3RWFB

Rhesus macaque mhc class i molecule mamu-b*17-qw9
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
b'MIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I
publication title Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rwfB00
3RAJL 1YEFH 1NEZB 4Y2DC 2QR0A 3U4EB 4MJ6A 4ZTPL 4NRZA 2GHWB 4EN3A 1NGPL 4RMSA 4WCYH 1REIA 2OJZL 1A6WH 5D7IF 4OZGA 1HH6A 3H3PL 4OD1H 5EOTA 1E28A 2OS7A 2O61A 3V0WL 5K9KB 1ITCA 1FNSH 2HFEB 1AR1C 4D8PA 5CCKH 5TQ0L 5EOQL 2X9WA 1EXUB 3RDTD 4M00A 4I48B 4EDWL 4RX4A 3ZO0A 5B39B 1CL7I 2XTJD 2OZ4H 5J13C 1RJYA 3QNZA 4LCIH 5SWQB 4KK6D 1NMBH 4JRXD 4JG1L 2VNCA 2VXVL 4GG8A 3QUMB 1MCWW 1PZ5B 1TJGH 3QXDA 3TVMC 4P2OB 4O51B 5GISL 5DT1H 1SBBA 3UMTA 5FYKL 1T5WA 3S36H 1J05B 3L6FA 4BH7B 3MA9L 1I7RA 4DUVA 3MV7D 1MIEL 2XWTB 1RI8A 1T1XA 3WFHA 3O6LH 4E41A 1PSKL 4NQTA 3JZ7A 4TPRH 3O11A 3C5SA 1S7TA 5E70A 3ZTJG 5HYJE 3NZ8A 5D7LA 4M61B 2NLJB 1MCKA 4P2QD 3P2TA 1G9NH 4JE4B 3F7RA 5IB1B 4P3DA 5HGBB 4BK5A 2IAMD 1R24B 5JXAH 3B3IB 2Z91A 2XWJA 1RUMH 2EICA 5DI8A 4GAYB 2OM5A 5KG9A 4M8QA 3JV4A 1CFVH 1U6AH 3FQRA 3S88L 3TV3L 1A6ZA 1HWGB 1Q9KB 1FL6B 4ZO6A 5E2VL 5E9DD 1YQ2A 2ITCA 3QDHA 4U6VL 5JQ6L 1FGVH 5C86A 3DBXB 1Y18A 3KGRA 4EVNB 3X3FH 1V5JA 3LH2H 1FBIL 4EIZC 4K8RL 4KZEH 1JL8A 1FL5B 2AS5M 1JTOA 4O2FA 4U1LA 1X44A 4LPTA 1HCFX 2D4FA 1CXHA 3FB8A 1JGUL 3WFDH 4MNGB 1KPVB 3MFGB 4UOW0 1J8KA 3QQ3A 4GXUN 4Y16C 4ZOAA 2A9NL 4LP5A 4OZIE 4F7TA 1SY6L 4PTUA 4FQXA 4QYOB 4RAHA 1C5DA 5B21A 4D9LL 5DJYA 3QPQD 2O5XL 5C0ND 5IHZB 5E4EC 1UM6L 2XXMB 5AWNL 3GK8H 1QKZH 3TBTA 1TJHH 4GXVL 3IDIB 3MRQB 1KTLB 2EECA 1MQKH 2OYPA 4MD5A 1FG2B 1CGWA 4Z5RA 4KY1L 3B2VH 2QL1A 5CINH 3HMXL 1JHTB 3PHOA 1CK0H 2M26A 1JHLL 3EKCA 3MRLB 1TNNA 4X80L 4TULL 3ES6B 1RIHL 3BP5B 1NKOA 3JVGA 2APBA 1N5YL 3PP4H 1LO0H 4KRPD 5EUKA 5C0FA 2XG5A 1FZMB 1TQCB 3HZYA 1XAUA 5HI5C 1T66D 1J1PH 4BSVB 2DQHH 4W81A 1LP9B 4WY7L 3GI9H 4PJBB 2RAMA 3RJDA 1AC0A 1IM9A 1IKFH 15C8L 4M6NH 1B3JA 3NCYP 4ZFZB 5SWZD 5E24E 2L7UA 2DLTA 2ZOLA 3GHBH 3DO7B 3EOTH 3JTSA 2MJWA 3BW9B 4MNHA 1A7NL 4X7CC 4NIKB 1NCWL 4QRPA 4Z0BL 1DE4A 5IVZB 2W60A 4XNQA 3KYAA 5H2BB 4AT6B 5I0DA 1A7PH 1KTKE 3QIBD 1ZHNB 1Q9OB 3L9RB 1P4BL 5IB2B 4NQCB 4QNPF 3EO9H 4XBGA 5DYOB 4HS6B 3MLXL 3H6JA 3X12A 4TSCH 3D2UB 3E1F1 3NACH 1S9WB 1T5XB 5DJ6B 4NQSA 1TFHA 2QQKL 1K2DB 1FFNB 4UILH 4K7PY 4Q9RH 2R2BA 5D9SA 5CWSB 4N90D 4JQVC 4JFDB 2Z93B 3BP6A 4LPVA 4P3CH 4G9FD 3EGSA 4ZPVB 3MNVA 2QQNH 1Q0YL 2B1HL 4G8EA 5IB5A 3V52H 1F2XK 3H9ZA 2WWMD 1IBGL 1KB5L 3RDTC 4JCMA 2JCCE 3DXAB 2VTFA 1UACL 4JPVL 4DEPC 7FABL 1CXLA 2XTJC 5D70L 3KPPA 3U0TA 5I76A 3BPLC 1KIQB 3IB4A 1MFAH 4XAWH 3D0LA 4M6OL 4X4ZA 3RWEA 4KK6C 3DMMA 2EIZA 4X6EB 1KLGB 2OK0H 1BQHA 3MNZA 2GJZB 3W2DH 5J6GA 1MFDH 5IT2H 4FQIH 4HFUH 2E8YA 4UI2A 5SX5H 2UZIL 1E6JH 3BPCA 3TIEB 5DRWA 2CKBH 5IMMA 1CDHA 1Q9LA 5FGBC 4HKXA 5DEFB 2PO6D 2DD8L 1FZKA 2FB4L 4NOFA 3MROA 3MXVH 5EC1B 1BD2A 4P59H 3QQ9D 4X8JA 4MD0B 1X6LA 3IF1B 2XKUA 4OFPA 4HPOH 1QRKA 2X4PA 5KW9L 4N8CL 2IAMC 5DHXB 1MCPH 4PLJD 5TDOB 4HMEA 1LD9B 2Q3AA 1KACB 4O2CB 1ACYH 4LAQL 3R06B 5ISZA 5C1MB 2OP4L 2I5YH 4M7LH 5F88A 2FO1A 1SJHB 1V7NH 1KFAH 2R1XA 3QFJB 5ILTH 4ZFOA 5KANI 4LHUD 3DVIA 3WLBA 3VDCA 2Q87A 1VKXA 1R3IH 1YPZA 4LLUB 2G60H 1JUFA 5IQ9B 2VLRD 3KLDA 1ZT1A 2YUXA 1JF1B 4K7PX 1TETH 3CSGA 2E9IA 3GNML 4TTDD 4KI5D 1FPTL 5EZOH 2G9HB 1RUQH 4TTGA 3NFNA 2DWDB 4WHYH 5I1GL 1GAFH 5F1SA 1BFVL 4QTHB 1KENL 4ZUVA 3QPQC 5C0NC 3B5GA 2EDXA 1MHEB 2J88L 4PR5B 3CXHJ 4K2UH 2YUVA 3QIUB 4NUJB 5I1EL 4GG6A 1NCDH 