4QDGA

Crystal structure of a putative adhesin (bt2657) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution (psi community target, nakayama)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
300
structure length
300
Chain Sequence
DLAPCPHGVSLRFIYDYNMEYANAFAKKVDCLTLLVYDENGNYVDTRIVTGTELQDENYRMKLDLKQGNYHFVAYGGLACNKSSFLMKYTPGEGTGYTDLQVELDSECLTNPRRKNLHGLYWGELTLATADLYSEGTVEMMKNTNNIRVVLQQMNGEPVDDKKFEFEITDDNILFSYDNNLLENGMVTYTPWAQGQASAGFTDEGREVVVAYAELSTSRLMVRDWYSPKLTVRRKADGVEIINIPLINYLLMLKSDLYASMDSQEFLDRESEWSMIFFLSPNLEWIKTYIKINDWTVRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative adhesin (BT2657) from Bacteroides thetaiotaomicron VPI-5482 at 2.20 A resolution (PSI Community Target, Nakayama)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Cell adhesion
molecule keywords Putative adhesin
total genus 72
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08842 Mfa2 Fimbrillin-A associated anchor proteins Mfa1 and Mfa2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2090 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qdgA02
2.60.40.2100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qdgA01
4QDGA 3GF8A 3PAYA
chains in the Genus database with same CATH superfamily
5LCVL 4BYHA 5JORB 2CJUL 4DPAX 1IT9L 4RFNC 1HIMH 2L7JA 3MUGB 2VDKB 4HS6A 4RIRA 4WGWB 4Y4KC 2JCCF 3BSZH 3RTLA 2XA8L 3D07A 2R56L 1L6ZA 1W72H 2A38A 4AE1A 1A4JA 1CGXA 2AEWA 2F08A 1AGDB 4JDVA 1WJ3A 5GGSB 1XGQB 5EEYA 1II4E 4G5ZH 4RFEB 5CCHE 2KDGA 2FO1A 4GP5B 3EZ8A 3K2UH 1FORH 1JI2A 2IJ0C 3GLAA 5J9PB 2H47C 2IALB 2WM0A 4DN4L 2MTAA 4U2YA 1XGUB 4IRSC 5LXGH 1YY9C 1P7QD 5KG9B 1XR8A 5IWLC 5E70A 1ODUA 2P45B 3DJ9A 1JGUH 1IGCH 3GEFA 1KIRB 5IMOA 5MHSE 3S34H 1W0VA 3QNZA 5CJXA 4W9GC 3FTWA 3ZYIA 4A6YA 2JMRA 1R75A 3MLYL 4YBQC 2BZDA 1CYXA 5H2BA 3U4BL 5AB0A 4GSUA 3RYMA 4PRIE 4S1SH 1JV5B 1WISA 1JRHH 3JV6B 4N2CA 5KJRL 1LQSR 5F3HA 5CZVH 1QZ1A 4OW6A 4F57L 5SWQB 4EAEA 3EHBC 3IN0A 3ZTJH 4N8PA 3NP4A 4FN0A 4AQZA 1T5WB 1VFUA 3HE7A 5I5IA 1JGVH 4JFQA 4K3JL 4OF7A 4HPHA 4HQQH 4G82A 5TDNA 2C4XA 3ASWA 3SE9L 3SGEH 1T0PB 4MZRA 1JL8A 3C6SA 4M7LH 4WRLA 1P7KB 3B2VL 1HHJA 1OAXL 3FRPB 5F72S 1IC1A 2YXMA 3WBDA 2ALAA 2HUHA 3NABH 1AO7D 4JJHA 3W9EA 4G2AA 4IEFA 4GRWE 2EC8A 2NSQA 2MPAH 2GFBB 1KN4H 3QBTB 1HH9A 2HVJA 5EOCL 3QJHB 1U8LA 1MHEB 1NCWH 1UWEH 4F92B 1XSIA 3GKWL 3LPGA 3DWTA 5EFIB 4UT7H 4NYLB 4PJAF 5ANMA 3D39D 5HYSA 2NY7H 3L2NA 2G9HA 5FW8A 5F3BA 1MCPL 1SJHB 2ATPA 1OM3L 4G1MA 5HGBB 4NUJB 3T8XB 1H5BC 2JJWA 4XNBA 4F1ZA 4HSQA 4G9FE 5E2VL 3BPOB 3UPRB 3LRHA 5DJYB 4NM8L 1M71A 3RVWD 3VFMB 4G7VL 2VISA 3FUJA 1BQHA 4O51A 5EZIH 5E5UB 1I9IH 1TOXA 2B4CC 3NDZE 4XT1C 2VXSH 1MAMH 4NM4H 4X4ME 3WJJA 3O11A 4G1EA 5TDOB 4CJ0A 4NWTL 4HLZG 3WN6A 3PGFL 3FO1A 2FQFA 4X99A 3HKZA 5SWQA 3W56A 1X3DA 2YZ1A 2K6YA 1OXYA 3CK0L 4PVLA 1YQ2A 2VIRB 1KBWA 1E2VA 3EYFB 3QDGE 2CJUH 4JHWL 5TQ0L 3ZPDA 4HIIB 1HIML 3LIZH 5JHMA 5GZOC 3EFFB 4Z3GA 4HDIB 5DZLA 1VFBA 2J8UA 3KJ6H 2W65A 1OAYL 4KI1A 3PDOB 1BQLH 3SO3B 1F1GA 5T1DH 4LQ1A 3WD5H 3MYJB 2GK2A 5LGJB 4H2CA 2I27N 4M9PA 1ZS8B 4Y9EA 4ZTOH 3H85A 5TE7L 3BUYB 2FIKB 3KXFB 2GSGB 3OAZH 4QGYA 3CVIL 1GSKA 4DUWA 3WAJA 2BSRB 2ODHA 5PAZA 2F8VA 4N2NA 4XN5A 1WZLA 1JD7A 2QKIA 5L2JA 3N5AA 1BXVA 2BSRA 3HVNA 5EU5B 1PYWB 3KR3H 1PU0A 3MJWA 3NJFA 4XVTL 3AXLB 4B9PA 3GK8H 4L23A 3AQZA 3GRWL 5F7KC 2QHLA 2YQ2A 4FFVC 3C2AH 5F0LB 3CU7A 3MTXA 1A3LH 3TJEH 4P9MH 3PY9A 2VDOL 4HKZB 4PRAB 1IBBA 5IJVA 1AY1H 3FFCD 4H44C 4JZOA 4TVUA 3CDZB 4PJGE 1UOVA 3L2LA 2J8UB 2EDRA 2GKIA 3NIFE 3OR6A 3IMVA 5FHBH 3SY0A 2OJEB 3WN5A 2LR4A 3BMVA 5CR8A 5EA0H 4Y4FA 5E7FA 2HJKB 5IFHL 1YEHH 2CJ3A 2ZUXA 1ETZA 1NFIA 4H8WC 1DQTA 2O61B 1RULL 4A7UA 2B20A 3G04B 1B2WL 1WT5A 1K4CA 4AQAB 3SE9H 3T04D 5F1KC 4K73A 1MXDA 1XH1A 1KTCA 3B8YA 4ZZKA 5JLZA 2F1EA 3H2QA 1MHPH 1MVYA 4JDZA 4O51B 3RI5K 2P7TA 4MXQD 1G9NH 1KLUA 2W9DH 3GSOB 1KMGA 5GSRB 3KWVA 5E94A 5KSVA 3RGBA 3FNKA 4XBPA 4D7BA 4OFPA 5CZXC 3MRRA 3DO7B 3LH2H 1IGMH 4ETYA 4G8AC 4B9FA 3IJEA 2VJ0A 3WDIA 3SE3C 5GSVB 1A66A 4GW5B 4PRPD 3TN0A 5GJTL 1S7WB 1NCCH 3P3YA 4TUJA 3WELA 2AJ3A 3CHRA 4PJDF 3FKUS 5BV7H 3MBWA 2HSIA 2GUYA 5D7IB 1JPSL 1IC0A 3FFDB 2EE9A 3G5VA 1OL0A 2PWDA 3JV0A 4KBPA 3P77B 4LGPB 1OM3H 1MCKA 1VEOA 3GM0A 4HAKA 1MJJA 4RVBA 5GGQL 4HUVA 4FNLH 5F3FA 1M6OA 3RRQA 3THML 3L2MA 4MNQE 4K94H 3FPYA 3OAUL 5FO2A 1GHFL 1PSKH 1JCKA 4RDQG 3STZA 3ZL4L 4X7TA 1UM5H 3K7UA 4APQC 4W68A 3SD5A 2FBRA 1KLFA 4MS8C 2VXSL 4TQHA 2XWJA 1A2YA 2CBMA 5AOKA 5GS3A 2XFXA 25C8H 2JFCA 2Y1ZA 4GRMB 1HOCB 2I32A 3PHQB 3S8FB 1HU8A 2NW2A 4MNQD 5CN3A 4OIBA 2VN4A 3BAKA 2ZZUT 5KBKA 3RX9A 3TYGH 4U1NB 2G0LA 4UDTB 3A5VA 3VACA 1OCCB 1UD5A 3LIZL 1JV5A 5FM5O 3AT8A 5BW7C 3JWNE 2AXHA 3BEWB 4CSZA 5I8EA 4DFIA 5IVOA 3WS3B 4H0HB 1EEZB 1GGCL 5H2BB 1S2EA 4D3CH 3RTQC 4HS3A 1EO8H 4UF7C 4ZMAT 2GT9B 2VLME 1NQBA 2JKTM 3VXRA 4DFHA 4JVWA 4LASL 3X12B 3NBNA 5IVZB 3B2PA 3QFJD 4GO6B 2YD9A 5ICZB 4NNXA 4AEEA 1FG9C 5EWIL 4UQIM 2DQCH 1J5IA 1TYJA 4BSJA 5BV7B 3G6JE 1LEGA 4MMXB 3PYCA 1A65A 3IB4A 1SQ2N 4CW1A 1I8MB 4WHDA 2LHAA 4F2EA 4X6CF 4Z77B 4PYHA 1PFCA 3RA7H 3GIZL 2ED9A 4G42B 3PJSB 2VDOH 1HHKB 1KTLB 1OAZL 1YYLH 2RHEA 2W88A 3ZKNC 3O8XB 4KUZH 2NYYC 4IDJL 