA 4Q6YA 1YQ2A 3H9SB 1WYJA 4G6JH 5ETUA 4Q9RL 3FQ1A 1XGRB 1QPKA 1W72H 1FH5H 2F5BH 2LU7A 3J27A 4FLSA 4FFZH 3LB6C 2XXCB 4M5ZL 5I1EH 5DEZA 2VXTH 5I8OH 4LSQL 1VKXB 4JAMB 4AYMC 3PREA 1NCGA 3WL9B 1X7QA 2Y7NA 1A9BB 2K4WA 4ZUUA 2VR7A 4NIYE 1YNTB 4LL4A 3OLEA 5I1AB 5IG7A 4NUGL 4XB7A 5LAXB 3U9PL 5ALBH 1YN7A 2QVFB 4OCYL 1O6VA 3H7BB 4MA8L 1D5BB 3HPLA 2G3MA 4S1QH 5E8DH 1CT8B 5KBPA 2B08A 2CIKB 4WAFA 4DHLA 4XMXA 4DP2X 1IAKA 3V0WL 1FNGB 4J8QA 5AWNH 4DKEL 3G04B 3PWUA 2EEAA 4TKWA 1CBJA 2Y69B 3NJNA 4WJ5A 3HZKB 4M48L 3MR9A 3X3FL 1BX2A 2JKNA 1EFQA 2EKSB 4OT1H 3UMTA 2CJUH 5C0BA 1GZHA 2YD2A 1M7UA 3SDYL 2WMPA 3I6GB 5A7EA 3IVKA 3CPLB 3U0WH 1FV1A 3L4VA 4L18A 3QDJA 2W60B 4FFYH 2Y3NA 3HG5A 4X4YB 4K15A 1KB5A 1S78C 1YEDB 3TTYA 1KB9K 1CE1H 5C70A 1OW0A 5I16A 1OAXH 4MSWB 4MYWB 4YDVB 3FCTB 2DQTH 2YUVA 4PRNA 3ZTCC 3GXFA 1W8OA 3MXWH 3X12A 5KW9H 3F6IA 5C08A 2VC2H 2ZP9A 4KJPC 1A3LL 1AZBA 4APQD 1DJHA 3HMWL 1F13A 4J6RH 1PEWA 3BZ4A 3KVQA 1T2JA 3HCVA 3VH8A 5SX4I 4JPVH 4WO4C 5AAWC 3SDXF 2A9DA 5ISZB 3VXUD 2HRGA 1CDUA 1E27A 4LOFA 3VFWA 1PLGH 2E9IA 2ZF8A 1U41A 2O5XL 3K2UH 3ILQD 4UQ2B 5HBBA 2NYYD 2XN9E 5EULV 2CALA 5TK4A 4MMXA 2BWDA 2DQDH 4RFNC 1QRNA 1AQDB 3FAWA 5IOKA 1GL4B 5EBLA 1G7LB 4UCFA 3MNWB 4DNLA 1UM4H 2HT4D 1XGYL 1CB4A 4Y19D 2F0CA 2OA9A 4DGIH 2XTJE 4S1DD 1M7IB 2SEBA 5FEBA 4OF7A 1ITCA 4NQXA 4M6MH 2J20A 1DVUA 3JZYA 2NUTA 3WO4C 4MNQB 4JEGB 5EEWA 3MMEA 4PRPD 3VD2A 2EXWD 2IO5A 3TJEH 3O2VH 1UA6H 1KULA 5C0AA 4QKTA 3W11D 3WNNA 4EN3A 3QR0A 2W91A 1FL6B 5G55A 5DJAA 1TETL 2KT6A 2IPKA 3H42L 3WNKA 4CDGC 5DMYA 1U21A 3HG0A 1SJHB 2BOCB 2F74B 2XV3A 4GG6F 4R0LA 3RKDC 1XHHA 1A5FL 5CP3A 1E3XA 4G8GB 5FUCE 2DEXX 1NC2B 4XE5B 3QUYC 4S2SA 5T1JA 4AYBA 3E7JA 3RNKB 3BKCL 5IEHB 1RIVL 2HN7B 4OBRA 2EE3A 5IB2B 5DJZB 2ETWA 5EPMB 1OAQH 2X28A 4U3SB 3STLB 3PYCA 3ZYIA 3MSPA 4JX0A 4KRMB 3QCVL 3UZEA 2WXRA 3FN9A 2B9AA 3KR3L 4XCNB 2X42A 4AMKL 4M1DL 4NN5C 1A7QL 5BRQA 2IPUK 1FHNA 1NC4B 2NNRA 3QCTH 1NCDH 3PG2A 4NFBA 5I5JA 4HOMA 3IAGC 3JV0A 4N0YL 1G0YR 3QDMA 1SOXA 1V7ML 4MLSA 3S36X 1RVFH 5SWSE 5DHVA 1CXEA 4WHYH 1XBRA 3VFUA 2HWZH 1JVLA 1D7CA 4EBQL 1CLVA 5HVHB 4YBLB 3M17A 5EO0B 4JDVB 1TZ8A 3GO1L 2IH8A 5I9QB 4BZ1L 1C7SA 1JYXA 4JUTA 5HHVL 4NDMB 1ZVNA 3UYRH 4Y4FD 4OD1H 5KTEH 4DJMA 2LVCA 4A2DA 1KJMB 2GTWB 4ONGH 2GTZB 3TA3C 1KIUA 2GI7A 4PY7B 2HLFC 1NBVH 4OKVA 1A9VA 4LSSL 4Q0XH 4IHBA 1H6UA 1NIAA 2ZG2A 3AWGA 4XO9A 5EN2A 1X4ZA 4PJCA 3H9SE 2J7LA 1KENH 5E7BA 3FN0H 3LEVL 3TYFA 4X6BA 4C58B 3A22A 1IBZA 4ZFZA 3TZVD 4ZD3L 2XWEA 5DQDH 2O61B 1UA3A 2VDKB 2VGLM 3BAIA 3RWHB 3DPBB 3I6KB 4YEFA 2VZUA 3GXUB 3JYBA 3W3BA 3ZL4H 3T2NL 4GEJA 3P11H 5KOMC 3BIBX 1N0LA 2OZ4L 3KGUA 3MROA 4HIQA 2NY5H 4IBZA 1ILUA 2ZOKB 4PP2A 4NS0A 5CEZL 4LF3A 3EZJB 1Y18B 3K8KA 3OKLA 3FB7A 3L4UA 1XTMA 3IXTB 35C8L 4PB0L 1JZHA 4Z23A 1NFDA 5F7UA 1BBDH 1PMYA 4QTIH 3BAWA 1EX0A 2NX5E 4M4PA 3CIAA 3LH8A 4HGWA 4WGKA 2ILLA 1QATA 4A7GF 1AP2B 4PUBL 4Y5YB 2BNQD 4B60A 2W9EH 4TULH 3ZHNA 1QLRB 2EYTA 1HH6B 5ESQA 3RFZB 5IMOA 3QC6X 3K5SA 4JUSA 3GMOB 5AZEL 2RQ8A 2EVFA 2V8MA 3CU1A 2A4ZA 3EOTH 1KCUL 1HL5A 5I15H 4TLSA 4P23B 4BWUA 2QVTA 4L5FH 2I60H 2IAMA 2JI2A 5JW4N 3GXMA 8FABA 2KL6A 1MQ8A 2NY5C 2P28B 5FAAA 2VISA 3KPQA 2EH7H 3C5SB 2TAAA 4JFHD 4FQLL 1LD9A 3VWJB 4XPFH 4DOHB 5EOTB 4K2UH 5TE4H 4R7DB 3ZUNC 2WVUA 4ZMVA 1T21B 3UBGA 5HDQL 2V2XB 1ZPUA 5BO1L 4XBGB 5AAMC 4E0RA 5I1JH 1CDCA 3O6KH 3TVMC 2XG5B 3MN8A 3U2SB 4HJGB 3Q3GB 4U1GC 4FG6C 3RZCD 3VWKC 3W9DA 3WN6A 3VD4A 5SWZE 2P7TA 4DPAX 5GSRB 4R5TA 3RWFA 3ZVVA 2CDGB 4ZXBC 3NRPA 1QTPA 3N9GL 2G3XA 3FHAA 3LRMA 3MLTB 1PNDA 5EFIB 2WUCL 3FO1B 4LGPB 4LQFL 3SD2A 2CK0H 1AY1L 1QW8A 3QIWD 2X6CA 4M6OL 4RMRA 2JJUA 1XCQB 4PJ7B 4EI5D 4PJGF 3GSUA 4OZHE 1X5FA 2ZUTA 1OZTG 4OCSL 5DSCB 3ECUA 1AFVL 1KPVA 3NFNA 1BJ1J 4G8AC 1S9KC 4J2XA 5A6IA 1MSPA 4OAWA 3F58L 1AI1L 3WIFA 1RURL 1FYTB 5AAPA 3A24A 3MVSA 3LJ3A 2PWHA 3OR7A 4O2FA 5T1KA 1UASA 2GSMB 4KI5D 5IMMA 5E6YA 3HR5B 4YL9A 2J5WA 3T4AB 2GHWB 5I18H 2NY2D 2CM5A 3KYMA 2EDFA 5E51A 4KTYA 1LEKB 3S3DB 3KLHD 1ODUA 4YHML 5GZOC 4ORZC 4Y2OB 2D0HA 4FHBD 4JO5A 4FD0A 3RB5A 3V4VH 3U79A 5D6DA 2VR8A 1CR9H 3CHRA 3FUJA 4JQIA 4CILA 3LKQB 3DX9B 4O02L 1BZOA 1IM3D 1M4KA 1CDYA 2W8CA 3EYOB 3KLAA 4WI5A 4BKLA 1MJUL 2GC4C 3VM5A 1HINH 4CJ0A 1WFIA 5BXFA 2OYPA 5DEGA 5JPNA 3FU7B 3I84A 4NYLB 5DJDA 2A9NL 2YUXA 5EIQA 3EGSA 2JWYA 2YBRB 3NJLA 3O3AA 2EDNA 4ZAKC 5BUAA 3R1GL 4JFYB 4ZYKB 2V2TB 5ECGA 3EHBD 1VDGA 3WCYA 5C0BE 5DK0B 1IC4L 1XSOA 5CJXA 2IDTA 1KB3A 1P7BA 4XXWA 4KZEH 1IL1B 3MLVL 3OZKA 3QDJE 3O6FC 3WFBH 4OZIF 5K1VA 4K55A 4RFOL 4AV0A 4WHTA 3ALWA 4ZFOL 5DD1H 5CD3A 4GSXA 1EH9A 5CF3A 5EU5A 1MREL 1EXUA 4Q9BA 2PXYA 5C08E 3P0VH 1I4FA 4XCYA 1R3KA 3K4DA 3UTPE 1BD2B 2CKBA 4G82A 2FL5A 2OTPA 1FVEB 2OMWA 1L0QA 2X88A 1MHHA 2DMBA 2B8OT 4DKAA 3P73A 4HMEA 4KZDH 2AAVA 3IPFA 1LO0H 3ULAB 5DYOA 1A6ZB 4EVNB 1A4JA 5F8QC 1H3PL 