3RWFB

Rhesus macaque mhc class i molecule mamu-b*17-qw9
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
molecule keywords Major histocompatibility complex class I
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rwfB00
3G6DH 4LARH 4Y5XA 2QKIB 2JCCB 3VGBA 5MENB 2VL5B 3V6ZA 1VFAB 4IOIB 4ZUWB 5IEKA 3PP4L 1A6AA 1GGCL 1T7WA 3CVIL 5IW1A 5GHWL 3RY4A 1ZLVH 1NUDA 5BMFH 1KJ2B 1JHTA 1QTYT 1WQVT 3UAJC 5I8KL 2XACC 4P2OA 5IKCA 3DX7B 4KRPD 4ZFFA 3IDNA 4QHLA 3TN0C 2LTQC 3WLBA 5TDPB 1A7RH 3O2VH 3LD8B 2VQTA 3HNTL 4CMMA 3SKMB 1S7WA 1MF2L 2E6JA 3O6LL 3GI8H 5F1IA 2B5IC 4GBXC 2GTZB 3MBXH 4GS7B 4LSSH 5DJ2A 1R5WB 2VH5H 5HBBA 1BJ1J 5DWUH 1KXTB 1MJUH 1MFDH 4OCSH 1D5BB 1JRHL 1OGAE 1WFUA 4PJHB 4JZNB 3MR9B 4MZ3A 4OI8A 4DGIH 3T2NH 1BFTA 3RGVD 3OG6B 1BVZA 4XNYL 5E6IA 5D72H 4XNXL 1FZJB 1T2JA 1J0JA 1DLHA 4KRPB 4N5EC 4WFGE 5TH2A 2FX7L 3DNKA 5HYEA 2D7MA 4M5ZL 1RZ7L 1YY8A 3UYPA 5ALBL 3V6OA 4M7ZC 5AD0B 4KQ3L 3THMH 1U2CA 2Q8BH 1JPTL 3FOMB 1NBYA 4H1LA 2BVEA 3OTTA 3QWQB 5J57B 3BGFC 3PQYD 4AG4L 4RMVA 1RY7B 3FQUB 1GL4B 4P2YA 5K59F 3JWDL 3WNOA 3MOAH 1T6VN 5DJ6B 3RAJH 4U0RB 3VFTB 3SDDB 4LVHC 4XVTL 1AFVH 5BRZD 1HZHL 1FYHB 3IJSB 5JPNA 5J11B 1CGSH 1GGUA 1YN7B 4HUUB 3EIFA 4JQVA 5ICXA 3DOSA 4NQEA 3WIHL 3HE6D 3DIFA 2BMKA 1YY9C 3DHJA 2HH0L 3RY5A 5DRWB 1JHTB 1BVLA 3R4DA 3DMMD 2R2BB 2BVPB 2CLZB 4HGWA 4LP4A 3LMJH 4X9FA 4U1SA 5L2KA 3IVKB 5KSBB 4MD4A 1HN1A 1RHHB 4QHNB 5AG8A 1N6QL 1ZHLA 4RGOH 4NQEE 2YPVL 1RHFA 3GMNB 3NFSH 2PNDA 3JWOL 4Z0BL 5BRZB 4HBCL 2VLJE 3W81A 2H9GB 2AXGA 3HPJB 3MREA 5DJXB 5J1TC 5IHZB 1XF3A 1A7NH 3VI4F 3V4PL 2DM4A 3VGDA 3HMWH 4I0PD 3BKML 3WNMA 5FYJE 3CU1A 2YA0A 4V2CB 5T3XE 5ECJE 2LU3A 3LS5H 4LSQL 4RA0C 5D1QA 5TQ2L 3IRZA 3FFDB 1J11A 4FZ8L 3VWJD 3G6JA 5GRXG 1EGJL 4WW1A 1H3VA 4JRXB 6CGTA 2I9TA 1YNKH 4D0CA 4DK6A 5HI5C 4H8WL 5KVEH 4TVPH 3TO4A 3VFGL 3MLPA 1KN2L 4HKZB 2ATKA 1IAMA 4LRIC 5FYLE 1AGDB 4AEIH 4BH8B 3ARBB 1OPGH 4FQ1H 1YEJH 5C09E 4HJGA 2VB5A 3MO1A 1RU9H 1N64L 2E5EA 3EOYG 1EEYA 1H8SA 5T1MA 4IRSA 3HKFA 2Q7YB 4PJ5D 2XZQH 1E6OH 4M7LT 3CH1A 3IU3A 1ZLWK 1PG7H 3ZDXE 4N90D 5JPNB 1QSEA 3E6FA 4M61A 3QCUL 1JTOA 1MVUA 4JN1L 1DDHA 4O51A 1NBZB 4RBPH 5IG7B 4GQ9L 4XAKD 5EU5B 4JY4B 3ARGD 2B4CL 3T0VA 3MLZH 3IXAA 5A2FA 5ESVA 2FZ3A 2A6DB 2HVKA 4X6DF 4CNIB 1DR9A 1IGFH 2I9LB 1FGNH 3DHMA 2FX9L 4YDLC 3C6SA 4K8RH 3TO2B 5CZVL 1MRFH 3GSNB 2ZUUA 3WJJC 5DSCB 3UROR 2EDYA 3ZSTA 3VWJC 3QCVL 1TZIA 1YN6A 4LRNH 4O2CB 3LVEA 4PV8B 5EZJA 4CN4A 4DK3A 4NQDB 1JZ8A 5TFSH 1FZKA 1PGRB 5IHZA 2GJZB 2JF1A 4OZHF 2VR4A 1BFSA 1HDMA 2FJGA 1BQUA 1ITBB 1T20B 4OZHA 4P2RD 2EKSB 4M9OA 4RIRA 3H9SA 2RAMA 4P23B 1N6VA 4O2FB 4LCWD 3SJVE 1HYSD 4OD3H 3ULVL 5F8RC 1C7TA 5C7XL 1WICA 1K5NB 1MCOL 3V5HB 4KDTA 3ZYJA 1FYTD 1HIMH 1V05A 3DX9A 4GW1B 3MJ8B 3T2NL 4DUVA 4DZBB 3NCYS 4OLVL 2XV6B 4OF5A 2JJSC 5FGRA 3DO3A 4XC1H 5F7WC 3V2AR 3T1WA 5KAQF 1ZLUH 1OOAA 3ZDZF 1LWRA 2H6PA 5EU4B 5HHOB 2IAMB 3P30H 2C7UA 4ODXB 4HC1A 4X8JB 1XF4A 4FTVA 3KDMA 3RPIB 1BHGA 2ICEA 3M07A 3MRQA 1OPGL 4FQ1L 3UC0H 4LCCB 5DS8B 2QSCH 4HH9B 4AMKL 4HUNB 3D39B 1A02N 4ENED 5IG7A 1IGIH 3MFFB 3IDYC 5EU5A 3EOAA 2KUTA 1YZZA 4KVNL 3HPLA 1YNKL 4CN1A 3KPRA 3DTXA 5GISH 3KPMB 1U95A 1IGML 3ZKNC 1DSFL 2X4RA 1R3LB 5KSAD 3ROLB 2QSVA 4X6CB 3AC0A 1DLFL 3VGEA 1AC0A 1OF2A 4M4RA 3TBTB 3T09A 4XCYA 2PYED 1YYMH 4UBDC 1Y18B 1MCKA 1KCRH 3NA9H 3VG9C 2QHLA 4PS4H 1T4KA 2ICES 4CU7A 3HG1B 1DN0B 1VHPA 1B0WA 2AJUH 4IOIA 5IEKB 1T1YA 1JWSA 1QBLH 1ZT4B 1P9MC 4ZOBA 2VDNL 2DQDH 3QUYD 3B3IA 1Q72H 5INCA 4YGAB 3WMSA 2IPTH 1IEBA 1D7FA 3EGSA 3TV3L 2OL3L 2XWTB 12E8H 3MA9H 2DI7A 3QWRA 4G8GA 3PWPD 1BEYH 2EH7H 3MJ8A 1BVKB 2Z31A 4NUJB 4DVBA 3S4SA 2NY3D 1I1AD 1R3IH 1JYXA 2B2XH 4MXQC 3SKMA 4DN4L 4L9LB 4AEHH 3P4MA 3CLEL 2FECL 4MDIA 3CVHH 2IAMA 3K2UH 2C7UB 3OKNA 4JR9L 4POZC 1EJOH 2NY4B 3MV8D 1KENL 1HOCB 2VLKE 4AIZA 5IVNA 4H5SB 5FYKE 4G6MH 3OL2A 3RZCB 4JKWA 4N68A 4LQFL 5FXCH 5HGGS 4RZCB 5FKAA 1Q0XL 1NDGB 1MCLA 5D93B 5DJ0B 3VFUA 4RISL 5SX5K 5I18H 2DKUA 4AZ8A 3F7YB 5I2IB 3EYSL 1S3KH 2OP4H 2X9YA 3BPOB 4S1SL 3BD3A 1N0XH 3FB6A 3CGTA 5JOFA 1BGXH 4U6XA 4L8SB 1MHHB 5HYJE 2Y72A 1XIWA 4S1DD 2JJTA 3MC0A 3FN0H 1B6DA 4WEMB 2P5EE 1JYWA 2ZCHL 1LHZA 2DJSA 1E27B 3K2MC 4QHMB 1JPFB 1TNNA 1BIIA 4HWBA 4L8DA 5F3BB 4XZUB 5F8QC 4X6CE 3BI9X 4ZAKC 3U1SH 5C09D 5EWIH 1CFVH 5J11C 4D0CB 2P8LB 3UTSE 3LKRB 4LAQL 3K8KA 4HPYH 2FH8A 3BUTA 3OZ9L 4GRLA 1IAOA 1MI5E 3S36X 5GS0L 1NDMA 1FN4A 4PJAE 3QXDB 3X3GL 2GT9B 1NGWB 2R2BA 1U8NA 4P3CH 3U46B 1QPPA 2CJUH 3X13A 3VJ6A 2OK0L 1GGCH 4FQQA 2DQTL 4U1KA 5GRZA 5I8CA 4POUB 1J18A 2HJKA 2J8UA 4J6RH 1IRAY 4ZPVB 4JO3L 1YEEH 5HTSA 3BKCL 3TA3C 4YR6A 5DDHB 3MZTA 4LPVA 4Q0XH 5BZWB 2VC2L 2OZ4H 4MXVF 3WEXA 2APFA 5DGQA 4KHTL 2X4SA 3Q6FA 1LDSA 4S1QL 4QRSB 4MAYC 4FRWA 5KG9A 4D9RE 3OKEA 5T1KB 5KS9B 4HLZH 2P8MA 2AEQL 4WI2A 1L0YA 5I66B 5EO9B 4UTBH 2DOCA 3WXWL 4KFZC 4OFPA 3PP3H 1GZPA 1DBJL 1NGYB 3BH9A 1FIEA 1R0AH 1KJMB 1BREA 1CDCA 4PBXA 1PZ5B 1OLLA 4JFYA 5EWIL 3SGEH 3C8KB 2XT1B 5K59E 1RUAL 4PJ7B 4WW2F 3D85D 3V4VL 4X6EA 1CYGA 1B90A 4L8SA 4OZGF 5T5NG 4R0LA 3MLYL 3RIFK 3RGVC 2WINB 5C0BE 