2EUWA

Structure of a ndt80-dna complex (mse mutant ma4t)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*TP*CP*AP*AP*AP*AP*AP*C)-3'
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
total genus 88
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2euwA00
2EUVA 2EVFA 2EUXA 2EUZA 1M7UA 2EVGA 2EVHA 2EUWA 2EVJA 1MNNA 2ETWA 2EVIA 1MN4A 1M6UA
chains in the Genus database with same CATH superfamily
1ZHBB 3QJSB 2J8UE 4P9HC 4XP4L 4HP5A 5D2LF 1S7TB 5F9OH 4HOZA 1FL5A 3CX5K 4OLZH 1Z3GH 2AW2A 2WGXA 2WQ8A 2VW7A 2EZ0C 2A9NL 4H1LG 1SVBA 2VRQA 1CR9L 1VESA 2IALB 4XWOC 2WXOA 3D3VA 3SE9L 5BRZE 1S7UB 2YSSB 1U6AH 3EH1A 7PCYA 4QXTB 4K15A 2WLKA 4DAGH 2HX8A 2XZQH 2Y3NA 4FQ2L 4J8RB 4RMVA 4G9FE 1J1PL 5JXEA 5C0JA 2YGVA 1P6FA 1OP9A 3MGOB 4U1JA 5DJDB 1J1OL 4FNLL 3TEUA 2IF7A 3EO9H 2BOCA 1DVFB 1ZDSA 4BK5A 4IJ3B 4JRYD 2X4RA 3QVAA 5C0GA 1G6RH 4X9HA 1CIUA 3NOIA 1LEGB 1S9VA 3AUVA 5FOBB 5H37H 4NRXA 4WTWA 5I1LB 4ZG1A 3VUAA 1FA4A 1PZ3A 4UT7H 3RNQB 4M4RB 2FUTA 3BJ91 5I8KH 3N40F 4QLRA 1H19A 4Q6YA 3L5WB 2DB8A 3GBDA 2PCPB 2XI9A 5LBSA 4TTDD 5D71L 4EUPB 4JRXA 3GMOA 4D0BA 1BM3H 4YSAA 2UZXA 1Q1PA 1OVZA 1QSFB 3MJ7B 4Z7VE 1OANA 2BNRB 4G6FB 4OF7A 2Q1EA 4PJFE 4L3AA 4DN3H 2WTOA 5MENE 2JCWA 3LXCA 4N6QA 4PBXA 4GG8B 1ZCRA 3ABLB 5FOJA 2ATAA 4J3WA 4N0UB 4V2BA 2IO5A 4PRNA 1EH9A 3KCWA 1IBZA 2GVYA 3AMLA 2AJUH 4P2RE 3WJLC 4F57H 2B08A 1AI1L 2EDKA 1M71A 1NBYB 4J3SA 1PD0A 3L1EA 3QQDA 4S1SH 4AZ8A 5JUEH 4WJ5B 4HOXA 2BVYA 1N5AB 3A67L 2NY5C 4I89A 2XG5B 4DGIL 3GSNH 4NNXA 3EIFA 3W2DH 1P84K 3BGFC 3GMMB 3UZQA 3UTQB 5MP6L 3NEXA 4IKKA 1U8OB 2BNQE 3TBWA 2AF2A 3A5VA 5DJYA 3VRLF 1R3KB 4N3TA 1SLVA 2VR5A 4BA0A 3W11C 3B9VA 3EYVB 4QRFA 5BO1H 2X6AA 3KDMB 4Y88A 2V9QA 2WIIA 3KDPB 3K2UL 3B2VL 1G1YA 4NUMA 3A4EA 5TE4L 3ML8A 1SEQH 1DFXA 2XUWA 4WI0B 5C6WH 2Q76B 3AB0B 4HEPA 2J6EL 1E9PA 2ODHA 3ESUF 3EYFB 4EI5B 2E46A 3US0A 3GMNB 4OLUH 3UYPB 3M1OA 4UTCA 1F6FB 1WFNA 4TL4A 4DCQB 5AB9A 3IXAA 5FIEA 1I3RA 4CNIA 2ZP8A 2CHNA 3EFFB 5KTEH 1RUKL 3T04D 2YLHA 2Y9RT 2PYED 2NSXA 4AJYV 4FN0A 1GS7A 1PAMA 4K3EL 4K94H 5AVTB 3QUXA 4PY8I 4DHLA 2XWEA 2X7LB 4JFOA 4G5AA 2JXMA 3UTSB 2IH1B 2DWEB 3PWPB 4I87A 4DGWC 4AGQA 3PGCA 4KXCA 2BSRB 3BYTA 3D05A 2VRAA 3C12A 2B1HL 1MCPH 4KQ3L 2DJSA 1X5ZA 3G3LA 3VFOB 3G9AB 3P4LA 2HH0L 4ZS6C 5TFSL 2R23B 2VR4A 2CDEB 3GO1H 5I0ZA 2CKBA 4Q58C 1MW3A 4PJ5D 2K6YA 2PTTA 2V8MA 1IKFL 3L5XH 1THAA 3GUTB 3KAAA 1XV8A 2YD7A 3A6BH 1SHXA 1NDGB 2QGEA 2BSTB 2NPLX 3KWWA 4OZGB 2HJLA 2P8MB 4UM8B 3RTLA 1NCDL 1TJGH 2EXWC 4JO1L 4X7SL 5BS0A 2DW5A 3QUML 1UT9A 2DIBA 1KIUA 5GGTH 2J1XA 2LLNA 3K6FA 3W37A 5D1QC 1YYLH 4AT6A 4RGND 5K9KB 1VGKA 2P5WB 2MMXA 5D8JL 4C47A 3CX5J 4BUQA 3PAZA 5EEYA 2DMGA 2YMXL 4UQ2B 1KWGA 2WQWA 3QG6A 1Z5LA 2EP6A 1NEPA 5HVGB 5J89A 3FJTA 4N2DA 5TGBA 5ID1B 2F58L 4OZIA 4NFDA 1QABA 4OLVH 5LXVA 4E0RA 2JIXA 5E8PA 5E0QA 2G0LA 3CZFA 1YMME 43C9B 1J9CT 4RSVA 4PSPA 4Z7NE 3QS2A 1TMCB 4P5MB 2PW2B 5E95B 2N1TE 4A6YA 1ZA3B 4GUOA 1J11A 3VM7A 3BH9B 2H0EA 4P23B 1NGQL 3ARYA 1FFOB 3ME0A 4JKPL 3GLDA 3ERXA 3RWIB 4YGAB 1S7VA 4QUOA 3CZEA 1YAZA 3U7WH 3FOMA 1IIIA 3GBML 4HJ1A 4V1DD 4E5XB 1UM5L 1NLBL 2Y7NA 3DTXB 1U9KA 2K9UA 4CN6A 3VGFA 5EEUA 1LP9F 4WFFE 1F6LL 1R5VA 1E2ZA 4HJJL 1U8QA 4KO5A 2YQ3A 5GRJH 5HGDA 4PMEA 3AS0A 1M05B 4FQLH 1FI8C 4MASA 1NGWA 4XN9A 5ALCH 3HAEB 3PV6A 2H3NB 4YR6B 4LDOB 1H9VA 4XVUC 5L9DL 2ZG3A 3BHBA 2IPTL 3MRIB 3NZHH 2DM7A 4EDWL 1A9EB 3VX1A 4TUOB 1MH5B 2NCMA 1ODUA 1FVEB 5EZIH 3ZDYB 3BZEB 4AGPA 1H5BB 4PJEA 3BIAX 1QW9A 2Q5BA 2OCJA 3KXFB 2VLRD 3MV9B 3P9MA 1X44A 2JI1A 1XGUA 2K45A 1HNFA 4PJIF 4WNQA 4TULL 1WISA 3GK8L 2VAAA 3CFQA 1EZVY 4X6FA 3FPYA 5E5MA 5GQBA 2KHAA 3BVNB 3HE7C 3MV11 2LFEA 4KMQA 4ORZC 3L13A 1XDTT 4UM9B 4HHGA 5AYTA 1WZMA 5I6OA 5JIMA 3KYAA 1MCLA 5I8OL 5DFVC 5TDOA 3MBWB 2DMKA 2CXKA 4AIZB 3O8XC 4JO2L 1AXTH 4XGZA 1YPZE 2DLEA 2OMZA 3JQOB 3C9NB 4PHXA 5C0CB 1L0QA 2KI6A 1QI3A 3P0VH 2E7HA 3E6FA 1JI2A 3LEXB 4GMSH 3UEQA 1U0QA 5HHOA 3A0OA 3ZRSA 3V5HB 2QKIC 4ZFGH 3H55A 1LO0H 3O6FA 4KRPB 4KK8C 5EB9A 3JSSA 1FDLL 2IH3A 1UWGL 3QW9A 2AJZA 7CGTA 4QRPD 1PQZA 4GIOA 1M2VA 5E2TL 4AUUA 3C6LB 4BH7B 4WF7A 2EDQA 5AYUL 3PJNA 4XPBL 1SXNA 2H26B 2VXSL 3DBXB 3FT4B 4Z0XB 4ZK8A 5SWZE 1BOGA 3RY5A 4UUJA 4NPKA 1L5GB 3MOAH 1JNLL 3ISRA 6FABL 3K5SA 3KYOA 3RPBA 1OAYH 4RFNB 3NCBB 2A1WH 2XA8L 3TIDB 3B2DC 4QTIH 4XI5C 4P5RA 4U1KA 1EBPA 2YMTA 4K9EC 4TQIA 5AG9A 1CICC 5KS9B 3CK0L 4RBPH 2O6CA 4F7EA 3ATAA 2VDQL 3SDAB 5TE7H 1M6OB 1AAJA 1RURH 3KR3H 4N6RA 4ECNA 3RFZC 3NRFA 1NQBA 3O41B 1HYSC 4RWYL 2LQRA 5DD0H 1VIWA 3TA3C 4GLRH 2FGWH 2VAJA 5IR1B 5CP7A 1S2EA 3BUTA 5LB1A 2C4FU 4D9RE 3PGDB 3HB3D 4JFHE 1U3NA 43CAB 4PJ7F 4LCCB 5KVDL 5A16A 1AD0A 2YN3A 3HLAA 4LKXA 3V0VA 3IAGC 1QHQA 1V3JA 1CDCA 1S7WA 3FHEA 2XC8A 5IVZB 1IC4H 1XIWC 4JB9H 1RVFL 1IL1A 1X5LA 5AWNH 1FG9C 4DEUA 1PEWA 1CWVA 5CLYA 3ZT7A 5D6DC 4PRIE 2SODB 5E9DD 1R1CA 4KJPC 2CIKA 3QR1A 4JM2A 4XPTH 4ELME 2Y22A 5GRXG 1B2WL 1D2OA 2VDKL 3MUGB 4N3UA 4MGXA 4G6AD 5BZDA 1QO3A 1BF2A 1T83A 4HFUL 3WEOA 5AQ0A 1IAII 2PXYA 1MCIA 3BH8B 1S46A 4ZZKA 3MTXA 4AXWB 2XPZA 4TSAL 1IC7H 1OQXA 5KVMC 4LP4A 