5JHLA 2CHNA 5FYKD 1QRNE 3TOPA 5JHAA 1D5XB 3ARYA 5I19L 4X83A 3GXDA 1CD9B 4LKXA 3LXBA 4X0KB 1FG2A 2QL1A 3APDA 5KSAB 1KGXA 4P2CG 3IMSA 3ELQA 3RA7L 2OJZL 2FJGB 3F5WB 1MEXH 1RIHH 3IPEA 1YPZF 1UWXH 4XMWA 3QUKB 5CJOL 3RI5F 4CL7A 1HJCA 1DVFA 5I73C 1J8HA 1HZHL 1L7TH 1P1VA 3CZKA 5IBLD 1H8LA 3NK4A 1PLBA 1K3IA 3FOMA 4M5SA 4TQ8A 1KJ2H 4HS3A 5D1ZI 1FJ1A 1KNOB 3DUUB 5C0AE 1IX2A 1X6LA 4LSVH 3IMTA 4W9HC 1Q9KA 5DR5L 5B1JA 4ODVL 2OR7A 3ZZQA 3TESA 1DQML 1T89C 4PJIE 2F8OA 3K91A 2EJ1A 3E8VA 3LMJL 4U1JB 5FGRA 3TXAA 4LHUD 1V5JA 3DBSA 1P4UA 5GGSA 1I8AA 1ZEAH 3IDIA 3GXPA 4FG4A 2VR4A 4XO5A 2WO2B 3Q44A 3L4TA 3B83A 1RUML 4FQ1H 4K9JA 2MJWA 1KYOJ 1G1CA 1EAOA 3CU7A 5GGVH 1ADWA 1TNMA 5IHUH 2A73A 5AB1A 3QDGA 4U6XA 5FCUL 4M29A 2PR9A 1NLBH 1XWVA 2M83A 2X53A 4KGLA 4NENA 1INQB 2HJKA 3RDJA 4ES8A 4KDTC 4HK0A 3PNWA 1JAEA 2Y6TE 2IGFL 2ZX5A 4JNXA 2FQDA 2NZIA 3QDME 4XMKH 4GXVL 1MFAL 1OB1A 2RTTA 5G5DB 1AANA 4DAGL 4WW2C 3ZGHA 3UP1A 3UGUA 4LPUA 3JVGC 1U0QA 2P42B 2IV8A 3CZNA 4JPKH 2BSBA 2H3NB 3SGKC 1ES0B 3L08A 3REWB 3PP4L 3HKFA 4OCRH 3LN4A 3CC5A 4R8WH 2OSLB 3ISYA 2H1LM 1HEHC 1YEEH 4UU9A 5LNEA 3KYNA 3QG7L 4Q9CA 3CCHA 2X9YA 2BOBB 4APQC 5ID0A 3H2QA 2ALAA 4DCQB 4KPHL 4GXUM 5JUEL 5HPMA 4LVOB 3I9AA 4UT6L 3ARDC 4RMSA 4ANKA 2XVKA 2GY7B 3NN8A 3GPSA 5D1ZA 5LDUA 4HHAB 4LP5A 3NA4A 4YDJB 1CWVA 3P40A 4HF5H 1PZUB 3C2AL 3QJHB 3ILQC 2NYYC 1TDQA 5DJ6A 3NIDB 4FNQA 2W9DL 1FYTE 4GSUA 4QT5B 4JZJA 2EVHA 3QO1A 1BM3H 4PTUA 5LBVA 5AD0B 2AQ1A 4YSDA 1QFUL 5T3XL 4F7TB 3CSGA 2LU5A 2AANA 3HFML 2QQKH 4U6VL 2HKFL 2HT4C 2WINB 4MS8D 3MUJA 5DC2A 3QQ3B 4ERSL 2QSTA 4S1DC 1KSRA 2YC1A 2W80C 4OSUL 5T3ZL 1AMYA 1PD6A 3DMMD 3D50A 4FQPA 5DVPA 1VPOL 3VFVB 3U1SL 1DJXA 4GT0A 1HKFA 2H7WA 3FOLB 2EXWC 3VGAC 4X6CB 5AUMA 4YFLF 3VO0A 4YSEA 1A3ZA 3ZL2A 3W11C 1XIWB 3VNZA 1BZ9B 1MDTA 3OJDB 2YRZA 4Q89A 5AVSB 3LNHA 4M93C 3NZHL 2BHZA 2VL5A 5D55A 1F4XL 5DMKA 3RPIA 4NPJA 1RZ8B 2FQEA 5DUBB 2XT1B 5B4MD 2CBTA 2NY0B 3Q1EA 4XOBA 3TIDB 4JFFD 4DP8X 3D0LA 1B2YA 3L3OB 4XMLH 4KWUA 4PFEA 5DZOA 3E2HB 3CPUA 4MBRA 4BFRA 2KKQA 3QORB 2DIAA 3NIFE 4Y5VB 1EEYA 4JQVA 4FTVA 3EJZD 5EBMA 4V1DB 3WTUA 2W65B 4P2OC 5AG9A 3FUEA 1FVCB 1RSFA 4JDEA 3IFLH 1N6VA 3E3QC 4QHMA 5EU6A 1WO2A 2PW2A 2AV7A 4ZX4A 4C59B 3EBAA 3KPRB 1T83C 2ADIB 2AERT 5AW5B 1GRWA 1E6OL 2COQA 4IIZA 2QQNL 1W0WA 3CH1A 3RY4A 4F37F 1JPGB 5GS2H 5HHQB 1HI6B 2XIIA 1ETJA 5BS0A 1T66D 1BZDA 4LNRA 4HPHA 3QISA 3WTVA 3CLFH 5T5FL 5F3BB 1UJTA 1TKWB 4IEFA 1T0OA 2AQ2A 4FG2A 4Y4FC 4DERA 3P4LA 1K5NB 2VH5H 1E28B 2B9BA 4JPQA 4LVHB 1NMBL 2OL3A 4UTBL 1CXFA 1TTGA 3SBPA 1ZHKB 1ZTXL 5IVXA 1IVTA 2O93L 3ESUF 4EI0A 1B3JA 1U3NA 4M7LH 4AVIA 2PCFB 5SX5H 3BHBA 4JG0H 5FFGA 4FFVD 4BQ9A 2M2DA 1CMOA 2UZYA 2YD3A 1KIQB 5KYYB 5CILL 2A6IA 1Y0LB 4G6FB 2E0PA 1FBIL 2JKWA 5HGDB 1DFXA 3L48A 3O9WC 4B3VA 3V5HB 4JDTL 4NNXB 5HP5A 1EJOL 1EZLA 4QHNB 3QEGH 4KTGA 4CNIA 3ULVF 5I66A 3CWGA 4GP5B 2GT9B 4JO1H 3O2WH 3BVUA 4F7KA 2GAZA 3IFNL 4XVTL 5GGTL 3SGJA 3NOIA 4IMKA 4JPWL 3A47A 2BINA 3OKMA 2PYED 2WTPA 1KT2A 2H8PA 3F01A 4G7YL 1Q0YL 3SPGA 5B21A 3JSSA 1VFBA 2FQFA 5D2NA 2QVIA 2XWXA 3TNMA 1RZJL 4QUOA 1OM3L 5GRWA 3VD0A 5DFVD 2D7TH 3DVNA 1OD9A 1LMKA 4WY7H 4AKQA 4PGDA 3G6JA 3ARGA 1XTLA 2UXFA 1EO8L 5DCCA 5B1CA 4ONFH 1FFTB 2AJYH 2TSAA 1GZPA 3Q2VA 1W6LA 4JHWH 2MH4A 1FIGH 2ZNXA 3F00A 4JG1H 2WLHA 4JHVA 4NO0B 1Z9NA 4Z0BH 4PJXF 4PJAF 1XB8A 5CN2A 4KXBA 5KYWB 3OJ2C 3BVNB 3B9KD 3DC0A 4LEXH 4X5PA 4LLMB 5I5IA 1T7VA 4O5LL 3TO4A 4F93B 4HHWA 4X4XA 1HHJB 5CJ8A 1S9XA 1QX1A 1GY2A 2CE6A 4MNHB 2ZXQA 2VN4A 5F9DC 3P30L 3ZPDA 1NUFA 3MC0A 5A2FA 3GLDA 2XZCH 1NOLA 5I76A 2Q7YA 1FFOB 1YC7A 1R47A 2P5WA 4UMSA 5GS1A 1II4E 5FYJD 3RZCC 4ODXA 5I5MA 1LDPL 2XA8H 1IBDA 3CE1A 1A14L 3JV6B 2RFXB 4CMMB 1ID2A 1MIEL 2IIJA 4OZFG 1GGTA 4NC1C 4G3YH 1ND0B 1EWHA 3MRCA 1ZLVK 4Z76A 2QJDA 3ATFA 5EBWA 3HS0A 4QHLA 1HT6A 1VCAA 4MWFB 4QYOB 1PYWB 1TVDA 2ADFH 3HR6A 3QNYB 4W70A 3A67H 3VJ6B 3CDCA 3QIWC 3RGVB 3HZVB 2QHLA 1J8HE 1OXYA 3OKDB 4EI5C 1EVUA 1J12A 2BWQA 3WSQH 5KVMC 1UD4A 4HS6B 4QRUB 2WO3B 1PDKB 3R7QA 3O3EA 4HFWB 3SE4C 4BFFA 1YZZA 2CBQA 4R2GB 2Z1KA 1ZE3H 3REVA 3ZL1A 3FZUD 3F7PC 1L7IL 3WEOA 5ESAB 4IBSA 4LK4A 2FH8A 3ILDA 1M1XB 2P24B 1UH4A 4KI5C 2IALA 3EYUL 1DO5A 2AMGA 2NUPA 4LCCC 2NY2C 2ROXA 3TN0C 4LLUB 3HG1A 1MF2L 2FEDC 2NXYB 1RIUH 5GGRA 2FEEL 4EPSA 4Z8FL 3DK2A 5K59E 1ZAGA 3IJYB 3FDWA 3EJPA 1VENA 2X4TB 1FE8L 1SEBA 4Y2DB 3U4EA 3MNZB 1JZ3A 1G7JB 4BZYA 4X9GA 2EDJA 4I9WE 3Q5TA 5I6XB 1H6FA 2VDMB 3QDGE 5E94B 1AQ8A 1MWAB 2C1PA 2YQGA 3AG3B 1XH2A 4AM0B 5FHBH 5JOFB 5FYKH 2WY3B 4LEBA 5A7BA 3KW8A 1QKZL 4MCYB 4S1SH 3U0PA 2GIXA 3EHBC 2Y07L 3AREC 3W0WA 1KTRL 1NGZB 1DLFL 1L9MA 3NPSB 1ZE3C 4MLIA 4D7PA 3QT2A 1KTLB 4RGMB 4OUOA 3AY4A 4XAWL 4ZUVA 3RGBA 1VACA 1WT5C 3QH3A 1UKSA 2ZJSL 3AB0B 2ORBL 3IJSB 3OV6A 1SYVA 2XFXB 2LT9A 3ARSA 1SOSA 5D7EA 1AG6A 3KPSD 3MUZ1 4M62L 3OC8A 4WI8A 