4BM7A 3FOLA 5E2WL 2AABH 2ILLA 3P0VL 4P57A 2PUQT 5EWIH 4OCWH 4JDTL 5CBAA 2QV2A 1JWUA 1RJLA 2G2RA 1MAJA 4XNXH 1P9MA 3D3VB 4IOSD 1CD0A 4PV8B 12E8H 2AK1H 3DNKA 3DRTB 4IJ3C 3VRJB 4M43L 4PJ9A 1GRWA 4OGXL 3VI4F 2GT9A 3R4DA 2IG2H 4KRPC 2RFXA 1UH4A 1T66C 4XP4L 3V95A 1A1NB 3FQTB 3M17B 4IIQA 5IBTL 4A6YH 1UWEH 1J8HB 3PQYA 4NNYB 4MXWH 4NC0B 5DRXB 4OV6F 2YK1H 3EYOB 5LGKA 4YHIB 4EN3D 5BV7C 5EBGA 3VXTB 5L2KA 3GUTB 1M1SA 5D1ZC 4D3CL 3JUYA 1OAYH 5GRUH 5JDSA 1IGML 5C3TA 1CLOL 1MCWM 1I3RB 2X70A 5EORL 2H9GA 4HUWA 1NKRA 1UWGH 4RX4D 1RVFH 4M7LT 5T3ZD 3NH7H 3N85L 5I75C 2E3VA 4JN2B 3BKYL 3QIBC 4U1JB 1FVEB 2Y36L 2BRQA 1QFUL 3WN5A 2ZOKB 2MQCA 5FUZL 4FZ8L 3S37H 3MLRH 4U1IA 1P69B 5IOPB 5HHMB 3G6AA 4RMWA 5F70A 1WCBB 1M7DA 3MRMB 1C12A 4YXLL 3V6ZA 3T8XB 2UVEA 3PHQB 4NQXA 5B8CB 2XN9E 5CSBA 3S9DB 1DBAH 4YC2B 1UQSA 4OJFL 3P77A 3IFNH 2QSCL 2EC8A 3RZCD 4RZCA 3W5NA 1EHNA 4U3CA 3HLAA 1QRND 5D7LD 2WWMC 3MCG1 3OKKB 2COQA 3OPZH 2O5ZH 2VSDA 1IGFL 4JANB 3MLSH 4G6ML 3WKML 2HJFB 1HHIB 3NGBB 4YHKH 1EIBA 4RMTA 3RVWD 1JNLH 1S8DA 3L7EB 3CFKA 5DLMH 4FP8H 3P9LA 6FABL 1VGKA 4K7PL 1GSMA 2NZ9D 3IJHB 4HV8A 4ONHB 4ZFFB 3CSYB 4O58H 4YEFA 3RQ3A 4JQIL 3WHXA 4KJQD 4MCYA 2JCCF 4Y4FB 1UZ8A 2FD6L 1PX4A 1SEQH 2DKMA 5D1QB 2PO6C 3PWNA 5AG8A 3QYCA 5E8PA 1R3JA 2FGZA 3BZEB 3L3DA 3QQ9C 3A6CL 3DUUA 5A2FA 3PJSB 1SJEA 1RY7B 4OIIL 1MF2L 5T3XE 3LQZB 4NKIL 4PLJC 1C8PA 1KJ3H 5GJTL 4FQXD 4U1KA 1C7TA 1F58L 2VLMD 4PB9H 2GK0A 4AEIH 3TF7C 3PWJB 3T0BA 1NAMH 1GPOH 1NLDH 5D7IA 4APQD 2EEBA 5TE6H 4OCMC 2JK5B 3BP7A 3QXUA 1EEYB 2H26B 5FYLD 5C7XL 3LPFA 3ZTNH 3GKWL 2YN3A 3MOQA 1YA5A 4ZTOL 5LQBL 1U8HA 3GJEA 2W9LA 5CBEA 1E27B 3QCTL 1IL1B 1CXIA 2WANA 1ZGLA 4WW1A 1T21A 2EDQA 1T2XA 4TTDC 3FFCD 2BNQB 2C1PB 4KI5C 3NFSL 3JWOH 1VEMA 3VDBA 5HGAA 4BFIB 1U3HB 3RNKB 5I1AB 5F72S 5KVGH 4ELKA 3U0WL 1YEKL 3LMJH 4FRWA 4F57L 1IM9D 4XZUB 4GKNB 5HHOA 2IH3A 3WO4C 5EC2B 1KTDB 1M71B 4WWKB 5E7BA 1U8JA 3DIFA 3KYMB 3K80A 4JG0L 4RFOH 3OKLA 2FWOB 1YNTB 2PYEE 4TUOA 1QVOA 3L1OH 1MEXH 4FXGB 4YGVA 2I07B 4XBEH 4XBPA 4XVUD 5GHWH 3KPMB 4M5ZH 4XCEB 4YGAB 4JR9L 3UROR 2FH6A 4JFEA 1H5BA 1B6DA 4J3OC 1G7MB 5GS1C 1XF1A 1I7ZA 4KPHH 1H3GA 5LBSH 1JP5A 2X4TA 1BOYA 4WI5A 3L3OB 3CH8A 1F90L 4UT7H 4ETQA 2GY7B 1JGEA 1RMFL 3VXSD 4M7ZC 3G04A 2CJUH 4EN3C 2ZPKH 2FO4A 2E7BA 4MAYA 1XFPA 2X7LB 1R5WB 4IOIB 4LCUA 4BQ6A 3TZVA 4TN9A 4Y0GA 2DOCA 2A77L 3MCKB 1MHCA 3TCXA 4AM0B 4L8SB 1HH9A 3C9NB 1NBYB 5IFJB 4BYHA 3GRWL 3VXQB 5KAQG 5KJRH 4L4VD 3VGAB 2LAAA 3DMMD 2C26A 2E7MA 4IBLT 5DXWA 3ULUE 2DL2A 4P9HH 3QEQD 1S9YB 5EBMA 3TT1H 1JZ2A 1FGNL 5SWSB 2VL5A 4MNGE 5C0CA 2YPKA 1U8KB 2YZ8A 5DS8B 3ARXA 5IGXH 1JPFA 3N9GL 5C0AB 1X5GA 2ZSWB 4QHMB 4HJGB 4YFLI 3MLWH 3JV6B 5D2NB 2NY1B 3RZCC 5HYSA 4WNQB 2FYYB 3JBG7 3IDYC 4DZ8B 4JB9L 2X10A 1YUHA 5F44A 4QXUH 3UTQB 4JZNA 4PGBA 3P30L 4XVTH 4U6TA 5ID0A 1CD1B 2JB6A 2VJXA 4OLZH 4E0RA 2NQCA 1K6QH 4FFWD 1A6UH 5FO7A 1J1XH 5I66A 2F8OA 3RVWC 4HS3B 2XPGA 4YUEL 5TDNA 3ZKQD 1UKTA 2H32A 4X5WA 5E56A 4ZDHB 1Q72H 3QRFM 4NKOB 1GZPB 4NRYB 1BPVA 3ULVD 2NZ9C 3DJ9A 1JE6A 4LU5L 5F93C 3S97C 5IHBA 2F58H 1LO5A 4KJQC 3BO8A 3MGOB 1HQRB 1OLZA 3W39A 1GIGH 3H9YA 4PJBE 4U33A 2EDOA 2GCYB 1IT9L 2VLKB 4HIHA 1OSPH 3RVTD 5ECJE 3DX6A 1OCWH 1MWAH 1JGLL 1N0XL 1QBMH 4DKEL 4Z8FL 4G6JL 2GTZA 1QPPA 4LKCA 1SJXA 5ITBH 5DZLA 2YR3A 3AM8C 1DBBL 3PGDA 1ETZA 4WDIA 4LSSL 4JHAH 3BKMH 5EZIH 2NY7H 3OBAA 5CP3A 1G7JA 4JDZA 4QXGH 4K94L 1I9RL 2V6HA 1FJ1B 4HSQA 4YAQA 3P0YH 3WEXA 4FQXC 4NQCE 2C7UB 5FHBL 3KG5A 3MLYH 4H20L 4KROD 1JF6A 