3P30L 3MCLL 4WI3A 1O0VA 2ZSVB 3MO1B 1FNEA 5HPMB 3ARDC 2CD0A 4PJGA 3DRQB 5C0EA 3R06B 5FAAA 2MMXA 1FYTE 5DJCB 3QUKA 5C0BB 5DVMA 4TULL 5DXWA 4QT5B 2FL5B 4X7FC 1F6AB 3WXVL 3SKJH 5IBTH 4F8QA 1XT5A 5DK2B 1FQ9C 2AI0L 3IDXH 3SGJC 3X12B 2ARJQ 2G2RA 1H5BB 2B20A 3FHAA 4HQQH 1Q0XH 4IM8A 4NGHH 1DQML 3PGFL 5GGVY 3AU1B 4WUUA 1P2CA 4D0BB 4U6TA 2F9BT 4KZDH 5M7QA 2QR0A 4NJ9H 4NQSA 4MNGA 3DXAA 1WISA 4EDWH 1UM4L 5JIHA 1UZ6F 3U6RA 3VH8A 2A0LC 4PGDA 4LCIL 2EXWC 1TZGH 1LD9B 2Q8AL 3P0VL 1TITA 4XNUL 4OCRH 3BISA 5E5RB 5H94B 4AL8L 4PJ8B 3NPSB 5E6ZA 4G8FA 4LSTH 1R3HA 4L9LC 3L3DB 1PVHA 3NH7L 5I1DA 5C0FA 1IL1B 4OQTL 4FQHB 3MLRH 1KLGB 1A1OB 2JIXA 2MQ0A 4JQIL 4YAQB 4MJ5A 4PLNC 2HT2D 3I6GA 3ARGC 3MRIB 3GO1L 4YZFE 4RAUA 4WI9A 1W0WA 2NY4D 3QFJA 3BXNB 1I3RA 3DYPA 2WLZA 3SDYH 5AUMA 5HYIA 3AAZA 4OGZA 2DQFB 4PREA 5D2NA 4UT6L 4ELMA 4DKFL 3G5YB 1A4JA 3MRMA 5GRVL 5KZCB 3U0PA 3QPXH 4K55A 4OCNC 4PJ7A 3HE6A 3T0BA 3IXTB 4MXQD 5DMKB 3GIVA 1QA9B 5T3ZL 2ICWB 3VFNA 4I8DA 3KLAA 1RUPL 2VLKD 4HZAA 5AYUH 3BZFB 1RURH 1ZA3B 3C60D 4D9QD 3LQMA 4U6VL 1P4BH 3DRQA 1N64H 3R06A 1ZS8A 4L8BA 2FR4A 4YO0A 1FVCB 3C60B 3LIZH 1CN4A 1VFAA 1EBAA 4PD4J 1NUGA 2VZOA 1P4LB 5JQHC 5DK2A 1VDGA 3DSFL 1XGQA 1TTUA 3FHQA 2HJLA 1NEUA 4XH2B 1TQBB 5BZDA 4YHZL 4I0PA 4NUJA 4W4NA 3DPBA 3DXAB 5FYKL 4QRTA 2UV3A 3H2WA 2YPLA 3W11C 4G7YH 4O00A 1SJVA 4Q9RL 4IIQA 5DMJB 3MLVL 2W9LA 5F1NA 1FFPA 4CL7A 2CKBH 3BWUC 5F88A 3MUJA 3EFFA 3MRKB 1JHLH 1CVSC 3GB7B 4PJ5A 2I5YL 4X6BB 1W8OA 3NCBB 1WF5A 5EUOA 5DJZA 5HI3C 4ZO9A 1F3DH 3X14B 4XP6L 3Q5TA 1HSAA 4U49A 1D5ZA 1DCLA 2X1QA 1CDUA 1NDGA 3QA3B 3V9FA 1I7ZB 4PRID 4P5TC 1ZLWH 5L88H 3C09C 4M7ZB 4APQA 4KKCD 5FV1L 3O3BA 3CK0L 4DN3H 4S0TD 3GBMH 2AJYH 4MXVE 1EXUB 2VXSH 1QQDB 1RK0B 3RRQA 3B3IB 5HDBF 1VGKA 3RWHA 1PFCA 1HHJA 4LLDB 4U1GB 3QXUA 3MUGB 4O58L 3AS0A 4FMKA 1BIIB 4UIMA 4Z7VF 1CICB 2XQBL 2X6MA 5HHVH 4GS7C 3P0VH 3VFOA 1U3HD 4P5TD 4H1LH 1U8HB 2ESVA 5I1LB 2ZUWA 4I77L 2VLMD 3KYMB 4TSBL 4OBRA 1R3KA 3HB3D 1A6AB 2VDKH 5IF0A 6FABH 4IJ3B 4G42B 2L4OA 4G9FE 1XGPA 2F5BL 2FO4B 2BOCB 4OCXH 5AEAA 1INQB 2NXYB 5CJ8A 3ZYIA 4JFHD 2J5LC 3B8YA 4ONHA 3K4DA 3TA3D 3V8OA 2NLJB 4WI4A 3BDYH 3RHWK 2FGZA 2J8UB 2AQ3A 3KWWA 1T0NB 4D9RD 1FP5A 2ERJB 3RVTC 2R69L 3CDCA 4FXLA 4IRJB 3MRGB 3RUGF 4PRNA 4M1DL 4NO2B 2BRQA 3O45B 4PLOB 1MWAL 1AGCB 5DWUL 1UC6A 1FAIH 3C5JA 5EOQL 4ZUUA 1ZHLB 5I17A 3D0VB 5AWNL 2VE6A 1VFOA 3MOBH 3HZMB 4YEFA 3GB7A 4PJ5B 3QNYB 3LHPH 4ZUVA 4OSUH 4U4BA 4KMTH 2CH8A 3EYUL 4HGMA 4U1NB 3B5GA 1SBBA 3DXAE 3TN0D 1N0LA 4EOWL 5IVXB 2CIKB 3BSZH 1OGTA 4FG6C 4U7KA 3JUYA 2GKIA 1SQ2N 2EEDA 4F3FA 4PRHE 3DGGA 5HYSB 2M1KA 2WZPD 5DJAA 3RWDB 4PY7A 5GRUL 4JHWH 2W0KA 1D9KC 5E4EB 1EO7A 1X3DA 1IKFL 4NJAL 4ZODA 3IJHB 4LLVA 1G7PA 3U4EA 3RWHB 3E6HA 3DYMA 4NRZB 5ALCL 5DRXB 2ZUTA 3VXSA 3QUXA 3TLRA 3QQNA 2HKFH 3D87B 3SCMB 1RURL 5C0BA 4ZPVA 4JLRA 3RI5K 5DK0A 4WEBL 1P7QD 3RWFA 1LP9A 5DMIL 5CWSB 4KI5F 5E6ID 3D1MC 5JIIA 1YYLL 4OF6A 4ODWA 1H5BA 5DYOB 2X4SB 3Q6FB 3VFWB 1IGCL 1MREH 2J6EH 2GFBB 4UV7H 3O2DL 1WWCA 3QQ9D 5F1SA 1NGPH 5CIPH 4J4PD 4P2OD 3LKOA 3KPPB 1SEQH 3GMMA 2HVKB 3I6LE 5CEZD 5DC0A 3I6LD 2V5TA 2C5DC 1YQVL 4WHYG 5E95B 4Z7OF 3PV7A 3OX8B 4J3SA 4OCMC 5BRZA 2OTWA 5DSCA 2H3NB 3DMMA 5E9DE 1NFKA 5C0FB 4E0RA 3D0VA 2X40A 2LU7A 4ONFL 2VE6B 5C9JB 2J1KA 5D9SA 3RDTA 1J8KA 1JHKH 3HAEB 2Q8BL 2ADFH 2FBJL 2EKJA 3K0WA 5FYLL 4TUKH 4LLQB 3VXUB 2FGWH 3QEUA 5EZIL 1BJMA 3X12A 4F7MB 5DMKA 3QG6A 1QA9A 5HGHA 1K5NA 4MAUL 2XWBA 1HNFA 2GTWA 1B0RB 2QLVB 4H8WC 5IB1A 4YPJA 1BM3L 2DLFH 3WKMH 2AK4D 4GMSH 5DHYB 1XR8B 3B43A 4NN7B 4OLUL 1NL0L 1V5JA 2Z93B 4NQUA 5T1MB 4HWUA 4DZBA 1UH2A 2IH1B 4O5LL 1DBBH 1FGVH 1CGXA 3QIWC 1DN2A 2EO1A 1UKTA 1YMHA 3GI8L 1G7JB 2CUMA 4KY1L 5FYJU 2IBZY 3QEHA 3U4BH 2FJFB 4Z0XA 5JW3H 2R0ZL 3C5ZA 5EOCL 1MVUB 4X8JA 2OL3H 4TUJB 3VGAB 1O7SA 1XF1A 1OTTD 5KSUB 1I7UA 2OSLB 4NQED 4XWGL 2BNRA 3NGBB 1H3GA 1EHXA 3ULVC 4K3JL 5DMYA 4GSDH 1A6VL 3T3PF 3EOAB 3RVUD 2DMBA 1YC8A 1DEEB 3GSXA 2FJHA 1SM3H 4IHOB 5IROC 4UU9B 3PP4H 4TTDC 3T0DA 3GRWH 4ODSH 3EHBC 1FFQA 1I1FA 3O3UN 4FQ2H 1U93A 3H3PH 5ERWA 3U2SA 5MENE 4TQEL 3VRJA 4LSDA 4JFDE 1CFNB 2IG2L 1I8MB 1F4WL 5DD5H 1U8IB 4JO3H 4XPAH 5ACZB 5ALCH 3UDWA 4H0HB 1EFXD 3LDBC 4KJPC 4N8CH 2KPNA 3HG1E 1QSFD 4F80A 1KG0B 3H42H 3ARFD 1ES0B 4ALAL 3W11D 1ROWA 4PJCF 4CMHB 1DTUA 1MI5B 1U91A 1M4KA 3EYOA 1QRNE 2WWMC 4NKMA 3ZE1F 2NQCA 4Q9QL 1RJZB 2O61B 5I0ZA 4IRJC 4NZJA 3UTTD 3UTZB 2AJSH 5IIEA 2JE8A 1MRCH 3IS0X 4HJJH 2XOTA 1QO3B 2JLLA 4K9EL 2DM7A 2Y25A 4MA3B 1TQBC 2H2SD 8FABA 5B8CB 2WWKT 3H9SE 3TT1H 2B8OT 4ZTOH 5ICYB 2VR9A 3BMVA 4WHTA 1YDPB 1TPXC 3KYOA 3TBVB 2NX5B 1YMHB 2YRPA 3WIIH 5J1AB 3QIUA 1IEAA 5F9OL 4NKIH 1A5FL 3MRQB 3OKNB 3STZA 4QO1A 3BT2H 5FOBB 4LVNC 5IOPA 2VLKB 3EYSH 2VITB 3MJ7A 3HZYB 5HVWA 4HGKC 5C7XH 1ZVHA 5ETUB 4CDGC 4ZFOL 4HBQA 2Q87A 1T1ZA 5J9PA 4O4YL 2BRRL 3KPRB 3OXSA 4KUZL 5DJ0A 3VFUB 5K9JH 3H3BC 4H25A 5B38B 4V2BA 3L3HA 5INDB 3B6SB 3D3VA 4P9HH 3WFDH 1Q94A 2YBRB 4HUWA 5E70A 4P2RE 4JDZB 1Q0YL 1Q9LA 1F3JB 3CIQA 4XVUD 4ZYKB 1R3IL 4LCWE 4O2EB 1PAMA 4ZG1A 2CKBB 4CU6A 4MXWH 1UFUA 