5DDHB 2BVQB 5EU7E 3OWEA 5EZIL 5G4NA 5JW3H 2D3JA 3OAWA 3MOBL 1HSBB 4J3XA 4XZUB 4MQ7A 4KJQC 4PW4A 1TJHH 4Y9EA 2PW1B 1PAZA 4FHJA 4Y5XC 2YN5A 3HUJF 2Z34A 1FGNH 1FNEA 3JUZA 4WSJA 1OF2B 3L3DA 1HXKA 5KYXA 1A1OB 2GCYB 1V05A 5IV2A 3ET9F 3B6SA 2UY6B 2R1YB 5FUZL 2UXGA 4S0SD 3GS7A 2E74C 2X3BA 3VDCA 4K5PA 5CN1A 3KCPB 5D8JL 2QFPA 1TVHB 1LE5B 5LAPA 2VXSH 2H2SD 2K6WA 4GP4B 4ZBJA 1T7WA 2Q86B 2EUZA 4MJ6B 3LSOA 5B3JE 1YEHH 1A25A 4G5AA 4KTDL 3B9AA 5IBLC 5CZXD 1OGSA 3F6JA 2FBOJ 1ERNA 1KCRH 3INUL 4KKLD 3RTLA 4Y8DC 1D9KC 4GQ9L 4BQCA 5BUGA 2B5IC 5F7MC 5C92A 1R33A 2BNUA 1NBZB 2XPGA 2DKMA 3GHEL 1KLUB 3HE7B 1NAMB 3LKPA 3SO3C 3VG9C 2IEPA 4L9LB 4MMZC 1DBBL 1PG7W 2V6HA 4MAYA 4UUJA 4ANXA 1G7MB 3O8XD 4HK3J 1JWSB 3RJQB 3STZA 1NGWB 5TDNA 4ZPTB 3SE9L 1BJ8A 1KGCD 1A1MA 3WJMA 2ZX8A 4NZRH 4AIZA 4PD4K 4YPGA 1EJ8A 2WXJA 2ALWA 3T4YA 2CZNA 1C1EL 4M5TA 4NPYB 4X7FC 2PO6A 1TIUA 1ZWIA 1OSZA 4EZMA 2W95A 2VDNH 1NOAA 3IM1A 4UM9A 1BAGA 2JIXB 1JWMA 2XXFA 2YQ2A 4FTVE 2K9UA 2X6MA 4JFDB 5TE6L 3PDGA 3PHOB 4BZ1A 3VD5A 1HHIA 4P3WA 1A6TB 2DMKA 4YHOH 4TF4A 1PY0A 5IB4A 4U0QB 1UT2A 1J5DA 1FQ9C 1TZHB 1UB6B 3EJSA 3HRZB 5EU6E 5HYJE 1NANH 2XWDA 1J5OL 3IKKA 2AQPA 2Y22A 5DUPH 5IVNA 1DQJA 1P7HL 3NJGA 4A37A 3BGFC 2LLLA 4E42A 1EIBA 1SOKA 1HEZA 3QFJD 1RMFH 3MBEA 1CDBA 5BS0E 2IQ9L 3X3GL 3QWQB 3G5WA 1KBPA 3C8DA 2NXZB 4HLZG 5F7EL 1QBMH 5FKPB 2JJVA 2DI9A 1HSAA 2WZAA 5K33A 3D4CA 4JY5H 5J57B 4E41A 1GSMA 3VD3A 4Z77B 2OZ4A 1CFNB 2LLGA 1U8JB 2F2HA 3TBWA 2IC2A 4BCXA 1TVBB 5IVXE 4GMSH 3PGCB 1Y7VA 5DJYB 4ZTEA 2P46B 2ZWYA 5D7JB 1OTUC 1SJXA 1ZGLM 3SDDA 1ONQB 2UWEA 4G8IA 4OIAA 4QHPA 2P26A 5DTFB 2VW6A 1XGUA 3W82A 2VAJA 3WXWL 1KGWA 1P9MA 2NNFA 3LKRB 5L2JA 5I8CA 2WXPA 3IBEA 4JKPL 1RUPL 4MS8C 1S3KH 4JJOA 4QLRA 3BISA 3OKNB 4IOSD 4TUOA 3LQZA 3VFTB 1JHKL 5EOCL 3DYPA 3DMMC 2NW3A 1G7QB 3ESPA 3WN5A 1QSFD 1AAJA 4PJEA 2Q5BA 2OMUA 1M6OB 1EK3A 1JNNL 4KKPA 1GVIA 5IT2L 5J9PA 2P52A 3HZMB 4XMPL 3D3VA 4KNUA 2A83A 1RZKL 3CZJA 4UV7H 4HT1H 2EE0A 1B0IA 5D2NE 1OWRM 3GMNB 4NT6B 1MNNA 1CFQB 5KVEH 1OGTA 1K8IB 1XF2A 1SMAA 2NZ9D 2GFBA 3DROB 3G6JE 3KYKL 1R5WA 2PLTA 4FMVA 4X6DB 1IQWH 3H7LA 4PP1D 3GTVA 3EJTA 3F64A 1U8HB 1VJSA 2GSIB 4WEBL 4PEEA 1JHTA 1TJXA 3C08H 1HHGA 1SPDA 4RAUA 4WWID 4GAGH 1A64A 4IYKA 1MJ7L 4P4KD 3QJRB 1W0VB 4LSRL 4HIIA 3EJZC 1WBZA 4L8SB 1IB5A 1AOHA 1L3WA 1WJ3A 4A68A 3MV7D 1U8IB 1UXMA 3BQUC 4XN5A 2MOQA 4LAJH 2B1OA 5DHXB 4C57C 5KSUB 2APTA 4KRLB 1ZANH 4Y1AB 2P80D 1B9KA 1YY9D 1DUZA 1I85A 3FSOA 1HU8A 1ZVSA 2F61A 1WIPA 2WP3O 4CKVX 4PRBA 3T2QA 4WU7A 3IE4A 6PAZA 2R1XB 3QUXD 5JXAH 4M8RA 1RU9L 2DQIL 3GXTA 4R90H 1G9NL 3FT3A 3LS4H 5CUSL 2YPKA 2P5WE 1K4DB 5A6LA 5GRZA 3U30B 3TH4T 4H1LB 3AXHA 5F1IB 5CR8A 4JDZB 1YEFL 1FZOB 4NP9A 1L4IA 5DQ9A 3D51A 4O2EA 3KJ4C 1CGYA 4EOWH 1A3RL 3F8UB 3AXLA 3CVHB 3GSNH 5JMOC 4IRJD 3ZX1A 4TXVB 3UTTA 3CMGA 1BVKB 1A6UL 4FFVC 1TR7A 3L7FB 5JYLA 3Q2LA 2O72A 4P2QB 4PY8I 1G7HB 5HHMB 3V5KB 2WZPD 2A74A 1Q72L 1XBDA 4LCVA 3EDJA 3L5XH 4L8BB 2G75B 1AE6H 1Z9OA 4O02A 5H35A 2HJLA 2R56H 3HN5A 5DVLA 1Y07A 4MZ3A 3WLBA 4KZ0A 1PNCA 2AV1A 3QDAA 3WY3A 1YYLL 2W81C 4K7PH 4XBEL 3V6FA 1J1XH 3ESVF 2B39A 5GJTH 3EOBB 4TL4A 1ADQL 4OZ4B 1GAFH 2YUWA 1DL7H 4TM9A 5MENB 4CU6A 4MX7A 4PLJD 4PRAA 5FCSH 3HG1E 1I8KB 1IEBB 1O9ZA 3X14A 4CMHC 2E56A 1CDIA 3QQNA 3IU3B 4NM8H 5IBTL 4W9IC 4GEIA 4LCYA 2HRPH 4K3DH 3EYQC 3DJTA 1N12A 2CR6A 3L7EA 5IMKA 1PKQA 5DU7A 4ZFOA 2H5UA 3FB5B 5I1LA 3H3BC 3IAPA 5FYJH 2R8SH 1BVZA 3CFBB 4LLYB 2DYPD 2XZZA 2ZAIA 3T2OA 3FU8A 3ZDZF 4NERA 3EOAA 1YQVL 2DQJL 2BH0A 3ZYZA 5CGBA 4DN3L 1BREA 1FDLL 3C8HA 5BRZA 2CXGA 2CM6A 3SPCA 4F9LA 2ERJC 1NGXB 3MXVH 2GITA 5C07D 2ENSA 2WKLA 2Q76B 1OAKH 1FO0B 1Z3GL 2VLME 5DRNA 4N87A 4JGUA 4XNYL 3RIKA 3C6EA 1LP9F 2J5LC 2WZ6A 5ANHA 1A9BA 3X13B 1KEGL 3VFNA 2AJZB 3NCFB 2XIDA 4IGBD 3TASA 5DVNA 1IGFL 1YEGH 2J6EH 5BOPA 1D5ZA 2B1HL 2YGOA 1J8SA 3E8UL 1NGPL 5E2WH 4F2EA 1GGBL 4XCCL 3VNYA 5A1AA 1PGRB 1SMOA 1P84K 2LE9A 2WBJD 3NH7L 4I3SL 3BEWB 4NKOA 1DEEA 2BS8A 2XACC 2YPVA 3HLAB 2OTUA 4YX2L 1GJIA 3F12A 5AFAA 1JRHL 3GFUA 3S7GA 3M7OA 5D7HA 3IFPB 3WMPA 2HMID 2X3AA 3O2DL 4GSDH 3FT1A 3QIUD 4JMXA 3A4FA 4MXWL 5E08L 2FZ3B 2YEQA 1RZPA 1CO1A 2ICEC 2JB5L 3TBVA 4JVPA 3FQNA 3WE1A 2Z65C 5A16B 1DVTA 1XEUA 3U25A 4L29A 1HJBC 2ZCHL 3V8OA 3MV8A 1DVQA 1SHMA 3D87B 4HULB 2VDML 1TT6A 4PLKD 4TQIA 1VGEL 3LTVA 4O2CB 5LG1A 2P8PA 3O6ML 4JHBA 5D1XC 3HNVL 2WQWA 2EDEA 4U3HA 4CU8A 3APNA 3MA7B 5LN8A 1UXWA 2OMBA 2VLKB 43CAB 2BC4B 3ETBF 3ULSB 2R7EA 3BIKA 4J3OG 3MO1B 2R2HB 5D5MF 2J4WH 3DX2A 4DZ8B 1NPUA 2NY6B 4RGNB 1AGFB 4FZ8H 5E2JA 1QUNB 1PZ5A 1UWXK 2HFFB 2J43A 2X70A 4XNUL 2GIMA 4G5ZL 1RZQA 4ODBD 3WAKA 3UDWA 1JDCA 3P4MA 4DUVA 3LRGA 4KHTL 1M7IA 1QZNA 3ALPA 3RDTB 1CI5A 1L9SA 1ORSB 4LHQB 3KBHE 2BO0A 3I75B 2DQUL 1AD9A 2WLIA 3QXUA 2QPFA 4GKLA 2Q8AH 5KJRH 4WW1B 3VXNB 1D5IH 1J7VR 1RZ7H 1L0YA 4HCRA 4GRLA 3KJ6H 