1TLMA 3Q2CA 1YUHB 3QXDA 3RP1A 3ZTDC 1CLYL 4XBPB 2BVQA 5KJ7E 5F1KC 3QO0A 4JFQA 5K9JH 2UY7A 2PW1B 4XBMA 2F7RA 4QRQA 2CO4A 3PIQB 4Q6IA 4M8QB 1BYOA 4UBDD 1O6SB 1DR9A 1VZHA 3MV8D 1T3FB 3LHAA 3BYYA 4H13C 4KO9A 4YSUA 2C3HA 2XVGA 4ODBD 3I9AA 4NBZB 3SYOA 3DX8A 1WEJL 5DJAB 2VQ1B 3MRHA 2CG9X 3O4LB 4O4YL 3NAAL 2GQHA 4WW2C 5D7SH 3T0VA 1SJHB 3VVWA 1J05A 5GRUL 1IEBB 1WAAF 2FWUA 3TL5A 2VXQH 1BOYA 2YXFA 3ZDZF 4G9DB 2ZCLH 1TTUA 3IN0A 3MLSL 3QI9A 5HJ3B 2WCPA 3FUHA 3PGFL 4PGBA 1SZNA 3QZLA 3E2HC 5FGCB 5FYKU 3QJVB 5JHMA 4L3EB 3G5VB 4PG9B 4Z8FH 1E4KC 3JZ7A 3RX7A 2DQCH 3D07A 2HPOA 4UZGA 2ICWI 4GKZB 1NUDA 4PJGF 5IFJA 5AW4B 4X9YA 3LY6A 3LDBB 2DPKA 4XMVA 3N2JA 4PR5B 5IIEA 4L3FA 3VE0B 3C5JB 1RSYA 3NH7H 2HTLC 2F1AA 4NB7A 4DGYH 5HYFA 1SQ2N 5I26A 2Q2EB 1XBRA 2R2CA 5H94B 2IC2A 2JV6A 4LE8A 2R4SL 2XTJE 5LDUA 4UQ9A 3JVFC 4P3CH 1RJYB 3CPLA 4HS6B 5IW1B 4AM0B 1DO5A 4S1QH 1LO3L 1Q94B 1REIA 2CO3A 3GHEL 4FAAB 4FS0A 4I2XB 3ZE1F 5CCGE 3PFQA 2BVEA 4KKAC 4U3CA 1BPLB 3T09A 4K8RH 3NSJA 4RRPG 5T5FA 5DR5L 1JZJA 3TT3H 2V2TB 1FVCB 1LK3H 2X9YA 3S37H 4AE1A 3FS9A 5CGBA 3KLAA 4LDLB 4F2ME 3MTRA 4TUJB 3ECQA 4PN6A 4JG9A 5F0PB 3KCPA 1BWWA 3GWJA 3BQVA 2X4OA 4WFGD 3SDDB 4AVHA 3N6YA 2ZSVB 4PS4H 1FCCA 1MEXL 1F3JB 1L6ZA 1QRND 1TZHA 3LZLA 2OXHB 3ZK0A 4DAGL 4O00A 3WFHA 3U9UA 1HILA 4YDIL 2GYSA 3BEVB 4NX0A 4YGVA 1H3XA 5D7JB 2DQGL 2YD0A 1NBVH 2XIBA 1LE9A 3GBEA 1XF2A 3WXWH 1YC8A 1TQTA 4IQHA 3WXVL 1MCQA 3RAJL 1MVFA 4K3GA 3ZKXB 5IB3A 4NUJA 4CKQA 5CSGA 4PJHB 3QH3A 4F7CA 3WTUA 1E5AA 2CWRA 2X2JA 3ALWA 4AX3A 3B2UD 3VDBA 1TCRA 2MEJB 3MU3A 2F19H 2NR6A 1NLDL 3IU4L 3WNPA 2H1PL 4JN1L 4MHHG 3HC2A 1NJ9A 4JFFB 4B0MM 4EZMA 2WV3A 1NSNL 1UUNA 3LV3A 2NUPA 2K6WA 1VHPA 4JKNA 1M7DA 1N8ZA 3KPRD 2MCMA 3TZVA 1ACCA 4IK7A 3RIAF 4LIQL 3IMUA 4RCAA 2X4TB 2F74A 4Z7WE 5I6NA 1HTYA 5C0RH 4KRLB 3BPNB 3VDCA 3MV7B 4WY7H 5EU5B 4L0YA 2AV7A 2IAMD 2P5EB 3OJDB 3NJLA 3VGGA 3D0VA 3TS8A 1BF8A 5FAAA 4ZUTA 1OCRB 2LE9A 3FN3A 5KUKA 4LSTH 4XZ4A 3ZGHA 2H45A 3BLBA 1YUKB 4S1SL 5A2FA 3JTTB 2HFEB 2KQMA 4U49A 2YUWA 2QMKA 2F5BL 3DETD 1P7HL 5BRZD 3LJ3A 4DN4H 4HHAA 1A7OH 5JPMA 4WUKL 2CLVB 5D72L 3Q05A 2NTSP 4LRNL 3WG7B 1SJEB 3HI1A 4KRNA 2O72A 3D39E 4JLRB 1N6QL 1DN0B 3CSPA 1ANUA 3K4DA 4J28A 4Q74A 1FPTL 2IPUG 4G9FD 5IROC 2B5IB 2IGLA 1GTFA 5FM8A 1F4XL 5BQDA 2JKJA 3OXRA 1AGFA 2XKNB 3D34A 1I1AA 2VJ0A 2Q9OA 3K1DA 2FHFA 1JL8A 1XGRA 2VXUH 2YPLB 3F7VB 5IM7B 1A22B 3PHQB 1S78C 1TTBA 3WHXB 5GS0C 3KPQB 5DZPA 1OALA 1TT6A 1SY6H 5FGBC 2HRPL 2B4CC 4UT9A 2EKSB 4MJJA 4KJYA 4YIQB 1KBKA 4QWWC 2IV9A 4KJWD 4X8JA 3QWOB 3WKPA 2PYFB 4FGMA 5KTEL 1NCCL 2WKOF 2HKFL 4PBDA 2HFTA 1GPOL 1S5HB 1GGCL 4LSRH 5EU4A 1A14L 5LGJB 4TV3A 4PJFF 4HEME 3O3EA 5TQ0H 4ZFFB 4BCZA 7PAZA 3RTQA 1NOFA 4WU7A 2OJZL 3ULVC 4WUUA 5ICZB 5MEND 2ENQA 4X7TA 3TPUB 3UZVA 3K6IA 1NM4A 1BZ9A 1T2JA 3NP3A 3O0RH 3UGEA 4PWFA 3VD7A 1CO1A 2IOMA 3PQYE 4FQXA 4P2RD 3SN6N 2GIXA 4JZJA 5TK2A 3CFDB 2HKHH 4YX2L 4J5VA 2VZOA 1OSYA 3BZFA 3MHZA 1A6ZA 4FFYH 5JOPE 3VFWA 3B9DA 4P57A 3MRFB 1UQSA 3S96B 4PJ8B 2DYPA 1XF4A 3C5ZD 5LLIC 2BNQD 2EDNA 3WTTA 4Z7AA 2X9WA 1BLIA 4PRAA 3DKHA 4MMZB 2ORBL 4NQXB 3VFVB 3FUDA 4P46B 4AENA 4HZLA 1BVKB 4JFDA 4RAUB 2XWXA 4JPIA 2H1XA 2HVKB 1K8DB 2YC1B 2BMKA 4X4ME 3THMH 3FQUB 3LD8B 4UIKH 3TTSA 3JWOH 3N06B 1X9UA 1AGCA 3RNKA 2J20A 3VO0A 4XBGA 1BX2A 2R0LL 3PHOB 3QNYB 4JPWL 4KRPC 4X5WA 3P77A 2ZYSA 1UGNA 3KVDD 5E1AB 3LNIA 2AJVL 2P48B 2OI9B 4NCC2 4L8CA 3OZLA 3WMQA 1L9TA 3D50A 2V2WA 3H9SE 5GGUB 4Z77B 1ZLSL 4UMGA 5DHYA 3NSXA 3C6LC 2YPVA 3T9WA 3BDXA 5HP5A 4BQ9A 3FZUD 4GG6F 1N6VA 2IAAC 1PKQA 4I3GA 3TYGL 3V4VH 1R5WA 1JIBA 2ICEA 3O3DB 4I9WE 1KEGL 1KLUB 5ABAA 3HHMA 4A68A 4NN6C 1EZSA 3KLHD 4OQTA 4RFNC 2HX7A 3QNZB 4UQAA 2NNFA 3L3JB 3PF2A 2Y7QA 1SF5A 5D1XE 1RFDL 1BAWA 2DI8A 3FHQA 1B4JL 2L0DA 3QFGA 5AVVB 4UTBA 3WUWA 2YOAA 2EDLA 3K91A 4LU5L 5HYJA 3MACH 3Q2VA 1QHPA 4F20A 1A3LL 1I1FA 3PNWA 4UDTA 1HSAB 4NHUB 1MJJB 3B9KD 3P54A 3P11H 3RDTA 3IMSA 3ZDXF 4IOSD 2JB6A 3WJMB 2ZOKA 1MJUH 3BSHA 4QTHA 5EZIL 5E6ZA 4XXWC 5FW6A 1LTXA 2BOBB 3BAYA 3ARGA 1SPDA 5EZPA 1KJ3H 1JCKA 3OC5A 4HS8H 4MS6A 2CXGA 1J9TA 3EZ8A 5LGKA 1I1CA 2R56H 4JKLA 4LCWB 3P9LA 4M61B 3MXVH 4MQSB 1OTUC 4ONOA 4YS4A 3TP4A 1G0XA 1HHKB 3D87B 3HI5H 1IIKA 3S3DB 4R4FL 3SDCA 4Q52A 3H6AA 3JV5A 1YMMD 2VW4A 3O45B 3V0JA 4Z0BL 4QAMB 2VLKA 1P7KA 3F05A 2JJVA 5ANME 4GFTB 1KT2A 1OGAE 5DUML 5T3ZE 5CEXB 3ECWA 4JFXB 3FQXA 3ZE0B 3C60A 3BSZA 1HCZA 5I1IH 4ZUVA 4IHOB 1F11A 3K4ZA 3KE0A 4DUVA 1RZPA 3A23A 5DZLA 3T8XB 1E3FA 5CIPA 2YQGA 4NC2B 5LAXB 3TJPA 2PCYA 3QFJB 3BKYL 5I8EA 2V0AA 5HPMA 2UUDH 4Y16B 1BXUA 1G5GA 3BO8A 1TETL 3B3BA 1J1XL 4WFFD 5HHVH 4M1DH 3V4LA 4PREB 1F4AA 1F02I 4XN1A 3HC3H 2MQ3A 5SX5K 3MNZB 4XAWL 1KNOB 2GY7B 4YBQD 2QPFA 1HQ4A 1D5IH 5CWSA 1WIUA 2ZCKL 4F7PB 2H2SD 4XPGH 2XY1A 3Q7JA 2APXA 4MXWL 2UV3A 1QI5A 1KBWA 2V33A 1A1OB 5HJGA 3TX4A 4LEBA 3QRGH 1GS8A 2R0ZH 5D7IB 3ZE2E 1MWAL 2EC9U 4M3HA 3D85D 1CT8A 1I3UA 3SYQA 1N0XH 2DH3A 4HPYL 4KI5E 1DE4A 4FOMA 5FO8A 1FAKT 3NIDE 4L0PB 4PLJC 5KVDE 1UXMA 3FRUA 1GW0A 1FORL 3CVHA 1NM9A 4JHAL 4F37F 4PP1D 3FB6B 2R1XA 3OKNB 1Q9OA 4ZAKB 4W9LC 