3MACL 4MAYA 2EDRA 3SJVA 1AXTH 4HT1H 4UNUA 5D2LB 4J2XA 2VAAA 4JHAL 1A6TB 2BNQD 5HI4C 4HS8L 1G6VK 5JMOC 1UZ8B 3VA6A 4RFOH 5IMKA 1AO7B 5L7XH 2DQDL 2ZCLH 1BLNA 4AT6B 1DP0A 3OHXA 2LABA 2FX8L 2AV7B 4LCWA 1H3PL 1URLA 5DVNA 1QO3A 2XKUA 5I1AB 3N50A 1KF9B 5DEFA 4HC1H 1A6WH 1CLOL 3NIGF 5GSRA 5JHDE 4PS4L 3GJEB 3UZQA 5ESAB 1J9CT 4ZPTB 1QRNB 1A1MA 1RULL 1QLEH 4KRNA 4G80A 4LNVA 5JA8B 1QEWA 4P2QA 3STLB 1TJHL 3O4OB 5JHDB 2X4NA 3G9VA 3S5LA 3DVNA 4NO0A 3MNWB 3O0RL 4ZUVB 1T83A 4WHDA 5DQJA 1CVRA 1W0VA 3V6OE 1W72H 2VLKA 3K4AA 1OTTC 1JZ4A 3P9LA 4E42B 1XIWC 2GITA 3LS4H 5FGSA 3RWDA 2Z31D 5C6TL 5H37H 3DBXA 3B6SA 5E5UB 3FFCD 3HI1A 2R29L 4TSAL 4LKCB 4OM0H 1RFDH 3FQXA 4U1MA 4R0LB 1MIML 4NRZA 5DRXA 3VXSB 1OAXH 5GGUB 3S96A 5BV7C 4U3HA 2C1OA 2BRRH 4Z7VB 5DJ8B 1F4YL 3MYJA 2EH8H 1Z3GH 1T0MB 1TDQA 2KQNA 4ODUB 2BSED 3RWFB 1LP9B 5H37G 3RIFF 3KLHD 4LDOB 4JVUA 5F9OH 1M7IA 4HH8A 5ESQA 2DQEL 4CW1B 4D9LH 1A21A 2G9HB 2VLJB 1CI5A 3WHE0 5LGHH 3RUGE 4KTDL 5DO2D 2G2RB 4BQCA 2HTKC 1WZLA 3H3KA 4GBXD 4HF5H 3B2VL 3PWJA 4WUUB 3S36L 1W72B 4ERSH 4K3DL 4CDHA 1P53A 2XWJB 4OF7A 2IH3A 4YBHA 3KR3H 2HT4C 1KSRA 5E8OB 5IHUH 4DWHA 3BO8B 5F7YC 5C0CE 1DVFB 3VRIA 2O93L 5DFWH 5C0CD 3DV4A 5I1CL 4Y19A 2ESVE 1I8KA 2OX5A 3UXFA 4X5WB 2GJ6B 2ESVD 1YECH 5KG9B 5DUPL 1E4XL 3QQ9C 5C9JA 2Q6WA 4JDTH 5I1DB 2W9DL 1J12A 4XVJH 5BJTB 2W0FA 3WFBL 5I74C 4BH7A 1R5IB 5FM8A 1MHCB 4OD1L 4XBEH 2HVJA 5DFTA 1NBVL 1CFQA 4PJIA 1AR1C 1CFTA 1T0PB 5JO5A 3GM0A 3QFJB 5D72L 1I3RB 2IG2H 2WAHA 1T3FA 2XKSA 1WK0A 3F62A 2YWZA 2EH8L 4UINH 1F4YH 1LO4H 5IP4A 2K9UA 5DT1H 4LSPH 4UQ3A 1IEHA 1HILB 4PJDE 3MBXL 5GGUA 1QSEE 3S96B 2D9QB 3BP6B 4CRPA 3REVA 4OLWH 3VCLA 5B3NA 1HE7A 2YS4A 5HJ3A 4JPWH 2EZ0C 3BZEA 1J88A 1ORSB 2WMPA 4L8BB 5FUCC 4EUPG 1N5AB 3DGCR 3MJ9H 4P99A 1FVCA 1LO3L 4Z0XB 4JDVA 2KL6A 1FSKB 5EU6A 4H8WH 5HYQB 1HYRC 3WDJA 2C3WA 4V1DD 2V6HA 1V8HA 1P2CB 3CD4A 1XGQB 1N8ZB 2BNRB 3H42L 1TMCB 1EVUA 1S78D 3MNVB 3LIZL 4QRUB 4PR5A 5CEYA 1UB5B 4XWOD 3OKMA 4GG6E 2FATL 1U8KA 3GSUA 2R23A 4JY6B 3P73A 1AQDA 4PJEB 3UTQA 3ETBF 2C4XA 4PRBB 3QUYB 1LD9A 2HTKD 3LB6C 4YX2H 4P3WA 5JDSB 4ZD3L 5FFLA 4I3SH 4MNHA 3CXHJ 1J0KA 2HRPH 4E5XA 2R2EA 3S35X 3A6CH 1D5XB 4RGOL 4LLUA 4U3CA 3ABZA 5GSVB 4L4VA 4NC1E 4YBLB 4QXUL 1F2QA 4NM4L 3QZWG 4NM8L 2H2PC 2JB5L 2ITDB 4K9EC 1JGEB 4HMCA 1UCTA 5HHOE 3MROB 2UZYB 5KTEH 4EBQL 4IMKA 5CBEA 5E99H 2F53A 3RTQB 3PWVA 1A2YB 3D3VB 3UCRA 1AGEA 1CK0L 3EYOB 3MRFB 3QG7L 5FDWB 1T3FB 1HQRA 2DM2A 4S0SD 3PG2A 4OCWL 1ED3A 2CUIA 4GLRI 4U0RC 2VKWA 4YFLI 3B5HA 1MLBB 1VGEL 2D03H 3DURB 2ICWA 4MA3A 3ELAT 1DQJA 2AJXH 3REVB 3NIDF 3WFDL 4EIGB 2HN7B 4PY8J 3LPGA 4M7KH 5KTEL 2E7BA 2XPGB 3OMZA 4MA1C 3RNKA 2E7LA 3SBWA 1YUHA 1OM3L 1R3KB 2DBLH 3GBNH 2BVOB 2K1MA 1BF2A 5TPWH 4XXCC 3NPZB 3SDXB 2YUWA 5EFIA 3EKCA 3FB5B 3A67L 5DEFB 1D9KA 2F54A 5K9OA 1MCBA 2ZWLT 5DUBB 3EYVA 3G5VA 1S7XB 2IFFL 2LAGB 3D25B 3OGCB 1FZJA 4IIQB 3IFPA 2NX5D 2CGRL 4P2QB 1FFPB 3STLA 4NO2A 4WUKL 3Q2CA 4Z9KB 3MZGB 5CS7A 1ZWIA 1DQQB 1Z2KA 3WN5A 3DX8A 2X44D 4P2OC 3IT8D 1A14H 4RGNC 1QVOA 1X5XA 2EH7L 2F54E 5HVFB 3X14A 2FSEB 5BQ7B 4HD9A 5IQ7H 3P9LB 4PJ8D 3ROOA 1R0AL 3PL6C 1IC5L 3W5NA 1PKQA 2B1AL 4WTZA 3MROA 2VERN 5IR1A 1UADC 2YRZA 3SDDA 3O4LE 2AGJH 5J12C 1HH6A 1T2QH 3DBXB 1EXUA 1MCCA 4F2MB 3ULUH 1CD1B 5BMFL 5ITFB 1EAJA 7FABL 3CCHB 2P42B 5CLTA 2ATKB 1S9YB 2AP2A 3FO2B 3DIFB 5JPMA 1R5VB 3ZHLA 3ZZ1A 3WJJA 4YNYA 5L2KE 4POZD 2R1WA 3P11H 4TQEH 4C55A 3QQ4A 5HYJD 2LV4A 3GRWL 4ODSL 5ISZD 3CH1B 1JL8A 1NC2B 1WT5C 4MHHG 4XPHL 2FEDC 4APQD 2CRZA 3SKOA 5CWSA 2VLJA 3S5LB 2IMNA 3TH4T 3MRNB 3ZT6A 2R0WH 1F58L 1WBYB 3TPUA 5L2JA 1IKNA 4BK5A 5BW7A 2E7LC 1TJGH 1BD2D 1YEDA 3IFNH 3DWTA 3WHE1 3F6LA 5HD8D 5EA0L 5SWSB 3PL6B 5F6HJ 5TE4L 4YHIA 1T7VA 4F58H 2AJXL 2KBGA 1K3IA 2NLJA 1F97A 3O3EB 4E42A 3MGTA 5K9OB 3L3KA 1FNGB 2VDPH 1EIBA 3ALXA 5D1QB 5EU7C 3G6AB 2J6EA 2HFFA 1T2XA 5ENWA 3U36A 1LO2H 3QULA 3GHEL 2YZ8A 3V6FB 1WITA 3PUCA 4K3DH 4G9FA 4X7DC 3ARFB 1FZMA 2YPKB 4S1RH 4JFEE 2X4UB 3RU8L 3TBSB 3QDHA 4BZ2H 2A0LD 5T1KD 1FO0L 3O6KL 2AJYL 3HS0A 3OR7A 1KGCE 3S9DB 1I8IB 1G7LB 3C08H 3QAZC 2ICWI 4K23L 4K71C 5D9SB 3RDTB 5DJ8A 3MRHA 2BVQB 4JHBA 4L3CA 4WGWB 2HYMA 4UAOB 2FEEL 3TZVD 1BQSA 1WLHA 2NXZB 4ONGH 5D96C 4PJFE 2A6KA 2WW8A 4QHKI 1JNHB 2E9BA 3VG0H 5B3JF 4MD0B 2ZCKH 2V2WB 4QWWD 3T1FA 3TN0A 5F7UA 2PUQT 3NFNB 4Q2ZB 4ZS7L 5F96H 5HJ3B 5TE6L 3KR3L 2YRLA 5IFAH 3CH8A 2ENSA 4AJ0A 4H26A 3BN9D 1GGTA 3ILQD 4OT1H 4HSQA 2BDNL 3MRPB 4ODWB 3QDME 3QEHB 3G9AB 4KJQC 4OJFH 1QSFA 3MRNA 2IPUG 3FN9A 1MCEA 3QIUC 5JXAH 1BMGA 4HS6A 1ZLUK 5EIQA 4EKXA 1VACA 4JFZL 1TJHH 4WO4B 2Q86B 4N0FA 2AJZA 3WJLA 3EYFB 4TVPE 5DFVC 3QRFM 3F7PC 1J1XL 4R2GD 3UJTH 4R4BA 4RIRB 5DVOA 3GSRB 4WFGD 1G84A 5DR5L 4LGSB 3VXMA 4LLUB 5GSVA 5I30H 5ERWB 3U2SB 2XA8L 1R24A 4OFDA 2EO9A 4XP9L 3SDYL 4IBLT 3ZHDA 5JW4N 4BUGA 3HAEA 2K7QA 5MEOA 3RTQA 4LIQE 4DCQB 5D7JA 3PWNB 3QH3A 4JQVC 4L3CB 2VXVL 4LLAA 4LHJB 5EU4A 5HHOA 3L5WA 4P5KB 4LPYA 4AIOA 3MBEC 1RJZA 2O61A 1JI2A 1I7RA 5LKNA 1H3WM 1XF2A 3KJ4B 3LEXB 4PPTA 3CUPA 4L8CB 3TN0B 2ED9A 4G8GB 3SDAD 1ZV5A 4HIHA 5JXED 4HIJB 