1MFUA 4JKNA 5IWLC 3ZT6A 2WJ5A 1XF4B 3H9HB 3X2QB 4F3FB 1U58A 3L9EA 3OAUL 4MNGB 3EBHA 4UT6A 5L9DH 2WUBH 1S7XB 4PM1A 5EIIB 1YUHA 1LDSA 2X6VA 1G0DA 5E9AA 2EZ0D 3DHPA 4NKDB 4HPYL 3QUZC 2BY0A 2BMKA 1HKLL 4XWGL 4JZOA 3K6SB 1WZ1L 5HGAB 3VTMA 2DAVA 5I2IB 3BW9B 2FWSA 4NJAL 2OCFD 2VAAB 4PB9H 2MOGA 1KN2H 4A38A 1ZVYA 4G42A 4WI7A 2Z7WA 5GPRA 5DZLA 3T77B 3ATEA 5I6KA 2G9HA 1W72B 3MLPA 2BERA 1NFAA 1ZIAA 4E41E 4ZX6A 4P59H 3PV6B 4J3VA 3DDFA 1S7SA 4MDJB 4OTXH 1FFNA 1MFMA 3IJEA 3IGKA 1NAML 3FH5A 5J6GB 1DBAH 5AVWB 3SO5A 3EH4B 3GRGA 5JIIA 1AC0A 4FNRA 3Q6FA 4YHYB 4RGOH 4AEHH 4KVCL 1NC4A 2UWEE 4OD2B 4NKQB 1EFXB 5LCVL 4NZDA 3RY6C 2WP3T 2Z93B 4YHPA 1LO3H 4WO4B 3QB7C 2FJSA 5EU4A 3IETA 3KS0J 1BXAA 5E8PA 5EEYA 1LK2A 2H2SC 2WQAA 4HJ0D 4PBDA 4PJ5A 4OU3A 4JDVA 3Q9PA 5C3TA 1G6RA 5AKRA 1DN0B 1YNLL 3QJQB 4QRPA 4N8UA 4RFNB 4MA7H 4RWYL 1IILE 5CZXC 1UWYA 4JE4B 4NDMA 2VLRA 1T2XA 2V9QA 5DLLA 2DWEA 3U6RA 1LO5A 3C8KA 5E6RB 5FKAB 3FYEB 5FOJA 1Q9LB 2GTZA 5GSVB 1RZIB 3D3VE 4GAJH 3QXTA 1JZJA 1MNUL 9CGTA 5IJCC 1BVNP 2XQYK 3F7KA 1YCSA 2R1WA 3O4LD 4DFIA 3CFDA 3WO4B 2AEOA 1F3JB 1U8NA 4OLYH 3QR1A 3O8XC 1ZHBB 5IR1B 3QEQE 1PIFA 4FQ2L 2PR4L 5KANI 1XH3B 2R0ZH 4DQOH 1UACL 4GJTB 4J8RB 4LLDB 5J1AA 2FVNA 3DPBA 2VC2B 2X4PB 4X7SL 4NLHA 4HAFA 4XBPB 2Q9OA 1AHWA 2OX5A 1TOXA 1DQTA 3FB6B 3UPCA 3EDFA 1P7KA 1OK8A 3MBXH 1N5AA 3D85A 5T5FA 1MCPH 1CICD 3N1FC 4JFSA 2ESVA 4K94L 3SB3A 1ORQB 1F2XK 3LZOA 1GOFA 2WVVB 3DX7A 4OJYA 1BSIA 3ROOA 3U4BH 4XN9A 1SXNA 3UP6A 3C5JA 4JFWA 4DH2A 3QUYB 1LO4L 4X42A 1D6EA 3SOBH 5IQ9B 3ATBA 2VSMB 4UTBA 3LZFL 4QRSB 2DBJA 2JJTC 2DJUA 1M2OA 1MY7A 4CW1B 4S0HA 1SXBA 3D5OF 1ZT7B 1CLCA 2ZONA 3QZLA 5GGUA 2ZX9A 1R17A 3MYZA 5HYQB 1QFWL 1G9ML 1QYGL 2JELH 1QR4A 2D0GA 3D33A 2JFCA 2K1MA 2VDOL 4MD5B 4NRZA 4NN5B 3NJKA 5D7IB 2VJXA 2XNAA 4IKJA 4HIJB 4KKQA 4YLCA 3WAJA 4KKBD 1JNHA 1MHEA 3QIBD 3GIVA 3FFCA 4CC1A 4PJFE 1U3YA 3VGHA 1NAKH 1B2WH 1HXYA 4K8RH 4TTGA 1EDHA 3OR6B 4I1PA 4LMQI 4PJBF 2VQTA 1WF5A 3U2JA 5EO9A 3V6OE 1I1FB 1NCWH 2X12A 2K0RA 5KBNC 3V4PH 5GGTA 3U9UB 1OE2A 4Z7OE 2HAZA 3UYOD 1MCLA 2V3FA 2WWKO 3UTTE 2GK0B 1IGJA 4ODSL 1BGXH 4I77H 5AL8A 5AZ2L 1M7DB 3TA3B 4JPSA 2I9TB 3MAWA 1PQZA 2X1QA 2DRUA 4RGNE 3FBKA 4PV9A 3PNRB 1QSVA 2C3VB 3ME0B 1VERA 2Q2LA 4OJCA 4XX5A 1NCAL 2XN9D 1QAWA 1KMGA 1AIZA 3Q3GA 5EC1A 3OL2A 1XCXA 4MFHA 1UD5A 4OV6F 4Z7WF 2AABL 3EDDA 3WJLA 2JKJA 3PLYA 2R4RH 3QXVA 2ATKA 3X11A 3CDZA 4FS0A 1WS8A 5L6YL 3LKNA 3QPKA 4HUCA 3K8MA 2DLFL 2IBGA 3IBOA 4K8RC 3D2UA 2XTJD 4OM0H 1EAPA 4W9ZA 4PV8A 4YMPA 5A2CA 4M8QA 4K07A 1VFUA 2YJLA 3MLTA 7CGTA 5KVGL 1ZSHA 2EE6A 1C08B 1PKQE 2VXUH 3POCA 3RBSA 2E75C 3TYGL 3RRQA 1JPSL 2NZ9C 4PJ7A 4TYUA 1W8EA 2WPGA 1EEUA 3RWGB 4HZ1A 5KBMA 5CBAA 4Y4HA 4PP1C 4NQSA 3FULA 3RVVD 1S9VB 5BRZE 2V8LA 1IE5A 1DLHA 3O45B 2GJ6B 4MD0A 3A6CH 3TV3H 3AQDA 4Z7NF 3T0EA 4RBPK 1UXSB 2DLIA 2WAHA 3S3CB 2D7NA 2YMXL 1IT9L 5L4JA 2QVMA 5FO2A 4JFOB 4JKLA 3AABA 5AB9A 3OKEB 2BP0A 3CVHL 1DANU 2DWTA 1NCTA 3HNSH 4HCFA 1RUKL 3QBTB 4NWUH 2WVSA 3ABKB 2CGRL 1KBWA 4KMTH 1KFGA 3T3MF 4KV5F 3GSXB 4LARH 3P2BA 4JM0A 1N7ML 4PG9B 4PREB 1CXLA 1WIUA 4M8VA 3WUWG 2AJSH 3SQBB 1T2QL 1XZ0B 4GI9A 4BFNA 5FW7A 4JO2H 1E5CA 2OPCA 2QT6A 2CLRA 5LBSH 2QR0A 5HY9B 2ID5A 4HWBA 1FL3A 4FULA 3KWWB 3DSNA 3M1CA 4HD5A 3D39B 4I18C 3PABB 3O3DB 2WM0A 4JFYA 5CU5A 1CFVH 3L5HA 1EGJL 3CD4A 4FG0A 5H37H 5SWSD 4QOKB 2ADGA 1E4JA 4QRRB 3QE5A 3KXFA 3ZHKA 5M94B 3ARVA 4KGJA 1C5BH 1SM3L 2P9RA 1JN6A 3MREB 2D31A 4NQCB 3VWKB 3OPZL 1AS8A 1QABA 5AVUB 3MV8E 4G6AC 4IDLA 4UOQA 1YY8B 3UTSA 1TJGH 3FSVA 3IDMA 1VZIA 4N1CA 1DSYA 5F0MB 3AACA 3MGOA 1CF1A 4JKWA 4B9KC 5FA3A 1FVEA 1ZIBA 3MLXH 1FO0L 4GS7C 3B2VH 4I3RH 3LS5L 2JJSC 2GSGA 4W4OC 1QNIA 3H9SD 5FOBA 1Z2KA 3RUGB 5IFHL 3BE1L 3A4DA 3FCGA 4KRPC 1HK6A 2PPDA 4MJJA 1T04A 4KKCD 1BQRA 3RPBA 3NUKA 5IREA 3DXAA 3MLZL 4GUPA 4NXSA 5F1OB 4YXHL 1UXLA 3IDGB 5D7LA 4D8PA 1I7TB 1I9JH 5CEYA 3WIHL 4B9YA 1YEJL 3IWUA 3IS1X 3ZE1F 1UG9A 3KGSA 1SHWA 2F1BA 2CBOA 1KFAL 5LUMA 2A0LC 3VI3F 2F7RA 3B4NA 1CGUA 1I7ZB 4PGCA 1GW6A 1IGTA 1JPTH 5E8OB 3TL5A 4B95C 3QNZA 3DECA 5CKGA 3AU1A 3D05A 4U3CA 1YRKA 1P4LB 2Y72A 3SDCA 5KUKA 4L2LA 2HG5B 1MZZA 2MRYA 2DIEA 4R3SA 3L2MA 4GH7B 1FPTL 3V4UH 2NX5D 3IMWA 4Z0XA 4AX3A 2OS7A 3LVTA 3V9CA 3Q8BA 1ZJAA 4AW7A 1N18A 1XCWA 5JLZA 4TUJA 2FD6H 1SEQL 1A6AA 3H6AA 4C47A 5LBGA 1F18A 1S7QA 3K1KC 3IK2A 4OGXH 4ZAKB 2CDEB 2XN1A 5T3XE 3H9ZA 5LN4A 4NCC1 4DEWA 1I1AB 4TTDD 5GZNA 4WTQA 4U1SA 3CSTA 3HMXL 3QEUB 2XN2A 1FLTX 1L6PA 4XP4L 3O6FB 4RESB 3CN4A 5LLIC 2Y7SA 1G0XA 3BKJH 4R96A 4HUVA 2YZ8A 2ZUUA 1KF9B 3VSTA 2JMRA 1MQKL 1BIIB 4PRDA 3QG6B 4M4RB 3FSWA 5E95B 3D52A 3FQTB 4JZNB 2HLAA 1CG9B 2BFVH 3VU2A 3FTYA 3MRMB 4K3EL 3V4VB 2O5ZH 2ZPKH 1YSOA 3AY2A 3A0OA 1OCWH 1UKTA 4ZMXA 4NN6C 1J0IA 1JVKA 4OFYD 4RISH 5F9OL 3NIGF 4PJ5E 1CK0H 1PVHA 2H3NA 1NBCA 2IOMA 4HC1L 4TNVK 4ADGA 1ES0A 