6TAAA 4PJ5A 2XY2A 2CCVA 4PRDB 3F5WB 4UYQA 5JW4M 1Y6MR 3FBKA 4PJIA 5IBLD 3N04A 4PAZA 1AD9B 3GGWB 4NGHL 2VXTH 1RULH 2I9TB 1T66D 4HJSA 4AENB 5IWLA 4LO9A 4AV4A 5IQ9A 4HXBH 3A6OA 3SDXA 3RY6C 1A4AA 4QRPE 2QSQA 4DUVA 3S98A 1MNUL 3ZHKA 4NZUH 2YEZA 3ASNB 4UV7L 3E2HB 3BHBB 4XX1G 2ENSA 4M1CC 4KXBA 4ZFFB 4LCIH 2BW4A 2W9DL 4Q52A 5IQ7H 1EUTA 3OZ9H 1DDHB 4FL4C 4BCYA 4G6KH 2P3YA 4N26A 1MAKA 1SUJA 4M7JL 5GS1A 2JCCE 4NP4H 1MW3A 3E6FB 1QO3A 3I9IA 3BN9C 2FB4L 4HJEA 4X6DB 3ES6B 4N3TA 5F1IA 5A6MA 3OVUB 4FQQA 4DP9X 2C9RA 4P04A 2L04A 2E5EA 3KWWB 1I82A 4R97B 2HFGL 1QSZA 4N0UE 3O3EA 2BM3A 4XNZB 4Z0BH 4IMKA 4A7GF 2DMHA 2G5BB 3VFVA 2FWLB 1MLCA 3Q3GB 1DBJH 3ES6A 3HLAB 4J8QA 4KKAD 5DVOA 1XH2A 2C3XA 3U7YL 1TU2A 4DEPB 4Z78A 5IV2A 2I85A 4PJBB 2UXFA 2X6BA 3DVNB 1THAA 4R0LB 2HXAA 4LOEA 1HYSD 3PGCB 2BWDA 1O6VA 2IV9A 1UVQB 2JIXA 5CLWA 4KRPB 3WLBB 4ELDA 5T1MB 3VXSE 1KXHA 3QUYC 3O0LA 4HMEA 5T1LB 5HJGA 1JAEA 1Q1JH 4LNRB 3VJ6A 5IBUG 2MSPA 1AQHA 4BFRA 2XQYG 5AENA 4YNYB 3TYGL 1QSFA 4UBDC 1AQ8A 4AMXA 4HZLA 3MNZA 2JF1A 4ZUWA 3V9CA 2ZWKA 3UCRA 5IQ9B 2XC8A 1ACYL 1I9RH 3MX0B 1JGDA 1X5XA 4JPSA 2I9LB 4LEEA 2JKNA 5IROC 2TRYA 4N68A 4HUKB 3WMQA 1HEHC 1IGIL 2XT1B 3OB8A 3GNML 5C92A 3DO4A 5KTEH 4WV1A 3BP6B 4OF3A 1HHKA 1KTLA 2EIJB 2PXYC 2BS8A 3A6CH 3I50L 1M3IA 2AK4B 4XXCC 4KROD 4U6VH 5IR1B 1ZT4A 2N56A 3AS0A 1JWUA 3CSFA 4XXWA 4L8SB 4IRJD 4WDIA 4MVBD 3RILA 5C07B 4AYFB 4K55A 3HTLX 1FLTX 3PU7A 5KSAB 2DM2A 1ZVHA 1DFBH 1QRNA 3C60D 2DQJH 5DMGD 1RQ5A 1ZWIB 4YHPB 1Q0XH 2BVUA 1YMMB 4ZYKB 4YC2B 4YMPA 1P7QB 3T0DA 4G6JH 2ZOUA 3MLYH 4HLEA 1WFOA 3QW9A 4OLWH 1BF8A 4EZKA 1S7TA 2XA3A 3HAEB 2HFTA 2P49B 2AQ3A 4Q4IA 1TMCB 2DIEA 4B9GA 5GHWH 4PI2A 3AQXA 4P2RE 4AH2B 5AW8B 4JY6B 4UILL 1IZKA 1S5IH 3FO2A 1UGKA 4W4OA 1S7TB 3ARBD 4X0KA 1JPFA 3R06A 3CZFA 1KENL 5IQ7L 1EEYA 3OHMB 4MAYD 2XN9D 3CFKA 5T1MA 4KJQC 1TEFA 4RQQB 1WO2A 2UXTA 2CDGB 3M6DA 1RD6A 3HA0A 3FRUB 4R4FH 5A6IA 1HXYB 3A24A 4G8EA 1PG7X 3AGVA 1I1FB 1U8MA 2A77L 5F0MB 3QA3B 2RAMA 3T0EC 1CYWA 1QMUA 1MCQA 1KN4L 2NY5C 3FL7A 1SHSA 2VC2L 2APSA 2EAEA 2DWTA 1U91A 3GXNA 4QRPB 3GKWH 4YXHL 1XF5A 5D71H 5I1JH 4N28A 3S3SA 1CICA 1YY9D 4G80B 3VFTA 2E6PA 5E4EB 1JF1A 3S4SB 1NINA 1YEGH 3T0EA 3KYOA 1QFWM 3DNKA 4WVRA 2M83A 4FQQB 2VQ1B 4NNPL 3T0EE 5JYMA 4NX0A 3MUHL 1EHLH 5D1XA 3IMBA 4KV5F 2W92A 4LHUG 1XTMA 3FFCB 1U6AH 4FQHB 1FL3A 4LP8A 4M8RA 2VR8A 4G8IA 5HI4D 2A6DB 4TVSa 1ILSA 4FTVD 1MCJA 4PJIE 1FFPA 1YNLH 2QTEA 1E6OL 4PLOB 3ZZ1A 4KO9A 1SYSB 2W94A 2X9YA 3C60C 4APXB 1J5HA 1AS8A 3IJHA 5FK9A 2NY3C 2VN5A 5E1GA 2YBRB 3MA7A 5BVJB 5KBPA 2K9FB 2X6MA 4PR5B 3BKCH 1FYTE 2AK4E 4MMYA 4ZW6A 3KPNA 5BV7C 2A74B 5TF1L 2QVTA 2J6EA 4X98B 2YWYA 1OGAA 2YQ3A 4X6EB 5I6NA 4HHAB 3M1CA 5JHDA 2OTWA 1A7QH 1A6TB 1NZRA 4N3UA 1F4WL 5JIPA 2XVKA 3L4UA 4XMWA 1NH6A 4P3DB 3UDWC 1YMME 3QUKB 2ZT9C 3A6CL 1NFDF 1CGVA 3HRZB 2XPGA 4XMUA 2JE8A 3T1FB 4X6DA 2HFEB 3SBWA 5TGBB 3SOTA 1CJYA 3NCFB 4WCYH 1KC5L 4HOWA 43CAB 5MI0B 2K6WA 4FI6A 2K78A 1CTNA 3IPEA 4IKNA 1GYUA 3QNYB 4ANXA 5MEQB 4PGDA 6FABL 4JGNA 4IHBA 1Q0XL 4G9FD 3CXHK 4JZNA 1CLZH 3L9RB 5DUPL 1DANU 2WTRB 2WKLA 2G2RA 3BD3A 1KTDA 3GSQB 1PEWA 3MXVL 4Y5YA 5IJBC 5LWYH 2AZUA 1G7PB 4K3DH 1BXUA 2AJUH 4FI7A 3UBGA 5AD0B 4XMZA 4C47A 5CBEB 1CE6A 4ZAKA 5GHWL 5C0BA 2FX9H 3VDBA 1VFBB 2C4FT 4QXVA 3KYKH 5EA0L 1O5DT 1HILB 2DQEH 2N3JA 4L3AA 1RZ8B 5D1ZB 1T0MB 4EIGB 3QG7H 1AD9A 2VIRA 5A40E 1JDCA 1T7XA 2R1YA 2VDLL 5E24E 3D87B 4U3SA 2MOQA 5DFAA 1NANI 3H7BA 4JGMA 1G6RH 2L8AA 1RMFL 1KYOJ 4XNAA 3X11A 1KFAH 4JANB 5E9DB 4PLKD 1P53A 4OFQA 5CD5C 5KJ7E 2FAUA 3O4LA 3WKML 5HHQB 4HJIA 2WLJA 1T3FB 2LAAA 3MGOA 3TXAA 3U2SB 5IKCA 1BPLB 1WBXA 2ZOKB 5HVHC 2X89A 5DMJB 4ATTA 4FXKA 5D6DA 1IGFH 3LH2L 1NCAH 1NBVH 1BZQK 1CS6A 1Z32X 4W81A 3QUMB 1FNSL 5FC9A 5CN1A 5DHYA 4LLMA 3RGVD 2QQNH 3P77A 3R4RA 1UQSA 3SGJA 3CJJA 4Q9RL 1QLEB 3IT8D 5IB5B 3VRLE 1YEJL 5ANMB 3ZMRA 4WO4D 4F5CA 2J5LB 1UKSA 1G0YR 3W5MA 4LLVB 1B9KA 5KEZA 1R24B 1IEBA 2O5YH 1ZHNA 2ZXDA 1MH5A 5KBMA 1KEMH 4YSEA 3VTTA 3NFPA 2F5AL 4QRBA 3D3VD 5CSBA 4J12A 4CN1A 2OLDA 4LU5H 4KRPD 1A7OL 1P1ZB 2JJSC 5IHWA 4LPVA 5CJ5A 1B4JL 3V6OA 4CMHC 1QFOA 1JG9A 1KLUB 5DR5H 2R4RH 5IEHB 4GKZA 1SXAA 1W8EA 2A73B 2XWRA 2HMID 4PRBB 4Q74A 3DOSA 3Q8BA 3HG1E 3TFKD 2Z35B 4TLSA 1HEZB 3MJ7B 4Z95L 3QIBC 3NCCB 3CFDB 2E27L 5DC9B 3KCPB 3FMGL 4I18B 1OSZA 2DLEA 3MLRL 1UXMA 4PWIA 3VFGL 4MRBA 1BM3H 2XQBH 3VGGA 1R24A 4FX5A 3ILQD 4OH2A 1IBYA 2APVA 3CDZA 3RJDA 1U4FA 2BVPA 2C3VB 1S7WA 3BAYA 1I85C 5CNHA 2HTLC 3O4OB 3ILPB 1HXMA 4LSPL 4A37A 1AZCA 3KLDA 1C8PA 4XVOA 5GS2D 2IDFA 3EO1A 4LESA 4HWBA 4HCFA 1EIBA 4LAQL 2F58L 2G3XA 1NCBL 4WK0B 5EDXA 4EUPA 5BUAA 1ID5I 3CBJB 1LK2A 2QDWA 3EJYD 4FQLL 4KMQA 2F1BA 1ZLSL 5L2KD 4TNEA 1FRGH 1E5BA 1DLHB 2PCYA 2WD0A 1T7WA 4JE0A 4KJQD 4N87A 4FE9A 2P7TB 2LU3A 2ARJQ 4Y2DD 4LSQL 3HC2A 2DJUA 3HNVH 1RIHL 1X9RA 1NEZG 2RJMA 4XC1H 4AQ1C 5C0JA 3MRDA 4B9YA 5F7NC 2IANA 2FJHB 2VAAA 1MQKL 4NUMA 4WU5A 1M53A 2V9TA 4JANA 5HHOB 4X7DC 3EOBB 3N0PB 1MRDH 1G5AA 5KYNA 2W91A 4CU7A 3CSPA 3KPRD 5J6SA 4X5XA 2WVSA 2EIBA 3EYFA 2YJQA 5T3ZL 5B8CB 1G6RL 4IU3B 1WH0A 3OR6B 4ZS7L 1MNUH 4MMZB 2GC4C 3M1BA 4NZUL 1LL1A 4NN7C 4AMKH 4NCDA 1ASQA 1YEEH 3MRNA 2NDFA 4I48B 4JFDB 3BGMA 1HKLL 