4QDGA

Crystal structure of a putative adhesin (bt2657) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution (psi community target, nakayama)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
300
structure length
300
Chain Sequence
DLAPCPHGVSLRFIYDYNMEYANAFAKKVDCLTLLVYDENGNYVDTRIVTGTELQDENYRMKLDLKQGNYHFVAYGGLACNKSSFLMKYTPGEGTGYTDLQVELDSECLTNPRRKNLHGLYWGELTLATADLYSEGTVEMMKNTNNIRVVLQQMNGEPVDDKKFEFEITDDNILFSYDNNLLENGMVTYTPWAQGQASAGFTDEGREVVVAYAELSTSRLMVRDWYSPKLTVRRKADGVEIINIPLINYLLMLKSDLYASMDSQEFLDRESEWSMIFFLSPNLEWIKTYIKINDWTVRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative adhesin (BT2657) from Bacteroides thetaiotaomicron VPI-5482 at 2.20 A resolution (PSI Community Target, Nakayama)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Cell adhesion
molecule keywords Putative adhesin
total genus 72
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08842 Mfa2 Fimbrillin-A associated anchor proteins Mfa1 and Mfa2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2090 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qdgA02
2.60.40.2100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4qdgA01
3PAYA 4QDGA 3GF8A
chains in the Genus database with same CATH superfamily
3WJLC 3TXAA 4HSAC 5AKTA 2MRYA 5F6HI 1KJVB 3PL6D 4E9LA 1N3NB 3P0VL 3TPKA 1ET5A 1T4WA 5DFVD 4CMMA 3CDYA 2D3NA 2QQNH 4KXCA 4D94A 3D3VE 4GRWF 3UADA 3U9UB 4A1RA 2FX9L 4DEPC 4F7TA 3H8NA 4HIEA 3L6FB 4X80L 1G6RB 2B2XH 3F62A 4UUJA 5DFTA 2ODHA 2BNUB 2VDPL 3BUYB 3B6SA 5CIPB 3WHE0 4L1LA 1I7ZA 1D6EA 3BIKB 4ALAC 2ZUQC 1KB5A 4WU7A 5LBGA 1RJZA 1VFMA 5I1EL 1U8HB 4ETQA 3D39A 1EQWA 3OR6B 4EI6A 1GGYA 1NLDH 3VXSD 2OFQA 1NKGA 3GM8A 3AW5A 3TN0D 1QLRA 2EE3A 1II4E 5C0EB 3ILQC 4NC2B 4PJBA 4LARH 4P5KA 4QXUL 5HYSB 5HYIA 5IFAH 1ZHKB 4K5PA 3Q6FA 1EDHA 2EXSA 2APWA 1K2DB 2X4TB 4V1DE 5EEUA 4MA7L 1I8IA 4M8QA 1N8ZB 3WFEH 3MXVL 5JXAH 2P5EA 1HSBA 2P7TA 4HD5A 2QELA 3C5SA 4M1CC 1PG7X 1SZNA 5EU4A 1DP0A 4M93B 4PUBL 3N1QC 2B4CC 5D4JA 4DPAX 2W9DL 5F0LB 1A7QL 2BP5M 2VDQB 3O6FB 4HJIA 4Y19B 2ZKMX 3V6BR 3TNNB 4ZTOH 1HZHH 3GIVA 4QHKJ 5IQ7L 2DWYA 5AW1B 2NY6C 4XPGL 3ZYJA 3BDYH 1TZGH 2NT0A 1JN6B 4J12A 3K4AA 2WKLA 2F54A 3TYGH 3VXOB 4TNWF 3PABB 1XWVA 1KF9B 3DX3A 5IQ9B 1HIMH 1XGTA 5AB2A 1G1YA 1CS6A 1HESA 1RV6X 3MACL 1IM3A 3EBAA 4YIQB 2BVEA 2CJ3A 2QQKL 5I17B 2QQLL 5AWNL 1HE8A 2OL3A 1WTLA 2JMRA 2ZCLH 4PJ9C 1OAUL 2R56L 3MRGA 1BZ9A 4X7TA 3BZFB 1IM3B 4AKQA 2Y6TE 5GIRB 2OMTB 3DX0A 3MROB 3QG7L 5D7LD 2XVKA 3D4CA 5EG6C 2CO2A 2I26N 2YRPA 5DK3A 1IGIH 1VESA 1PSKH 5B3NA 4R83A 1ZLUK 1OT2A 1TJHH 1I1AC 1MAKA 3ABLB 5FDWB 1YN7A 1I3RB 2R4SL 2GSGA 2QZ5A 4OCRL 5FCUL 1NOLA 5L88H 2RD0A 2XPGB 1D7CA 3BKMH 1LWRA 4NM8L 1J8RA 1IAOB 3KBHE 5GGVY 1J1XH 1ERNA 4P4RA 1WZLA 5FYLL 4OU3A 1TJXA 3VA2C 5I1HL 1A3QA 1NCUA 3VD2A 4S1SL 2NXYB 1DEEB 4QCIB 2XBTA 4JM2C 4TVPL 5A2BA 3MJ9A 3C09B 1E7VA 1I7TA 5SX4H 1X5JA 1U8LB 3O6LL 1OP9A 2X9WA 2LFEA 4L29A 1WIUA 1T6WA 4TN9A 3WG7B 1RZIA 4XP1L 1G0XA 4YOKA 3FF8A 5GS2D 1NGYB 1CI3M 4IBTA 1IEAB 1KN4L 2HJLA 2VUYA 3NZ8A 4WZ9A 1ES0A 1I3GL 3W57A 1NC2B 3EG9A 3IWVA 3PXHA 4RESB 2CD0A 3UAEA 4HCFA 1RZJC 3TBWB 3PP3K 4A68A 1ET8A 5D7LB 3CBKB 1KN2H 2BS8A 3SN6N 1AO7D 2XU9A 3EJRA 1J0YA 4FFYL 3WIHA 5ISZE 3HE7A 3V8OA 4Y5VC 2Y2WA 4G7QB 4ZFOB 1I7UB 3VFNA 3BH9B 2JXMA 2H3NA 2BOCB 2VXVL 2HT4D 4P5TA 1HC1A 1I53A 3LB6C 3RUGA 3BT2L 4GLRI 3WNJA 1UWYA 1BREA 1BZ9B 2CWRA 3TEWA 2YAOA 3WD5H 2N56A 1J5OL 3VYOA 3HS0B 1ESOA 4F7CA 1A6PA 1TUPA 1U9KA 4XE0A 2YPKB 3ENEA 2GTWA 3V0IA 5G55A 2VLMD 1WT5A 4HFUL 3MV7E 4PRDA 4AMKH 3PL6B 4HWZA 4C56B 3QO1B 2WWMC 2XWBA 1P5UC 2ZSWB 1YEDB 3WFEL 4ZXBC 4PGBA 1W2KT 4PIRF 3K6SB 1RZFH 1W0VB 4HLZG 4JFZL 3TIDB 1D2OA 5EV7A 2WUCH 1CR9H 3ULAB 3VFGH 3QQ3A 2WOYA 1E4KC 2Y69B 4ATWA 4ODTH 2F15A 1XF5B 2CCLA 3V4UH 3QUXD 4WI9A 3FSVA 3F7VB 4G82A 3SO3C 5EZIH 3C8KA 3GSRB 2NX5A 3P73B 3S8GB 3U0PA 5EU6B 4GT0A 2FDBP 1X6LA 4J39A 3GRBA 4I18C 1KN4H 1X5FA 4JO1H 4RFNB 1WP6A 4U49A 3V0VB 3PPSA 4CGUB 4LGPB 5EEXA 2QPUA 1NANH 4KK5C 4JFTA 4RZCA 1JYXA 1IV8A 2XSKA 2EDBA 2AANA 4YHPB 5DI8A 3Q7JA 4JFEB 1FUNA 4V11A 3U4AA 1D5MB 3E80A 3L3GB 1B2WH 1CXLA 2V4LA 4GO9A 2CLVB 2ZF9A 3H9HA 1QSEE 2V2XA 4OM1H 1HH6A 5KSAC 1R3LA 1B0GA 5I1IL 3C5JB 4ZSOE 3U6RB 1FL5A 4JHBA 5G2NA 3ULUE 4PJEE 3DX7B 2FH6A 4HKBB 1U8QA 4ZODA 1KCSH 1GGUA 1OEZW 2EE2A 5CZVH 2Q86B 2A9NH 3N41B 4ODSL 4C8XA 2YXFA 4R4FH 3RIAK 1MELA 2F7PA 4K8RC 3LN4B 5A2JH 5E94B 2OTWA 5HGAA 5A6MA 1UCBH 5FGRA 4JGNA 1KJMA 2NUTB 1OTSD 2D31B 4NZUL 4Y2DD 2MOGA 3HI1B 4BJLA 4UOQA 1YEDA 3ECVA 5GSVA 4RMSA 5IWLA 3CVCA 2FZ3B 3MLYL 4ADIA 4DWHA 5LUMA 3RTQB 2NY0D 3BISA 3MLSL 5BMFH 5F6HJ 2EVHA 3BE1L 3ZZLA 4RRPA 5C92A 2P24B 4PRPE 3PIQA 5EC1A 4NPYA 4NGHH 4X7FC 4XP9L 1KEGL 3ULSA 1BQHA 4I0PC 1HSAB 3HC4H 2OMZA 3ERXA 3HLAA 1MQKH 4KV5F 4HOZA 1FDLL 2RMNA 5ITBL 5TPWL 1VCBC 2V17H 4PJBF 4Y2DC 2FBRA 4TQ8A 3PWUA 4XO5A 5TE7H 1MCEA 1T7ZA 3T3PF 5GRVL 2DWSA 3GI8H 1XSOA 1E65A 3TO4D 1YY9D 2G3XA 2ZYIA 3EGDA 3S8WA 2YARA 2A9MH 5DA0B 2EVGA 3LN9A 1R5VB 3QPXH 4MJ5B 2FHCA 5GZNA 3H0TA 3UZQA 3S36X 4EZJA 1CQYA 3DX1A 4OLZL 2XXMB 3D33A 2J55A 1U8PB 3UBGA 1PW3A 3CFNA 1CI5A 3U2IA 3EJYC 1QMUA 1TO4A 3NJHA 1EJOH 2J1WA 3DYOA 3ML8A 3EOBB 