5SWZD 3REWA 5GXBB 3FCSA 3NEEA 4QRPE 2X38A 2H2PC 4F92B 5FS5A 1FUNA 3T0BA 2QZQA 2X6UA 1ZT4A 2VLRE 5ERWB 4MNQD 3U7WL 3RTQA 4OZFA 1DDTA 3FB8B 2VW4A 3I2CH 1AIFB 1SY6H 4HHAA 4O4YH 5K9JL 4YDJA 5I73B 4HGMA 1LE9A 5FM4A 4UT7L 3BEVA 4LKCA 3RP1A 1HQ4B 1P5UC 3IFOB 5C3IA 1I7RB 1E9QB 2WTRB 4WHYG 3ZTJH 2E9BA 4I0PC 4G6JL 1N6UA 4G8GD 4ZMZA 4R7VA 2F5BL 1W72L 1FH5L 4FFZL 5I1EL 1BQLL 2QHRH 2VXTL 5I28A 1H9DA 1EEZB 4JFPA 5GRJH 2EADA 4WI6A 4BDVB 1R4XA 1Z6JT 2AF2A 2ESVE 4P9MH 3AT8A 3ARQA 3PJLA 3SPIA 2E7LC 2XZQH 4HUMB 4Y2LA 2X09A 5CJ5A 1LEIB 1T22B 3L9YA 4AGOA 1JOIA 5ACMA 5ALBL 4WFHD 1KCSH 1BZ9A 12E8H 1E4WH 3O11A 1BCIA 4S1QL 5I1GH 4XXCA 1JZ8A 2EZ0C 3PU7A 3MRPA 3S34H 4J7RA 4N6RA 2BW5A 3WIIH 5GJSH 3K74B 4A7VA 1DUYA 2YEVB 4N2AA 3MBWB 2XVLA 4ICXA 4L1SA 5C2BH 5C0BD 1KJ2B 2TSBA 4ES9A 5JIKA 3FFCE 1MVUB 1BQHB 3ZDXB 4OT1L 2CJUL 4MJ2A 4ALAC 4CADB 3GJEB 4I2XB 3QDJD 3PPEA 3I3DA 4Q6IC 2KERA 1S7UA 4WW2B 4Y5VA 5SWQA 3C6LA 3WDHA 3U0WL 4N2FA 4FFYL 1U4EA 2C9PA 3ZE2B 4HUKB 2WLMA 1CE1L 4GB9A 3CH8A 3DYMA 4HS8L 3BOVA 1OAXL 1EHNA 5CLWA 1K85A 2JH2A 3L54A 4F15C 5C08D 1AXSB 1PPIA 2DQTL 4APQB 1JV5B 2VXVH 3WYRA 5KW9L 1MCQA 4DO5A 2VC2L 1P2CA 2EYSA 2RJMA 3ARDB 3N41B 4V11A 3VXUB 4J6RL 1S9YB 4LLWB 4NLAA 4MGXA 4YHIA 2BJMH 4JPVL 5F6IC 4H8WL 2MOVA 4HIHA 4ENEC 3QHZH 3S97C 1LM8V 1PLGL 3WJJC 3ZKQD 2OZNA 4CC4C 4J4PD 2F1EA 3IE9A 1BYNA 4YZFE 3PWVB 2ZG1A 3DIFA 2DQDL 3GSWB 3P1VA 1KLFB 3ZHLA 4IKIA 3MDJA 3D18A 4BFBD 1I8IA 4HJJH 1R3HB 3B7RL 1URZA 1S7VA 2P3YA 3PP3K 1E4XL 1OIOA 1UM4L 1AH1A 5CZRA 5EZLA 2XCMC 1IGYA 4DGIL 3I3BA 3FQYA 5FGCE 2CCWA 3WFCH 4PRPB 4XPTH 3E6FA 4FF9A 1WHOA 4HSQA 4M6ML 4NAQA 4NZFA 3VGAB 3NRFA 1PU0A 2XJLA 4S1RH 3ZMRA 1KIQA 1RUQH 2X4QB 1TTFA 3VXME 4PJEF 3ZKXC 5KSBF 4KK8D 1BF5A 2RAMA 4LSDA 3TJEL 3O2VL 1DQLH 1DE4A 1UA6L 4U7KA 1J9RA 1PJ9A 2NRDA 1TQVA 3T0EE 2ICWI 4PIBA 5HTSA 1I9IH 2WN2A 1BZ8A 2AKRB 4M93B 3OXRB 4LO9A 1OP3K 3FRUA 3SJVA 5DZAA 5FGBC 3EYVA 3VXSE 1GC1C 1V7NL 1A7OH 5FFOA 1DQDH 1UM5H 4IU2A 2R59A 2V9RA 2G5BB 4P2RB 3ABZA 1RJLB 1N5YH 4AEEA 1CFSA 2XV6B 1M05B 5J6HB 4GRWE 3GXIA 2BS71 3NFPB 4E5XG 2ADJA 3Q2NA 4N5EC 2GPZA 2YK1H 2FATL 2VR9A 1F6LL 4D8PB 4P2OB 2J2ZA 4ZQTA 2NT1A 4I5BA 2PYFA 1V3MA 3JWNH 4KKBC 2MQ3A 4AKPA 3OHXC 3QIBC 1FRGH 2FIKA 3FK3A 5MERB 3HS8A 3RL2B 5EC2A 3TGXA 2JCCB 1NCDL 3QCTL 3DRTA 5ICXB 4NPKA 4YDKH 3BVNA 5BJTB 1OANA 4FJYA 2EIZB 2VM4A 4AE1A 5HDBB 3IMVA 3KXFE 2YLKA 3KH4A 2HWZL 4DKFH 1NCOA 5ACZB 1ADQA 1GKEA 3SDAA 2AXJA 4KH2A 4XVOA 3TNNA 3OJMB 3BLPX 2OMZA 4HSCX 1MCSA 4Y4FB 1IZJA 3UTSE 4G9DA 3WE6B 3ZDYB 5E00A 3UYRL 3CDGA 1FZJB 4OD1L 5KTEL 2VIRB 5C9JB 2F5AH 2MIZA 3K7UA 4W9FC 4QXUH 4ONGL 3MQIA 3TP4A 2F53A 3PUUA 5HGHB 1NKOA 1GJWA 2ZCZA 2P8LB 1NBVL 4JM2A 4Q0XL 5DGRA 3FTXA 5DWPA 2XQBH 4BD4A 1FNSH 4BQ6A 4JQXA 1UHVA 1FYTD 3ULUC 4YNYB 1PIGA 2ZXBA 5JW4M 1KENL 2ATPB 5DS8A 4QY8A 3O9WB 2X0UA 3DXAE 3G3LA 5DQDL 2DDQH 3M1BA 5T8IA 4ZMAT 1YECH 2MWCA 3T0XA 4HH8A 4JFQB 1NIFA 5C0EA 1AKJB 3RWCB 4A67A 3MFGB 4ELKA 2XTJC 3M8OH 3VFPB 5MEOA 4AQ1C 3ZL4L 2FYYB 2HKHH 3P11L 5BVJA 3J07A 3BPCB 2AW2A 4QYOA 2NY5L 3VXQB 3CHQA 4H25B 4PWJA 1RK7A 2FSEA 5E1IA 3X1FA 3UGEA 3H4FA 5IF0B 5LVEA 3MTXA 1FN4B 5T1MA 4RIRB 3T3PE 2CWRA 4QRUA 4IJTA 4JRXB 2EDWA 1ZV5A 1BBDL 4QTIL 3V7MA 4M1CD 4QPEA 2WN3A 1CD1A 1CFTA 2A5UA 5JOPE 1FF5A 2Z31A 4WNQB 3MHZA 1WFTA 4L23A 4QTHA 3BGAA 1BAWA 5EN3A 2YBGA 2OMVB 2BVYA 2F68X 2BNQB 1D5RA 3O2DA 1C5DB 1KXTB 2P45B 2W9EL 3NJJA 4TULL 5LGJA 5CHNB 1BOGB 2YD8A 4RZKA 5E2VH 1AHKA 5TD4A 1BXVA 5CCHE 2EUXA 5BZZA 3EOTL 3T71A 1G6VK 1HCVA 2F15A 2IAMD 2W88A 2WBKA 3GI9H 4OLEA 4Y2DA 1G7JA 2K8QA 3VM7A 5I15L 3I50H 4L5FL 1MUJB 1GZQB 3TBTA 3U0TB 3V5DA 4DP1X 1XR8B 4LCUA 2B16A 1BD2D 2COVD 2BSED 2D3NA 5CR1A 2APFA 1YNTF 2EH7L 2E8ZA 5F9JA 4BKTC 1S8DB 4UTAL 4KUZH 3EDEA 4EQ3A 4WKZA 4XPFL 1U3ZA 2F58L 4DVBB 5CM1A 3D9AH 5TE4L 1ZS8B 2KLTA 2FWUA 2IBZY 1NGZA 2FT8A 3RVXD 3QZWB 4MJ5A 1TZIA 4PW3A 4B9FA 4C56A 3UH8A 1HWWA 5C0NC 1UKQA 1BMGA 3NACH 1UJ3C 1MXDA 1OE1A 4PRIA 1EHLH 3RHWF 3VQ1C 4FZEH 1WICA 3O6KL 3BZFB 5KSAD 3RZCB 5I1JL 3FU9A 3CSYB 3MACL 2EO7A 5C09A 3SQOH 4AIOA 4U2YA 1WAAF 3UYPA 4PJDB 2WKGA 1GKOA 3FSZA 3MUY1 2VUKA 3EUUA 1HSBA 2V5SA 2ZQKA 4BXVA 3QHFH 1G7PB 5I1IH 3MV9A 3QO0B 4XRCB 3NSDA 3N2JA 1X44A 4PW9A 3QIWB 3ZZLA 1NWPA 5E5RB 3BN3B 4EI5B 4L3CB 2JKTM 1N67A 3BAJA 3GMPB 1OP5H 2K3TA 4KKCC 2DWDA 4DKTA 4AGNA 1JE6A 2K7PA 3GYRA 2ICWB 3OXSB 5HYSB 4AK1A 1JGDA 4JHAH 3GWJA 4N0UA 2B20A 5T1KD 2HVJA 2Q86A 5DFWH 2FBRA 1FCCA 2OJEA 2WGXA 4LCCB 4DP4X 2NY2B 3TN0B 2ITCA 2OTWB 4GW4B 1RULH 4M61B 4R4FH 5I18L 3B34A 2IH3B 5GIRB 5IUCA 3MRQB 4AJWA 5DJ2A 1PZSA 3K6DA 4WTXA 1WD9A 1PF3A 3GBEA 3C60C 5C0CB 5F0PB 3V4VL 5I5RA 1IM3B 2I25N 4ZI8A 1CR9L 3HE7A 1V55B 3F7YA 3HAEH 2FJFA 2DL2A 1BAFH 2ZOWA 3NG5A 4XVUD 1M42A 4DK3A 5CKAA 1QVOB 5JDSA 1HINL 4NJ9L 1N26A 3KPOB 3D69B 3L3JB 5LCVA 4C83B 2Y36H 3D6GA 3EHBB 5ID1A 