2QV2A 5ANME 5F89B 2MQ3A 3BSZL 4RDBA 3NACH 5CF3A 3OLGA 3GXDA 4DK3A 1RUAH 1TQBB 2PO6A 3SOBL 3NZHH 3MRGB 3AM8C 5I17B 4AM0B 2X1OA 2YRZA 1RZ7H 3T08A 1P4LB 4GSRA 1CGUA 1F42A 4QPEA 1JPTL 1MJ7L 2J5WA 1MG2C 3JSSA 5DDHB 3WFBL 2BMKA 5TGBA 4JX0A 5H37A 2GG1A 1YO4A 4H26B 3TF4A 4IRJA 1DJGA 2J8UE 3NIFB 3X1GA 1BOYA 3HNSH 1I7UB 3MACH 5FKPB 2EDWA 1ZLVK 4QRRD 3ILQC 1MHCB 1NTDA 1IGCL 4NYLA 1DE4B 1HHHA 2XKNA 2OW6A 1CCZA 1FHNA 1P4BL 2UX7A 1U8LB 5ACZB 1A1MA 3VB9A 4NQXA 4WSGA 4N2AA 4GYBA 1V3JA 3MMEA 1CWVA 5BRZB 3PV6A 1FG2A 2IOOA 1URIA 1QFWI 2J21A 4U6TA 4NUQA 5HGDA 3AG1B 2P8PB 3GBMH 1UXSB 2R4RL 4ONHA 5T3ZD 3VW3L 1BVKA 5CD3A 1N8ZB 2NXYC 5HDRA 4AGMA 2MQCA 1V3KA 3CXHJ 3K74B 4KUCD 4NQSA 3KLSA 1PNDA 4D8OA 2CPCA 3L4XA 4ZW3A 1A8JH 4X6FA 2VE6B 2ZX6A 3NYKA 5B1KA 2KBGA 1BQRA 1SN5A 4HIPA 3TBCA 4KZDL 1E27A 2CLRB 3LD8B 3RWCB 5IZ7A 2EIKB 1QVOA 2RQEA 4YE0A 5C0RL 1NAMB 2F53E 2DQFA 1BIHA 1SJHA 4CL7A 1V55B 2NY2C 4LLUA 1JHTB 1C12B 4DPBX 1F3JA 1N0XL 3AAZA 4N2MA 2Z7YA 2XV6B 2XNAA 2I26N 2X4OA 2GW5A 3BO8A 2X3AA 2VDMB 4IBLT 5IB2B 1TJHH 1IBZA 1T2QH 4L48A 3QQNA 4FZ8L 5DRZB 2BIHA 3B7TA 4AJYV 4JFZL 4HISA 1XGUA 5D7SL 2FO4A 4LAQH 2R2BA 4QHNB 3MLPA 3C6EA 3UTTB 4J8RA 1E5YA 4LF3B 5GRUL 1AH1A 1LYQA 1XIWA 4NHUB 3GJFB 1KGJA 1OHZA 1DBML 1FH5L 2GCYA 3GMMA 4UI2A 3TWCH 1KULA 1HXYA 4G8EB 4ENZA 3DJSA 5IMMA 1RURH 2QJDA 3JWDC 1AGDA 3Q8FA 2EC9T 4YUEH 3C08H 4L9DA 4R7VA 4U3CA 4H0IA 1EEYB 2VTFA 4U6YB 1NA8A 1J88A 4OLWL 2NXYB 5FAAA 2ESVD 4QXUL 5J1TC 3FZUD 1U8CA 3UC0L 4LSRL 2P8MA 1Z7JA 3W9DA 4NWTH 5I1DA 5T3ZH 5FV1L 4JDTH 1DQLL 3INUL 4YDLB 1T0MA 1FGNL 3KBFA 1C08A 4KHTH 3AMLA 2RB8A 1BW8A 2COVD 1N19A 1NAKH 1MCHA 2ESVE 3WEXA 3A21A 1HKLH 4GFTB 4XNQB 3BZEB 4QRQB 2XX1A 4FI8A 4G7YL 3UH8A 2WNGA 3EBGA 4L4TA 4QWWC 4PG2A 4X4XA 2XIBA 3O9WD 2ZUSA 1FN4B 4W6WB 3C60B 1TTFA 2IALA 4TQEL 2P47B 5FM8A 3O6FB 2X70A 1F90L 3V4VH 2FJGB 5E1AA 3G08A 3BZFB 1XAKA 3GJFH 5D7EA 2YRPA 2WXRA 3PP4L 4PP1C 3ZGIA 4AGPA 3MZTA 2CKBL 3ARDA 3DX4A 4YQXH 5IR1A 2HT3D 4YDVA 4PREA 4YSSA 2CAKA 2K4AA 1YDPA 4OQTA 3HPJA 4JS7A 3T1WA 3N41F 3ABKB 1UOLA 4KNTA 2Y5QA 3UO1L 1WHOA 4LVNB 3L7EB 1EHLL 3U83A 3VFWB 1JHKL 2GBAA 3MOBL 3K0YA 4LCCB 1EBPA 4LLWB 5E6IA 5C3LD 3ABLB 1E5CA 3ESVF 4J3XA 3GMNB 1IV8A 4S2SA 1YNLL 4AW4A 1E6OH 2Y1VA 5AG8A 2RACA 5JPNB 4DVBA 1UD8A 1BCIA 5KAQF 3QK0A 5C0IA 1YLBB 3IFPA 3C5SB 4HWNA 4JR9L 3UADA 1ZD6A 4YHKH 3DC0A 3FQWB 4L8CB 1ADQA 2IFFL 5LDSA 5DWUL 2JIXB 4OUUA 2BSBA 2IXQA 1UXWB 2VABA 1YEFL 3TEUA 1G9EA 3QIWA 4PV9B 4GBXC 4H40A 2V9QA 4JFVA 4FQHA 4HWZB 3ULVF 1EO7A 2DD8H 2NSXA 5HDQL 3BWZA 3OXSA 2Z0BA 4OCLC 3VFVB 4X9GA 4RMUA 1OF2B 4PHXA 1RH8A 3PFQA 1JYNA 1E4KC 1X7TA 2SODB 4N2LA 3ULUD 2QQKH 2XTSA 2R0ZL 3BN9D 4YXKL 1VDGA 4HEMA 1PD1A 4FRWA 1MW0A 2Q7NA 4HW6A 1KEGH 2FHFA 4WCYL 1Z0MA 2FX7L 2YPVA 1KCWA 3GSNB 4LSVH 3K80A 4A7SA 5LBGA 3ZDYF 5K9QG 1N5YH 1F56A 3BE1H 1UA7A 5GGQH 1UJ3A 3VCLB 5ISZE 4M5YH 1PZCA 3LN4B 5C7XL 1FJ1B 1T0NA 3QRGL 5LWYL 1DJXA 1S78C 4TVPH 4MJ2A 4WUUB 1LO5A 1GYVA 1TSHA 3KL3A 2Q2EB 2NZ9D 2LLLA 2X4QA 2IWGA 3FCSA 4LSRH 4WI8A 3Q9QA 5F70A 4ODUA 3VI4B 3U1QA 3ZJAA 1QFPA 1MWOA 3MCYA 5HHXH 2TRHA 1P6FA 2I5YL 4G71B 4JQVA 2ZOOA 4MJ5A 4OCXL 4P9HH 1V8HA 1MDTA 4E9WA 4PTTB 3QUXA 3D85B 5FEBA 1E9OA 1OSPH 2OTUB 4NKIL 3WSQL 3N85H 3I6KB 1LK3L 3IDJB 4M48L 5CN2A 1KCKA 1MFVA 5K39B 4XTRD 5IROD 4TQPA 5LLIC 5ES4B 1CBVH 3WIIH 1IE4A 1L5GA 1FVCB 5JHLA 2ZUQC 3VI3F 2XQYA 3ILEA 3NJVA 5I74C 4FNSA 5EOTA 2BFVL 3V0AC 2OZ4A 3OKMA 4WF7A 1TJMA 4NHUA 2R7EB 1CFSA 2IC2A 1FDLH 4BH7B 2ISDA 2XN0A 4D0CA 4KROC 2FO4B 4QHNA 1PF3A 1DQIA 3BN3B 2DWDA 1Q9KA 5JIHA 4QUOA 4JN2A 2PN5A 2JV6A 2XBTA 5EBWB 2NUTB 5K39A 1RU9H 1KN2H 5AFAA 1EHNA 1B4RA 4H7VA 2PR9A 1VF5C 3J2PA 3EXJA 1AXSA 3HS0C 2JLLA 3LVEA 2B2XL 4TL4A 5T33H 3F6IA 4KUZL 5AVRB 4DP4X 1X9UA 1NEZA 4AEHL 2CHXA 3O6KH 4LLUB 1PX3A 5D1ZC 1M1XA 1RJYA 2Z31A 3LZFH 1OEZW 4G6FD 3LQAH 1J12A 1I8LC 3IMWA 1V54B 1P6AB 1SRDA 2N7SA 1PIGA 2Y5EA 3VXSA 1V3MA 4HXBL 4YHYB 4YNYA 5JQ6H 4PJ7B 4YHML 2XWBB 2X4QB 3KLAA 3NEOA 4OGQC 2ZJSH 5T3XE 1ED3A 1MF2L 4H8QA 2YD6A 4XZUB 5CJOL 3S3CB 1AD0A 3VQMA 3US0A 4M4RB 3BH8B 1C5DA 1ET7A 3MLUL 3FB7A 3VM7A 1MFDL 3BH9A 2DQTH 2BX5A 1AXTH 4MJIE 4DF9A 4DGYH 4Q2ZB 4YSTA 3TBTB 2Q7AA 3U0PB 1BM3L 4GMSH 3R19A 2NY5L 4HGWB 4NQXB 3EIFA 1WD8A 3I75B 4KRNA 3IETA 4P2RD 5EH1A 3IFOB 2QQKL 4R5XA 1SEBA 1HHHB 2E56A 1L9QA 3L6FA 5E8OB 4ODXB 1WF5A 3IFLH 4OFKA 1CLYH 3BZ4B 2FX8L 3N55A 1LE5A 5AVQB 4DPRA 5HYJE 3NTCH 4D2NA 3PGDB 1QABA 4WSKA 5DURB 4ERSL 3IXAA 4OU3A 1WS7A 3QQ9D 1UB6A 1NUNB 1UKTA 4M5YL 3NFSL 3RX8A 1FRGL 2APXA 1ND0B 5FS5A 3SQBA 3MRGA 1J9SA 4HETA 1JPEA 4X2UA 5DJ8A 3TONA 1QHQA 2RH0A 3UJIH 5C1MB 1PX8A 1HSBA 1IKOP 1BZ7A 1M05B 4DO6A 2OMBA 1AHKA 1K4CB 2EE0A 3MRNB 5BS0B 1Z9PA 3LNIA 4WTWA 4XNUH 1TVHB 1NFIB 3L54A 5FYLH 3G5XB 3PV7A 2QMKA 4MNQB 2Q5BA 1T04A 3ZL2A 4YJZL 4Z7WF 1SNRA 3GGWA 1F1AA 4BQ6A 1IM9A 2Z31D 3UPCA 3WJLC 4PRDA 1UT2A 3KPMB 5D7LE 3WE6A 1S9WA 1YNTB 1E3ZA 4Z7VE 1QFWL 4EVNA 4OIAA 2FJHA 2VAAB 5C6WH 5I66B 3QDJD 2EILB 4AIOA 1CG9B 1XCXA 2IMMA 4QOKB 5ITBH 2BNRB 2AQPA 4HU8A 1FHGA 4R7DA 5LGYA 1QASA 4U6VL 4E9TA 3P3RA 1LK2B 2QDVA 4U1MB 2Y07H 1YEWA 1YEDA 4L1TA 1S8DB 1HNGA 5I8KL 5I0XA 1OO2A 3KXFA 2P8LA 2JJTC 4NIKB 2QSCH 5IMKA 4PRPB 