1RZGB 2A9NL 4K8RH 32C2A 2Z93B 1LE9B 3QUYC 1J1OL 2E0PA 3C8HA 3TCLB 3RVWD 3S3DB 1USQA 4KXZI 4DKFH 2OKMA 2XX1A 2Z31A 2VDNB 5J6HB 3BX7C 2X44D 2C4XA 3SZKC 3KPLB 2ARJQ 1T6BX 3ISYA 3BUTA 2WB1A 4X9YA 2FO4B 4F8OA 3BEVA 2WVSA 3D18A 3O6FC 1XIWA 4O51B 1ND0A 2DZEA 1JNLH 1E8WA 2PP8A 3SKOA 4UU9B 2NTSP 3FTGA 2X4RA 2QVTA 3QIWC 3K91A 3BEWB 4N0YL 3QIWB 3WY3A 4OTXL 2CRZA 1HHIA 4BZ2L 2HJKB 2P5ED 1DCLA 1FFRA 3QW9A 2CDGB 1VGEL 4OFPA 4DKDC 2AC0A 1NEZG 4LCIL 3FPXA 4MMZB 4B3VA 3DTUB 2GAZB 3A24A 4DTGH 1A6ZA 2YWZA 3DPBB 3EF7A 5D70L 4FEMA 2VZVA 4HZLA 1D5XB 4MJIA 4N8PA 4QXTB 2EKJA 1P0SE 2ZOTA 3RDJA 1ZS8A 1ZIAA 1I8LA 4WNJA 1WFNA 4KNSA 3UTTE 4Q6IC 3F05A 3GJFH 4P5MA 2X0WA 1GYAA 5C8JA 1X7SA 5E7BA 4YZFE 1KC5H 1KGJA 2FHFA 3FCSB 3DBXA 3SB3A 3UTSB 3JYBA 5JXED 5AW0B 4GPVA 2UWEB 1ZTXL 2CHXA 2GY7B 4ZW5A 3GSXB 1G9EA 1E28B 2WQ8A 1BDYA 2J1XA 3WKPA 4F3FB 1MFBL 3QCTH 3SHSA 4AC2A 1DQVA 4LLYB 5KBKA 2AGJH 3PHOB 1JZ5A 4FXTA 4K8RL 4U1IA 2IOIA 4OCWL 4XNUL 5H37G 2C9RA 3ZIYA 2KQNA 5T3XL 5AAWC 3M88A 4JKNA 3KPTA 1NCWL 4QRRB 4B0MM 3G6JF 3I3EA 5MERA 5IW6A 4UM8B 3PNWB 4Q2ZB 1WFTA 1SYVA 4QYAA 2BDNL 3BWSA 4KDTA 1M7IA 2CH8A 3C60D 4HGKC 5FO8A 4JNXA 2HWZH 1V3LA 3E6FA 1F4XH 2ROYA 2C1PA 5EFIB 2H3NB 7CGTA 1OARL 1JERA 3MRRB 3T3MF 1BZDA 4Q9RH 1S9YA 2YOAA 4WK2B 2BNQD 1A1OA 4JRXB 4X6EA 4NJAL 2E47A 2PCPA 3VQ1C 3NQKA 3NCYS 5HYSA 1N0LA 3QRGH 1S7SA 3KPNA 3MRKA 1I3VA 3CHRA 4PP1D 2X2IA 4TTDC 1T0NB 4G6KH 2IQAA 4FG2A 1Z2KA 3AT0A 1NGYA 4K7PL 4U1MA 4BQBA 3H1ZA 4XMZA 2FJFA 3EJZC 2GK0A 2QADB 4HGWA 4XXCC 2JCWA 5FV2A 5B38B 3A4DA 3RB5A 1BFSA 1LXMA 3I3BA 3BQUD 2WANA 2HTLD 2V33A 2QSVA 4F33B 1IFHL 5GRWA 3G6JA 3DO3A 1I7RB 4FCAA 4NQCB 1JRHL 5KZCD 3OL2A 5B21A 3WL9B 4LRIC 3SCMD 4HS8H 2AJYL 1BV8A 3CBRA 3LNFA 2Q7YB 2K3TA 3QORD 4H13C 2VCOA 5I0DA 3GB7B 4LDCA 3ME0A 1VERA 1MNUH 2YN3A 3ECWA 3ILEA 3NFPB 3F7QA 1WZ1L 4P2OB 4U1IB 1WYJA 4LPYA 5I16A 4JVWA 2VE6A 3C2SA 3WUWG 4M62H 1DQIA 2R4RL 4AV4A 1RJZB 12E8L 1H3PL 3DOHA 1M9SA 3V4PB 4DZ8A 2TSBA 2RJMA 1EBAA 3S48A 3X1FA 1PZDA 3S3PA 5SX5K 4PJDF 2AQ3A 1MF2L 1Q0XL 4DGIL 1A6UL 3IFOA 3NJXA 3IKKA 4JRLA 5EN2A 3BZFA 1HAUA 4WEMB 3VXRA 2CNYA 4LIQH 1W8OA 1IAKB 4PJXA 2DJSA 3DTDA 1JXDA 4E9XA 3PIQB 3GS7A 5B3JF 4R84A 4OIIH 4H88L 1A7NL 1NM4A 2I85A 4UTBH 1H3WM 3FO0H 4JLRB 3WKML 1YDPB 5F1NB 2X6MA 5CAYB 1S7UA 3AQDA 2GKIA 3IDYC 3UP6A 2HMID 3S8FB 4WFHD 5JQIB 4J2QA 4U6YA 4G6FD 2M1KA 2G5RA 3QARA 4M6ML 4WKXA 2OXGB 2Z7WA 5I8KL 4UT9H 4BD4A 4JDVA 4CRPA 3NK4A 5D7LE 4GUOA 1A7QH 1K72A 2IDQA 2NCEA 3D9AL 1MVUA 3DX8B 2PPFA 3ZDYB 4Y7MA 4Q52A 4HH9B 2AJZB 4QHLB 3K2UL 4HC1A 1CLOL 4CSTA 1SVZA 4Y5VB 1JGLH 2F53D 1BWWA 2ICES 4HUWB 2CNZA 3FOLA 2ZJSH 3IGAB 2XWJB 1YYML 1MAJA 5FXCH 4APXA 1ORSB 3O8XC 1U6AL 3CWGA 2XA3A 4FKEA 1E4XL 5AW3B 1OAQL 5INCB 3U4EB 4L4TD 2F8OA 4FFZH 3LMJL 4NKQB 5CJOL 2FCBA 5J5EA 2E74C 4Y2LA 1JS4A 1YECH 4QRBA 4A6YL 5FO9A 1ULVA 2AQ2A 2XV0A 3HW7A 3JVFC 1ETJA 4WW1A 3WIFA 2KLTA 3UAJD 2X89A 4CVZA 4XC1H 4JG9A 1DBBH 1YEEL 3CXDH 4FS0A 5E6ID 3F00A 1RHFA 1AGCA 4KOCA 1JPGA 4G6AD 2I5YL 5I23A 3MR9A 4DK6A 3W1ZA 4WSGA 5CEZH 1PD0A 3O41B 3QJTB 2Q2EB 1MEXL 4OCYH 4ONHA 1F8TL 2NY3D 3LNGA 4XCCL 5FGCE 1HHJA 4FFZA 1SLWA 5EHFA 3K5RA 2FECI 1ONQA 2Y7MA 1AD0B 2AQRA 4ELME 3QR0A 4KTEH 3V0WH 3VCLB 1A1MA 43C9B 1TZHB 4QTHB 1BVNP 2MTAA 3E2HC 1KLFA 4XH2A 4XMXA 1XSKA 1XCTA 4PS8A 3D85A 3MRFA 3TF7C 2WCPA 3BSGA 5TF1H 4JN2A 3BWZA 3SE6A 3RJOA 2YD4A 3UC0L 1F3DJ 1X7TA 4OLVH 1EMTH 3TJEH 4HJEA 4KY1H 2HFGL 4DSYA 1XFPA 3ARFC 3IDNB 3KPSB 2H0PA 4JG0H 3TESA 1UM6L 3CFJB 3N1FC 1RI8A 1K3IA 1DTUA 3TJPA 2EEAA 3B1UA 5J3HC 3UP1A 3ZE1F 1HHGB 2PYEE 4HPOH 3BD5A 4JN1H 1XDTT 5IR1A 4WFFE 3CCHB 2QJDA 2F5AL 3CVHB 4X98B 4HLEA 3GMNA 1CE6B 1JL8A 1U93B 1AS7A 2JTDA 3QUZD 3OF6D 2BRQA 1UJTA 4K07A 1NC4D 1FL3A 4B9GA 3HS0A 2A6DB 3FYIB 1H6FA 4PJGF 3LJ3A 1O0VA 3N6YA 3TS8A 4N0CD 1SEBA 4GRLD 1R47A 4P2YA 4F2ME 1HCYA 2D0FA 1RKRA 1GCYA 4U7MA 3WSQL 4EDXA 3MOAL 2R39A 3E8VA 2IBZX 3L16A 4P4KB 4UTCA 3HI6H 4KI5E 1HXMA 5CINH 5C0BA 5D7LA 3GEFA 4AM0B 4Z3GA 2BFGA 3I50H 1SY6L 4PJ9A 4O02L 2QSCH 1QFOA 4P46C 4YEEA 1OGTA 2ICWI 2R0WH 3L5IA 3FQ4A 4DEWA 2FWOA 4RQQB 1BD2A 3RVXD 2W0KA 4NNYB 4Y1AD 1IKOP 5A2CA 1OHQA 1PFOA 1MH5A 1AHMA 4EKJA 4G7YL 3L4CA 4AJYV 1CFMA 5B8CA 1KXVA 1CICC 1OGAE 2AEQH 1JV2A 3GTNA 5E8NB 5ACZB 3HG0A 2FEDD 5CD3A 3UBHA 1CGWA 2ADJA 2BSRB 3OMAB 5ETUB 2MEJB 3E6HB 2CSPA 1MFAL 1UXSA 3L5WB 4JQIA 5EOTB 4Z7VB 4CVWA 1E6JL 4WTXA 3MKGA 1YC7A 2NY5L 4UOW1 4Y4KA 1T66D 1FZJA 5DURD 2C1PB 2J56A 2YD2A 2WZAA 4PJIF 1JZ7A 1NSNH 2FQGA 2X4UA 1MNNA 1R9FA 1PX4A 4PRNA 4V2BA 4UOJA 2CO6B 2B20A 4M8UA 3QRFM 5DJ6A 4M9PA 2OMWB 1NBCA 3HZKB 5IMKA 1XF2B 2FBOJ 2R29A 3HZYA 3V9EA 3OJ2C 4W9ZA 3FAWA 2DQEL 4IRSC 1I8LC 2R1WA 1FNLA 4R6UA 4O2EA 3RPKA 3QHFH 3H0TB 1E2ZA 3UZQB 4AYFB 2A4ZA 5DWUL 2F7RA 1V3MA 4HJ1A 4EI6B 1YMMD 3CHOA 2Q76B 4QUOA 4OM0L 4YWGL 3ZPDA 5I28A 3WDIA 1KXVC 1UACH 2IPTL 4KJYB 5KYYA 4ORGA 2AW2A 4D8PB 2DMGA 5I76A 3SDCD 2X9ZA 4Y4HB 4DZBB 4LO9A 2RQ8A 3JWDC 4HV8B 4FULA 5DO2C 2XT1B 4IOSD 3PAZA 4OJYA 1TSRA 4Z7QB 1KTDB 3UAFA 4C54A 3QJQB 3U9PL 3VXUD 3KDPB 2IEPA 3JWOH 4TQPA 4A2DA 2F53B 5ELIA 3S34H 3BW9A 5I8CB 5HVHB 1CF8H 1DANU 2CR6A 2AFNA 2Y2YA 4X6CB 5DMKA 4NHUB 6FABL 3ROOA 4LLWB 1H5BB 4OLWL 2FR4A 