5DEJA 4AENA 4AT6B 4JPIB 1UVQA 5EZOH 5IFJA 1G84A 3PHQA 4BSVA 4ELMB 1AKPA 1P53A 1J8KA 3SHSA 1F3RB 1U8PA 4MJHA 3TBYA 4DESA 2XBTA 4DP5X 2OBGA 4XCEA 4HV8B 1TTRA 5B3SB 3ARFC 4KZEL 1A7NH 5DJXB 3WFBL 4FKKA 5IW6A 5AENA 4FHKA 3ASWA 5DD1L 5JW5B 4PR5A 4DVRH 2AJ3A 2D3LA 3HRZA 4H0HB 1OPGH 3DTDA 3N1PC 1GTNA 4D9RE 1T1WB 3P0VL 4QKXB 3IDJA 4ABUA 1AO7A 4NWTH 1S3RA 4N90E 3QXAA 4IBQA 4P49A 4TVUA 1VZGA 4Y5XB 1MCNA 1M53A 1NGYA 3EOYG 4IRSC 4BSJA 1IIIA 4EF3A 2XDHA 5DMJB 4AIEA 5CMAB 4F58H 5C6WH 4KZDL 4IBLT 1FL5B 1RJZA 4AUJA 1LO0L 1DBMH 2QFRA 4KH9A 2DYSB 4QXTA 1OT1A 3RG1C 1IEAB 2XVGA 2ZWZA 4UYQA 4H44C 1NDMB 5HI3C 2PPFA 4NO5A 8CGTA 1RV6X 1TU2B 1ETZB 2E7CA 2PCPB 4FERA 1NJ9B 4X5QA 4JVUA 5H94B 3ECBA 1MEXL 1RIHL 3BH9B 3LV3A 3WNJA 1DVFD 1D6VH 1GYAA 5D7JA 1WG3A 3VYNA 1J8HD 3D30A 3OGCB 4OV5B 2DEYX 1OVZA 3P9MB 1L7TL 2A38A 3LQMA 2Z35B 4MXQC 1D9KB 4WDIA 2B5IB 1JTOA 4I88A 5HGBA 3N40P 1XGTA 1HWHB 3AT9A 5FF6B 1KJ2L 4CVWA 4CSPA 1J05B 1QSEA 4XR8C 3SO3B 3WFEL 4HWUA 3DOSB 1AGCB 4LSVL 4MMZB 4R9HA 4XNZC 4ANVA 2J8HA 4LE8A 1U6AL 2MKWA 1QI5A 3EDKA 4NNYB 4UILH 4LHUB 4YR6A 5TGBB 3SJVE 3Q8AA 4Y4KA 3S96B 3JWDH 3QORD 5KN5B 1E6JH 2VLJA 4WV1A 4KKAD 4V1DD 1SDDA 2Y24A 2YAOA 3MJ8B 3ECWA 3QW9A 2B15A 2Z92B 5D9SB 1ZEAL 2Q6WB 1U95A 3RWJA 3MLSH 3B8YA 5D2LA 5D96C 4JY6B 4FQ1L 2VDKH 5E2TH 4I9WD 3G5XB 5C6PB 5GGVL 3QDGD 1WQVT 1G7IA 5CU9A 5IHUL 3DROA 5I1HH 3L3HB 2DTMH 4UNUA 2WNWA 2EICA 5B39G 2GJPA 4I85A 1C12B 3T9WA 1FNLA 3IJHA 1WCBA 3BAEH 4CGUB 3BP4A 2FNWA 4X8XA 5M95B 1GZHC 4RZCA 4WFFE 1HAUA 3SD5A 4YUEH 1QI4A 4P46A 4WO0A 3KZ8A 2ENYA 3BGFB 3BDXA 3OB0K 4HJUA 4XMKL 5H2BA 3LYRA 3TV8A 4LDLB 4ZTOH 1OW0C 2B7DT 2IVFC 1MDAA 3L4XA 3BLKA 1DSFL 2GI0A 1DN2A 1R3LB 1P6WA 2NSMA 3D2TA 3ESMA 3ETTA 4JPKL 4PCTA 1E4KA 5KSUA 3ENEA 4DTGH 3JWDC 4OCRL 1WBYA 4UZUA 5J3HD 3QYNA 4QNPF 2FHCA 3GUTA 1YEEL 3I6LE 2Y1ZA 5FK9A 4LQ1A 4CDHA 3MPCA 5EU3A 2VDNB 5BUPA 3HPJB 5D1ZD 5DO2D 3QQXA 2F53E 1IJNA 3ABGA 3QS3A 4IDJH 3OD3A 5CP3H 3PXJA 5INCB 3LN5B 4HF5L 1R1CA 3L3IA 1RHHB 4WEMB 4MMXC 4B7IA 1PY9A 2KC0A 3DJRA 4OM1L 5A43C 3WKYA 1RFDL 2J8UB 1BM3L 1FSKC 2B2XH 2WB1A 2R9HC 4QO1A 3QUMA 1NSNL 4ZMLA 5SX4H 2AMUA 1I1RA 4QIRA 4E9XA 2ZXCA 3DMMB 1KDJA 3GMRB 3NTCH 1NH6A 4HD9A 1CQYA 3PWLA 3IMBA 3FU6A 3NVQA 1F4YH 2IJ0C 4LRIA 1H5BA 2MHAB 3IMRA 2N7AA 5KOVC 3WBDA 5ICZB 5EUKB 4KK8C 1JBJA 5C1MB 4EN3C 2IFFH 3SQRA 2W92A 4BSWB 5FLUA 5ALCH 4ZOCA 5C0FB 2EIEA 2YPLA 3EJCA 3TFKD 4PRHB 4IJ3C 4I4WB 4AOFA 2CA4A 1ZLUK 4NO0D 5I0ZA 5I17B 4R0LC 3PWPA 1XF3A 3S3PA 5F96H 2H1XA 1MCKA 1VHPA 2P48B 3DV4B 4I3GA 4ETYA 1FZMB 3IRPX 1OSPH 2DM3A 4PJ7F 4RMVA 5MENA 2VMEA 3QWOA 5IK3A 4WUUA 1D5MA 3RKPA 5C6TH 2VR3A 2YA1A 4ZQKB 1JWUB 4XMLL 1ED3B 5KSVB 3ASOB 4OD3H 4FL4C 4TMPA 3LIZA 5EZJB 1ROCA 3VSUA 5ACLA 4WHDA 3BQUB 2QMJA 3QNFA 2AXFB 3UZEC 3RBGA 5ANMA 2DQEH 4AGPA 5D7KE 1HZLA 5EU6D 1ZV9A 2J57A 5HYJD 5I71C 3WLWD 2KUTA 3IFLL 2MQ0A 4P4RB 2M1KA 5HD8C 4HIPA 1KN4H 1QFHA 1FO0A 4R4BA 2E7HA 4JRLA 4XVJH 1RPQA 2YSSA 3BUQA 4C56E 1T20B 3NQIA 2IDSA 1TQWA 4PRIE 2KZWA 2AJZA 4ODTL 1I7UA 2WIIB 2HTKC 5C09E 3CLFL 4YBQC 4FNLH 4GAYB 1BVLB 1Q9WA 4F7MA 1Y6NR 5AVRB 3RGVD 3BP5B 3KJ4B 1QHPA 5FO9A 4X98B 4D2NA 2VH5L 2QMKA 1UEYA 3K6IA 3MV9E 1OQXA 3ARBD 3B3IA 3LPFA 3W81A 1ZDSA 2VE6B 4HKXB 4PWFA 4X6EB 4W9LC 4H4NA 2CIIA 4ZUTB 5KS9B 4AL8H 4JG0L 4FI7A 4KZCA 2Y5TA 4AITA 4AVJA 1T5WA 3DVGB 3C09C 4ZOAA 2EC9U 1N64H 3HBQA 3G6AB 2OULB 4L37A 3GSQA 5B38B 4EDWH 1KUMA 2FWOA 1OPOA 4GKZB 3ZO9A 2EILB 1JFQH 2HTLD 4N0UE 2G3ZA 1E5UI 3T6VA 1LO2H 1J0JA 2OMTB 3GSRA 4HJTA 4KVPA 4JO1L 2FO1A 4L3EA 3JYCA 4FDWA 3F3HA 5FO7B 2ZAGA 4LGRB 2PYEB 1Q8MA 4CMHB 2C4XA 4WNSA 1MH5A 2CJSA 4M7KH 5C0DB 4OLUH 3EYFB 1S9WA 4N9GB 4KO6A 5DK3A 1JPFB 1NINA 1JGLH 1OE3A 9PCYA 1DQIA 4M3JA 3S8GB 4PWKA 1YEIH 3GSNB 4IRZA 4BH7A 3MRGA 3N06B 3NJMA 2D7TL 4XGZB 3PWNA 1YMMA 4H13C 4OFKA 5L2KB 4ZODA 2ERJB 1VADA 4AL8C 2AJYL 3EG9B 4UQ9A 4JHWL 5L4FA 4JG1L 1P4IH 4Z0BL 3LRSB 2QQLH 1Z5LB 4YFEA 1J5IA 1U8OB 3RWEB 1DZ0A 2MCPH 1TQSA 3TO4D 2IAMC 4LDOB 4LEXL 3RDTA 4L8CB 2YEZB 3KWUA 3OKKB 3TJPA 2B59A 2FDBP 4ZMQA 4J39A 3MX0B 4GT7A 2VSKB 4U6TA 1TCRA 3G5YB 1QEWA 1SYSA 5CJQH 2WLKA 1JV2B 4PCKA 3ILPB 4FYQA 4I48B 4F7PA 3VDAA 3N55A 3RVXC 2CSPA 4M5YH 3WUWA 3IGAA 2HG0A 3P9LA 1F00I 1AO7E 1RL1A 5IJVB 2APBA 2YMTA 4QLWA 2J8UE 2P5WD 4BE6A 4X9FA 4U1NB 4Z7VB 3NP4A 5JA8B 3QNXB 1AZUA 3S5LB 1JI1A 2M26A 3SCMA 3VA6A 2LV4A 2YXMA 4U49A 1UGKA 4G71B 3VD9A 2XA8L 3V2AR 2BIOA 3TF4A 1AQMA 2ICEB 4LLVA 1G43A 5C0RH 4JQIH 1NFIB 4G3YL 5K9KB 3GPEA 3W9EB 1WWCA 1AGDB 5L8KB 1G87A 2ITDA 3EGXB 1EJFA 2V2WB 5GRVK 4Z6AT 5CFHA 4NM4H 5DURB 4OUUB 2VN5A 1M7XA 5F7DB 1WIOA 3SY0A 1MN4A 2ADFL 3VE0A 2C7UA 4HEPG 5D1XB 3ZE0E 2D03H 1OTSD 2K70A 4JO3L 1YVLA 4FLQA 3WSQL 3UJJH 4QDGA 4EI6B 2D2CC 1JI2A 1MLCB 1QSEE 5HI4D 2IPTL 1GR7A 4QJ4B 4ODUB 4RFEA 1GMEA 5E7FA 3QRLA 5KVFE 3B7UX 4RMQA 4APXA 3I6SA 4Y16A 