3HNSL 3GSNL 4FFYL 1X4YA 4H1LH 2DRUA 5AKTA 2KPNA 4XX5A 2MCPH 3UBXA 1UM6L 4PWKA 4NAJA 1I8UA 1QFUH 4K8RL 1XH0A 2BK8A 2P5WE 1IKNA 2X4OB 3NOIA 3RNQB 2P80A 3WY4A 1BQ5A 1SLXA 3WS3A 4DCQB 5BXFA 4LAJH 5KYXB 5DJ6B 3TA3D 3RLSA 1N6QL 5JQ6L 5I1CL 1ECZA 2ZX9A 5I1DB 4MQ7A 3SDAB 4P23A 4PB0L 4LCUB 3T8VA 4AI7A 4MX7A 1MJ8H 3D6GA 4L4VA 3DSNB 3DX7B 1DVFC 1BF5A 4PJ7F 4QXTA 5D4IA 2VLKB 2CJSA 5B3JE 2XWEA 3GD1C 4NBYB 4IGBA 4GAYB 2MNUA 4POUB 5DRWA 1T0OA 5IB3B 5KBNC 3OQRA 1WWAX 1Z0NA 1XIWB 3ZTNH 4O9HH 3K3QA 1CO1A 3PWVA 4G83A 2YGNA 3PQYD 3QXUA 2BH0A 3NFPB 4KITB 3QVAA 3HG3A 1MAJA 4LPTA 3V95A 3EYSL 1DBKH 2VAJA 3JBG7 4KKNA 4NOFA 3T6WA 5HYJD 3X3GL 3IVKA 4KTGA 1JPGB 2EYSB 3CH8A 2W0FA 4GI9A 1JNJA 4M7ZB 3E3QE 2WZ5A 1OGAE 4LCYA 3U6XA 2XSKA 1YEGL 2XZAL 4ERSH 1UQSB 3RL1A 3FT4B 2GFBA 4GAGL 1O9ZA 2WKGA 2CIIA 1GZQB 3WXWL 5I73B 1RPUA 2TSBA 2XX0A 4EZMA 1N64L 2HFFA 4X6CB 1NC2A 3GKZA 3FUDA 2X10A 2CE6A 1RZKL 2VE6A 3HUJA 4HCGA 4OT1L 4YIQA 3G3LA 1E9QA 2AVFA 1XGRB 4PJ9A 4E42A 3ESUF 3MJ6A 4LHJB 4QXUH 4FMFA 2VDRL 3HS8A 3VE0B 5AKVA 2JNZA 2GK0B 2EIDA 5FFLA 5FYLL 3X1EA 2MCMA 4L4TE 3GI8H 4U49A 1WBYA 5JHAA 4OSUH 4W4NA 3S2CA 1BVLB 1FGNH 2XN9B 3FUEA 1D6EA 4EKJA 3V0FA 3FN3A 4F7PA 1WFUA 3CSTA 4NB7A 3L3JB 3MV01 1GS8A 4XCEB 5DI8B 2IPTL 4P5TB 2XKSA 3S3DB 4A6YB 1DE4A 4YPGB 1U21A 2KYIA 2P5ED 2OZNA 2G2RB 2R29L 4Y5YB 3CDCA 3VQLA 4JJOA 1XEDA 2VN3A 5EU7C 5B7FA 1RUML 1NMBH 2H45A 2B1OA 4LOFA 5HI5D 1NC4D 5A3IC 1BM7A 4U0QB 5I16A 3K2UL 4N24A 1GYAA 1F00I 5C07D 2EXSA 3LPPA 1U3HB 3DHUA 3HVDA 2XRAH 3SE8L 4B95C 3WIFB 5FLUA 3QAQA 1Z5HA 4YSQA 5HGHB 1D7FA 1T1WA 3MYJA 3T4AC 1A1NB 1ZLEA 4G8FB 5H35A 1U92A 5KANI 1IU1A 1CC3A 1WHPA 1FI8C 1A1OB 3LKPB 4FF9A 5CU5A 3E7JA 3ARDC 4GW4A 2OMNA 1DDTA 2XETA 4N20A 5I1AA 1JK9A 1R3KA 1QSEE 3GO1L 3VMOA 4ZMWA 5I1CH 3DIFB 1PGRB 5D2LF 5HPMA 3AC0A 5HHOA 2VR9A 5IBTL 3D3VE 3CQPA 2HRPH 2IANB 2YBRA 3MA7B 1DYZA 3HBZA 3T5WA 4M43H 2XQ0A 4JVPA 1E67A 1DZ0A 3VQ2C 3QQ4B 2H1LM 4L3EA 5E9AA 1FFPB 4BK8A 9PCYA 2A4CA 3F65A 3W38A 1U8JB 3WCYA 5C0DA 3MNVB 4FJYA 3EADA 1H6UA 3K1DA 5EZLB 1NCWL 3ECQA 1A7NL 1KYOK 5I6MA 3NJMA 2WSPA 3QCUH 3RVXD 4R2GB 5GZOA 4GAJL 4ZMPA 1EXUB 1O6SB 5D5MA 1Z6JT 4LLVA 4DQAA 1WAEA 4YAQA 2A2QT 1DSYA 2WUCL 5F97E 2R27A 4F7EA 2QVIA 4NJAH 2B7DT 2B59B 1UFUA 4N6RA 1N5YL 4NZTH 3BE1L 2D8KA 2F6AA 1FV1B 2ZG2A 4WI4A 5E8EA 3W82A 4KO6A 5E4AA 2N0KA 1R17A 4GG8B 1S7QA 5HJ3A 3KLQA 2DLHA 5ADPH 4L3ED 3GYRA 2NY0B 4G9DA 5B1JC 3BW9A 1OCRB 3GSWA 2E4FA 4MD5A 4RBPK 1AD0B 1DEEB 2OL3A 1U3HD 1IIIA 1T3FA 1SMOA 4UOW0 4L4VB 3Q8CA 2E8ZA 4P46C 4GKZB 4MKMA 3RI5F 3WG7B 4OUOA 3X3FL 4X0KB 3GI8L 2XTJB 1NDTA 1VEMA 5E0FA 5EUKA 1OWWA 4E41E 1XGTA 3CK0H 3SE4A 3ZQ9A 5LGHL 3TBYA 4OCXH 1FFTB 2B14A 4P9HL 1AI1L 4H5SB 5JA9A 1IJ9A 3CPUA 1TKWB 3EH3B 1I75A 3DX6A 3TEZA 1DVTA 1NEZB 1IEBB 4QTFA 3GFUA 4HIJB 1BQLL 3B9EA 4HKBA 3CH1A 1V7NL 5EU7E 4L0ZA 1RY7B 5BO1L 3QXVA 4O2EB 3VVVA 4ALAH 4CMMA 1KWKA 2A5UA 5KG9A 4KTEL 3UGUA 2CUMA 5CLYA 4KQ0A 3D3VA 4JHVA 4JFTA 2AQRA 3QQ3A 5J6GB 1KJVA 2BFVH 2O6DA 2Z4TA 3LKOB 1FDLL 1QWNA 4P5MA 4UT9L 2F58H 4WNQB 2AK1L 4I0PD 5CP7A 1EXHA 3FT3B 3BP7A 4ZMXA 3AB0C 4FQLH 3D0LA 4NQDB 3SGDH 3C2AL 1U8HB 1HNYA 4F58L 1KN2L 2XV0A 2JLPA 3ZDZF 2JI2A 3F83A 5JO5B 2HLAA 5JW3H 1ZPUA 3DYMA 2L7EA 3EOAB 3N0AA 5LN8A 3D9AL 1MQKH 2EEBA 3NIDE 1BVNT 4WI2A 2EADA 1S7VA 3VXOA 1NPUA 2OTWB 1NGXA 1YEHL 2IPKA 3C09B 5AUMA 2BP0B 2DMGA 2K3HA 1NAMH 4PJGB 2NNRA 2WNXA 1FGVL 5BMFH 4WWOA 4M6OL 1ODAA 1HHGA 2ADGA 3LV3A 3GUTA 1AIFB 5B3SB 1NIDA 2BP8B 1D5BB 3D34A 4ZS7H 5DJZB 5EPMA 3T2OA 2NNXA 3V6OC 1M05A 5AD0A 5I19H 3RVVD 4U05A 4HGMA 1E4XL 4AITA 3Q2LA 1RPQA 5BCAA 1OAQL 3NACL 3L3KB 4AL8L 1X5HA 1FNEA 3W11C 1T6BX 1BWWA 3NZSA 3ZX1A 2L0DA 4PGDB 2YLHA 4LKXB 3RB7A 3DURB 1M7XA 3VFOB 4I8DA 5JIIA 3KJ4B 2Z8SA 1EFXB 1XD1A 1F41A 2NY5H 1HSAA 2UUDH 2OZ4L 4C56B 3EGDB 1RUKH 4K3HA 4XHQA 1KGCE 2BVEA 1I53A 5C0AA 4ZMOA 1XR9A 1FO0B 1KIUA 3RWDA 5ELIA 4ZOAA 4WTQA 5BV7L 2WUCH 5DK0B 1WDAA 3EJCA 4KC3B 1H9DA 3ZK0A 2AS5M 1ZHKA 4FXKC 5D6DC 1OF2A 2Y25A 1MOEA 2C4FU 1CICB 2PTVA 4BD4A 3TZVA 2QMJA 3FO0L 4FHJA 4X6BA 5F88B 3ZE2B 5ADPL 1NBZA 5CZKA 4XCCH 5CZXD 8FABA 1DANT 2A0LC 3AWGA 2VO8A 5CGBA 2IQAB 1MIMH 1OPOA 2VABB 3BH8A 3UGXA 1W15A 2QSVA 2CJTA 3QUZA 1ECYA 4L18A 4ZFFA 3UTQA 3QUZB 5E2UH 5L4JA 1HL9A 2P42B 5E00A 3DV6B 5C09D 1WAAF 3RPIB 3RWHA 3ZRCC 5IJDC 1OW0A 1MZZA 2MNWA 1T21A 1YNTF 4CSSA 2B8OT 1DQVA 3H9SE 2AK4D 5B1BB 1ONQA 4XH2A 4KZDH 2OMUA 4AH2A 1DN0B 5CZRA 3V52L 2BP0A 3TV3H 5LG6A 3EBAA 3KAAA 1MY5A 4HWUA 3HZMA 3HG0A 4IOFC 3LX9A 1RZPA 5FCUH 2DWSA 1N0XH 2VDNH 1YEIH 3FQ4A 3GT6A 1ZK5A 3AACA 3H55A 4N0FB 1QTPA 4G80A 4HHGA 2CM5A 1YDPB 2VSKB 4FEMA 1R9FA 3MC0A 1F6AB 3MTRA 5J4MA 1GZPA 5AYUL 3S3PA 4OAWA 2Y22A 3TFBA 1G6RA 3TPKA 4Z23A 4LVNC 1NDMB 3RFZB 1CGSH 2CU9A 2VZ1A 3Q6GL 5GGRA 2ZWSA 1E8XA 3CV5A 4R6UA 4TVPE 2WXQA 5GGRB 1EJ6A 5AVTB 1KY6A 3H42L 1FZJA 1KJVB 2WQUA 4FP8H 4MNGE 5DQJB 5F1SA 3FQTB 5DFVD 3GHEH 2ZWLT 4KRPC 3JT0A 2PXYD 1JXFA 4MZ2A 2OMVA 4UIMA 1DBBL 1OB1B 2A7BA 3C08L 4P2RA 5DD5H 4HKJA 2LLNA 2EVFA 3NCYP 3U1SL 1RIUL 2MTPA 4X9BA 4Z7VA 4PJGA 2YPLA 4DEPC 1R0AL 2XACC 4MJ5B 4MQXC 2YPLB 1R6VA 1EGJA 4MAYA 1RK0A 2DB8A 1CT8A 1NBQA 2W8CA 4JO4H 2K6ZA 1L0QA 1OP5K 3O3BA 5EULV 4UDUB 