1G9NL 3FO1B 2AITA 2AZAA 2FZ3A 5CEYB 4XWOD 1PMYA 4X5RA 4WWPA 1PIFA 2C3XA 2F8VA 2ZOLB 1RUKH 3LNDA 4L29B 2Y6SC 3BAYA 1DVFA 4LP4A 2YFOA 3N91A 4K71C 1H3UA 2HJKA 2WGXA 4DESA 2ZQKA 3A6BL 1QOKA 4ZS7L 1ACZA 3M07A 4JAMB 2E4TA 4Q4EA 2BFVL 4JS7A 2FB4L 2P52A 1ZLWH 3TLRA 3CZJA 2WJ7A 2BINA 1N4XL 3GPEA 4OUOA 1RZ7H 2K3HA 1WBYA 3QUMH 3KH4A 3ZKQD 3SBPA 3S35H 2PR4H 4AXWB 4CN1A 1IVTA 2IQ9L 4KITB 2BVUA 3OR6A 2EDQA 3BT0A 1QTSA 1LK2A 3QZMA 4YNYB 3ZE0E 1MCKA 4Y4FB 2XTJD 3EFOB 4RBPK 1H3XA 1ZDSA 3G5VB 5L2KB 3RGVC 4ZDHA 4MD4B 3D51A 1AGBB 1I9IL 4AYDC 4MAUL 1G6RA 4J6IA 1OF0A 1U8NB 4WWOA 3UJTL 4N9GB 5HYQA 1UACL 1OTUD 2IPTH 3JBG7 5I24A 1AXSA 1ZVHA 2DQJL 5JDSB 4R90L 4EXPX 4R4BA 1G4RA 2K6ZA 3ARED 3QAZB 2E6PA 3K0WA 1QNZH 3MV11 3KHQA 1KTRL 4FQJL 4W4OA 1PY4A 5JR1L 1HXMB 2OP4H 4IIQB 2J8HA 5CZXC 1DVUA 3SKJH 5AD0A 3UJJH 3LH2H 4JDTL 1FA4A 3NSFA 4HXBH 2H47C 2HFEB 4BXSV 1BYOA 4GEJA 5D2LE 1JV5A 1GGIL 1PDKB 2D2CC 4YK4B 3MRLB 1G9NH 3UG5A 5CFAA 1P4LA 2J12B 4JG5A 5SV3A 4KXZH 1A6VH 3TVMA 4KO6A 1WBZB 2R9HD 4E9VA 1A9EA 3R06A 1KB5L 3EJCA 3KCPA 2CXGA 5I30L 2A83A 3BSHA 2OMYB 3HUJE 4BUHA 3ATEA 3HE6B 5D8JH 1FFTB 1A1NB 2YA1A 2PXYB 1OTTD 3RVWC 2O26U 3C87A 3P4NA 4ZJ9A 1I8IB 4HULB 3CSFA 3ECUA 3WXWL 2FR4B 1K2DA 2X4TA 1E8XA 1NMBH 2Y6SD 2YBRA 4YHLL 1U2CA 3HE6C 5IVXA 2K9FB 5KSBA 4WKZA 5J9PB 1A5FL 1MCRA 1X5LA 2HUEA 3FC8A 3OMNB 4ENED 1HE7A 1RFDL 3PWVA 5F88B 5BZDA 4JE0A 4TV3A 4QD2E 3C5ZB 4PI2A 1EVTC 5DRNA 3PPEA 1XH2A 3OG4B 3ZT7A 2W9EH 1DJIA 1XH1A 3LXBA 1UZ8A 5T5NG 3WFZA 3HE7B 4R90H 4L8SA 3BH4A 2Z8WC 4NO5B 4PB9H 3SGKC 3O3DA 4M6NH 3OG6B 4GSUA 4DO6A 4NO0B 4R4BB 3IVKB 1VFBB 4YHZH 3MRJA 5FKAA 5E4AA 2R83A 1EFXA 4XVTH 2EO7A 3D0AA 4CVZB 3D48R 4OFYA 5FV1L 3OKLB 1ZWIB 4U3HA 4LU5L 1THAA 2HWZL 2W5PA 2UXTA 2Y7SA 3VXNA 2XQBL 4BFJA 2DTMH 1NEZB 4Z7UB 1T2QH 3ATAA 1YNTF 2HKHH 4ETYA 5IMLA 4JFFA 2JB6B 3AITA 3L7FA 5DUPL 3MNZA 5JOFB 1IBHA 5BZZA 4G42A 2D7OA 3GZQA 5FB8B 2GIXA 2XPGA 2KC0A 1C8QA 1VACB 3UG3A 3ECBA 4FQLH 3IDXL 4QXVA 2R0ZH 5HJ3A 3QEQE 4AGMA 2VLJD 1Z66A 2YJQA 2FYYB 3DSNB 4QRRD 5CILL 3T1FA 1MH5B 3F7LA 1U2YA 2EYTB 3GFUA 3VXPB 3MZGB 4FQQB 5LG1A 1FRGH 1OSYA 3FQNA 3GNMH 3CK0H 2YPKA 2B59B 3N85L 3POCA 4LFHG 3WTXA 5F0MB 2O4EA 4IK7A 4DQOH 2VQ1A 1JCKA 5TQ0L 1FZKB 1RSYA 2AKRB 2XVGA 4FTVE 2X6UA 5I75C 5AW4B 3V6ZA 3RX7A 1I85C 3VG0L 4HEME 3E8UH 3IFNH 3F12B 5DYOA 4PJCB 2R2EA 5CD5D 4NKMA 4N2IA 3RKDC 1DANT 1JZEA 4UINL 2EO9A 1AKJA 1P4BH 5FKPB 5DS8A 1SXSA 1X5KA 1MREH 4UQBA 2WKOA 4EDWL 4F24A 4NPJA 3UPAA 3FQXA 5E1AB 1PKQE 1QZNA 3SDYL 4OT1L 1G7IB 4NN7C 3WIHH 3TO4B 1UZ6F 1OW0C 2AS5M 3FSOA 4MKTA 2YC1A 5SWSD 3N1GC 4JPVL 3QORA 4ZUVB 4PV8A 3BAXA 1RJLB 5C0AB 4J8QA 1BECA 1U8LA 4V2CB 4JG1L 3LDBC 5CJXC 5F2FA 4FG6D 3REWA 3US9A 4UOW0 4MZ3A 3NIDB 4X0KB 3L4VA 1CL7H 1QSFE 4DP9X 5INDB 1YEHL 2DWDB 1JDDA 3U7WL 4DKTA 5JW5B 1D5IL 3NDYE 4LLUB 5EOQH 1KCUL 3L4YA 5EDXA 3EBGA 2FLMA 2ZXEB 3S4SG 2P45B 4LL1A 4YBQD 1P6AB 1DUYA 3O2DL 2ID5A 3NVQA 5ICXA 4MS8D 4OGAD 2GFBB 3RNKA 3WUWB 8FABA 2A5UA 3BAJA 2HT4C 2JQZA 4D0BA 4A6YA 2G5UA 4AYEC 4YHML 4PJCF 2WVTA 2CM5A 3B6SB 4CSZA 4JFDB 2G2RB 3FK3A 3STLB 3VG9B 3ZN6A 4M00A 1RD6A 1QTYT 2XRAH 4N85A 2R7EB 1ZY9A 3VG0H 3BP4A 2Y22A 4FJYA 4J28A 1ZT7B 3VXSE 3ESNA 3MOBL 4XVUD 4JO3L 1Z0NA 3RL2A 4JK0D 4N0FA 4QRPB 1MREL 4TLUA 1R24B 5JW3H 2CHZA 4L3CA 3MQIA 1HHKB 4MCNA 5D2NB 2OL3H 1MCBA 4HIQA 2CKBB 4P4KA 4YR6B 4F8TA 3MRQB 4JRYE 3ULVL 4WEEA 4CILA 5IFAL 2HG0A 5AB1A 5FYLD 2OZ4A 1CDBA 3PGFL 3VO0A 3T3MB 3S6CA 3NIFF 3HUJB 4EQ2A 2IGTA 2Z34A 4FXKC 4MASA 2KZKA 4NWUL 5EOTA 2ZUUA 3ZT5A 1KZYA 4NB7A 3BPCA 4LPTA 4J7RA 2Y1AA 3FOMA 3O6KH 4Z7QF 2OXGA 2FE0A 4HEMA 2L04A 5I9QC 1IE4A 2B3RA 1SJHA 3RVTD 4QXTA 4C59B 2MCAA 5IMLB 3P77B 4L5FE 4KGJA 1HHGA 2F58H 1KJ3L 3GHEL 4P9MH 5HD8C 1J8HE 4YSOA 4ZMQA 4M8QB 2ZYSA 1JPFA 2P1YA 3ABMB 3ABZA 1VSCA 5M7QA 4P57A 4QTFA 2P8LA 2IDUA 3EYSL 4QOKB 4BXVA 3F84A 3PS6A 1EGJH 1WJ3A 1G7LA 3L3IB 3MMEA 1U8IB 2AV1A 3FXIC 1ZPUA 1TJMA 2B39A 4FNTA 3T0EA 2V5YA 4UQ2B 5KVFE 3G6AA 4JKMA 1JIBA 3AQYA 2K70A 4MHHG 3HHRB 5BO0D 4JKPL 4YEFA 3RU8L 1BIIB 1KB5B 3NH7H 5T1LB 2ICEB 4RISH 1I7ZB 1QSFB 1UA6L 3BIKA 5K5YA 3QCVH 5AB9A 4ZAKA 5K33A 3KPSD 3CZSA 3HFMH 4QHMB 5C0BE 3FFDB 1WPCA 2Z93A 4QEGA 5TE6L 1YQVH 1DQML 5BNXD 3NRPA 4RFNC 2MPAH 4U6VH 2WCGA 4LLDB 5FHAH 5FAAA 2XJKA 4IRJC 1F3DH 2XKNA 3MAWA 3CFIC 3HI5H 3K5SA 2QV4A 4KPHL 4NHCH 4FNLL 4XMKH 4NZDA 2MNUA 3O0LA 5B7FA 3DRQB 1DSFL 5GZND 5IW1B 1QVOA 2X40A 1NINA 4OY9A 2O5XH 1RIUL 1P6FA 3FAXA 4Y9CA 3WKQA 4RMRA 4XP5H 3CFJA 4AEEA 2HRLA 1DSYA 3H7BA 1W0WB 4X8CA 3SGJA 1Z5HA 3T4YA 3M1OA 3C12A 2CA3A 3NCBB 2F58L 3DX8A 5EPMB 1AZRA 5AW6B 3ZMRA 1F6LL 3TVMB 5AFAA 2PWGA 3HR5A 1IC4H 2X3BA 3GQFA 3H9SE 2WHVA 3CFDB 1XB3A 4KKBC 4QTIH 2Z92B 1EFQA 2YXVA 4MJ4A 1U3ZA 2ZOKB 4Y4FC 3LAFA 3OF6A 1N2RA 4O02A 4PMEA 1EAPB 1K8DA 4HUUB 3P3YA 4LP5A 5I76B 2Z35B 5IBLC 1GGBH 1S9XB 2OK0L 2DQTL 4A2MA 4U6XB 1F11A 2H9GB 2HCZX 3ZXAC 5MEOA 5F1OB 5FECB 3WHXA 4MD5B 1SFHA 3PV6B 4KJWC 4RLDA 4ZMWA 2WZ0A 4W6WB 1OAJA 2V5RA 1TVHA 2X87A 4M7ZC 4M62L 4ZUTA 3I6LE 4P05A 1MG2C 4HJJH 1LDSA 4PB0L 2ZXGA 3CFEA 3DSFH 3VB8A 4M5TA 2MHAB 2BH0A 1XGYH 2GG1A 2NYKA 4PRNB 4NP4H 1U8QB 2XBDA 4RX4A 2UZYB 5KG9A 2H1XA 4OH2A 3BZDA 5TJWK 4CU6A 1NFDA 4G6KL 