4WEBH 1RUAH 4I3RH 2K7PA 4MA3B 2UWEA 1U93B 1Y18B 3ECUA 1JGUH 1UXSA 1ZT7A 1NPJA 5EO0B 3RUGF 4FZEH 3U0PA 2NXYD 3WNMA 3ZKND 4NFCA 3ZKMD 1L9OA 1MQ8A 3VFUB 3CQQA 5E0FA 4CBZA 5HHXH 3ZYJA 1H0DA 2V9TA 3QDJB 3CSYA 1OD9A 1S7XA 4XP5H 3MYJA 4H0HB 1IC4L 2X9XA 2HRGA 4NM8H 2WM0A 1UCBL 4JZNA 4F9LA 5JHDA 3TJHD 5B38A 3EOBA 3FUNA 3PCYA 3UIYA 2YRPA 3O6LH 1U4EA 3W0WB 5EOCJ 1BFOA 2CJUH 5JR1L 2IDUA 1C5BH 3MA9L 3AWFA 4QHLA 5IVXA 4OT1L 1H8NA 4NPYA 1PIFA 3NFSL 4ODUB 4ODXB 2YA2A 3MCG1 5SWZD 4HCRH 1JF1B 1BG9A 4MA8H 1MXDA 4FXKA 4OIIL 2YBRA 2MCAA 5EEXA 4NQEB 4F8OA 2H0JA 5IREA 4RMWA 3MJ9A 1IC7L 1RJLA 5C7ZA 2HFFA 5FGSA 3M86A 5I6MA 3LB6C 1F56A 2CO2A 3CFIC 3FBQA 1CC3A 4O2EA 3OGOE 1CFQB 5L8KB 1F90H 3AM8A 4X6BB 2WINA 3WS3B 5T1KA 1E9OB 3CN0A 3SKMA 1GSMA 2PWGA 1H3VA 1A2YA 4UQDA 2D0FA 5E2WL 3F3HA 5AW1B 3B7RL 5J0BA 2GSIA 4X7CC 2AEQL 4UQ3A 3ZKXC 2BXYA 4A2LA 5EO9B 2QSCH 4FTVB 4F8TA 3OJ2C 4D9RD 1UC6A 2V5YA 1O5DT 3VXRE 2EUXA 1VJSA 2ZT9C 2BHYA 1NAKH 2WLZA 2EUZA 1IJ9A 4F58L 2ZJSH 4P4RA 5E2VH 4ZOEA 1OL0A 3QDGE 4JQIA 2ARJB 1S8DB 2YAQA 4ELMF 3RVUD 5AW8B 5FUZL 5F7DB 2GBTA 1FFPA 1Z9SB 4JM2C 4PRID 5HVHC 1EAQA 5FYJU 2Y1ZA 5C3TA 4NWUL 3PHAA 3RB5A 4AUYA 4H2CA 4PI0A 3SE6A 5DYOA 4IRSA 4K5OA 2FJFB 4B53A 4PRPA 4LGPB 3IWUA 2APSA 1X5FA 2NX5B 4MD5A 5C8JA 1HI6B 3BAJA 1FRGH 3NH7L 3QIBA 5KAQG 3OV6A 4KJQC 5CUSL 4OV5B 1OOWA 1T2QH 4MLIA 4YDVB 1E0OB 2C1OB 3K81A 1YDPB 4PUBH 3TT1L 3PU7A 3ZZLA 1E4JA 1MVUB 4HJUA 4FKEA 4G42B 2P8PB 8FABA 3VXME 4AV5A 1WICA 3AGWA 1KPRA 4FFZH 4N8VA 1KPVA 1YYML 4FG0A 5FWQA 4GUQA 3S0PA 3ETBF 3GKWL 3NIFF 3E80A 2FZ3A 3NGBB 1BVNT 3UTTA 3MLPA 4JAMB 4U1NB 3X13B 2ZOUA 3S37L 1QOKA 3Q5TA 4TLTA 3JBG7 5HDBE 1IQDA 5IBTH 1DQJB 2HRLA 2IFGA 3VI4A 1IM9B 3FT1A 3FT2B 5KZCD 4FLRA 4YLQT 1M7IA 4LHJB 4KH2A 3MROB 1NWOA 1V3MA 4B9KC 4AQAB 5L2JB 3AT0A 2V7NA 5DI8A 2EXTA 3HR5B 3O2VH 4P4KA 4BXSV 4H8UA 1NICA 3WEXB 2B1AL 4Y5VA 2PPDA 4MD4B 4EBQH 1DDHA 3LN9A 4XOBA 3X3FH 2ZCHL 3HHSB 4G8EB 4BSWA 3K46A 2BP0A 1ZEAL 4HALA 1UASA 4QRAA 2XPGB 5C6TL 5AOLA 2Z8SA 5E8DH 4ZSOB 1LEIB 4FE9A 1P1ZA 5F6HJ 3B8YA 5EZOL 2VISB 1FFNB 2WVVA 5GS0L 3BVVA 4JRFA 4AV4A 2B0SH 5C0EA 1GTNA 1FCGA 2Z31A 3O2DA 5CINH 4FYRA 1TSRA 3T1FB 1NAMB 1IBBA 2JK5B 3L3IB 4N0RA 5FEBA 5I1AA 3PWJB 3TGXA 2BP8A 2CJSA 4KGLA 4H0GA 1N7MH 3UZEA 4PJ8C 3TWCH 5D5ME 2VLME 2HVBA 2WXNA 1AJ7L 1OTSD 3HMXL 4ISVB 4WY7L 5ETUB 1HL4A 4U4IA 4C83B 3T4AB 5L6YH 4QNPF 3D8MA 4M56A 4QHMA 3HE6D 3MRGA 5AVUB 4WI9A 4OD2A 4HYTB 4P46C 2K3TA 3OBAA 4O02A 2NYZA 4IBTA 2Y1AA 4NOFA 4XXDA 2NY2B 1D9KA 2D31B 3A6CL 4JQVA 3F5WB 1DBKL 2G75A 4LSPH 5B4MD 5J13C 4H20L 1WAEA 5HGHB 1WBYA 4G80B 3A24A 4RDQG 2Y6TE 5CU9A 5I76A 5IQ9A 2XIIA 3BC9A 4PJDA 2VN3A 2EEDA 2XV0A 1U3HD 2A3TA 4CBPA 3G08B 3FH5A 3JWDC 3PXHA 1KLFB 2BZCA 5B1JA 4ODSL 4ESKA 4Y2NA 2OI9C 4LCUA 2MCPL 5B38G 1BZOA 4N2GA 5FPIA 1QNIA 1RH8A 2X42A 2NR6C 3SY6A 3PWVA 4FERA 2AQ1A 4D8PA 1YEDA 1AP2B 4R96A 2OMXA 1X7TA 1CGSH 3S35X 4RGMC 1QPXA 4YHYB 1D5MA 4BBWA 4PJCA 1ZTMA 4HS3A 3UGUA 1DHKA 5TF1H 1GZQA 1CXIA 1DLFL 5C08A 3ZHLA 5I73B 5IJKA 1BD2A 1E5BA 5DJZB 1EJOH 5DK2B 1R5IA 4YXKL 4MXVE 5ESAB 4ZMPA 5D1ZA 1WD9A 2NNAB 3CFEB 4ZXBB 4K55A 1MCDA 1R46A 4KMTL 4OD3L 4EOWH 1LDPL 2JI3A 3IKCB 4ODHH 3RJDA 3WN5B 1DCEA 1KYOJ 3BQUA 1NKOA 3L4ZA 4PJBB 5A3ID 1SNRA 4QMEA 4WCYH 4HULB 1TITA 5LKNA 3ZR6A 2Z6FA 5E6UB 5D9SA 4PD4K 3TO4B 1EGJH 3O0RL 2EE6A 2OMTB 1PVHA 4KFZC 1TOXA 2OP4L 1CLZH 2VSDA 4W4OA 1JNHB 4IDLA 3ARSA 4G5ZH 3SKNA 1NGZB 3QNFA 3Q01A 5FUCC 5BV7H 2BHUA 3CC5A 1TVBA 2CH8A 4X8GA 3B2XA 5JPMC 1I3GH 4NQDE 4Y4HA 4YSTA 4IBSA 1T1XA 3RG1C 1YNKH 2XVBA 2HT2D 3E8UL 4U6XA 1OCOB 1L3NA 3B5TA 5IHUH 3D39D 2Q6WB 4ZPVA 1OGPA 4L4VE 4WNSA 2N7SA 3U0TB 3SDXE 2AK4B 3VTTA 4NAMA 3KS0H 1AQKL 4Z95H 4D3CL 4DP8X 1RZIB 2NZ9D 3S5ZA 3OX8B 4NPJA 3INUL 2VDOH 3L95A 4MMYA 5DD6A 1KEMH 4NJ9L 5ADPL 5AKRA 3L1GA 4YXLH 2MQCA 4QOKB 1FSKC 2OTWB 4LLMA 3SBWC 5D2LA 1RUMH 4UDUA 4P2OA 1FAIL 3GI9L 2EVHA 3X14A 4OF8A 5MI0C 1WITA 3H9ZA 5DFTA 3V52H 2OMWA 3ZR5A 5IF0A 1KTLB 4POZC 3IKKA 5IHLB 3NEOA 2OMVB 1PG7X 2UZIL 5TJWK 5IMLB 1DBML 3FO1B 2P24A 1SYVA 4BXVA 4P9HH 4MJIB 5EHFA 4MJ2A 5T3XH 2BVOB 5E1QA 3MLTB 2OSYA 1U8LB 1XD1A 1KUMA 4IDJL 4N8VG 5MEPB 3PWLA 1GZPA 3NYKA 5KEZA 3CIQA 3AABA 5D2NC 1FZOB 2YK1L 4JY5H 4TSCL 4XNYL 4UOJA 3SKJH 1WTGT 4G7QB 3E8VA 4HVBA 3O11B 3CHQA 2K8MA 2JTDA 3PQYD 4PSRA 3GHBL 5DJ0A 1I8MA 3DK0A 2AGJL 2ZXQA 3EJCA 4K7PX 5ES4B 2IADB 2FEDC 4LSSL 1QLFB 2AKRB 1N18A 3GS7A 5JOPD 2GJZB 3I75A 2D03H 2UXTA 4RQQA 3DDGA 3GS0A 3WUZA 3UJJH 4L5FL 3BDBA 3MBEB 4LKCA 2W94A 1BQLL 4JQXA 5KOMC 3O9WA 1TKWB 1JN6A 4K23H 4J4PC 2Q86B 1UKQA 1L3WA 2Y07L 1LGVA 5L0QB 5C0AE 1UJ3C 4XODA 3L6FA 4ICXA 4ZMAT 1HXMB 3QZWB 1SDDA 3X1BA 2FR4A 1MJ8H 3GSWA 4OM1H 1IAIM 3K3QA 2J43A 1Z2KA 2R56L 1KCKA 4AG4H 4QLWA 5J11B 3DUSA 1CE1H 2WQUA 4AEHH 1VFMA 3HJ0A 2NY0C 4HK0B 4ZUSA 3F64A 5E4AA 3H3PH 5E99H 4ZW7A 1ECYA 3RJQB 1NC2B 2AXHA 1B3JA 1MHHB 4JHWH 4X5XA 4LCYB 3IPEA 1JGDA 1HL8A 4A63A 3IDJB 1OM3H 1FFQA 2GKIA 2XOTA 5AEAA 4LLYA 3D12B 1JZHA 3BKJH 2ICEC 3E1F1 1FGNL 3M07A 1WZLA 3J27A 2WBJB 1QEXA 4UV7H 5GGVL 1DANU 4NAQA 4I9WD 3ULAB 4XMKH 1NFDE 