1MPAH 4NCDA 4AXWB 2ZWSA 4TLTA 1U92A 4N2MA 4WCYH 5D4IA 2JIXD 3NIDF 3QJOA 3HG1D 4UQ3B 2VLJE 1JGEA 2CJTA 2FGZA 3V10A 1JZ4A 1E5AA 2CKBH 1RIUL 3DYOA 2RHEA 5D6DC 3CTTA 1E8XA 4FFYA 5D2LE 1EPFA 4KUCD 5C7XH 2OMYB 3FT4B 4H26B 2HP4A 4FFWC 5DFTA 5A3IC 2KS0A 3UBXG 5JPNC 5JHLH 3ZR6A 4FXGA 1CVSC 2X4NB 5FHBL 4K7PY 4LLDA 5FYKL 1DP0A 2DMCA 3WKNA 4X6CF 4S1SL 2VLMD 4HOZA 3L1OH 4M1GL 5CJXC 5E6IA 3G5VB 1H0DB 2H9GB 5FDWB 4XXWC 4MZRA 4HQQH 3BDYH 3BH8B 2W0FA 4DPBX 1X5YA 3QUZB 1HH9B 4IK7A 2VLLB 3GMLB 3SDXA 3RI5K 4LU5H 4N0FB 3TH3T 1X5XA 3C5ZA 1S2EA 2XTSA 4WWKA 3BWAA 1VGKA 4MTMA 5FM5O 1NEPA 3NA9H 3KPSB 4P5KA 4X5XA 3D25B 3VI4B 2ED7A 3FBQA 2AEWA 4NHCH 2PXYC 4FLRA 4F7EB 5JW3L 1QD0A 4QRSA 2IWGA 4KI1A 4UOW0 4TOYH 5B7MA 4OBSA 1WFJA 4HZAA 3MRIA 1TJHL 2OYMA 4FA8A 3SGDH 4MHHG 1TF4A 3VD7A 1CDJA 4F33A 5CZVH 1F42A 5CP7B 4PJ9D 4B5EA 1A7RH 2YKLH 4X2UA 3BPNC 1AQKH 2KH2B 1FI8C 4LCWB 5GRUH 2CHXA 3EAKA 3FTUA 4L4TA 1HQRB 1MCJA 1NDGA 2DWYA 3AADB 4Z78B 4N9OB 4TVPE 2B77A 2EVIA 4JFZL 2J1WA 5JHDA 2WLLB 4U3XA 4Y7OC 2VXSL 2XWCA 3IB4A 1PZBA 5AYQA 1DVFC 4ICWA 2GK0A 4MA3B 3VFMB 2A4CA 4GG6A 1J88A 2IADA 5FX3A 1YEHL 3Q9QA 4P5TA 5TDOA 2ZSVB 3HHRB 1GPOH 4PG2A 1KCRL 4IKNA 2Q3ZA 5DF0A 1EHKB 2A9MH 3BN9D 4HOXA 3VQ2C 3RU8H 5DMIL 5B1JC 3KYOA 2YPLE 3E9TA 5D1QA 3QYCA 1RUAH 3O8XB 1PY4A 1N68A 4QGTA 5I8EB 1F58L 3BQVA 3PWPE 4XN4A 1X5AA 3C9NB 5MEQA 4N0RA 1NICA 2EE9A 3GEFA 3WV0A 1BQUA 4KKAC 4NZRL 4Y0GA 1OT2A 4Y9FA 1I8UA 4WUUE 3IXAA 2PO6D 5E1AA 4L05A 3FONB 2UYLB 3I9GH 1FH2A 1PD0A 1IC5L 2E27H 2FX8H 4U1HB 1P7QA 1UZ8B 4Y1AD 2VDNL 1NDTA 1GXEA 1DBKH 1L6ZA 3TBSB 5K5YA 3CFJA 2YAQA 2WD0A 3FJTA 1XXDC 2J88H 3MRJA 4BRJA 4EKJA 4DUWA 3RWGA 5ANME 3LH2H 1GSKA 5C0IA 5L8LB 2FT6A 4YHNA 2QV2A 1O75A 4UQAA 4YHOL 1GHFH 4WTZG 4BCYA 1ZSDB 4PWGA 2X2JA 2XVBA 3NCJH 4G7VH 3FUIA 3ECQA 3LNIA 5DUPL 3UXFA 4RCAA 1LHZA 3QFJB 3KPLA 3I02A 3FFDB 3T1FB 1A4CA 2ZXGA 4WEUD 3MBED 2DQCL 3V9EA 1I9RH 4MJIA 5FO8B 2XU9A 1RMFL 2WSDA 3GSXA 4CVXB 4KJYA 1FZKB 5EU7C 5EA0H 1KJVB 2R0LH 2CUAA 4JW3A 2QTEA 5J3HC 2O6CA 5ESVB 1QBML 4E41D 2GQHA 4JG9A 4Y9GA 1NCHA 4JY5L 3IKCA 4XCFH 5GHWH 3RVWC 2WQRA 5HY9A 3FRPG 3L9BA 2OXHB 5D1ZC 5DO2C 4MD4A 1E8YA 5IROA 3UTZA 3UPRB 1T1ZB 2WLNA 4GMSL 3S5LG 1HDMA 1PL3A 1JNLH 2UX7A 4NHUB 4P99A 1VEOA 3RJDA 3ZRSA 4JZJC 5AYUH 5I6LA 2A6DA 1N3NB 2GABA 3KVPA 4XPAH 5EUOB 2XQ0A 5DUMH 3GK8H 3BRDA 3LZLA 1H19A 1L9QA 1OTTD 1ZGLB 2H6OA 3OX8B 3EFOA 5CWSB 3QJUB 4POZD 2XWTA 4EJ1C 1PSKL 1NFKA 2L7JA 3WGUB 3OMZA 1XSIA 3DURB 5TPWH 2D7PA 1BFVH 4NQCA 3IU4H 4DP6X 3S0PA 4L3EE 2KZKA 1E5BA 1JF1A 1OGAA 2QSVA 4KITB 4A7GA 2EIDA 1R5VB 1U8KB 3QA3A 4RSYA 3SKNA 4WJG3 3L9RA 15C8L 1U8LB 4Y9CA 4QRQB 2CDFA 4MAUH 1NPJA 4CSTA 3TFKC 4FQQA 1IBYA 4KTEH 4UV7L 4F37K 4Z5RB 2WWMC 3V4PB 5KVEL 1G1OA 5D4QA 2ZXWB 3QEQD 1SXSA 1XAKA 1YMME 3BUYA 4UTAA 3WKQA 3OVUB 3I74A 1U3HA 2A77L 1IQWL 5MEPB 2Z9TA 3B37A 5K93A 4AYFA 3IDGA 3C08L 4X50A 3U36B 4GAGL 3HG2A 1LJMA 2H0JA 4JQVC 4Q2ZB 4Z3HA 3QPXL 2E6QA 4BH8B 3TO2A 2BVUA 1HIMH 1GOGA 5D7SH 1HOCA 4NO3B 1S7WB 2EIJB 4W1TA 2R4SH 3AJ7A 4OLVL 3UAJD 1BZ7B 3DX8B 1ZANL 1HFUA 1AJ7H 3PWJA 2F9BT 3QUXB 1EDYA 4AZ8B 3GT6A 4QRAA 3BVVA 1ZT1A 2DQGH 5JXAL 1X9RA 1K2DA 3L95B 3BO8A 4PJHB 4HUXB 5LGKA 4JRYA 2FB4L 4E5XA 1IAOB 4I18B 4R90L 2EO9A 3LS4L 3NABH 3QJTB 3U83A 4F57L 3HNTL 4ZO8A 1ZMYA 4PJGA 1I1AA 1Q9OA 1YEKH 4N8VG 3CG8A 3DETD 3RWDA 1MWAH 3L3GA 3PL6A 4AK2A 5IKCB 2X9ZA 4TSAH 3NK3A 4ZTPH 1CF8H 1Y1DA 2H47C 4EOWL 4N3UA 1BIIA 3UTTD 3GSNL 5LB1A 1A6WH 3ZKSD 2HB0A 3X1NA 1N6QH 4JZNA 3UO1H 3RYMA 4AQEB 3ETBJ 5DQJA 4OZGB 3FW6A 2FJUB 3BWUF 4J3BA 1JK9A 3EO0A 5IB3A 4QWWC 4RGND 1DQVA 1QSZA 4AQOA 4GS7B 4LSTH 3DGDA 4C4UA 4U6HB 3L5XL 3IEAA 4YO0B 1AE6L 1HXMB 4D0CA 5HDWA 4L3FA 2R56L 5IB1B 3GMMB 5JO5B 3AUVA 3Q6GH 5D71H 4KRPB 1SJEA 3LB6D 1HILB 4MDIB 1O6SB 1A7PH 2FBJH 1YYML 3W2DH 4K7PL 1OSEA 3SGJC 2BSCA 1N4XH 4IMKC 1J1XL 3CIQA 5GJTL 5D72H 4WIQA 1GAFL 1OP4A 1DL7L 3GMQB 2LU4A 3GSOB 3H3KA 4KQ3H 4M02A 1E2VA 4WFGE 2XRAH 2X1XR 2ISDA 5D2NC 4NM8L 5TH2A 4K3DL 4J3WA 5IM7B 3EH2A 1Z9SA 3ARGC 5F72S 1EERB 2DYPB 2VN6A 4OZIA 3V0DA 1MIML 1XV8A 5FYJL 2H32H 3MRNA 3BZEA 3MODH 2R8SL 4CVUA 5BRZD 5EEZA 4KDWA 4QCIB 4K23H 2WTRA 5B1KA 5C07B 1XF5A 3M46A 4JN2B 5TDPB 5LQBH 3IF1A 3MXVL 4K3HA 4PMEA 1JPEA 1OAKL 4EE2A 1A4BA 4IOFD 3TO4C 3VCLA 3CN2A 2X4OB 4G1MA 4QD2E 2UY7B 4P5SA 3SDXE 2R69A 4G8FA 4I0CC 3TM6A 2HT3D 4B7LA 4XP9H 1AZNA 4OB5H 3MJ9L 5ENWA 2FQGA 3V6BR 2I07A 1LEIA 3NSXA 3MNVA 1A0QH 2FO4A 3G08A 1JUFA 3PF2A 4JFXA 1BPLB 2J6EL 5HDRA 1L9RA 1DCLA 2ZXDA 4XZ4A 4A63A 2OW7A 1MAKA 4GKNA 4ZMOA 1KBKA 4G80A 1EFXD 2WBXA 1HYSC 1JCVA 4Z7UB 4FQCL 2VQ1B 4HUNB 5GS1C 4ZW8A 1H15B 1WGOA 4C4BA 1YPZA 2YA2A 2WK2A 5K39A 2A99A 3O81A 3ZTEA 4GSDL 2PP9A 4L4TE 3E0GA 5AOKA 1XO8A 2EDTA 3FQXB 3PIQA 2HH0H 4I2XA 4NCC2 1F4AA 2ZYSA 1QHOA 2NZ1A 4NN6B 4P3DB 3VW3H 1YMHB 4MZ2A 4ONHB 5JHDE 2QSQA 3NCYS 