5LXGL 1IU1A 1D9KA 3MV8A 3D3VA 1OIOA 2D73A 3H53A 2ICWA 3TWCH 5IT2L 4TOYH 4YBQC 2CK0H 1BBJB 4P9HL 3SOTA 1SDAB 1KPRA 4YAQB 1M7DA 4FQIH 3MLXL 1Y6KR 3V79C 4IRJD 3QQXA 4NQCA 1GGCL 3F58H 4Y2DB 1GVIA 2ENSA 2OQJB 5BRZB 3PQYA 3VGBA 1C1EH 2DYRB 4B50A 2F19H 4PCYA 2X09A 3FDWA 3OKOB 4R3SA 2VDOB 2AF2A 4G5ZH 4PQXA 1XMEB 1Q0YH 2L0DA 1RJCA 1WGVA 4MQTB 2BNQB 4NOFA 2X42A 5F7AA 3U2SA 2EDEA 3ULUL 4GXFA 2DQDL 1MJJA 2O6CA 5EC2B 3MRKB 4QRQA 3DTXB 3V0HA 2V6HA 3NJNA 2J1ZA 4NENA 1A1OB 2N1TE 2JFCA 4X6EB 2WYIA 3QJFA 5I1AB 3DRTA 3H42L 3OAYK 4JAMA 4PH8A 3A67H 5BO1L 2IOOA 5TH2B 4HQQL 5DHDA 4KMTL 4B7IA 3EYQD 3NJVA 3KPMB 4BYHA 3FB8B 1Q9KB 2J20A 4N5EC 3GLDA 2DQIL 5DLMH 1MJ8H 1N64H 4JBSA 3X3GH 4YLBA 2JCCB 3BQUC 5ESAA 2W65A 1COBA 4O2EB 1D7FA 4UT6A 4MJID 3ZYOA 1JGVL 4HWEH 3VXQA 5I8CA 3CDGB 3UGXA 4Y0GA 1R17A 3RG1C 1QW9A 1XTLA 5IEKB 4JRXD 2Q7YA 1Q9OB 4Z3JA 4FN0A 3QZBA 1BX2B 1RZQA 4DOHE 4MD5A 3FU7B 1VEMA 3FTXA 4BA0A 1EVUA 2VDQH 5DJ8B 1BBDH 5DHMC 5EUKA 4ISVA 1H3VA 2EIBA 3LIZA 4LLQA 4YFLF 3HC0A 3V4LA 4GP8B 4HV8A 2FJGA 2KPNA 1WAAA 3LZRA 2YK1H 4JFDA 2H32H 4AQEA 4XBGA 5AOIA 3U2JA 1JVKA 3QFDA 5KSVB 4JHWH 2BNRE 4K3EL 1KGWA 4UNTA 3RI5F 1VACA 1AQDB 4PRPD 5B8CC 1U8MA 4PEEA 1K9TA 4K5MA 1ADQL 4X7SL 1GJIA 2QLVB 4AEIH 4JFFB 1A6TA 4IRZH 5AW9B 3MLPA 1EHLH 1E9PA 3E38A 2NY0C 4PV1C 3U0WH 1FV1A 3K1KC 4DP8X 3KGUA 1JZGA 4TSBL 2IH3A 3IBEA 4NSKB 4XP4L 1QBMH 2WP3T 4JFPB 3ORJA 4B41A 3FUDA 3DV4B 2UY7B 4PWKA 4PSRA 1LO0H 4IIQC 4LLDA 3SGJC 2LU7A 1GC1C 5IHZB 5D1QB 2XXGA 1B6UA 5C0BB 5T1LD 1N64L 5K1JA 3ZDZB 1QASA 4Q9QL 1IBDA 1QKZH 3DX7A 4HKBA 4LAQL 4NO5A 1Y18A 4AUYA 5C07B 5KAQF 1P7HL 4WU7B 4XC3L 3KW7A 1M6UA 2MQ0A 1L9TA 3HVNA 4LNRB 3D69B 1KUMA 3IDMB 4PJGB 5T1LA 5FYKD 3TYGL 5CNHA 3OJMB 4DKEH 4Z3FA 1RPQA 3T6ZA 3LXUX 2RFXA 5HDBB 2QHRH 3W9EA 2YGPA 2VDQL 3CFEB 3TO4C 3PWVB 1SLXA 4WV1C 4X7TB 5C0CE 1BZQK 3F7PC 5HHMD 3HE6D 1EH9A 3GZOA 3WXVH 1CD8A 2CBQA 2W9DH 5IHBA 5I2IA 4A04A 1BQUA 5FYJH 3K0YA 1MW3A 4NNXB 2J2ZA 5IHWA 1JHTB 1OCZB 1D7BA 3SPVA 4BDVA 4N90D 3ROLA 2PTUA 1RL1A 1LEGA 2DIAA 2ZKWA 2X5PA 1G7PB 3BVVA 3CDZA 2HKHL 4LDLB 1EAPA 1A6AA 3MYJB 3NACL 1FFNB 2AK1L 3P77A 3IDNA 3KPSA 3OLGA 2VERN 5FUZL 1X5YA 1X5GA 1IGML 3G5YA 1JZJA 2L7EA 1UXMA 2BRRL 2FB4H 2VABB 1BOGB 4E9SA 1SOSA 3FFOA 3P69A 1KENH 1GTFA 5EC1B 5IFJB 4MMXC 1OCWH 5EPMA 3QDHA 5L0QB 1QUPA 5CHNB 3VI4F 3ZTCC 3ULUH 5JA9A 1CXIA 2ADIA 4Z7WB 4G6JH 5H4YA 2LU3A 4AVKA 4FFYA 1JWUB 5CKAA 4J6RH 4G8AC 1JPSL 4MAZA 5HVGB 2EYSA 2LW3A 1VEOA 1LO5B 4NBXB 1BLIA 1DBMH 4HX1B 3G3LA 1DQJA 3MLTA 5L2KD 1ZLSH 4O2FA 2O6DA 5DWUH 3C6LA 4LHQB 5JTWA 2V9TA 1SNRA 2VITA 4U3CA 4U1HA 4HZAA 5IVZA 1CK0L 4LXFA 1I3GH 3AXIA 1IBGH 4FYQA 4XOAA 2LE9A 3QO0A 3Q6GH 1EZVX 4QYOA 5DHVH 4ENEC 1FVEA 1S2EA 3HHMA 4HOXA 2ZT9C 3LKNA 3FUJA 4HIHA 1CDCA 1L9PA 4I1RA 1MFAH 3DDFA 3VFPA 5LVEA 2VLRD 4C83B 3QUXB 3DROA 1UCTA 5I0XA 3D5OF 1NGWB 2RHEA 3B8YA 3MRBA 4I0PA 2J8UA 3S4SB 3FRPG 4QO1A 3EYVB 3WD5L 1J5OH 5HHMB 2AK1H 5MHSE 3G5YB 3KEDA 3QRGL 3FQRA 1F4YH 2GJ6B 1IQDA 2X7LB 1M05B 3MUJA 4FQ1H 4NQED 2BW5A 1HXYB 4DHLA 1BA9A 4J3VA 4XCYA 3J07A 3P30H 4XAKD 5D72H 3CHPA 1U8CB 2C3VB 2OTPA 1JCVA 4A7GF 5JZ7D 3FOLB 4EVNB 3MRPA 3U0TA 1G87A 2J2ZB 4YGVA 1WUZA 2PWEA 4LPWA 4JFVA 1Z9NA 3GBDA 3TA3D 2K6WA 2V5SA 2D7PA 1KYDA 2PR4L 1IM3D 1K5NB 1CFBA 3PJSA 5I0VA 4KROB 2CKBL 3STZA 4FQHB 4KBPA 1PKQB 1KT2A 1V7NL 4JVUA 2GSGB 2JJVA 4BSWA 1NLBH 4LLYA 2OSLB 3MXWH 2UZIL 5L7XL 1KGIA 5T3XE 2Q86A 3KYKH 1F6FB 4DAGH 5DS8B 4XTRD 4R7LA 4HC1H 4DZ8B 1QKZL 3IMSA 3SE8H 3P9WB 5BXFA 5KVEL 4PJCA 4L4VB 2AEWA 4NQXA 3T2OA 3X1NA 4Y16A 5H94B 1OLLA 2PN5A 2YGQA 4LRIA 3MLRL 3Q06A 4J2XA 5F7UA 4NP9A 3H9HB 5ID1B 5FA4A 1QG3A 1KXQA 3DX9A 1MFEL 1ROCA 4KXDA 4GEIA 2VC2B 5HYQB 1X9RA 3BZEA 1EX0A 4UM9D 4Y1TA 5I5JA 3GD1C 2CG9X 1QSEA 2AI0L 4MX7B 3RWCA 5A16A 2WLLB 5E8PB 4ZS6D 3T77A 3AT9A 3QNZA 1PD6A 3P3RA 4YSUA 1VKXB 3BESR 3EGSA 3P2TA 1XCWA 4U1MB 3V0GA 2AK4B 4DGYH 1VF5C 2NQDA 2VMEA 3PDOA 1JI2A 3DUHA 5DJAA 3SKOB 1PAMA 1KLUA 2XIDA 1GC1L 5KS9F 4FC3E 2BSBA 1NM9A 1V7MH 2DYPD 1ILUA 4HSCX 1RZKL 1S7SB 3KPNB 5SX4I 4LQFH 5I15H 1PS3A 5GS1A 1LWHA 3B5TA 3WJJC 3ZW3A 5JW4M 5CGYD 4WTZG 1J8HA 3KGRA 4QRPD 1S7TA 5H8DA 5DZJA 5FM5M 3UCQA 1BZOA 4XVSH 1BMWA 3IGLA 4PJ5A 5IJKC 2C3GA 5DDHB 1J5IA 3GJEB 1F56A 5DEZA 3Q1EA 4RDQG 1JWUA 3V9CA 2DQJH 3SGDH 3T2LA 3I84A 1AIFB 4OR1A 5KVGL 3MLVH 3B5HA 1PVHA 2PLTA 2IO5A 2VISA 3FTWA 4FQ2H 4HS3B 1OPGH 3DVGA 1U8PA 4JGJA 4EN3A 5GRZA 4DFIA 8PAZA 2IFGA 1OAQH 3R4RA 1J05A 3Q2NA 2VMCA 5DZAA 1G7JA 2IV8A 3D39B 1HX0A 1VFAB 3C9NB 5LGJB 4F3FA 4B7LA 1X4ZA 4MXVF 5I8OL 2A7BA 4YL9A 5DZLA 4BRVA 2NW2A 1G7PA 4KMLB 1E4HA 5SV4A 4A37A 3ZZQA 1TQCB 4NUQA 2JSFA 2NSMA 2MPAL 3GZKA 5ABDE 1Z5LA 3FRUA 1U30A 2EDHA 1RVFL 2J88L 4IRSB 4YVUA 5T3ZD 2GJJA 2R23B 3RWFA 2JQAA 2E7HA 4PJAE 3ZTEA 5BV7H 4H7VA 1BZEA 1VZIA 2GTQA 4J3UA 3IKCB 3L3OA 4L5FL 3WMQA 3T8VA 4X4YB 2A2QT 3D07A 4GMTH 1RIUH 1CWVA 7PAZA 4X5QA 5EUOE 3ULUF 1T03L 3GMMA 1GJUA 1GZHC 2FL5B 3WKNA 2P5WE 5D1ZD 1DEEA 2PPCA 3T4AA 2J6EA 5HJ3B 5SWZA 1UFGA 4GAAA 2FEEI 2GQHA 5D4IA 6PCYA 2QGEA 4F8NA 4N22A 1J10A 3PV7A 2EVFA 3E6HA 2JKXA 2VL4A 3GRWL 3QI9B 4AEHH 2AJ3B 5I19H 4HHGA 1BVLB 5CFHA 1A6ZB 3AFLA 3ZKMD 4N0YH 4UDTA 5G4NA 1E2WA 2FO8A 1T1WA 5SWSE 