4QDGA

Crystal structure of a putative adhesin (bt2657) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution (psi community target, nakayama)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
300
structure length
300
Chain Sequence
DLAPCPHGVSLRFIYDYNMEYANAFAKKVDCLTLLVYDENGNYVDTRIVTGTELQDENYRMKLDLKQGNYHFVAYGGLACNKSSFLMKYTPGEGTGYTDLQVELDSECLTNPRRKNLHGLYWGELTLATADLYSEGTVEMMKNTNNIRVVLQQMNGEPVDDKKFEFEITDDNILFSYDNNLLENGMVTYTPWAQGQASAGFTDEGREVVVAYAELSTSRLMVRDWYSPKLTVRRKADGVEIINIPLINYLLMLKSDLYASMDSQEFLDRESEWSMIFFLSPNLEWIKTYIKINDWTVRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Putative adhesin
publication title Crystal structure of a putative adhesin (BT2657) from Bacteroides thetaiotaomicron VPI-5482 at 2.20 A resolution (PSI Community Target, Nakayama)
rcsb
source organism Bacteroides thetaiotaomicron
total genus 72
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08842 Mfa2 Fimbrillin-A associated anchor proteins Mfa1 and Mfa2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2090 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qdgA02
2.60.40.2100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qdgA01
3GF8A 3PAYA 4QDGA
chains in the Genus database with same CATH superfamily
3VNZA 2L7QA 2ZJSL 3L5JA 5G55A 4ZOBA 1GSKA 1M2VA 1KLGA 1MQKL 3KCPB 3GIVB 4XPAH 4GQ9H 4B50A 5I19L 3MACL 3TIEB 4J5VA 4NC1C 4TNWK 3HC0B 4CAGA 5C0JA 3MUUA 3ZDYF 5D71L 4E9LA 5E6IC 1UURA 2J57A 5BRZE 1MHEA 3EO0B 5FYJL 5LHDA 1D2PA 1YEGH 3NPSB 3PJSA 1KPVB 2ETWA 4PRAB 1GXEA 3PGCA 4OZ4B 2X9XA 4NJ9H 4N2GA 3KPOB 5F3HB 4MQXC 3CUPA 4BQ6A 4Z3FA 4W1TA 1MFVA 3LS4H 5C8JB 1IGTA 4X5PA 2GTWB 4LPYA 3ETSA 4RGOH 5I16B 2DL9A 4F37K 5KSUB 2NNRA 5FS5A 3AADB 5C0CB 4CVUA 3DXAD 4ORZC 2OTWA 4QF1B 3CZNA 3KL0A 3VXQA 2DQMA 4HUXB 5MEQA 3TJEH 4NCC2 5GS1C 1TQWA 1FHGA 2VQ4A 2AQPA 4FQHA 4XMWA 4AMKH 1CN4A 3GF8A 1RUQL 4FF9A 3W5MA 2GCYB 3V55A 3DMMC 2F54E 1U30A 2A1WH 2IG2H 3ZT6A 4OGYL 3F05A 2Z31B 5LB1A 2LFEA 3GDCA 4AM0Q 3ARGD 4LNRB 5FWQA 4LPTA 2QGEA 1R19A 4LVOC 3BHBB 4F80A 3IRCA 3A6BL 2BMKB 3U9WA 4BH7A 1AGDB 1ULVA 2EZ0C 1BV8A 3GZKA 4XVTH 2DRUA 3X3GL 1CLZL 4NB7A 2WB7A 4NXSA 2FX9H 3MRFB 3UROR 1I8KA 4HC1L 4ZI8A 2LW3A 1GYCA 3ARGA 3BZDA 5IB4B 3FO9B 3LNGA 1FLRH 4JM4L 3RVVD 3GZQA 4PD4K 4QRSB 5E8NA 2FD6H 4X6FA 4BKSC 3D9AH 2F61A 1TCMA 4YZFE 3SGEI 3ECBA 1PYWA 3LMJH 3Q8CA 4PJDB 5TDPB 3GSXB 2HAZA 4N5ED 1JZIA 1AIFA 3HG1D 3A6OA 4GPVA 4N2IA 1U92A 4NNXA 4EI0A 4RETB 2O5ZL 1OSPL 3S96B 3L3IB 2OLDA 4HD5A 4RSVA 3VSQA 1C5CH 4QT5A 4GKOA 3PAVA 3SKJL 3VFVB 1OB0A 2Z0BA 4X99B 4X8JB 4ZS6D 1H8NA 4TMPA 3VXTA 5BQ7B 4R0LB 2E9WA 4FP8H 3VWKD 1U8KB 2Z64C 4XO3A 4YHNA 2FHFA 4S1DD 3U7YL 2HRPH 1S7SA 4H2CA 2OP4H 4PJFE 5DR5H 3FONB 5FYKE 1P2CB 5I15L 4QHKI 1EERB 4ZXBC 4OQTH 1CBVL 1KJVB 4NN7B 5JLZA 3UG3A 3UXFA 2WKLA 3GLDA 3VWKA 4F3FB 3ULVH 5C7XL 3CZJA 2FO1A 1LJMA 3FSAA 3WXWH 3CHOA 1E8YA 5KYXB 1CL7L 3MJ8A 3SO5A 3HC4H 4P99A 1H3PH 5JIQA 2C26A 4XCFH 2BCKB 2ED7A 4Z7OE 1JYNA 5A2IH 5E2TH 2ICEC 4IOIB 3A4EA 1Q1JH 4PW3A 5J7CC 1IC4L 1GKOA 3NCFB 4LRNL 1R24B 5E8EA 1B4LA 4WSKA 2PCFA 3PL6D 1I31A 1R3LB 3NA9L 1GYAA 2GBUA 4ZMOA 3AUVA 1ZEAL 1YMHA 1LGVA 2C3HA 2DBLH 2KUTA 2VDOH 4FQCH 5EC1B 5EORL 3MN8A 3WXVL 3ZGIA 3HLKA 2BVTA 1NUDA 5IBLC 2J6EH 3UP1A 2MNJB 3F64A 1J10A 3P4NB 4UB0L 3LZQA 5FX3A 3TC9A 5AOMA 5IHLB 4GS7C 1JMZA 1HSAA 1PZSA 3IDMA 3PL6A 3MJGX 1ZV9A 3GRWH 3OV6A 3CZUB 4LVHB 4K3GA 5I1AB 4DN3H 2NTFA 4NGHL 4UM9D 4JG1L 1RJZA 3HG2A 1AQDA 5F7MC 1MI5D 1BW8A 2QPDB 3SBRA 6FABL 1OWRM 1A64A 1EV2E 1PY0A 4PJHF 2R23A 1QNIA 2ZYIA 2G75B 4JG0L 1CK0L 1F18A 4L9DA 1MAML 3RY6C 4WFHD 3BKMH 5T1MA 5DS1A 5MI0C 1G94A 3QBTB 2M1KA 4AWJC 3B7SA 5D7IA 5JW4R 4EI6A 1MI5A 1NKOA 1ED3B 3VMOA 3P4OB 2OMZA 3BWUC 2NY1C 1AZZC 1OP5K 4HLEA 5KVGL 1J1PL 2NY6B 1S8DA 1J12A 2XTJD 4HZLB 3TWCL 1ZHBB 2CKBA 4ZMLA 5JORB 3RVTD 2QLVB 3QG6A 5K9KA 3ULUC 3SJVE 3EHBB 2XVKA 2F5AH 1L6PA 1HL9A 3WFBH 4YHYC 32C2A 3UTZA 1AGCA 3EF4A 1XL4A 1EUTA 1SPDA 1XF1A 2LGNA 4TNVF 4Z1PA 4YUEH 1OO2A 1TYRA 4K3DL 1FCCA 1TETL 4XPFH 3BPCA 1WGOA 2PWDA 4Y4KD 5E9DE 5ITBH 1D5XB 5E8DL 2DMBA 4FQ1H 2BSRA 3C60C 3H7BA 1A8JH 1LQBC 1HEHC 1TU2A 2IGLA 4PRIA 4XH2A 5DVPA 5GGRB 4TTGA 5EEYA 1MNUH 4YXHH 4HGKC 4JFFE 3T6XA 2APSA 3X13A 4OT1L 2F9BT 5HDBB 3GJEB 4LQ1A 2OS7A 4G6FD 5SV4A 2NTSP 2WHVA 3FB8A 4MZ2A 3TPUA 3G3LA 4Y4KA 2ZOTA 1JGDB 4WSGA 5E1QA 5AB2A 3V6BR 3ABKB 4P9HL 3L3HB 1SYVB 1IBGL 2LT9A 4OZGA 2HN7A 4EKXA 1RUKH 4PBXA 1NAKH 4XODA 3O6KL 3RY4A 3G5XB 3UYPB 3MRPB 5D2NA 5BOPA 5T3ZD 1XGTA 3DYPA 3WFDH 4LCYA 5CN2A 4DPRA 3LVTA 3ZMRA 1U8IB 1YN7A 3HKZA 3T8VA 3ZSTA 3STZB 3MLZL 5B3SB 3UCQA 1UXLA 1Z5LB 2Z8SA 1T1XB 2V3EA 3ECVA 3HLAA 3LPOA 2Y2TA 1VKXB 1TZIB 3RX8A 1S2EA 4XCYA 3C2SA 2VW7A 5GSRB 1TTAA 3S34H 3ILQC 2R1WB 3MNWA 1MF2L 5BZZA 5J57B 3ETTA 1T1ZA 3IK2A 3RDJA 2WTRB 1H19A 4PV1C 3NIFE 1BZ9A 2JKXA 3DJZA 1AP2B 4Y2DA 1A47A 2G3XA 1BX2B 2A73A 1NOFA 3O2VH 3VGGA 3WFCL 3JTTB 1U3HB 1HTYA 3FFDA 4FQIL 4CSZA 1CG9B 4PJDF 1JZHA 5FYLE 1UATA 1QWHA 3V4VH 1PW3A 4X98B 5L9DH 3VXMB 4QXVA 1F3JA 4F33B 5J6SA 4KKPA 4X7TA 1UACL 2B77A 5J8OA 2EECA 5IHZA 1T3FB 4G43B 3VGFA 4NZUL 2Y25A 1JD9A 43CAA 5HYFA 4LKXA 3CX5J 5T33L 4Z95L 3EGXA 5C92A 2VR5A 2FL5A 