4QDGA

Crystal structure of a putative adhesin (bt2657) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution (psi community target, nakayama)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
300
structure length
300
Chain Sequence
DLAPCPHGVSLRFIYDYNMEYANAFAKKVDCLTLLVYDENGNYVDTRIVTGTELQDENYRMKLDLKQGNYHFVAYGGLACNKSSFLMKYTPGEGTGYTDLQVELDSECLTNPRRKNLHGLYWGELTLATADLYSEGTVEMMKNTNNIRVVLQQMNGEPVDDKKFEFEITDDNILFSYDNNLLENGMVTYTPWAQGQASAGFTDEGREVVVAYAELSTSRLMVRDWYSPKLTVRRKADGVEIINIPLINYLLMLKSDLYASMDSQEFLDRESEWSMIFFLSPNLEWIKTYIKINDWTVRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative adhesin
publication title Crystal structure of a putative adhesin (BT2657) from Bacteroides thetaiotaomicron VPI-5482 at 2.20 A resolution (PSI Community Target, Nakayama)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Cell adhesion
total genus 72
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08842 Mfa2 Fimbrillin-A associated anchor proteins Mfa1 and Mfa2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2090 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qdgA02
2.60.40.2100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qdgA01
3GF8A 4QDGA 3PAYA
chains in the Genus database with same CATH superfamily
4NO3B 3OB8A 5T1MB 5CZXC 1LK3L 2W94A 5D93B 3WAKA 4DP4X 4OJFH 4WK2B 3QUZB 4YHLL 4X5WB 4FL4B 4HF5L 2CJUH 3I9PA 4ERSH 2X7LB 1DQDH 4YO0A 2OJEB 4NN6B 1F11B 2EVIA 1PY4A 3DRQA 5IBLD 3HB3C 4NM8H 4CVZB 5E4EC 2CMRL 4PLNC 2C8NA 2UY6A 3LVEA 2P5ED 2Z4QB 4WK4B 5HHMD 1JGIA 3IAQA 2VMCA 3G3LA 3P0YH 2YSSB 3HLKA 3LNGA 4PG2A 3W37A 1U42A 3HHSA 3BSZH 2ODHA 2VABB 5C6WH 1HHGB 2FYVA 1YY9C 3DHJA 3OAZH 5T5FL 1V54B 4Z77A 2OXGA 1OAXL 2Z7ZA 4LRNL 4QF1A 4UQ3A 2DL9A 4ZUVB 2F7IA 3ZE0F 5HD8C 3U4KA 1CFTA 2DDQH 2PW1B 4LARH 2BOCB 3PAUA 5FGRA 3FFCD 1AQKL 1T66D 2ZSWA 3QC6X 3IMVA 2Y7QA 3IETA 1IM3A 2ZOOA 5DYOA 2E4TA 4Z78A 1CL7L 4XXCC 3C60C 3TFKD 1S7QA 2JKXA 2OTWB 4N2DA 1GZQA 2EIJB 5FA3B 4HPHA 1RURL 3KXFD 2VTFA 3FO0H 3QG7L 1RLBA 3RURA 1NCAL 4GQ9L 5GJSH 5MENE 4BE6A 4A2EA 1AJ7L 3QZLA 4Y2DA 3O0LA 3EJCA 2YFNA 4RIRA 4J3TA 4DGYH 2PR9A 1EUUA 3J8F7 2GTWB 3KGRA 1HJCA 3P4MB 3TWCH 3RWFA 1PNCA 1JGUH 3KM1A 1MH5B 2YR3A 4NC1C 3IXTB 4RAUB 1N67A 3ML9A 1RZKC 1LMIA 2EO9A 3GEFA 4BFBD 4N5ED 3RVWD 2IIJA 3FUDA 2OMYA 4PGBB 4U33A 3IKCB 3WEOA 2NOYA 3H3PH 4HUNB 2HKFL 5C0FB 1QR1B 4NBXB 5BZDA 4JZJA 2NY0C 3QQ9D 1NUDA 1YUHA 3QUHA 5DJYB 4LDOB 1XF5B 5CP7B 3SOBL 3T65A 1BP3B 1NKRA 1OGTA 4ETQA 1HKLH 1KIQB 1KCWA 3UTTA 1OAQH 1T7YA 1IBHA 2NUPA 1ADQA 1CDIA 4P9HL 1IAKA 2QHRH 2OTPA 1PYWA 2F0CA 4UILH 4BK8A 4QRRB 3RWEB 2DM2A 2GW5A 1A14H 4QRRE 1T3FA 1TU2B 4UB0L 2HUEA 1ZEAH 4FI7A 3TL5A 1P5UA 3ZXAC 4EUPA 4K7PY 1M9WA 3TO2A 1Z5HA 2G5BA 3ZQWA 5GGSA 2ZXAA 3MRKB 2VLME 1KCKA 2BSSA 4X9HA 3UROR 4P3CL 1UWEH 1KTJA 3JYCA 4MGXA 4X6CB 1L9TA 2X1PA 1AR2A 3K5RA 2AK4A 5KUKA 1GYWA 3AB0C 5BQ7A 1HWHB 4ZOAA 4QMEA 2M26A 2F08A 3ILPA 2APSA 1Z9SB 3CG8A 4P23A 1L0XA 1U91B 3QDJB 3PV6A 2JB6B 1NFDA 4LHQB 1FZJA 3D0LB 4GNKB 4I0CC 2EEFA 4OLEA 4F33B 1D9KA 4JO1H 4UT6A 4B9KC 3QG6B 1KJ2H 4JX0A 2ZWLT 2VLLB 1QP1A 3STZA 3Q1SH 1WFJA 3VQMA 3RBGA 3V7AG 1QUPA 2YPKB 1ZHKA 1H19A 1L9PA 2C5DC 3FT1A 1YRKA 1TNMA 2G9HB 3ZU8A 5JQ6H 2ICEA 3F7VB 4N8CH 2H2SD 4HISA 3RVVC 1N5AA 4Y4FC 5B1BB 3CSYA 2PWHA 1K5NA 2PWFA 3I75B 3IRZA 1N68A 2UYLB 3P11L 3H9HA 3L4VA 4NPKA 3TF7C 2R56L 3VRJB 1FLRL 1U8JB 3QB7C 3BLPX 3GSRB 4C83B 1OANA 2EH7H 5JHBA 3ARFC 2VJ8A 1T22B 3EOBA 1UKTA 3OAYH 5EG6C 4I48A 4UOZA 5KBLA 4GOSA 3L95B 1G0YR 1SNRA 3DVIA 4QRTB 3V4VB 1XCWA 3A47A 2VO8A 4YHOH 3IT8D 2H1PL 2OFQA 2IQ9L 3QQ4B 3RWJA 3DX6B 4FABL 3A67L 3SDAD 3T08A 3OKDA 4N0CC 2FSEA 4ZFOA 3L9EA 4ZRGA 1EEQA 2F53A 2ZT9C 3GMPB 3IGFA 1IC5L 4PJDA 2JFCA 3ZT6A 2VXQH 3IDMB 3GI9H 2FSDA 4H0IA 1ZHBA 3ETBF 4KX7A 5F7YC 2JF1A 3SDCB 5FO9A 4K7FB 3N6YA 5ELIA 3U48A 4WNQA 3MRBA 4I9XA 4M1CC 3TGXA 2QMJA 3MRGA 4N28A 4OUUA 3ZMNA 2X1QA 2I9TB 4JQIH 3TVMB 3SGKC 1VENA 4MA3B 2BP8A 5B4MD 5FO8B 2BVPB 1TCMA 3SYCA 4OGAC 1IO4C 2P26A 2ITDA 1Y0LA 4WEBH 4ILDA 2UZYB 1E4KA 5LGKA 4KVCH 3MUHL 3GS7A 2WAHA 2EYSB 4MQXC 1YEKH 3V4UL 1AAJA 2BVEA 3RB7A 4AGNA 2CO6A 1NJ9A 2HRHA 4IK7A 1U3HB 1DDHB 1GOGA 1DFBL 4F7TB 3VRLF 5I1CL 4YDKH 4XNZC 5FOBA 3QJVB 1I7TA 3BZ4B 3RA7H 2IANA 2R15A 4A6YH 2LAGB 5E5UB 2I25N 1IC7L 3CQPA 5IWLC 4FQ1L 2XT1B 4O58H 3V8OA 5AVTB 2X9XA 1U8MA 4D9QE 1UUNA 4J6RL 3DETC 3P1VA 3NFSL 1F6FB 2H7WA 3NN8A 3VGEA 3MRNB 4QRQB 1WFTA 4FNRA 4N0UA 4ZMAT 2VLJD 5J1TC 1RUKL 1ZA3B 4N2KA 1BDYA 2WMPB 5I6LA 3LIZL 1UYWL 2PYFA 4MAUL 4PTTB 5K1JA 2P5WD 3K2IA 3EJYC 5I6MA 1TEGA 1UCTA 1IAIH 2W65B 2Z8RA 5HHNB 5A6MA 2QGEA 4XRCB 5I15L 1U36A 2ZUSA 1SHMA 2MRYA 3MLUH 5EZPA 2MPVA 3QGVA 4M61B 5IVXF 3FXIC 2R2HA 2P1YA 5JDJA 4XNXH 3VQ1C 1X5GA 4ETYA 5LVEA 2FD6L 4B9ZA 3FUEA 4BD4A 1PZBA 2EILB 4F5CA 3DYOA 4TVSa 3FU0A 3KYNA 2IV8A 5KOVC 3QZWB 3FZUC 2VM4A 3ZYJA 2KC0A 4G6KL 4V2BA 4AE0A 3VG9C 4IIZA 2UZPA 3MODL 5FW8A 5CM1A 1AO7B 5HYIA 4BBWA 2AXHA 3RVUC 3QXTA 2DM4A 4M7JL 4E42B 2A83B 1AO7E 4FZ8L 1IARB 4FXKC 3OX8A 4XMKH 4ZMWA 3KPOB 5AW5B 5JNYB 1RZKH 5K59E 5D7JC 1FBIL 4ALAC 5EOCL 1NGZB 4QD2E 4ODWA 3FCGA 4KDVA 5DJZB 5F1OB 1I7RB 2I60L 4G6ML 3UAJA 2YPVH 4DZ8A 3ZSSA 3VWKA 