1ID5I 3AREB 4K9EL 5DD6B 2WLZA 2X4QA 3ETTA 1QEWA 3L95A 2ZPKL 2DL9A 5E8DH 3CLEH 3VWKD 1CO1A 4F8PA 4IKIA 4RFEB 2WN3A 5FOBA 1FH5L 1P7QD 4JO5A 2A6IB 5F8QC 1N0XL 2N3JA 5DJ2A 3VFTA 5KBDA 1BJ1J 4H4NA 5TK4A 3T0XA 5HHXH 4PJ8A 4PCTA 3VMPA 2CBOA 2H9GA 2NY4D 2X38A 4CSSA 4RIRB 1NFDB 1S9KC 1L9OA 4TVPD 2HVKA 5KS9A 1Z1WA 1KYOK 5DEJA 5AOLA 1NAKL 2XIBA 3L2MA 1KTKE 1SBSL 2DLGA 3EDKA 2XX0A 35C8L 3BKML 3IMWA 4NM8H 5DC2A 4I87A 5T8IA 3IDXH 3QJOA 5IVZB 4LVEA 4P46D 2J7LA 3E7JA 3K80A 3M17A 4MRBA 1NQBA 1BAGA 4ZXBB 4P49A 1A0QL 4FG0A 3AXHA 2KDYA 3FJTA 4WNQB 3RGVA 3ZKSD 4POZC 5E6UB 2EADA 4BUQA 4G80B 4KRPB 1S9XA 3H54A 3KYMB 3OXSA 2VXSH 4F57H 3H55A 2Z0BA 4GS7B 1E6OH 3SDAD 4KHTL 1FQ9C 5CP7A 3QUZB 3TTYA 4RFOH 1N5AA 4PTUA 3CU7A 2QDWA 1SQ2N 1QRNE 5GGQL 1WIOA 2Y07H 5DJYA 3QJHA 5HGDA 4Z76A 3K6NA 3UYOD 5DRZB 1PZSA 3VNZA 4UCFA 2C4FU 5DHYB 2HTKD 2F6AA 5DVNA 4Y19D 1KIPA 3FQTB 1S7VA 3PP3H 3A67L 3CNKA 4KKQA 3B43A 5ADPL 3SDAC 4H2AA 1UA6H 2VLJB 2DAVA 4G7VL 4HZ1A 4KKBD 2YMXH 4ORGB 3QCUH 3QJRB 4IIQA 2HLFC 2P5WA 1K6QL 3NN8A 4H1LG 5HHQB 1B0GB 1NCDL 4QYOB 3O4LD 3KPRE 4GINA 4UTAL 3WFCL 1LO4H 1EHXA 3DGGB 3MREB 1G7JB 3M8OH 4ZO7A 1VRSA 2YBGA 4HPHA 1RUAL 1WH0A 3N50A 2CPCA 5D96C 2XHNA 1RU9H 2OMVA 1IBFA 5K59E 1I31A 3KLLA 1R3IH 3CC1A 2BWQA 4R7DA 35C8H 4MS8C 4OGAC 1LK3L 5AVZB 1OAZL 4JQXA 4YDKH 3H3BC 5D7KD 1GZQA 3VH8G 5IG7A 4JX0A 4MHHI 2IANA 2R4RH 1EMTL 2WVUA 3RJDA 3ZJAA 5JPNB 4KVNH 2FJHB 2BK8A 3C8KB 2MQ3A 4NQSA 4UNVA 1QBAA 4PJ8C 4AKPA 4YSDA 3CLFL 4L8BA 2IQAB 2LQRA 4DP1X 4EIZC 1EA9C 1MCLA 2Y4SA 1UWXK 4X8XA 4LIQL 4PRAB 5E6IC 4UAOB 4NC1E 4YFLI 3EH3B 4RAVA 1G9HA 1NUDA 1X5MA 1NDGA 4X42A 4L48A 2CHWA 1FBIH 1HL8A 2Y1ZA 5JQ6H 1HNYA 3FUHA 3W38A 1MCPH 4ORZC 3GMRA 4Z77A 2XY1A 1YEWA 5EO0A 5TE4H 4ODUA 4FXKA 2HA1A 4DT2A 1HDMA 2LV4A 1SEQL 3S9DB 1ZVYA 3O2VL 1X5IA 1TTRA 2DM2A 3K6IA 5JW3L 4X8JB 3QI9A 1I3UA 4B60A 4TNVK 4HS6B 4X5XB 5IBUG 5J1TC 2X28A 1NCCH 1T83C 2RALA 3PJLA 7TAAA 1TJGL 4XCNA 4CA4A 1CD9B 1FH5H 1SQMA 4Y2OB 3TA3B 5BUPA 4IJTA 4KK8C 3NJMA 1SPDA 3AY2A 5AKVA 4GKOA 4WY7L 5GSRB 4OSUH 4WI0B 3QEHA 4CBZA 3NPZB 2NXZD 2JIXA 5HD8D 1LDPH 3ZGIA 2ZWZA 1IGJB 2BS9A 5EBWB 5EU5A 3LXCA 3RNKB 1U6AH 2CKBA 1A7RL 4OCMC 2ED9A 5DA4A 4YR6A 4PJFF 3EDDA 1F3RB 3ABGA 5CO1A 3QBTB 3G6DL 5L8JB 2QEJA 1F4WL 3SJVB 1FO0H 4Y1AA 5C0JA 1WLHA 4P59H 5JIMA 1MIML 4Z18A 3GSOB 2NY7H 3QFJD 4GAJL 4YHOH 1ZPLA 4C4BA 4FQIL 2O5XL 3EJZD 2EE6A 2HG5B 2ZWYA 3QFJA 1KACB 2BIOA 3JWNG 4M02A 2ETWA 2ZCHL 1L3NA 2QSQA 2G75A 5ICYB 2IXQA 1XO8A 3DHJA 4UIKH 4AVHA 4NDMB 4OJAA 3V0JA 3KPSE 4JJ5A 3ZK0A 4U2YA 4OLXL 1XR8B 2YPVL 3NA9H 5K39A 2X6VA 3UTQB 1FGVH 4QHNA 1SYSA 4U1SA 1MIEL 3WFBH 5CJXA 1Z9SB 4R2GC 2LT9A 1GMIA 3U4BH 3GUTB 5KSUB 4PJAF 1NH6A 4GH7B 4NRZB 1XBRA 3QORC 1JNNL 3GS0A 4IQHA 4PWIA 5FUCC 3E3QC 4U31A 2VLLA 2JF1A 4DP4X 5D71L 1MN4A 1TEFA 5EF2A 5I8EA 2MQGA 2Y9RT 4S1QH 2Q7NA 5FO7B 3UPRA 1UZGA 2DQUH 3SKMB 4MMYA 4HKXB 3RQ3A 2H41A 1SXNA 3L3HB 3WAJA 5D1ZC 3RZCD 3AUWB 1FVCA 3TURA 3VGGA 4PJ9B 2CUAA 3A4FA 1JYWA 1OSPH 2NW3A 2WBXA 4Y4KD 1P5VB 3VJ6B 4BBWA 3I75A 2QDVA 5KJ7E 1BFTA 4AQZA 5J56B 3P0YH 4DCQB 1E90A 1EZLA 1ETB1 4B95C 3K46A 5EBMB 3ZO9A 2MCPH 5JO5A 4ZMOA 1UWXH 3NCCB 1FFPA 3QE5A 3V2AR 6TAAA 3F5WB 1D6VL 2X4OB 4JCMA 1IM9B 1WWAX 5E4EC 5GGVL 2A1WH 2VAAA 2LAGB 1PD1A 3OGOE 4ZD3H 1AKJB 1QPPA 2UWEA 5HJDA 2WTPA 1QSEB 1DFBL 1AHKA 4KZCA 1URIA 4JZJA 2ZOUA 1H6TA 5TFSL 4AL8H 3EADA 4FADA 1AXTH 2X4SB 2ZCKH 3V4UL 1HL4A 4XO4A 2EIEA 4YBLB 1KJ2A 4IBQA 3FU9A 3G04B 3LKPB 4TQIA 3BDBA 2FSEA 4S0HA 4FMVA 2AEPL 5MEOB 4HZLB 4MJIB 4QR7A 1EWHA 4EVNA 1FFNA 2WNXA 1FFOA 4AQOA 1JGUH 4ZMNA 3QIUD 1OT1A 1IC7L 4YDJA 3CFKA 1KB9K 3IPFA 3I6KB 2HLEB 4YDLB 1CFQA 4TRPL 2EUWA 4XOEA 4FYTA 4KHXH 3MV01 3V0FA 2WWKT 5LCVL 4Y1AE 5IGXL 4KJQD 4PJBB 1TZIB 3ZDZF 3ZSTA 4AH2B 3JYCA 3I50L 3QEGL 4K23H 5D7IF 4R0LC 2VXVH 3WO4C 2PCFA 1KLFB 1H8NA 2I69A 2X6BA 1CXHA 3MYZA 5IB5A 3UTQA 3QUKA 3H9ZA 5HDBE 3L4UA 1ZA6B 5JHLL 2KMWA 3CZKA 4X9FA 2WQSA 3LKRA 5DSCB 1KIUB 2XWXA 3OKMB 4M5YL 4MZ2A 4NJ9H 4BQCA 2VE6B 3L6FA 3WE1A 2WLMA 3VFWB 3P0YL 5MENB 4ODBD 1JRHI 4XPFL 4YC2B 1RUML 3SE9H 3C08L 4XNQA 2YSSA 1TQBC 1YPZF 2WQAA 3BN3B 5MP6H 4AG4L 4UV7H 1JWSB 1NWPA 4WDIB 3ZRFC 5TDPA 2DICA 4P59L 2O5ZL 3NA4A 4YQXL 3VFWA 5MENA 3OKYA 1OGAB 1OAYH 1J8KA 1KY7A 4LPUA 5AW5B 1NAMH 5DS1A 4ZPTA 4JPVH 5FKPA 2OA9A 2N0MA 3B9KB 1I4FA 1NMAL 3GSRA 5EBLB 4WWID 2CA4A 3LEYL 2K6YA 4MAYD 4H44C 3D50A 2JJUA 4HF5H 4XR8C 2HJFB 1XF5A 4FA8A 1U8IA 1Q1JH 1KCWA 2AJVL 3NESA 5JHDB 2AXFB 2ED8A 1MW2A 2HFTA 3D4ZA 3BUIA 1JXGA 4X8JA 3RTQC 2BC4B 4GUPB 4BQ6A 3C5XA 1ZHLB 1XAUA 2DMCA 2YUVA 1JTOA 2FYYA 5I0YA 3TA3C 2H6PB 4P3DB 4A2FA 2ZKYA 2BNRD 3BWAA 3HJEA 4PGCB 4WAFA 1ZHBA 5CJQH 1CLZH 4J3WA 3RWDA 5GS0D 4P2QE 4ZFOL 5IEHB 3WU1A 4QHUB 5F0JB 5JNYA 1AXSB 3V55A 4TULL 1YAIA 4RAUA 2D0GA 2OMXA 5CCGE 4G8IB 4IOIB 4NJ9L 5EWIH 3S36H 1J9CT 3HAEA 5HVFB 3QAQA 5KOMC 1YO4A 4XBPA 4GSRA 4CAGA 4UILH 4CC1A 4JE4B 1VDGA 1BXVA 1J8SA 1KGCE 4UQ3B 4KAQH 1NOAA 1RIHL 3F7RA 4N2EA 2VDKH 3GBEA 1XT5A 3RPIB 4F9LA 2ZX7A 5LGHH 4B9FA 3GIZL 3D08A 4R5XA 25C8H 4BE6A 4JHZA 4OZFA 3LNIA 5J6GA 3F83A 1CN4A 3SPVB 5DZPA 1T21A 4CJ0A 2COVD 4MXQC 4PJ8B 1FJ1A 3D2UB 3OKLA 3LY6A 2A77L 3ZZ1A 1QI5A 1ET7A 3OR7B 1A7NH 1HN1A 