2YLHA 3NEOA 5GGTH 5AZ2H 5KSAD 4KY1H 3D8MA 1BQ5A 1T7XA 2JQZA 5IWLC 2WCSA 3QFJB 1RIVL 4LLQA 4TUOA 5FO7B 3UTOA 1PSKH 1ADWA 1RULH 4NOFA 1CE6A 1RZFL 2WLMA 3GTNA 2NY4D 4XNMB 4ERSL 4EIUA 1CGVA 1OAYL 1CTMA 2BSDA 4NO0D 5DQDH 5T3ZL 5F88A 3HOGA 2NXZB 5KSAA 4ALAH 4BCYA 4WLCA 2F0CA 4OTXH 4X0KB 4OF3A 1R3JA 1N6QL 12E8L 5IOPA 1M05A 3PYCA 3JWOC 5B38B 3D2TA 2JELH 3HUJE 4WI4A 2DWEA 5EOTB 2W92A 4DVBA 1LE5B 2X7LB 4JDTL 3OB0H 3V52H 5HPMA 4DFIA 4MNGE 4NO0A 2APTA 3S48A 4HLZG 2FQDA 4Z3JA 2A9ML 1ETB1 3KBEA 4GAJL 3BCFA 3MRLA 4M7KH 5JUEL 2YAQA 3MUGA 1OP3H 4FMVA 1OEZW 4DK5A 3B8SA 5CJBA 1UOLA 4ZQKA 4OB5L 4JRXB 1BF2A 1SLVA 2W59A 1HH9B 5FLUA 1PDKA 2I07A 4EQ3A 1GOHA 1HYRC 1QEWB 4F7TB 4WNSA 4LCCB 2NY7H 3BVXA 3HTLX 1A4KA 3LQAC 3NAAH 1U42A 2NX5E 4WI8A 3AS1A 4XVJL 1XGYH 5D4JA 4AW7A 2A6JB 1FIGL 1KTDA 2FIKA 3IN2A 4NHCH 1I1AD 2HT2C 2WZ0A 1EXUA 2CDGA 1X9QA 2IADA 3APFA 1J9TA 4AEFA 4LEEA 3IKCB 3LHPH 3VM7A 5C09E 1FI8C 2ITCA 4K7PY 3D18B 5CCJA 3BOVA 3O0RH 1DL7L 1QAWA 4ZAKD 2YN3A 1JPSL 3GB7A 1E2ZA 3T3PB 3ZYJA 5DLLA 3AY4A 3D4CA 1ILUA 3VD4A 3MCLH 5IJCC 2RH0A 4JJ5B 1I1AA 4JB9H 1PCXA 3GGWB 3LNDA 1EEYA 1N7MH 3V5DB 4WU5A 4XMKH 3HMXL 3K8KA 4TRPL 4PGDB 2F08A 4RDBA 5AQ0A 3CK0H 2BVEA 3MGTA 4ZAKA 5J11C 4OZHE 1C5DA 4P05A 2FLMA 3BYYA 4JPVH 2J56A 2FHCA 4L9LA 3CIAA 4QMEA 3MBXH 4J2QA 3NGBC 3MJ6A 1GYWA 4G8FB 1NDGB 3QJHA 4IKNA 3H4HA 4N0FA 2MCG1 3V0WH 4NRYA 4PWIA 3IDUA 1IKFH 4K5NA 4UIKH 2WXGA 1AHMA 4M3HA 4H26A 2K8MA 1G7MB 4XMVA 2DI9A 1E7VA 1NANH 4O2FB 1N5YL 2BWQA 3MLVH 4WRLA 4YMPA 3E1F1 2ZOKB 3T2LA 2F74A 4EI5B 5L2JB 1D9KD 1ODUA 1R5VB 2E27L 1LP9B 2R7EB 3CH1B 4JDEA 1Q90A 3SE8L 1JZ8A 5HYSG 3RUGB 4BFEA 1T5WA 3EFFA 1ZHLA 1XR8A 3GSOB 3BGFB 3F12B 1JF6A 4YNYA 5CR8A 2B7DT 2E9IA 3D69B 4RAHA 5EN2B 3H9HB 1IQWL 4IRJB 3TJHC 4DP8X 3X17A 1PFOA 1I1CA 3AM8A 1P1ZB 3PAYA 4L4TD 3RNKB 2P5WA 3MODL 4PJCB 5FFOA 1UVQB 4PJXF 4C56B 4PRDA 3QQ4B 4C4BA 1DVUA 1C8PA 2N3JA 1XX9C 5IMKA 2M2DA 1BQHG 1CURA 3DDFA 4G6JH 3ILEA 5D7IE 1BOYA 5E6SB 5KJRH 3QIBA 4JPWH 1A7RH 1JGUL 1YEHL 4IU2A 5JW5B 3SE9H 1E4HA 4L4TA 1YEIH 4XO8A 3F58L 5KUKA 1E6JL 5HHPA 2H0FA 2OFQA 1P6AB 3U9UA 3NK4A 4H88H 2PXYC 3V6FA 3JV6A 4FXGC 3NFSL 2LAAA 3MA9L 4LLWB 2XETA 3H6JA 2WQXA 1KXHA 1M7IA 5INCB 1AFVH 1YEWA 2FRGP 4PTUB 3UDWA 5I6LA 1XZWA 4FD0A 4OY9A 2KYIA 5C0DB 2KZ1B 2XPGA 3L5WB 1KBWA 1I3GL 1NGYA 2VL5A 1ZPUA 4ZUUB 1KNOA 3P54A 1CXFA 1DR9A 1FO0L 1EJOH 2OBGA 2FWOA 4Z7UF 1PKQA 3LIZA 3OAZK 3ORJA 4H1LG 4HIEB 4PRIE 1L9OA 4MLSA 1MREH 5E2VL 1B0WA 2Y06H 3VI3F 4BWUA 1YYCA 4LL9A 1ZLVH 3FO1A 3MLXH 4S1SL 1M4KA 4EIGB 1LEIA 2Z91B 3I6LD 3ZUNC 1F6AA 5FDYA 1RJCA 2J2ZB 4N0UE 2IAMC 2VAJA 4PV9B 4FEIA 1X9LA 1XT5A 3DX6B 4N1CA 4RMSA 4TM9A 4QGYA 3UC0L 1Q9OB 4IBWA 1G6RL 2ZNWA 2XRAL 3QZLA 1E0OB 1H9VA 2IPKA 5L0QB 1JD7A 1ICTA 3L95B 3TEWA 3GXMA 3LKRB 5D2NE 3LNIA 1WAAE 4IRSB 2PO6D 2OW6A 4J6IA 3DBSA 4ZYKB 3KD4A 3GMRA 4OLYH 5JZ7D 3WEAA 4RAVB 4HWBH 3T8XB 5IG7A 4ZFGH 2BPBA 4MAZA 3K74B 4WV1A 1BQLH 3N42B 2AK1H 3BKCL 4ZUSA 2YQ3A 2GUOA 3AU0A 3IDXH 3K8MA 5CJ5A 2Y24A 5FW7A 1SDDB 2G60L 2PO6A 3ZYOA 3EFDH 4KQ3H 4PG2A 5ANME 1IM3D 1LL1A 5DSCA 2BC4A 2QPFA 3SO3B 2EYSB 2XKNA 3SGJA 3VXSE 3LIZL 4APQC 1KXVC 2XG5B 3FC8A 5LVEA 3S5LG 3ZDZE 4AQ1C 5JQHC 3MRIA 4F9PC 4M00A 4FXKB 4WF7A 5ISZD 5AAPA 1RUML 1HNYA 1FH5H 3MTXA 3W2DL 2EEBA 5CSBA 3PGDB 4HDIB 3TA3D 4Z7QB 4GRLC 5IHUL 2GIXA 5CBEA 2GEQA 1F4AA 5CZKA 5SWZB 1U8CA 5HI4D 3STLB 1TMCB 3N1PC 1XH3A 4PGJA 1RQ5A 4QRPD 4LSPL 4NQCE 1ROCA 5I1EL 1D5MA 5IK3A 3UACA 4YHMH 4OCYL 2QFRA 2UWEE 4LOVA 4NZ8A 2ZUSA 2R15A 2VZ1A 3LY6A 4FL4B 3PCYA 1SBBA 5JIMA 1GPOH 3OPZL 4UQ2B 3S3PA 2HRLA 2YN5A 1F3DJ 1HE8A 3GMLA 3S3JA 2HSIA 5IVZB 4P46C 2EE3A 5F6IB 5I1GL 1U8OA 1DTUA 1IX2A 4XE5B 2Y7LA 4QRPA 4WHYH 2I7OA 3TN0C 4NQEA 3NIGB 4YBHA 1UCTA 3IJ8A 4CVXA 1FNEA 2DQDL 4X6CF 3EOYG 3PIQA 4AXWA 1AS8A 2EYRA 4JPQA 2PYEA 1RERA 3COOA 4WENB 4K15A 5HHVH 3BGMB 5L2KD 4MZ3A 4RDQF 3NTCH 1R3IL 5IQ9A 3BD4A 3LEXA 5GIRB 4JFDD 1HT6A 5LGYA 1E5YA 1VPOL 1SVBA 2C5DC 4JFPA 4R4FL 3QFDA 4L8BB 3O3DB 4F9LA 2BS9A 4QHMA 2H1LM 2OYMA 1YAIA 3C5JB 4JPSA 5LN4A 3WL9A 4EMZA 3ULUE 3P9WB 4LPCA 4Y8AA 5CEXA 4JQIL 4XXWA 3B3IA 5AG8A 2FR4B 5L2KA 3F85A 1V7MH 4ZUVA 2N1TE 1KBKA 3NRPA 4JFDA 4G6KL 5CMAA 3MLYL 4AL8H 4Y5VC 3L9RB 5E7BA 1E9QB 4UF7C 2YEQA 5IQOA 1JNLH 2XZAL 4K23H 4RZKA 1HCYA 3O11A 5A1AA 3DJSA 2JKNA 1YCSA 2F5BL 4HV8B 4MJ6B 3RAJL 4BQCA 3KBHE 4RGNB 3ULVC 5F7HA 1UUNA 5DJYB 4CADA 3G5WA 1DQMH 3LRLA 3QRGH 1EFXD 4OM1L 4IJ3B 4IIQB 1OT1A 1KGXA 1JNNH 5FFGA 3MV7D 4GSRA 4CBPA 1IGFL 5JDSA 1HZHL 1J8SA 2YGPA 4ZMTA 4KRLB 5KOMC 5FKAA 3RUGF 2R69H 2Z93A 2H6PB 1I1YA 2NY0C 4H20L 1FE8H 1A9EB 3L7FA 4GUPA 4JY6B 3G5YA 3LEVH 2FGWL 4PJ7E 3LB6C 2BHYA 2IOMA 3T1WA 2OTPA 5KVFE 3FAWA 3MV7A 2FEDC 3ARBB 1FVCB 2B1AL 2NYYC 2WIIA 3A23A 3BO8B 3PDOB 3NP3A 4WNJA 4Y7OC 5E4AA 4B9ZA 1UWEL 2R0LL 4NLHA 4PJ9C 4QXUH 2OJZL 3GNML 5HSFA 1N70A 2XTSA 2DKSA 3Q48A 4K8RD 1RH8A 4G8GE 2DYPA 2IF7A 3EDFA 2Y6SC 4PRBA 1I9EA 4OVUA 3UGXA 3LJ3A 4XB8A 2FLRT 4W9KC 2J1WA 5E8PB 5IOKA 1KCRH 2WLIB 4RLDA 3PXHA 4K94L 5JW4N 2GT9B 3SDXB 1JS4A 2VDQL 2DTMH 3K91A 1BVKA 3D5OF 1C16A 1AXIB 3FSVA 4R3SB 1TTFA 1QRNB 4PGBA 4MLIA 5H94A 3ZR6A 4OV5B 2Z35A 1ESOA 4KI5F 4OJYA 4DO4A 2L8AA 1AO7B 3WNNA 3T4AB 2JV6A 