4JRLA 4WY7L 5C0GB 1JGDB 1W80A 1AZNA 4LGRB 4PJXF 2BSED 1A3RL 4NRXA 4ZOEA 5C0CB 3O6FA 1FFRA 5E8OB 4HGWB 5C0CE 2F7OA 4PJBA 1NDMA 1S2EA 3WTXA 3TJPA 4G3YH 2WQWA 4MX7A 3ILDA 3OG6B 2CBPA 1KN2H 3BDYH 1JWUA 2RMNA 5I2IB 5ENWB 3L1OL 1NCCL 2G2NA 3H0TB 4Q8BA 4Y4HB 2EVGA 3ARQA 5DWPA 1YHPA 1FFOB 1DVQA 2BNUB 2F68X 1RZIB 1B3IA 1MHHB 1UEMA 4FLQA 3VTTA 1TVHA 2CK0L 4CGUB 4UU9A 3SY0B 4CDHA 3UPRB 2AEPL 4Y4KD 1OW0A 3EH2A 4AKOA 2IBGA 4FAAB 1YEJH 2PCPA 2ADJB 1JVLA 2H0JA 4GXFA 1FNEA 3AG3B 1MRCH 1U8HA 1II4E 2CJ3A 4JG0L 1AACA 4J3OF 5TFSL 3H55A 4ZD3L 3ATAA 3ULVC 2E27H 1IGYB 1IB5A 2R9HC 4PB0H 5C3IA 3WY3A 4ZO8A 2EXSA 4S2SB 3K2KA 2AJVH 2NNFA 1UACL 3WKMH 4KMQA 1QMUA 3LRHA 5E5MB 2WSKA 1H8SA 3IB4A 4UQAA 1Y18B 3QHTC 4WHTA 4I3GA 3GF8A 4G8AC 1VESA 2KZWA 2A1WH 1B0GA 2YD4A 4ATWA 1WC7B 2GSIA 3H2WA 5LN4A 5ACLA 1E2WA 2YPLD 5CJBA 1GCFA 3SJVA 3D87B 5CJQH 3GZQA 3VWJD 1N59A 3T1FA 1UXMA 2JQAA 2V3EA 1ZD6A 1ECZA 5HDQH 1LDPH 3D85A 5K9QI 1NFIB 3PS6A 2RTTA 3CLFL 1IJNA 2EC9U 4W93A 3EG9B 1TQSA 4QI3A 4YZWA 2OKMA 3L3KA 2MQ0A 1K2DA 1NIFA 3HG5A 4N2MA 1AH1A 4GKLA 4XP4H 5H94B 1UB6B 2IFFH 2FLMA 1UJTA 4L8BA 1M05B 5I71C 1O7DE 1PMYA 3OQRA 2V0AA 5HJGA 1INQA 5KVGL 3ZQXA 2WZAA 5FK9A 5L7XL 2XIDA 2CALA 4ZUTA 4YHIB 4OZFA 1BCIA 4AM0B 3RX7A 1KB3A 3SPHA 2P4AB 2ESVD 3FO9B 1Y6NR 3QCTH 4JNXA 3BD4A 3QZPA 3B7YA 3G08B 4M5YH 2EUWA 5A2CA 2IXQB 1I3RB 5ALCL 4AZ8B 4F7MB 1F41A 2FBOJ 4GT7A 4FNLL 3ZDYF 1ZVSA 5J6GA 4NO2B 1DO6A 3KWWB 4N9GB 2EDNA 4LCCA 2A0LD 4KKLC 1QFWI 12E8L 2X4NA 3GSQA 3MNWB 3TH4T 3IVKA 2EE3A 1USQA 2AGJL 1RULH 2GI7A 3SSGA 4EI6B 5I0ZA 2OMVA 2HT3C 1J8HA 1H9VA 4U2ZA 3RNQA 3SD2A 1Q9KB 4OLUL 4Z7QB 3AZUA 5DHDA 1U93A 3PP3K 4J3UA 2W9DH 4AITA 4CNIA 1RHHA 1KIPA 2QADC 4XNMA 5EWIL 5KJ4A 4EN3B 2XXMB 3WTTA 1GHFL 4FZEH 1E5ZA 2QVTA 1YMMD 1BJMA 5CD5C 1LO0H 1DVUA 3U1PA 4IIQA 1G7PB 2W9EH 2SEBA 3FBKA 2YWZA 2XCMC 1G7JA 1PBYA 4FXTA 5AEAA 3W3BA 5AKSA 3VXSB 2A73A 4KO9A 2NX5D 2DQMA 3WEMA 3VXSE 2CHDA 4XNQB 5JHLL 4RH4A 3GUTB 3CXFA 4WHYH 3CVDA 1NWPA 3BUDA 3HE7B 2CNZA 1KLGB 3PWNA 4M5SA 1EAQA 2Y36L 2VDQB 5E94A 5HI3C 4KJYA 4XCEA 2NCEA 3FO1A 5FFOA 1JAEA 4AL8L 5CAYB 2WKOA 2DQGL 2ZG2A 2ARJA 2XZZA 1G84A 1SYSB 4Q6IA 1K4DB 5L8LB 4CVXB 1MCCA 2M1KA 5D2NB 2O5YL 5DS8A 5D2NE 2Q1EA 3BAIA 1MDTA 5JW4M 5IF0B 5E00A 2QSVA 2GEQA 2ZWYA 4LOFA 3LXUX 1R46A 3OAUL 4O02B 4XVJL 4XXWA 4B53A 1MFUA 1X7TA 2X3CA 5JOEA 1YEFH 1CI5A 3TNNB 4P2AA 3T77B 2BERA 2XFXB 1W2KT 1YEGL 2EKSA 1NEZG 1D6VL 1K3IA 1J0ZA 2VUOA 4M4PA 4MZ3A 4X7TA 3ZRSA 5K9OB 3GPSA 4PGDA 3ARBD 1A6ZA 5KZCB 4ODUB 3G6JA 1I85A 4KZDL 2AVGA 3DIFB 3SZKC 3GMMB 2ZJSL 4F7EA 3VD3A 3C6SA 1BZ9A 1PGRB 3TCLB 4KKZA 3DJSA 2WAQA 3S96B 1EJOH 1H3VA 4UM8B 1DQQB 1DVTA 4HWEL 4W9IC 2OYMA 4HQQL 4JRXB 2GHWB 5HHVL 1UZGA 4JRXE 4ONHB 1VPOH 4MD5A 4OJFL 2CBOA 1JN6B 1FZKA 1F5WA 2CJUL 4ZMPA 2A9BA 2XYBA 2FBJL 3FS9A 2Q5BA 2XIBA 3NK3A 5DR5H 1KJVB 2DWDB 3REWA 4I77H 4HU2A 4XPGH 1YVLA 5GIRA 4NM8L 1I7ZB 3N91A 2BS9A 3D25A 4PWEA 3CZJA 1DLFH 1A25A 2G2RB 4GAGH 2I27N 1JWMB 4TL5A 5CHNB 1M2VA 4L4TB 3C6LB 3P0YL 4X8GA 3U4AA 3VGAB 4L4TE 2Q7YB 5JXAH 3MC0A 3WU1A 3FQRA 3FUKA 1V55B 5AOIA 2OX5A 3IPBA 1TXKA 3ULUF 1JXFA 3SZ6A 3I3BA 3BZEA 4U6TA 3KCPB 3ZN6A 4LKCA 2AAAA 5MP6L 3T0EA 4E0RB 3HR5B 4NWUL 2DDQL 1NZRA 3S97C 2X0VA 3RILA 2GPZA 2ZP9A 3OMNB 4GKNB 2IDFA 2ILLA 1CLCA 3BN9D 1KIUB 2PNDA 3QIBC 4X7SH 5K39A 4MYPA 2ZUXA 3MX0A 3V8CA 3WFBH 2R4RL 2XWBB 2NW3A 5EPMA 1OCRB 2KHAA 4ADGA 1GC1C 1KENH 5KBNC 1FN4A 4DQOL 3VXPA 1CBVH 3NT0A 3AS2A 1SFDA 3HI1A 1RZ8B 5DVNA 2YZ1A 4JZNB 4UQDA 1HI6B 5AYTA 1AGDB 1S5HB 1DZ0A 3NBNA 3QA3B 3FO0L 3QIWC 1J5DA 5HHQB 4XE0A 4FN0A 4PR5B 3ZKMC 2O4EA 3FTUA 4GG6E 2NPLX 3FSVA 5F9AC 1OTSC 3C5JB 3QJFA 3LH8A 3GSNB 2BP0B 2EDDA 3WD5H 1XGPA 5EO9A 2BW5A 3IMUA 1KBGL 2MTAA 1W16A 1JGUL 1UZ6F 2ZKXA 3PU7A 4QRUB 3BAJA 1BQRA 4AYMC 4ZS7L 4R3SA 4ZFQA 3VXRD 3R4DA 2WQXA 3UJIH 5KVFE 3LMJH 1N0XH 1T21B 5CBAB 5DD0H 3I6GA 4Z7UB 3TIEA 3B9KC 5C97A 3WNNA 3TO4B 1XIWD 1FJ1A 4Z7UE 3NP3A 4P5MB 5JHDB 5GRXG 4OKDA 4IOFC 5C0AD 1JBJA 1JDDA 1X5YA 5JHDE 3MRFA 2VAAA 3H2PA 3SDXA 2WLKA 3L3GA 1IKOP 3HPJB 3O3BB 1G9HA 3QNYA 5FUOH 5L4FA 3VGGA 5LDUA 1LEGB 1FH5H 2Y2YA 1N7ML 3KVDD 5L6YH 3TBSB 2A9CA 3M88A 4LHUA 4GRLD 4X9YA 4Y5VB 2QHRL 4UILL 4PJ9D 1E6JL 3V4LA 4K7PX 3SYPA 1SLVA 5EEUA 1A14L 2WQVA 3UEQA 4FFVD 1ZEAL 5GS1B 2QVIA 3G9VA 4E5XG 4J4PA 3OJ2C 1NIDA 1KT2A 3QDMA 1S9WB 2EIBA 3CSGA 4CU8A 2KLTA 2MEJB 1IVTA 1UOLA 1PTZA 2AJYH 2VXSH 3MRPB 1H8LA 4ZO7A 2ROYA 5JORB 4NQCD 3ZMEA 4NZFA 1KPRA 4ELKB 3AMLA 4NC2B 3ZYZA 4LLVA 5GS0C 5J1SC 1KGCD 3CQQA 5AOZA 2OSXA 1MHPH 4NHUB 5DJ0A 1FVEA 2WBJB 3PQYA 3UBXB 1MREH 2Y72A 1Q94B 5CCHE 4GSQA 1DE4A 2CR0A 4TUKH 1DBJH 1KJ2L 1T7XA 2BHYA 4EQ3A 2DMHA 1JV2A 3DOSB 2VB5A 3S8FB 1X9RA 4UQ9A 3Q1SL 5JYMA 3U0PA 2FR4A 4MMYA 2JE8A 4G8FA 1I8MA 4KKAD 3HZYA 3JWOH 3ARDA 5ACZB 5F9OH 3VFRB 5JQ6L 3MV7A 1CDJA 5BZZA 2B8OT 2EYTA 4N8CL 4UDTB 1B2WL 2AQ2A 3NG5A 1FGVH 4AYDC 2MKLC 4PG2C 3FT3B 4N2AA 2B16A 1G7QA 4W9LC 4JM2A 2YD2A 4NQVB 4PD4J 3RGVD 5E8DH 1IE5A 1AD9A 5FKAB 4R4NC 2YEZA 1FA4A 1TZHB 1J9RA 4NO3A 5T1MA 1PSKL 5AZ2L 1W72B 1N3NB 2EH7L 4DP2X 2BOBB 4EO5A 5IFJB 3QUZA 4Q14A 2RCSH 3EYFB 1VZHA 2J88H 4FQCH 4R96B 4X5WA 4V11A 1DBMH 4FFTA 4PMEA 2KBGA 2X7LA 4OD2B 2OJEA 3BC9A 3LNDA 