2NY5H 3SZ6A 1PD1A 3WE1A 2WTPA 4J3OH 5L2KA 4E2OA 5F7FA 3BAEL 1QSZA 3QHTC 4Q4IA 1RZFL 3OPZL 5D1XD 1FL3B 5DMKA 3FAWA 4U3SB 5JW5B 3Q9QA 4XH2A 2C3GA 1HXYB 1TVDA 4M5YL 2GI0A 4U6VL 3HS8A 1T1YB 3CXDL 3PP4L 4IMKA 4JS7A 1JYNA 3BFWA 3E7JA 3MLRL 1GGYA 1X5AA 1AY1L 3QZWG 3UYOD 3GPEA 1G87A 1RZ7H 5EOTA 1NBZB 2WKGA 2XFGB 2YFNA 4AEIL 2BIMA 4I3SH 1S7QB 4N9OB 3PABB 3ARDB 2WUCH 2WTRB 5C0BB 1P2CA 4NO0B 2XA3A 4G8GE 3ARGC 3B2PA 4WI2A 1VKXB 1Q9KA 4IRZL 2B9BA 2WNKA 3NJJA 3UJTL 3RB7A 1PIGA 3QWQB 4K3HA 3D4GA 3D18A 4JM4H 4Q2ZB 2P28B 3IU3A 1QZ1A 2KKQA 3MFFA 5EA0L 4JMXA 1T20B 3CD4A 4DKDC 1EUTA 3AS1A 3MLUL 1INEL 1I8LA 3W9EA 1EAPA 2YKLL 3VSQA 2CUHA 2IOIA 1AQDA 3BESR 2XG4B 4L9LA 1SJXA 3C60C 2A2QT 2FNWA 1U8CA 3LN5A 2A7BA 3NQKA 1OGAD 1PPIA 1ZT1A 5TK4A 1QSVA 1G5AA 2LAAA 4W9JC 4XTRD 1ZSHA 3PNRB 4ZT1A 4QT5B 3PDOB 1J8RA 2BNRE 3IDMA 2X6VA 2D7TH 1H6UA 4YZFE 1V55B 2R4RL 3U7AA 1KXQA 4FLSA 5GSRA 1KELL 1PSKL 3G04A 2WB1A 4I4WA 4MWFA 3S98A 4HUWB 1NIFA 1NPUA 1CFNB 1J7VR 4L29B 3UPCA 1JP5A 4JFTA 1EWHA 5CJOL 3UBXI 4L18A 4DW2L 4JRYB 2ARWA 2WMPA 2BCKA 2NY3D 5DU7A 1XL4A 4GT7A 4X0KA 3MLVH 5JW4R 2VO5A 4X6EA 3TBCA 1P4LA 5CJBA 4RX4D 3PV7A 1MCBA 2EDRA 1UA6H 2WWMC 1JSYA 1FE8H 1M6UA 4WKZA 1IM3D 4G6JH 5I30L 3FF7A 4RWHA 4S0SD 4FNTA 5DD5H 1WPCA 3NN8B 1MDAA 4KTGA 3VRJA 4HUMB 3HZKA 7FABH 5EZJB 1GA2A 5AAPA 2G5BB 4H5SA 1W0VA 2XTSA 1AHMA 3VWJB 4AH2A 4Z3FA 3FF8A 5FM5O 2OL3H 4XE5B 4WW1A 2QQLH 4KC3B 1E9QA 1SVCP 4OF6A 1YN6A 1T0MB 3B6SB 1LP9A 2E4FA 2KQNA 3ESMA 3IDNB 4ZUWA 1PZUB 3FDWA 3GM0A 3NA9L 5DO2C 3ROLA 5KJRH 3I6GA 4MNGB 3KD4A 4Q9QH 4LLQA 3L3GB 4IRJD 3LKRB 1T21B 4OKVB 4UMSA 3T77B 4Q8BA 2Z8VC 3LOWA 3WNNA 2KZ1B 3M17A 2K6ZA 4YK4C 3V8CA 3L1FA 4HKZA 2VLRA 4OZFB 4Q89A 5AW5B 4B3VA 4ZS7L 3RVTC 4JFPA 3W56A 5FYKL 4Z18A 1XWVA 1FL5B 2LVCA 4GAJL 4AQ8C 4GKNA 5CEZH 1MY5A 3RKDD 3VXPA 5IGXH 4HJGB 3AREA 4HXAL 2QQNL 1WT5A 4PJIA 3FTYA 4JY4B 1Q38A 5FYJH 2ATPA 5CD5D 4EQ3A 2IDTA 1WCBB 1ASQA 2P46B 4WU5B 2B39A 1BJ1H 4ZTOH 4GB9A 3LRSB 4QXWA 3SCMC 5FLUA 4I0PA 4IKJA 2H32A 2XKSA 4NUQA 3WLBB 1TUPA 2YAMA 1G7JA 3IGKA 4W9GC 2IH9A 5AZ2H 3RURA 4PUBL 1JNNH 4Z3GA 3I6KA 3DX0A 4Z3HA 4TVSa 2PYEB 1QNZL 3DMMA 4OZGE 3N85L 4QCIA 3SO3B 1FBIH 3A47A 1NCWL 1VEMA 4H8WC 4B9FA 5E23A 2QPDB 4N2IA 1CD1A 3P4OA 5J6HA 2GJPA 2WO4A 5EBLA 4OUOA 3ETSA 4ADIA 4GBXD 4HC1H 4PRHD 1F8TH 3DGGB 5EIQA 3RWDB 5DWPA 1OWRM 4DZBA 3MYZA 4AK1A 1EXUA 4MCMA 1PCSA 3SSGA 1C1EH 5JHLH 3GMOB 2F68X 2J88H 4X80H 3WFZA 1ZLUH 5CMAB 2NY4B 5GJSL 4KKQA 4OB5H 4RMQA 2D3LA 3RVXC 1SXSA 3ZL1A 3VXRD 4IBVA 1CZ8H 2W88A 1XF1A 3MBXL 4MYPA 3ESVF 4TXVB 5I17B 3H6JA 1JPTH 2V37A 2VC2H 4FTDA 3QJHA 3HI6H 4HWZA 2WYHA 3WFCH 5K9QI 4U1IB 4NUGL 1IGIH 4OJAA 4P3DB 3L9RB 4BZ2A 5D4HA 4YWGL 4P9MH 4PP2A 3QUYD 1EDHA 1NKRA 4URKA 3WDIA 5H4YA 2AQTA 2VZVA 4OF0A 2BDNH 1E6JH 2WXFA 3UZQB 2BWIA 3I85A 2YSTA 1QYGL 3QIBC 5E9NA 3TBWB 1FNSL 2DQDH 1WWCA 3LEVH 3IVKB 2OZ4H 4K9EH 3VB8A 2YIHA 4GAYA 2HG0A 3V4PL 2NY1B 5CILL 2W0KA 5EDXA 5DGQA 4ODTH 3ZIMA 4PJ7A 4KK5C 3CN4A 1A3RL 4YE4H 4QJ5B 5E9DA 1N6UA 4H1LH 3WHE1 3HNSH 1ZAGA 5KSAD 1E28B 1Y07A 4NO5A 2JJTC 4AEFA 2MKWA 3EZJB 4TRPL 5F1IA 3FRPA 2AXWA 4ADGA 4M7ZC 4XX1E 3CVBA 4XNDA 1JZ5A 4K3DH 3QEGL 3G6JE 4JFOB 1N64H 2DKMA 4CC4A 1FZMA 1ACYH 2P7TA 1FHGA 2CRYA 3I9GH 1IGCL 5GIRA 4RZKA 2VH5H 5C3IA 5T1MB 5IT2H 2Y5EA 4M6NL 2E75C 5EU3A 3VXUE 4NJAH 4AOFA 4NO3A 1WIPA 3TEZA 5CBAB 5E6YA 3FO2B 4OR1A 1A8JH 4GW1B 4NNPH 3IFNL 4PAZA 1NDMB 3ULUC 5IV2A 1ML0A 3U2IA 4H26A 5DHMC 3AG2B 4KKPA 5EF0A 3HRZA 3WL9B 4OGXL 4D2NA 1DQIA 2DD8L 3LIUA 2C34A 3RWCA 4V11A 1WV7T 4QF1B 4PU2A 4DT2A 1U8HA 3LQZB 1GJWA 3SKUD 1ITCA 1KIUB 1JZ2A 5HI4C 1P9MA 1WAAA 3T4YA 2WD0A 1MZZA 4PB0H 3K1KC 4E9WA 1JRHL 1IFHH 4EIGB 4NHCL 5IK3B 3DIFA 1LEKA 4FP8L 3D48R 2TRYA 4U6HB 4KKLC 5IHZA 2VLMD 2FK9A 2XICA 2ID5A 4RNRB 2G0KA 1OF2B 2NZIA 2BINA 3AS3A 2YAEA 3DVGB 3MBEC 1ZA6B 4XC3H 2E0PA 2D2CC 3U36A 1DFBH 1SEBB 1TO4A 1GW6A 2R83A 3KBEA 2ZKHL 3L3OC 2E3VA 2Y1VA 2JKLA 3OLEA 4PJGA 4ZFOB 4MJ5B 4NZ8A 2JIXB 5E8PB 1CLCA 3STZA 1D9KC 1OTTC 2HTKC 5K9OB 4OLXH 1NL0L 2MHAA 3LKOA 2NW3B 2IMMA 3UO1L 1U8KB 3M45A 3HC0B 3K2MC 3OM3B 4NQTA 4NZTL 4ACTA 1YEFL 4WTXA 4S2SA 3QEQA 4QRPB 3GBNL 3FQNA 1EANA 1IFGA 5J11C 5HHNA 4Q9BA 2CR0A 3O2WH 4YHIA 5KSBB 3HC4H 4M6ML 4YNYA 3RWJA 2F54E 3C5XA 3BAWA 2J25A 2Y7SA 1GOFA 4XMZA 3VFPB 4HUUA 2VDOL 5E08H 2ZYHA 3RI5F 3WN6A 2DJUA 3BUQA 3V0WL 3WI9A 4AYDC 4JO4L 3FTWA 4EDXB 5DEFB 4MXVF 1I8UA 1EZVX 1NGWB 2NUTB 5IB5B 2A0LC 1QRNA 1NMAL 2CHZA 4QRSB 1I9JH 2XWBA 4CMMA 3U0WH 3BHBB 4G83A 5KVFH 1EJ6A 4WEEA 4MQ7A 3DXAE 3ROOA 2WXKA 3CZSA 3VMNA 4CAGA 2R29A 2CJTA 5IWLA 3QPQD 3OSVA 2Z93A 2CM5A 1INDH 2QADD 1U92A 4PJXF 3QJUB 3FQ4A 2ZWZA 4W1TA 1LE5A 5GGRA 2O6DA 3TNMB 4W9HC 3WFDL 4X6FB 5E5MB 3VD4A 4L5FE 4I13B 4WO4A 1NH6A 3R7RA 1G9HA 3US9A 4DZ8B 3EW3B 1ZHKA 1EERB 3ARDC 4U0QB 4OVUA 5AZEL 2ITCB 3AU1A 5CZVL 2J4WL 2CO7A 2CDFB 5TDOB 2FLBT 5HY9B 4M7KL 1S3KH 1BFTA 2WBWB 4BCXA 4R0LA 5EF1A 1B0GB 4AMXA 3MUJA 5IMKA 4NQDD 4JVPA 3KPRA 1DYZA 2WO2B 3VI3E 4ANKA 3UFIA 1UG9A 5I8CB 3NDZE 3OG6B 2HKAA 3IDYB 4KNUA 4PTTA 1XR9A 5HHOB 2DS4A 4K3JL 4OI8A 3MSPA 3ARUA 1A4AA 