1MRFH 2E7LC 4K7PH 2W94A 2QQLL 2WXPA 2ADJA 2X4SA 5A2KH 2VM9A 3MLTB 1QLFA 3L3DB 3NFNA 1T4WA 3NN8A 1LWRA 5AVSB 2BSSB 4DCQB 1P84K 2ATPA 4ZDHB 2HTLC 4WTZG 3D39B 4LSQH 3WN6A 2YJLA 1NAMH 1K3ZA 1O9ZA 3FZUC 1MRCH 3TH2T 3ZHDA 4ZODA 5HHOD 1ZJBA 4RMTA 4LSTL 1UASA 3SBWC 2AV1A 2V37A 3MX0A 4WO4A 5HDLA 4JN2B 2BINA 3ALWA 1NLBH 3NK3A 1DQJB 4PP2B 3PP4H 5AOIA 3Q2VA 1RZJH 3O6FA 3TO4C 2X6MA 2VRAA 2EIJB 4LARL 3ES6B 4BFFA 5IMOA 2X70A 4YS4A 1CE1H 1HWWA 2J1YA 2K70A 4KK6D 2WNXA 8CGTA 3KPTA 2WBKA 2WVUA 4MASA 1NPNA 2CR6A 1EZLA 3RWFA 2QLYA 1SOXA 1D5BA 3IAPA 3ZDWA 1GZPB 4X6DF 4HJUA 2Y23A 4J3UA 4OJEH 1HHHB 4H8QA 1G7IB 2ITEA 3TV8A 5IBUB 1OVZA 3OJMB 4P4KB 4K8RL 4XB3A 3KYAA 3NIDB 1LE9B 5CLYA 2E9JA 2CHNA 3L4WA 4HUWA 5LGJB 2BVQB 3EOAB 3FKUS 1HINL 1UJ3A 1KBPA 3ZMEA 1TF4A 1ERNA 3O41A 1XCWA 5DI8A 5E4IA 1RPKA 5C0FB 2VN4A 2BFVL 1SJMA 4QWWC 3E7JA 4V1DE 4JFSA 4OQTA 4Y5YC 1FNFA 4HHAB 3HN8A 3VI4E 1K4CB 4DN4H 3F65A 4MJ5B 3LNEA 3Q1SH 4OAWA 4D0BB 4ABUA 1Y6MR 2VMJA 1N0LB 3CZEA 1QSEA 1TLKA 3IETB 3U6RB 5AKVA 3HNVL 1CYGA 2ZCKL 3QDGB 5FB8A 1KJMA 4NQSA 2F53E 3D2UD 4O02L 1OP5H 2ADFH 5B8CB 4UDUA 4ATTA 4Y4HD 1F3DH 3FSZA 1L9QA 3MJ7B 2VMDA 3SCMC 5KBNC 3EH2A 2KERA 2YSSA 1OAZL 2EUXA 3MRHB 2X1QA 4WU7B 5JPMC 1F8TL 3DC0A 5FYJU 4HG4K 3AS2A 3AUWB 2V2TA 1YECL 3DX8A 2DI7A 3NP4A 1AHKA 2WQRA 3D2UA 4OLZH 4IIZA 2K7QA 1SY6H 2Q6WB 5E0QA 3FRPB 4Y4HA 3T09A 3RFZB 1ND0B 3RVUC 4GG6A 2J6EA 4MMYB 5D70L 4W93A 4U3HA 3V0GA 2X4TB 2YQBA 5HVGB 4HIJB 4U1MB 2Q2LA 4WEBL 4B0MM 1GC1H 2AQ3A 5CFAA 2K8QA 4P5SA 4XN7A 3Q06A 2OMYB 2OK0H 3C2AH 3FT2B 4PWFA 1AD9A 3CN2A 2L3BA 2I32A 1TQUA 3L3OA 4A6YB 3UYRH 2CU9A 3G08A 5C71A 3LHAA 3M45A 3SQOH 5KVMC 5AFAA 1SHXA 3UG5A 1ASQA 1MKFA 3HNSL 2AJYH 7FABH 1HCZA 3E8UL 5BVJB 1WG3A 4RMWA 1FGNL 1AY1H 4HW6A 2DM4A 5GGVL 2YARA 4NZRL 2YZ1A 2FECL 1PBYA 1CXLA 2FGZA 3BVUA 3SOBH 2WVVA 2ZX7A 4ALAC 1NCNA 3TNNB 1BFOB 3Q5OA 1D7CA 2H0PA 1NGPL 3MCKA 3P3YA 3QPXH 2XX0A 4LHUA 1GHFL 4PWHA 5I82A 2YGOA 3QS3A 3QQ9C 3DO3A 2IFFH 4ZTOL 3K0YA 4YBQD 4Y19B 4AQAB 1X7SA 1N9PA 1GCYA 1ZWIA 2AABH 2ZP0T 1PD0A 1DBAH 3BISA 3BT0A 3FPXA 3QQ3B 4XWGL 5DRNB 5DTFB 5EIIB 4HT1L 4ELMB 5DFWH 2WGNB 1OZTG 3II3A 4PWJA 2VXVH 2PYEE 1QI4A 4U1KA 5K39A 1VZHA 3KWTA 1USQA 2XWJB 2RQ8A 1KEML 4QRTB 3NSCA 4O58L 1BJ1J 5GRUH 4ODWA 2WKOF 3THML 1HNFA 4QY8A 5JOFB 5ICYA 3EYQD 2CD0A 2X89D 2WXNA 2HFTA 2XQYG 5CD5D 2PTTA 3ZTNH 4DPBX 2EDBA 2YD2A 3WDJA 2C3VA 3P0YH 1X5AA 4KDVA 4TQEH 2R1XB 3MOAL 3SQBA 2HT3C 1OSYA 4GW5B 4I3SL 1TR7A 4YDKH 3ZL4L 4Y4FA 4Y8DC 5CF3A 4L8CA 1H15B 4OBRA 4W9EC 5KWYC 1ZAGA 5IFAH 2X1WL 1MQ8A 1U8QB 3NZSA 3S2CA 3BDXA 5AKSA 3SDXF 4ZT1A 2EIDA 4YVNA 1WCBB 2QQQA 2E4TA 4UTAL 4AYEC 4WWKA 1H3WM 1JZEA 3K72A 2VITA 4TSAH 3P73A 3OHXC 4L5FH 3BQVA 4NI6A 2GKIA 4PS4H 1ZLSH 1AOZA 4RDQG 1A3RL 1JZGA 3EYUH 4E42B 3D25A 3II2A 5LGKA 2WB1A 3MLSL 4Q6IA 2BCMA 1J9RA 2QJDA 1BZOA 6PCYA 1I7TA 1I7RB 2WINA 2C7UA 4UOZA 4TSCL 3CVIL 3RDTB 1N59B 1HI6B 3QNYB 2AK4B 1IC1A 4N3UA 3FSWA 3QC6X 3IJEB 4LEOA 5LNEA 2ZSWA 4ZPTB 1HHKB 1UFUA 2W0FA 4OCXL 4QJ5B 1HSBB 2K3TA 4MXVF 2WN2A 1KDIA 4P2QD 4W4OC 1SDYA 1ONQB 2QEJA 4YC2B 3KZ8A 5J5EA 1T20A 1WFTA 5FEBA 4WSJA 5DJDA 3RX9A 1X5JA 3C09B 4AJ0A 4QNPF 5E24E 1JK8A 3BZ5A 1E5BA 4LP4A 5AW3B 4G9DA 1QZ1A 2JXMA 2WUBH 4XNXH 5I8EA 4J3OD 2AJ3B 4GEIA 4PJ8C 2GIYA 2EIMB 3EOTH 4G6AC 3IGFA 4HFWA 1DJGA 1OCRB 1UXWB 4R2GD 2OCJA 3KAAA 4AQEB 4KJQC 1JGVL 3LH2L 3FQXB 5KVDH 3TBWB 3ARDC 1INDH 1JV2A 2XIIA 3HPJA 4GO6B 4QXTA 2UZYB 3LOWA 1FFOA 2A9NL 3TEYA 2FEJA 3NRQA 3LPGA 4FDWA 3HNTL 2FB4L 2ZWNA 4U0RB 2VLLB 3KGRA 3KBPA 4EDXA 3V0FA 4LIQH 3P2TA 3SD5A 5D1ZC 1ZGLP 1I7UA 3MLRL 1WBXB 4HS6B 4NJAL 3QZMA 3NFPA 3ILPB 3BP6A 4NQTA 4RMUA 4UZUA 3OWRA 3LSOB 1BGXL 2J8UB 3QB7C 3G6JA 2FVNA 5CGYD 1Q9LB 5IM7B 1UTDA 3JXAA 2BY3A 3RIAF 4M1DL 2P42B 1H5BB 2FSDA 1BIIA 4B96A 1YO4A 4X6BA 3IAQA 2BZDA 3ZE0B 5DYOA 2R4RL 2H8PB 1I3RB 1LO2L 3ZGHA 3L7EA 4HVBA 2YFNA 5GRXG 5AYUL 4J3WA 1A6UL 2N0KA 3TBTA 5A2JH 1KYUA 5DLML 2HX9A 1XH2A 4O5LL 3HE6C 4PVLA 2VXUL 4U1SA 4UI2A 2QKIB 1BFSA 4MBRA 2XN9B 2VR3A 4U33A 2Y22A 1A14H 1WC7A 3NJVA 1Y1UA 5E7FA 2DWYA 3BVVA 1AXSB 2M8XA 2XWRA 3GBMH 4I0PC 5F0PB 4UQAA 1L3NA 2YLKA 1MLCB 4UNUA 5FV2A 2CO3A 2KLSA 2B20A 2MKWA 4M7JH 3IXAB 1D5ZB 2OR9H 3PDGA 4ZSOB 1II4E 2NZ9D 3AQYA 5B7EA 4ODXA 4WDIB 3KPLB 4JUTA 3FQ4A 1KCVL 1ZLWK 2UXTA 1PSKL 1XQ4A 2CMRH 2IIJA 1T1YB 3C6LD 2OMUB 4I18B 4ZUTB 3MZGB 3U4BL 3BPOB 3WDIA 2EIEA 3SPJA 2YO3A 1KY7A 3ZHKA 2NSMA 2OL3H 2Y0SA 1T4KA 3VRJA 1E28B 3MV9B 2DM2A 4LDEB 4YHKL 3A0OA 1YNKL 1KTKE 2BNRA 3ULVE 3KGSA 3LKNB 3ZDXE 3AG1B 4MMZC 1KIPB 3GMNB 5IJDC 4XCCH 4FQ2L 4UNVA 1XIWD 4KTGA 1RUPL 2NYKA 3SB3A 3UJTL 3VXRD 3PABB 3FOMA 3O6LL 4QRUB 5JIDA 1JWSA 5IFHH 4AE0A 3WIIL 2YGQA 3X11A 2Y2WA 5HDRA 1FFNA 1CLYL 3BUDA 4RWHA 1QOKA 1EBPA 1Q0XH 1FF5A 5F7UA 5HYJE 2BM3A 1XIWA 4N8VA 5F1NB 3P3SA 2EEFA 3UBXI 3VCLA 3ZK0A 2P8LA 3FFCB 3EGSA 3VXRA 4UAOC 5IESL 4P5TB 1WT5C 4FQXD 2CO6B 4Y5XC 3RVXD 3DVGA 1JP5A 4K3HA 4HIIB 4M5ZL 3TBBA 1ETZA 1I75A 1YYMH 1DEEA 2DQFB 2QTVA 2EDFA 2ZX5A 3MQIA 4L8SC 3TONA 3OB8A 5CILH 1G4MA 5E2UH 3WIFA 3WI9A 4NHCL 5DK2B 4ELMF 4GG6E 2NDFA 2BDNH 1BJ1H 1YMMD 5D8JL 2OX5B 1UB5A 3OAZH 4XBEL 4GAGH 1RZKL 3VWJC 4JFQB 4Q14A 1QSFB 4QAMB 3LZLA 4Y2OB 3H1ZA 3RGVB 3ZT5A 