4HULB 4TNVF 1OP5H 1F11A 1UFUA 2CCLA 3T3PF 2NY6C 2OSLB 1PJWA 1ZK5A 3B3BA 1TVDA 4CVZA 1T1WB 1TYRA 3LQZB 3QEQD 3VFWB 1EIBA 5MI0B 1INDH 2VXQL 5CGBA 3GI9L 2Z4QA 3VFOB 2YOCA 3P3YA 3PWJA 4N4YB 1JPGA 1T0PB 3MZGB 3HUJF 3QEUB 4KKNA 2YSSA 1NL0H 1RMFH 3DX9B 4P2YA 3RWGA 5GGVY 3UOAB 4JQIL 4NQDD 2VABA 2P5EE 1FC2D 3P40A 1UCBH 1ZGLP 1HHGA 4U3CA 4TUOB 4U7SA 5DU7A 3CHSA 5I30L 2IBZY 2CO3A 3M17B 4WU7B 4ZUVA 4XP9H 2YUXA 4NLHA 3GLEA 1BZDA 4KVCL 4FQ2H 2PW1A 5D71H 4XHJD 2BOCA 3O3EB 2XACC 3Q01A 3CFKB 3FQNB 2VSCA 4G5AA 3K6OA 4JFUA 5AB2A 4JZJC 2J71A 2TSAA 3FFCB 3TBYB 1HWGB 3K72B 4YDLC 2DOCA 2OTWA 3ZDXF 3FFCE 5FA3A 4YDKL 4WNJA 4YHYB 4LE8A 4FQIH 4DPCX 5IM7B 5MENA 4JCWA 5DGRA 3RA7L 1A6PA 3CK0H 4AJWA 4TNFA 4JY5L 4A6YL 1ZDSA 3CHRA 4OFDA 2DYSB 2EDFA 1LDSA 4PS7A 1LXMA 3KXFB 4O58L 1ZJAA 3CHOA 3SYQA 2QQKH 1AKJD 2LLNA 3RB5A 2GTWA 3KXFE 1UXSB 3MOBH 1AGEB 3P4MA 5C07D 1IMHC 3EJQA 3MLPA 3BDBA 1MH5A 2F19H 4E36A 5CEZL 1P5UC 5D6DC 5BPPA 2DQUH 3IXTA 4RAUA 1UHVA 4FC3E 1F3RB 1OK0A 4RETB 3T6QC 5F7FA 1TTBA 4O2CB 5LAXA 2YK1L 3WSQL 5IMLA 1RK1B 4PGBA 1IAMA 3C8KB 4XB7A 4F37F 3ZKXB 5C0FA 1QR1A 3KYKH 1Z32X 1HXMB 1IAIL 2EXTA 2L7UA 4MDIB 5D70H 2Z8WC 1Q1JL 5DJYA 2IMMA 1XF5A 5CP7A 4LEEA 3KPMB 2CH8A 2Y69B 4P23C 4Z0BH 2QDVA 4W9FC 1KIQA 5DHEA 3PL6D 1NAML 2KS0A 1GC1H 1QSVA 4IU2B 4XB3A 1YEDB 4J39A 3ABGA 5G4NA 2HPOA 2NR6C 4XNXL 4L8SA 3IEAA 5CSZB 3KPRB 4Y9FA 3UC0H 3BHBB 4QRRA 3ASWA 3RWEA 3BFOA 3W9DB 5D1ZD 3UG5A 4U1GC 1TU2A 5C86A 2BHUA 3NIFF 1CU4L 2HT2C 3BEVB 2ICEC 4IGBD 3DV6B 3MRKA 3EYUH 1AZRA 3MBXH 2EIMB 4N2LA 4MMXA 2XUWA 3WUWG 2WLYA 3Q06A 3M1CA 3VJ6B 5TF0A 1OE1A 3MLSH 3FTVA 1E7VA 1RZKL 4HSAC 3O2VL 3RKPA 5F7BA 1EBAA 5H37G 2J5WA 2CU9A 1F13A 1Z9SA 3VXUD 1U91A 1XCXA 1ZSDB 5PCYA 2JB6A 4RMUA 1EMTH 3D0LA 1GR7A 1MFBH 2AMUA 1UM5H 3QQXA 1J9SA 3BN3B 3KYMB 4R9HA 3QG6A 4J8QA 5DEFB 4Z1PA 4G3YL 5F7MC 1A21A 3WNLA 2MSPA 2VLLA 4I88A 1KN2L 2MIZA 2NQCA 2BSCA 1E5UI 1WA1X 1GW0A 2V2WB 5CIPB 3CQFA 3BUIA 4OLYH 4AKQA 3F7VA 5D4QA 4XH2B 5EFIB 3O3AA 4RDQG 3I75A 4PGEB 4AQ1B 3EAKA 2UYLA 3NZSA 4BGLA 4G1EB 2F54B 3NSCA 3VRJA 1YY9D 1U8JA 2X9YA 2F54E 1TTAA 4Z7AA 3GSRA 4LU5H 4C83A 2Q7NA 1O0VA 1E4KC 5C0RH 1PQZB 4HVBA 1G87A 1T22A 4UT9A 3STLA 3L95A 4QRTA 4XP1H 4YSUA 3IPFA 3JTBA 3L5HA 2FHBA 4YH6A 5DHVB 3QQ4A 4OF5A 3DX6A 2KPWA 2E27L 1C5CL 4QT5B 2ZXQA 4KQ3L 2YO3A 1QZNA 2X4PA 2EJ1A 3GMPA 3HTLX 4QHMB 3U79A 4HOXA 1A7RL 3F7QA 4JFVA 2AJVL 4KY1H 1GYUA 3P4OB 3WKML 4KK5D 2JI1A 3HG3A 3SDCA 4K7FA 2FB4H 4YHPB 5TGBB 5HJBA 4BCZA 1CLVA 1AG6A 3GSXA 3L6FB 1A1MB 3U30C 2XZQH 2B3RA 3DOIA 3DURB 2I9TA 4AGOA 5D6CB 3TVMA 4QXUL 4YDVB 4MA3A 2V5YA 5FO8A 2BVPA 3QRLA 1VFOA 4OTXH 3WUZA 3MUUA 5CJQL 2UZYA 5JOPE 5HDQL 2EYSA 3WTWA 3KVPA 1LDPL 2WY3B 4X9GA 2IAAC 3F04A 3FKUS 4X6BB 2LU3A 1DDHA 4A2DA 3NJHA 4F7TA 4R4BB 1DBBH 4L29B 4ES9A 3QZOA 4M7ZC 4BFJA 3F64A 3GRBA 3DPDA 2UX7A 3BZ4A 4JGUA 4LSQH 4WSKA 4OIBA 4XVTH 3GQFA 3WHE1 3IF1B 1ZHLB 3QCTL 4TPRH 2AEOA 1B9ZA 2PXYB 2AQPA 3JWNH 2PWGA 4GRWB 4H88H 4M5YL 3RRQA 2WLLB 3EZJB 1OPGH 4H8UA 4P46B 4GRWE 4L5FH 4CJ1A 2CHWA 2P42B 4LPCA 4JO5A 3MRNA 1AZBA 4QRQA 4LSUH 2RJMA 2Y22A 1L0QA 1ZA3A 4QPEA 1ZLVK 3L4TA 4YHZH 2WMPA 2WVTA 3IMSA 1GW6A 1WWAX 4U05A 4PTTA 1MNNA 1RULL 3E1ZA 1WSST 3LPPA 5I0DA 1SGKA 2VLJB 1RPUA 1KTCA 3QH3A 4G9DB 4MNGB 2W65A 2VLJE 3ISRA 3UAJC 4KFMA 1M3JA 4MNGE 1TJXA 3A4FA 4XRCA 5E6ID 3RZCD 3VWKC 4PJ7F 4R97B 4FZEL 4M61A 1IEAB 3O6FC 5C0ND 1ZVNA 4PAZA 4Z7WF 3LQAC 5KS9F 4NKIH 4XOCA 4LOVA 2FLRT 5L4JA 2NY1C 3WJLA 3B43A 2F18A 3QZWA 2DL2A 1PL3A 3SBPA 2VWEC 4HJUA 3JUYA 1EVUA 4V1DD 5F7EL 1AO7A 1WFMA 4XN7A 3R18A 4A2GA 4OQ1A 4E42A 3TBVB 1UZ6E 1Q90A 1FVCB 3KPOA 5JNYA 2WIMA 1JZGA 1SJXA 1NBYB 3ILEA 1QHOA 1OW0C 1V5JA 4KPHH 1S4IA 4M8QB 2PP7A 1MXDA 1NGZA 3UTQB 2H32B 1I7RA 3FOLB 1WAPA 3FQWB 4RAVB 1F3JB 5F2FA 7PCYA 2K9UA 3GI8H 5CJ8A 3ARFD 4AX3A 5EIIB 2X3BA 5DVKA 5C0GA 4Q89A 1JGDA 5J13C 4QNPF 2JLPA 1F6AB 5C0CA 1SEBB 2JV6A 3G5ZB 4H20L 4Q4EA 3D51A 5E8OA 1MFDL 4HGWA 4B9CA 1X9LA 4X0NA 3A24A 1TKWB 1YQVL 5F7UA 4UCFA 4HZLB 4Y5YB 3VAEA 4QUOA 1EBPA 3U2JA 5I2IA 1ET5A 5ENWA 3O9WA 3H0TA 2NDFA 3V0DA 4Y4HA 4ZI8A 3T9WA 2C1PB 2XA8H 4L3ED 5AW4B 2W88A 1PNDA 1KXVA 1FFOA 2BNUA 4TRPL 1J0KA 3BRFA 1YO4A 4LIQE 1UENA 1RZIA 2GJRA 1MHHA 2VDMB 2IH1B 1H6TA 2RR3A 5DVPA 1KULA 1RSFA 3SY0A 1ZV5A 3UPRA 4ISVA 2YAOA 5L4MA 2HN7B 4E9LA 2FE0A 2BLFA 2ADJA 4N85A 4AYID 4LP8A 1EJOL 1LNUB 3NTCH 3MJ9A 4U1SB 4I85A 4B0MB 1QBLH 2Y1YA 1FDLH 4GAJH 1IGYA 4DGWC 3VU2A 1VPOL 2LAAA 4XVSH 1TFHA 3TOPA 3K8LA 1ZHNB 4OLWH 4TXVB 4FJZA 3SDYH 3ZRCC 5B3JE 4S2SA 5HGBB 3TJEL 1OY3B 2GEEA 4DP5X 1NIAA 2OLDA 1R19A 2IH3B 1EFQA 5DR5L 5GGTA 5E5MA 1WUNT 43CAB 4I77L 4XPGL 2OMWB 3E1F1 3JZ7A 5I9QC 1NCBL 4P2OD 2K7PA 1Y18A 1VFUA 3FBQA 3S35H 5FA4B 3GLDA 4XR8C 2X4OB 3UZEA 3VB9A 1JXKA 1KEML 4DTGH 1RJZB 3R1GH 1WC7A 3ZZQA 3GM0A 2Q9OA 2VERN 4CKQA 4JMNA 3AUWB 1M56B 4PPTA 5AFAA 4LCCC 3GDBA 2YPLB 3QIUD 3UTSE 1ZV2A 1NFIA 1O7VA 2YPLE 3VWJB 4IBUA 5SX5H 3OZLA 3EG9A 4UYPA 3TJHD 1O5PA 3BAEH 3EJYD 3QDHA 1AHWB 1SBBA 4PRIB 1VEMA 5IP4A 1WRFA 5H94A 1UB6A 1GKOA 4R8WH 3T3PB 1M05A 3G5VB 5GZNC 3IDUA 4MS8C 4QRSB 3V0VB 4ZTEA 3T3PE 1R75A 1BOYA 1CICB 1KENL 4YHIA 4AM0A 4OJAA 4B9YA 1T5WB 3FO9A 1BF8A 4IIQC 1M1SA 4KTYA 3G08A 