4XAKE 4XHJD 3IB4A 2IAMA 3TN0B 2DBJA 3PREA 2GJ6A 3MRQA 2AANA 5F8RC 1K4CA 3KMDA 1IT9H 1K8IA 3GJEA 4L3EE 4U7SA 4Y19B 4ZD3H 2VDPB 2A77L 4C56A 2RBLA 2VOTA 1TJIH 1CU4L 3KPOB 3QIWB 5DFVD 2DQEL 4U1LB 4UUJB 3ARFA 5BPPA 4QXGH 3UG5A 3MV8B 3T2QA 5JOFA 1A6UL 2IWFA 4YHOH 3SODB 1R3IH 1T6WA 4EF3A 4GSXA 2W07A 4ZO8A 3RL1A 4JFYB 1S9YA 4HU8A 3VNZA 2D3NA 3CE1A 1OM3L 4J6RH 3F58L 1Q0XH 4F27A 4H40A 2BRQA 4ZUUB 5MHSE 4F7EB 3QORB 1SMAA 3CVCA 1OAQH 1Y1UA 1NGXA 5D70H 3ZKSD 3NBNA 2B3IA 2I69A 3IFPA 4KDTA 5IB2B 2EECA 1J8SA 1WFOA 3VFGH 1G9MH 1VPOL 4I2XE 1BQRA 3FRPG 1KY6A 5F9WB 1E40A 4TTDC 1WZ1H 4GXVH 5E2UL 5HDOA 1PLAA 4PLKD 1R47A 3T6XA 1Y0LB 3MMEA 2BNUB 2VTFA 1PJ9A 4ALAL 1OCCB 1H3PL 1FNGA 5A16B 1AR1D 1VGEH 1M2OA 2WKOA 2HT3C 4ODVH 2AP2A 4DP4X 3LS5H 2WQRA 5LNDA 1N4XH 1H6FA 2C8NA 3V6OA 4RA0C 5B39B 4LEXH 4IEFB 3QWRD 4OM0H 4XI5D 1MHPL 3HPLA 2ZOLA 1HVXA 1TQVA 2X70B 1LNUA 2B4CH 1DJZA 4YDJB 5DS2A 4AIEA 2A6DA 3ZSTA 4DNLA 1JPSH 4ZMZA 2RB8A 2FX9H 5KBMA 2H0PA 4KMLB 2I27N 5LBSH 3EYSL 4G3YH 5C0AD 2X41A 1TNMA 1JHLH 3APDA 1H8SA 3V0AC 4Y8AA 1NEZA 4PJHE 3HG1B 1BP3B 1QO3B 3GXMA 1Z9OA 1KBBA 2NLJB 2YD8A 4FYTA 4Y1AE 2PXYB 1I8AA 4G59C 4JFEA 4BKTC 2BJMH 4DEPB 3C5ZA 4NRYA 1UXWA 2VWEE 1PDKA 1E27A 3OHXB 5ESVA 3ULVH 4M3JA 5I9QB 4KPHL 3CFBB 3N50A 4N0YH 5EZLB 5I28A 5I6PA 2WLMA 2OSLB 1R24B 4D9LH 5HYSA 2OK0H 4Z1PA 3MREA 4MZ2A 4U05A 3KPNB 4O2CB 1HWWA 4E9VA 4TLUA 2YPKA 2J73A 4GJTB 5DLMH 2FJSA 2WZ0A 1CE6B 1M1XA 5TF0A 4R97C 4OJCA 5AYQA 1PY9A 1O9ZA 1T4WA 1EEZA 5ANHA 5L4FA 4BHUI 4MNQB 3VJ6A 1EHXA 4PJAB 4BQ8A 3AXIA 2OX5B 3VACA 2Y7OA 2JCCB 5DRWB 2GBAA 1RJZA 4W81A 2XDHA 4G8IA 4AWJC 3FB7A 3T3PF 4WHTA 5F9AC 2XZCL 1TG8A 2DQ6A 1HEZA 1IARB 5DQJB 3OR7A 3QI9B 3S88H 3BUIA 4PGBB 5ID0B 2PCXA 3EO1A 3N1QC 4HCIA 4YH6A 4OZHF 1XB3A 3BD3A 3JWNG 3QUZB 1BLNA 2IQ9H 4WW2F 1YEJL 3Q3GB 4GG6A 4PLOB 2BC4B 2OTUB 4L1HA 1DVFD 1E5YA 4AL8C 5BZZA 2I07B 3C6SB 3OTTA 4WFEE 4G1MA 3ATBA 3S35H 4FXGC 4YL9A 3TOPA 4QXVA 4NYLB 2QHLA 2JB5L 5FYKE 5DD3H 5EWIH 2DWXA 2O5XH 2FWSA 3QEUB 3UYRL 5F0LB 1MUJA 1I8LC 5GS1A 2QVIA 3B9KA 4WEUD 1CGWA 4WWPA 1MW1A 4PB9L 4ABWA 2R0KL 2EADA 2OA9A 3E1ZA 3J07A 2P80A 4KROB 4RGNC 1QFPA 2KLTA 4NQQA 4YZFF 3TJEL 3K6SA 3EYOA 4FQIH 4OLYL 2CKBH 5BW7A 3QZBA 4LHQB 4BFFA 2YWYA 2CPCA 5AKTA 3FQRB 1QSFD 2C7UB 4NQVB 2J8HA 4BFBD 2BNRD 3BSGA 4G6FD 2FEJA 1JFQH 5JHBA 3VYPA 2NY1C 3OKDA 4G9FB 4EIZC 4U0RC 1MAMH 3DX2A 2WQXA 1A8ZA 2SEBB 3P3YA 3NZUA 5HHPA 3T2NL 4OFIA 5F3HB 1I7RA 5TDPA 4HWBH 2A38A 4X6CE 3VRIA 3I2CH 3FFCE 1IAKA 3OZ9H 1XH3B 3L9BA 2F7PA 4I5BA 1EAJA 2OJEA 2AQ3A 1OSPH 1LE9B 1LHZA 1YEKH 3D7PA 2E9BA 5IFAH 2VXTL 2QELA 4NUJB 1G7IA 3HG4A 3MR9A 2AHIA 5ISZE 1GGBH 1C5DA 3D4ZA 1T89A 3MRKA 1A1NB 5MEOB 5DK0A 2EO1A 4Z7VB 3ILPB 2JLPA 3FTSA 3FCTA 1U8NB 4JUSA 3DUUA 1XEDA 5FHBH 4A6YH 1DSFH 1QUNA 4EI5D 4Z3IA 4MZRA 2FLRT 2WP3T 2YUZA 2OYLA 1ZK5A 5ESQA 5ECJE 1KJMA 3UCRA 1H6EA 5I0XA 4TQEL 5A2IH 4HT1L 4XRCB 5C6PB 2D4DA 4HIHB 1I1YA 2VE6B 1HK6A 1TU2B 3LKSA 4WJG3 2CRMA 1KIPB 2FCBA 3UTSD 2AV7B 2CNZA 3PWPD 1UYWL 3D0VB 3HUJE 4ZMYA 1MFAH 5DZJA 5JIKA 4ZUTB 2CIIB 1CL7H 1F0LA 2DI9A 2P8LA 2VDNB 2VITA 3KJ6L 1WT5C 3ZX1A 3DSFH 5T1LB 5FO9A 2O61A 1J87A 2H0FA 5JW4M 4KZDH 3L45A 5DRZA 2JE8A 1OSZA 3NZ8A 3ARZA 4FKHA 4K7PH 4L4JA 4R90H 4AIXA 3TESA 1SM3H 4KTDH 4RAVA 1L7IH 1W80A 3WKYA 4TUKH 1HKLH 4OZGF 3ULUL 1IFRA 2R59A 4PY7B 4LZKA 3QARA 1LWHA 2BK8A 5DT1L 1YMHA 3ZL2A 5FM4A 3ORJA 1AGFB 4XP9H 2CPUA 3HG2A 3RUGA 2WB7A 5ACZA 1XGRB 1X9QA 1BVLB 4J1UB 3EOAB 5F7YC 2QFPA 4KKBD 4YHLL 1JWUA 1P7QA 4ZMXA 1T4KB 4U33A 1YJDC 1YN7A 5FFOA 3RL2B 1A47A 4X99A 3LS4H 3DV4B 3C2AH 3HNSL 3R06A 4GUCA 3WDHA 4M62L 2D9CA 1N0LB 2V5TA 3SQOL 3QSKB 4MAYD 5EU4B 1Z3RA 3H85A 3BOVA 4LSVL 3JVGC 4HIXL 5EIVA 5I24A 4JRLA 3EJQA 2YJQA 4UIMA 4FQCL 5ABDE 4LCWE 4R26H 4X42A 1JFHA 3VWKA 3RTQB 4ZMLA 1KGXA 1FH5L 2DQIL 4UV4H 4N2BA 3PL6A 5B1CA 3S3JA 2ROXA 4QHKJ 5EOCH 2NQDA 1U8IA 3N1PC 4X7DC 5C7XL 2C4FT 4ZYKA 5GS0D 3WIIL 3WFEL 1OM9A 2ICWA 5AL8A 1E5UI 4FQXB 5I6XC 4JZJB 4P23D 2H6PB 1CURA 2WUBL 5EUOA 2JELL 4KAQH 2JH2A 1R3LB 1JK8A 4J2XA 3BUYA 3ATDA 2D7PA 1DL7H 1HZHH 3CDGB 4NKOB 2FQEA 3WFBL 4DWHA 2CLZA 3HB3C 3QFJE 3VFWB 4P57B 4YFEA 4GRWB 3FTGB 4CGTA 5DJ8B 3W81A 2PABA 4PGEB 1D5RA 2JJWA 2CCLA 3QULA 4Y5YC 1MCFA 1MREL 1T1WA 4HWUA 5E5RB 4XN4A 1KCUL 3B7TA 3ZDYF 1FN4B 3GMRA 1X5GA 1QVOA 3ARRA 3C09B 4YLCA 3INOA 2H9GB 4HLZG 1G84A 2ZSWA 2DLHA 5E8EA 2E76C 2Z92A 5DHXB 3ARWA 4NENA 2BMKB 2JI2A 1YMMB 1UUSA 2QPUA 2WXMA 1MI5E 4Z7NB 2Y06L 1X5HA 1RZGA 4AGMA 3M1BA 1AKJB 5D7LA 1AGEA 4G6AC 3RNKB 3NT0A 2E59A 3H2QA 3MV9D 4PG2A 5AOJA 3WGUB 1ZGLB 1BX2B 1VCBC 4RISH 4X5WB 1HH6A 2FH6A 5JIQA 4L8CB 1SDYA 3LXAA 2HT4D 4UM9D 3AQZA 3T2LA 1UZ8B 2AK1L 4RIRA 1R5WB 1XH0A 3QIWC 4PYHA 4WWNA 3RILA 4PV1C 1EZUA 1E3XA 4UBDC 2PP7A 3VXUD 3V4VA 1IJNA 25C8L 1PZAA 5C0CD 3MGTB 3GLAA 1O9WA 2NZ1A 2N1KA 3O6KH 1HSBB 1CF1A 1A21A 2XWTA 3WUWB 1KB5A 3HRZC 4RBPK 5HDQL 5GISH 3DRQB 4J3TA 1SRDA 2V3FA 2VM3A 1HDMB 3MC0A 4BRVA 1V7NL 3EOTL 2BWQA 1VF5C 4JFVA 1EUUA 3HFML 2G3ZA 3B56A 3IDIA 1YVLA 3U0WL 3ZMRA 3WNKA 1KCSH 1YECH 5C0DA 3R8BB 4UTAL 2OLDA 5F9WC 2X4NB 2O5ZH 