4AEHH 1IM9D 1P84J 5BJTA 2OXHB 3GHEL 1FPTH 5F7EL 5FIEA 4EQ2A 3MFGB 3QAQA 3O9WD 1SNRA 2XXFA 3BZ4A 3U46A 1BP3B 2GTZA 2AJSH 3VTAA 1YMMA 1VJSA 4CN4A 1DVXA 3N50A 4HEMA 2B15A 3E3QE 3KPRE 4MNQA 4KUCD 4G6MH 1MEXL 1IM9A 1USZA 2MCPL 3EGDB 3GHPA 1FVEB 5BRZB 2OSLA 5CJOL 5AALA 3O9WA 2AZUA 2XNAB 4JPVL 4QOKD 3UIYA 4KKCC 4PPTA 4OF0A 3EJZD 3DX1A 3RWJA 4HHWA 5A2AA 4JM2F 1A1NA 4MRBA 4YPGA 3HZMA 4YXKH 3B5HA 3FU3A 5ILTH 3DK2A 3B2UC 4N5EC 1VENA 3PF2A 3L45A 5I9QC 2XXCB 5KSBF 2MMXA 4D8PB 4FMKA 4QOKA 3EH1A 1JF5A 2DQEH 3A21A 3HB3B 3OKNB 3APNA 3FTXA 2NLJB 4L4JA 5CGTA 4CW1A 1R0AH 3MV11 3NZUA 4DQAA 3ZKMC 2P80A 2O30A 2FH8A 4ZS6C 2CDFB 1BD2D 2V17L 3LH8A 3UEZA 1MCWM 4U1JA 1U8PB 3MGOA 5KUMA 3VWKC 4IBVA 5HVHC 5BS0D 1X6NA 5IF0B 1FYTD 2IBGA 3TWYA 3IMWA 3F5WB 4A2EA 1DANT 4KROB 2F54B 5D6DC 2VLJD 4J28A 5BV7B 3SGDI 2NY5L 4NPYA 3BMVA 1HXKA 3B7UX 2VDNL 4DIXA 1XDTT 1MJUL 2K6YA 1N67A 2NY3D 1ZA6A 4QRRE 5HY9A 5JPNC 5C0AD 4LSVL 4EUPA 4L29B 1JXFA 4IHOA 4OM0L 3DECA 1ZVNA 3DX0A 4UZSA 3MREB 5JNYB 4G6JL 4A2MA 1TCRA 4OJFH 4J3VA 3BSGA 2VLJA 3D3VE 3EO1A 4N9GB 5GS0H 4FLSA 3OC8A 4BUQA 1GGIH 1PL3A 5EU3A 4DGIH 3MNZB 1NZRA 2R0ZH 5F1IA 4OCRL 1AZVA 1MFDH 2GAZB 5DURB 5C0AA 2HTKD 3DDGA 3P4MB 4XOCA 3GMPA 4DKTA 4U4BA 2QHRL 1GYUA 1EVUA 4WZ9A 2G3NA 3RJQB 5FUCC 2PETA 4JL2A 2UZXA 4XWOD 5ESQB 1FAKT 4OGQC 1QFUH 3S4SB 4XMPL 3BSZH 4NO3B 5HGAB 2X4QA 1RUAH 2CLVA 2LOEA 2Y7MA 2CQVA 1J9SA 1ZXQA 4GP8B 4B5ZA 4QHUB 1ZS8A 1AXTH 5AOLA 3T0EC 4CA4A 1BSIA 2VO8A 4XZUA 1BM7A 1KT2B 3FCBA 3GRGA 4PJIE 2IQAA 2HX7A 3ZE0F 1UQSB 4FADA 1BLNA 2DQGH 2HLAB 4BK4A 35C8L 1ETJA 4CU7A 4PJFB 4FA7B 4YFEA 4IEFA 3HCVA 3PQYD 4C4KO 4P9HC 3DGCR 5KZCD 3FQWB 2YMXH 4PU2A 1KB3A 1ZLEA 2HFGL 1UC6A 4LSUH 4A2LA 3VH8B 3EDKA 3W9DB 3EYFB 3WEBA 4NERA 4HIPA 4P48A 5G5DA 2DMGA 1AGFB 2X4NA 5AVZB 5I1JH 3Q05A 4IKKA 1GGYA 4FAAB 4Z3EA 3VTTA 5KYYB 5JTWA 2NUPA 2R2EB 1CB4A 5FO9A 1UT9A 4Z6AT 2MOGA 3PQYA 3U0WH 5I8KL 1F58H 2I9TB 5C0EA 4FXTA 5KBMA 1PLGH 3HR5B 3QHFL 1EHLH 4N4YB 2XJKA 4O51A 4FQJL 1IBDA 1P4UA 1CFQB 3NPZB 4DQOH 2FT8A 4Z7OB 2X9WA 2R0KL 5L8JB 1EXHA 3S35H 3BXNA 5MEPA 5D6CA 1NCCH 4D0CB 2OMBA 1FZJA 2GJZA 5HJ3A 1BYPA 2J4WH 4ICWA 4EVNB 1GGBH 4L2YA 5JQIB 4FE9A 4FKEA 4HUVA 1JRHH 4G7VL 2E7BA 1EGJH 1XB6A 3R8QA 1EEZB 4FI8A 4H5SA 4OCWH 4WFGD 5C9JA 2DQHL 5K5YA 3H3KA 4NNPL 4R7NB 1TT6A 2AERT 4GBXC 3T77A 1CGSL 1Z5YD 1TJIL 4AM0B 4JFUA 1VERA 3TBSB 3OMIB 2NDGA 2OZNA 2C3GA 2JSFA 3LRSA 1ET5A 3BVNA 4MBOA 2EDRA 1VB9A 3DV4A 4H0HB 1I85C 5DZ9A 1RL1A 2DLFH 5ANHA 4DP9X 5GJTH 3BVWA 1XGRB 2BSBA 4TUJA 4DEPC 3DX7B 4M7LH 5D1QC 3ROLB 1MWAH 1QPXA 4EZJA 3IDNA 3LXBA 1E7UA 3UBXG 4DJMA 1GR7A 3L1FA 4FLHA 1FNLA 2Z8VC 4L3AA 3GSQB 4LCUA 3VFTA 4HUKB 1A5FH 4XPTL 3QCUL 3CWGA 1KYDA 2IPUG 5IVXF 4A7GA 2XXMB 4HIXL 4NO5A 5D2LF 3UAJA 4NC0B 3QUZB 4WI9A 3VFSA 1CDHA 3L2NA 5FHAL 2DZEA 4NP4L 4LLDB 3ZO9A 3JV5A 1UH4A 4G1EB 4HAGA 2PUQT 3WJJC 3Q5TA 3L4YA 1E4WL 3RTLA 1M3JA 4BDVA 3VFWA 3JTBA 5DVKA 5DQJA 3JUZA 3SJVB 3S36L 5D5MA 3O2DL 2KDYA 4DP4X 2CDEA 1BEXA 3PWVA 2B2XH 1SLXA 3QDMA 4FKKA 2E0PA 1KPUB 2CBTA 5E9DB 1QWNA 1N0XL 2K78A 5G4OA 3FQRB 4N2LA 5EHFA 2CO1A 2WXOA 4OJCA 5I1LA 4BSWA 4AEIL 2EXWD 2HFEA 1I8UA 1OAQH 5I1CL 4JFFB 4F7MB 1MCWW 1SBSH 4HH9A 2RACA 3QXDA 1E5CA 2B8OT 2WO2B 4PR5B 4AZUA 3KYMA 1QATA 3U7WH 5KTEH 1YEJL 4QTHB 2MCMA 1JUFA 3HHSA 2IXQB 3L6FA 4PJBF 4WK4B 3K0WA 3W11D 1RURH 4FS0A 4LOUD 3Q8AA 3HG0A 3TVMD 1OTSD 5GJSL 1ZTMA 3V79C 3QR2A 1MHHB 5FOBB 5IFJA 4UQ3B 1NEZG 5KSAC 1G4RA 1QFHA 4ZFFB 3L08A 3KLKA 2N56A 4FYTA 3BD3A 3BEVB 2A38A 4F7KA 5B1BB 2VXQH 1QHPA 2NY4C 3M86A 5J12B 1TSHA 4FYQA 3TVMA 3WEOA 2X6BA 2V3DA 4MNQE 4WAFA 1FA4A 1XZ0B 1PGRB 1SVZA 2VM3A 3NH7H 3OMNB 2XZQH 3MXVH 3PWUA 2JKLA 1BFVL 2PF6A 4R4BA 4KGLA 1UOKA 1XGPB 4M7ZC 1KCRL 3QQXA 4UOQA 3DURA 3OXRA 3NIFB 3V95A 5EIIG 3K6SB 1IAOA 1MDTA 2FJFA 5D4HA 2WQSA 4MMXA 4IRZA 4KRPD 3LKOB 1W0VB 3LQZA 3N0AA 1I8LC 3KBFA 3QHTC 3RU8L 5C0RH 1CDIA 5E1AA 1TKWA 4DHLA 3M17A 4PV8A 1NCWH 1ZANH 4FJYA 5CU9A 3VXQB 4DTGL 3O4LD 3MKGA 4GG8A 5SX4H 1JGLL 3DYMA 4APXB 3ZO0A 4ANKA 1HYSD 3GI9L 4TLUA 4EXKA 1OTTD 4MS6A 2DQUL 1LWHA 4KVCL 1WIOA 2ZOUA 5DJZB 5I0VA 1W72L 4LSQL 2X2UA 4JCMA 4M61B 3GHBH 4HUCA 5H4YA 3SYQA 3R7QA 5C70A 3MYJA 4AVHA 2DQTH 2R27A 4JVUA 3R06B 4XOAA 2QPSA 3OL2A 1QUPA 2VH5H 2IH1B 1R17A 2AJZA 3SYOA 3O4LA 3JV0A 5EU4A 4K3JL 3GMMA 4ZAKC 3SSGA 2HP4A 4QKXB 4JFWA 4HPOL 2WY3B 3KH3A 4ECNA 4BFIA 1A1MA 2VT0A 1CGWA 1CR9L 2UY7B 4BWTA 1U95A 2BP8B 2JI3A 2I7SA 2IH3A 1GZHA 1S7RB 1A0QH 4Y16D 1MHCA 1CFNA 3MBEB 1KACB 3HUJB 2D31B 4V33A 4M6MH 4DP5X 1UM5H 5ADPH 1S9VA 1NC2D 4IRZL 4BUGA 2LU7A 4MNGB 1B0RA 2RIKA 1DSFL 2BOLA 4D3CH 1QD0A 1S9YB 4DKEH 2X05A 1OK8A 1A6WL 3ECQA 1F13A 1NBVL 1C8QA 4TN9A 4Z18A 3BIKA 1XO8A 4C8XA 3WN5C 1OE1A 4Y1AD 5I66B 2ADGA 3GTTA 2VLRE 1HX0A 1PAMA 2EXTA 5DS8A 4GRMA 5J56B 3DYOA 1UA3A 1ITCA 3MNVA 3GI8L 1F4XL 2VDKL 1D9KC 3FTUA 1WGVA 2NX5B 3HI1A 4OZFB 1MHPH 2W65A 3V4PA 2GFBA 4YHNB 3T6VA 1S7SB 2NMSA 2VN3A 3WLBA 2IDCA 5C09B 1KUMA 3QEHB 5GRJL 5I76B 2BY0A 3HS0A 1F90H 2AJXL 2JLPA 4GI8A 4YIQB 3ZKXC 4AV5A 3MRMA 3ARFA 3RPKA 1H6FA 5KS9F 4O2EB 4N26A 4ETQA 4NRXA 4RBPK 5CKAA 3WO3B 1JOIA 1NFDE 1AHWC 3GRBA 2XA8H 1RY7B 3W0WD 3U6XA 1KIUB 4J4PD 1UD5A 1E4KC 3I6SA 4N5UA 4TNVK 