3RWCB 4L1HA 3O4OC 5EBLA 2WBKA 1TQBB 3LS5H 4APQC 1UJ3A 1MCBA 2P24B 3G5ZB 1FNLA 5I1HH 4NHCL 4QHKJ 2XI9A 5IW1B 4JY4A 4LF3A 3LKRB 2DM7A 1NCBL 4KQ3H 5FYJD 1Z3GH 3V4PL 1F4XH 1N7ML 1U3YA 2CIIA 2GJJA 3JVGC 3CFCL 2AGJL 4LLQA 5F3HA 3O3EB 3GSRB 5DRZB 4HIIA 1AXSA 4OGYL 1ZGLM 3VXMB 4MD4B 1ORSA 3BKCH 5JNYB 2GIYA 2Y6SD 1FORL 3AB0B 4HG4K 4Q9QH 3K2UH 4DGIH 1DN0A 4YQXL 1MLCB 3O45B 1ZA3B 5FOBA 5KBNC 4M03A 5ID1B 2N1KA 4Y19D 1E4XH 2DLHA 4GFTB 1FL3B 1RUAL 1CGYA 1JZ8A 1B0GB 4JN1L 5E8EB 4M1GL 4XVUC 4K3EL 2H3NB 1NGZA 1J18A 3GMLA 3RL1B 3TC9A 3L5XH 3G6JB 3VG9C 1L6ZA 4K7FB 3RHWK 4YDJB 3FT4A 1WWWX 1U8OA 4LCYB 2LTQB 4I4WA 3TT3L 4X4YA 4XNZC 3CFEA 4Y5YB 3WCYA 1HSBB 2WBJD 5E95B 5LWYH 3MR9A 3VXRB 3BPOC 2H2SD 5D7KD 1QLFA 5HYJA 1X5YA 2ATPA 3B5TA 2F54B 1T1WB 2XICA 3S3PA 1TDQA 3ARGA 3U9PL 5FK9A 3QXTA 3C2SA 2NXYB 3VFGL 4GAJH 1OAXH 2V2XA 4IS6B 2ZCHH 2X05A 3NFPB 1EMTL 1Q0XH 4KZDH 5L7XL 5CJBA 1OM3L 4XP6H 5IFAH 1F3DH 3BZ4A 3QFJE 2Q8BL 2BY2A 3L3KA 3QG7H 4PJCF 4YHOL 2AKRB 4PJHB 1LNUA 1IC7H 3DMMC 4Q6IA 5ADOH 1G7PB 1MJJA 4OV5B 3K8MA 3S8WA 3MLTB 1MI5D 3MRNA 3FCTB 2QSTA 1S7XA 3BUTA 3C5JA 3D25A 4OCSL 1CU4L 5DHVA 1DQLH 2M8XA 3MRKA 2VDRH 4S1RL 1T6WA 4RBPK 4Y7MA 3STLA 2IJ0C 3BOVA 4H26A 1EGJL 4ZQKB 4U05A 4D9QE 1I1AA 4OZIA 3RHWF 4RAUB 5AZEL 2D4DA 3UYRL 4OCXH 2FX9L 1QQDB 3ULUF 2C4FT 2LE9A 4MA3A 5ICYB 3TPUA 4OD3H 3IXTA 3QUYA 4PY7B 3WBDA 4FFWC 3FB7A 4U49A 3Q5OA 4DAGL 2BNUB 3GMMB 4CKVX 1PLGH 3DHMA 4F37K 3LSOB 2LU3A 3REWA 5IK3A 5T3XL 2VIRB 5DMKA 3ULVC 4R4BB 4ODSH 5JW5A 3V0VB 5J56B 4EUPH 5FB8B 2Q20A 4D9RE 1J8HE 1KB9K 1NDGB 4PUBH 3TH3T 4AJ0A 2IGFH 3RVTC 4R0LB 2FX8H 4WWID 1OQXA 1ZA6B 4TVPH 2HTLD 4KJYB 4JAMB 2ED9A 3R8QA 4UNUA 4QT5B 3F58L 3MACL 2VDOH 4QRSA 1UWXK 3NPSC 1LE9A 1KJ2A 1MHHB 5ICXB 4ONFL 3CD4A 1CN4A 1UCTA 4X9HA 2QHRH 5HHOD 1LP9F 2EKSA 3G9VA 3LEXA 4XPBL 2AJVH 4PJBF 2IALB 2OSLB 4KROC 4R6UA 3STZA 3CLFL 1CE6A 4WO4A 4BUGA 2V9QA 3QDAA 1BAFL 5AAWA 5I17A 3OSKA 4HK0A 5HVHC 3BEWB 4P4RB 1AFVL 2AJZB 3P3YA 3IXAB 4LVNC 5C0IB 1QPXA 5EU4A 1P9MC 1YQVL 1IZKA 4JFED 2R2HB 4YDKH 3WXWH 4UT9L 4F9PA 4ZNEE 4X0KA 3QRGL 3DARA 4MMXC 1B4RA 1IKNA 3O81A 2VN4A 2PXYB 4ZOEA 5IKCB 3F62A 4AQOA 5C08D 4XP9L 5KVEL 3WKNA 3QZWB 1KULA 1IEAA 1I4FB 3GBLA 2YD5A 3EJYD 5J6HA 3KPRD 3O9WD 3QXAA 2FECL 1R3KA 1HHGB 3B9KA 5F7EH 4KXZH 5B4MD 4HCRL 3VH8B 5HJ3B 4KMLB 2BRRH 2Y6SC 2EC9T 4NQVA 2JCCA 3OXRB 4Z7WB 3N1QC 2D31B 2C5DC 4G7YL 4OLXH 3L3JA 3TZVD 5IMOB 1XGPB 3LN4A 4PV9B 5KVMC 1SM3L 1QSED 4A2LA 1NGXA 3HRZB 1UCBH 4TOYL 1DQJA 1NGQH 2QBWA 3T08A 2AJYH 3UDWA 1NAKH 5BQ7A 5F1IA 1IILE 3P73B 5MHSD 4X7DC 4C56D 2HN7B 3WN5C 3K81A 2X4SA 3HNSL 4OB5H 3TH4T 5IMLA 3CMOL 3VFMA 1NH6A 3O3BA 2JJVA 3QO1A 4LVHC 3QAZC 2WBJC 4XMPL 2HKHL 4JM2B 4URTB 3RU8H 5JW4N 4EI6B 1U8PA 2H2SC 1CDUA 5C0CD 4PJ5B 4MXVE 3DYMA 5M94B 4LCCC 1A4KB 3RWHB 1BBJB 3S5LG 4YDLB 3TNNA 4Z77A 1RZIA 4XMKL 5F97E 3VXOB 5IBLD 4HBCL 4J8RA 5T3ZH 4LASH 4QGTA 1S7RA 4XC3H 4RDQG 3TO2B 2YWYA 5DHYA 1MCQA 3FHAA 5EOCL 4CADB 4UIMB 3O2WH 5CZVH 5I19H 1JV5B 2D0HA 4J7RA 2APXA 1DLHA 5I30L 3JWDL 4I2XB 3QJFB 1T4KB 5A1AA 1G9MH 1CG9B 3DTXA 3PV7A 5T5FL 1AXIB 1HWHB 2Q76A 3GMQA 4G43A 1DDHB 1WT5C 1WFUA 2IBBA 1A7RL 2KDGA 5L9DH 3E8UL 4YLQT 5DQDL 3U46A 3NABL 5I6XC 1X5JA 3SE8H 1CLYL 3MO1B 4DGYH 2AJSH 5EO0A 3K0WA 5HY9A 3CVHL 3E6FB 4P46B 3QUKB 1MJUL 2UZYB 5F7DA 4ELMB 1ZHBA 4PGDB 5GRZA 3NCYS 2BSTB 1HIMH 4ODUB 4KAQL 3VFUA 1MAML 1GGUA 4OZHB 4J3WA 4GKZA 1AGBA 1NL0H 5D72L 3SY0A 4FQHB 4ISVB 3VWKB 5DDHA 3BWAA 3BEVB 3GSVA 6CGTA 3VA6A 5DJZA 4XC1L 