2IXQA 3BVNB 4AZ8A 4F7MA 2V9UA 4LSSH 1S78C 3UX9B 1FE8H 4JVPA 4NO2A 4XP5L 3KWWA 4N9GA 4NERA 2L3BA 4NQXB 3HVDA 3T2LA 4CUCA 1ET8A 1VFMA 4M56A 2I85A 4QR7A 1ACXA 2VSKB 3SKMB 4EI6A 3IE4A 3K6DA 1F56A 4G6FB 1Q9KA 4XO9A 3UJIL 5A2BA 1N0XL 1UJ3B 1X5AA 4H26B 4L1HA 5DD0L 1KGJA 5FPIA 5B8CB 1XWVA 4Q6IC 2LLLA 3EH4B 4EN3A 4OCMC 3JV0A 4ONGH 1XTMA 3ZDXB 3T8MA 4MJ5B 4OF8A 2Q20A 4WAFA 3ZDXE 1MCPH 1IU1A 1J8RA 5TDPB 3RL1B 5FUOL 4E9XA 1FH5L 1YMMB 3BWUF 5L6YL 1YMME 5AYQA 4XXWC 3VXSA 1JFHA 2JKNA 4GKSB 2AEQH 4WQOA 2FJUB 5GGUB 4BFGA 4XNQA 5BS0D 2NY3C 2WHVA 3F7YA 3GUTA 4JGNA 3BI9X 1SBSH 3HE7A 1KLGA 2CUMA 2NX5B 3RWCA 2P80A 4POZC 4CMHB 2NX5E 3FQ4A 5F9WB 2C3HA 4QOKD 1RP8A 3LPWA 3CDZB 1AZZC 1ICTA 1J1PH 2VXSL 1SYSA 2AJYL 1HOEA 1JHTA 1A6UH 1K4DA 4HC1A 4JO8A 3F58L 4LOEA 4CVXA 5D2NA 4UQIM 3VH8G 2W5PA 2E86A 3SDDD 4CKVX 1PW3A 2F5BL 4FYTA 2B1AH 5IF0A 1AHKA 3VTAA 4XN4A 2FT8A 1MREL 3B5GA 4O02A 4A55A 3LQMA 3T0BA 4C54A 1KSRA 1DBJL 1TQUA 3GFUA 3TNNA 3T77A 3W5MA 4UTBA 2XFXA 3BVXA 5D2LB 1NEZB 1TJIH 4N5UA 5KJ7E 4BSWB 2JSFA 3JWOL 4NKQB 2VZOA 5K9OA 1RL1A 2ZUQB 5D2LE 1ZSHA 1UZ8B 4M02A 4ODUA 2WXHA 3DIFA 3BP7B 3FH8A 3GMMA 1G4MA 1FGVL 1Z0MA 2Y7LA 3K2UH 4YSQA 1J8KA 1VGEL 3TCLA 1NIEA 4NQED 3ARBB 4P5KB 4K3DH 4XAWH 5E8DL 3S96A 3NDYE 5HDRA 4UM8A 1ETB1 3X3FH 1DQQA 1FFNB 4JRXA 4XAKD 2JELH 1KYUA 2DLEA 4ONHA 3T0EC 4YOKA 3IDIA 4FYSA 5ADOH 4WI8A 1JN6A 2RCSL 2J88L 4FQCL 1DBML 3ASOB 3CX5J 1JNLH 3MBEA 1KJVA 2DWDA 4IJ3C 4YXLL 4A66A 5FCSH 4DIXA 1I7ZA 3FRPB 5LBVA 4QKXB 5JZ7D 2FO8A 4JO4L 2WXIA 1C8PA 1INDL 2G2RA 4ODTH 1CXFA 2A6IB 1JWMA 2NQDA 5CHNA 1J86A 2FL5B 4L4TA 3SPJA 3RL2B 3WO4C 3C6LA 1KLFA 2NYYD 2Q7YA 2H5UA 1NL0L 1RMFL 4OLVH 1B4JH 1VACB 2IBZX 4AJYV 4GAAA 3AUVA 4HG4J 5AG9A 2WJ5A 4JK0D 3CJJA 2J44A 2J1YA 2WXOA 3CHQA 3CN4A 1LWJA 4HD5A 2EE0A 5FGBA 3O6LL 3II2A 1CGVA 1JP5A 3KCPA 5E23A 4FQ2L 5FAAA 4E0RA 3HR5A 2Y1VA 5DD5H 3B56A 3OJMB 4GKNA 1JGEB 3ELQA 4JB9H 4XMLH 1MCQA 1WZMA 2IAMD 2WGXA 4OIAA 4JGMA 1KIUA 2D0FA 2Q86B 5E9DB 5DF0A 2XWBA 5E9DE 1WLHA 3KPTA 1UXWB 1RZ8A 3LDBB 4HALA 4JZNA 3GBEA 1HI6A 1EEYB 4WCYL 1AGDA 1S5HA 4FQIL 5CLXA 1VFBB 1E3XA 3WFHB 5AOJA 4GG6A 3CAFA 1OXYA 4S0TD 4YR6B 5HHQA 3H7BB 2B14A 4NCDA 4PR5A 1DJHA 4ZMQA 5E08L 2LTQB 3C5JA 3ZHKA 2GK2A 3GSNA 2BP0A 1V05A 2QQKL 4KQ4H 2QZ5A 4QRPD 3MOBL 3VMNA 4L48A 1RIVH 3NFPB 5J11B 4QRUA 5F0PB 3QUXD 2F19L 1UB5A 2DI8A 4RGNB 4BE5A 4J4PC 3FQTB 4KVNH 3ZKNC 2DH2A 4RGNE 2IJ0C 4UNIA 1T21A 3EH3B 4ZZFA 4Z7UA 4J3BA 4LESA 4K0OA 2PABA 4GXVH 3VXRB 4OZIF 3FPYA 2H3NB 3VXRE 5JHDA 3IRCA 3NJLA 3KYKL 4HEPG 1IC4H 3APMA 2X89A 3GRGA 1CR9L 1LEIB 2LV4A 3DX2A 1XIWB 1KV7A 1YDPA 5AOKA 3HPJA 1CDCA 4XC1H 4Z0BL 1G9NC 3O3BA 2APVA 1YNTF 5GQBA 1LEGA 1GC1L 5IJDC 5JHMA 3IFNH 2Z7UA 4H8PA 3TBSA 2CCWA 2ZCHL 4JFEB 4Y5VA 1QPXA 3UC0L 4FFYA 2DQCH 2VH5H 4WUKH 3CWGA 3ZY7A 4JPIB 5D4HA 5GS1A 1TZOA 3ARDC 3MA9H 3JZYA 4G7QB 2VDLH 2QSQA 1NCWH 3EYUL 5HGDB 5SWZB 3MBXL 1UWXH 4HOMA 1S9WA 2APWA 3DOHA 3MQIA 3VXQB 3HBPA 1S7RB 5SWZE 2D03H 2DKMA 2L8AA 5KSUB 1CZ8H 2ZX8A 2VZVA 3MRPA 4JM2C 3RHWF 4PVMA 5JORA 1QYGL 2WUBH 4ELKA 1LILA 4WTXA 3Q43A 3WNPA 2CXGA 3KJ6H 5D93C 4J12A 4GBXD 4NZUH 1YEHH 5IMMB 4NM4L 4P05A 1MFBL 4NHUA 1RZJH 2WBJA 3UBXA 4FHKA 4NN6C 1Q94A 4MJ2A 5FHAH 4Z7WB 2HTKD 5KS9B 1KWGA 3QFJD 3DOSA 4Z7WE 3BKJL 2DEXX 5KS9E 2Q0ZX 4TUJA 1BVKB 3CU7A 4YN3A 1XSOA 3EYQC 3DV4B 4H0LC 2NZ1A 3QCUH 4APXB 3VFRA 1OAJA 3C08H 5AVXB 4PJ5B 4PP1D 1XB3A 1L6XA 2OULB 4PJ5E 4PHZA 1KIRB 4ENEC 3FT3A 3HCVB 1G6VK 4G6JH 5INDB 4F7CB 1QNZH 1DQLL 1PVHA 3EO9L 1VIWA 3HBGA 3PP3H 5FKAA 5FM5M 3QJSB 1CLZL 1SF3A 1TZHA 4NSKB 4LU5L 1W72A 1N3NA 5C0RL 3M1BB 4WW1B 3RGVB 2C26A 4ZMXA 3BKMH 3BRDA 2BOBA 1A4JB 4NLAA 2E3VA 2N01B 3F2LA 3EYFA 4I4WB 1XH2A 2B9AA 4R96A 5EC1A 4XP1L 4OD2A 4E9YA 4HGMA 4XZUB 1GGBH 2ZYIA 1EHXA 1XF4B 1MF2H 2VIRB 3QUMH 1N6UA 3QUGA 1TZ8A 3BP6B 3FQ2A 1IZKA 1T1WA 3LQZA 3VFWA 4GW4B 3NVQA 3VFOA 4E9VA 4LSTL 1X5FA 5I1LB 2FB4L 3PNWB 5MEOB 3QEUA 5BNXD 3QEQB 3QIWD 5LBSH 2GTZB 2P49B 3Q9QA 3DX9A 2P5EA 1DDTA 2XZQL 3MCLH 3QEQE 2DQ6A 1L7TH 3ARTA 2XN9D 3SPGA 1VF5C 3IMRA 3UZVB 4TUOA 2Y0SA 4IMKA 4U1HB 1UGKA 1RV6X 4C56D 3M17A 2G3MA 4WU7A 3RFZB 3B2UC 1I31A 3D3VD 5E2UH 1DVFC 1EJFA 1JRHI 1JJUA 3SE6A 4AZUA 4NQDE 1EXHA 3D8MA 2X1OA 3O3EA 1NDTA 4DPBX 3RX9A 2JI3A 4K23L 1GXEA 2UUDK 4K55A 3CFKA 3X13B 3FQNA 4PJAB 3H8NA 3V52H 2ZCKH 3FFCA 3TBYA 5JA9A 4PJAE 3K72A 3CFCH 1E9PB 4X50A 4K8RC 3L3JB 5IM7A 3IU4H 4LSQL 1L6ZA 1OAKH 4MAZA 1U6AH 2YRLA 2ZKWA 5GPRA 2HAZA 5FWQA 4B95C 4L8SC 3KXFA 4PUBH 4YDZA 2XI9A 1UXSA 1AGEA 1PDKB 4H88L 1A5FH 1BZ7B 1OPGL 4L05A 4L5FL 3P2TA 1ET7A 3FU3A 1IBYA 1AKJB 3CDFA 1XGZA 5C07B 5AW2B 4LSUL 4MMXC 4A2HA 1SY6H 3R0MA 5C07E 4YHZL 1UA7A 1RK1A 1B90A 2N1TE 3C8KA 1ZPLA 2WZ6A 3ESUF 4YC2C 1HXMA 4MDIA 1QHPA 3MPCA 3SO5A 3ARED 5F0LB 4CBZA 1KN4H 3KPMA 4ZW6A 1QPPA 3UFIA 1REIA 1CXKA 2BVQB 5C0EB 4IU2A 4PW4A 1YEDA 4H1LH 3D33A 3LKNB 1H3PH 2YUZA 3E9TA 3QPXH 5CSZA 3RI5K 3PL6B 3BHBA 3WJJA 4PWIA 3W9DA 4DVBB 2FCBA 1UH3A 1WIOA 1JMXA 1I8KB 4I1PA 4J8RA 4GXUM 4KKCD 3BEVA 5JW4Q 3ZL1A 3DV6A 1RFDL 2DD8L 1G1KA 4IQHA 4QLRA 5D1ZB 4RBPH 3WUWB 5H2BB 3VJ6A 4IKKA 2FRGP 1IT9L 3MGOB 3NYKA 1BOGB 5FHBH 1WTGT 1PZUB 3NH7L 3VM7A 1M6OB 3HRZB 4A7GF 2O6CA 3GI8L 1QFWH 3OGCB 1KGWA 