3EBAA 3LYRA 1AD0A 1NQBA 4R96A 3O3AB 1BQHA 3CHPA 4RFNC 4QTIH 3MOQA 4JFVA 1NIDA 2UZIH 4YFLF 1EA9C 4LO9A 1D6EB 2EE6A 2IH8A 5CXPA 3QULA 4OZHB 2J44A 5DD1H 5E6IB 3DSNA 2JKJA 3GSVA 4XO5A 5K93A 4ODSL 5BZXA 1MCPH 3RTQD 1DQIA 4J4PA 3MO1B 1WDAA 5HHME 2AQRA 3KLDA 4Z7WA 4OUUB 4AZ8A 4N90E 4WUUD 4N2BA 4WK0B 1KYOJ 2XWBA 4ZO7A 1XBRA 1SJEA 2OSWA 5LAXA 1WITA 2B59A 3S9DB 1OCWH 4UV7H 3RGBA 1IC5L 2WLKA 3TCXA 4FHBD 2VDPL 1R75A 4JPIA 2R0WH 1AI1H 4H4NA 3FO0L 2FYVA 5C07A 3V4PL 4FNLH 3OAYK 4X4XA 3WTXA 3QWQB 4GXUM 1MVYA 2HH0H 2R59A 4WUUA 4AYFB 2WTOA 2NNFA 4NQUA 3IDMB 4UT6L 2VN6A 1HDMB 1ZOXA 5T1LD 4GFXA 2JJTA 2JIXA 3KLLA 4Z5RB 4AKQA 2D9CA 2BRRH 4C58B 1EEQA 3OXSA 3FTZA 4PJEA 3VGHA 5AKRA 3VTMA 1PCSA 1DUZA 1YEDB 3M1BA 1OM9A 4WHTB 3EF7A 1SHSA 3CFKB 1S7WB 1E9PA 3DMMB 4FHJA 1B0IA 1QTPA 1Y6KR 3ELAT 4YO0A 2KZBA 1Z32X 2RD0A 2XJLA 2Y5TA 3GKWL 4YSOA 4CVWA 3CZFB 3SDYL 1KC5L 1MCEA 4BZ2H 1WZMA 3S37H 2Q8BH 3KCPA 3GIVA 1X9RA 1SOKA 3TIEA 5D7IB 4N2KA 4EI6B 5DD5L 4RESB 1VAHA 3HC0A 1V05A 4PP1D 1LO4H 4H8WL 1K5NB 5EEUA 1G0DA 3QYCA 2XDHA 3EO0A 1L9TA 1MWOA 1DJHA 4WJKB 1KPVA 4PRAA 3W57A 5JZ7C 5KW9L 1YQ2A 4I4WB 5F3HA 5F9AC 3B5GA 4ZNEE 1MCOL 3CN1A 5C8JA 3EG9B 5AYTA 4U7SA 2GTWA 5DVMA 5FUCE 1FGVL 1KCKA 1NCJA 2AHIA 3P0YL 5I16A 4G59C 5KSUA 1O75A 4GRWF 4XP9L 4L3EE 3U2SA 1V3JA 5CO1A 3TV3H 5C0CA 1G7QB 1VESA 2EO7A 2YQ2A 4C4KT 2VKXA 1KJ2B 4QF1A 5I71C 3S88L 4HUXA 5TD4A 2Z31D 2WANA 1G1OA 3BPCB 3QR0A 3CBJB 3V9CA 5LKNA 4YDMA 4PTTB 1LDPL 1PZDA 3BE1H 3H7BB 4G7SB 3JWNG 3T0EE 4PRIB 4XH2B 4EF3A 1AC6A 4WTQA 4Y9EA 1KENL 2FQGA 4FZEL 3QW9A 4K0OA 3RJOA 5KVEL 5J6GB 3Q3GA 3TA3C 3CMOL 3V5KB 1ZLWH 5CKGA 2GCYA 5AAMC 3F7YB 5HI4C 3TPUB 3FN0L 1AKJB 5JR1L 2Z31A 4N0UB 4H0GA 2CBPA 2XZZA 4LNRA 4RWYL 1KTJA 4F5CA 4ZMQA 1RPUA 5F21B 1EHAA 5KBDA 5AWNL 4IS6B 2MIZA 2AV7B 3QPQD 3BHBA 2BMKA 2ZIDA 4L4VA 3CX2A 1JZ2A 3LXAA 5D2NB 3WNIA 5E9AA 3HBZA 5CFHA 3MRFA 4IM8A 4UM8A 1QVOB 4HS8H 1P5UC 5B1KA 5JXAL 43C9B 4NHUA 5IB4A 3FO9A 4KMQA 4QRSA 1JSYA 1C7TA 4KZEH 1DJSA 1QNZL 2J73A 5EZIL 2O26U 3BP4B 2X5PA 4P3DB 1H6UA 5TGBB 4B9PA 1M6OA 4YWGL 1DJWA 3STBA 2RHEA 2ICEB 2OULB 4PJDA 1DJZA 5TDPA 2J5WA 2NNAB 2WUBL 4K94C 1TQVA 3CBKB 1ID5I 5ANMB 1WUZA 3FB5A 1IAIH 4JO3H 3ESMA 5D7LD 3VXSB 2ODIA 1IMHC 4Y2DB 3S96A 1BQKA 1JNJA 3L3IA 1SXBA 2R9HD 4TL5A 3ZDZB 1X6LA 1ZT7A 3VFVA 1NIEA 4K07A 4X8JA 4X99A 4OZIE 3PP3H 2OMWB 2ENJA 2PR9A 2R29H 3FFDB 3EJSA 3OWEA 4KRMB 5BQ7A 1U8KA 4GP5B 2XLLA 2VXSL 2WUCL 1VZIA 4GS7B 3TGXA 3TCLB 1JVLA 1OIOA 1AQKH 3ASOB 3FONA 4NQCB 1P2CA 2F7IA 4FXLA 1OOWA 1PG7X 2KMWA 1NCAH 3RX5A 2UWEB 3T2NL 3X1FA 1KJVA 4D9QE 43CAB 1Q0YH 2QADC 3QWOA 5D1QE 5D7EA 1J18A 5GS0C 1JZ7A 1MJ8H 4UQEA 3LKQB 1ECZA 2ED8A 5EOCH 2A9CA 4RZCB 2D2OA 3OAWA 2GJJA 4JCWA 4LLQB 5DJ8B 5AW8B 1JN6A 5KYXA 2VZSA 2IDQA 1CE6B 2P45B 1XCTB 3KVPA 2CALA 4MQ7B 1IGMH 2BCKA 4YXLL 3MSPA 1BIHA 2NY1B 2WWNA 2Y1YA 1HIMH 3OKOB 3DO7B 1MY5A 2BNQD 3K71B 2NW3B 2IWEA 3IPBA 3P69A 1R24A 1G7PA 1M05B 3CAFA 3EJRA 1URLA 3UTPD 4NZTL 2DWEB 4V2BA 5EBWB 3S6CA 3UPAA 4JKPL 5HPMB 4XCEB 5EC1A 1MXDA 5DJXB 3WGUB 3WTWA 4YHYB 2Z1KA 3ARXA 4OZHF 3V0IA 2NQ3A 1OCZB 3MGAA 4E9TA 3P4NA 2OPCA 2OXGA 4GSQA 1P9MC 5AD0B 5I8OL 3C60B 1DJYA 4BQ9A 3HRZC 1GOGA 3F3HA 5I1AA 1OAKL 1TZHB 2XQBL 3B9VA 4ANXA 2AANA 1OT2A 2EXSA 1MIEL 1O9WA 3IFPB 1MCQA 2IDSA 3FF7A 4JR9H 4OLVL 1FZOB 4ZTPH 4K9JA 5GHWH 5CLWA 5EA0L 4WJ5A 1HJCA 1OGSA 5ALBH 2NY6D 1P7QA 4W68A 2G75A 5CWSA 3FUDA 3T08A 3CFBB 4GUQA 4KKAD 4LU5H 3SKUD 5IZ7A 3DI2B 1NDMB 1A2YA 1R6VA 3EHBD 2JCCE 3MRKA 1ZE3H 4PJ7B 1ED3A 3P4OA 4KTEL 4F2FA 5HI5D 1TG8A 2XV0A 1FCGA 4HZLA 1G9NH 3BN9D 4KK6C 1BHGA 4JPKL 2LLNA 5GZND 5JORA 5B4MD 4G8GB 4JO2L 2EILB 2UZPA 2H0EA 3OGCB 4EN2A 2ZF9A 4MYPA 2ZUTA 5D7IF 4DK6A 4M56A 5E2WL 4FQPA 4Q4EA 4EJ1C 3FMGH 4U6HB 4OV6F 3U4KA 4YJZL 4PY8I 5F97E 3NESA 4M6OH 1D5XA 4JVPA 5GZNA 1BYOA 4XN5A 2BJML 5GGRA 2EH8L 2XUWA 2ZCLH 1E90A 4IBTA 2XV3A 2AJSL 5FOJA 4PRNB 3GJEA 1CQKA 4YSQA 3BKJH 3ABMB 3CVDA 1CUOA 4OCSH 3VFPB 2F58H 3C6SB 1JGDA 3SKOB 4UINL 3BFOA 4TOYL 3C5SA 3EFFB 4KOBA 1QPKA 5AVTB 1XR8B 3L3HA 1ZS2A 1SYVA 1IFHH 4YNYB 3IFLL 2F19L 3FUIA 1KGYE 4Q9RL 3U7AA 2LVEA 1N68A 1RIUL 3G5XA 3UYPA 3MRPA 4N20A 2R2BB 3TT1H 5C2BH 3REVB 2MOVA 4JFEE 3IN0A 1BOGB 1U8IA 2YD4A 3STZA 1EH9A 1GS8A 2WVTA 1DBJL 3EBHA 5IMKB 3EXJA 3ABZA 1Z5LA 4MJJA 1T1XA 2VYRE 3BH9B 4K9EH 5ITFB 1VKXA 1TZIA 3L16A 4OZGF 4G8EB 3QIBB 1XD0A 5GSRA 1XAUA 2VJ0A 3QR1A 4UTCA 5EC2B 4N0YH 2XFXA 2R1WA 2WXJA 3MRRA 4KX8A 1WQVT 5I17A 2V9UA 1C5BH 1WAAF 3QEUB 2WTRA 3VXMD 4I87A 4FKHA 4N0RA 4GXVH 3GSNL 3V6FB 4AYGA 1AP2A 2ZKWA 2XQYK 3JV6B 5TPWH 1BX2A 4HZAA 3ECUA 5EO9B 3JTTA 2WZ6A 1M7IB 3H9ZA 2HG5B 5T1KB 1U3HA 2WK2A 5IB2B 4HJEA 1CG9A 2OCFD 4PYGA 4TPRH 1YYLL 2WJ7A 4X98A 4EKJA 3WHXB 3VXMA 2PCPB 4M1GH 4V1DB 4AYMC 2VL5B 1B4JH 4F33A 2FX7L 3F7KA 1D6VH 3BAKA 3O45B 3VI4B 1K8IB 5JIPA 1A66A 3O2WL 3T6ZA 2BIQA 3J7HA 4KH9A 1T3FA 2I69A 4G43A 4PLJD 5KVDE 4ZBJA 5PCYA 2AEQH 3MCYA 3PPEA 1MFAH 1S5IH 4BIKA 1ZV2A 2F53B 3VQLA 1G43A 1GH7A 3QFJA 4MA8L 5DMJB 5FO7A 1F4YL 5FM8A 3LTVA 4LIQE 5EWIL 2X0UA 1EAPB 1DZ0A 4R7DB 5I28A 3OZKA 1Y0LB 4NBXB 3UBGA 5LQBL 2QVKA 3CDGA 4JZJB 2LAGB 2APVA 2CBMA 3EDJA 3N44B 4L4VE 2FK9A 4YBQC 4X0KA 1XXDC 1UJTA 2QSTA 1OF2B 1XXFC 