1TCRA 5ICZA 2HN7A 2Z93A 3S36H 8FABB 3AREB 2R23B 1T66D 4L3AA 3O8XA 5D71L 4OB5H 3L9RA 5D1XD 1ZT1A 1OARH 4N8VG 4L9LA 3SCMC 3GHBL 3GMOA 4NCC2 5HHNB 1R3LA 3ROLA 2JB6B 3D0LB 1D5XA 2NY7H 1C8PA 4OV5B 5DC4B 4OCYH 1MFBL 4RMUA 2NY7L 3SDXA 4M6MH 4K23H 1UXWB 2GUOB 1NMCB 3WNKA 1HSBB 5E9DD 1MAMH 1ZSDA 4XHJD 1E28B 1E4XH 4IEFB 1E4XI 3I75B 3WIHH 3BH8A 1AXSB 4GBXA 4GUPA 3QDMB 1RFDL 1S8DA 3C6LB 1HXYB 2XTJB 4R8WL 3CLFL 2BSRB 3MOQA 4HKJB 3RGHA 2NPLX 1RJYA 1KIRA 2P47B 4AL8H 1Q94B 2G60H 4EQ3A 4BKLA 5SV4A 2JCCF 2NW3A 5C0AD 3MLSH 1JGLH 4M1CC 4FG6D 1T04B 1X4ZA 3T3MF 4MZ2A 2YXFA 2HLFC 4QRRE 4Y4HB 4PTTB 1G7MB 2Z8RA 1CG9B 4JO2H 4PP1D 5KW9L 2CR3A 1MPAL 4YXLL 5E9DB 2P8LA 3V6ZB 5A43C 1YJDC 4JHZA 4MX7A 3W0WA 2GEEA 4J3WA 1RK1B 1C08B 1KTLA 3D39D 3ARSA 3MLXH 1RULH 3DMMC 3EDEA 1KJ2A 4M8QA 1N5YH 3QCUH 5KSBF 5B38G 3NFPB 4PTUB 4KWUA 1U8NB 1V3LA 4OCSL 3ES6A 1X5GA 3PWUB 1NAML 3FFCA 1SYSA 3GKWL 3QQ4B 4YDIH 1BD2E 3PXJA 3QI9A 2EYTA 2AV1A 5LBSH 4JFXA 1A3LH 3D69A 4I1NB 4M9PA 1Z5LB 2P43B 2VLLA 4PG2C 3W0WE 1QR1B 2Y7QA 2EYRB 5C0AB 3UX9B 4ZSOB 1PD6A 4YPGB 4DW2H 4WI8A 4JO1H 4QRPB 1G0XA 5CJ5A 4Y16B 1HHGA 3L1OL 2NY5C 1YPZB 1HQ4B 1IAKB 4Q9QH 1YNTA 5TF1H 5IM7A 4Y1AD 3MACH 4JFED 5LG1A 1RIHL 4Y4HC 5EU6D 3OAYK 2R56H 5F7KC 2C1PB 3VXOB 5J9PB 5ENWB 3U36B 5TE6H 4K2UL 1DBAH 4GXUM 2CGRH 2VR5A 2A83B 5A16A 4S1QH 4PJGE 2X05A 1P5UA 3QDMA 1N7ML 1ZGLA 2X4OB 1JWMA 1NAKL 3VDCA 4MWFB 3T0XA 4PRAA 5H8DA 1T1XA 2P5EB 1UM5H 3C9NB 4F57H 5EBMA 1QRND 3AXLA 3EZJB 4MD5B 5JW4R 1T6WA 4IDJL 1CE6B 1G0DA 4P4KD 4XI5C 1JPSH 4FFZL 4A2MA 1RIVH 4D94A 1BBDH 2Z9TA 1YMMD 1HHHB 5CEXB 2DIAA 5TDPA 3MXWH 4F9LA 3HC4H 4XWGH 1A6UH 1VPOH 1JGVH 5IMKB 3OHXB 1AY1L 5JDJA 5GS1C 1CXIA 3SE8H 1YEDB 2BOBA 5B4MD 1A1NB 3TP4A 2YC1B 3P0GB 5K9QG 4M02A 2HFEA 1BVLB 4RQQB 4KJYB 1J0IA 5CGTA 3GHEH 3IDJB 4MNGB 3VXTA 4Y5XC 3GJEA 4ZPTA 4OF0A 1CK0H 3P4LA 4ELKA 1IQWL 5KJRH 1CU4H 1VPOL 4NO5A 2EICA 4NT6A 5E0QA 3UBXB 4J3XA 5BS0A 1WBZB 2MHAA 4ODTL 4BFIB 4KUZH 4WTXA 3BAEL 1WIPA 1I8IA 1RIUL 2IEPA 2FGWL 4PJAF 4Q7DA 1IAKA 4NM8H 1YYLH 4MJ6B 1A1OA 1SHMA 4Z95L 2X70A 4LQFH 3KJ4C 1TTGA 5F6IB 3QHFL 4LCUA 4F57L 2HVJB 4JM2D 1E4KA 3SCMD 1CFQB 3IKKA 2CXGA 5DI8B 1X6LA 2DD8H 4K3EL 1KENH 2XICA 4X99B 1XZ0B 5GQBA 1D9KD 3L3GB 2IGFH 3G5YA 3AREC 5C71A 1FO0H 3JTTB 1I1AC 1AIFA 4NRXB 3FQXB 4U1MB 5I16B 3S6CA 3ULUL 1IGMH 4IRSC 4OAWB 1F00I 1A0QL 4MD5A 4NBYB 4Z7WB 2QHRL 4KTEH 4Q58C 5F7DA 4JKKA 2ADJB 4EDXB 2PO6C 1CFSB 3JV5A 1T0MA 4QRPD 3CFEB 4Y8AA 2OI9B 1IC1A 1UXSA 1ORSA 5FV2A 4MA1B 5ILTL 3S98A 4HUMB 2Z0BA 4NN6C 3BW9A 5GGRY 5LCVH 5B39B 1LVEA 1H3UA 1XGRA 4Z7NE 3MREB 2UUDK 1EFQA 1W2KT 4XC1L 3BEWA 5F6IC 3LKNB 2DJ4A 4OLVH 4KV5F 1KV3A 1UWXK 3TZVB 4NQVB 3ZYOA 4S2SB 4X9GA 1OL0A 5BCAA 3SDDD 1RVFL 1KCRL 1RZFH 3HR5B 3GMOB 1KB5B 5BOPA 4U6YA 4N5UA 4NKDB 4CADB 4RMSA 5GS3A 4YIQB 3EFFB 4HDIA 3DVGB 2AW2A 1SEBA 4YHNB 1OM3H 3C2AH 1M7XA 4JHWL 4NN5B 2EDFA 3MV7B 1MQ8A 1WUNT 1WV7T 4FS0A 3ARBA 3FFCE 4M6OH 4BH8A 4I48A 5BXFA 3KG5A 2FLRT 1NPUA 1FVEA 3B9KB 4WJ5B 4W6XB 3LY6A 1S8DB 3BSZL 3D9AH 2F53B 3HI5L 2EDJA 2B39A 5CBEB 2GCYB 4EI5C 1CWVA 2BY0A 3IU3B 4KMTL 5BV7L 1NCCL 1XZ0A 1RZIA 1NC4D 1A22B 3Q5YA 4N8VB 4QXGL 4Y5YB 4R7DA 4GG8B 4KRLB 1VB9A 1T04A 2G5BB 5I6XC 4DTGL 3D39E 4OAWA 5C07B 4I0PB 5E8NB 1N3NA 4GW5B 1GOGA 4D9LL 5E00B 5JQ6L 2J6EL 3WN5C 5MEND 3VFSA 5E2UH 4GKOA 5I9QC 2MSPA 4MMZC 2JB5H 2DAVA 3GJFA 2EIEA 3SE9H 3TO2A 1LO0H 3AB0B 5F88B 3GSNA 1Z3GL 1Z0NA 1CXHA 1UEYA 4KK9C 4JE4B 4Y5VB 4CU8A 2Y5TB 3FRUB 4I3GA 3SN6N 5CBAB 1DE4B 5HGAA 3DLQR 4KGJA 2AXFB 5HYSG 2Z8SA 2LAAA 2NYYC 3MV9E 4M7LH 5SX4I 4TSAH 1T0NA 2CK0H 4EUPH 1WGOA 3V8CA 3FQWB 2FATH 1DBKH 4PRDA 1BJ1H 2OTPA 2KZ1B 4WDIB 4AEHL 1KIPA 4HG4J 3UYOD 1YY8B 5AAWA 2B2XL 4HK3N 1QLFB 3IKCA 1FNLA 3VFGH 4L4TB 5FHBL 5I17B 3U7WL 1B3JA 5KVEL 4J1UB 2C3VB 5LWYH 3PHQA 1KPUA 1WZKA 1UZ6E 5H2BA 4HMDA 2DDQH 3QYCA 5DEGB 3RA7H 4PIRF 4YWGH 4L4TE 4WW2C 2EC9U 3C60C 4LSRL 4PJBF 4PGBA 4AQOA 2NZ9C 5IB5A 2DYPB 4NSKA 5BOZG 4KI5E 3TVMC 5FA4B 4YFLF 2IQAB 3W39B 5IR1B 3T08A 4LRIA 5C2UB 4GKSA 1CD9B 5D96B 5JR1L 2QV2A 4GRWF 1FG2B 1YMME 5GPRA 43CAA 4XHJC 3IJHA 4L29A 1MCFA 2HAZA 1PG7L 3ARDB 3KPRE 2JJUA 5E5MB 1M05A 2F53D 3TJEL 3BDYL 2FHCA 3PP3K 2QQQA 3OB8A 2VN4A 5EOTB 3F12B 4PRHD 3SGKA 1GZQA 3K8MA 3C09B 5IFJB 3I50L 2IAMC 2CLVA 3RNKB 5KS9F 1T7YA 2JK5A 3E8UL 3T4YA 4ZTPH 1AXTL 3RVVC 1YECL 3OXRB 1XGTB 3M17B 3QPQD 4AYFA 1KCLA 1FO0B 5FHBH 1IGIL 5DTFB 4TNVF 4CVXA 3MJ9L 3WUWG 1L7TL 3FT3B 4NIKB 1OTUC 1ONQA 1WZ1L 3VXTB 5DJYA 5FB8B 3RZCA 3PF2A 3ARFC 3EYUH 4JFOB 5FKAB 3RTQD 5CSBA 3MX0A 3GMMB 5D1ZD 3EDDA 4QOKB 1CTOA 4CGTA 1AQKH 1WCQA 2YUXA 4L3EE 4DKEH 3WFEH 1U9KA 5F7EL 5HHOD 1AXIB 1OAYL 2NY5H 4KZDL 1JWSB 3OPZH 1ZT4A 5JOFB 1CCZA 4P46C 3ZL4H 5IMOB 4HV8B 3LRSB 1B2WL 1U8PB 4L3EB 3OR7B 3TWCH 4G8IA 4DGVH 2YSSA 4GW4A 5C0DB 1U58A 3L95B 4ZAKA 4L5FH 4QHMA 3F5WB 5C0IA 1TETH 4HEPG 5CEZE 1I1CA 4LKXA 3V7AE 2HFTA 4PGJA 3TJHD 5D7KD 5KSAB 4P23D 4LNRB 1IVLA 5D7KE 1MIEL 4PGZA 3WFEL 4ZTOL 3P4NB 2APWA 3HTLX 4CUCA 3O6LH 1JGUL 4YLQT 5D1QD 3FRPA 1R5VA 2WBJB 3IF1A 4ZO8A 5HHMB 5IMLA 4QGTA 3V4UH 1IE5A 3B9EA 