5HI3D 3V9FA 1OM9A 2ITCB 5SWSB 3DV6A 3RPIA 1R3IH 3FCTB 5EF0A 4BRJA 4B27A 2WQSA 4KK9C 4BFNA 5DGQA 3ZKND 1RPKA 1FZJB 5DQJA 3ZE0E 3TVMB 3SGKA 3PAVA 8FABB 1UWGH 4WDIB 3VSQA 4F7TA 1OTSD 4GRLA 2D3NA 3BGAA 4KPHH 5DHVH 4NO0D 4HUVB 4ZK8A 3PP4H 5C0BE 5LDUA 5L6YL 4XN7A 3AWFA 1CGYA 2P24B 3ULUL 2PKDA 4PJAB 2ICEC 1MLCB 3CTTA 2HFGH 3Q3GA 4NUGH 2Y6TE 1WITA 3F7PC 2EDTA 3UTSE 4G6AC 4BZ2A 4NO0A 3NSYA 2ZXCA 4M1CD 1MIEL 3KWWA 5DXWA 5IQMA 1C5BH 3APNA 4YOKA 1F3JB 3AAZB 3ZDZE 4KY2A 5C8JB 2C3WA 1IAKB 4P2AA 4F3FA 2ZUTA 4KXAA 4K7PL 5IB1B 3T6VA 3TBYB 1QVOB 2ITFA 1IKFH 2BXYA 1T1ZA 4MBRA 4Z7WB 3BD5A 3JWDL 5SWSD 5KVGL 1IKNC 5FO8B 3MRMA 4JFPA 1BYNA 1ZOXA 2CXGA 2KMWA 2WXFA 4RMBA 3DRTB 3F2LA 3VGEA 5ADOL 3LNDA 5J7CC 3PXJA 1T6WA 4A63A 4ZXBD 4F2ME 2AJZB 2J8HA 4N85A 4PCKA 1SYVB 3H3PH 2IFFH 4N9GB 5D96C 3QCTL 5DJZA 4CMHB 5FUCE 4ABUA 2RR3A 4JZJB 5HGDB 2CK0L 3U9UA 3VG0L 4ZFOL 3NESA 1ZIBA 4OKVB 1TU2B 2OL3H 2JKJA 5SWZD 2B59A 4K0OA 1RZJL 2DD8L 5DLML 3B9KA 1S7VB 3VXOB 2G5BA 5HDQH 2RBLA 2BC4B 1NL0L 4PJEA 2C7UA 4ZNEE 3CVBA 4TNVF 5HYSG 2J5LC 4JGUA 1A1NA 4G8FA 1CN4A 2R29H 3L5XL 1I7UA 1WP6A 2CHNA 1NMBL 3PJSA 3STLB 1BBJB 4YXKH 3QI9C 2KC0A 3ATBA 3VNYA 1U8NA 2R0LL 1V7MH 3IAQA 4YGVA 5FYLD 5EZLA 4Z77A 5C3IA 1KEGL 3BVNA 1IBHA 3AITA 4UBDD 2BY1A 4F80A 2F68X 4HV8A 5DMIH 4ZOCA 3JT2A 2I7OA 1DFBL 2E7MA 5CMAB 1JZ2A 4RWYH 3F7QA 2P46B 3QPQC 5SX4H 3KGRA 3II1A 3SCMD 4DGWC 1E8WA 4KHXL 4LOUC 5BZWB 3SPVA 1J1XL 1XV8A 1SOKA 1FQ9C 5TE6H 1JZIA 1TCRA 4AG4L 3OJDB 4PM1A 5K1JA 4PJHA 3WIHA 5SWSE 3LN5B 1N26A 2VW4A 2NXYD 3U4AA 1P2CB 4LLYB 1N4XL 2WN2A 5HHPB 5SX4I 4P5TA 4AK2A 3I02B 1J9TA 3JUYA 1IM3D 3U0WH 5AUMB 2YSTA 4XBGB 2FNWA 3QUGA 4PPTA 5IBTH 2VXVL 5GRXG 3SGKC 1PLAA 1QBLL 3PWJA 4DQOH 3HC3L 4CSPA 1GKEA 3TM6A 4NKIH 3HN3A 1K4DB 1A9EA 4M48H 3V4UL 1YA5A 3L95A 3A4FA 4XMLH 2XICA 4NKDA 5DEGB 3BH4A 1U3HA 3VMNA 2X87A 4HFUL 4XE0A 3PAZA 2P5WD 4R97C 2JI3A 5DVPA 2DOCA 3HEIB 4NQUA 4N6QA 5D71L 3QEQE 2V7HA 1CU4H 4NNXB 1S7XB 3TBVA 5E2WH 4YBLB 2J1WA 2BNQD 1C5BL 2D9CA 4DOHE 2DMCA 1YAIA 3BWAB 4OF8A 1XX9C 4OLXH 4PG2C 2V6HA 4NZTL 3L3JA 4JM2A 3F7RA 4HK3N 2FT8A 1DVZA 1P9MC 2EE3A 2WXPA 3IK2A 5E95B 2VDKL 2VM3A 3LHAA 4PJIF 3TNMA 2OP4L 3W9EB 4QF1A 5CLTA 4NENB 3F64A 1F86A 5IB3A 2XDHA 4X9YA 2RFXB 2HRHA 1XZWA 1SDAB 3QQ4A 2Z35A 3VYNA 4PGCB 3L3OC 5EIVA 5KVMC 3D39E 5EZJA 1D6VL 1KLFB 9CGTA 3EYOA 3ECBA 3QCTH 5IEHA 3WNIA 2A6JB 2ZCKL 4Z3TA 1W16A 4UM8B 1QLRB 3OMIB 4KKLC 1ZLWH 3E1ZA 1T5KA 5CM1A 2XTLA 5DFVC 1UUNA 4MMZC 4BUHA 6CGTA 1Q8MA 4RFOH 2PYFB 2HJLB 3SPGA 2Y36L 4Y4FB 3RZCD 4NO5B 1R3KB 3FSWA 5JUEL 2CR6A 2E6JA 1XIWC 2HX9A 4KK5D 3VGFA 3BGFC 3KGUA 2VMDA 2NXZD 1J0JA 2GIYA 4ZMNA 4JHAH 4HX1B 2NLJB 1UZ6E 2DF3A 5FKPA 4X5QA 1AQDB 2R0LH 5FUZL 2VLKD 3Q44A 2K9UA 5DGRA 1C7SA 1ZA3B 4LVHB 5DMIL 4GQ9L 4Y16B 3T2NL 5JR1H 3HBPA 3DHJA 2X6AA 3PWVB 4R4BA 2AK1H 2WKOA 4M7LT 3MBXH 1ZXQA 5J11C 2DM4A 3UZVA 4ANWA 4L8BA 4KJWD 4G7QB 1E9PB 4KK9D 3TEXA 7PAZA 4HU2A 5DEGA 1KXVA 3BUYA 1KBVA 2OK0L 5JW3L 5T8IA 4FEIA 5E9NA 3VI4E 5GPRA 4JFEB 1E5ZA 3G5ZA 5TQ2H 1EXGA 4RIRB 4Z7QE 4P23B 5DHVA 2ZXWB 2ZD0A 2ZX7A 4KVCL 1NAML 3IKCA 1WZ1H 4GKOA 2QADC 4L3FA 4ZXBB 4YSCA 3EDKA 4EIUA 5AW1B 4N2KA 4PUBH 4X99B 3WL9B 3HHRB 2YUWA 3V4UH 4GBXA 3ZRSA 1IT9H 1DN2A 4F7CB 4WEEA 1KGCD 2DWXA 3S2AA 1REIA 3VH8G 2R4SL 1OAQH 3BVXA 2VLJD 1CFTB 3TO4A 2WB1A 3CQQA 5ITBL 4Y5XC 1AOZA 1C8QA 35C8L 4Z18A 1FP5A 4ONFL 2NDGA 4HP5A 4JJ5B 4GXUM 4OZHF 5E8PB 1D5RA 2GSGA 3CXDH 2W80C 2C9PA 4EEEA 2Y7MA 4YGVB 2FECL 4UWQB 3VO0A 3QRFM 3VU1A 1NIAA 1K8DB 4LLDA 2FQEA 2TAAA 4RMQA 1WFMA 3HZKB 3VRIA 2EYSA 1S3KH 4P3DA 1J9CT 1LILA 2OJ1A 5LQBL 4GRLC 2WXKA 1BD2E 3PNWA 3VX0A 3IETB 4HIIA 3SDDC 4PJEE 2XZQH 2FGWH 3MCG1 5FA3A 2WBXA 2MQGA 2YXVA 1WBYB 4CC4C 1B4JH 4UTAA 3PWLB 5EG6C 4LPUA 3H9SD 2MRYA 1IGTB 4FZEL 1UD4A 3BH9B 3MJ7A 4M03A 3PDGA 4YDKL 3OMAB 1SYVA 4I0KA 3FRPA 1USQA 4XPGL 5J1AA 5D9SA 3TIEA 1CI5A 3K6FA 4HQQL 2WY3B 2BRQA 1KCSH 5I0VA 3TESA 2AHIA 3KLKA 1M71B 3S35X 5IK3A 1I1AC 3FXIC 3QJRB 2A6KA 1ZGLM 1OD7A 2YGVA 3SYOA 4HG4K 3RIAK 1VACA 4OCSH 4JHZA 4Q9BA 3MLSL 5HGBA 2FVNA 4A6YH 4M62L 4PU2A 2WUBH 2CQVA 3K2MC 4C83B 4DVRH 4OZ4A 3HMXL 5FCUL 3MLXL 3BAIA 4LNVA 2RQ8A 1GRWA 5I71C 3WEOA 4UOZA 5KBDA 2DBLL 3ZMEA 1NPNA 1L9OA 2NUTA 3SDAC 2C5DC 1CGTA 2WWKT 1SBSL 1RZFH 4HJ0D 3TFKC 2Z64C 1NCHA 1ETA1 4BHUI 3U0PA 1R5VA 1NOFA 1SDYA 5FYKL 4FG6C 4U1GB 2Y7SA 4YHYC 4ZUTA 3WXWH 5J89A 2E6QA 2LLGA 5F7LB 2NZ1A 4QY8A 2MJWA 1WA2X 3KWUA 4AVJA 2JKIS 1LP9A 2GVYA 1CXEA 1FVCA 5C07E 1UCBH 3BT2L 3QQDA 1ETJA 5EZIL 4WNJA 3CFUA 4JFQB 4Y5VA 4KGLA 4XMKH 4CVZB 1NGYB 3O3BB 2XTJC 3HHMA 3X11B 1R0AH 2LVCA 5C2BL 5AAPA 4J5VA 3MLWH 4E9RA 4OSUL 4Z7OE 2FO8A 4PJ8D 4LBEA 1FE8L 5TQ0H 2V9RA 1AGEA 1KGWA 3CUPB 1GY2A 4Y1TA 2ZX8A 3S5LB 1R3IL 3DECA 4EN3D 3TEYA 4S0HA 1KIRA 3FTGB 1Q0YL 2WBKA 1X5JA 1MVFA 1OE3A 1UURA 4W9FC 4Y19E 4GG6B 2GTWB 2G4GA 3VFNB 4I87A 2CH8A 4YHPA 35C8H 4TLTA 3WUWA 3K4ZA 4PW3A 4OCYL 5F7MC 4HK3J 1H6TA 4AYFA 5FKAA 3QH3B 5J11B 4KKCC 1E5UI 4PLJC 2R23A 1ROCA 3H4FA 2FEDC 4XRCA 4JDVB 5HBBA 1HESA 5ABZA 3QEGH 5D7IF 1JFQH 1TZGH 2ADJA 2HFEA 3N43B 4JAMA 4XVTH 1M2VA 3FN9A 4QWWD 5JHLH 3STLA 3BZ5A 3D2UB 2W95A 1CE1H 2A74C 3IDGB 3JVGC 4H4NA 4X4KA 2ZF9A 3T4AA 2DQMA 4Z3JA 3CSGA 