2G0LA 2WBJC 3O0LA 2O93L 5F9WC 3WTSA 5IROD 3NBNA 5EOTA 3OZLA 1LE5A 1I7ZB 4I5BA 4EOWL 1JMXA 1OD9A 2FX8H 1HZLA 4JRXD 5J11B 2HWZH 5T3XH 2AGJH 2YD9A 1JCKA 4Y9CA 3N3EA 3NGBB 2VUOA 4MXQD 1TVDA 3OKDB 1TO4A 1XAKA 5CD5C 5EO0B 5I6OA 4I3RH 5IROA 2Y7SA 1DCEA 5DMYA 3CV5A 1A3LL 1IE4A 4LSRH 4JRXA 4J8QA 3EOBB 3VU1A 2Q2EB 3LEYH 1HH9A 1O5DT 4FLQA 2YHGA 1QEWA 4F7TA 4WGWB 1WISA 1A6AB 4ORGB 4F15C 2O5XH 4DNLA 2N0MA 4M6AA 2V8LA 1ACYH 2A6JA 2LFGA 2ILLA 4Q6IC 2AF2A 1KB5L 3BAIA 3B37A 4ZNCD 5I18L 4MD4B 3ATEA 4J3BA 4IOFD 2VXTL 3IKCA 2BVYA 2WSPA 1GGTA 2X4PB 5K59F 3MA7B 2H7WA 1SHWA 3QEGL 2BVOB 4O4YL 3I6LE 4ODTH 1GS6X 4JJ5A 4DW2L 4RGMC 3MLPA 3ARWA 1AH1A 2AJVL 4FFVC 1TVHB 3UERA 3GGWA 3GSRB 2J72A 4HQQL 3IMTA 3Q2NA 4PGDA 5TDNB 1FNEB 4Q9BA 2D8KA 4FNSA 4IHBA 4ZX3A 5B7FA 1UB6B 2ARJQ 2CSPA 1E4JA 2PYEB 2EO1A 2AXJA 3H85A 3H9SD 2AMUA 3WD5H 4BKTC 2EVJA 2JTYA 4EI5D 1CD0A 2OJ1A 4G8FA 3L4UA 3BIBX 5DUJA 2EO9A 2PXYB 1W0WB 1VSCA 1IT9L 2AKRB 3HG3A 4FXGB 1RZPA 2AEPH 3OVUB 4G7RB 1G7MA 4J3OC 2XPZA 2VLKE 3QJXA 4O2FA 4G82A 1KLUB 4IRJD 5D72L 5BUPA 1XTLA 5CMAB 4GIAA 3DTUB 4EI5A 1T80A 2DH3A 1R5VA 4LPXA 2R7EA 2CO2A 1LP9A 4R2GC 5ACLA 5L2JA 2KQMA 4Z0BL 4JHWL 3O11B 2X2HA 5DEZA 1HAWA 1E2VA 3GSOA 3T04D 1EIBA 2Z9TA 3F12A 4QYAA 4OSUH 3D69A 1ACCA 1ADQH 3BUIA 5EN2A 3H9HA 4IRJA 5FWRA 3E6FA 2AQQA 4G1MA 2EDDA 5LBVA 4LLUB 3DETD 3RNKA 3GPSA 4UBDD 4PJCA 1UVQA 4MCNA 5F96L 4C56A 2LU3A 2IAMB 5IQLA 4DGVH 1UA7A 5FKAB 3GO1H 5C9KA 3IDJB 1I1YB 3OHMB 4I9WD 4GUPB 3DJ9A 5CGYC 5CZVH 2P5PA 4KI5D 4E41D 4FG6C 3VXUD 2GJ6D 1OGAE 4KKLC 2WLLB 3PJNA 3CC5B 1INEL 3S3DB 2CNZA 1HEJC 2Q3XA 1EAQA 1OPGL 4HK3N 1NGQL 4FABH 3V0DA 3ARVA 1UZ8A 3PWPA 2GK2A 3KYNB 1D7FA 2JI2A 1KN2H 1LEGB 2ZAHA 2Z4QB 1CZ8H 3AFLA 1L7IL 2DYPB 4DH2A 2A77H 4LLWA 4KY2A 4BH8A 1HILA 5INCA 1Q72H 5I0WA 4DERA 1PMYA 1TMQA 1CGYA 4XNQB 4NN5B 4JGUA 5C0DA 3L5WA 4M43L 5JXEA 1U2YA 1A4JB 2J12B 4ZUUA 1PJ9A 1BVKB 2MH4A 3GXIA 3NEXA 5AOJA 4APQB 5IB1B 2C9VA 2YGVA 4AQ1B 2Z35B 1HL4A 1WZLA 3P40A 5ELIA 4HIEA 1YY8B 2FO4B 4HAKA 2KZWA 2NNCA 4PY7B 3VB9A 2EC8A 4HEPG 5DUMH 4DUVA 2FATL 1SEQH 5E6RB 2PCYA 1HAUA 3C6LC 4GRLB 4RBPH 3DUUB 5SWSE 4IRSD 5HVFB 2J2ZA 4YPJA 2HJKA 1UFGA 2W9EH 4P3CL 4PV9A 3DX6A 3VG9C 2W95A 1Q9OA 5AAWA 1TEGA 1JYVA 2HJFB 1NCHA 2OQJA 3QDJA 1P6FA 4WO4B 2PPDA 3L95A 4G42A 4AK2A 2AXHA 4FRWA 4P9ML 5B1AB 4HUNB 1OKEA 4ZYKA 5CSZB 5I1KH 5EU5A 1PLCA 4Z8FH 2OKMA 2GSIB 2H4EA 4LLVB 2DYSB 1FNSH 4RAVA 4X7SH 3DJTA 4QIRA 3T8XA 1QYGH 3VD3A 4Q9QH 2R39A 1MVUB 1U6AH 4FQXC 3GBDA 1WA1X 1AGBB 3ASNB 5FHBH 1WVZA 3RVXC 4JJHA 3N44F 3PUUA 4Q0XL 4OD2B 5CGBA 1SDDA 4AQ8A 5TE7H 1O9VA 2VWEC 5C0GA 3NJIA 3OAYH 3WY2A 3AREC 2EYSA 5SWZD 2DJ4A 2CIIB 2NY5C 2XG5A 5K69A 5IKCB 4P3WA 4PYHA 1XF2B 4HF5L 1RK1A 3H4FA 4R5TA 1KZYA 2BWDA 2J1KA 4TYUA 3PGDA 4HDIA 1M53A 3FN9A 1J1OH 5DI8B 5LNDA 3BN3B 1KCSH 4DP7X 1DLFH 1CDJA 1I9JH 2B4CL 2DQJL 3STLA 2DQIH 2A6KB 2PYFB 5D96C 4YHZH 4LL4A 3FDWA 2IV9A 3VM5A 1U93B 3RI5F 3ZDXB 5FA3A 1KV3A 4P5KB 3Q13A 1QSEB 1NCDL 4UQ2A 1B3JA 2FZ3B 1NCOA 4FZ8H 5IVZA 3KGTA 2E76C 1JV5B 3EJZC 2NY0B 3PREA 2C9QA 1ANUA 4TVPL 5HHOE 3ZTDC 5KJ4A 3WYRA 4XPHL 3NACL 5ADOH 4N1EA 5HYJB 3O3UN 1GGUA 1W8OA 5INDB 3BGMA 1UD4A 2YD5A 2Q7NA 4M5TA 1ZDQA 2G9HA 4BZ1A 1DANU 1DP0A 4PJ9B 5TQ2L 4YSDA 3A6CH 4XT1C 2VDOB 1NM9A 4L8BA 1AZUA 2R51A 3O3DA 4OLUL 4KO6A 1MY7A 4MD0B 1UWGL 3C5JA 1AZCA 3AXLB 5B38G 4GG6B 1YNLL 1BVNT 4N3TA 4RGND 3OGOE 2FWLB 2FR4A 1UT2A 5M7QA 1G84A 1MW2A 4JO1H 1IIKA 4M8UA 3L9RA 2FJGA 1E9QA 5HP5A 3V2AR 4UIMB 4LEXL 4LKCB 3W5NA 1AD9B 4FJ6A 4ES8A 2YAFA 2J88L 4HV8A 4R7LA 5AVVB 4MJ6A 1WZ1L 1UM4L 2O5YL 4JHVA 5DJYA 3G08B 4OFYD 1MRDH 1M42A 4JFHE 3SKNB 4IIQA 3MRDB 3KPRB 1TJGH 3I2CH 2XBDA 5D93C 5LBSH 3ARBD 4IK6A 3D0AA 1NMCC 2QGCA 3FU8A 1ZIAA 4K71C 4L2LA 1E8XA 4AC2A 3SODB 2P5ED 3ZE2E 3JYBA 4G3YL 2WLHA 4YHPB 3QIWC 2PNDA 2F2HA 3JWDH 3ZL1A 1K6QH 5BOZG 4ZOAA 1TTUA 1A9EA 4X5WB 1LK2B 5BVPL 2HTKC 3IFNH 1V7NH 3IF1A 3FCUB 2YOCA 4RISL 1L3WA 4BZ1L 3DSFL 1OCWL 3ARBA 1FVCA 4NWUL 4UV7L 3BO8A 1OSZA 2WKOA 3PDOA 4U1HB 1YJDL 3LS5H 4RA3A 1PG7W 3WKML 4JK0D 5CCHE 2R0WL 2AEOA 4LVNC 5G4NA 4M5YH 5D7KD 1QRND 4DKFH 4KZDH 1E9OA 4I0KA 3WJLA 4CMHC 1LYQA 4PMEA 3OJ2C 1AO7D 2H6OA 4YGVB 3AT8A 5E8PA 5AVQB 3ZRCC 2WLIA 3BMWA 3IRZA 4GIPD 1WYJA 4FYRA 2ZX6A 5JW3L 2GT9A 2FBJH 1IGIL 4KJWD 4R3SA 1QRNA 1ZDSA 4OV5A 1O6SB 4XN8A 1QFOA 3D39D 3CSGA 4LHQB 1OP4A 2L4OA 1AO7A 5I8CB 3T4YA 3T4AA 4QRRB 5ESAB 4MCZB 5JOPD 4L8CB 3RIAK 1H3UA 1M56B 5IREA 2C9SA 4S0HA 5IGXL 2D7TH 2ZUQB 4Y5YB 5ENWB 2DB8A 4HXAL 4DCQA 2BSSA 2EDJA 4ZDHA 3D3VB 1YLBB 1ZE3C 1TJMA 2AS5M 3D39A 3P77B 3ZR5A 3UO1L 5JHLH 1X7QB 1LEKB 2I60L 2ZXEB 3ASWA 3QRLA 4JN2A 4E9SA 4EBQH 4PP2A 5IHHA 3EDDA 3QCTH 1FORL 4G7QB 4PRHE 2B9BA 2H32H 3ES6A 1LTXA 2DEXX 2VR4A 3SCMB 3KGUA 1Q38A 2ZKHL 1O5PA 4WTWA 2ZWLT 4Z77B 1GAFH 5IEHB 5JPMB 2HT4D 1GZPA 1KGWA 1UH3A 2JH2A 2AVFA 4W9JC 1HQRB 4PJIB 1HHHA 1G7IA 1JK9B 1OQOA 1UT1A 2QTEA 4J3TA 5I74B 3U36B 1T20B 1AKPA 3QEQE 4MDIB 2H9GB 3NJGA 4P4KA 2EACA 2R29A 3ABLB 5HYEA 5JMRA 1LE9A 2GITA 1IJNA 3WTVA 3V4VB 3VX0A 2YPVL 5LGJA 5I8EB 1FLTX 3IMBA 3EOAA 1T03H 1Q0EA 1JHTA 1AANA 4FYSA 4K5MA 3VSUA 4HMDA 3QDGD 2HKAA 2DD8L 1IBYA 1VFOA 1CCZA 1QO3B 2JKWA 4HHAA 3BPLB 2C8NA 1K4CA 4MJ5A 