4Y5YC 3Q5OA 4M03A 5F7DB 1YEFL 2A6DA 3F58H 4I18C 4FFWC 4LRNL 5T1LB 2IH1A 2IJ0C 1QSZA 3BQUD 4NZTL 3VGAC 4M6OL 5L9DL 1PX3A 4U1LB 3B2VH 4F7TB 4NT6B 3O0RH 1KYOJ 5E08L 2NY6C 1AI1L 3QFJE 3CX2A 3OXRA 4TUJA 5FUZH 5IK3A 4BFBD 1CDHA 2H8PB 4HIEA 5E2TH 4E0RB 1F11B 3TM6A 3CC5A 3ARBC 5JIKA 2W60B 2OZ4L 4Y8DC 1JVKA 3I6KA 4NQVA 2XA3A 5C09A 5DR5H 1OW0A 4JFOA 2H1PH 1NUFA 2MCPL 4OKVB 3PNWB 4WCYH 3KPSD 3FRPG 1SJEB 4R4BB 1JWUA 5KOVC 4RBPK 4HDIB 4NCC1 1JF5A 3LKRA 4ZQKB 3LDBB 3MLYH 5AZEH 2AGJL 4I5BB 5DD0H 5L7XL 4N0CD 5HGHB 2DIBA 4I9WD 1ETZB 7CGTA 1YEJL 4FABL 2IADA 4JFDA 1L9NA 1SMAA 4Z7WA 4FFVC 4M4PA 4TRPH 1JV5A 1S9VA 4EDXA 2UZIL 1U58B 2R15A 3L95A 4ZAKB 3UPRA 1DEDA 4YBQC 2CDGB 4JFFA 2A77L 2X7LB 2BNUA 3D2UB 1ZKAA 4MB4A 4N8VA 3T8XA 1CZ8H 3HMXA 5DZLA 5JNYB 4FXGA 4HX1A 3VWJB 3O9WA 3SO3C 5EORL 4HS3B 3P4NA 5C0RH 3RX8A 5IIEB 2UY7A 4XVUC 1KB5H 2IALA 1QHOA 2ZSWB 3DV6B 1OHQA 4XAKE 4JRYB 5HDBE 3BEVA 4UI2A 4IRSD 5I66A 1KPVB 3IETB 5C70A 1UQSB 4WHTB 1M71A 3H9HB 1QFPA 3KXFA 3MLTA 2PKDA 4B53A 3EZ8A 4KJWD 4YQXH 4X6CA 3QI9C 5HHNA 2CO6B 1MFCL 4YIQA 2Z35A 1QSED 4PJFF 4PJDB 4YHLL 4ZUTB 4RGMC 1KC5H 1C5BL 4YHYC 4YHOH 1TVDA 1XF5A 4TUOB 5HDLA 4NZDA 1UCBL 1YEHH 5J6GB 2VDLL 4D0DB 5KJRL 3LEVH 2M26A 4G3YH 3VXNB 3HG1A 1JMXA 1OSZA 2XN9B 3CFBA 4PFEA 5DQDL 2NY3B 1QFHA 4KKLD 3RJQB 4PJGB 1KGCD 1VGEH 5F70A 3I6GB 4OLYH 3LKPA 1RZJC 1YQVH 1NFDF 3KPLA 4HFUH 3NCEB 4UDUB 4EI6A 4IRZH 5INCB 5D70H 4ZUWA 4MQ7B 2MPAL 2Y6SD 2BX5A 3DUSB 4XCEA 1I9RH 5TJWK 2F8VA 1Q9LB 4ZQKA 1PQZB 3FQTB 5DLMH 2OTUB 3PE9A 2CDEA 3T0EE 5K9JL 3UO1H 2R1YB 4OZGE 2DYPA 4I0PC 2AEQH 3S4SB 5SV3A 1S9VB 1OD9A 1DQMH 4NM4H 1MY5A 1TZHA 3KPRD 5ICYA 3I9GL 3BQUB 2OQJB 1ORQB 5I8EA 4IS6B 5IBUB 5DMIH 4Q97A 4UTAL 5CCKH 4WEBH 1I75A 4XHQA 4KVCH 4NKIL 4PLJD 3NN8A 1OT2A 5JNYA 3IDGA 3L6FB 4XNMA 1NAKH 4JB9H 4UT7H 4GO6B 3MRDA 4A6YA 5FOBA 1OQXA 1EO5A 1YEKH 3QDMD 4JFQB 2VH5L 4N9OB 5D7JD 3FTGA 3G04A 3GSQB 4DN4H 3HC3H 5EOTA 4RDQF 2MFNA 4XI5D 4UQ2B 5CEZL 4ELME 1A64A 4OZIA 4YAQA 4MJ5B 4NP4H 3QUZB 3HUJE 5D7LA 3AUVA 4IMLB 2XI9A 3ILQC 3D0LA 3MA9L 12E8L 4YDKL 2B0SL 3EJZC 1UJ3C 4YPGA 4YDKH 3OQ3B 4W70A 1YPZF 4L3ED 1W0VB 1ULVA 3K3QA 4KTEL 4DGYL 2VDML 5DVKA 1DQLL 1IKNC 4WUUD 5CEZH 3HR6A 4O5LH 1KCSH 4NSKB 1ZA3A 5EH1A 1PX4A 1JMZA 4OLUH 4APQB 3B2UD 4WWKB 3EAKA 1MWAH 5DQ9B 5D2LA 4BQ6A 1A6TA 4XCFL 1F4WH 2J8HA 1GJIA 4HFWB 3FOLA 1I1YA 5IT2L 3ULUF 4ZOAA 1G7IA 1UM6H 2G5RA 4NBXB 1NDMB 4PJCB 1FJ1A 3Q1SH 3DUSA 4XCEB 2MJWA 3QNXA 2AV7A 4LCWB 1NFDB 2CDFA 1MFAL 2JELL 1GGYA 3U0TB 1KJVA 3DX7A 2DBLL 3GBNL 4ZFFB 2WV3A 2X89D 3F12A 3DYOA 2H26A 1FE8L 1A1MB 1U3JA 3MRCB 4MMXC 4ORGA 3JV4A 4GMTL 2A9NL 5F1IB 4QHNA 4NQEB 5HHVL 4MJ4A 3WLWD 1XGTA 5I76A 5TFSL 1XGPB 3TBWB 3U0WH 2D03L 4U1HB 2XY1A 1JYVA 3L6FA 4XNMB 4XWOC 4MJIA 5HVGB 2ZKHL 4J3OC 3UPAA 3PGCA 1I9JH 1OW0C 1YEIH 4FA8A 4BELD 5LQBH 2FX9H 2ZG3A 2R9HC 3OAZH 1XH3B 2W38A 4XCNA 3MRGA 4GQPH 3GMNA 3V5DB 5FYJD 1NCWL 2FB4H 2W65A 5F7HA 1MREL 5I8OH 4YHLH 4BQBA 3KPQB 1MFCH 2VIRB 2WUCH 3GZKA 5IMOA 2YOCA 1MCSA 4W4OA 3DRTB 4XP6H 4S11A 1JPSL 4LSUH 3VXQA 3A6CL 3RX7A 1WEJL 4QOKD 3GI9L 5GGSA 4DKEL 2BHYA 2FIKB 1AP2A 3LZFH 4NBZB 1QFUL 3VFOB 3BIKB 1AO7D 2CIIA 1KPRA 3KPOA 1UJTA 3TO4B 1OLZA 1KFAL 3HC0A 3AS2A 4NJAH 5GZND 2DTML 1G6RH 3LN5A 3RBGA 1FHGA 3LS4L 4WU5B 4N90E 4F7CB 3WFCH 4DEPB 4ZFZB 4KVNH 1MRFL 5CILH 5TF1L 4NZUH 1IQDB 3RI5F 2QL1A 1Q9KA 4IRSB 2WWMD 4RGNE 4P9ML 4QTIL 4BJLA 3D2UA 2DM3A 2DQGH 1X5LA 1CBVH 3UTPD 1KCUL 1P1ZB 4JVWA 4IJ3C 2PTUA 5EBLB 1Q72L 3AM8A 2A73B 3ZTJG 5FF6B 4OSUL 4F33A 3BFOA 5AZEL 2VDRH 5EG6C 1A7NL 4OGYH 4K94L 4ZXBC 1LNUB 3EJJX 5IEHB 4WI5A 3ZKQD 3N0PB 5GJSH 1CQYA 4PG9B 4HIXL 1A6WL 4HC1L 5GGTH 3B9VA 3IB4A 5JR1H 2XZQL 2J7LA 3KXFB 3MLTB 2R4RL 3RIAF 4EVNA 1IJ9A 1XH3A 3ZKSD 5E94A 3LMJL 5A40E 4XBEL 3MODH 1AI1H 3UBXA 1TZIB 1YN6B 4Q6IC 4OCXL 2DQGL 3HE6B 4UUJB 1I3VA 3HMXH 3TYGH 5GRUH 1G7PB 4R2GC 2ITDA 3QQ3B 5E1AB 4MXWL 1JBJA 1FNSH 1YNLL 1XGYH 4KQ4L 4W4OC 2X70B 2UVFA 1EEYB 1YPZE 5DD3L 3QEQA 2QSCL 2KKQA 2CDGA 4JFFB 4M93C 3UC0L 2R2HA 3X11B 4JLRB 5DK0B 5E1HB 2Q8AH 2IWGA 2OXGA 2DWDA 1QSEB 3O81A 3E6FB 2BERA 4H20L 2EDTA 5HY9B 4Y5YA 1F90L 3KDMB 3RPIA 2OTUA 4Z0BH 5D4QA 4HIIA 2OJZL 1IGFL 2YPVH 4YHML 2IF7A 5FM5O 1MJJB 2ZOLB 1BP3B 5TE7H 3TJHC 4LPCA 1KPVA 3IETA 4U31A 1M71B 3BT2L 4ZO7A 4NQTA 4CAGA 5DURB 3TWCL 4HUXA 5HHPB 3HLAB 4FQXC 4GFTB 1U42A 5I8OL 1NGXB 2GI7A 2VZ1A 4XBPB 3H7LA 4EXKA 4QNPF 4JM2A 2P5WD 3GEWB 4DTGH 3O6KH 4OUOA 5ITBL 1OF2B 4BZ2L 4LSSL 1XF5B 1TJIH 1MVFA 1C5DB 3BPCB 1I9JL 5ELIA 1I7UB 2OSLA 5GJTL 4XBGB 1JGEA 4ZAKD 3LKSA 4F7PB 3DTXB 4HHAA 1HWHB 3G5XA 1QYGH 5C0GB 1A7RL 3O2VL 1NSNL 3QUZA 4RX4A 2DMKA 2LVCA 3BZ4B 4O58H 3JTSA 1JP5A 3ZKXB 4DQOL 3NTCH 5FDWA 4JG1L 1BF8A 4YXKL 3QPQC 3FQTA 1JRHI 1FIGL 1I8MA 3WCYA 1ADQL 3NOIA 1B0RA 4KKAC 2I60L 2JIXD 1DN0A 4HK0B 4P57B 4H88H 5IB5B 3BQUA 4JN1H 5I8EB 3PWPE 4U1GC 4E41A 2W07A 1QACA 3LRHA 3X11A 1V3JA 1RZJH 1OVZA 1JPGB 3DO7B 2Y07L 5EO0A 5C8JB 3EGSB 1E6OL 43CAB 3NA4A 4ZSOE 4MQXD 3ARDA 3PGDB 4RRPA 4YNYB 1OT1A 3KHOA 1D9KB 5JMRA 5ILTH 4PJBB 3HPLB 3L5JA 2GSGB 3MV8E 4P5TB 1DVFD 4QHLB 