2PXYD 4ALAH 1SUJA 3GBML 5FYJD 3RDTA 1ZKAA 4ZPVB 4LDEB 3KLKA 5FUZH 1TTBA 1BLNA 5IMMA 1DVFB 1AGEA 5E1HB 2VR9A 1TT6A 5D6CA 4G8FB 1GHFH 1IGCL 4L3FA 3IRPX 5LBSA 3VH8A 1O5PA 4KOBA 3RX9A 4ELDA 2DLIA 2VSKB 1RULH 3SPHA 3EJSA 3MOQA 3MA9L 3QT2A 3VFMB 4RX4D 4AMWA 1E8ZA 3VFRA 1FZOB 1A5FH 4O4YH 8CGTA 4LLUA 4CSPA 4NQQA 3W0WD 1NBZB 4X7EC 2BXYA 2IMNA 4Z7IA 4OF5A 4NSKA 4YVNA 5CJQL 3RWJB 1ZGLM 2HVBA 5BMFL 2PW1A 3GJFB 1FVDA 1MWAL 2ZSWA 5E9DA 2WZPD 1YN6B 1PTZA 3CFBB 3V6OC 2W9EL 4PGDA 4MSWA 5T1DL 2AZUA 1XGQA 1OWRM 3BPLB 4PJHF 5DRWB 3GBNL 5MEQB 4AZUA 4LSQL 4XAKE 1LWJA 4NYLB 4UINH 4XPTH 3CDFA 3GHBH 3V4VH 3CDGA 2W8CA 3OPUA 1HINH 3Q6GL 4A7QA 5I1CH 2P48B 5LGKA 2IJ0C 4YXHL 3QJXA 4Z8FH 3ARUA 1ZT7A 3BHBB 3B34A 5D2LB 43CAB 3EH1A 4G9FD 5MEQA 4A63A 2JLLA 4HDIA 4XWOC 1TJIL 3MBXL 4TPRH 4X5LA 2V8MA 3IJHA 4OKDA 3T8MA 1DZBA 4XBGB 1CGTA 1ID2A 1TXKA 1VLXA 5ESQB 3HG3A 2X70B 1JNLL 1J1PH 3ARBD 2GCYA 1C7TA 1GYWA 1MQKL 2VB5A 3FRPA 5HTSA 2YD9A 1QSVA 1MFCH 1BQHB 1DUYB 4N86A 4J3OD 2K1MA 1MY5A 2FAUA 3CH8A 3TJEL 3U2SB 4ODVH 3SQBB 1IARB 2WXOA 3D0LA 5C0DB 4JR9H 4Y4KC 4WW2A 3BP6A 4PVLA 5ES4B 1R75A 5GZOA 5DJ6B 1OLZA 3ARFD 1P7QB 4NCC1 3ARZA 3BJ91 4KKCD 2GJRA 4HXAL 2EDDA 4QRTB 2X4QB 4MD0B 4MB4A 4QRUA 1W6WA 3QZPA 5L8KB 2XWEA 3RVXC 1IO4C 1NDGB 2VDMH 3IJEB 3QQ9C 4KX7A 4PJHA 4GRLB 4J3SA 2IWKA 2BY3A 3ZO0A 2YPLD 1EHNA 2ODIA 4WI5A 1NLBL 5HHVH 5CP3A 4R9HA 5AKRA 3WBDA 2ESVE 3DTXA 4FKKA 4N0CC 4MNGB 2IWFA 2YN5A 3HKFA 3HPLB 4K3JL 2WXQA 4TTGA 1CFVL 1U91B 4JEGB 4ZAKB 1Y1UA 2BIPA 2JKIS 4XN2A 2NUPB 4MJ6A 1QSFA 4EI0A 3RFRA 2GJPA 3ESOA 3BH8B 4LSTH 2WTRB 1N6UA 1NBVH 1NCOA 3L9EA 3OX8A 4NBYB 4IDLA 1FHGA 5D7JD 1I1FB 4H26B 4LCVA 2EC9T 1F58H 4GW5B 2CLVA 3VVVA 4MA3A 4MXVE 4RSVA 2LU5A 5DFVC 1YY8A 1NIBA 3OLEA 1P2CA 1KLGB 1TVHB 1JGIA 1NICA 3FMGL 1C9SA 1SXZA 2X88A 4GKZA 4HK0A 4QJ5B 4OIIL 2BOLA 4PFEA 4Z7QE 4EN3C 4IHOA 4KKNA 3THMH 1G43A 5ESVB 4FTVA 1A21A 3TWCL 2CDFA 3DJSA 1MXGA 4JPKH 4A7UA 4YLQT 3E8UL 1AE6L 3C60B 1L4IA 1TQWA 3S5YA 1SMDA 5CILH 5D7SH 4GSDL 5F7EH 3F04A 1PIGA 2C9PA 1E9QB 2NDFA 1ZT4A 3NABH 3NFSL 3F7VA 4DVRL 2FD6H 5HYSG 1N5YL 2WZ6A 3TN0C 1QI3A 4PBDA 1PZ2A 3SDYH 1G84A 1JPST 4F9PA 3U36A 4F58L 1W0WA 1KWKA 1QQDA 2YBRB 3BI9X 2CDEA 2EXTA 4OB5L 4X98A 2VC2H 3DI2B 3KL0A 4ODUB 4X5WA 3ZKXB 2YS4A 2V3EA 4E41D 2NY3C 3DYMA 4YHMH 5H35A 1UASA 2VO8A 1HEZA 4EJ1C 1AZBA 1BGXH 1C5DA 4FDWA 1N2RB 3PYCA 4MB1A 5F1SA 4G1EB 3SEPA 4PG2C 1M05A 2EIZA 2X7LA 3QQDB 1R24A 3BVNB 3QZWG 4DUVA 3IDGB 2V2WB 1DBBL 2Z65C 4NAMA 1S5HA 1E4KA 3VFSA 4K7FA 4JM2F 1EGJA 2NY6D 4DERA 1OARH 1HL5A 2BM3A 2KKQA 3CQQA 2O5YL 1F8TH 2LAAA 1OHZA 5LAXA 3AMKA 4HWEL 3Q5OA 3TX4A 3GK8H 2EXYC 1G7QB 1UURA 1ZA6A 3RWGB 5D6CB 2G60L 1ROWA 1A4AA 1KGXA 3BJLA 2Q87A 2PPAA 1S7RB 2ZAHA 4QWWD 3SGDI 4M48L 3GHPA 4BFKA 2YD8A 2ESVA 4HT1H 3JV6B 3I2CH 4XN7A 4WI8A 2NY7L 4GAJH 4PJEF 3OMIB 4QY8B 5KJ4A 4JM4L 4M7ZB 3U6XA 1E2VA 5DD0L 1IC5H 4U0RB 5FA4B 3KXFE 4GW4A 3ILQD 4IRJA 1BMZA 1CMOA 3BGFC 4F7MA 4OQTH 1QA9B 3D30A 3GMPB 5GJSL 1C5BH 3QNXB 4L9LA 1KY6A 3CFKB 3REWB 2CRYA 3TU6A 5L4MA 1DQTA 1T5KA 4AIXA 2KHAA 4KMQA 1A4JA 4FI6A 5EU6A 3SDXF 4QAMB 4MDJA 4AXWA 4XRCB 1WZ1H 3KWTA 3HMXH 1R33A 3EDEA 3FOMB 4PS7A 1AO7E 5CHNA 3O3EA 1MVUB 2VDKB 3L4XA 1N5AB 5TTRA 3D06A 1J12A 5C3IA 4QDGA 5D6DC 5HHNA 1I1YB 2X4OA 3WTVA 3QR1A 2WYZA 4PB0H 3O11A 1QBLH 4F7EB 1XAKA 5FYKE 4NWTL 5FA3A 3IJ8A 3I75B 4N0FB 4QRPA 5JORA 4H1LB 2EDXA 1TJHL 5HHME 2XI9A 1BQSA 1O9VA 1W15A 1EEZB 4OCRH 1R3IL 5IM7B 4W9CC 4TUUA 1RK1B 3WAKA 2Z91B 3CQPA 5FS5A 4AIEA 2VLME 5CBAB 4UT9A 4N90E 2HMIC 5T3ZL 2UV3A 1EO8H 3GSVA 4L3EB 3B2DC 2XG5A 3TWYA 2J6EL 1ADQA 3B9KC 3FU6A 5BRZE 1NBQA 2E27H 2G0KA 4AJWA 8FABB 4PCKA 2EUVA 4TUJB 1QSZA 4GQPH 5EOCH 4WO4A 2QLYA 1HHKA 2I5YH 5BZWB 4A66A 4KWUA 1JGLL 3GMQB 3VSVA 4Q6IB 3DYPA 2VL5B 2WIIB 1QFWH 3KJ6L 3KM1A 3GLAA 3KPRD 4ZBJA 4PLKD 5LBVA 5I1KL 1XF2A 2NNAA 2ZWKA 3WLWC 4K9EH 3HR6A 4JRXA 5GS1C 3ZQXA 3AACA 3DVFA 1RURL 1FO0A 2VDLB 3BPNC 2IAMC 3UPCA 4EIUA 1NSNL 4TVPE 2WJ5A 1ASPA 1TETH 3PGDA 2YPLB 2VXUL 1F3JB 1IC1A 3MLUH 2VLLB 5A7BA 3TEUA 4P5TD 2A6JB 2QQLH 2VW7A 4RMTA 4HWBA 1LO2H 4BV1A 3MDJA 5IFJA 4GMSL 3EKCA 2E9GA 2X6AA 3QDJD 4KTGA 5DQJA 2YXWA 3OAYH 5SWZB 2DBLH 4HU8A 1RK7A 2CU9A 4YO0A 3CTTA 5EORH 2HKFH 5IBUB 4UTAH 1UXWA 3QFDB 1JF5A 4GP5B 1UJ3B 2X05A 4N1EA 1KDIA 4AE1A 2VXTH 3HZMB 4ONFH 5EU6E 4XX5A 4N87A 5GSRA 1B4TA 2GBTA 3OVUB 4AC4A 3MZTA 3SCMB 4X4KA 3Q2VA 5EIIG 4YHZL 3NSXA 3ECQA 5HGGS 1TMQA 1IAII 1QR4A 1SYVB 1T1XB 4OCSH 3DUSB 3S5LA 1TNMA 3OR7A 5GRUL 4KTDH 3U4KA 2CBMA 4PJ5D 4AYFA 2W0LA 3S37H 5DJZB 3BO8A 3LKPA 4XPBH 4YHOL 5I1DA 1E50A 1QWUA 4TOYL 3PWNA 5ID0B 1QFHA 5EOCL 3IFOB 4LSUL 2G9HA 2ZKHL 5EN2B 1YG9A 3RAJH 4DK3A 5CINL 4E68A 3MRHB 1XIWD 1TTCA 3BRFA 3BH8A 3LPWA 2F54B 3KJ6H 4LEBA 5ALCH 1M9WA 2DS4A 3HCVA 3QIWA 2A83B 2G4EA 2VZTA 4RAVB 4TNVF 1S9VB 4UBDC 2K8MA 3AS0A 2CALA 4K2UL 4NENB 4NN5B 5F3HA 2X6CA 1I85A 1HCZA 1E42A 3O6FA 5FB8A 2EEBA 2W1NA 3NCYP 4M3KB 5D1QE 4HS3A 5SWZD 5IVXE 2I9LA 3IU3B 2R0ZL 1ZS8B 4HPYL 3O8XB 3VFMA 2ARJB 1FZMB 2WLIB 3S5LG 2F61A 3PWJA 5GS2H 4HJGB 1WAAE 3RY6A 3TBVA 4B53A 2YPLA 1AR1B 1CDUA 3OKOA 4R3SB 4Q0XH 1JVLA 4XCYB 3NAAH 1A47A 3FN0H 4LLAA 4MVBD 1BZ7B 4MAUH 4QRTA 5KUMA 2O6EA 5FGSA 5FR3A 