2XQYK 4QNPE 4N2IA 2OTUA 3AVEA 5ESAB 3TJEL 2VLRE 3DHMA 3VMPA 2NR6D 1AY1L 4NQCB 3IKKA 4K7PH 1F11B 3WTVA 4HHAA 3U6RB 2Z7WA 4NQEB 1IKFL 4K7FB 3TTYA 2WHVA 2WWMC 2NXZC 4WLCA 2CD0A 4I88A 4ETQB 3GHBL 4HPYL 4JZJA 3X17A 4YSUA 4DGUA 1UHVA 4AUUA 3S7GA 4C4KT 4QCIB 5GGTH 1EZUA 3ARFB 5E6SB 3BPNC 3B9AA 4XZUA 1SYSA 4APXA 3EOTH 3DUSB 4NKMA 2H1PL 2ZE0A 3B5TA 4NUPA 5C0IB 5ABDE 1K8IA 1W0WA 3TZVD 4N90E 1JPST 5DO8A 3ZYZA 4A6YL 1G9NL 5C0RH 3MV7A 5DK2A 4WWKA 2GTZB 4PJBA 2VLJB 3SYCA 5KVEE 3BP4B 2NOYA 3I9GH 4UU9B 1CK0H 2ENPA 2YPVH 4G9FB 4N5ED 3VFWA 4ENEC 5I8OH 4ZO9A 1O9VA 1A7NH 2Q20A 4RETB 2XWTB 5KYUB 2VR3A 5DEFB 3T0EB 1JVLA 1T2QL 4G8GD 1TNMA 2FD6L 3DMMD 3D39A 4TRPL 3QHTC 3BQVA 1Q94B 4E9YA 4G9FA 5E1HB 3ZIYA 4XWOD 4AQ1A 4RAUB 3GMOB 1G7HB 3WIHL 1FH5H 4J23A 4CILA 5GISH 1JWMB 4PV1C 3WUWG 4IM8A 5DJ2B 1A4BA 4IQHA 3CLFH 3ESOA 1K8IB 4HUWA 3FRUA 1MHHA 2IV8A 2A4ZA 1X5LA 1UM5L 3WE1A 3KGTA 3UC2A 1BMGA 1U58A 4LRNL 3CG8A 4ZRGA 1XWVA 4L4TB 4PLNC 4XOCA 3NPZB 3LB6D 3FT9A 5FGCE 1W6LA 3S5LA 1JYXA 2YAEA 3SE4C 3RIKA 1EHXA 1RZQA 2YUVA 3NQIA 3FUHA 3ZHDA 3OJVC 4B60A 1QBLH 4DQOL 4WSJA 1NAKL 4HJGA 3SSGA 3F5WA 4BZ1H 3H53A 4JKPL 1FFOB 1SOSA 3CZNA 1YCSA 4M3JA 1V7NH 4K3GA 4OM1L 5B1JA 1CXFA 3D2UA 2V2WB 3UERA 2GEEA 1MFAH 2E3VA 3NCMA 3ZU8A 2ADJB 4YDVB 1ULVA 2R39A 2C9QA 4X5PA 2OJZH 3PG2A 5HDLA 4LCWD 3HZVB 2ZP8A 4OZFB 4GQQA 2FJGA 3IDXL 1CUOA 2IDQA 1ZE3C 2X2HA 5E1AB 5FGSA 1URLA 5AVUB 4RMTA 4YSAA 4RGNC 4Y4HB 5F9JA 3JTTA 2FEEI 5AVWB 4R5TA 4CVXA 1IX2A 4FCAA 1LO4H 4AEFA 2RA1A 3L7FA 4NO3B 5D2NA 2IQ9L 3HMWH 3REWB 1C08B 1XBDA 2WOYA 3DI2B 1H3PH 2D73A 5BQ7B 3V4VB 3E80A 5IVXE 2DJSA 5J12B 1HTYA 3VI4A 1QBBA 4QRUA 3RWCA 4XGZB 4OD3L 4Y19D 5DJXB 4Z7QF 5DRNB 3CDFA 4JR9H 1TDQA 3KPRA 4MTMA 5KYWA 3CN3A 1U8QA 4KVNL 1YC7A 1BIIB 1ZTXE 2JJTA 1OCZB 4UV7H 3F7VA 4BM7A 1HVXA 2P80D 3FTZA 2ATKB 3IFPB 4IKLA 5F0PB 2PTTB 1H3VA 3WJLA 3BW9B 3GSWB 1N8ZA 2VSCA 1V27A 4CRPA 3ULVE 1IAIL 1V10A 2YO3A 5DJ2A 3SN6N 3QWOA 3POHA 4HWEH 4R0LA 2OMYB 1G7HA 2H2PC 3QXAA 4C4KO 3UTTA 2FL5A 1L0PA 2OX5A 3KDPB 1JYVA 2E46A 5E08L 1IO4C 4Z78B 4ZX3A 4OLVH 4PH8A 2R0ZH 2X7LA 3AT9A 4PY8I 4QHPA 2X1WL 3LRSB 1EAOA 4QJ4B 5MI0C 4WEMB 4ZNCD 5J57B 3UTPD 3ROLB 4LLDB 3Q2CA 2J12B 4LSVL 4PIRF 5D1ZI 4ZI8A 4GT0A 4YBHA 3B8SA 3MBXL 2AV1A 2EVHA 3HC4H 5IUSA 3S4SG 2LFEA 5C0DB 4PV9A 1P4LA 3VA2C 3VXNA 2PCPB 4Z7IA 3BIAX 3G08B 5EU4A 4A04A 3RZCA 1JK8B 2ZG3A 1NFKA 2HT4C 2H7WA 3HG1B 2IXQB 3SEPA 3ALWA 3ALXA 5ISZB 3NA9H 3LS5H 4LQFL 1NIEA 3ARFA 5K59E 1JZEA 4JW3A 2CDEA 4H8WH 5F1OB 5C0NC 4MDRA 3UACA 4KDVA 4RMVA 5CBAB 1LO3H 5EPMB 1MELA 1EDHA 1PLBA 1OTTC 3G04A 3QQ9C 2I5YH 3TCLA 2YQGA 4NDMA 1JVKA 1WZ1L 4ZDHB 4FHKA 1HCYA 2ZKHH 1T22A 1BSIA 4UB0H 5IGXH 4JFFE 1QSFD 2M8XA 2OR7A 1PY9A 4MA8H 5DF0A 4LK4A 5I6PA 3DJRA 3CVHA 1QD0A 3VD3A 3G6DH 4P2QB 3H0TB 3QFDB 3NRPA 2UZYA 4Y7OC 2NZ9C 5I8CB 4S1QL 5DQ9B 1XVSA 2CHZA 3KPSE 3F12A 4AY0A 3D0LB 1J11A 3B9KC 3ULVC 1E9PA 2VITB 3CX5J 3FBQA 1EBAA 3RNKA 2W1NA 4OZFH 5HTSA 1D2PA 3VA6A 2F9BT 4J6RH 3ZHNA 1HC1A 3ZKXB 2BCKB 4P5KA 2BY2A 5DC4B 4AM0A 4ODWB 4F1SA 4NZRL 5I9QC 4U4BA 1U8KA 2ZKMX 3C5ZA 4X4XB 2C1PB 4FKHA 2W07B 4PLKC 5T33L 4XPAL 4WEBH 3SJVE 4UQ2A 3WFCH 2HH0H 4FHBD 4RFNB 1FAIL 3OJMB 4U1GC 3OLIA 2AXFB 4Q58C 3ESPA 1U8PA 3D25A 3VXMB 1Q9WA 3ULUE 3KCPA 2QGEA 3RY6A 4PW9A 4FFYA 3K81A 3EOBA 2CR3A 4YDKH 5CSGA 4NKOB 5K69A 4MD4A 1U8CB 3VSTA 3VXUE 4ABWA 1KTKE 3WEMA 3PWPB 3UMNA 1S9XB 4CVZA 4MAZA 3BIBX 2ZOWA 5IF0B 4POYA 3DJZA 3EYOB 3GZKA 3QO0A 3BSGA 1XBRA 1OSYA 3H9YA 5DYFA 3QUMH 4PS3A 2ORBH 5FGBA 1YY8A 3SQOH 1S7QB 3S8WA 2HPOA 4HZ1A 2K1MA 4G5AA 1U3ZA 1PCXA 3H9SA 4JKLA 5AW2B 1MJJB 4GIOA 4LGSB 3WEAA 1W0YT 3MPCA 1ITCA 2AEOA 1A1MB 3QR0A 5K93A 5BQDA 5AEAA 3ZDYB 5L6YH 3ULUH 3P9MA 4XCYB 3CZEA 4GRWB 3EH1A 3VWJB 5KSAC 1KGXA 4NUGL 3SKMB 2OMZA 3BO8B 2FX8H 1SOQA 3H2WA 3NTCL 5IB5A 4IRJB 3B3IA 3N06B 2WTPA 3SIKA 5ECJE 3SDDB 3ZXAC 1H19A 4S0SD 5DDHA 2CLZA 2H0EA 4P2OC 1KTRL 4QNPF 2ZCLL 5E94B 3NJLA 3D30A 1OVZA 1QATA 2LFGA 4HMDA 5J13C 3T3MF 1M57B 1OD9A 5KVGH 1YEKH 5I2IA 1N9PA 2DQHL 2IO5A 3GC3A 2J7LA 3OKOA 1LO3L 1DUYA 5TDNB 1PTZA 1K4DA 1G7IA 2H9GB 5CD3B 5LO7A 4WV1C 5GGSY 5C2BH 4Y19A 1QRNE 1TTCA 2BSEA 2DJ4A 4J4PD 3TNMB 4J3WA 1OANA 3G9AB 5FO7B 2VXQA 3MMEB 3R8BB 3ECUA 4JREB 2YD7A 4PP2A 3PUCA 3F05A 4GMTL 1QSVA 3WTWA 3KH3A 1Q0YH 4ZO7A 1E4KA 1F4HA 4UQ2B 4E0RB 3KXFD 1HQRB 1I1YB 1MFEH 3LKQB 2H1XA 1NGWB 3RZCC 1F4YH 3JWOH 2C1PA 1BQKA 3GZOA 3VI3A 4PJ5E 5F9OH 4BA0A 4XB7A 1PNCA 4C8XA 4Y2DA 4JZNB 3TBWA 1FVDB 1DLHA 3IN2A 4FQ1L 2E9GA 5GGRY 1AQKL 2BCKA 2JQMA 2QFPA 4P5KB 3A6BH 4WUKL 1ZMYA 3NCWA 2CUAA 3LNFA 3KXFE 1AE6H 3G6AB 4JRYB 5EIIG 2FHBA 4IRSB 3H6AA 4L5FE 4Z7QB 1PKOA 3S34L 3QPKA 4I48A 4JFDA 4KH2A 1MFUA 4GBXB 4KVPA 2GITB 1LWHA 4YPGA 3SZ6A 1NKOA 8PAZA 2EEXA 4XAWH 4IK7A 4NXSA 1XCQB 4A2MA 2BOBA 5DMKB 1N59B 1QWUA 1N6QH 4F57H 3PWPD 1RZ8A 4KXCA 4FOMA 3KEDA 4FLOA 3NCBB 3L3HA 1XB6A 4RZCB 5F2FA 3U0WL 2E9BA 3B5HA 2QKSA 3NFNB 5CBEA 3PABB 2B9BA 3L45A 2X0UA 1RMFH 4PR5A 1G7IB 2H9GA 4ZX5A 1Q72L 1HSBB 4G3YL 5HVGB 3K4DA 3OR7B 4XI5C 3DOSB 1OAXH 2V5MA 3ZMNA 1SJEA 2VR5A 2WLKA 4OJFH 4JRLA 4WHYG 3BRDA 4IKJA 4E5XG 2ED8A 4DWHA 4XMLL 3U79A 2ZONA 1OGSA 5TDPA 5I0WA 2ARJB 3QJQB 3BMWA 4O9HL 1Z5LA 2HT4D 3EUUA 