1WIOA 1QFWI 1GGBL 1I9IH 3MRCA 4QKXB 4PJ7E 1KN2H 2FHFA 5CSZB 1X5YA 5H35B 3TVMA 2R8SL 4XAWL 1JK8A 2HT2C 4D8PA 1T89C 1RZKC 1TVBB 2XRAH 1LDPH 2HG5A 4WIQA 2AJVL 5ADOH 1HOCA 2IANA 3EO1B 1OTSC 1AKJA 2ICCA 3LS5L 4KKAD 4LSQH 1FH5H 5FHAH 5HI5D 5TQ2H 1KFAH 2P48B 5BQ7A 3FN0L 3CXDH 2YZ1A 5K9KA 3VXPB 3RWCB 5KN5A 2YPLE 1BGXL 5IWLC 1B9ZA 4JFFD 4PY7B 2UUDH 3IFLH 3A67H 5F3BA 3K4ZA 1VKXB 3T3PE 3NFSL 3BMWA 3TA3A 2YPKA 3O6MH 1OP9A 1FC1A 5ITFA 4QOKE 5C6PB 2XY2A 4HQQL 1ZHNA 4GG6F 1IEBB 4MCZB 4G6ML 1IAOB 1NFDA 5IVXE 2DLTA 1GHFL 5SWZB 3EOBA 1S7QB 1K4CA 1K4DA 3NZ8A 3HAEG 4OZIF 2QQLH 3CPLA 5C1MB 2IFGA 4DVBB 5F7NC 5FA4A 1IQWH 3S5LG 3QIUD 2AJ3B 4CVWA 4Y2OA 4JRYE 2MOVA 4H1LG 3BUYA 4PJFA 5DRNA 3SKOB 3FCTA 3HZKA 3ILPB 4X0KA 4OLYL 5I1GL 4HUKB 4JQXA 4XRCA 2PR4L 5JORA 2R2CA 2WWKO 4MJIB 1MFEH 2EDOA 2QJDA 3SE8L 2AXHA 3D9AL 3HI5H 3PGCB 3V52L 4HAGA 5EA0H 5I15L 3FB7B 3QDJD 3WUZA 3ZE2F 1QSFE 5E99L 1T89A 5DMGC 5F7FA 4PJAA 5L2KB 3IVKA 1BIHA 1EAPA 3GBLA 4KQ3H 3THML 2A73A 4Y4HD 4F33B 4QWWC 3U9UA 3MV9D 3SQOL 1V7MH 2YD3A 3PDOB 1Q1JL 5CSZA 5FKPB 5H35A 3H7BA 2DRUA 3ARFA 3SO5A 5B38A 2V2TA 1QEWB 4D8PB 5F7MC 3BGMB 3PABA 4PG9A 2AXGB 3RBSA 4K94C 4YHYB 4MAYD 1BJ8A 3JSSA 5DQJB 5JZ7D 2V2XB 2Y36L 4ZYKA 4FTVE 2WBJD 1RQ5A 2XTJE 2YKLL 3EYFA 2DYPD 1BQHG 4KZEH 1X5KA 1XCTA 4XMKL 5C0BD 4Z7WF 2NY1C 4QY8B 4NKQB 3EBAA 1SM3L 5IVOA 1KJMA 3GSOA 4LLQA 7FABH 1KPRB 1P7QA 1A4KA 3MJ9A 4LL9A 4FQPA 4MB3A 5ID0A 1CDYA 4NUGH 2P5WB 4ZUSA 4MD0A 4FOMA 4MNGE 3SE4A 1X5AA 3LRSA 4X7TA 3I85A 4RRPG 3VMNA 4FABH 5TDNA 5MEOB 3PQYB 4DCQA 5CUSL 3QH3B 3QNZA 1BWWA 3EFDH 1IZKA 5ABDE 5FF6A 4LSPL 3AY4A 1S7UB 3BKJH 1QFWH 5HHME 2HLAB 2NCMA 5E2VL 3TCXA 2R39A 2DD8L 4K3EH 3G6DL 2R69H 4R4NC 1NLDH 2F8XC 1VEMA 3QHFH 3MGOA 4M00A 4H88L 4HWEL 4HXAH 4YDJB 3AREA 3NIFE 3V5KB 3RJDA 3I9GH 2E8YA 3EW3B 4B0MM 1N2RB 5E08H 4RAUB 1PLGL 1DFBH 2BY2A 2E9JA 1ACYL 5EIIA 3MTRA 1UB6B 4OV5A 3UPCA 2BNQA 5GGVL 1WWAX 4M7KL 3RWIB 5I1CH 3X3FH 1IL1A 1NMAL 4OF8A 3QJHA 3WUWA 2QEJA 1WWBX 4X6DA 3CLEH 4PLKC 1CFVL 2RQ8A 2DI8A 5BJTA 1V3MA 1EEZA 3TO4C 5FO7A 4R90L 2C1OB 2Q20A 1NGQL 4XNQA 4NKOA 4PJ8C 4I2XA 3RHWF 3V7AG 4UV4H 4C56A 1AXSA 1JNJA 3SGKC 5AUMB 4OCWH 2DF3A 3QDGA 2FL5A 4OLXL 5I1IL 3EDKA 4NKMB 4YO0B 4X4YB 2Y9RT 3C5SB 4PRPE 1F5WA 4QXTB 1KIRB 4YDVB 3FT2A 2IPTL 2D2OA 5BW7C 1A6UL 3VFVA 3CZFB 1ZEAH 1TETL 3RVWC 4WNQB 2F8OA 5GGSY 4W6WB 4WTZG 1S3KL 3PWJB 4G6AD 2L7JA 2A6IB 2ARJA 4BZYA 3BP6A 2APTA 3KPSA 1FLRH 2AEIT 1MHPH 4PTTA 1JNLH 3ULSB 2QADB 2V5SA 2BNUB 3C60A 3PDDA 2VLRA 1F02I 4IS6A 3S4SG 2G75A 2CRYA 4JDVB 1EJOL 2PW2A 3EOTH 3MMEA 4UNVA 1FL5A 4YGVB 3BKYL 1EERB 3HFML 5FYKH 4JRWA 5HDOA 5TGBB 4A6YB 5DJZB 1EUTA 3GMPB 1EFXA 2ZUQB 1YNLH 4QYOA 1ZSDB 3MNZA 2R4SH 3JZ7A 1SBSH 4MNHB 2YPLD 4WTWA 4WY7L 4JRYD 3U82B 4Y1AE 5D6CA 5EC1A 1U3HC 1ACZA 3LQAC 3MODL 5C07E 3DSNA 2Z31C 3CFIC 4Z76A 4M5YL 4KROD 1IFHL 1EZVX 3TBTA 1R3JA 5C07D 3V0VA 5J6GA 3TJEH 1FNAA 2N56A 4ZFOB 1A6ZA 2GAZB 4N9GA 1AD9B 4Y5VC 3JBG7 2OZ4A 5LGJB 1RUPH 1S7TB 1ZA6A 5DT1L 3MQIA 4WHCA 4B7LA 3N1QC 3BP7B 3D2UD 4FQCL 4UINL 4NFBA 1D5MB 2ZOKA 1OP3K 3VFMB 3UEZA 2VN7A 1GIGL 4Y89A 15C8L 1JPGA 4Z7WE 4LASL 5FUCE 3S7GA 1HQRB 2BMKB 1VEOA 2P5EA 5JXAL 5GS2H 3LB6D 4KKBD 1AHWB 2ZUYA 4P46D 5JTWA 2CDFB 3NZ8B 4JHAH 4XVJL 3RVXD 5FO8B 1INEL 2NXYC 4ONHB 4HT1L 4JFDD 1A3RH 3KPSB 4YHKL 5CHNB 3MLSL 3D69B 3SGEI 3WL9B 4PJIE 1I3UA 4L4VE 3QDJE 1NCBL 3KYAA 4M1CD 1AE6H 4L4VD 1AGCA 1G9MH 1Q0YH 4G43B 3QEQD 1DBKL 4E5XB 2R2EB 2BOBB 2IPUK 1JGUH 2YC1A 4KI5D 2VDQL 3O9WD 1QNZL 3QNYA 4JFQA 3G04B 2Y23A 2ZCKL 5F9AC 1ITCA 3DUHA 5I1HL 1J8HB 5ACMA 4PJAB 2NXZD 3KNBB 4OQTA 3EYVB 3U79A 1UWXH 1W0YT 3PGFH 3G6JB 4LSUL 4ELKB 3O45A 3BJLA 5I2IA 3MLUL 3CK0H 4NNYA 3MLZL 4L5FL 1KELH 4IMLA 4OCYL 3ZDZE 3CDYA 3WN5B 4I3RL 5HHMD 1Q38A 2EDHA 4P5MB 2BVUA 1V3KA 4NQCB 1EX0A 2ORBH 5MP6L 3OPZL 1EV2E 2RB8A 3EOBB 5D71H 3QUXB 1XCTB 1U36A 3WHXB 4EN3D 5GGRA 1L7IH 4MVBC 1T66C 1T5WA 3HUJA 2CQVA 3T2QA 5CIPB 4ZXBA 1QHPA 5HYJB 3NACH 3T0ED 3O8XC 2NY3C 3MJGX 2ZJSL 5FM4A 4OF3A 3BUYB 3KPOB 3A6OA 3FCTB 3P0YH 4YHZH 1NCBH 3O2DA 4I0CC 5DRZB 1FVDA 1WCBA 5DHVB 2HT4D 3OJ2C 4IOFD 3HHRB 3QXDA 4K8RL 3W2DL 2W9EH 2Z4QA 3RY6C 3VXSD 3BD4A 2P7TA 2W1NA 4PUBL 3CFEA 3T0WA 1KBGL 1K2DB 2D31B 2DS4A 3HE7D 3IDIA 2O5ZH 2NTFB 4YR6B 1PDKA 2VQUA 2QQKH 4QHKJ 5DZNA 4ZUUB 4LIQH 5MHSE 1ZT7B 4QHUA 5AYUL 5GRWA 3BWAB 1FZKB 1OAKH 2FRGP 2GK0B 2Q7NA 4Z77A 1C1EL 1H0DB 4KMLB 1H3PH 2NNAA 1S7SA 1EPFA 2GQHA 4PJIB 1FNGA 3L3KB 2VDMH 5DVLA 1CE1L 3H9SB 4M1GL 2D7TH 4POYA 3K80A 2ITCB 4UT9L 5D6DC 1LE9A 3CNKA 3OX8A 2W65B 1FBIH 1K8DB 2JKXA 4FQJH 4OJFL 3RWIA 3B2UC 4OI9A 1HINL 3QHTC 4JM4L 4HCRL 2AABL 4AIXA 2DQUH 1PG7X 3ARDD 1A0QH 2DQJL 3FT4B 3MSPA 2KH2B 3RFZC 2ZUSA 2XG5A 4P2QD 3QQ3A 5E1AA 2WUBL 4WUKH 5F96L 3FAWA 4PJXB 2HP4A 3E1F1 3LQZB 3MOAL 4WFEE 1NFIA 5GGRB 5MEQB 4RMRA 2VLJD 4GKZA 3HUJB 3NPSC 4YUEL 2H6PB 2EXYD 1UXSB 4UT7L 3VXUA 2DLHA 5I1JL 3QEUB 3S37X 2A38A 1NJ9A 4WWKC 5J3HC 3ZO0A 5F9WB 4J3VA 4Z5RA 1WBYA 4HLJA 5L2JB 3VU2A 3N06B 4TSCL 1XGRB 5JW4Q 1IBGL 3GSNL 4D0BA 5IBUG 1IQDA 1HCFX 1AQDB 1F3RB 4LEOA 5D6DA 3BRDA 2AK4A 