4XHJD 3BE1H 4TNWK 4LARL 5ALBL 4LQFH 3WHE1 4LSDA 5D6DA 1UXSB 3UC0L 2D7NA 4B5EA 4F2MB 3SPVA 5KVFH 3FT2A 1AGDA 2X4NB 2I27N 1WC7B 1WIPA 2HTLC 4MQ7A 3P4OB 1ZEAH 3BYYA 2DQCL 1MAKA 1WFNA 4BZ1H 3CU7A 2ZG2A 4LPWA 4PJ8D 3NIFE 2A6IA 4X6BB 4Y5XC 3ARDB 2Q86A 4X6CF 1YYLL 3EAKA 4MVBD 1AD9B 4J23A 3W9DB 2DIAA 1RK1A 4LEXL 2VXTL 3K46A 3GHEH 4RNRA 3QUXA 1E6OL 5FYLH 2ZKHH 5F6HI 3RGVB 1K3IA 1ZGLP 3HZKB 4KTEL 3VD7A 2R4RH 2AXFB 4KMQA 4ZPTB 4UT6L 1FC1A 4ODWA 5LGHH 3I75A 5T1DL 3S5LA 4KUZH 4Z7QE 4I3RL 1C5BH 4IDLA 1H5BC 5B22A 1ZVHA 1DLFL 4HWEL 3KWWA 5D2NE 3BH8B 3P4MA 2EYTB 1WISA 3OAZH 4PRPB 5MERA 1S78D 3DI2B 3HS0B 35C8L 3INUH 3TCLB 3EJYC 2XN9A 4YXKL 3TBYA 1J88A 3O9WC 3HI6L 2YS4A 3ARZA 3D85D 2CXGA 5HYJD 1NUNB 5B4MC 2I9TB 2OTPA 3V6OE 3QXVA 2V7HB 4TNWF 2J8UB 1MRFH 5EU6B 4YO0B 4XCNA 2CK2A 3MUHL 1CI5A 1VHPA 2QQQA 1OAZH 4PD4J 3TZVC 5TGBB 1WTLA 1G1YA 4AIZA 2AJ3A 4AEHH 5E5MA 3SGEI 2ADGA 3QWOA 3UO1H 3HNVH 5INDB 1K5NB 1QFPA 4LLVA 1E0OB 3TN0B 2Q3ZA 3X13B 3OR6B 4FQPA 3UBXI 2I26N 3RX5A 3TNMB 3QJHA 1EGJA 2QSVA 1A9BA 4F58H 2XYCA 2QSQA 4LDOB 5CILL 1AGEB 1I3GL 1FRGH 2DM2A 1EEZB 1TZHA 5EFIA 3MGTB 5T33H 2VMFA 4PIRF 5DK2B 3F12A 3QCUH 3VXNB 1T04B 4M6MH 1WSST 3BZFA 5J8OA 4JFHE 1JTTA 4Z7UA 5D93B 2N56A 5IBLC 1HILB 3HA0A 2W38A 3BGFB 4IDJH 2VABB 2VDLH 1I1AD 1UM5H 3I02B 3B6SA 4PJEB 2OI9B 2R23A 1CBVH 1DQDL 2HJKA 3WJLA 1ONQB 1J0KA 4CMMB 4KTYA 3OR7B 3S34L 1ZLUK 1FDLH 3N1MC 3VW3H 3QUYD 1J7VR 3BHBB 1JWSB 4K3DH 3DV4B 4MCZA 1JPGB 4XB8A 4KU1A 5H37G 3QDJD 4MWFB 3U4EA 1EAJA 5I73C 2WQRA 5L6YH 4XVJL 3PWVA 3R8BB 3OX8B 4LCWB 4I18A 2KZWA 3VXME 4UUJA 3FHQA 5D7JB 5K9KA 1V7ML 1KPRB 3AREB 3UJIH 2HFEA 7CGTA 1U8NB 3W5MA 1NSNH 5DJ8B 3LS4L 1EXUA 3WFZA 3ZT6A 1FE8L 1B4JL 4HKJB 3BJ91 4XNYL 3C8DA 4N0YH 3RIAF 1TCRB 2XKSA 3O6FA 4DN3L 4Z7NF 4L9LA 5SWQA 1UYWL 1WVZA 4JZJB 3MRBB 3QUMA 4X9IA 1PZ5A 1CFQB 2NZIA 5E8DL 3FO2B 3SDYL 3ULVH 2WWKO 4P2OA 3G6JE 4O51A 1TVBA 2KQNA 2PYEA 3MBXH 3A6OA 4QRQA 4WI2A 2LQRA 1J05A 5MEOB 4BH7A 3V4UH 3WFBH 4ZODA 2RCSL 2XWTA 4WO4D 5HYQB 2AI0H 2NTSP 4XHJC 1PG7W 1KGCE 4KUCF 3LQAL 1S7WB 3VXRE 3MLZL 5FAAA 3MV9B 2VDML 2F54E 4M4PA 3S35X 1LHZA 3PIQB 3W0WB 5IVXE 3B9DA 4M61A 2NLJA 5IHUL 1ZS8A 3CXHK 2FJHA 2BJMH 2CR3A 1FYHB 3EOYG 2R4SL 1R24A 4PJ8C 1HKLH 3OKOB 1DFBL 5I8OH 3CVIH 5JO5B 4AL8L 3UJTL 2NY2D 2VZOA 3D0VB 5GGVH 4MVBC 1YJDL 3B9KD 4XMLH 4ZUSB 5F8QC 1CT8B 3IDJB 5I18L 1JHKL 1FL6A 3NMEA 4F7MA 4WI3A 3O2VL 3BGAA 4UQ3B 1YY9D 1Z9SA 1DUYB 4PJHE 1MCRA 4ZTPH 1BIHA 3DBXA 4ODBD 4EVNA 2QADC 2CLZB 1NGPH 4PJGB 1Q9WA 2OJZH 5C8JB 1B0RB 1Z6JT 5FYJH 2ED7A 1NCAH 5DR5L 1WZ1L 2CDGB 3LOWA 3H9HB 3MJ7B 3RKPA 1FL5A 4H88L 5EOQH 4TUKL 4NN5B 3IDXL 5J1AB 1NPUA 2JLLA 3ARPA 1KPVA 4NGHH 1A6TA 2DQFB 1WUNT 2B4CC 4DGVL 1I7TB 4MA1C 4F15B 4LRNL 4I3SH 3QUZB 1S78C 3NIGE 4I0CC 4JG1H 4A2MA 4QYOA 1RK0B 3X11A 5IHZA 4AEEA 3OQ3B 3ZE0E 5ELIA 5A43C 3IDIA 3MRQA 3KJ6L 4JKKA 1KTLA 5B38B 3LV3B 1MIEH 1XR9B 1FG2A 4Z7QF 4J4PA 1PSKH 3GEWB 1JHTA 4OSUL 2LU4A 4WU7A 2QR0B 4DCQA 2EDWA 4UIKH 3GJFH 5DEGB 1OD9A 4OZFG 3SO5A 1CFBA 3J7HA 4RGMB 4KDTA 4HUNB 2AXGA 4X83A 2W91A 2FJGB 5DRNB 3I3DA 1DR9A 5I8KL 3ILQD 3ES6A 4D8PB 3BP5A 5K59E 5M95B 1FZMA 4JO1H 1LDPH 3LRHA 2WIIB 4L9DA 4CAGA 1EERB 4Q6IC 1HHJB 3C6SB 2MTPA 4PJBA 4KK9D 4YPGB 4MB4A 3U7WL 1AH1A 1B2WH 3BN9D 3S88H 1RJYB 1NJ9B 1C1EH 3IU3B 5E2VH 1ZLSL 4L5FL 3BW9A 3QXDB 1FN4B 3C8HA 4HZLB 1T1ZB 1NANH 4GUPB 1WBYB 5IVZA 3ZDYF 2EH8L 4FN0A 5H2BA 4V2BA 4AT6A 1I1AC 1T1XB 4E41B 1ZHNA 1Q9OA 2F8XC 5IB2A 2JJWA 1EBPA 4NQCA 4NWTH 4P5TA 1RZJC 