1XGQA 3HS0C 1QQDB 1HE8A 4L4VA 3X1GA 1A2YA 3EFFA 1ACCA 4R6UA 2X89D 4GG6E 3A4EA 4PMFA 4R7NA 4F8NA 1CL7I 1K8DA 4XC3H 4OW6A 3CFEA 1BM7A 2R15A 3VXOA 3UAFA 2XKNA 1ZA3A 1USZA 2G2RB 5KBDA 1XZWA 5HI4C 2V9TA 4XXDA 3SBWA 1MFBH 3B56A 3BPOC 5D1QE 2HX8A 3RZWA 1NL0H 2LHAA 2J4WL 3BZ5A 1YDPB 2NTFA 1CGXA 1P5UB 2BP5M 1CLYH 3AS0A 2PP7A 2W5PA 3FT2B 4RVBA 1XGPB 5LO7A 4FZ8L 3RKDD 4F2MA 4YFLI 3ZLQC 1R24A 3KPMA 1EXGA 4I0PB 2PETA 4Y19A 5E8NA 2OW6A 2EXYC 5IQMA 1KYFA 1J86A 5E5LA 3DV6A 2KMWA 5DT1H 3SKMA 3W39B 3RVTD 4J3OF 3JBG7 2Q8AL 5KJRL 3CFKA 3D0VA 3F7VA 1D5IL 1RZ7L 2GY5A 2OQJA 3P77B 1F1GA 3KJ6L 4LLQB 1J8RA 2EQDA 3VFRB 2WQVA 1T0MB 3TX4A 1ZHLB 2MCG1 4EUPG 5L9DL 2HX7A 2WUBL 5C0JA 1MCRA 3AY4C 2ED9A 5PAZA 5C0GA 4MJIE 3FXIC 4RAHA 3MLWH 3WOVA 4KK9D 1T3FA 3MJ7B 3VRLF 2ZWKA 4PB9L 4X6DF 3BKCH 1G9EA 1KN2L 1W0YT 5ICYB 2HVKA 1RJLA 2FSDA 4GMTH 4Q6IB 3KD4A 1M05A 4X7DC 4G9FB 5AEAA 1CXIA 2AS5M 2WQUA 1HZKA 1MWOA 4XB8A 4YVUA 1QLFA 4P59L 3T8XA 3V6ZA 4OTXL 3L4CA 2V7NB 4F15B 5DJ0A 3B9EA 1DBAL 2CO7A 3KHQA 1HCFX 3UJTH 4V2BA 4QEGA 1BYOA 3NZSA 4DIXA 4E36A 1PLCA 4RGOL 1ZDQA 4PS8A 4FMFA 1BBJB 5BJTA 2BP8B 2CRMA 1LO3L 5F6IB 2EIZA 5BQ7A 1Z5YD 4OKDA 4PJ5D 3N85H 3CSFA 3PDOB 4X6FB 2L4OA 2IH1A 3OZ9L 2E6PA 4NQDB 5HHVH 3BX7C 2NSXA 3WEXA 4BE5A 1IV8A 3IDXL 4ZZFA 4WI0B 1UZGA 4JFEA 3BZDA 1U91A 1A6PA 1KTDA 1OGAE 2GJRA 3JTTA 1KXQA 2VLRD 1BZQK 4XNBA 1IKFH 3ZUCA 5IQ7H 1FZJA 2DN7A 1M2VB 4L8DB 1YUKB 2H41A 4BBWA 1Z5HA 1NCCL 4UYPA 2HJFB 1T5XA 4CBZA 3O4LB 4GAJL 4HU2A 3LEVH 4KX8A 3WHXA 1U30A 4MAYC 4ZD3H 5LGHH 1OL0A 3TZVA 4OLYL 3WEAA 1YLBB 2ATPA 4WEEA 5K9OB 4MCMA 2QGCA 3SKJH 4DQOL 2R0ZL 2OZ4H 1ZGLP 1NEZB 1QA9B 1Y6MR 2PO6C 1JZDC 4I13B 2FWLB 4YHZH 2DLHA 1SJMA 3FAXA 3UZQB 3MRBA 4P3CH 1BXXA 1OWWA 1WD8A 3S5YA 2VDQH 4JFVA 2MCAA 3D85D 1NKGA 3QJFB 2CRYA 4OIFA 5DVMA 2EDMA 3MBXL 1UUSA 1MCPL 3C12A 3GS0A 2NLJB 4RIRA 5E23A 1LL1A 4IW4C 4HEMA 3U4BL 1CU4L 2FTAA 1E2ZA 3SOBL 2Y1AA 3FYIB 1FA4A 2DQFB 3LKOA 4POUB 4F24A 5F3HA 1TTUA 3R06A 4ABVA 4PYGA 1FC2D 1MKFA 5T1LB 3MBEC 2JELL 2F8XC 4JRYE 4XO3A 5FECA 4FABH 5E1HB 5E4AA 4QRRD 1QR1B 3TVMD 3OHXB 4X7TA 3QIBB 3V0VA 1BMWA 1V3JA 1J18A 1BOGA 4UI2A 3PGDB 3FQRA 4FG6D 3TIEB 4PJGE 5AVVB 5B39A 3S4SB 7FABH 3D0AA 4G1EA 2A9BA 1NAKL 1B2WL 2YLHA 4K8RL 4F8QA 1E0OB 3F83A 4RSVA 1L0XA 1MUJA 1NCWL 4ZXBD 2B14A 4CN6A 1RSYA 2G0LA 3V4PL 2HFEB 2N4IA 3FN3A 5CCKL 4LXFA 1HTYA 3SDDC 3UZVA 4FJ6A 3VRIB 1I3RA 1UH3A 3DUSB 4Z3FA 2Y23A 3V0IA 4GO6B 2AQ3A 1BGXL 4I77L 4N3TA 4Z3IA 4HLEA 1JK8B 3THMH 1CE6B 2WXKA 3X17A 3C87A 1A65A 4UV4H 4UNVA 1JVOA 2XYCA 1P9MC 1VFAA 3P4NA 4POZC 2PPEA 1BVOA 3K0YA 1WPCA 5IBUB 4A1RA 4EIZC 2QPEB 2X4RB 4U1KA 4RA0C 4UQIM 3WN5C 4U1LA 4E9QA 4GUOA 4X8JA 3MRFA 4X99B 1OB0A 3F85A 2NY3C 2R4RL 1Q94B 1WSST 3ZRCC 3N9GH 5JORB 1Z7JA 1IEHA 2XTJB 5GZOD 1OO2A 4AQ1B 2BS9A 4GAAA 4PJXA 2CO6B 2I32A 2WXGA 4OM0L 4PJAA 4RQQB 4RRPG 3O41A 4YC2B 1F02I 4B53A 1LTXA 2NNAA 3IT8D 3CMOL 4YL4A 2VXUL 1WC7B 2XWBB 4OCXH 4D9QD 1QEXA 5JTWA 3DRQA 4OZIE 1MI5A 1RZGA 2PABA 4Y4HD 3VXMD 3QZNA 5BQDA 3VVWA 4B9JA 1K5WA 1IAII 5I0XA 5CSZA 3BP6B 2YGPA 3ORJA 5E03A 3T0ED 3BSZA 2Y2TA 5DJCA 1X5HA 3A6CL 3VVVA 1H8NA 3R4RA 4M43H 2BZ7A 5HVWA 2CLVB 1N8ZA 4LEOB 4MCNA 4YHMH 3VXSD 5EF3A 1S5HB 1SNRA 2X10A 4NWUL 3VFOA 4HIEB 3O6FD 4M61A 4KMTL 5BZDA 3K4AA 1XH1A 2JKRM 1SFDA 4LARL 4FQHA 4OQTH 1I85C 2ZIDA 3LIUA 5ITFA 1HHKA 3FQWB 3QQDB 2IXQA 2AJSL 1ZLVH 4X9BA 1IFGA 4JO2L 43C9B 5BOZG 2VZVA 5JPMA 5LBSL 3ES6B 3PQYA 3HW7A 5F88B 4BZ2H 1F97A 2ATAA 1P6AB 5DRXB 4ATWA 1QW9A 3R1GH 4NXKA 1YPZE 4AYID 4NQEA 4URTB 5SWSB 3DETC 1U8MB 1CFVL 3K72B 1O7VA 3NJVA 1U8CB 2VABA 3RWIB 3UABA 4F7CB 3BXNA 2XG4B 3NZ8A 2AXGA 4UAHA 4I8DA 4L4VE 1C5BL 3IN2A 1B4JH 5E24E 5KVDE 1WTLA 3UTSD 3INOA 3TTSA 5I6OA 1TCMA 4U7SA 1FFRA 4UAOC 3RNQB 1TJGL 5IB5A 2BCKA 1U36A 3AM8A 2A74C 3WGVB 2BSTA 1T1WA 4LGSB 1WA0X 4UDUA 5FIEA 2QSCH 4TLKA 3MLXL 3NEOA 4I3RL 4P04A 4QMEA 4PGEA 3QULA 2A6JA 5G4MA 1W15A 5J7CC 4FN0A 1U4FA 1GIGH 1KBBA 3FUKA 3I9PA 4JK0D 5JQHC 5I19H 1EHAA 3MLYL 3ILEA 4HH9B 4ZS7H 1MHPL 2O26U 3AW5A 5CGTA 3CXHJ 2N59A 2EDYA 3G6DH 4F2ME 3HI1B 4NUJB 4LBEB 4JRWA 4FOMA 1M6UA 1DJSA 2PN5A 4OCMC 1YG9A 4O51A 4MRCA 5AOZA 1ZHNA 4Y19E 1S7TA 5BOJA 1I9JL 3EGDA 2YPVH 1HZHH 4DZBA 2I24N 1DFBH 3MV11 3BPLC 2GBUA 3OGCA 2NMSA 4JREC 5HJ3A 4ZNEA 4LVNC 5KG9B 4FQXA 2V7HB 4AQAA 3IDYC 3OF6A 4F9LC 1SMDA 2LLNA 5F1NA 1KDIA 3C60B 3GB7B 2NX5B 1OARH 4AQZA 3QP3A 2YIHA 1DQMH 3DOSA 4E9VA 2CH8A 4HJIA 3V4UL 4A2LA 2RB8A 4IOFC 3ZKMD 5DC4B 3QEHB 3VXTB 2YZ1A 2FD6L 3MTRA 1DBJH 1TYEB 2HT3C 4NRYB 3HUJA 4PTTA 4OGXL 1QTYT 5INDA 4AH2A 5D9SA 1ZLSH 5GZND 4YGVB 3E6HA 3L3KB 1CXHA 4H40A 2GJJA 1FFPA 4A6YA 2Y6SC 5JIQA 3FTGB 5AW4B 5FCUH 4YSTA 1I3VA 3ARFB 2A4EA 2ZICA 5LNGA 3BKJL 1V54B 2CUIA 3ARDD 4NZ8A 1QPXA 1ZY9A 3S4SG 2W0KA 4YSUA 5IMLA 4G6KH 4TSBH 4TQPA 2GJZB 1MRCH 3NDYE 3FCBA 3ULUE 2BFVL 4EDXA 4HKBA 3HG4A