3JVGC 4OFYA 5D1ZB 2X4RB 3B8SA 3MRLA 3S34L 4R26L 5I15H 2YUVA 2XYCA 4DAGL 4BQ9A 1KJ3L 5C08D 2BNQB 1I1FB 3MMEB 1I1AB 3U7YH 2WIIB 5AZ2H 3UTSB 2CSPA 5CJQL 5CP3A 4UV4L 3FONB 1U8MA 2DMCA 1KIQA 3DUUA 2VDPL 3IRPX 2J8UE 4I0KA 1SEQL 1SMOA 3TNNB 1CGUA 3LKSB 2WLYA 4G3YL 4F7PA 1QD0A 1IM9B 5EU7E 2VDLH 2BNRE 3E2HC 4O02H 4PRHB 4AG4H 4R26H 2X1WL 2V7NA 2YEZA 2E6PA 2J88L 4Y2DC 1WVZA 5I8KH 2BVTA 1U93B 2YR3A 3MXWL 4GOSA 4WW2B 4Z76B 3BP5B 3CZFA 5F6HI 2V2WA 5CP3H 2WP3T 5DEGA 2VUOA 3UTOA 3QRGH 3IYLW 3BN3B 3ESVF 1NAMB 3VFNB 3JWDC 3CSGA 1XR8A 5DHYA 4Z8FL 4ZD3H 1D5MA 2COQA 3EDFA 4Y5XB 2DQHH 3PWNA 1OP5K 4OFVA 4XCFH 4GAGH 5FGCB 5KBNC 4FQ2L 4C54A 3G5ZA 2NY0B 5E6IC 1IEAB 5KANI 2C4FU 2VRAA 1SYVA 5T3XL 1GC1L 1I7RB 4YGVA 5EO1A 1QSFB 4NQCD 5E5MA 3CUPB 3OAUH 4JG0L 4JZOA 4LHUD 4H0IA 3FO0H 4N0UA 1AR1D 4LAQH 5DC9B 2GSGA 4FQJL 3MNZB 3VXME 4JO1L 1ZANL 4PD4K 3D48R 1CD0A 3K1DA 25C8L 3L9RB 4AEEA 4YE4L 1BWMA 1HXMB 5J8OA 3LHPL 5BS0E 4KY1H 5FA3B 3SHSA 3T2OA 5D6CB 5EC1B 4NNPH 4G5ZL 1MJ7L 2DL9A 5A3IC 2ZCHH 3ZHKA 3GKWH 4YK4C 2VXUH 1OAKL 2V17H 4K7PY 1J05B 2Y36H 5EBWA 5B3JE 5C0GA 5K9KB 3BP7A 3BH8B 3GNMH 3FJTA 2JCCA 2O5ZL 3BD5A 3C6LA 3OR6B 1I85C 5TDOB 1BAFL 4LHUB 3WLWC 3JV0A 1ADQH 1UZ8A 1TPXB 4MA7L 3WFBH 1CL7I 3FOMA 4BSVB 5EUKA 5LGKA 5J13B 3HE6C 4XXCA 5F1KC 3U46A 1M05B 2X09A 3ULVF 1CU4L 3MUGA 1EBPA 3MCKA 5B8CA 4UIMB 5GSRB 4XP1H 5IHUL 1NGZB 1QYGL 2OMNA 1Z9OA 3CVHA 3S3PA 8CGTA 1LK3H 3O8XB 5KSAA 4HFUL 1GSMA 3TBYA 4CVZB 1U8LA 5AZ2L 5EO0B 5DRNB 1XGUB 2X4NB 3QG7H 3WKNA 3BGFB 2ZUXA 1JZ3A 3MUZ1 2P8MB 2YD4A 2UWEF 2R0KL 4KJQD 4LMQE 2ZPKL 4JO4L 5IVZA 4ENEC 4UV7L 5DJYB 1CLYH 5KVFH 5ESAA 3FB7A 3JVGA 2HFFB 4MA8L 4RFNC 3NCMA 3QDGD 4ZDHA 4X5LA 1J7VR 2R1XB 2K7PA 3IDMA 3C8KA 5CKGA 3MNWA 4KK8C 4JDZA 2NY5L 3L7FB 4LOUD 5SWSE 5I19H 5SWQB 3R1GL 4HWNA 3VWKD 5F7EH 1BX2B 1XR9B 1XF3B 4H1LB 4KKCC 2BJML 2O5YH 1L0QA 4M7JL 4G6JH 2AERT 2YSSB 2F54D 1ZVSA 5C0RL 1JNNH 2BCKB 5KVGH 5FCUL 4L8SC 3CDGB 2EECA 1DBAL 3QB7C 4UB0L 5HYJA 4QY8A 4Z7NF 1HYSC 1OAUL 4GKNB 1GVIA 3HI1B 4QRRA 3HMXL 4KDWA 4QTHB 1FVDB 1WCBB 1FLTX 1AGDA 3FT4A 2ARWA 1BFOA 4WO4D 3ARTA 4M8QB 4DW2L 1UA6L 5EUKB 4A6YH 3IU4L 2IPKB 4XP9H 4X4ME 2N4IA 3X17A 3PQYA 4H26B 4Y19E 3H9ZA 1DQDL 4XX1G 2P45B 5EOQH 2M8XA 3CVHB 2L0DA 2GK2A 1Z5LA 4PJ8A 2Y6SC 2FH6A 2NW2B 4HX1B 3VWJA 5J0BA 4R7NA 1OTSD 3QUMB 3NABH 2D7OA 1KJ2L 1I8KB 4XMPH 5FYKD 1VACB 2GK0A 4XP5H 4LLMA 4PJDF 1RAMA 2PO6A 1MRDL 3KLDA 5FUZL 1FV1B 2EC8A 2FLBT 3PDGA 1JZ7A 2GITB 2HH0H 4WFHD 3V5KA 3MRLB 1RUQL 2W9DH 5BVJA 1MCNA 3W2DH 4NZUL 4JRXA 3SBWC 1SJEA 3TESA 5EUOE 4EN3C 1A4JB 2BHZA 3MRMB 3R0NA 5KSVA 4X5WA 3TVMD 3ARGA 3TIEA 1MJ8H 2PXYC 2P5ED 1DL7L 1VERA 4HW6A 5D7SL 2RGSA 1UWGH 4ODVH 4PGCA 3FONA 4FMFA 5EBMB 5IHBA 3S37L 2DQIH 1O7VA 2P1YA 4NCDA 3VRLF 1QR4A 1T5XA 3VGGA 1FFRA 4P9HL 3OJVC 5MI0C 5HGDA 2XZAL 4I2XB 3BZEB 1KOAA 3R1GH 5E8PA 1YEGL 2H2SC 3VG0L 1Y6KR 4MQ7A 4U33A 1JNLL 3LN4B 3T8XB 1OSPL 3NIGE 1NCDL 3O41A 3KGRA 4IRJD 4F7MA 4GQ9H 4MNQE 3WXVH 1NAMA 3CFDB 1A1NA 3B9KD 4WI6A 1CLYL 4LP5A 3MLUH 5HYFA 4J23A 2HFEB 4P2RA 5MERB 1CICC 4JRYA 3A6BL 5D7IB 4PJHE 4V1DE 1MFDL 1EEUA 3QNZB 5JUEL 3GSUB 4JY6A 4PJEA 4G9DA 4EN3B 1YEIL 3CX5J 5IW6A 4X80L 1A6PA 1KLFA 4Y0GA 3FO9B 3RVXC 3WS3B 3VXMD 2OYPA 3NZHH 5CKAA 3BP4A 4G7VH 4R90H 4F37F 1ZE3C 4OM1L 1UXWA 2GUOA 4JZOB 1C5CH 4KKBC 1WBXA 3MFFA 2D9CA 4GMTH 4FQXD 4NC2B 3KS0J 5J3HD 4UQ2A 1X7QB 4UZGA 1AGFA 4OCLC 2XN9A 3CFBB 5I1EH 4R96B 4PRBA 2R0WL 4QYOB 1KIUA 1HXMA 2IBBA 3QXAA 2YEZB 3E3QE 4Y2DB 5JXEA 2YN5A 2VISB 5DI8A 4KAQH 1HK6A 5K93A 3WNPA 2JELH 4CADA 1MRDH 3EO0B 5EPMB 4PJ9A 4P59H 3SPVB 4OLZL 2LE9A 2XTLA 2DWEB 4JQXC 5I16A 3TIDB 3HI6L 1DBMH 4GW1A 4IDLA 4OZ4A 1CICA 5GGTL 4J6RL 2OK0H 5JOPD 2ZOKB 4Q6IB 1ZXQA 5F7LB 4OZFA 3V0WH 1NANH 2YK1L 4JFPB 1UWEH 4AM0A 4WU7A 4PJCA 4K3JH 2FO4A 1EMTL 2F19H 3NFPA 4PTUA 3F6IA 3ES6B 2PTTA 5D93C 2BDNH 4WUUE 1PYWB 2DLIA 3CFDA 4E41E 1V7NL 1ZVYA 5J06A 3IJYA 1KN4L 1FZOA 5E8EB 3P73B 2J12B 3UTQB 4ZNEA 3RY6A 5J56B 1UKSA 3QUYA 3OGCA 4LSTL 1QR1A 1DBBL 5C0AA 1C16A 4MDIB 3C87A 4XNUH 1OAQL 4GT7A 4OD2B 1BQLH 5I76B 4I13B 3RNQA 1FFOA 3M8OH 1YNTB 4OTXH 5IM7B 1TIUA 1NKRA 1QVOB 1J1PH 3IAGC 2OP4L 2MKWA 1OGTB 4E9LA 1T1ZB 4MHHI 1JFQL 2VYRE 3ARED 1T22A 3OR6A 4PBWD 5IBTL 5FECB 1B4JH 4TNWK 4F37K 1A5FH 1UT9A 1IZJA 2VISA 5JQ6H 1QLFA 3IKCB 4JCMA 3ARVA 1G7IB 2KDGA 4C83A 3GMLB 3QI9D 1RJCA 3BPNC 3H6JA 1JRHH 1KT2A 5A2JH 3V0VB 2IAMD 3DURA 5JPMB 1CIDA 5DD1H 1MFEL 4YHPA 2G5BA 2DWEA 5J7CC 4MS8D 4HUVA 3K1KC 2R0LH 1KEGH 2OJEB 3RWEA 3V4VH 3HNTH 1HH6B 5CIPA 2MQ3A 1NFDE 3FMGH 3S3SA 4HPOL 4Q6IA 5EIVA 1YEHL 1LO5A 4YHOL 1MUJB 1K85A 4I18B 4NDMA 5IB2A 1MCIA 4KI5C 3N9GL 5EFIB 2IPKA 3C2AL 1PLGH 2PTTB 3VJ6B 2X5PA 3LKQB 4N8CL 2Z8VC 4KMQA 1EK3A 4OGAD 1CL7L 4X7CC 1MHEB 4WRLA 2NR6D 1U0QA 1AO7E 5EOCJ 3Q1SL 3LD8C 1JF1B 4Y16D 1QRNA 1K2DA 2D31A 1G0YR 4LARL 3LRGA 3QULB 3ALWA 3P11L 2E27H 2Q3ZA 4PJHF 4R7NB 1IC4H 2JK5B 5D7IE 5I1JH 3FB6B 2HTLC 3QUYC 4WFHE 2NTSP 5CJOH 4YUEH 3DVNB 4NO0B 3B83A 4ZOCA 4JANA 1Z0MA 1NUNB 1MI5D 1CZ8L 3K8LA 5I75B 2WQ8A 4PJHA 3EDJA 1DSFH 4U1IA 3MR9A 1ONQB 1PG7W 3NCJH 