5DYOA 4MAUL 4HS6A 1JGUH 1CR9L 4HEPG 3QUYC 5T1LD 3MUY1 3VE0B 3D2UA 5C2BL 3AGVA 1FNHA 3WNNA 1T5XA 5DJ6A 2ATKB 4XPTH 5GRVK 1K2DA 1FFNA 4OI7A 5ACMA 4I77H 4P3DB 5BXFB 1U2HA 2EC9U 2RQ8A 2HT3D 2XWJB 3HFML 1UM6H 4PRDA 2Z93A 4Y4HD 2ICWJ 4GXVH 2DS4A 4DUXA 3QG6B 4ZPVA 4KK8D 3LVEA 2X09A 1G7HB 2VO5A 4YE4H 3M8OL 4KY1H 1YEEL 3FQWB 4Z76A 4KKAD 2WUCL 3U2SB 4Z7WE 5I71C 5E1AB 1OT1A 2WINA 1BQLL 1NBZB 1KIQA 2WQ8A 5IUSA 4X80H 3SDXB 1JGDB 2QLVB 4OCRL 4AH2B 1MPAL 4GW5B 3THML 4X6EA 1KLGA 3LKOA 1N5YH 4HXBH 3NCJH 2UVFA 4KJPD 3PF2A 3K4AA 1HXMB 3WNMA 5LXGH 2MCG1 1YYMH 4NZRL 3TIDB 1I8IB 3QNXA 4WO4C 3TIEA 3FB5A 2QKIB 3KR3L 3PDDA 4NRXA 3UTSB 3H2WA 5CEXB 2AW2A 4F7TB 3MJ9L 5DEFA 1C5DB 1JCKA 2ITDA 5EC1A 1BEYL 3WDHA 3L5WB 4MD0A 4DK3A 2BVYA 4LMQE 4F9PC 4MD5B 3O41A 3IF1A 1A2YA 4JPWH 5IJKA 1W0WA 3G6JF 5GS0L 3HR5A 1FNEA 1J1OH 1FIGL 4XWGH 3MOAL 2BVPB 2NY2C 1RD6A 4S0TD 1AXTH 1LD9A 3PP3K 1D7FA 5E99L 4Z7VF 3B9KC 4O2CA 2QQKH 3R06A 5HYEA 3D9AH 1YY9C 1A0QL 3UPCA 3H0TB 5C0FB 4QWWD 3U30B 4I2XE 4ODHL 1G6RL 5FXCH 5FA4B 3QFJA 4ZUTA 1BIIB 4TUJB 1OHQA 1T03H 3QFDB 5F7MC 5EA0L 4NQUA 2B1HH 5CJQH 4LLUA 3WMSA 1IBGH 3RY4A 3JTSB 3UDWC 1EUUA 4NQDB 5IQ9A 1EVTC 4B7LA 1JZ7A 2E9BA 4JPVH 3MYJB 3WL9B 3CC5B 1JF1A 4XXDA 2NXZB 5KSAD 2W60B 4M6OH 4XNQB 2DWDA 1I9IL 4LSTL 3P40A 1AO7E 1VGEH 4PJHF 1E4XI 1UA6H 4Q0XL 4CBPA 1OAKL 2VRAA 1H3PL 4QTHA 4ELME 3KLSA 3DROB 4XBGB 3HE7B 3PGFH 1MHEA 2CGRL 4PR5A 4OZHE 3MRIB 3QIUA 4OD2B 5ESQB 2UZIH 4R4FL 4ORGB 1XGRB 3QEGL 4NZUL 4LHJB 5T3XD 2W0PA 3LDBC 2FSEB 1K8DB 4BQBA 5CEZL 4N1HB 1D5IL 2DD8H 1A6VL 3MLVL 4ZSOB 2FB4H 3LEYL 3KYNB 4WI4A 1ADQA 4PV8A 3EGSB 3DRTA 4ODTH 4K9EL 3VRJA 1HE7A 5AZ2H 5HHXL 4EKXA 3RNQB 4NYLB 3I6LE 3ILQC 4JO3L 2VDPH 3FMGH 3KPLB 4KQ4L 5IQ7L 2VXUL 3H9SB 2ID5A 3ZE0F 5IB3B 1A1NA 1UB5B 2H1PH 4NM4H 3WXVH 3DHJA 4KK9C 1J8HA 5K9OA 3KPPB 4NNYA 1JJUA 3PDGA 5DRXA 3BN9C 4JVPA 25C8L 2XZQL 3D0LB 4NJAL 3HMWL 3FKUS 2GQHA 5JLZB 3VXTA 2EIZB 2J7LA 3MNZB 5ANME 2WUBL 4UTBH 3QWRD 2KBGA 3KPQA 1X5FA 4YFDB 4NCC2 1T1YB 1DANU 1T7WA 2NY5L 3MBEB 5K59F 4HH9A 5DRWB 3A6BH 1QYGL 2YPLB 4JN2A 3U82B 4U1JA 1WICA 3OWEA 2JF1A 1FVEA 1P7HL 2H32H 1FZKB 5GSRB 5I1LB 5C3LD 1EUTA 4KK5D 1FPTH 3FZUD 2B39A 1MCEA 4LAJH 2E6PA 4P2OD 3HKFA 4J3UA 5I1GH 5IOPA 1WJ3A 4R4ND 4WUKL 5BZWB 1BFVH 1CICA 1KENH 4JGJA 5ALCL 4PRPE 5HDQL 3MRMA 2HH0H 2HT3C 4U1HB 3SGJA 4HXAL 5B8CA 3PXHA 4ZNEA 4Y4HC 1W72B 3PHSA 4KK8C 4HKZB 5D6DC 3QI9B 5F21B 5E2WH 3T2OA 1C7SA 5GRVL 1U9KA 5ISZB 4LSVH 2J8UE 4KKAC 4P48A 3OKKA 4DZBB 5F88B 5CP3H 2DTML 3IJSA 2HJFA 1HHIA 3IFLL 4M43H 5GQBA 4OGXH 1ZLWK 3DUSB 1F4HA 1CE1L 4QRUB 1Y6MR 2Z4QB 2IANB 3L7EA 1NGYB 4KJPC 4WHTB 1ZT1B 4OLYH 4M62H 3IJHA 4I3GA 4ONHA 4ZFFA 4UB0H 3HAEG 5EIQA 3L95A 2FZ3B 3NFNB 4Y4FA 4LNVA 4Z7WF 4WFGE 4YBHA 1JK8B 4ZUVB 1URLA 3HPLB 2BXZA 3IVKB 4U6YB 4D3CH 2OL3L 4HJ0D 3ULUD 4AY0A 1QSVA 4S1QL 3TBSB 3OKMB 3PJSA 4IRSD 4PBWD 4TNVK 1YNKH 4YHML 3KDMB 3N85H 5GGUB 3BKYH 1SHMA 4JFQB 3BQUB 4MQXD 3PWUB 5TE7H 2ADIB 3LQZA 1MCFA 5I16A 1HK6A 2DMCA 3UEZA 4PJEE 5FUZH 4FZ8H 3KPTA 2GTWA 1AE6L 4XAKE 4L8DB 4Q7DA 2FHCA 4PJ9B 4JM2F 3CCHB 5A40E 3PWJA 4U7SA 2GT9B 3EZ8A 2P5WE 2JK5A 1EEYA 4QWWC 2CXKA 4J4PD 4YXLH 1WIOA 4IIQB 2VKWA 2KPNA 4DUWA 4FFYL 1LO3L 2ICWB 2JIXB 1E27A 5HDBE 4KXZI 2B4CH 1DVFB 3D18B 4L8BB 4LCWE 4LLYB 1F3RB 2XY1A 3K8KA 5EZJB 2AV7B 1IGFH 2FR4B 2O5YL 1WTGT 4LSRL 2X70B 5HPMB 5KSAC 4CN4A 5F9WB 4BFIA 1A1OB 1U3HA 3RNKA 2F8VA 1I1YB 2YMXH 4K71C 1U8QB 1H3XA 3MRHA 4EZMA 2F5AH 2DN7A 2N7AA 1PKQB 1RZGB 4QXTB 3L7FB 4XZUA 1RIVL 