5D7JD 3NSCA 3P4NB 3TT3L 5SX5K 1P1ZA 3I9GL 3TH2T 5EOCH 3UG4A 3OPUA 3PGDA 1J87A 1KIQB 3QZWA 3ZLQC 1J8HE 2IAND 1CDBA 1ZVNA 4HJUA 2QQNL 4R26L 2ZICA 3ROLA 1VERA 4UT6L 4ODXA 3QEHA 2J1KA 2X3CA 2XY1A 3FONA 4KKQA 1G7JA 4FLSA 4QTIH 3Q5YA 4OLXL 1VESA 1IE5A 2O5YL 1OGAB 2DMBA 3WTXA 2XWCA 1KCBA 4B9IA 2FWUA 1CFNB 4WWKD 2CUIA 3WUZA 4G7VH 4N8VG 4LPXA 5T5NF 3ISWA 2DQHH 5IFJA 2WZAA 4MD0A 1DHKA 4QRSA 1A9BB 4UZSA 3SGDI 4DP0X 1N10A 2A73A 2J43A 2WIIB 4XP5L 5A43C 4P8QA 1XCWA 5EEZA 3OSVA 1I8IB 4Z7NB 3KPRB 4YVNA 2Z91B 1PD0A 1OW0C 3HE7B 5A16A 4UDUA 2DLIA 4D9QE 5AQ0A 3ILDA 1W80A 3Q13A 2ZCKH 4QRUB 4Z7WA 5MENB 3N40F 4ZO6A 4DETA 1RK0B 1E0OB 4JY6A 2FBOJ 3ENEA 1M1XB 3POCA 2ZAIA 3FQUA 3QUZC 3S5ZA 1XQ4A 3DBXB 1GL4B 3MBEA 3VFRA 3P0YH 3HAEA 5HD8D 4O4YL 4FQPA 3UIYA 4WI7A 2ZSVB 4NKQB 4DT2A 4YZFF 2WNWA 2A83B 4IRZH 4K9EH 4PBXA 3RDJA 2SEBA 5IJCC 3C8HA 4MA7L 3OB0K 3B4NA 2YD3A 4ODWA 4BH7A 1SGKA 3BWSA 2DTSA 1M3JA 3T2NH 5JR1L 3U7WH 1NKRA 4E9XA 3FUFA 2IFGA 1NCBH 2XRAL 3RWJB 3TPUA 5IHBA 3SE8H 3TN0D 4WO4A 1DP0A 3OAYK 2BNRA 4HGKC 1IL1B 3FT0A 1GIGH 2QLVB 1H3GA 2Z3FA 4KOCA 3IGKA 1EH9A 3O4LB 3P30L 5HHQA 2KH2B 1QBMH 1R3JA 1F5WA 3HNVL 2NY0C 2XJLA 4K5MA 3CZFB 3OSKA 1A3QA 5C09E 4BFIA 2ZX5A 1U93A 1GW0A 1Y7VA 5AG9A 1CL7L 1YJDH 2VJ8A 2AANA 4R7NA 5T5FH 2AJVH 2R83A 4YK4C 1OGPA 4TV3A 2FQGA 4F8PA 2APBA 2WN3A 1YYML 3G5XA 3UL4A 4GJTB 3P4LA 3INOA 3KH4A 3KZ8A 3RPBA 2YUXA 4X6DE 1KJ3H 3FCSB 2QQLH 3II3A 2OMVB 3CFTA 5HPOA 3I9AA 3BFOA 3ETBJ 4MXQC 4Z7UB 1QFHA 5IIEB 3RDTD 3BJLA 4JG5A 4BFJA 3GDBA 3UTPE 5C9KA 1TVBA 2KZ1B 5GS0C 1KB5A 1KBBA 2VDNB 3GDCA 1HZHH 3MFFB 1NDMA 3W3BA 4HV8B 1GOHA 1A6WH 4U31A 5AB9A 2WZ6A 2PYEE 2G60H 2W0PA 3MOAL 3EYVA 5GJTH 2QL1A 4NZFA 2FLRT 4WUUD 3AB0B 3JWNC 3LCYA 3NSFA 4KMLB 1U2HA 1AR1C 1PKQB 3RAJL 3UAFA 2BC4A 4WHTA 3KPRE 2VDPB 1THCA 4OZHB 3BI9X 3B7RL 5JHDB 2ETWA 1HS6A 1ZJBA 3EGDA 4YDMA 2I9LA 1JSYA 4GUCA 5IY5B 2VLJA 4YE4H 1GHFH 4RGMB 1B0GB 3JVGA 2A74A 1QO3B 2YZ8A 1D5MA 4GBXD 4WIQA 3SO3C 3ZE1E 2FGWL 4U6XB 4BQ9A 3TOPA 2VDMH 2EXTA 4JL1A 3GBML 1XFPA 3L4VA 4OUUB 1DSWA 1FBIH 1JNHA 1F6FB 1TQCC 4RQQA 1DJZA 3I85A 3DRTA 4YK4B 1U8QB 5GRYA 5FYKE 3HNTH 5AWNL 3RVWC 3ECWA 3QIBD 3L17A 2P5PA 3QPXH 5CXPA 1XD0A 3QAZB 3RKDC 4PJDE 4R5VA 3V5DB 1RHHB 2G5UA 4EDXA 3P4MB 4EXPX 1SJMA 1MW2A 3I3BA 4UB0L 5IB1A 4U0RC 1YSOA 4U1IB 2MIZA 4M62H 2WUBL 4ZPTB 1SF3A 2AV7A 3ZBMA 4V2BA 2D2CC 4ZMVA 4RX4A 1TQUA 3Q2VA 4MASA 4WI3A 1IAOA 4KTEH 4AGOA 4K5OA 3ZZSA 2UYLB 5EWIH 1XR9B 3PHOA 1AS7A 2A1WL 1JN6B 1QAWA 1KT2A 1P69B 4F2FA 5DRXA 3BXNA 3U7WL 3LJ3A 4Y5VC 4UT9H 5D7SH 4J6RL 4M7ZC 4P5MB 4WNQA 1TVBB 3ARPA 3DETC 3QH3A 4NZRH 1EK3A 1EZLA 4YHOL 3QC6X 4LCWB 1Z9NA 2WV3A 2X70B 5CINL 5F0JB 2ICES 1FNGA 1O7DC 1A25A 5FGCB 1WRFA 3K6DA 5JDJA 5EO0A 4GG6A 2IGFL 1Y0LB 2AKRB 3GTTA 4QHUA 2E7CA 4ATWA 3OAWA 4AVHA 4JFED 4WJKB 1KJMB 3AFLA 4KY1H 2WWKO 2ADGB 4HS3B 2ZYIA 4MNHB 2LU4A 1MI5D 3BAWA 1DQJA 4XMKL 4AENA 4ZSOA 4RISL 1TQSA 2Q9OA 4NN5B 2ESVA 3UAJA 4DKFL 4KMTH 1TPXB 1E6JL 2PXYB 2H3XC 1KJMA 5KWYC 1FE8H 4P2RB 2Q10A 4XMPL 1F0LA 3MJ9A 3WTTA 4MWFB 3GSUA 4D94A 5GS0L 5GRWA 3FN0H 4ODVH 5EO0B 2WIIA 3QUML 3E3QC 4A2HA 4UNVA 5B38A 3S96B 5D6CA 1BGXL 4M7JH 5AW3B 3TASA 2QVFB 1I1AA 4J3VA 5IW6A 2F18A 4OCYH 4HD9A 4GG8A 1UG9A 4MMXA 2J57A 1E7VA 2G60L 2ICCA 3DPDA 5DVKA 4HH9B 5HI3C 2WP3T 4EI5A 1SFHA 4IBSA 4O58H 4L8DB 4B7LA 1JOIA 1Q94A 2XXGA 2FYYA 5D7IA 3T3PF 5CKGA 3AXHA 3LZQA 3UJJL 4PBWD 4XP4L 4Y0GA 3UTTD 4D9RE 3KHQA 3Q8EA 4MA3B 4NAMA 4R84A 2FH6A 1B6UA 3U7YH 3P69A 3FPXA 4EDWH 2IDSA 3FH7A 4EJ1C 3BP4A 1QI3A 4HAGA 1KYDA 4HWZA 1N5AB 3R7RA 5KSBE 1ADQL 3BCDA 4TPRL 4XN4A 2B77A 5LAPA 4F24A 1MIML 5GSRA 3BRFA 2DI9A 1KFGA 4ALAC 5CKAA 1YEKL 4L4VD 2X12A 3EDDA 3UZEA 4J3SA 3IYLW 3U2IA 5I1HL 4JFXA 5GGTL 3VWKA 2B4CH 5IOKA 5EO1B 3QPXL 4P23D 4YHKL 5DUBA 3B56A 3ARFD 2H26B 1NJ9B 2WXNA 3QJFB 4G9DB 5CEZD 1J8SA 3OMNB 5E6YA 4KDTA 1MEXL 1D5MB 1WSST 5E8EB 5IEKA 5FUOH 2H4EA 5D7KE 1D9KB 1O0VA 1KTBA 3Q0HA 4LCCA 1TSRA 3QI9A 2WXLA 3L9EA 2EIEA 4I3RL 1XL6A 1N0LB 4ZTPL 3HHSA 5C0FB 1A1OA 3GNMH 5C0CE 3MBWB 4S10A 5KTEL 1XGPB 2N59A 1Q9OB 1C1EH 4YBQD 5HGAB 4BBWA 1GAFL 3MCLH 2BRRL 3AS3A 4PJCA 1A47A 1OQOA 4ONOA 4D9LL 5EB9A 4FQ1H 2VL5B 4N22A 3QUHA 3ME0B 1AQKH 3UBHA 3AXLA 4MZ3A 4DIXA 4XRCB 1OT2A 2G5RA 1L7IL 2QKIB 4JUTA 4P4KD 4A2EA 4CW1B 2F15A 3IRZA 3BESR 3DBSA 1XF2A 4MAUL 2EICA 4GSQA 5DMYA 4J6IA 3LH8A 3R8QA 3IDIA 1CFTA 4ICXA 4N2HA 4XMXA 2DDQL 5ALCL 3OR7A 3QI9D 1A64A 1ZVSA 2FYVA 3DGDA 5FFOA 4S1RH 4AQAA 3WEXB 1RFDH 4JY4B 5K9KB 1LP9E 3NA4A 2ZP9A 3TGXA 4RISH 4MMZA 1FPTH 3V0VA 2ZF8A 2VJXA 4HUUB 4QI3A 2CWRA 3ARUA 1ACCA 2YSSA 5MHSD 4JFDD 5C0ND 1NDGB 2K45A 3BP5A 3LRGA 2EH8H 1DJSA 2C7FA 1YRKA 4UQBA 4XMPH 1BJ8A 4LLQB 1AS6A 4KO7A 2GITA 1KPVA 1UATA 2E74C 1A6UH 2KZBA 5BVPH 3KPOA 1T83A 4LVOC 4BE6A 5HY9A 1G6VK 5E6UB 5LN4A 2IG2L 1X5KA 4OM1H 2N01B 3SY6A 3VVWA 5CLZA 3S88H 1LXMA 2E47A 3VGBA 5B3NA 1QP1A 3WIIL 5FA4B 4JFHE 4YIQB 3JTBA 3O2DL 3DDGA 3UPRA 3RWJA 3IMTA 3GSVB 4AXWA 4ZS6D 4YFDB 3D7PA 4ES8A 4Y2DB 3TBWB 4MXVE 5ECGA 3V4LA 3V7MA 3W37A 4OCMC 3RL1B 3V0WH 3FFDA 3QZWG 1AMXA 3WNPA 1KLGA 7FABH 3WAKA 1WEJH 1WBZA 4E0RA 4R8WH 4W9DC 3DGGA 4K2UH 4M1GH 3VWJA 1KUMA 3EFFA 2CGZA 5L0QB 5I5JA 3VFPA 1HKFA 4OZ4B 5H4YA 