3MXWL 2VIRB 3MUHL 1M6OA 2D9CA 1NIDA 2EECA 1ZEAH 4ANUA 4ES8A 3IJSB 2B5IB 3II2A 2HRPL 4HYTB 5C0CB 1NFAA 5KVEH 5KVDL 1VIWA 1NL0L 1KBBA 2CR3A 4QF1A 2PP7A 1QD0A 4WHTA 3IDUA 4ZK8A 3RZWA 5FHBH 2X1OA 4H0GA 4HKJA 4TSCL 4KKZA 2DOCA 1NIFA 4PG9B 3RTQD 4IU3A 4ZUSA 3GKWH 5GRUH 3GPSA 5SWSB 2LOEA 5CR1A 2BJML 3LZNA 4AQEB 1CBVH 1FLTX 3O2WH 2CQVA 4TVSa 2YEZB 5GGTH 1OF2B 5I1LA 2LR4A 1LLAA 1XSIA 1T04A 4J23A 5LHDA 4LVNB 3SY0A 1TEYA 2X4PA 5LXVA 1KV7A 3BCFA 4IOFC 4ZFZA 1HVXA 4TL5A 1TPXC 3BDYL 4LPVA 5CKGA 1WCBA 2RACA 1BEYL 4MLSA 1TTAA 2O30A 5CBEA 3VXUB 2WXIA 5IVXB 5GISL 1TZ8A 1JGVH 3DJ9A 2GJ6D 3BE1H 4L23A 3SJVA 2LVEA 4FA6A 1QFWL 5I1KH 3L1FA 1DQLL 1QFWI 1BJ8A 4P46A 4HX1A 2DKMA 2P5EE 5IR1B 3IE4A 4ANXA 1JFQL 3KYMA 1UH2A 4NQEE 1JGDA 4XZUA 4U05A 1OCCB 1RZPA 1O7SA 4ERSL 4MLIA 2DQHH 3S5ZA 4IKKA 1NCCL 4N26A 4WGWB 1VA9A 1WDAA 2BXZA 1DJXA 1WEJL 3RIFK 2VR4A 4WI2A 4XB3A 3HRZB 4KROD 2O72A 2BP3A 1RFDH 1DN0A 1E9OA 1LO2L 4POUB 2YHGA 4X6DA 1M1XA 1FNGA 3P9MA 3HOGA 2E5EA 2JKLA 3L45A 3AVEA 4YGAB 3W39A 3FB6B 3KYNA 5E03A 3S35X 4MVBC 3MNWA 1BFOA 3QPQD 4A7SA 1YEJH 2V9UA 4JANA 1ZJBA 3OKKA 1W16A 1T20B 2YLHA 1HH6B 3QXUA 1A9BB 3DXAA 1G7HB 3UC2A 1K85A 2YJLA 4OZIA 4JPWL 2WQXA 1TQSA 3FFCB 4HIPA 4HK0B 4JY6B 4N25A 4OLYL 4R7XA 5TDPB 3WN5B 5E94A 4NLAA 3H2QA 4MA3B 2HB0A 4XXCA 2NY1B 4FXGC 4XNQB 4JQIL 3LX9A 4K3GA 5GGTA 3QWRD 3ZE2B 4KK5D 5E5RB 1U3YA 4ZW3A 4M1GH 1T2QL 1A6VL 2ZKHH 1V05A 3WCYA 3X14B 4N2FA 3CE1A 2JI2A 4KRMB 5KYUA 1VADB 4W9JC 3Q01A 3PAUA 3QPQC 2MCG1 5EIIB 4XO9A 1OP3K 1XQ4A 4H8VA 2ITDB 1A25A 1IEBA 2JKJA 2QFRA 3X1EA 4OZFG 3Q2LA 1HQRA 2ITCA 2BHYA 2OP4L 3CH1A 1Q1JL 5E00B 5F7FA 2BIQA 3EJJX 5G4OA 2P5PA 2QQQA 2Y5TB 1DYZA 1NGQH 5T5FH 4MYWB 5DRXB 3QH3B 3WHXB 1B9KA 5E8NA 1GGIH 4G6JL 1AGBA 1SFDA 3I9PA 4EI5D 4LAQH 2ESVD 4LCWE 1Q4NX 4X5WB 2GK0B 4YL4A 3O4OC 5BOZG 5DO2D 4P2RB 4E0RB 3B3IB 2ATKB 1E67A 3JUYA 1INEH 1QQDB 3BGMB 4I48A 4DAGL 1NMCC 4EPSA 3JWNE 3NSJA 3MJ7B 4GG6A 3MRDA 2Y3AA 2R69L 3JTSB 5H37H 4ZO9A 4HCRH 5IOPA 2P44B 4AENA 5B1CA 3R7QA 2GYSA 1FL6A 4NUPA 3PFUA 3QIUC 3NCMA 3SYOA 3MLRH 5KVDH 4DW2L 4U6HB 3IMTA 3T09A 4UMGA 2NW2B 2DQGH 2CE6A 2PMZA 4EO5A 3Q9QA 3V10A 4B9ZA 3ARDB 5E5MA 3FU3A 5KW9H 4ZMVA 5GSVB 4GB9A 2DJMA 5HGBA 2GIMA 3KEHA 5EUKB 3AWGA 3QC6X 4AK1A 2IALB 3Q8AA 3VD3A 4M7JL 5F9DC 5EEWA 4WJG3 5E6ZA 4ZW8A 2VQUA 3W82A 3T0DA 3H7LA 3M7FB 2R23A 3BCDA 4O2CB 4NGHL 3RWFB 2Z4QB 1RERA 3GO1L 5ESAB 1WCBB 3CVHA 4FL4B 2X2HA 4FRWA 2IALA 2E9BA 1UEMA 4P04A 5E9DD 3OKDA 2BP0B 1FIGH 5BQ7A 4XNZB 4EBQL 3O45B 2PYEB 2HVKB 5KS9B 2DB8A 5C7XH 4Z7UE 3ZHDA 4D0BB 4Y88A 4KKRA 2WPGA 3IXAB 1EZUA 2H3XC 3WY2A 2FJFB 3IAPA 4N5ED 4U3SA 3VTAA 4HU2A 5EMYA 1B4JL 3VFRB 2IG2L 1KOAA 3U7AA 4UQ2A 4HS6A 1YEIL 2L7UA 4QJ4B 4Z78A 3INUL 4FG4A 2ATKA 5JPMC 1CK0H 3AS2A 4I85A 3POHA 3MLVL 5ACLA 5I71B 5JHLA 4MDIB 4L4VD 2IAMD 4NAQA 4OCXH 4JFYA 1UADC 4RNRB 1U36A 1QBBA 5HI3C 3RZCA 3NSDA 2PO6B 5KN5A 3O41A 4PBVC 4UV7L 4QLRA 1AY1H 1CDHA 2W92A 3L9RA 2E7LA 3LPOA 2LLLA 4N8VB 1EDQA 2O5ZH 4G7VH 3TASA 4LCUA 4P2AA 3ZU8A 4D7BA 4EN2A 5I82A 1D5ZA 4HETA 3NQIA 3KLQA 4O51A 3AU1B 2JCCF 2JVUA 3QXAA 3C75A 2OJEA 2V3FA 1E3XA 4IMKC 4YIQA 3N43B 1MUJA 1PQZB 3CSPA 5I6LA 2DWEA 1T6VN 5KYXB 1KXTB 1LP9E 1VKXA 2FL5A 4IBZA 5LCVA 3UXFA 2Z31B 4A39A 4RH4A 4TUOB 1CICD 4JM2D 1HOCB 1ZCRA 5I1JH 1EUTA 4YPGB 4UTBL 1AJ7H 3LS4L 1LK3H 3L5XH 3M1BB 4PY7B 1MUJB 1PQZA 3GIVB 4P2QD 3ARYA 3AS1A 1AAJA 1WD8A 3ARRA 2VDPB 4KO9A 4OJFH 4D7PA 3BO8B 3SQRA 5DD5H 1CE6A 2NXYD 4IK6A 2N1KA 1FN4B 2H6PA 4P3DA 5EU4B 2M8XA 3H9SA 3WFDH 3D1MC 5T33L 1C1EL 1PG7W 1KCUH 2HH0L 4P5TB 5F96L 4I0KA 1ZTXE 2MCMA 3BRGC 1CLZL 4XVSL 1CLOH 3KLDA 1IJNA 4RGMC 1ZV2A 4N6RB 3U9WA 1FAIH 4HLZH 2X4NA 2Y3NA 5ITFB 1P4IL 2BC4A 5FW7A 4ZO6A 1GL4B 2VZSA 1KIPB 2GFBA 1MFDH 2HYMA 4OCWH 2QZQA 4OFQA 4OGXL 3HR5B 3HVDA 4NUGH 4UU9A 5CR8A 2EH7L 3IMUA 5F9WC 3UTSD 1KCVH 3WNMA 3WTTA 1OPGL 4I7ZC 5GHWL 4YHNA 4S2SA 4XMLH 2ZSVB 2FX8H 4PTUB 3GUFA 1CDJA 2CIKB 1U93A 5LGHL 5GS0L 1W72L 1ZANL 4QI3A 3IBOA 2CHDA 3PREA 1EJ6A 4MDJB 4YGVB 4BZYA 3WIHL 4LHUB 5B3SB 1JGDB 1BHGA 5IVNA 1TIUA 4ZSOA 2BNUA 3BUYA 3LTVA 3NZUA 3T3PB 4NWTH 4F1ZA 5L0QC 5F1KC 3X3FL 3CX5J 1IFHH 3L13A 3DARA 3QDME 5D9SB 1BCIA 4I89A 4QRPE 5J3HD 1MQ8A 1TJIH 4TPRL 2ITCB 3ETBJ 1PLBA 2P26A 3GSOA 3QRLA 4WTQA 5FO9B 5C6TH 4ZFZB 1INDH 3I9IA 1TVBA 1FG2A 2ESVB 3MRBB 3IVKA 4LVNC 4POZD 1ZV5A 2W81C 4AK2A 4KX8A 1MPAH 4Z7OF 4NN6B 1YN7B 3WMPA 1UOKA 1UKSA 2CLZB 2NZ1A 4UYQA 4HMDA 4N2LA 4NQCE 3W5NA 2ZXAA 4ES9A 4HGWB 1M57B 2ZUQB 3GXFA 3O9WA 4Y9GA 3CZUB 3L1OH 2ZG2A 1QUNB 2BSED 3O2DH 2OULB 1RK1A 5CGMA 3L3GA 3A5VA 3GMLB 4NKDA 3WN5A 3WV0A 3EHBB 2NY4C 2J4WH 3MRDB 5GRYA 5D5ME 2VABA 4LZKA 5FUOH 1QTPA 1G4MA 3P4OB 4BH8A 1RLBA 1QEWB 2X4NB 5KS9E 2YQBA 1KGCD 1Z0MA 4FXKB 3AREA 3ETSA 1HEZB 3G7TA 3HG1E 2X9XA 4E41A 5T3ZE 1JWMA 2CGYA 3RVVC 1FFOB 2AXWA 5IQ9A 5HP5A 3MLUL 4LCCC 2IPKA 2WGNB 5FYKL 5I75B 3P73A 1FN4A 2VDNH 2NDGA 4HGMA 4F8LA 2APXA 1NBYB 4GQZA 5KVGE 3ECBB 4H20L 9CGTA 2VLKD 4QIRA 2R8SH 1SLUA 2AXGA 5L6YH 4GMSH 3HI6L 2A74A 1IL1B 5DEGB 1RJYA 5A43C 1NDTA 2ENPA 3HE7C 2PNDA 1P4LB 4FJZA 2FBJL 2RFXB 1M71B 1VGKB 2JTYA 4GRWH 1IGFL 3VAEA 2FJHA 4M29A 2PCXA 4ONFL 3CJJA 3F5WA 4DETA 1FYTA 2QHRL 5J13B 5LXGH 1DJSA 5GRVK 