1P5UA 3RGHA 1KFAH 3IETB 3ENEA 3T65A 4OSUH 1HHIB 3TV3L 3VGDA 1QEWB 3VD5A 3RFRA 5KS9F 2FX7H 2VCOA 5KSVA 1SBSL 2XT1B 3PUCA 3VDAA 1BGXH 3D5OF 5I15L 1TDQA 4HJEA 1H15A 1XZ0B 3H42L 5LWYH 1YPZB 5F3BB 3B3IA 3F7YB 3FB8A 1JRHI 3UAJA 1ICTA 3SDCB 3SDAD 3BT0A 3QDME 4XVTH 5I19H 1AGDA 4F9PC 1YNLL 4XMPH 4TNFA 4AM0Q 2CE6A 2VLKB 4I48A 4NEHB 1NCHA 4WV1B 2V4LA 1MRFL 5JW3L 2B16A 3FQXB 4Q9RH 1C9SA 3CSTA 3G5YA 3OL2A 1QLEB 4TQPA 3JWNC 2XJLA 2UY6B 3A6OA 3MJ6A 1TPXC 1CXKA 2BSSB 3TBYB 2HLAA 4DEPC 3BW9A 3OF6D 3SPVA 4U31A 3KYNA 1CLOL 4GXUM 2RQ8A 3VFMA 3ES6B 3T8MA 5I9QC 3AQDA 3FQWB 3BO8B 3MCKB 4LLVA 3HE6A 4LNRB 2UVEA 5DC0A 4CRPA 4BZ1H 4Y7MA 2K9FB 12E8L 4ODWA 1HHHB 1R4XA 1CDJA 2AQRA 2Y6SD 1GAFL 2DQUH 1FYHB 4UILL 3STBA 4NIKB 3KWTA 4QRUB 5CWSB 2ZKYA 1VA9A 2CZNA 5B1KA 1ETB1 3IMRA 1GZHA 2DIEA 4GO9A 4QTFA 4UINL 1LO4L 5GRWA 2ENPA 2X44D 3W39A 3IFOA 1S7SB 2NX5E 2Y4SA 1URLA 3DXAD 1U3HA 2VDMH 1CT8B 4OVVA 1TZGL 4LVOC 3CQFA 5CSBA 2QDVA 4MRCA 5EOQH 4AMKH 4EKXA 4N2MA 3B2UC 4EPSA 4XWGL 3QYNA 4H8HA 1VFAB 1FL6A 3QS3A 1OAXL 4TNGA 1T7ZA 1XGYL 3MRNA 3VFGL 4LASL 5MEQA 1WYJA 1Q9OB 4GMTL 4L4TE 4HUNB 5L88H 2OMYA 4DTGL 4HKJB 2XQBL 5K39A 3SGKA 2Z91A 4EJ1C 3GHPA 2JKSA 5E94B 3L1OH 1P4BH 4X4ZA 2HG5A 3T2PA 4AQOA 3PYCA 4PRIB 4QRRA 3WY1A 1UEMA 4PWJA 5DMIH 1WA1X 1CXFA 4K0OA 4CDHA 2IQAA 3APNA 3JWDH 2A9AA 3OMZA 4JREB 4LPWA 1U36A 3CSYB 4OIFA 3O4LD 1S7XB 1URZA 2XU9A 1V27A 1VACB 2ENYA 1B9KA 3WE6B 3MYJB 2DYRB 3NCJH 2OBGA 2IAMC 1MFDH 3LEYL 1KXTA 3NJGA 4NZFA 4U3XA 5C09B 1MJ7H 4JZNB 1ILSA 3UTOA 1IKNA 2Q7NA 3UBGA 3EOBB 3MRRA 2OMUB 4BKLA 4YC2C 2R0WH 3MCYA 4FXTA 4KI1A 4EEEA 4L3ED 2OKMA 3KPPA 1MRDL 3DETC 2KPNA 3BKMH 4LOUD 2J6EA 3KYKH 1AOHA 4PY8J 5JDJA 4F8LA 3BUPA 4Y4FD 4DP7X 1ILUA 2G30A 1QBAA 5C07A 2E47A 2ODIA 1RJLB 4HCRA 4AKOA 2HFFB 3REVA 1T04A 2C1PA 4AQEA 5TPWH 3BJLA 3MX0B 5GRVK 1V05A 3VFSA 3L16A 4UT6L 4CU8A 3OB0H 1T03H 1AZNA 1G94A 4D9LL 5T1KB 5I1CL 5F6IC 2FIKB 3LPWA 4N22A 4Y9GA 4WAFA 5MHSD 4QO1A 4KJWC 1WCQA 4IBUA 1JDCA 1ASPA 3LN4A 2XVKA 4QPEA 4A7VA 4ETQA 3GMQB 1BZQK 3P40A 4QGTA 1KJVB 4HXBH 1HIML 1JUFA 2ESVA 3P0YL 3QRLA 4XO9A 4B9YA 3HZVA 4MB4A 4XZUA 5ITFA 4YUEL 3SE8L 4N8PA 1CD8A 1X9RA 3V6OC 2QV4A 3GXUB 1G9NC 4MDJA 3STLA 2Y2WA 3SDDD 5I1KL 2ADFL 1LK2A 5DJXA 1OQOA 4NM4L 1FFPB 2P5PA 1WGVA 4MA1B 4N4YB 4OJFH 4PJHF 5JMRA 1JJUA 1D5BB 5D7JD 3SPJA 3ZPDA 4DKEH 2XTJB 1KMGA 4UQCA 4L3CA 3VH8A 3G5XB 3QAZC 1TJXA 1VDGA 2I5YL 1N2RB 2YJLA 4MD5B 3QCTL 4Y1AD 3S5LG 5IW6A 1J5IA 1Q9LA 2GUOA 5LNEA 3C5ZC 3RJOA 2ZZUT 5FXCH 4M9PA 2G9HA 3VG0H 3MCLL 3F7KA 2XKUA 1XGQB 4JFFD 4A7UA 2H4EA 32C2A 5DLLA 2VLJA 3P4NB 2CU9A 4F37K 4FCHA 1BQHG 4MDIA 1KN4H 4XPFL 1KPRB 4F2MB 1BZEA 4MD0B 2IPKA 4G6KL 4O5LH 3VXNA 1USZA 4MAUH 4FFZA 3LIZL 3CXHJ 4FQHA 3MNWB 1DQDL 2I60H 5KANI 3G5WA 4PJBE 4YDLB 3R0NA 2CO1A 3CN3A 3C08H 3QCVH 4H88L 4Y4KA 3LKNB 3HNTH 4IIQC 2P5ED 1G4MA 3FN0H 4HIEA 6CGTA 4ZTPL 3ECVA 5T1DH 1M7IB 3IGAA 1F42A 2H2PD 3NUKA 1BG1A 3CHXA 1RULH 4Z78B 4NWTH 2H8PA 2AJ3B 2V7NB 3FZUC 5DQDL 4A2MA 4PGJA 2ADIA 4Y2LA 5FK9A 1UM4L 4GAGL 4GEJA 1UB6A 5FCUH 3NFPB 1DDHB 1DVSA 1G0DA 1UVQB 1ZIAA 2WPGA 3QUKB 4LARL 1HN1A 2DQTH 2LLGA 3KLHC 3ZGIA 4NQUA 1U8PB 4BD4A 5HJBA 4FEIA 2HWZH 3IJSB 4NNYB 2WLYA 3G6DH 2AK4E 2Q7YA 3FUIA 4MB1A 5DJ2A 4AYBA 3DRTB 1SHSA 4ZFOL 1AFVH 1SUJA 2YPLD 1PL3A 4HUXA 4WFED 3T0BA 2NQ3A 2WVVB 3V5DB 5J3HD 2VJXA 3HVDA 5J6SA 5F93C 3CFJA 3N9GH 5FYKD 3VM5A 1MFBH 3B9KC 3CVIH 2VZ3A 5GGQH 1PG7L 1I75A 1EDQA 3X3GH 3MNDA 1RHFA 1I31A 1DP0A 4RVBA 4OQTH 3SBQA 2CK0H 1D5XA 5AAWA 2TAAA 2BSED 2Q20A 1BZDA 1CJYA 2XN9A 1UWYA 4QYOA 4C55A 3LPOA 2EILB 4UTBH 4JO3H 3CFTA 1L7TH 2DBLL 3H9HB 5CZXD 4YHPA 3AGVA 3D39B 2DZEA 1A6TB 1Z9PA 2DLTA 5FX3A 3QIUA 1BFVH 2QQKL 4HGWB 2A83A 2DJ4A 3FB5A 4XXDB 4GSDH 2XXCB 2GT9B 1JXFA 2QT6A 1OIOA 2ZAHA 4B9CA 2IGTA 1AXIB 1EO5A 2CRIA 2ZOWA 4BFIA 5I76B 5IQ9B 1ES0A 3CH1B 3D2TA 4L8DB 4PJDB 4L1BA 1KIQA 3ZHKA 3O3AB 4PVMA 1QFHA 1ND0B 35C8L 3V9EA 4HIIB 4M5ZH 3U1PA 3SHSA 5C9KA 1DQLL 2PTVA 4OCRH 5KOVC 2VL5B 1T89C 3PWVB 4YE0A 4HGMA 2WANA 4O9HL 1FYTA 1RHHB 2Z0BA 4PJCB 1TTAA 4LEEA 1PYWA 2VN5A 4YBQC 2AERT 1NIEA 1RIVL 1T5WA 2EC9T 2WYZA 2H2SC 1KLGB 1AIFB 1CDHA 1TTGA 2GK0A 3H1ZA 5C08B 4FQPA 3VFRA 4TMPA 3IYLW 3SD5A 3BSZH 3WJJC 1I9IH 2NYYD 3Q6GL 4P2QE 5CIPH 4GKSA 5JDSB 5F89B 4M7JL 1UD5A 4BH8B 5IJVA 1NANI 2FIRT 4HIPA 4K9JA 5FA4A 5I5MA 1R0AH 5DD1H 5M95B 4RA3A 2CGRL 4OGYH 4S0HA 5J1SC 2Q8AH 1CGTA 1I4FB 2VDPL 4PP1C 2AXFA 3RIKA 5BQ7B 1U58B 2GSMB 1EGJA 3BWSA 2NMSA 1KGCE 1Z66A 2A9ML 3SKNB 3DK2A 3CC5B 1TVBB 4CDGC 1KV7A 4KVPA 3GLZA 3I6SA 3ZKNC 3RZCA 3ZKMC 1RUPH 2EXYD 5FB8A 3U9PH 3EUUA 4MAZA 3GIZH 1YC7A 2ZUWA 3T0EA 3LZQA 1N70A 3KPSE 1U8MA 1WQVT 3OKOB 3V4UL 1DEEA 3OG4B 3DX4A 3QO1A 3RX8A 1BW8A 3Q44A 2AJSH 3TJHC 1MVYA 1OSEA 3MNVB 5D6CB 5GS2H 4I1PA 3L95B 1X4XA 5DD6B 2XN0A 3CDZB 4WV1C 2I25N 2CALA 5KVEH 5DFAA 1X4ZA 5C0BE 3H9SB 4P2OB 4A7SA 4DGVL 4EZKA 1CS6A 3X14B 5J5EA 2W9DL 3ESOA 2IVFC 1X5YA 3ULSB 2OMWB 3VCLA 5IF0B 1MF2H 5PAZA 4NZRL 2ZKMX 3GM8A 1D3CA 2UUDK 2FT7A 3ASOB 3LKQB 4NZUH 3HMWL 3A22A 3CXFA 4L8SA 3WKML 1ETZA 1SYVB 4LCWD 5CHNA 5AOMA 1IVTA 2APWA 2YEVB 