1T2QL 2X4QA 1L9MA 4FHBD 1YMMA 1JF6A 5C2BH 4XAWH 1ADQA 4NNYB 2NY1D 3OBAA 4ZNCD 5C86A 4GG6A 4DEPC 4GKNA 4GKSB 5T3ZE 2ADGB 4UT9H 3HC0B 3QG6B 1FG2A 2VXTL 2D7TL 5JHLL 3OAUL 4JG0H 3QO0A 4U2ZA 3GUTA 2DICA 5D1XB 4NQCA 1G7LA 2APBA 3ZSSA 4JFEA 2F58H 4JREC 2FIRT 3FQUA 3I3EA 3VFRA 5C0EB 1Z9MA 1A7BA 1Q9KB 2WIMA 5T1LD 1VA9A 3CMGA 3OF6D 5I6XB 2IFFH 3VXRE 1TQCB 2A6KB 3UJIH 4PJBE 1N5YL 1I3GL 2UWEE 3IJSA 5D1QC 2VWEC 4KTYA 2LQRA 4JKPL 2FDBP 2XTJD 3T4YB 3WEXB 2RBLA 2J2ZA 5E2TL 5I18L 1LO5B 4Z95H 1LNUA 35C8H 4OD3L 5ACLA 1BZ7B 1NEZA 4X4XB 5ID1B 1UACH 1IGJA 1V7ML 5KW9H 4MQTB 1RIUH 2VXQL 4P2RB 5J1SC 2IQ9L 4NYLA 4HWZB 2Q86A 4JDTL 2BVPA 4NQSB 1LP9E 4YXKH 1HCVA 2CLZA 2V7HB 4HGWB 4R3SA 3RL2A 3Q3GB 3S3JA 1JHKL 2P44B 1DEEA 2P5WE 2F74B 2FJHB 4I77H 2SEBB 3NTCL 4JR9H 2XWJA 5HHPA 4XP4H 5DK3A 4HPOH 3QJFB 3TEUA 5E8OA 4K7PX 4G9FB 3GSRA 2X4PA 4NZRL 3HNVL 1R3HB 2HLFD 4QEGA 4EIZC 2E9IA 3KAAA 4UUJA 5GJTH 4HS6B 4X80H 4N0FB 2AJZB 4Z77B 4I48B 5DQDH 5E8DH 1KNOA 5C0NC 1E6JH 4PJIF 5FGBC 5ISZB 3F5WA 1KG0A 3VDAA 5F9WC 4G8EA 1AR2A 2Q76A 3O4LB 1T1WB 4PRHA 2VQ1A 1RZIB 1JNHA 2AK1H 2I9TB 2NY2D 1BBDL 1HHIB 1S7RA 2LU4A 1B2WH 3CX5K 5BVPL 1NCDH 5HY9A 1YJDL 3QCTL 1F8TH 5D7IF 3DETD 4Y4FD 4L8CA 1G9EA 1BBJB 3LV3A 3NA9L 5I73B 2QR0B 1ZLSH 3M8OL 1U8JB 3VH8B 3MV01 3MLVH 3VWKA 3WIFB 3U6RB 2YA2A 3HUJF 4QRPE 1CIUA 3SKNB 2A1WL 3H0TB 4X9HA 5CJXC 3L5WB 4P5KA 4AM0B 3C6LC 4M43L 4EEEA 3FO9A 4G6FD 4K8RC 3VD7A 4FXGB 4MGXA 4JM2F 5L8JB 1VESA 2KQMA 4M6AA 4TVPL 2VXVH 3ZMRA 5IOPB 5I75C 1HH9B 4K07A 4ZTPL 1PZUB 3MXVL 4PRPD 5E8EA 3BEVB 4HWZA 4RWYH 4LPTA 1ZTXH 1TXKA 2V7HA 3Q3GA 5GRVK 3TFKD 1D6EB 2YK1H 1CDJA 3R8BB 4PRPB 2JB6A 1RJLB 4XP5L 1HXYA 2QQNH 1CLZL 4I4WA 1G7HB 2C3VA 1G9NL 4Q6YA 2Z92A 1VSCA 4WCYL 5TF0A 4XPGL 4HIXH 5LAXB 3QIWB 5T1DL 4OZ4B 2GJZA 1J05A 4PV9B 2VDRL 4JFZH 4K71B 4P9HC 4OLEA 4E41B 3GO1H 3QFDA 1KCUH 3AFLA 4RWYL 4C83B 5AAMA 1QFWM 1TFHA 3CZJA 1CF8H 1NANI 3RWJB 2HA1A 4BSWB 1HHKB 4PRIA 3BE1H 4C57C 4Z6AT 1MLBA 4HIJA 2GIYA 2DTMH 3VXUE 3IJYB 1MCPH 1GZQB 1FZOB 2E7HA 4N1EA 3Q6GL 2P46B 1U8JA 2AJ3A 4R8WH 4G6JL 3B9AA 4MX7B 3AVEA 3LZFL 4LOUC 3O2WL 2XXMB 2EYRA 2RFXB 2DN7A 2BC4A 3MGAA 4O9HL 3NN8B 3OV6A 2A74B 2P8PA 3HG1D 1AKJB 1RD6A 3OKLA 2FX7H 5IROA 4HXBL 5FUOL 2WUCL 5HDQH 4FZEL 1MHEA 2F15A 4KROC 5C6WH 1OSZB 4IRJA 3GFUA 3ULUC 3U9UB 2EDKA 5D7JC 2EC9T 2X4TB 3IFPB 1MJUL 1U3HA 4HKJA 1BOGA 2X1XR 1FAKT 3UTTA 1VGKB 4Q9BA 2CKBL 3HZMA 5B8CC 3MCLH 4HK3J 32C2B 4G7YL 1RU9L 1NCCH 4Z7OE 3HNVH 1LK3L 4XPBL 3LSOB 4NQDE 5D5MF 2OJEA 4NQDD 4XP4L 4F58L 1HWGB 3GIZH 4XCCL 4WWKA 3WFZA 3ARWA 3GM8A 3KXFE 1JWMB 3UP1A 1TLKA 4GRMA 4LVNB 4FQXA 4HUUA 1D5IH 4MNQB 3V0AC 3RZCD 5CMAB 4PRAB 4WEUD 4FZ8H 1MUJA 1VEPA 5EZOL 1OY3B 4LLVB 3U4EB 4TVPD 5IB4B 2BOCA 3IDGB 4HLZG 4YZFF 1J86A 1BQHB 1DZBA 4Q74A 4U1JA 5DD5L 1MLCB 4IOFC 4U6VH 5E2WL 5LXGL 1SYSB 3IDJA 2Z31B 1G7QB 1K3ZA 2IC2A 4KKLC 2PW1A 4XVSH 4R0LC 3BO8A 2DQCL 4GAFB 1QFWL 1N26A 3OKOB 4HAFA 5FO9A 1FCGA 1G9NH 3L7EB 1CR9H 4PYHA 5DGRA 2H9GA 5IK3B 5CD5D 4DKFH 2D7QA 4KXZI 1BOYA 3VFWA 3ARRA 4M5YH 2VMFA 4J8RB 2VABA 1FL6B 3WNLA 3OG4B 2YD9A 3VE0A 4XX1E 5D2NC 1VFUA 1FV1A 2DDQL 1MWAA 5LWYL 5D2NE 1F45A 1CGSL 2EIZA 1P7QB 4FP8H 4NUGL 1ZGLB 1U8QA 3ZYZA 5BS0B 2H41A 3HCVA 5ANMB 5IGXH 3J8F7 3L3GA 3WNNA 4Z7VE 4U6XB 3L7FA 5KSVB 3HC3L 4HKBA 4Y4KD 1OAZL 3I2CL 1NL0H 1XIWB 2A1WH 3VXSE 5KVGL 1YEKL 4J4PA 1HILA 5CJOL 4GAGL 3PHOB 3U4AA 4R4ND 3L3IA 4UIKH 3PV6A 1CT8A 3T0AA 1T5XB 2ADJA 1CGYA 3P77A 1S5HB 4D9QE 3PJSA 3O11A 4UDTA 4NGHL 4XMLL 3U9PH 5FYLH 3MBED 4LLWB 1LO0L 5D7LD 3LN4A 2X2YA 2GTWB 3UYRL 4XNYH 4OUUB 3CJJA 1I4FB 3LPWA 1F4HA 4TULH 4NFDA 4WV1B 2FZ3B 4XXDA 5I0DA 4LEXL 3RZCC 3QUMH 5MERA 1UQSA 3BDBA 5I8CB 4NHCH 2AS5M 3BVNA 3MV11 3PQYE 3GSVB 2PW1B 1UYWL 1WFTA 3LQAL 3P2TA 4QRQB 3PWPB 3VMPA 3QUMA 3N1MC 4PV8A 2D0FA 2ZUQC 3WS3A 4KK5D 1AY1H 2EE9A 2ZNXA 4QRRD 1KTRL 4J12A 1JGVL 3DRTA 4X6DB 4QF1A 5JZ7C 1DUYA 3ECBB 5GGVH 1MOEA 4J3TA 5KOMC 1U6AH 5B21A 5BXFB 2FJGB 4ALAH 3AMLA 3BRGC 3KPNA 3KPLB 2VXQH 3BYTA 4RCAA 4IIQC 1WC7A 5BO1L 3SKUD 1GZPB 1JFQH 1DUZB 5GXBB 5GGSB 1IGTA 1AP2B 3CVIH 4JFFE 3NCFB 1MWAB 3BIAX 4X4YA 3PWLB 4MSWB 5FCSH 3KYKH 4K7PH 4XPAL 4LVOB 3S35L 4AY0A 2HRPL 5HVHB 4YHNA 3IFLL 2VC2H 3RP1A 4BK4A 1UM6L 1PQZA 3N1FC 3QWOB 4DVRL 3BN9C 4RSVA 4LF3A 4KK5C 3JUZA 4ZFOA 3ARXA 1NCAL 4JPVL 1QOKA 2Q1EA 1OAZH 5L8KB 5T33L 3VWKB 1T80A 2OQJA 4GW5A 1N3NB 2E3VA 4YH6A 2GHWB 1ES0A 2OBGA 1LQSR 2ATPB 3RKPA 2RIKA 5GISL 1GPOH 1P1ZA 1YUHB 2F5AH 3RDTC 4YE4H 2G75B 4ODHL 2B1AH 3KVQA 4JFPA 1QPXA 5IHLB 3BW9B 3CFCH 4PRIB 2B0SH 4L9DA 4FNLH 4L4JA 2XXCB 4EXPX 4HIIB 1JGDB 4PP1C 1S78C 5TGBA 3I3BA 5FO8A 1QKZL 5EC2B 4HIHB 3HA0A 4JGMA 4JPKL 5L6YH 4KPHH 4PGDB 3UAJD 3FQWA 5T33H 3GSXB 4HUXB 1A47A 4GMSL 4GRWE 4EVNB 1NC4B 1LO4L 1ZWIB 5HHXL 4Y5VA 2GTZA 3HI6H 2DQHL 4L4TA 1N0XL 5KANG 1REIA 3N1PC 1BFVL 5TQ0L 2OM5A 3H8NA 4Z8FH 3HZYA 4JN2B 2NZIA 3KYKL 1PEWA 1A6ZB 2GJJA 1CXKA 1AD9A 4JRXE 1AGFB 2J4WL 1FVEB 1LEGB 2PO6D 3B9KA 4PGBB 4WDIA 4WJ5A 4D3CH 3BAEH 3T65B 1KIPB 3MRIA 4JFHE 1W0WB 3MFGB 1MCWW 2BSSB 4PJ9C 4U7MA 2EE3A 1DUZA 1Z6JT 2V5YA 4HKXB