2OR7A 1PEZA 2B08A 4D0CB 4M6AA 2GABA 5CJOH 3KYMA 3P0GB 3VXUB 2IPTL 1WITA 1Q4NX 5DEFA 1BFVH 4WSJA 5F1IB 3VXUE 3IGLA 1L9OA 4KXAA 4EZKA 4N0FB 4URTB 2JJSA 4GUPB 4JBSA 5I8CB 4N2NA 6TAAA 1XGQB 2E6PA 2V2WA 3O2WH 2XA8L 3SDCC 5CIPA 4DK5A 4KDWA 4OD3H 3IDXH 4KHXH 2IPUK 4XH2A 5EFIA 4A6YB 4FTDA 5F7HA 3A6CH 1H15B 4PGEA 1J9QA 4Y2DD 1D5IH 3BQUB 3TVMC 4AQ1A 4N2OA 3VNZA 5T1LD 4G1EA 2F54A 3WL9A 5CFHA 5HVHB 4QLWA 1QO3B 4NQUA 5L0QB 2P5PA 1GTNA 5ID0B 5JW4N 2IGTA 1PQZA 3MREB 2ZXWB 2OZ4A 4DQAA 3FCSB 1CK0L 3N06B 3R19A 5D7SH 1S7UB 1CO1A 1UT1A 5DHVA 2W91A 1QBLL 4PJ8B 1FDLL 4GAJL 2OV0A 1UVQB 4QT5A 4JRWA 4XVSL 3SDYL 3CNKA 4J5VA 1PFOA 1HAWA 5TQ0H 3P4OA 5J3HC 5E6SB 3M7FB 4O2FB 5TGBA 3KWTA 1HINL 1PKQB 1BEXA 4KTEH 1BYPA 1RJYB 5AZ2H 1A1MA 3S35L 1PKQE 3S34H 1CJYA 1ZGLA 3DURA 3HC4L 1X7QB 4P2RD 2FBRA 5D6CA 4I7ZC 2VDRB 3IJEB 4YDVA 4DTGL 4F1SA 3D5OF 3R1GL 4CMMB 1T83A 2ZONA 4P49A 4LPXA 3C5XA 1J8SA 4LKXB 5C9KA 2JKJA 3LZQA 4BGDA 4HPOH 5IOPB 2TRHA 2IWFA 3POCA 4BKLB 2X70A 3LYRA 4GAYB 5B38B 2C3VB 3ZO9A 1LHZA 4KI1A 5GRJH 4X6BA 1OP4A 3JVFC 4P99A 3BAEL 3JWDC 5JIHA 5I8KH 2BCKB 3RDJA 4R4BA 4AWJC 3H9YA 4M5TA 4L29A 5DEZA 5DTFB 1JG9A 3LX9A 5EC2B 2NXYD 4P23D 1RSYA 1WEJL 3TNMB 1A3LH 4C57C 1D9KD 1DBAH 4DKAA 2C9XA 2VRQA 3IF1A 3LSOB 4ZYKB 1ZHLA 3BISA 2XN2A 3RY5A 2Q3XA 3WEXA 4BQ6A 5JTWA 3MA7B 2PXYA 2X12A 2Y23A 2WLLA 1B9KA 3WJLC 4AIEA 4JZOB 4P46A 4LSSL 5J06A 1T1YB 2QBWA 4YBLC 3CXDH 3PXJA 1JWSB 2OJ1A 5IG7B 5TPWH 2HT2D 1OQXA 3EGSB 4UM9D 2HG0A 4HEME 2J43A 3V0WH 3MLTB 5B3NA 2ED8A 2F58H 4U3SB 3QJHB 5LXVA 4K3EH 5AYUH 5F6HJ 1J11A 2VLJA 3N42F 4M7LT 2GUYA 2WIIB 4MNGA 4H25B 1XEUA 4Z3JA 2ZXGA 3IJHB 1J87A 5ID1A 1ODAA 1M2OA 2BHZA 4X6FB 2DLHA 3LZFH 2CGRH 2F8XC 1IEAA 1QLEL 1IGML 2C9PA 1AGBB 4IRZA 3WIIH 2FEDC 4K8RH 5E6IB 3RZCB 4L3FA 1MCPL 4G43B 5DO8A 2F1EA 5I1JH 1AANA 1A6WL 2VDKH 3X14B 4YNYB 1JHLL 3CZFB 3O9WC 5KAQF 3ARGC 4YL4A 4Y4HC 5DVLA 2R23B 1MFEH 2YAFA 1T1XB 2BDNH 2IFGA 1IEBB 1KXVC 1NCIA 1I8UA 1EZUA 2AEQL 1A7OL 2EQDA 3OKKB 2BY1A 3ZOAA 1Q0EA 4XN9A 1AG0A 3TBVA 2DJ4A 2O6DA 2JQZA 1FVCA 4PWHA 4WTQA 3DX1A 3FL7A 3B1UA 1NBYA 3EBIA 4V1DB 4M8QA 2AK1H 1SHXA 1ZV9A 1CXLA 4KBPA 1N19A 4V1DE 2ATAA 1Z9LA 3UTQA 1U8OB 2H32A 4I1NB 5I18L 3FOLA 5E95B 4OZIB 3FQWA 3LNFA 3Q8AA 1F3JA 4RAVA 3H6AA 4OZIE 1PLGH 1A6UL 1YSOA 3CFDB 5JO5B 3D2TA 5CEYA 5EIIA 4ZMYA 3RIKA 1HCFX 1V7NH 3GZPA 1SEBA 3G5ZA 4YMPA 3LZRA 2CRIA 3ISWA 5DFVC 4J27A 1TKWA 1EEUA 1T7ZA 1YNTB 4HZLA 4Y5YA 3US9A 2BSEA 3N1MC 4F15B 3BE1L 4L8DB 5L8JB 3GMRB 3OQ3B 2ZKMX 4HFWB 3LEXB 1MCKA 4QTFA 4OCYH 2XXFA 3OMIB 3UZEC 2IH1A 1SN2A 4KMTH 4L3EB 1TJIL 3QHZH 4L3EE 3T6ZA 4FRWA 2HN7A 4Z23A 1QR4A 4LL4A 4LF3B 3K2UL 4PGJA 4RRPA 4JFHD 3KBFA 3CHXA 1EO7A 1OF0A 1CTMA 2V9QA 1MNUH 1IC0A 2EDRA 4XAWL 4Z3EA 4Z6AT 1FAIH 4F8NA 1LNUA 1YC7A 1XZ0B 3X3FL 3ZBMA 3ABLB 4U1SA 2JELL 2K6ZA 1HQRB 3EADA 1QTSA 4Y1SA 1RKRA 3CH8A 5ADOL 3V4VH 1ZHNA 5F9JB 5HGBA 1O7DC 3TBWB 2IH3A 1NMCB 3FQ1A 5IQ7H 43CAA 2K9FB 3QJXA 4WEUD 2XTLA 2OMWA 2X2JA 4FERA 5IVNA 5DRXB 1XR8B 2LU5A 2X4OA 4NX0A 5EZOL 5F44A 4F27A 3AG4B 1RJZA 4P2OB 1UH4A 2H41A 1JTTA 4HJ0C 1E4XH 3BUTA 4HX1B 3CZSA 2X2HA 3E9UA 2DV6A 3OHXB 4M48H 4EQ2A 2ICWI 5F97E 5DYFA 4DETA 2YPLA 1BG1A 4UYQA 3VWJA 1ZT4B 3GB7B 1EZLA 4QO1B 5I5MA 5KYYB 3SEPA 1Y1UA 2DYPD 2CLRB 3QIUB 1AHWA 5DD5L 2BS71 4M8VA 4JB9L 5HI5C 4XMLL 2J12B 2MCAA 1L9QA 2EVFA 3PPSA 1ID2A 3G5VA 4FI6A 4EN3C 4RSVA 3RZWA 3V0VA 4QRSA 1QTYT 4F37K 1UA6L 1T2QH 1G5GA 4WI0B 3VGDA 3ABMB 1T5WA 1URIA 3K6IA 3SYAA 1WQVT 5AKVA 1A4AA 1NM4A 2OW7A 3B34A 4XWGH 1NMBH 1JZ8A 2GAZB 2JI2A 1T0OA 3D69B 1SLWA 4JFPB 4MRCA 4KQ4L 2DLGA 2E47A 3CH1B 1PZAA 1OD9A 2XKSA 2Z8VC 4P3WA 1UEYA 25C8H 4KJWC 4UUJB 3SKMA 2VM9A 4PTUB 5ILTL 4KVNL 4PV8B 1RZGB 4KROD 3HI5H 2F61A 4M03A 4NP4H 4W9JC 1UJ3A 4H26A 5F7WC 5TF1H 3PWLB 5MEPB 5B8CA 1TZIB 2XWCA 3S0PA 4GXVL 4DEWA 3GXUB 2KZKA 4LLDB 1U8IA 4KKRA 3TCXA 5D2NC 2IPKB 1IC4L 4YEFA 2V9RA 2KDYA 3L2NA 4MJ5A 1HZHH 4HKXB 3W2DH 4ACPA 3L5XH 3KLHD 4XC1L 5TDPA 3AW5A 3G5XB 4M8UA 4NNYB 5CWSB 4BSJA 3HZVB 3R4RA 4OV5B 1QEXA 1YMMA 2HTLC 3FQYA 2HSIA 4HKJB 1E4WH 1GRWA 1LO5B 3IJSB 3QZBA 1S9XB 3Q6FB 2DQCL 1K8DB 3O3UN 2VH5L 4AV5A 1MVUB 2VGLM 2GG1A 4LT7A 4HUKB 2OP4H 3MA9L 2XWZA 4XPAL 2NX5A 3ULAB 1VADB 2CHZA 1RJCA 2VDLL 1NCWL 4OCWH 1V3LA 3W56A 5BS0B 2ZCZA 3CDZA 3QNXB 3SJVD 5BS0E 1Q9OB 5H4YA 2R69A 4KJPC 1ML0A 4FOMA 1J5HA 1ASPA 1I8LA 4Z76B 3CZGA 2WUBL 4QOKB 1WIUA 2R0KH 4NI3A 5I1IH 4QOKE 4Q0XH 2UV3A 2E0PA 3SPVB 4NCC1 3OLDA 4NZUL 1IE4A 1YEHL 3PFUA 3SKJH 1TTRA 2AQNA 3VD0A 3QT2A 3V6OE 1FHGA 3MBEC 3SDDB 3D08A 2AJ3B 2X44D 4WZ9A 5FHAL 3AWGA 1JXDA 4UTAA 5FYJU 4GJTB 2IALB 3QWNA 4TLTA 5EA0H 3N1GC 4U6YB 1JIBA 4F7PB 4U4IA 4HWZB 4BQBA 5D2LA 1NEZA 3MDJA 5CLTA 4BSWA 1MQ8A 3C08L 4KO7A 1UZ8A 3C6LC 5AW8B 4UT7H 1PEWA 2XZCH 3VGAC 2BMKB 3ARSA 3BP7A 4LSVH 4YLCA 2HUHA 1KCSH 3DIVA 4G6JL 4P5KA 3ARBA 5C0BD 4LEXH 1QNZL 2YMXH 3ETSA 3KLAB 3P0VH 3TYFB 5AALA 1B4LA 3T8XB 2IGFH 2B5IB 5FGBC 4W9DC 4NQEB 3APNA 1PZCA 3BKML 4NQEE 2MCMA 2OMNA 4BFNA 2CR6A 2CPUA 4CC0A 2N0KA 2FQFA 3M07A 3VFMB 1ZGLM 2ZF8A 4KNSA 1GGBL 4XAKE 4LXFA 3E8UH 3BAWA 1SXBA 2J1KA 3HA0A 1W0YT 3FRPA 2EXYC 3BGFB 3F00A 3KLSA 2ZXBA 1MI5B 5IJKA 4C59B 3AM8A 2A6IA 5FOJA 1MI5E 4KNTA 2FL5A 1EUTA 