1ADQH 3C5ZC 4GPVA 4AEHH 4CC1A 4WJ5A 2XFGB 3MRRB 4FNRA 5AYTA 2GI0A 4WFFE 3D4CA 4ZMYA 3U6XS 4ADGA 4FFWC 4F15B 5I1GH 2JELH 3LOWA 1KJ2H 4OD3H 2X6CA 2B4CL 4ZAKD 5AOJA 4D0DB 3OKOB 4YHMH 3N91A 5DD3H 4YHNB 3QO0B 2XXFA 3H3PL 4GH7B 1CXIA 1DEEA 2PMZA 1YPZE 1F45A 1VCBC 2YPLD 4PGCA 3TT1H 4HH8A 4BFEA 1NMAH 2WINA 1AYOA 1JP5A 2ENJA 1NCGA 1E42A 1MFDH 1QPKA 5AZEH 3FO9A 5I74B 1M6OB 5E1QA 1J0YA 2F7QA 3D85D 3V6OE 2F74A 5AW6B 4RA0C 5HYSB 2AXWA 4CJ1A 4UZGA 1G7JB 4HC1A 1C16B 1Z3RA 4HIEB 4NC1E 4A7GA 4DP1X 3FTUA 1JWSA 3MCLL 2X4RA 2D7PA 2L7QA 2OMZB 1MI5E 4HKZA 1N68A 3K5RA 3T4YA 4TOYH 3LZLA 2HJFA 1BXAA 1TNNA 4IRZA 4MCMA 4OCWH 4MA7H 1RAMA 4XP9L 3QJHA 2XVGA 3AUWB 4N90D 2MHAA 4JRXE 4PBDA 2GBTA 5TH2A 1CIDA 3QZWB 4PSPA 4Y4HC 5D1QD 4PVBA 4DW2H 1IFHL 4IEFB 1KG0B 4K7PX 2OA9A 1COBA 4U1MA 1GKOA 1LDPH 2LT9A 1Z5LB 1XXFC 1SXCA 3C6LB 1KBGH 2A4EA 2F19L 2FH8A 1RJCA 1UGNA 2DQGL 5FO9A 5A2JH 1XCTA 5JOFA 4JFDE 3L95B 4S1RL 1BFSA 3WKQA 5K33A 1MSPA 4PWHA 1N4XH 3MJ8A 1NSNH 3KPMA 2YUZA 2W65B 1JHLH 1WAAA 3RIFK 2YLKA 1OWRM 3MNDA 3KPQA 2X9XA 4RZCA 5HHNB 1L9PA 4XBGA 3OV6A 2QZ5A 4X5XB 5TFSL 3QZOA 3NIDB 3SY0B 3W2DH 3QUZD 2WQVA 1F97A 2WC7A 3F85A 5AVYB 5LCVH 1TLMA 2EYTB 3WKMH 4MA8L 4PJXA 3HI5L 5KVFL 3ZHLA 4LCCC 4LSSH 4Y88A 3C5ZB 3OJDA 5I6XC 3O2DH 2BNRD 4HFUH 4OZIF 3L9RA 4HALA 4PJ9D 4IJ3B 1A3RL 3T2PA 4LEOB 3FOMA 5GGVY 1SEQH 1XSKA 4ZW7A 2F0CA 5I16B 5GGTA 2QPSA 3MFGB 1ORSA 4P99A 3DX2A 1I3VA 1PPIA 2Y07L 1FORL 2OI9B 3AU1A 4O2CB 1U2CA 2EEAA 2JJUA 2C8NA 3KM1A 1QQDB 1CICC 2DW5A 2FUQA 4H13C 1IB5A 1NGWA 1E3FA 2WVTA 2V5SA 4N2GA 1IVTA 5IVXB 5IT2H 2BVPB 2C3VA 1MJUH 3LRSA 1UM6H 5DO2D 1YPZB 3MBED 5TE4L 1OZTG 3SZKC 1QFUL 4TN9A 1PL3A 2AF2A 3ISRA 1BXXA 1K5NA 4ZNEA 1X5YA 2PYFA 2CXKA 4MB1A 4M8UA 5E6IC 2NY4C 2OMYA 3FO9B 4Q0XH 4OLEA 2VERN 3UGEA 4DEWA 1BLNB 5I1LA 1KGIA 2D3JA 5FM5M 2GIXA 2HUEA 2OMXB 5FDWA 1WICA 4H88H 3HNTL 4B96A 3I2CL 2Z7ZA 3QDHA 5I2IB 2ICWA 4AEIH 5ETUA 1X7SA 2VMCA 4C59B 1QYGH 2X4UA 4NOBA 4URTB 5D1XD 2W81C 1CDUA 4AT6B 3AW5A 2OYKA 3O8XC 4XGZA 4XO3A 2Y36H 4Q7DA 3EJZC 1ET8A 1MFCL 5D1XB 5F44A 4R2GD 3VM5A 1XF1A 1X5AA 5CEYA 4E9VA 4ZO8A 1J8KA 4FYTA 2KLTA 3KYOB 4MXVF 1UJ3C 2CGRH 3VNZA 4M61B 1JPGA 3QQXA 2D4DA 3P9MB 4XCYA 4CVXB 4GEJA 2EE2A 4P4KB 5KW9L 2GJ6E 2FSEA 2DLTA 2P1YA 3GTVA 2OX5B 3OF6A 1VGKA 2E0PA 4YHOH 1CFSB 4PJFA 2Y5TA 2ZUWA 3M8OH 3WY1A 4F7TB 1XO8A 2I60H 1ZTXH 4IIQC 2WAHA 4LSTH 3T8MA 2J71A 4M93C 5I6LA 4PHZA 5AOLA 1P7HL 2PTUA 3MGOB 4WW2A 4OT1H 2YA1A 2APTA 2H0JA 1ED3B 3EW3B 4KK5C 2WCGA 4UAOC 4BH8B 5D5ME 4ZS6C 1I9IL 5HY9B 2ITCA 5SWSA 1WC7A 3KDMA 5CGYD 2WZPA 1INEH 1A7BA 3TTSA 3IJYB 4MQ7B 2XVBA 5GIRB 2H0FA 4B9CA 4EI6A 4JFEE 4MAYB 1GR7A 2OI9C 2K4WA 5B8CC 1E6JH 3WENA 4Q6IC 2YSSB 2WP3O 5JW4N 3FCGA 4DCQA 1ZS2A 2NYZA 3LEYH 1OF0A 5FPIA 1AXSB 5E6ID 2RGSA 1JZJA 1B90A 5CP3H 4CGTA 2IPTH 2CNZA 3CPLA 1RLWA 4LSSL 1FL6B 4GQZA 2CRIA 1OAYH 5BPPA 3EF4A 4GIPD 3WMPA 4TULH 3DOIA 1XL4A 3ZKSD 4XN2A 4XVUC 1AJ7L 2VSMB 4K5LA 1LE9A 3Q01A 1CB4A 2BVOA 3NIFF 5F9OL 4YDJB 4DAGH 2OXHA 2X2IA 3D0VB 1UA3A 2ED6A 3QDJB 3HOGA 4BSVB 4Z7UF 4RWHA 4KNSA 4O2FB 4R7DB 1VENA 3DROB 4P49A 2CKBB 1O7VA 2WLLB 2J73A 2PCXA 1A4JB 5I8CA 3RGHA 4PGEB 1MJUL 2E59A 4YXLL 2BIPA 4P59L 2B3RA 4YDIL 3A67L 2Z93B 3BGFB 1A3LL 1ZAGA 2GSIA 1ML0A 3HC0A 5I75C 4EDWL 3FSVA 2V5TA 2DEXX 2YA0A 4XX1E 5TPWH 3U4KA 3EFOB 3U46B 2NY0D 4Q0XL 1P4IH 2YKKA 1EAQA 4AOFA 2Y1AA 3U9UB 1WIPA 4FYQA 3ZDZB 4AJ0A 5IFHH 3SD2A 3KPNB 4QR7A 2P44B 5BS0A 4Q14A 4NQQA 4ZMZA 4WY7H 3HMXA 2DTMH 3BCFA 2EDQA 3NZUA 1HE8A 2HRPL 3FU7B 3IJHB 2WIMA 5CEZL 4J28A 2CPUA 4KZEH 4JREC 2CO7A 2WBJD 4TSBL 2OYPA 4DP6X 3SQBB 4DVBB 3MUY1 2IEPA 3VXNB 4NRXA 2J8OA 4MDJB 4F2MB 1EAJA 5T1KB 3VSUA 5F96H 4IBQA 1UFGA 3IFNL 3F58L 3T71A 2Y23A 4AGQA 3O2VH 3ZY7A 3BPCA 1CLCA 2BIOA 2PO6C 3QGVA 1VGEH 5BOJA 1NC4B 4L1SA 4ZFOB 2W5PA 3O3EB 4E2OA 4A2FA 1SXNA 2J1XA 5KW9H 1NC4A 1YN6A 2OULB 4PCYA 4IDLA 2Q87A 3WKYA 2YGOA 5GZOD 1H3XA 3R1GH 5F1IB 3FYEB 3IE4A 4L4TD 2WKOF 4UU9A 4E5XB 1JPSH 1Q38A 5GZND 1G7QB 2GTZA 2ERJC 3HLKA 4RSVA 2CCWA 3MXWL 4Z7NF 4F15C 3V4PH 4UIKL 3MUZ1 3L9YA 2Y06H 4LKXA 2VM4A 3RKPA 5ENWB 4B0MB 4L5FL 2IWFA 3OAUH 2F1AA 3ARYA 1PSKL 2ZAGA 4PJ9C 3LMJL 1CGWA 4FLQA 3SKJH 1MFBL 3TLRA 3KLAB 3R06B 4XP5H 3S36L 3LD8C 3X3FH 1JDAA 5AKSA 3GBDA 2DLFL 3HN8A 1K2DB 3MLWL 1DQLH 3INUH 3G6JF 4PCTA 1Z9MA 1BHGA 4S1DD 1SVCP 3BLBA 5JXED 1YPZF 1I8KB 4N8CL 4NERA 3M46A 5IFAH 2HG0A 3E2HC 4P46A 4Q9CA 1PZDA 2ZXQA 3MBEC 5AALA 1LEIA 1VEPA 3O8XA 3OAYH 4MB5A 1HI6B 3QDAA 1EO8L 4TNWK 3IXTA 4QLWA 5I1IL 2XIIA 2F54E 4G42A 4N2FA 2YXFA 5F9JB 1CI3M 2R9HD 5DURD 1ZWIA 4JQXC 4FYRA 3N1QC 5ILTL 3TPUB 3TCTA 3EJQA 5LCVA 3QJOA 3QRLA 5C07A 4YQXL 3V4PB 1N7MH 3NIGE 3H1ZA 5EOTB 3K6SB 4ZPVA 4OAWB 2OV0A 3AG4B 4KRLB 5DUJA 5L9DH 3KVDD 3D3VB 2X89D 3JV5A 1L7TL 4QRQA 2MCG1 3GIZH 2ZXAA 4XNMB 2VZTA 3ZW3A 4L9LA 4PRID 1A6VL 1E9OB 3MBEB 2J1ZA 5TPWL 1AIZA 5D5MF 5IM7A 4U7KA 1H8SA 1C12A 1XEUA 1XGYH 3FQUB 5LB1A 1QSFE 1GOGA 4OLUH 4M00A 3A3YB 1BEXA 3EGXA 3QORA 5C08D 5DWPA 1KJ2B 1OAUL 2DJMA 4NQVB 4Y4FD 5I1GL 4NQCE 1OTSC 1E4XI 3W9DB 2IGLA 1T03H 2DTML 3EH5B 2AAAA 3BZDA 1RIVH 3HUJE 5ICXA 5IQNA 1BD2D 1A2YB 3L9BA 3TT1L 3GRBA 4IBYA 5EEXA 3RWGB 5JXEA 2MH4A 4CDGC 4L2YA 3CFQA 5CS7A 5EU6D