4GO8A 3ZJAA 4FX5A 4D0BA 4AUUA 3IT8D 1N0LA 1HOEA 3FFOA 4YK4C 3IETA 3U6RA 2BHZA 1JXKA 4JBSA 3BGAA 3QDGA 2FQEA 4NCC1 2K4WA 3BAJA 4YDLC 3L4TA 3M46A 1NGWB 1I7UB 4LESA 3JZ7A 4NP9A 5C6TH 4A39A 4BFKA 1ZA3B 3OSVA 1P4BH 5B8CA 3NJMA 5LLIC 3INUH 4YSRA 1PFCA 1O7DE 1X5YA 3LCYA 3MJ7A 2APXA 4LMQE 4WU7A 4QAWA 4PJ5E 2CUHA 4BK5C 1MSPA 2Q6WA 1J88A 3H0TB 4B9FA 3FRPA 1VLXA 2VDRH 1F45A 1Z9LA 2Y69B 1ND0A 4NKIH 4J27A 4FNQA 4MMYA 4WWPA 1EMTL 1SDAB 2MHAB 4U1SB 1PZ5B 4JHAH 3ZRFC 4D0DB 5TK2A 2LABA 4HIJA 2J5LC 4U1MA 4WW2A 2AQTA 15C8H 5IJVB 5FW8A 3VXNB 4BFGA 4XZ4A 5DHYA 4ZW8A 2OMYA 1F1DA 5LXGH 2NZIA 2WV3A 5BPPA 3FT2A 3QJTB 4NAQA 5FA4A 1RK7A 5EEWA 5FECB 3W11C 2P49B 2H1PL 3VA2C 4LOUC 4OZFH 4GG6F 4F93B 1MFBL 1V3LA 1Z6JT 5LWYH 2GUYA 2WKGA 2ZP9A 3BDBA 1P53A 5BVJA 3MJ9L 1PAZA 1XSJA 1EFQA 5ICXB 1HU8A 2V5SA 1IKNA 1OD7A 2R56L 4MJIE 1BZ7B 2G2RB 3BRGC 2I27N 4AYBA 5AVUB 1T2XA 4KTDH 3OHXB 2VDMH 3TNNA 1AC0A 4MMXC 4OU3A 4XP5L 1ZHNB 1UENA 1WJ3A 3BZFB 5IBTH 3MRNA 2H2PD 3FOMB 4UTBA 1DBKH 1UOWA 3VG0L 4HU8A 4LRIA 4WUKL 1OALA 2LTQC 1QHOA 2XG4B 1QG3A 4JLRB 4LASL 1L7TL 4G5ZH 3NSXA 4Y19A 4AQAA 2RALA 1FFNB 3QQ3A 5DTFA 5DRNA 5EIIA 4ELMA 1N64L 2P3YA 4XVUD 1NGXB 4KRPC 2BVUA 4Z7NF 3AW5A 2XWJA 1L9SA 4QRTA 5F7WC 4A2HA 4UV4L 1HCFX 1ETZB 5LGHL 3GXFA 2YA0A 1CF1A 1XGZA 3HRPA 4NT6B 2QV2A 5JOFA 1S7TB 2VIRB 3WS6A 3US1A 5AUMB 3IBEA 3OSKA 2BP3A 3T0VA 2ATKB 2WPGA 1E6OL 1OTTC 2EE0A 2G2PA 5DEFA 2R1XA 3U0PB 4XN4A 2ZQKA 2X1PA 4A6YL 4C4UA 4GW5A 3U2JA 4PIBA 1QFWH 3UTQB 4PJ8B 3MRBB 1XV8A 3W3BA 1EQWA 1H15A 1PEWA 3PXLA 1S78D 1U58B 2XN1A 2DJSA 4H25B 4PS7A 2WWKO 1U8QA 2IAAC 1AR2A 4XNUH 1T66C 3NQKA 2PN5A 3P02A 2RJMA 5IEKB 3K2UH 2Z7ZA 3ARDB 1N2RA 1DQQB 1BQRA 3RDTD 1HXYB 5EZLB 3PPSA 2AK4D 1FNGB 4ZO9A 1JIBA 3IU4L 3KXFD 5IR1B 1UZGA 3LRGA 1D5IH 4UTBL 4MNQB 3SDAD 2ITFA 1H0DB 3QARA 2VUKA 3QG7L 5D1ZB 4TUKH 3P2BA 2BW5A 1JFHA 1I7RA 5E5UB 3HI6L 3DVNB 3IDYC 4KK5D 4Y16C 2CRIA 4IBUA 4YHLH 1AZRA 1N59A 1HI6A 1L9RA 3QNYA 4ZS7H 2X3CA 2E6QA 5TE6L 2YXVA 5I6XC 3BAEH 3QZPA 3HZYB 4ZPTA 2WIMA 2ITDB 2A6DB 2GG1A 4NM4L 1HSBA 1W8EA 4YDIH 4KK8C 3X3FH 1ONQA 3WIHA 1F2XK 3MRGB 1BEYH 1DBML 5JQ6L 1RU9H 3KW8A 5G4MA 4OGXL 2VSKB 1JYWA 1C9SA 4FNTA 2MQ0A 2OMXB 3HE6B 1OT4A 2JJSA 4JFXB 4A55A 2YPKB 2CJTA 3BKJL 4XXDB 2A5UA 3FUNA 4GMTH 4LCVA 1LO0H 3A67H 5GGSY 1T5XA 1GMEA 5EOQL 2CO7B 5J0BA 4YHOL 2ZCZA 4I0PB 4HX1B 2VWEE 4FFZH 5E99L 4U1IB 4URKA 1UXWA 4KHXL 4OLWH 4AQEA 2B0SH 1H6TA 2X28A 2WLJA 1KBGL 1R47A 2HZHA 2O5NA 5I1DB 4RCAA 2AXWA 3RWDB 3QCVH 1TOXA 4YOKA 4WWOA 4D9LH 2Z7YA 2J3SA 3SDCB 4U1NB 5DZVA 5ETUB 2VLLA 3IJHB 1A7NH 4PJAA 5DU7A 1KELH 4H8WC 4NAJA 3WMQA 4J4PC 4GIOA 4TQPA 5DT1H 1TCRB 1HCVA 2EE2A 4HS6A 4KAQH 2K7PA 5D55A 3EO1B 2DIEA 1AJ7H 3ILPA 2WOYA 3RZCC 5BMFH 3D07A 1WTGT 3DROA 3F7VB 3LSOA 4GT0A 2J8UA 4IBLT 4ICXA 4MMZB 4FFYH 4XHQA 1Q9LA 5IM7A 3SDDA 3BT2H 4ADJA 1CVRA 1M7DB 2XN9D 4FCHA 5BNXD 1H5BA 3RTQC 3X12B 3IWUA 3WIHL 2UZXB 2Z65C 4GI6A 3IGLA 2H8PA 1I3RA 1UKQA 3PAUA 3CU7A 2XHNA 4QRAA 1ZTXL 1K8DB 3H42L 2C3XA 4X80H 4JCLA 3G6JF 2E8ZA 2VLRB 5IT2L 2QKIA 2XN9A 5BW7A 3L1OH 2EDKA 4Y5XB 3ZX1A 3L13A 3QO1B 4XZUB 5FFLA 4A04A 1AXSA 2KT6A 3D6GA 1NOAA 2IQAB 4L8SB 3O6ML 1W15A 3MLUH 1MLCA 3O8XC 2ZXGA 5IW3A 1QKZH 2VQ1B 2AEIT 5E1HB 1BLNB 1ZRUA 5IUSA 4AEEA 1D5ZA 4G7YH 2VDLL 4ZSOA 3MV9D 3WKYA 4O9HH 1P7KB 1BD2E 1BQSA 4DOHE 1QFWM 1INQB 1P4LB 3VWJB 4MA7H 3KPLA 4WDIA 5DDHB 3U9PH 1FYTE 1MUJB 5DO2C 3P0VL 3VW3L 4PH8A 3V9FA 1T1YA 1XD1A 2ZX8A 5FUOH 4I18A 3NRFA 1NFDB 2QSCH 4IMKA 4ZUTA 3TH3T 4DZ8B 1SM3L 4YLBA 3MV9A 4OD1L 2J21A 2MCAA 2OR7A 3LKNA 5IUCA 3QK0A 2FIRT 2HRGA 1KIPA 3GMNA 2I5YH 1PG7L 1EHKB 1KFAL 5GS2H 3FT0A 1HQ4A 4PP1C 4OJDH 2MFNA 3PABA 3C8HA 5DZNA 4QRUA 2WW8A 3QXTA 5IMMA 2OZ4A 3WY1A 4WNQB 2DJMA 2YPLA 5ERWB 2ADIB 3I9PA 1GKEA 2G5BB 4DWHA 1BF5A 2BIIA 2P4AB 5HHMB 4LCIL 3HFML 3MUHL 3N9GL 5HHXH 3PV6B 1V27A 4D7PA 5F1NA 3RX7A 3FFCA 4P5TA 1QSFD 2CO6A 2K6ZA 2Y2YA 3RGVD 3QYMA 1NC4D 1IILE 5I9QB 4HIIA 4JM0A 4DEUA 3CMGA 4GFTB 2DQFA 4X9IA 5HGHB 4X9BA 5DD3L 1MIML 4G71B 1J9QA 3BVNB 4M29A 1Q9KA 1ZMYA 3GIZH 5DK2A 3VXOB 1EZVY 4G72B 5K9JL 2OX5A 1PTZA 3VQMA 2R8SH 1P1VA 1IUZA 1JFQL 4JGNA 1WWAX 1L5GA 3V4UH 4TUJB 2YA1A 5HVHB 1QSFA 3Q9PA 4J2XA 5J3HD 3FQTB 4Z7VE 3TFKC 2OXHA 2F8XC 1A8ZA 1FAIL 3DRTB 5BRZD 1ADQA 3L1EA 2AQNA 3O3EB 2DQCL 3PNWA 4ZMVA 2BZCA 4OD3H 3QUGA 4LCUB 4NUGL 3VFTB 2WBWB 3K5SA 4X9HA 2H6UA 3HJEA 3ZE1E 3QPQC 2YK1H 2NR6C 2WYHA 5DK0B 1FRGH 4P5RA 5JIIA 2OZ4L 5EO1B 3IJYB 2QL1A 3MROB 3OR7B 3WFHB 5CCGE 3EGDA 1FVEA 5BRZA 4N6RB 5JYLA 3ARZA 3HBQA 3MRQB 3T3MF 1F5WA 4XC1L 2XNAA 4BQ8A 4P23C 3HB3D 3D33A 1HVXA 1XL6A 1UYWH 4TQIA 5E03A 5GRVK 1KXQE 4R0LC 2CWRA 5CEZD 5TK4A 1M71B 2X0VA 5JHDD 5D9SB 4L3EB 4D8PA 1DFBH 2DOCA 4KROD 4BE5A 2F54D 3WBDA 1SMAA 3OKNA 4AUJA 2NLJA 1U36A 2CJ3A 1MLBB 2C9AA 4WFGE 3T0EB 1J5OL 2CDFA 4NN7C 1ZSDA 2HFEB 4KMTH 1U8PA 4HETA 1J87A 3G6AB 4A68A 4KUCF 2L7UA 1WF5A 4HH9B 3S2AA 4HKBB 5ID0A 2PR4H 4GXFA 1QABA 2BIPA 4PUBL 1W8NA 4RX4D 3KEHA 2CBOA 2EUVA 3OD3A 2F54A 3IAGC 4X7EC 2HUHA 5F3BB 1EDYA 3HHSB 1HC1A 3L6FB 5E51A 2ZOWA 1FDLH 4UM9B 4PW9A 3N06B 5DURD 1VACB 3UC2A 3UZVB 5F0MB 1DQLH 1S5HB 2EE9A 4IDJH 4L29A 1QTYT 4N87A 5JNYA 3MREA 1DEDA 2AXFB 3HC2A 1NAMB 4JFYB 2Y4SA 2NUTB 