1CI3M 5CP3H 3RL2A 2NY4D 3HNSL 4TQ8A 3CVIL 3WN6A 1VACA 4UBDD 3S37L 4AKPA 3L9YA 5EZIH 1A65A 1WGOA 4ZFFB 1MLBB 4N20A 3MRHB 5K9KB 3BZFB 5LO7A 5E2UL 1LLAA 3IN0A 5DJCB 2YGNA 1S3RA 5FDYA 5IEHB 3MRIB 2BX5A 5IKCB 1JGEA 5EF2A 3MXVH 2Q86A 3APDA 5E9DA 4WNSA 2AFNA 2B3IA 3DTDA 3V52L 4DP0X 2IAMB 1UXWA 3OAZK 3T4AB 3CFCL 3LD8B 4JCLA 2GCYB 4JGJA 4U31A 1EEYA 3WDIA 4OLXH 4WGKA 3VSUA 1VFBA 3WFHA 4YR6A 3U9UB 3H7BA 2H45A 1OAKL 5EU7E 1U6AL 4Y5VC 1DBKH 1NCTA 1NWOA 4BUHA 5I1KH 4PUBL 4RMRA 4Y8AA 1CDBA 2X40A 4K7PH 3V6ZB 5ITBL 4LOUD 2P3YA 3H9SD 3RVXC 1KELH 1UC6A 4U6XB 5GS1C 1KXHA 3WGUB 1TCRB 2BRQA 2JMRA 2K4AA 2Y24A 2HLEB 3AVEA 4G80B 2LR4A 4WWKD 1EAOA 3VXRA 5IUSA 1QFUH 1VEOA 4U1IA 4S1DC 1F4XH 4AH2B 1LEIA 2GSGB 1XIWA 4BH7B 2CGZA 2QFPA 4FF9A 2XOTA 1JD9A 5FECB 3QYCA 3BPOB 3WMQA 3NIGF 2WBJC 5EMYA 2VMFA 3D0VB 1H3PL 5ACMA 5E5LA 1SVBA 3H1ZA 3QPXL 1BPVA 4IKNA 3OBAA 3PJSB 4B9JA 2O72A 1BAWA 4W4NA 1WV7T 3P69A 1NLDL 4JL2A 1RU9H 4JPIA 2CDEB 4GRLA 5T1KD 1RQ5A 4X8JB 2YQ2A 3VFNB 4PJ9A 1MFAH 1EO5A 1DL7H 5HGDA 5SWZA 4K2UH 5KANI 2VXUH 2RD0A 1S7RA 3VXQA 4LEOB 3FTWA 5KSUA 4X9BA 1J12A 3BSZA 5FHBL 3ZR6A 3D09A 1EK3A 2UXFA 1O6SB 4H5SB 3DWTA 1Q72H 1QFWL 3T0ED 1WFUA 3EW3B 5IMMA 1XGYL 4GUOA 4JQVA 4FG6D 1EXGA 2X87A 1FSKB 2MKWA 1ZANH 1RZPA 2FWSA 3LXBA 4Z7WA 2AF2A 3DMMB 5KS9A 4OQTH 2JCCB 4ABUA 5MI0C 1BVKA 2J1XA 2JCCE 2EE2A 3DV4A 4RRPM 3O2WL 3VVWA 4APXA 5IBLC 4K9EC 2CM6A 4Y89A 5JW4R 1FL3B 4ZO9A 4PJ5A 5CD3A 4OD3L 1L9RA 3IDXL 4KHXL 4UTBH 2Z1KA 1KIRA 3A6CL 4OCSL 3HCVA 5DJDB 4APQB 1D5IL 3UAEA 1WZ1H 4B0MM 4F7CA 4L4JA 4HH9B 3S88L 4IMKC 4L9LB 2Y5TB 4RGMC 4OI8A 4XXDB 1HEJC 3P02A 3L4UA 4NSKA 1GAFH 3M1BA 4WW1A 2R51A 3RGVA 1A4JA 4I4WA 3EUDA 1EX0A 2ZP0T 2FX8H 4J3OC 4P3DA 5F8QC 3UTSD 1YQ2A 2G0LA 3MUZ1 2KT6A 4XZUA 4WF7A 5ICYB 1R9FA 1XF4A 4EF3A 5CLWA 3BP6A 4GW5B 4ATTA 1T66C 3OZ9H 4NAQA 2ZG1A 1S46A 4GW4A 2ZWKA 3ZIMA 5TQ0L 4YHYC 2EZ0C 1VRSA 2XWTB 5JPMB 3ISYA 3PNWA 1NCDL 3GT6A 3KL0A 3QEQA 1KCVH 2LVCA 2GTZA 3OAYK 4KTEL 5DJXB 3ZTJH 3S34L 4TTGA 3FB8B 4BH8B 1KNOB 4DAGL 1A9EB 4U1HA 3UZVA 3GO1H 5I1HH 1J18A 3K3QA 4MXVF 1ONQB 1S5IH 5C0DA 5DQ9B 3FN3A 4DFHA 3RFZA 2P46B 4NQDA 2XN9B 4HPOL 2XN9E 5FGCB 4C56B 1LD9B 3IDJB 2QSCH 3QDMD 5I6XB 3D3VB 2G3XA 1UD6A 5FGCE 4C56E 2D31B 4GLRH 3NQKA 5AWNH 2P45B 3NA9L 3D3VE 3X13A 3ZKXC 4X6DF 4ICXA 4PJAA 2QL1A 4N5EC 4CA4A 3RVWC 1D2PA 3MKKA 1HILA 1IV8A 4OI9A 4WGWB 3GXFA 1U92B 3L3JA 2LHAA 1LVEA 3QQ9C 2NW2B 1A3LL 5I6OA 1SHWA 2OL3B 2OJZH 5KSAD 3LV3A 2UX6A 4UNTA 1DBAL 5JR1L 3H53A 4JHUA 1HT6A 3WJJC 2V7NB 4KI5D 3SHSA 1PDKA 5BRPA 5F3BB 3X2QB 1BZ7A 3QHFL 2BWQA 1P7KB 2VN7A 5TPWL 3CXDL 1AKJA 3ARDD 2SODB 5DURD 1BBDL 5C07A 2K6WA 3US0A 2XVGA 2YKLH 4L4VD 4I3SH 4ZOCA 2AZUA 2WP3T 3ECQA 4PV9B 2F58L 4JM2D 2X09A 1N70A 4K3EL 2CWRA 3MRRB 4RX4D 5AYUL 3VDAA 3CMGA 4PGZA 4AVIA 4XCCL 2HRPL 5EEVA 2PWDA 3ATFA 2E9IA 3Q5TA 2VM3A 1T03L 2BVQA 3QUZD 4OZ4B 4YSPA 3P30H 3ZRFC 1IGJB 4Q9QH 3BUYB 1SPDA 1KTKE 2VN5A 3WIIL 2WTOA 3MLYH 4K8RL 3PL6A 5T3XH 5I1JL 5J56B 2VDKL 4Q9BA 2JJSC 2BSBA 1E9QB 1QSZA 2YRZA 3GMQB 4DVBA 3CDYA 3C2SA 4GI6A 5A16B 2VXQA 1I8KA 3IDNB 3FTGB 4Q6KA 4LBAA 5CZVH 1MFEL 3T2PA 4FFYH 1CGSH 1ACCA 3W39B 2OYKA 3JV4B 3X3GH 4B9GA 5A2KH 1TQCB 4KY2A 5D1ZA 4HZ1A 4JE4B 1IJ9A 1MZZA 5H2BA 3UJTH 4A2FA 4LLUA 3SGEH 1A6VH 4DP8X 4JQIA 5CUSL 3LPOA 3MGOA 4H8WH 5BQDA 3KPSD 5HXMA 3JTSB 1M6OA 3HRZA 3BLKA 4FQXD 4QTHB 4XBMA 2HFTA 3NPZB 3OGCA 3LZOA 1NSNH 3FT0A 1V7NL 5FR3A 3TU6A 3BRGC 2H1LM 2JKSA 2B1HH 3KS0H 3IKKA 4HLZG 3QDAA 4B9FA 3VXUA 1BG9A 5FM4A 1YA5A 2J72A 5F1IA 2BSRB 5A40E 3TEUA 2UZIH 4N0FA 3BP4B 4GUPA 3MYJB 3HG2A 5I8CA 3OLGA 3SDAC 1XGQA 3OJVC 3A4AA 5CCKH 1AQHA 2FGWH 3PAVA 2H2PD 4WFED 8CGTA 4OZGB 1DQJA 4HIIB 4PCTA 1DQVA 4ADIA 1AYRA 4OCYL 4A6YA 3AXLB 3D1MC 4OZGE 1H15A 4FXGB 4P9HC 3BQUA 2LLGA 4KMTL 3QHZL 2HMID 2XN0A 4IK6A 4UV4L 1T83C 3HC0B 1RUPH 1QO3A 3ATBA 3N85H 3JWNE 5ID0A 2Z31D 3DX0A 3MREA 4XPFH 4F57L 5T1LB 3FCSA 3S36H 5B4MC 4LASH 4N1EA 4PJEF 2CUIA 3L4XA 1W72H 4JJOA 1UM6H 2FT7A 4PJ8A 4ZAKD 4UT9L 1UVQA 5AB0A 2I7OA 1J9CT 4Y88A 3V4VL 1C12B 4TMPA 2X2YA 2X1WL 1E28B 1A4KB 5IQ7L 3DUHA 4R5XA 4O2FA 1B0IA 4K8RD 2DMGA 2IG2H 1USZA 1PKQA 1W6WA 4N3TA 2A4ZA 4NFDA 1RJYA 5D7LD 5BJTB 4GFTB 4D8PB 1X5JA 3DIDA 5HDWA 1BYNA 3FQUB 3OR6A 1X7QA 2ENPA 4K9EH 3IJEA 2IDSA 1AFVH 2PXYC 2MH4A 2XWRA 1KB9K 2D7TH 4CMMA 1E4XL 1KBBA 4P46C 2O5ZH 4P2RB 1U30A 1XV8A 2IDTA 4LKXA 4M48L 2HRGA 2PN5A 5IOPA 4MBOA 4P2RE 2XRAH 4PSPA 4BKLA 3UGXA 5B38A 4GAYA 1PG7X 2C3VA 4FMFA 3L17A 2BZCA 4JPSA 1IKNA 3GPEA 3AT9A 3SPIA 2D7NA 4XPHH 4J3OH 2BCKA 5T5NG 4XWOD 1CF8H 2V2XB 1JPEA 4N9OB 5DTFA 2AC0A 1UT9A 1TLKA 5EC2A 2YPVA 3T04D 1BVNP 1BD2D 3J2PA 3QDJD 4OCRL 3TNMA 5GISH 4OD1L 3DNKA 1T2QL 3QULB 2WN3A 1OSYA 4ZYKA 3LSOA 4P2QD 4P9MH 2NXYB 2WANA 1SOXA 2L7JA 2C3WA 3MA7A 2DKUA 5JPNB 3T2NL 4UU9B 4MNQD 4TL4A 3WEXB 3UYRH 3LB6D 3L13A 3EFFB 3O2DH 1Z3GH 4JZOA 1NMBL 4XWGL 1R3HB 4CRPA 1JWSA 3LPFA 4HEMA 4WDIA 3EGSA 3H7LA 2QV4A 1CUOA 3GIZL 2YD3A 3MLTA 3V5DB 5E2WH 25C8L 2WTRB 3LJ3A 3U7YH 3UACA 3QJHA 1MAKA 3WE1A 4UM9B 3HI5L 2R0WH 1WAAE 1PZ2A 2WIIA 1ND0B 3H9ZA 4H25A 5TF1L 3GLAA 3WI9A 3HMWH 5LN8A 1ZLSL 2CUAA 1ID5I 3IJHA 2OMUB 2Z7YA 5JMRA 1J5OH 2VR5A 4X6FA 1R0AH 4X80H 1I3VA 1PZ5B 1XQ4A 3G5YA 