4N0UB 2D3JA 4JKLA 1HU8A 5HYEA 3VXMB 4FTVB 1JHTA 5AVUB 3UJIH 4ZZFA 2CK0L 4P9HH 4IRZA 2YKLH 2XKNB 2X10A 1JTTA 1MCOL 2UVEA 1BYNA 4HOMA 2JJSC 3NGBB 4FLOA 3JV6A 4I0PB 2FT7A 1N0XH 3EYSH 3BC9A 4L2LA 5I1LB 3X17A 2O1AA 1V3JA 1YPZE 3O4LA 5D7JC 2E8ZA 4GT7A 5L9DL 2UX6A 4QNPE 2P9RA 3I74A 1VFAA 1RUQH 2MNJB 3DK0A 1U8OB 3QSKB 1KBPA 4X80H 1SDYA 4HK3J 4JJOA 1DN0B 1E9OB 2XWDA 4YE4L 3WNOA 2FLRT 3NZ8B 4WNSA 5CIPH 3SDXE 4ZOAA 3KS0J 1SYSB 5F3FA 4D3CL 1A7OL 1N3NA 3BN9D 3HRZA 1AIFA 4KH9A 2WXHA 4QOKA 1GXEA 4P06A 3LVEA 3T6XA 4S10A 5ITFA 1QSED 1X5ZA 1CDYA 4XI5D 2VZOA 5J6HA 3O6ML 2YO3A 3BUQA 4L2YA 1VFUA 2YZ8A 4Z0XA 1KPUB 1OP4A 4TQEL 5FYLE 4KTEL 2K4AA 4KKCC 4F2MB 4X4YA 1BAWA 4DN3L 3WJJA 3IEAA 4W4NA 1FZMA 5E2VL 4LE8A 1NC2D 1QNIA 4HIJB 4I4WB 1EHAA 2ZUVA 1QX1A 2YA2A 3HS8A 3VXUA 1LE5B 4Z5RA 2YWYA 4I18A 4PN6A 2VDLL 3A21A 3PHOA 4XP6L 3GBLA 5FCUH 1KTDA 3B7RL 5T1KB 2JIXD 5B1BB 2QVKA 4AG4H 1IGJA 3KPMA 1WWWX 4TQHA 1QP1A 5JXEA 4Z6AT 1IGYB 4GAGH 5EBMA 1R0AH 3BPLC 4KU1A 1FPTL 1OZTG 1IKNC 4PJ7F 4RGOH 3HZVB 3DETC 4HCIA 4TNEA 3V6ZB 2N7AA 3ULSB 1P5UA 5JUEL 4MJJA 3ZOAA 1Q9OA 1OOAA 1VB9A 2W59A 3FQ1A 2WIMA 5ID1A 5DFWH 1HHHB 4I3SH 1YYMH 2QQKH 3DO7B 3MJ8A 3ZKMC 1PZ5B 3L3DA 3T1FB 3N41F 5F6IC 2H8PB 5C0BD 5FC9A 5TH2A 1Y18B 1J8HB 2Q0ZX 3V9FA 5I1HH 1TU2B 5JPMB 2DL2A 3ZE0B 1N10A 4PRAA 1NCIA 3SGEH 4C55A 4ZG1A 2HTLC 4CC4C 1W0YT 1PY0A 3O6MH 5L4FA 4NCDA 4K15A 2ARWA 3L4ZA 3BKCH 2DM3A 2A6JA 4KUCD 1OT4A 2Y06L 4LCUB 1SMAA 3S3SA 4LARL 3OB8A 1JPTH 5AEAA 3V0WL 4TSAL 3BDXA 4JHVA 1IEHA 3TOPA 1PPIA 3VW3L 1HXKA 1MCFA 3ET9F 5JQ6L 3GRWA 3MXVH 4PV8B 1UFUA 5B7MA 4ZUUB 2MHAA 2XVLA 4ZOEA 5HI4D 4F7MB 2X1PA 2RAMA 3WJLA 1OO2A 5E2WH 3IE9A 3O2VH 1OCOB 5F8RC 1PJWA 1ECZA 1T83A 2R2BB 4FP8H 4NO0A 3QUYA 1Z5LB 4JFZH 3JV0A 3WNKA 5J06A 2AQ1A 2GUYA 3K4ZA 2AK4D 1Y0LB 5T1KD 3NEXA 1R5IB 4HLJA 5GJTL 4U6TA 1MHPH 3RPIA 2H26B 2WYTA 5FDYA 4DGVH 4Z7OB 3HAEH 2EKSB 5T1KA 5AB0A 2WQWA 1IGTB 3GSQA 2WUBL 1P9MC 5JOEA 1HSAA 2WMPA 4H25A 4MJIE 1H8SA 3TV8A 4JZNA 3JTSA 3KAAA 5IREA 4KI5D 5TDNB 4YE4H 3UO1H 5B39B 2YLKA 4PJ5E 1YMHB 1O6TA 4LLMB 3GMRB 4Z77B 3QFJE 5F9WB 2KH2B 5E5MB 1YN6A 4HWBL 5JIIA 2WWKO 4PU2A 2HRGA 5H2BB 1SGKA 2P8PA 4BUGA 4UT6L 1I82A 1QRNA 1U3NA 3QDGA 4J8RB 2WW8A 3BMWA 1TSHA 4OIBA 1ED3B 2PTTB 4PYGA 5BS0D 1F42A 5IV2B 3SYPA 2VXTL 4OUUA 3ABKB 4Z23A 2HT3D 3HZ3A 4B5EA 5EZOH 2XWRA 4OI8A 4U4BA 1JK9B 3B9KA 1SJVA 3BSZL 1WC7B 5KYUB 5HHOA 3TJHD 3AWEA 1QHQA 4MXQD 4JO4H 3VMOA 1HWGB 5D1QC 4NKIL 3PJNA 3B9DA 1EJ8A 4GAGL 4WFFD 3W5MA 4X99A 1MJUH 3QISA 3TNMB 3FH7A 5K9QI 3DX9B 3VD9A 3QG6A 1YY8B 3TFKD 5FOBB 3CV5A 3T5WA 1VFBA 3QIUB 3GDCA 3D2UA 4MA1B 3WO4B 4L0PB 4G83A 5I18L 1D9KB 1PEZA 5DCCA 3B83A 2H3KA 4OZ4A 1MCQA 4TSBH 5EUOA 2H1PL 1OWWA 3REVA 4BK5C 1ORQB 4NS0A 3F01A 4K2UH 5DQ9B 3EFDL 4XHQA 2HXAA 1WAPA 2OR9H 3OKEA 5D71H 2BSEA 2WWMD 1UM4H 1ASOA 3CBJB 4WI6A 5GRXG 3TIEA 4NRYA 5CJ8A 2V9RA 3WKYA 2H1LM 2RBLA 4XT1C 2B7DT 1LMKA 5J9PA 4KROC 3W11C 3GINA 3VFSB 4QRRE 3D52A 2B4CH 3QQ3B 1C12A 3ETBF 3UYRH 3P54A 1DBAL 2L8AA 4FXLA 1UYWL 3S3JA 3N06B 3T0EC 1JPTL 3C8DA 2VOTA 2LLGA 4OCSL 4N2HA 5IROA 2JK5A 4E41B 1XZWA 2HFFB 4K5NA 2WBWB 3PNRB 5BRZD 2APVA 4MBOA 2ZP9A 2PYFB 1NIAA 1FDLH 5DGQA 5GGSA 3VDAA 4A2EA 1XEUA 4KJPC 3VYPA 3P2DA 1NGZB 3FT4B 3BSZH 3T65B 2YQ2A 1Q72L 4HEPG 4NM4H 4X8GA 1S3RA 2K9UA 4QO1B 3I02A 4Z7WF 3NACH 4X4ZA 2QGCA 2MKWA 3QAZC 4PJAA 2YMOA 5MI0B 3ZT6A 5MEPB 1ANUA 5C08E 1XTMA 5AD0B 1X9QA 3BGAA 2CGZA 3FO2A 1KJ2L 4IU3B 2O5NA 4Z0BH 2DIBA 3DRQA 2G5BA 2EXWD 2VDRL 2HN7B 4LBEB 2GVYA 3QUYB 3V6OE 4OFKA 1FG2B 2XVBA 2WXJA 2VRQA 2PKDA 4Y2NA 5JDSA 1NC2A 3W2DH 1W6LA 1OD7A 3SYAA 2CO7B 4L1SA 4XVTL 1U4EA 2Y24A 3N9GH 3FULA 5GZOD 1AQKL 3QWNA 5JW5A 3FFCD 1RULL 3KBFA 1A3RL 1WGOA 4LHUG 1Y6MR 1HSBB 2P7TB 2XV2A 5HYJE 2PO6A 2C3WA 2DLHA 4Y9EA 2KLRA 1RXLA 2P28B 4FQXD 5C09E 2LTQB 1XF4B 3F7KA 1BIIA 3D87B 1AMXA 1NEPA 1R34A 4MDIA 3O4OB 4R8WL 3LB6D 2CCVA 4U3XA 1CICA 3G5XB 5F1IA 5G5DB 2NR6C 2BZDA 2KS0A 1N18A 1UATA 2ZP8A 4XOCA 3CLWA 3QCTL 4TULH 5F3HB 2D7MA 4PRBA 1TYJA 1GOHA 1MVYA 1DVZA 2H7WA 4YE0A 3CPLB 3MCLH 4G7RB 6CGTA 1UCBL 5D1ZA 2AJVH 2NY2D 4KKAD 1KFAL 4NRXB 1BVKB 2YQ3A 3US1A 4YSEA 3LN5B 4Z8FL 3QUMA 2EDYA 1OGTB 5LDSA 2I7OA 1N59A 3C6SB 4YZWA 5D8JL 1GKEA 5E5UB 1J1PL 4C56D 4RGMB 3T0EE 4XMVA 2YAQA 4M5SA 4WLCA 5C2BH 2DQHL 2QVFB 4N0UA 2D8KA 4WWKA 2B14A 2ZUTA 2X70A 3WXWH 2RCSH 1D7DA 2YD5A 4YPGA 2EYTA 1DUZA 4XPAL 5AAPA 3LPPA 3ARBA 2VR6A 1TCRA 3FB7A 1RZKH 1JHLL 2CJSA 2PYED 4JZOB 4GLRH 3DJZA 1RCYA 1UT9A 5BJTA 3ISRA 1JXFA 3TNNA 4J5VA 2DYPB 3KR3L 3MRIA 5IF0B 2AXGB 5F7KC 1YEIH 4I13B 1ZHNA 2V7NA 4OLZH 3WS6C 2C1OB 3QZWB 2OW6A 3CHQA 3NEEA 1S7QB 2WO3B 1KTJA 5A40E 4XNMA 2WSDA 1E3ZA 4R2GB 4W68A 2EAEA 1RIHH 2DIJA 3MJGX 2VJ0A 1QLEL 3QGVA 3KWUA 1LYQA 4GAYB 5IQOA 3AABA 4BINA 3HPJB 2WAHA 2WQUA 2XZAH 4NXKA 3CFUA 4U1JA 4H20H 5DYFA 3HMWL 3CPLA 4XVJL 4NN6C 1F4XL 1CT8A 5EF0A 5HGHA 3ILDA 1M7XA 5E4IA 2FLBT 4XNYH 4PP2B 3IGKA 4HWUA 4KUCF 1YQVL 4HBQA 4GI9A 3F64A 3MV8B 4XMTA 3ATFA 1N0LB 1SUHA 2MQCA 4Y16C 1VFOA 4GIPD 4B0MB 1BD2E 2X0UA 3RWGA 3SE4A 4JB9L 4JG1H 1WFOA 1LJMA 1UD2A 4XXWC 3FN9A 3FU0A 4G72B 1OGAA 1MRFL 4Y89A 3ZHFA 2KUTA 1YNTA 2FJSA 5DD1H 4K9EC 1XEDA 2ENYA 3BHBA 5D2LA 5GQBA 3IFLL 1E3FA