5EC2A 1KTDA 5IEHB 2VC2L 1M71A 4WWKA 3OTTA 4K7PH 4Y88A 2J6EL 3SHSA 2VR5A 4ERSL 4KGJA 1AGCB 1YNTA 1LO2H 3TWCL 1MFCL 4B50A 4JKPH 4FXGA 1EHLL 2I07A 3KPNB 4XCEA 1C12B 3V6ZB 3V7AE 2B2XH 3WJLC 2D7TH 4D0DB 1OAUL 1ZSDB 3A6CH 5MEPA 1ODAA 2BERA 4MLIA 3RA7L 1G1CA 2V2WB 4ELMF 3HLAB 1MF2H 3D2UD 1I9EA 2DYPD 3E2HC 5CUSH 4LSUL 1DZBA 4NKIH 4HF5L 2BK8A 2AJXL 5DHVH 3L3OA 1EH9A 5GJTH 1F58H 1XCQB 2XKNB 2FATH 2OQJA 4NZTL 5JIPA 4JFDD 4PGCA 3TH2T 4JKLA 5E00B 2X7LA 1R5WA 1YEIL 4IOIA 2CRYA 2R1YB 1S8DB 3S3SA 2IQAB 1RZJH 4HHAA 3DXAD 4AM0A 1D5ZB 2BXYA 4L8SA 3C9NA 1CXKA 1NBYA 5IFJA 4ZTOH 1V8HA 4HPYH 5LQBH 3WHXB 5I1IL 4JRYB 3VXQA 4PJGE 2BMKB 1AD0B 1DBJL 1F45A 5DFVD 3TPKA 3BX7C 4MA8L 1D6EB 1R3JB 3NFSH 4KK5C 2Q8AL 3FZUC 3B9AA 2X4UB 1S9YA 2XQBH 1IC5L 1WFOA 4P2OC 4Q9CA 1IARB 2B0SH 3U0WH 1YEKH 4R4NC 4D2NA 5IROA 4Y1AB 1U8KA 1A47A 3HI5H 5DS8A 4YDVB 2ZSWA 5TDPB 1Q1JL 4QHMA 2BOBB 2CIKB 3EO1A 4HJGA 3PDOB 2R0LH 4JG0H 3JV6A 1CDIA 1XT5A 3T4AB 1YEDB 2YRPA 5F9DC 3ZYIA 4WNQA 4FG6D 1G6RA 3HTLX 3UTQA 1KNOB 1KJ2H 4FQ2H 1KUMA 1XZ0B 1D6VH 2DI7A 1CD1A 3ARBB 4BA8A 1ZVSB 2X9XA 3X14B 2VH5H 3F7YB 3GJEB 4JO4L 5CBEB 4YBLB 4HS3A 4HUUB 2J4WH 1FP5A 4QCIB 4ZDHA 4B41A 4NKOA 1GZPA 5D5ME 1ZGLB 4WW1B 4NRYA 3WYRA 3STBA 1NDMA 1FC2D 5BVPL 1RMFH 1P7QD 4ZD3L 4YXHH 4K3JH 2EXYD 4N9GB 2J8UF 3MGOA 1BGXL 1HQRA 3QFJD 4S2SB 2GCYA 1A3RL 4RWYL 5LVEA 1T7YA 1UM4L 2R0WL 4HJ0C 3ULUC 1UENA 2P46B 1P5VA 4IRSC 5JIHA 3G08B 2Q7NA 2P5EB 5I8EB 1RZFH 4JHWH 4M7KL 4OF6A 2GJ6D 4MQXC 5ADPL 4X9FA 4HEME 1RZ7H 4LRIC 3BXNB 3VFOA 1QLEL 3HHRB 4CMHB 4G8GA 5GZND 4Q58C 2R8SL 1FGNH 3DETD 5EIVA 3RWCA 3ULSB 4UDUB 4Y16B 1KB5B 3QIUD 4S0SD 1BF8A 2E7LC 2OTWB 3FO1B 4LVEA 2CDEB 2X4TB 3OKNB 4GO6B 3VXUA 2P24A 3G5ZA 5GRJL 4J4PC 5IW1A 3MFFB 4ETQB 5FYKU 3D3VD 1UC6A 3MOBL 3O4LB 2ZUXA 4PJDF 2VE6B 4R90H 4KDTC 3HE6B 4F8QA 2FO4B 4PYHA 3TP4A 1EFQA 3IKCA 4PJEF 4JB9H 4EBQL 2DQUL 4MAYB 2CRMA 4HJJL 5HHQA 2D9QB 4JKWA 4XGZB 1O5DT 2SEBB 4EIGB 1A14H 1TQCC 5E08H 1MHCB 3IYLW 3O3EA 4QRRB 4JJHA 5DRZA 2NW2B 3EO0B 2PTUA 3VXMA 5EO1B 4D9RD 2FJFA 1NFIB 2P42B 2VISB 5JNYA 4R2GC 3UJJL 4U1GB 1TLKA 3SDXE 1IFHL 2A1WH 1HQ4B 3CX5K 5FECB 2BNRA 1EA9C 3O45A 1ZA3A 4HWBH 5HDBF 5J11B 2FBJL 5ID1A 2VL5B 4HZAA 1FL3A 4BELD 2YPKB 5E8EA 1IT9H 1DJSA 2H3NA 5CGTA 2X89D 5E2UL 1JGLH 3RL1A 3BT2L 3UTSE 4Z8FH 5DUML 4G6JH 3G6JA 5TE4L 1A6PA 2D0FA 1DBBH 5AYUL 4BZ2L 1IQDB 4Y5YA 1VENA 5IBUG 1ND0B 4QXWA 3REVB 1HSBA 4OUOA 4K94H 4ZFGH 1JYNA 1YUHB 3VXRA 3L5HA 1A5FH 1HZHH 5HHMD 4PGBB 1CTNA 2F54A 1T1WA 5LKNA 5ID0B 4H20H 5IVXA 1GC1L 3TJHD 2MKLC 4DTGL 5TDNB 5FKPB 3GO1H 3M1BB 1P7KA 5KN5A 2H32B 1KYOJ 5GGRB 3N1PC 3KAAA 1QOKA 5E8OB 2FBOJ 4IS6A 3SKMB 2W9EL 3LHPH 2EE9A 4D0BA 3EDDA 5HGHB 1II4E 4JY5L 1CVSC 5EBWB 5F9OH 5L0QC 2ZCLH 4ZAKD 3V4PH 1IC4L 4JREB 2XNAA 5DFVC 1A7OL 3V8CA 3ZMRA 4NFCA 2AKRA 2OL3A 4PJHA 1LE5B 2BFVL 3KXFB 1RUKL 1G7PA 5F3BA 4OV5A 5IEKB 4NQDE 3HZVB 3BPLB 4OGYH 3MLTA 4RFNB 4WDIB 3FCTA 4G3YL 5KTEL 3TYGL 3I9GL 4R26L 4GRWB 3H42L 1FAKT 3BMVA 3R0MA 5JW4Q 4Y4FD 4YAQB 2DBLL 5EU3A 3OJDB 4OGZA 2X9YA 4X6DF 5D1QD 1SYSB 1U3JA 3O3UN 3QPXH 3IRPX 4PJGF 3KYOB 1MRCL 5FUOH 4ZQKA 5CD3B 5EBLB 3OGOE 2JJTA 4JN1H 5I1KH 1UJ3B 4RAUA 3TLRA 4K3EH 4FG6C 1QQDA 5ICYA 4NHUA 4JY4B 2LVEA 4PB0L 4PY7A 4ZSOE 4KDWA 3TT3H 5JW4R 1EK3A 3ECBB 4YHPA 1VEOA 4OZ4B 3U7AA 1T7XA 3U4BL 2VIRA 4X99B 3TEUA 2CIIB 4R4BA 2DIJA 5C92A 3H9SE 5GGQL 3V0VA 5A2LH 2EXYC 4HIIB 5FB8A 3PGCB 3QIWD 1QO3B 1S7QB 3VFGH 1NDGA 1A3LL 4LPYA 3LKPB 4R0LA 2R56H 3RX7A 4OUUB 1ZA6A 1YMME 4KJYA 