1AIFB 1AGBA 2AI0H 2VSDA 1HZHL 5E6IA 3II3A 3RZCA 1U21A 4G43A 2YA0A 3PGFH 2BZ7A 3DDGA 3X14A 4WI2A 4Y5YC 4YNYA 1WZLA 1B4TA 2EIKB 1E4WL 3MR9B 2R23A 1NDGB 1T1XA 3SOTA 4QKTA 1IEBA 4G8GD 2FECL 2A6DB 2LFGA 3P77B 4JKPH 2P8MB 4FA6A 3GXNA 3OKKA 5J57B 3U7AA 3NCWA 2PTVA 2R39A 5I1GL 2OP4L 3MLXL 1YUKB 4V1DA 5I8EB 4OCWL 3MJWA 1SUJA 1JTOA 1U8OA 1EVTC 4OZIA 1FGNH 3UGEA 1IGIL 4WLCA 3R7QA 1Q1PA 3PXHA 3U4BH 5JO5A 3CFDA 4A7VA 4KDTA 1OZUA 3NUKA 3FF8A 2VN3A 4X6EB 2EUXA 5IV2B 2DB8A 4Q0XL 2H8PB 3QI9D 2ZOLB 2P52A 4QIRA 1YNTA 1U3HD 3NIGB 2VJXA 4NGHH 3K46A 1K3ZA 3NIGE 3GMRA 4L8DA 4HFWA 2DMBA 3OMAB 1SM3H 5KSBF 2V8LA 2HZHA 2BINA 4MKMA 2JXMB 3JXAA 4L3EA 5C0IB 5CIPH 2Y9RT 1BVLA 1O9WA 5BRZB 1INEL 2EABA 3GRWA 1HE8A 2DICA 4UT7L 4D9QD 3BAXA 3Q5OA 5BRZE 4LSVL 4TQEH 2C9AA 4LF3A 4HIEB 1KCSL 4KC3B 4LEXL 1JK8B 2BM3A 2YMXL 1G94A 4LNRB 1KC5H 3WOVA 3ARWA 3GTNA 3A0OA 3DHPA 1R24B 5I74B 1XZ0A 4DW2H 2VJ0A 2FUQA 2IGFL 1SDAB 3VWJC 3CE1A 3C2AL 1HQRA 3EYSH 2OK0H 5SWSB 5FX3A 1LP9B 4CGTA 4KITB 5DC2A 4X4YB 4YSSA 1KWKA 2CJSA 1AHWC 4X9IA 5DWUL 1LP9E 5F9JA 5GZOD 1URLA 1DCEA 5HYEA 2LGNA 3TBWA 8FABA 3LHAA 3NMEA 1P1VA 2WZ5A 1CL7I 3CSBA 4MTMA 4E41D 3QJOA 1XR8A 4XI5D 1UWYA 1G4RA 5DMGD 4S10A 4J23A 5IFHH 2W0FB 3NCEB 5J5EA 3EYOB 3OWRA 1EO8L 3SY6A 5KVDH 4P2OA 4JFDB 4UMGA 4HX1A 3OHXA 1KXTB 5EZIL 3WTVA 1WIPA 4DKDC 2WXFA 1J1XL 1QG3A 1ZT4A 1NGQH 3GB7A 4QO1A 4MA1B 4H0GA 5KYYA 2A0LC 2CLRA 4WK0B 3K71B 1NCHA 1UJ3C 3QIUA 1H5BB 1DTUA 5B8CC 3D06A 3IGAB 5JA8B 4JRYD 2DYPB 3LRGA 1AOZA 5D8JH 2X6VA 2IO5A 4M6NL 4ZMTA 35C8H 2P48B 2FH6A 3C09B 4LLWB 4XNAA 1N6VA 4M93B 4WI0A 2EDEA 2WCSA 3PJNA 4IBYA 4OLXL 2DQEH 4OM0H 2L4OA 1HC1A 1WS8A 1QZ1A 3D69A 3PWPB 3HC2A 1DBKL 3CZKA 1KB5H 2XV6B 4LK4A 3PWPE 3QEGH 4X4ME 1X9QA 3T0XA 4MAYB 3ZDZF 3CH1A 2H6PB 3BYTA 4WIQA 4A67A 1QWUA 2WXRA 4MA8H 4Z7IA 2GBVA 3F3HA 4CBPA 1ZWIB 4MXVE 4K94C 4UOW1 4UUJA 2VYRE 4PTUA 3RBSA 3MKGA 1RZGA 4PV8A 4ZUWA 3ULUH 4CMHC 1NBVH 5F9WC 5DS2A 3RLSA 4JFQB 1K5WA 4G72B 3PWLA 5MEPA 1TZIA 4XBEH 4PJFB 1TVBB 4X6DB 1QFUL 4KROB 4LLDA 4PJFE 4L37A 1LGVA 1I8LC 3KVQA 5T3ZH 4X6DE 2IPKA 3LH9A 1JRHH 3VMPA 1RY7B 4HKXA 2M2DA 5LQBL 3TX4A 1L3WA 4POUB 1I9EA 2JB5H 3G5XA 4YVUA 4HT1H 4OV5A 5C2UB 4HKJA 1Z5YD 3QAZB 3CSTA 4TLSA 1LO5A 5AZEL 3IJSA 4J7RA 4ZTOH 1U8QB 3GMLB 2ZG3A 1S9XA 3Q6FA 3ZZ1A 1K8DA 1U3NA 4F80A 1MVUA 1RU9L 2EACA 2HH0H 3U2IA 2ZUQC 3K4DA 1VADA 4AQEB 3LXAA 1DL7L 3SYOA 4A63A 5BS0A 1WYJA 3H4HA 4YDJB 4N2CA 1SEQH 3QNXA 2D3VA 4JO2H 1IILE 3DTXB 1Q9OA 4UIKH 4YDIH 5DVOA 3ARBC 4S1QH 5BO1L 2VDQL 1VAHA 4N6RB 3ZTEA 1XD0A 3BZ5A 2GBTA 4Z76A 3INOA 4Q9RH 4FNUA 4QOKA 1LO3H 5GHWH 1CFNB 1T80A 3HPLB 5EZJB 3VD5A 3SPVA 1DN2A 3P4LA 3V6OA 4L18A 1Q72L 4KZCA 2OYPA 4HH8A 2XX0A 3KCWA 4F9LC 4UDUB 1R5WB 1ZANL 3A22A 4JDZB 3SDDA 2AJ3A 3QRBA 4GXUN 2A9DA 4ECNA 4F2EA 5DD1L 1KG0B 3BPNB 4BYHA 1YG9A 2PUQT 4PGCB 1JD7A 4U6YA 4F7PA 5IJKC 1GJUA 4HWZA 3AM8C 5EBMB 5IT2L 1XF3A 3TZVB 1YJDH 2BVYA 2AEWA 5GGVH 5L88L 4M3JA 2BMKA 3WNJA 1V3MA 4BUQA 4UTBL 1U41A 1UWGH 4DCQB 3GZOA 4HWBH 3KH3A 4M6OH 4MVBD 1WZ1L 3CZEA 2J6EH 1DEEB 3KLAA 3TYFA 4EVNB 4MCMA 3T8XA 2OMZB 3AITA 4WEMB 4YWGL 1O9VA 4NNXB 1IAIM 4A7GA 4FHJA 1M7XA 3O4LD 4XT1C 5KBMA 4NQEA 5K5YA 3ECWA 4OGYL 2FEEL 5C0BE 3D30A 2FX8L 1CD0A 3LEVH 4P57B 5T5NF 4CILA 4OZHF 1UG9A 2GIMA 3VFMA 4LSPL 1JI2A 3T8VA 1Q0YH 3E38A 5DD6B 1EQWA 2ZAHA 2EECA 3BN9C 3MRQB 4YAQB 1MI5A 2X2IA 2FNBA 1S8DB 1DSFH 2HVJB 3LDBC 5DSCA 3RY6A 2Z6FA 4D0DA 4L9DA 4X99B 3ULVF 5F7DB 4K71B 2YMTA 1G6RB 1MFNA 3ZE2F 2BHFA 4EIBA 1C7TA 1O6VA 1BM3H 1HL9A 3U9PL 4G71B 5KN5B 2WN2A 1HH9B 3GO1L 2NY4B 4KZEH 3QQDA 1OP5K 1MCWM 4PLKD 5J11C 1MLBA 1QWHA 1JGVH 1S5IL 3MRHA 2B77A 2Y7NA 3QFGA 5J4MA 3QYMA 2ATKA 3BZFA 2ZXEB 4RGNC 5CF3A 3WFEH 3HE7D 5DJCA 1HCYA 3K2MC 1RJLB 2VDLB 5IEHA 3MRIA 4L23A 4OSUH 5BVJB 2GBUA 1WFNA 2TRYA 5AWNL 3N40F 3P3TA 4GQRA 2PWEA 2IAMA 3AAZB 2RIKA 3VACA 3T4AA 3VG0H 1XIWC 2O5XH 1W8OA 3GHEH 2GCYA 1LMKA 3FUMA 4NYLB 1JPSH 3M45A 3V0JA 4M3HA 4QCIB 1EDYA 3U9UA 1QBAA 2OJZL 4Z3FA 1BIIB 4NXSA 3BVVA 3G5WA 2Z92B 3F7RA 2ZWNA 5B1AB 2WXGA 4Z3GA 3V6ZA 2JIXB 3ILQD 5HVWA 5D4IA 5IGXL 3IAGC 4GRLC 4U6XA 1UT2A 1DSYA 4AQOA 4MXQD 1TCRA 4PJ9C 4WJG3 3TF4A 2IH8A 4G80A 1EV2E 2GYSA 2W0KA 2KLRA 5F8RC 1AMXA 2YKLL 3H9SB 2ADFH 3OL2A 4FFVC 2ZXDA 4I3SL 4U3XA 5TE7H 3BUBA 1BWMA 2VR4A 2Q8BH 4GKZB 2D7OA 3H9SE 3TEXA 5BXFB 4YE4L 1H8OA 3E3QE 2PYEB 3KHQA 4KJPD 1X4YA 2X4UB 1BECA 3CBRA 3F65A 1MLCB 2Z35B 3HBZA 4WWKB 4CADB 2J7LA 2GSGA 2YBRB 4NKDA 4BH7A 4IOIB 2KPNA 4MB3A 2N56A 2EH8H 5B1CA 5FECA 4UZSA 1XF2B 4JQVC 3N1PC 1CC3A 3P30L 3VI4B 2DIAA 5HHPB 4NBYB 3D0VA 3MLWL 3VI4E 2AV1B 4AEFA 4YQXH 1B3JA 5T3XL 3PJSA 1TTFA 2AZAA 3QUMB 1PPIA 4AI7A 1DZBA 1BQHB 4FADA 4UAOB 4JFXB 2CDEA 4YBQD 2RQEA 4X8JA 2QKIA 3VFNA 4FFYL 4G42B 5JUEL 3X3GL 1CIDA 2J8UF 3N41F 4U1NB 4KKAC 4LEOA 3WE6B 4ZNEE 3UJTL 5M7QA 1A6VL 1DFXA 3BD3A 3AY2A 4JM4H 1G7LB 4JKWA 1E8WA 1TPXB 5GRUL 1T2JA 3LS4L 1I8AA 3T09A 1XX9C 1O6SA 3GNMH 3RGVC 4FP8H 3ZK0A 1RZFH 2ADIB 3BEWB 4FQQB 4H5SA 4EUPG 2JKIS 4DGVH 3IU3A 4KUCF 5EU6D 5J7CC 3KR3H 1NSNL 3WHE0 2N7SA 1C1EH 2H47C 5IJVB 3BW9A 4GBXA 3NABL 4BRVA 4N6QA 2UZIL 2JCCA 3C8HA 4R2GD 5EF1A 1OV8A 4ODSH 2EXYD 4ZK8A 2NY0B 3CGTA 2VUYA 4JPQA 4PRNB 4UTAH 5CCKL 