5D1XB 1JMXA 1Z9NA 3RX5A 4BSVA 3ZE0F 1DBAH 1NAMH 1IGYB 4KVCL 5EIIG 5B22A 4CSPA 4GS7B 4HPOH 5JORB 2BO0A 1N3NA 4YSSA 4JBSA 5D4QA 5DYFA 5FKAA 2C3XA 1HHGB 4F24A 1G7QB 3L4CA 3GSVB 2LLLA 4HJIA 5D93B 2MFNA 2RFXA 2HA1A 2HCZX 4GW4B 4PRHA 2ICWJ 5EFIA 5KVFE 4JG0L 1R3HA 1CK0L 2HVJB 2ZX7A 5JXAL 2V17L 2AABL 4O2FA 3T6VA 4DO5A 4HHWA 3SJVE 3DO7B 2X10A 1IGMH 4IS6B 3MJ9H 3QFJD 4KHTL 4Y16D 4YN3A 2NQCA 4JZOB 2ARJQ 2KPWA 4RQQB 2AEIT 3KGRA 4OJYA 3OKEA 4H8WH 3E9TA 1AZRA 2BHZA 1PBYA 1Q9WA 4TVPL 4NKIH 3GSRA 3N3EA 4QJ4B 5D7IF 1TQUA 2DQJH 2ITDA 4M43H 1IE4A 3RVUC 1JWMA 2J5LC 3EH2A 2QTEA 4OSUL 4YSRA 1K5NB 4BKSC 2AFNA 5IBUG 3L6FB 4A7GF 5GZOC 1J5OL 1G7MA 4B97A 1IEHA 1SDDB 4U4BA 3GSWB 4DKFL 1NMBH 5SWSA 2WZ6A 5ANMB 3BT2H 3CMOH 4N2OA 4UCFA 5K59E 1SXCA 5I16B 4HV8A 1E6OH 2CD0A 2D7MA 3CLEH 1DBJL 1ZLDA 1TFHA 4HKBB 4UZUA 5F96L 4EI0A 1ED3A 1AANA 4JQIH 4F7MA 1MFCL 3CLFL 3B8SA 3AAZA 1JV2A 1AO7A 3GI8H 4HH9A 4LAJH 4JY6A 2VO8A 3SB3A 2WO3B 4E41E 3NJVA 1OD7A 4ZAKD 4APQD 4W9CC 5J6GB 4WK0B 2FB4H 2F53E 2NY3B 3PAUA 1C16A 2X88A 3C8KA 1NCAH 4DVRL 3U7YH 5L2KB 3QDJD 1ZXKA 2IBGA 4HGKC 3NTCH 4YPGA 3TF4A 5DMKB 4YEEA 3UIZA 3DA0A 1I7ZA 4JGNA 1IM3B 2VQUA 1I9RL 2VDLB 3AWGA 5ALBH 5IB4A 3ZE2B 1CTMA 1TJMA 4E9XA 1AD9A 4PWIA 4RZCA 3ETBJ 5D4IA 1ERNA 3NIDB 5AVXB 3W0WD 3OAYH 4TSBL 3D3VE 5DZNA 2X53A 1EHLH 4XNZB 3NRQA 4B50A 1C12B 4ONHA 15C8L 1QP1A 2EACA 3N1FC 2DQFA 2PNDA 3UC0L 1P2CB 3FUFA 1C7TA 3AG1B 5T5FL 3MLXH 3IMWA 4LMQE 2QVKA 5AOKA 4NQED 2IG2L 4QEGA 5F1NB 5AB0A 3JYBA 1GS6X 3EJTA 3VD3A 1LILA 4PW4A 3CUPA 3CU1A 3FO0L 4IRJB 1FIGH 1UACL 2VDKB 3D18B 3HZYA 4QXUH 4P48A 2UXGA 2FVNA 4GEIA 3BP4A 3MFFB 1MKFA 2FD6H 1PCXA 2DEYX 2OR9L 4TNWF 4LQFL 3GMPB 1Z0NA 2FWOB 3L3HA 1A6AB 3S4SB 2A6IB 2XQYA 5DHVB 3KGTA 5FECB 2Y36H 2A6JA 2QMJA 5D96B 1ZVHA 3P2BA 4JRXE 3UTZA 5PCYA 1BBJA 3ASNB 3REWA 3U2SB 3GRWH 2IANA 1SYSB 1A7BA 5IEHA 4FTVD 4LVEA 4RSYA 1VCAA 1TVHA 1OTSC 3K2KA 2JKXA 5FKPA 3S7GA 1W72B 4TN9A 3NCJL 3I02A 5FO7A 3TVMD 4O58H 5JZ7D 4NN7C 4L1TA 3T71A 5GSRB 1QZNA 2E74C 2ED9A 4ADJA 4JFZL 1KYDA 3HE6C 1NFIA 3ULVE 2DQHH 1DZ0A 1MIML 2R0WL 4GIPD 1KJ2B 4QYAA 3BE1H 2E6PA 3NIGE 3OKKA 2YHGA 1VFOA 2KUTA 2MOQA 4QY8A 4XPHH 5B4MC 3GJFA 1GZHC 4Z5RA 3QJQB 4YDLC 4GBXB 4F2EA 3PE9A 3DYPA 2IFFH 5EPMB 3N41F 3QXAA 4J3OD 3HS0A 1OKEA 1U3HC 5HGAA 1FO0A 2CCWA 3LMJH 5CGYD 4ERSL 2NX5D 1F3DJ 1KYFA 2C3VB 4LCIL 4OTXH 3S4SG 1QATA 1CF8L 3LPGA 4GO8A 3EDFA 2LU5A 1TNNA 2IBZY 4GI8A 1T0NA 1K4DB 4U1MA 3VXRB 4O02H 3BPLB 3D2UA 5TH2A 3VD9A 4M48H 1OXYA 3EBIA 5IBLC 3ARTA 4OCYH 4Q6KA 2WNXA 1QFWH 1U8JB 3TU6A 4I18B 3QDGB 3BZ4A 1E9QB 3SGDI 4FX5A 4GPVA 4JANB 4L4TD 5J06A 2C9UA 2IJ0C 4HBCL 4XB8A 2OL3A 5E6RB 1J0HA 2ZTBA 3H0TA 4ZUWB 3TASA 3HOGA 1A1MA 1XCQA 3I6GB 4N8UA 1DTUA 3L7FB 3QUYB 2VZTA 4ONGH 3NFNA 2WWMD 4Q0XL 1WRFA 2O5NA 3SDYH 4NT6B 3M17B 1KTRL 3NG5A 1OAZH 2KBGA 2GFBA 3G6AA 5A3IC 1IM9D 3CBJB 2WVUA 4UT9L 1YEIL 1OT2A 4JFPB 1EMTL 1OF0A 4LMQI 1RL1A 4GOSA 3Q6FA 3PHSA 4PJXA 1FFRA 2FJGA 3EUDA 2PO6D 1T7VA 2ZXWB 4DPCX 1OPGH 4P5KA 3BWAB 4PV8A 4OFDA 3DURB 3NSDA 3U1SH 4BFOA 3VXMB 2CLRB 3GD1C 4UOW1 2X38A 2HT2C 1AZVA 4A7QA 3K8KA 5I1DB 2GEEA 2BW5A 1ZJAA 1WJ3A 3R8QA 4ZW3A 2DEWX 4WDIB 3QJFB 4BFRA 1N5YH 1N68A 5BS0E 2V9UA 5LCVH 2NZ9C 3P4OB 1CFSA 1G6RB 1GKEA 4YBLB 2O1AA 1ZGLP 5C9JA 1AG6A 3EGXA 1SVZA 2A4ZA 4FL4C 4Y2DD 5IB1A 2CSPA 1M1SA 3SE4A 1JERA 2X2UA 5E4EB 1G7PB 4N2LA 1BFSA 2BCMA 2DTML 1FZJA 3O8XA 1HAUA 1OW0C 4IYKA 4FQQA 5JHLA 4OZIE 1C08B 3SYPA 2FQGA 4J23A 1U30A 1ZPLA 1LVEA 4QR7A 2H1LM 4EN2A 5J1AA 1MPAL 3KPMA 2QKIA 2NY2D 3HKZA 1AVAA 1MZYA 4OD1H 2Y72A 5JQ6L 2X40A 2WYIA 1IC0A 2BX5A 4GXFA 2BM3A 1DBBL 1YEEL 5GPRA 5I1EL 2X89D 1RZQA 3RWEB 1W0WA 2CK2A 2WZ5A 4O51A 1INQA 1XEUA 5L4JA 5KYYA 4BJLA 4XCFH 3IJYB 2VXVH 3CFKA 3GSNB 2Z65C 4DVBA 1TQCB 4YHZL 2GAZA 2F5AH 4LP8A 5H37G 2J7LA 4M4PA 4LXFA 1T7WA 2AQPA 5ENWB 3RE0A 2P26A 5D5MB 3CX2A 2YPVL 1EFXA 2FJHB 3MLWL 1GGIH 4GAYB 3SBRA 4F2FA 5IZ7A 2DLFL 3X3GL 1XF5A 3RGVB 3MO1B 5BUAA 4D0DA 1JD9A 1CICA 1ZTXH 1TLKA 2BS71 5FDWA 1T6BX 1EO8H 4HJSA 2Z4TA 4M6OL 3FU7B 4PJBF 5E5UB 4OLWL 3DX9A 1K6QH 3ZU8A 3GNML 2Y25A 2HX9A 4ZXBD 2BIPA 2CBMA 3TA3A 4PJEE 2XZAL 1SMOA 3LRHA 4GRLB 1P5VA 4H1LA 2MIZA 5ILTL 2Z7WA 3RU8H 2ICCA 3UBXA 4PJ9D 4TOYH 5LBGA 5B1AB 1W6LA 3FOLB 1V5JA 3FFDA 1F18A 2UZYB 2CUMA 2E4TA 3TO4D 5L7XH 2HN7B 3WD5L 4MCZB 3OXSB 2QTVA 4JDZB 5GIRB 1DVZA 4KDWA 2HPTA 5BRPA 3CBRA 2J21A 2Q87A 4FA7B 3U6RA 1A9BA 1BA9A 1CBVL 1UOLA 1IB5A 3EDDA 3FU0A 4RGOL 4K7PY 1HHJA 5E9AA 1WBZB 3BP6A 4FHKA 1RV6X 5INDB 5LG1A 2Y23A 2R1YB 4LSQL 4XPAH 3BIKB 1MLCB 2HP4A 5D1XC 1HOCB 4H0LC 5HHOE 2ERJB 2A5UA 2AK4D 1S6NA 2LVEA 3NCWA 4YDMA 4XNMB 1SOXA 2BPBA 4HKXB 1F58H 2EIDA 3JUZA 4NKMB 2GABA 4TVUA 4Q9CA 4PYGA 4Y19E 5D93C 3TEWA 5IHWA 2ZXGA 4QIRA 4QOKD 2VGLM 4N87A 5AALA 5J9PB 2IALA 2AI0H 1S7UA 2YSSA 3IFLL 4MXQC 3GZPA 3NJFA 3ULUF 1QLEL 5EN2B 1OCWH 3M8OL 4XNXL 3VU1A 2GCYB 1TZIA 5GZNC 3NVQA 1XAKA 5CFAA 2R2HB 4YL4A 4X4KA 3MGOA 5IHZB 5DJDA 1S9XB 2XRAH 4MJID 1QTPA 2YGQA 4OZHA 1EXGA 1LEGA 4EN3D 5FOBA 3T0XA 4WW2A 4PJGB 1GIGH 2EYRB 4L4VB 5DSCB 2B7DT 1LQBC 9PCYA 4KXZH 5I1LA 2Z7ZA 