4JAMA 2FLBT 1EMTH 1KT2B 2QJDA 1OM3H 2VERN 4RMUA 5FOBB 1RSFA 3SDCD 2BNQD 4JO2H 4H8WC 4QT5A 2Q8BH 4PD4K 3CFJB 3F7VA 1U3HD 1X6NA 4V2CB 1NGZB 1ZE3C 1LQSR 5ICXA 2YPLE 5JQHC 4RGNB 5FFLA 4UTAH 5GZNC 4FOMA 1FZOA 3FONA 2IALA 2OSLA 2DQTL 3DETC 4W4OA 1GGYA 4X4YB 4KUCD 3QIUC 2XT1B 4OCSH 3CFEB 1CU4H 3VMOA 3MR9B 1OGTB 3T3ME 3BEWA 4S1RH 2AJZA 3IXAA 5C0IA 3CH1B 2RIKA 4K07A 2R2HA 3ARGB 3C5ZB 3MQIA 4G6AD 4OCYL 2PXYA 5MEQB 5IKCA 4G8IA 3UYRH 1L9MA 1YEJL 4JJ5B 3HNTL 3NCCB 4XRCA 1LILA 5ISZE 1T89A 3OKEB 4X8XA 2D03L 4P9ML 4JRWA 3BISA 1HHGA 4QTIL 4M3JA 1D5BA 3VH8A 5HJ3A 5C0RH 1IGCH 2XRAL 5EDXA 5IW6B 3MNWB 1J0IA 5T3XH 5JTWA 2HT2D 3MXWH 3OXRA 1LNUB 3ZYOA 4OQTL 2OXGA 4X7EC 2XZAL 1DSFH 2IANE 1TTUA 1XGPA 4PV9A 5BMFH 3D25B 5BV7B 2PTTA 1S5IL 3TJEH 2VZTA 1FAIL 4F9LA 3F65A 4LDEB 1EO5A 3P73A 5GGTA 2I60L 2AEIT 5D1ZB 1CF8L 3ZE2E 4AQ1B 4QEGA 1IMHC 5E2JA 4EXPX 4U0QB 2IEPA 3SDXF 4PS4L 4LIQL 3S36X 4JGMA 1A22B 1NANI 1DEEA 2H41A 4NDMA 5SWSD 1AGFB 4JM2A 4EI6A 3OKYA 3OF6D 1RUPL 2FL5A 4ONFH 1F4AA 3G5VA 4HKBA 3RWFB 1A4KA 3RWHA 1FNFA 2GYSA 1AQKL 1BBJA 5C0AD 3C60B 5B8CC 3FB7B 3TJHC 1EPFA 3NCEB 3WUZA 3VXOA 3LD8B 3VJ6B 2NY1D 3OJ2C 3GMPB 2GSIB 1HINL 3SOBL 1T22B 1BECA 1AFVH 2EO1A 1JZ6A 1HYSD 1X9QA 3BSZL 2DLFH 2FCBA 3FN3A 5D4QA 4CADA 3Q6GL 4FXLA 3QUMH 4ZAKC 4UIMA 4OM0H 3CDFA 3QRGH 1JV5A 3NGBC 1BBDH 1RZKL 1I7UB 4XP9H 5KVEH 1IGJB 3MV8D 4DWHA 4I2XA 3B8YA 3QJFA 1JYXA 1T4KA 1BM3L 4DW2L 4LEOA 5JHLL 5FYKE 4WJ5B 4Z95H 2C1OB 3MPCA 2VL4A 5BS0D 1BFOB 4FQLL 4WI9A 5HVGB 4OCLC 4Y4FC 3VWJB 4JPIA 2VLKD 1PKQE 5D1QC 4UV7H 5DZNA 3KLHD 1E4JA 3MO1A 4NN7C 1G84A 4DN4L 4PREB 4OT1L 1G9EA 2ZUWA 5C6WH 1AO7A 4XVSH 3E6FA 3D39B 2PKDA 1C08B 2G5BB 3MODL 4P46A 2FIKA 3ARRA 4XPHL 5I17B 3QUKA 4NZJA 4YHYC 4ELMA 4PGDA 2BSTA 4ODUA 2XZZA 1UB6B 1X5XA 3MRJB 1I8LC 4OZHA 4K55A 1KCUL 5DD5H 5EU4B 5F1KC 3HNSH 4FQHA 4JFHD 1EJOL 2W65B 1KSRA 3VWKA 4YEEA 1DBML 2F5BL 2HKHH 3T0ED 2Y5EA 4EI5D 1YEFL 1TPXB 1T80A 3N1FC 3QIWC 4PP2B 3VFPB 3ULUH 1S7UB 3IS0X 1UXSA 2J2ZA 4HBCH 2EE3A 5D1XB 1A6WL 4F2MA 1VFAA 1ZT7B 5BO1L 2X4NA 4NQVB 1WC7A 4MS8D 1FNSL 4NWUH 3P4OA 5CCKL 3GFUA 3T09A 5F6IB 4X6BA 4LHUB 1X4ZA 2YN5A 3GMOB 1UJTA 5FOJA 3SDCC 1JZ3A 3ARDA 1JMZA 1NGXB 1TTFA 1MCHA 1U3HC 3BD4A 3TO4A 3VXMD 1FH5L 3W9DA 3D48R 4JRYE 5ANMA 3BIAX 5D2LB 2X44D 4LCIL 5I30H 5BQ7B 3JWDH 1NMBL 3RFZC 3NOIA 1HHKB 3RGVA 5DT1L 4IMLB 1RIUL 3VFMB 3O3BB 3HZKA 4G8FB 3QO1B 2M2DA 5FO8B 3S36L 5FHAL 4WHDA 2AXFA 4ZPTA 3O6LL 4Y1AE 1RJZB 1MNUL 3ABZA 1F8TH 2HKFL 5JOPE 4TPRL 3TNNB 4G6AC 2R0ZL 2MSPA 3BD5A 1CDBA 3BH8A 1F4WH 2EYTA 1Z0NA 5IW3A 3S6CA 4ZNCD 4PRPA 1G9NL 4KAQH 1KGCD 4RBPH 2ARJB 2CO7B 2ZUUA 5HI3D 3VXRD 5JXAL 4P2RA 4J3XA 2L4OA 4YK4B 4D94A 2ARWA 1BQSA 2F54D 2I9TA 5C6TL 1OF2B 1UGNA 4XX1E 3T3MF 1CS6A 2V7HA 1U6AL 2J8UA 4LFHD 1DLHB 2HT2C 4O00A 3U0PA 4YO0A 1GCFA 4XC1H 2HA1A 3DV6B 5DQJA 3U7YL 2R2CA 5TGBA 4OF7A 2V5YA 1PG7H 5ALBH 1FGVL 3ILPA 4L8SC 3JUZA 1FYTE 4YDIH 3OAUL 5INDA 1K5NA 2EIBA 3TN0A 4KZEL 3X13A 3U46B 3OR6A 3TNMA 5FIEA 2DQCH 4OLUH 1HHHB 3WFDL 5EO0B 3WO3B 4HQQH 1YYLH 1AGEA 1QFWH 1YPZF 4OKVB 2P5EE 4ZS7H 3MGTA 4S10A 1ZHBB 2PF6A 4LEXH 5EOCJ 3OB8A 1X4YA 4WFHE 5DK2A 3SCMD 1IAIH 3VFUB 1JNNL 3QR2A 4JEGB 1E6OH 3LAFA 3VXNA 3SY0B 3TA3B 1QKZL 5D2NC 1GGCH 2NY1C 2ESVB 1UWXH 4KTEH 1ZHKB 1XGTB 3GSVB 1T20B 2VABA 3CMGA 3O6KL 3ZE2F 3I02A 4ETYA 1XR8A 1HYSC 4JQXA 4PJEA 5DJZB 5KSVB 3T77A 1Z9OA 2FRGP 5D8JL 1OTSD 1QZ1A 4R96B 4CMMA 1CK0L 2IFFL 3OR7A 4I3RH 1M6OA 3RZCB 5JHDB 1RQ5A 3V6OC 3ARFD 1SVZA 4YJZL 1N64L 3O4LE 1JWSA 