3MOQA 1OT4A 1TIUA 2FGWL 1KLUB 7PAZA 2YQGA 4GKOA 1KZQA 2Z3FA 1IIIA 2VXVH 3DBXA 3NSXA 5I0VA 4APQA 5DJDA 2J2ZB 4HP5A 3HZ3A 5TDNA 5D5MB 4HH9A 1BQLH 1SJEB 4L9LA 2Y6TE 2Y5TA 5D5ME 4XXDA 3VQLA 3RX5A 1S7XB 1F86A 1HWWA 3CFEB 3RFZC 3B8YA 3N85L 4XPFL 3K74B 4NZDA 1XO8A 3UG3A 3S36L 2EDWA 1DQKA 4H44C 1W72L 5ICYA 1VCBC 4EBQH 3TO4D 2DN7A 3KH4A 4XHJC 3MCG1 2X4QB 5JHDD 3P2DA 4GW5A 1YN7B 2WV3A 3NEXA 3EFOB 1MKFA 1LE9B 1OOWA 2RACA 1CQYA 1DJGA 4WHDA 2XWTA 5JPMA 5KSBB 5T3XD 5C0JB 1FHNA 5E8EA 5KSBE 3BLBA 3UJJH 4H1LB 1WWWX 3RTQD 1KNOA 1XHHA 1CD1B 2FH8A 1A9EA 4K9EL 4BH8A 1AFVL 1Z5LB 2E6JA 2D7TL 3S5LA 1KTBA 4GB9A 3VQ2C 5AD0B 1ONQA 5DQ9A 2O5ZL 3RVXD 1KYOJ 2XN9A 5AOLA 1XCTA 3KDPB 2CJTA 5TK4A 3EF7A 2XRAL 4NS0A 4C56A 5A2FA 1LD9A 3IDJA 2EUZA 2JTDA 1ZE3H 3MFGB 4Y19B 3C8DA 3D3VA 4E2OA 2D31A 4R90H 2HJKB 1FUNA 1R33A 3QXAB 1X44A 3ZW3A 1VKXB 4KRLB 1XAKA 3MUJA 1WE5A 4XPHL 5BZXA 4X7FC 1ZTMA 2WM0A 3OB0H 4FEIA 3U1QA 1DVSA 1JPTH 5E0FA 4Z7NB 4QRAA 1BZEA 1U92A 2BK8A 2WLZA 4Z7NE 3ARPA 1YYMH 2IBBA 4P07A 3ZMRA 2NW2A 5GISL 2C7UB 1AS6A 2ZX9A 2BNQD 2WBJD 4FCAA 4XODA 5AW9B 5DK0B 4P9ML 3PL6C 1E3ZA 2CSPA 2V7NA 1D6EB 5F3BA 2AMGA 3GC3A 4XCYB 5KSAB 1P7KA 4I3RH 4RMTA 3ZIYA 4HK0B 5BRQA 4WWNA 3V9EA 4PJHF 1MHCB 4AG4H 4TNWF 5D1ZC 4KI5E 4JPVH 3BZDA 4AYSA 2QGCA 3E2HC 3MJ8B 4WI5A 5E2WL 5HYJD 3VSQA 4PV9A 5DURB 1F3DJ 2ICWJ 4PVBA 2W9LA 4KRMB 4PIBA 4PJCF 4AEIH 4L3CB 2R0WL 4L4VB 1NM9A 1TDQA 3HKZA 4KQ0A 1A9VA 1A7NH 3HRZC 3OKOB 5CKAA 5IHWA 4L4VE 1B6UA 3BPLB 2VW6A 1CFQB 4FQHB 3HMWL 5FCUH 1VGKB 1JZ5A 1J5OL 4OZ4A 1R0AL 1IGJA 4X80L 4YEEA 3RIFF 2ENQA 1P2CB 3BUYA 3TEZA 2AI0L 3SQRA 5IR1B 4XZ4A 3BKCH 1GGIH 1R3KA 1E9QA 2BNRD 3CLEL 3GMQA 1C8QA 4DUXA 2H26B 3MGTB 3UTOA 3N0AA 3IDNA 5A16A 3FTGA 1T5XB 4M8RA 3TASA 3UO1H 3ZDZB 3G9AB 1RUMH 3JV4A 4XNZB 1FYHB 4FYQA 3Q9PA 5I0XA 4XTRD 4KVPA 1ZJBA 3IBOA 3MRCB 1OARH 3DK2A 3SE9H 4Z7VB 1W0VA 4FA7B 5HVHC 5JOFB 3MROB 4NI6A 1DVZA 4MKTA 4YBHA 5F1NB 3VYPA 4Z7VE 3JTSA 1TTGA 4QTHA 3RYMA 2A9MH 3U4BL 2ETWA 4HA1A 3KPSB 3F7PC 4J3OD 3WNIA 5EBLB 2YAPA 4FQXB 3KPSE 3CLWA 4PJ8C 3IBEA 5MEQB 3BD5A 2BSRA 3BP4A 2UWEF 3MYJA 2QPFA 1H3GA 3QQNA 1BEYH 4NGHL 1BGXH 1L7IH 4ZMOA 4QY8B 2EZ0D 2R29H 1SM3L 2ED6A 4HIIA 4OZGA 1MCIA 2VDOH 2C4FT 4RZKA 4XX1E 2DTSA 4MASA 5CSGA 4ZFGL 3AXLA 4KK5C 4YHNB 4FXGA 3I3EA 2HXAA 5AOMA 1N9PA 1P69B 2XJLA 1WF5A 5FO2A 3HC0A 4WFEE 3SKNB 4TQEL 2XWDA 3EUUA 2HRLA 1HSAB 1KXQE 3NSDA 3QK0A 3V0FA 1ACZA 5DHXB 2YA2A 5T1LA 4G7YH 3GSUB 4MDJB 1KC5L 2BIQA 3VG9B 3X1BA 4WUUD 4R7NA 2Z31B 2E4FA 3U83A 3TYGH 2OZ4L 1IKNC 4P4RB 3EYSL 4K5NA 2QR0B 2OK0L 1U2HA 3B2VH 4BIKA 3OKEB 5F7LB 1FNLA 4JREC 1FNSH 2NDGA 1C12A 1E28A 4ZAKB 3VDBA 1A4KA 2VKXA 3F12B 4M1DH 2NNCA 5BJTA 2HJLB 2DBLH 4DKFH 4D8PA 1YY8B 1WBZB 2IADB 3FAXA 5I8OH 5IFHL 3FQUA 4GP4B 3KPRD 3AQZA 5D7LB 4JAMB 4AV4A 2VDKB 3VFPB 2VLRB 3QR1A 5D7LE 3UPCA 3TN0D 1YC8A 4P2RA 2VLRE 4RSYA 1NEPA 2HX8A 1QI3A 4A2MA 4DKEH 2DYRB 2Q76B 3SPCA 1MJ7L 3VFVA 1MQKL 1XMEB 2E7MA 3AS1A 1NGQL 2GJ6B 5CMAA 3FSWA 2GJ6E 2EEDA 4I18B 3FU5A 1D5MB 4QXTB 2X3AA 4DK3A 4BFIB 3DDFA 4OZHB 5ESAA 2V2XA 4OZHE 3KDMB 3UCRA 1WT5A 4HKBB 3I6SA 5D8JL 1OEZW 3FQXB 4X6CE 5TTRA 2EDKA 5E7FA 3QULA 5E6IC 3RZCC 1KEGH 1BD2B 5SX5K 2DQEL 4OM0L 4R5VA 4X4XA 5JPNA 3JV6B 2WLJA 1GZPB 1BD2E 1JGLH 2DLIA 2M83A 1EANA 2V8MA 3EFFA 3FSOA 3KJ4B 3ZE2B 5C0NC 5I66B 2R8SH 4PJGB 1R3HA 3FFOA 1WBXB 4P2QB 5GJTH 4GFXA 3ZE2E 5BW7A 1KB5L 1A2YB 4PJGE 5GGRB 4YGAB 4P2QE 3QEGL 4DEPB 4FNPA 2ZE0A 1KFGA 2GJZB 4MNQB 3S5YA 3CD4A 3FU7B 1X3DA 4LFHG 4MA8L 5DA4A 3KPPB 3TT3H 3V5DA 3X1NA 4MNQE 4OZFG 2WTRA 4U3HA 1FCGA 1WAAA 1OOAA 4Z3IA 4UM9A 4M7LH 3ULUL 2F54D 1MCSA 1NBVL 1ND0A 4HHWA 4YJZL 2Z93A 3NGBC 4XBEL 5T33H 4PU2A 3ZGIA 3NJFA 4G7VH 4JPKL 2NZ9D 2OMUA 4KDTC 1MY7A 1G7HB 2XQYK 5TJWK 4ORZC 3QRGL 1F1DA 5DVMA 1AIFA 5DFTA 4KJQD 2UZXB 4LQ1A 5EB9A 4BXSV 1RIHH 5DEGB 1WP6A 1EEZB 4F8PA 1KFAL 3PP4H 1BX2B 4DOHB 4F15C 2VITB 4UQBA 4IRZL 3HN5A 3MR9A 3TFKC 1X9UA 3O45B 2Q2LA 1NDGA 3QJTB 4DOHE 3F6JA 2JWYA 2O26U 2A6DA 4ZTOL 3P77A 1HXYB 2P8MA 5CJXA 4KV5F 1JDCA 5ESQB 4D3CL 3EJPA 4XO4A 5LGJB 1GS8A 2HH0L 2VDPB 4G8GB 4TV3A 5I8EA 4G8GE 1HL5A 4JHBA 2DM3A 3CUPB 3P9MB 4HLJA 1GOFA 3EO1B 5KVEE 1B0RB 5JOPD 1EGJH 1SEQL 3A6BL 5DD3H 4UIKL 1M7IB 4DN3L 5E8NA 5D7KE 3RWDB 3PUUA 4Q9RL 1N4XH 3REVB 1LO3L 4K3GA 4QHNB 5GHWL 4X6EA 4TQHA 2ZWSA 4XPTH 5IV2A 2MCPH 2H8PA 1FORL 1DJWA 1EAPB 1A1NB 1N26A 2ZUUA 4DP6X 3BAYA 1E40A 2OS7A 1DUYB 3VRIB 1NMCC 4LLYB 2FQGA 3QI9B 4KXZH 3LVTA 3RX8A 2VN6A 2QEJA 1JZIA 5J6HB 2PPAA 1WA2X 2ZUWA 3WIFA 2JXMA 3GXPA 5C0IA 3MLRH 3IAPA 4AEHH 4LIQL 1WFOA 4G5ZH 4ZO6A 5BRZA 2BCMA 4P2OC 2G4EA 5DDHB 1EH9A 3I6KB 3N41B 2PXYD 2GY5A 2VDML 1UWGL 5IBUG 4P46D 3FONB 1YYLH 3OHXC 2WW8A 3JBG7 4HIEA 4LVNB 5SV3A 2VRAA 3NJMA 1ILUA 1JK8A 3NJKA 2YXWA 2AJSL 2XQYA 3P9LB 4G2AA 4HBQA 3U1SH 3ULUD 1CE1H 1R24A 1JYNA 3NSYA 3QWOB 1PIGA 4BKSC 1QACA 3H3BC 2E9WA 3BVUA 1LP9A 1HHKB 2KYIA 4X4YA 4NZTH 3QIUC 2BO0A 1YAIA 5F21B 5T3ZD 4NUQA 4W9CC 5IY5B 5GGSY 3GSWB 5DK3A 4I0PD 3TJHC 3VX0A 2OR9H 1CLYH 1HL4A 4D9LH 4YX2L 2AJUL 2W0FA 4GEJA 1SJHB 3EYOA 4PW3A 5FUCE 5L9DH 4KNUA 4LPWA 4E41B 4JFYB 1OT1A 4GPVA 4JFTA 4WO4B 4E41E 2A6KB 1RLWA 4G8IB 1HAUA 3RGBA 1E5YA 2VDRH 2L0DA 2DJMA 4K5MA 1KXTA 1OAUL