5J12B 1RZJC 4M4RA 4FQ1L 4YHML 3CZNA 4DP2X 3RHWF 2W65A 3V9CA 2R8SH 4AVJA 2FBJL 3L5WA 1RUPL 2QHRH 1Q72H 3NP4A 2PCPA 3FQNB 1BAFH 1EBAA 4F3FA 4ZMVA 4EUPA 1PLGH 1C5CH 5F70A 4XTRC 2YAOA 4QHNB 3QXUA 4HF5H 1E4KA 3BKCL 4FC3E 4FABL 3IRPX 4R5TA 4YNYB 4ZOCA 5G55A 1QSFA 3MJ7A 4AL8H 3SY0B 3CVHL 3IBOA 5KUMA 3FQ1A 3HPJB 4WSGA 4RDBA 5B3JE 3EJPA 4K2UH 4L8BB 4GG8A 5KVEL 4GQRA 4N0UA 4IOIA 4OJDH 2NY3C 5KN5B 5A2CA 2VLLB 4KITB 5DDHB 2HTKD 4XBEH 5F1SA 2BIIA 3FCSB 4WJ5A 1WBXA 4YDNA 2XG5A 3ROOB 1TQSA 3GMMA 4WENB 1MNUH 2Y2YA 3UTQA 1LDSA 1OY3B 2Z93B 1U8OA 5ICXB 4UB0L 2FLMA 4WFHE 2AQ2A 4AGNA 1R3KA 3ZXAC 1NC2D 3EYVA 3V7AE 4LAQH 3KDMA 4FLQA 1Q0YL 2ZOTA 4XNZC 5AVYB 3SE3A 1J0YA 1IV8A 1BEYH 4G7VL 3T5WA 2R69H 1IILE 2EH8H 2JWYA 3BP7B 4WI0A 1CFTA 2Q76A 2IIJA 2WBJD 4EI5A 4JHBA 4YQXL 3AU1B 3GMNA 3UYPA 5F44A 4DCQA 1UT1A 4IMLB 3CTTA 4JRWA 4R0LB 3P2DA 4RETB 4ABQA 2EIKB 2VERA 3EFFA 3NABH 3BVXA 3JT0A 4XC1H 4IRJC 3VSVA 8PAZA 3OVUB 2X7LA 5DZAA 2XQYK 4HK3J 4P3WA 4IU3A 4PTTB 3F8UB 3UTSA 5JYMA 1JG9A 2IH1A 3KPSD 4NKIL 4JKKA 4EAEA 2DWEA 3HRPA 4GQ9H 3PWPA 4BA8A 1OO2A 4NI3A 2GJ6B 4G82A 2IGFL 2BSRA 4BQ6A 5INCB 3RKDC 3GEWB 2B3RA 4P5TB 5B3NA 3GJEB 2V2XB 3KS0J 1MG2C 3E6HB 3MJ8A 1RSFA 3GEFA 4GW5A 5CD5C 2VM9A 1RK0A 2O5YH 4AYGA 5C0BD 3VFOA 2B2XL 4NO0D 4R7VA 2R23A 3CMOL 1THCA 2J44A 2Z3FA 1XX9C 2GIYA 3VXOB 4ENZA 1E6OL 3BAXA 5JOFB 1F2QA 3GUTA 4XN8A 1AS8A 3S6CA 4D7BA 4L8SC 1NFDB 2QFRA 4RMBA 2Y7MA 4JQIL 4WWKB 4EXPX 3X11B 5F8QC 4AC2A 1BCIA 1NDGA 4MRBA 2BSTA 3I3BA 4LLDB 1B0RB 1MWAB 2ZXCA 3D4CA 3EFOB 5BMFH 2P8MA 3IDGB 4HZ1A 4UM8A 2JKNA 1ZHLB 1LWJA 3QJZA 2EEFA 1OARH 3FONB 3S34L 4GBXC 1QQDB 3BDYH 4HISA 4OCSL 3JTSB 3M7OA 4N2KA 3UBXG 5K9KA 1M57B 2P5WA 3Q06A 2AEPH 3V2AR 2C9PA 2H32H 1TFPA 2W38A 1IBDA 1AS7A 1UENA 2B77A 2BWDA 3MMEB 4DQOL 2EDEA 5C2BL 2K1MA 2PTUA 4G8GB 3BPLC 3R1GL 1IGTA 4JCMA 4GUPB 5KW9L 4MA7L 1R75A 5IROA 2N7BA 3NPSC 1X5IA 2ZPKL 4I18C 1PZBA 1MQKH 3L9EA 1LNUB 5E6ID 2G3MA 5LUMA 4JFUA 1NIDA 1YJDH 4P5MA 2PW2A 5FGBA 1ZA3A 3OJMB 2DF3A 1HWGB 3BH9A 1GR7A 3QUYC 5DUJA 5IQ7H 2UZPA 1JGVH 5DWUL 3RWIA 3FMGH 2WCSA 4XCCL 3O3UN 3PAYA 1A7RH 2AJXL 4U6YB 5CEYA 4CADB 4P59H 3B7SA 4L2YA 5TE6L 3IMBA 5CGMA 4KKCD 4E5XA 4G6MH 4JFEB 2FD6L 4Q14A 1XSIA 2V5SA 2ZUSA 1E27B 5I18L 3TPKA 1CFVL 1RIHL 2HT3D 3KL3A 4XE0A 1OWWA 3VWJD 4LOFA 4XP1H 1HINH 1KTCA 1BV8A 5BOJA 3FTVA 3FUKA 5F9JB 1U33A 4BZ2H 1MHEB 1QBLH 2H3NA 4Z7UB 3IMTA 4YR6A 5IMOB 1T66D 1NOLA 3MRIA 5HPOA 2FNBA 2YPKB 2F53D 1FH2A 1DJXA 1A9EA 1ZLVH 5KSAC 4M7LL 1GSKA 3MA7B 4BWWA 1MH5A 1N19A 2EDFA 3GF8A 2BY1A 4R5XA 3BZEA 1F41A 3EDJA 1IZJA 1MCCA 1H5BA 1Q1JH 1KXVC 2EJ1A 3KXFA 3MV9A 2HFGH 1JK9B 2FX8H 2AAVA 4B27A 3O2DL 1RJZB 1FLRL 4YBLC 3D9AL 3V10A 1DVQA 3AU0A 2JSFA 2R7EA 3FU6A 4PWHA 1GHFL 3BVNA 3S5YA 1HEZB 1NGYB 3Q1SH 3OR7B 5CNHA 2RHEA 2P47B 5LO7A 3QUHA 1S5IL 4UM9A 1JXDA 5IEKB 1BIHA 2CCVA 4EUPG 3QR0A 5E4EC 2IFFL 2YAHA 3MBWA 1ZIBA 9CGTA 5J4MA 2YWZA 1ZLUK 1KCRH 4AIZA 4OAWB 3QHZL 1USQA 2DMBA 2W92A 4FJYA 2C3WA 1L9PA 5AW2B 5JXED 2Z35B 4NQCA 4U1GC 2ALAA 5C0CA 2G2RB 1FF5A 3AZUA 4MJHA 3ZL4L 1NEUA 2EH7H 3LEXA 1JGLH 1ZE3H 3KGUA 3RGBA 3W9DB 3VMOA 1GJUA 5CKGA 2HLFD 1QFWL 2XNAB 1UFGA 1WTLA 3LKPB 1MUJB 4ZOAA 1BMWA 2ZUQB 5E8OB 1NGPL 5GS1B 3S36L 1I7UA 3NJNA 3WNJA 3C6LA 4BH7A 2PR4L 3QNXB 4XP6H 3ZTNH 2H26A 3FT4A 3DBXA 1A6PA 5E5LA 4DETA 3IXTB 3UAEA 3EYOB 1TQCC 2IOOA 3II3A 5K9QG 5I1GL 4PBWD 1F4HA 2NY4D 5EUKB 4JE4B 2QZ5A 3ZDXB 2DKSA 3AT8A 4J3VA 2XLLA 4WUUE 3ESPA 3P30H 4Y5XC 2O93L 4OCXL 3RGVC 1N9PA 1M53A 5HHPB 3MLZL 5KS9A 2NW2B 2QSVA 3QCUL 3RZWA 3SDAA 4N8CH 1M6OA 4YHKL 4JR9L 3O41A 2P45B 2XYBA 2XY2A 4HWBA 4GRLC 1RZ8B 2L7QA 5IR1A 2P44B 5FYLH 1K3ZA 1AE6H 3HS0C 3OKLB 5KBKA 5CJQL 3TEYA 1ZANL 4GRWE 1A6VH 2XFXB 3PGDA 3RVWD 1OOAA 3FU3A 3BP5B 4XXWA 1KGIA 5E00A 4HSAC 4PRDB 2WJ5A 43CAA 3FQYA 4LCCA 4MAYB 5E7BA 1E8ZA 4PMFA 3DECA 2A4EA 1C5DB 2G60L 3RY4A 1OP5H 3DSNB 5IVZA 3ELAT 2NY1D 3LHPL 3GB7A 2VSMB 5DK0B 4JFDE 2C5DC 2MWCA 1RZKL 3KEHA 2X1OA 3AY4C 4QD2E 1J5CA 4UQEA 2EYTB 3PP3H 2HUHA 1IAOA 2QPSA 4IBLT 2FL5B 1XGTA 5GHWH 4ONFH 4XOEA 4NC1E 4G7SB 1BVNP 4KDVA 2CMRH 2ERJC 3ZKQD 3WV0A 4D0CB 4JL1A 4KY1L 3QPQC 2A9BA 2UYLB 3QUXD 1OZTG 3ATEA 1UD8A 2QADC 1V7ML 3BCFA 5F7EH 3DO4A 1CDUA 3BH8A 4PW3A 4FYSA 5AVQB 5C1MB 1TZOA 3W3BA 4WTZG 4N86A 5GJTH 4M03A 1P6AB 3TC9A 1AHWB 1YUHA 5IQNA 3KVPA 1EVTC 2AJYH 1A4KB 1PKQE 5BO0D 5G5DA 1MRCL 2R51A 4XBPA 1F1GA 3BLPX 4NC0B 4WJKB 2O61B 1KF9B 5JQHC 4EVNA 1F5WA 3Q8EA 2XETA 3NZ8B 3PIQA 3FHAA 2MKLC 4M8QA 1O6SA 2MPAH 3U4BL 3N1MC 4RAVB 4WK4B 2CBTA 3UGXA 2R29H 4MBRA 2EO9A 2FO8A 4PGCB 4ZMOA 1NCIA 5HYJE 1A7PL 1T5XB 5E7FA 5DJAA 5BRQA 3O4LA 1BJ1J 4I1RA 1ZV5A 1SJHA 1T2XA 2AC0A 4L1DA 1WSST 3S8WA 1IEBA 3RUGB 4XHJC 2COVD 4LVHC 4GNKB 4JN2A 3L3DB 1NCBL 4G9DA 1GC1L 3G6JB 1G1CA 2IWKA 3QG7L 1JWUB 1P7QB 2AEWA 4RRPA 5HJ3A 3CN1A 4CW1B 1KENL 1YN7B 2VMCA 4KOBA 2RACA 1A5FL 3R06B 4NLHA 3QHFH 4BHUA 2EC8A 3SE4C 1ADQH 3MLYH 1GOHA 1S7RB 4PEEA 4E5XG 1WD8A 4GKZA 4XMLL 1UH3A 3VXUB 2C9AA 1A7NH 4HK3N 4UIMB 2XN1A 3HNVH 3QZPA 4JPQA 1NIAA 2JVUA 1AGBB 3DX3A 2NXZB 2N56A 4PR5A 3VE0A 3C5JA 3BPCA 2BVPB 2DWYA