1RZ7L 2EH7H 4L1BA 4YX2H 4N9GA 5EEXA 1IEAB 2V2XA 3B2VH 1BBDH 3MV8E 3MNZA 4KKZA 5BUGA 2JF1A 3OKKB 1E65A 2R4SH 1F4WL 2GAZA 2JB6B 2QKSA 4JO8A 4HWZB 3C08H 1V3MA 2CA4A 3FPYA 3TO2B 1I1FB 1OQXA 3NJNA 4UU9B 5ESQA 4ZMNA 1E50A 4HJGA 2E47A 4LHUG 3S4SA 5L88L 5HGAA 3W9EA 1B2WL 3ALXA 3EYOB 1EO8L 1SN0A 3UAAA 4AITA 3RA7L 5DS2A 5FYKD 4QHUA 4I77H 5CEZL 5IQ7L 4WW1B 3JWOH 4NFCA 5FUZH 5GSVB 4OZIB 4GBXB 1KT2A 3LQZB 1YHPA 4ONGH 5H37H 3BUYB 1NUGA 2XZCL 3N1MC 3IS0X 5B3JE 1UQSA 1NBYB 4OIIL 5BV7L 4PJFA 2VZUA 4U3SA 2Q3AA 4HPYL 3KR3H 4LPWA 3FQWA 3ZDYE 3RKDD 4F91B 3DV6A 3OPUA 4DEPB 1F86A 2P24B 4TTDD 1HFUA 3EYFA 4LK4A 4M8QB 5D1QB 5TJWK 3VH8A 3W9DA 4YVUA 3TT3L 1AGFA 2EEXA 1MJ7L 1CTNA 4WY7L 2OYPA 1KWKA 1RHHB 2WSKA 1IKOP 3LQAH 2R2EA 2PCXA 4TSBH 1P4IH 2AJZB 4ODHH 1WZKA 4XP1H 5JMOC 3CFEB 2I9TA 4AGOA 3EHBC 4XP4H 3HR5A 2IPTH 3VD5A 5HI5C 4PJAE 1CFQA 2YAEA 2CCLA 3GEWB 3QUMH 5EF2A 1OW0C 3BN9C 4QPEA 2PW1B 1YA5A 3H7LA 3VFRB 4UT9L 4EVNA 5B4MC 1PVHA 1CU4H 3QAZB 5EFIB 2UVEA 1B0GB 2FAUA 4TNWF 5EBLB 2E46A 1QBLL 4LBEB 4EN3D 1EEZA 1TZGH 4MVBD 4R7NA 2DIAA 2X9YA 3ZKND 2YKLH 3CVHL 4AM0A 3TBSA 5I6NA 1IC7L 2CRYA 2HMID 1BVLB 4ONFL 5CINH 3CFDB 5FYKL 1J5CA 5DS8B 2DQIL 2WWKT 3ET9F 3U79A 1XGRA 2XC8A 1D2OA 4OFDA 4M48L 3DX7A 3KPMA 3QUZD 3QJOA 3EJYD 4UT7L 4JDZB 3ROLA 4YQXH 2OW7A 3KJ6L 2ADYA 2BERA 4X7DC 1N19A 2K3HA 3CSFA 3U1SL 5CNHA 2NY2B 3RFRA 3GSQA 1OAXL 5CP7A 1RAMA 4EZLA 5LBSA 2PPCA 4NRZB 3MR9B 3MRMB 4M62L 4NYLB 2JCCB 3GBNH 3QUZA 4JRFA 3CZLA 2FLBT 3NJJA 1KEGL 1T5KA 4LLDA 1RVFH 5IW1B 2X3AA 4G1EA 3OX8B 2GY5A 5TQ0L 3RPIB 1T0PB 1UHVA 1BAFH 3S97C 4PB0H 2AJUL 5E9DD 1J1XL 4P2OA 5F8QC 4FI7A 4A7GF 4JY5L 3SJVA 4FLOA 3UGUA 4ZMYA 1JI1A 2COVD 4JFFD 1Z3GH 3ZN6A 3GSVB 4NIYE 1IGCL 3LRHA 4XVSH 3MXWH 2Y1VA 3SZKC 1KCUH 4AZ8B 2A74A 4CNIB 4M7ZB 3KYKH 5IMLB 1A7OL 1KPUA 4GNKB 4KHTH 1SJEB 5GGUB 5LAXB 2K9UA 3FQRA 5A3IC 4WI5A 1B88A 2HKFH 1N8ZB 3IKKA 1E4XH 4M1CD 3QFGA 1EEUA 4JFFA 4JPIB 5D5MF 4F7MA 2V4LA 5C3TA 2Z1PA 3S8GB 3CXFA 4PR5A 4Y1AE 1CF8H 3CSYB 4R5VA 2C9UA 4AG4H 2DF3A 5DD0H 1JAEA 1M57B 4KPHH 2DWTA 4HJIA 1ZVSB 1FUNA 3HZVB 4QTHA 3AB0C 5LBSL 2IXQA 1CVSC 1SOSA 5LCVL 4N8CH 4PLJC 2JIXB 4W70A 2DKUA 1RLWA 4XN9A 1MHHA 5FOBA 1SEBA 3MBWB 4XNYH 4UQ3A 4NM8L 3TIDB 4F58L 1YPZE 2E5EA 3M1BB 2W9LA 4ZFFA 1BZDA 2V7NB 3RWCA 4J6RH 2B08A 3OMAB 1VGKB 3HMWH 3VD9A 3SGDH 4JFEB 3BEVA 1GGCH 5T8IA 5JHMA 5B39A 3PWNA 3CFCL 4AIEA 1E43A 1NIAA 1OB1B 1DQDL 4X7CC 4JGMA 3W0WE 1XZ0A 3WS3B 1DDTA 4JE0A 4XI5D 2YKKA 4UOW0 1OAUL 4HXBH 5FYLD 1IARB 3RB7A 1OE3A 2ATAA 1HHGB 4CJ0A 3UP6A 1VGEL 1V55B 1XGPA 5IROC 4FA6A 4H7VA 2VM4A 3V6OC 3K6SA 1HKLL 4XPBL 3I50H 1ZK5A 2X4OA 1TEYA 4XXCA 1DCLA 3GZPA 3QO0B 3UJJL 4ZMXA 4N8VG 5IHWA 3LKOA 4LCCC 1W0VA 3BLBA 2MRYA 4MXQC 3LKPB 3NZHL 4PJHE 5MERA 3U2SB 3FCTB 2CZNA 1BMZA 1YEEH 1FO0B 2D3LA 4LSDA 3W81A 4APXA 3H6AA 4I9XA 3NCJL 3GUTB 1LO3H 3P9MB 4ZRGA 2G2NA 2EINB 4L1LA 5DJZA 1D9KB 1DQTA 3CLEH 3FT3B 4FQQA 4M61A 1L0QA 5CJXA 3Q3GB 2YJQA 3VFGH 3VQ1C 3ZBMA 1N4XH 5F89B 1DSYA 1SLWA 2CGZA 3R06A 4IOFC 2VSCA 5DYFA 1KCWA 5GISL 2IH1A 1Y1DA 3NCXA 2Y07H 3DWTA 1IV8A 5I1HL 1BM3H 1QMUA 4XP6L 3FQUB 2WP3O 2K0RA 2JKRM 5E08H 4L4VB 3QHZL 1AHWB 2MPVA 4R26L 5GZOA 4JQXC 2Y36H 2QQNH 2UY7A 2BP8A 4UM8B 4XMTA 1S7RA 4NHUB 4RFNB 3FUFA 3MBEA 3C5ZC 3HUJA 2D31A 4YSTA 3VD1A 4OQ1A 3FT1A 4MNGA 1MFMA 1M6OB 4EI5C 5FYLL 1S9YA 2H1XA 2NX5D 1Z1WA 1MCNA 4JG9A 2XX1A 4PJGA 1S3KL 2CLRB 3EJCA 2WO3B 3FB5B 3L3GB 5I66A 1VA9A 5T1DH 5C09D 3LZFH 1OL0A 1NFAA 3OZ9L 1TTGA 4M5SA 4Q97A 1CPUA 1ZT7B 3CCHA 1MFCH 3OKLB 1YUHA 5F7NC 3MRJB 4R90H 4B7LA 2NX5A 1G7JB 1T83C 2EDNA 3IMUA 4OZFA 2Q8AL 1WBZA 4KNSA 3GEFA 2V9TA 2DMCA 2D3NA 1ID2A 2VISB 1YNTB 1TNNA 2FJUB 2P44B 5C09A 3VGAC 3QEHA 5I76A 4MXWH 3TTSA 1P7BA 4YIQA 4NPKA 3AY2A 3OAUH 2MPAH 3HBGA 4B27A 4BE6A 4O2EA 1P4BL 2NT1A 2OL3B 4ZD3H 3QWOB 1JPGB 4EUPG 1T7VA 3DETC 4JQVA 5F0LB 4RFOH 4AKPA 4FOMA 2BH0A 4HWEL 4G83A 4KDTC 1KIUA 2E8YA 1E8WA 2QR0A 1C1EH 2DEWX 3HC3H 3CN4A 3O3AA 2YD7A 4KI5C 1JN6B 2O6FA 3D12B 2IGFL 4ADIA 4OFPA 4EDWL 5I30L 2ZCHL 3L5XH 1D6EA 4HA1A 2X2JA 4OZHA 2ENPA 5E6IA 4I89A 4AGMA 2V7HB 1VEPA 3FT4A 2IDUA 3MO1A 1MPAH 4ZW7A 4LSSH 3FU9A 4OUUA 4R4ND 3T8MA 1S7XB 5G2NA 4NDMB 1G7PB 4HJ0D 3CXDL 5A16B 3L1GA 2JJVA 5T5FH 5CGMA 1MFNA 4U6VH 1DVFC 4LLAA 4XC3L 1YEFL 3BSHA 2V9RA 1LO5B 1EJ6A 2VLKB 1UCBH 3QUKB 5CCKH 2GI0A 4NO2B 5TFSH 4JHBA 4MAUH 4QXGL 1IM3B 3AQXA 2UYLB 4KJYB 2WXIA 3DMMD 5DZPA 3C87A 5D7LE 3UJIH 3PGFH 2OXGB 3ROOB 4Z7WF 4AYFA 2YRZA 5I71B 2FNWA 2B4CC 1SVCP 2WD0A 1CFVL 2E75C 3AT0A 1DLHA 1HDMA 3N41B 3RHWK 4Z5RA 4HEPA 4M93C 4AY0A 3TA3B 3WFEL 2EZ0D 1YEDA 1G9HA 1NCBL 4WHTA 4IRSC 2IQ9H 1S7WA 3CFKA 3DMMA 5EU7C 3ME0A 5EG6C 4KQ4H 1S7UB 4WJ5B 1OAJA 4DVRH 1E3ZA 4FNUA 1DN2A 4KV5F 1P7QB 3WEXB 1HOCB 2YUZA 4HIHB 5CWSB 2PP8A 3CZFA 1DYZA 3GMOA 5L7XL 1JVOA 2JCWA 2B1HL 3CHQA 4IDLA 4AQOA 1A2YB 1QBMH 3MRKB 3INOA 1YEKH 1A6VL 1OGAB 1NTDA 1UM6H 4MS8C 1K5NA 4OIAA 4PJEF 4MHHI 4RQQB 4WHYG 3V0HA 4POYA 5IW6B 2K6WA 4JDVB 1P5UB 2EUWA 3SO3C 2YAMA 3U30C 1XFPA 1FL6B 2CJUL 5I1IL 4YE0A 3PFUA 4I4WA 1OM3H 2Y3NA 1B4RA 2B14A 3UZQA 3EO9H 4FXKC 3LN9A 2FWUA 4PRID 3ATDA 1JHLH 3EG9A 3P11L 2B39A 2BNQE 1IQDB 3BI9X 2WNWA 3FF8A 1JPTL 5DWUH 3I9IA 1P5VB 3K6NA 5KN5B