2P5WA 3DV4A 3SPVB 1JPGA 2E9WA 1AGDB 3FT2B 3UTTB 1IGIH 1FHGA 4PG9B 3BP4B 4YXKH 4AMKH 5FF6A 3PP4L 1LO0L 4MWFA 4YX2H 1OD7A 1N2RB 4PLOB 1O7VA 2DQHL 4LSPL 1XGQB 3GI9L 4QRRE 2Q86B 3OX8A 4LCWA 5D7JA 3AREA 1KPRA 4PJXA 3RI5K 3EOTL 3KLHC 5DJ8A 4HKJA 2AAVA 3N50A 3D1MC 1XGYL 2VXSL 1NBQA 5FA3B 3B43A 1FFOA 3U9UB 2Y23A 1Q38A 3SDDB 1BZ7B 3Q48A 1A7PL 5ERWB 4JZJA 3MRBA 4ODWB 2A38A 1CFQA 2KQMA 3FO2A 4EOWH 5K9QI 4JM4L 5JR1L 1FV1B 5IR1B 5MEOA 3P4MB 1NGWB 5HYQA 1TQBC 1EV2E 3AS1A 3Q1SL 5MERB 4NKMB 3T0EC 4EI5C 4Y4KA 2XN9B 1PAMA 4Y8AA 3TBYB 1S7WA 4NC1C 1OW0A 5HGGS 2BCKB 3KPOA 4ZUUB 4PRAB 1RU9H 4P3CL 5DJDA 3PIQA 4OQTA 4EQ2A 1BZQK 2QQNL 4MS8C 4LK4A 2PXYD 4Y5VC 4ZS6D 3MZTA 3LPWA 3PL6A 1DQDH 1H3VA 3WUWG 1OAQH 1BLNB 3OKOA 3S34H 1B0WA 2GUOA 4AIZB 5JO5A 4NNXB 1S9VB 5CEYB 2ZUVA 5E5MB 4RRPA 2G5RA 1OSZB 4XAWL 4ZUSA 2EYSB 1S3KH 1W72L 1CT8A 3IDJA 3QWQB 1L0XA 5FUCE 3AB0C 4UQ3A 2EE2A 4RMVA 3W2DL 2Y07L 4XNMA 3GBNH 1MFDL 3KXFE 1J12A 4FQIL 3ZKSD 3MV11 3RI5F 5J12B 2CLZA 3ALWA 1MLBA 2XTJE 4HFUL 2E7CA 5C8JA 1ADQH 1E6JL 5EFIB 2CDGA 4NZDA 1V7MH 1JFQL 2CKBL 3MJ7A 5E6IA 5C70A 4JLRB 5C0EB 4HH8A 4GRWE 2IC2A 3LS4H 5J1AA 3O0RL 3RWIB 2XFXA 5HD8D 4XNYH 3MXVL 3S37X 5F7UA 1H3TA 4P59L 4Z7UB 2DQFA 1I7TA 1KCVL 5IESH 4HIJA 2DJSA 4DN3H 4HK3N 1A9EB 4Y5YC 2WK2A 4HPOL 5HI3C 1UYWH 2R23B 4JM2D 3VG9B 1MCPL 5E8DH 1RK0A 4PJ5D 1OWRM 2CD0A 2BDNH 2QEJA 2GAZA 1G7QA 4U1MB 1ACYL 5B38A 3LV3A 1XR9A 1YC8A 2J12B 1FCGA 2E6QA 1YMHB 2I5YL 3MLZH 5D7SH 1T0PB 5DEGA 4MXQD 2DQIH 2DJ4A 1QA9A 1KFAL 3GIZH 3PWVB 3MRGB 4U1NB 5FO9B 2FJGA 4I18B 5IHUH 5DRNA 4NFDA 4L4TB 4UUJB 1F02I 4E42B 5D5MA 1MCCA 2DM3A 3H7LA 2G60L 2VAAB 4HIXH 3GSUA 5CJ8A 1ZANL 2WIIA 1DFBH 1TVHB 1HHJA 3UJTH 3C6SA 4U4BA 2VZSA 4YPGA 1YJDH 1LGVA 3O6FB 1NJ9A 1GAFL 4L4VB 1JHKH 4L9LB 3SCMC 3IU3A 1CFTA 4CVXA 3SDAB 4HUKB 3QEQB 4RGNE 1FN4A 4PLKD 3NBNA 1CZ8H 4HZLA 1T1ZA 1TVBB 2PYEB 3K2MC 4GUPA 4QRQB 1WBYA 1T2JA 2GK2A 1NCDL 3GZKA 3RVVD 1WZ1H 1KEGL 2AABL 1TMCB 2JJTC 4P46D 1A64A 1XEDA 5IB4B 1OTSC 1A8JH 3SGDH 3T2QA 1MUJA 1D5MA 3ARFC 12E8L 4J6RL 4N0UE 3VE0A 2AK1L 2ATKA 4LRNH 1ZS8B 3VWKD 5GGRY 1ZAGA 2FJHB 2E27L 3WUWA 1WWCA 2IG2L 5BXFA 1AP2A 3CX2A 4HC1L 1W0YT 1UWEL 4TSBL 3V4VL 3QG6A 1G7HA 4FMKA 4YH6A 1BP3B 2F74B 3FQWA 4F7MB 4R0LC 4CW1B 3U2SA 5B3NA 3RVUD 2AEQH 2R29H 4ALAH 3WIIL 5E1AA 3CFBB 1NBZA 1Q9WB 1UWGL 1RVFL 3SDXA 3ARDD 4ZG1A 2C4XA 3I50L 5I8KH 5DVMA 1JGDA 4AH2A 3HZMB 1MY7A 3S98A 4GW5A 1OP3K 3BRDA 2V5RA 1LK2B 3QHFH 4PG2A 2HVJA 3ZKND 1HXMA 1RHFA 3S37L 5CKAA 4IRJD 4PY8I 3MLRL 2VDNH 1A6TB 4W4OC 3U7WH 3TIDA 1I8IA 3DX9B 3RGVD 2QKIA 1IC1A 3UTSA 2BOCB 5CEXA 4PRIB 1ERNA 2X4QB 5I15H 3JWOC 5ENWB 3X11B 1M4KA 4XPFL 5J06A 3BDXA 4KROB 2CUMA 3J8F7 3L5WA 4KKLD 2EH8H 1Z0MA 2IFGA 1Z9MA 1T6VN 3TBVA 3ARTA 4ZS6C 3IETA 4UV4H 3IAPA 5EIIA 4LVNB 3FAXA 4WU7B 4PRPD 4DCQB 1KEML 3OPZL 2O5ZL 5E6ZA 3D69A 2BVPA 4MAUH 3MLSL 5E6YA 2AXGB 3S35H 4YHKL 1N6VA 4ZYKB 4MA7L 2W07A 4M6AA 5DMGD 3FFDA 5EU6D 3H0TA 5I8CB 1JNLL 4PLNC 3CVHB 5DLML 2GW5A 4FP8L 2DM4A 4L3CB 4H5SB 5CFHA 1GYAA 4LPCA 5FA4A 1U95B 2WSKA 1BIIA 4TUJA 3QFDA 3ZKXC 4O58L 1JRHH 2PR4L 3P11H 3V8OA 3M8OH 1YEEH 3TN0D 4F9LC 4NQDA 1A3QA 1AC6A 5HD8C 1Q94B 3MYJA 3WL9A 3CC5A 5IVOA 4Y19B 3RL2B 5LGJB 2IPUG 1BQLH 5C09B 5B3JE 2JB5H 3EDEA 4B0MM 5HDOA 3D39E 2WBWB 4WFGD 3THMH 4JM2C 2E9JA 3WIHA 4PJFB 2AJUH 3DROA 4P5TB 3C2AH 3HE7A 1Q8MA 5HPOA 3AMLA 3MRIA 5TPWH 4OD2A 2P7TB 5ESQA 1EBAA 4ORGA 1XGRA 4GRWF 4AEIL 1JYWA 3KR3H 1N0LA 4J12A 2JJSA 1NAML 1GPOL 1NLDL 4WEMB 2FSEA 1K8DA 2IBZY 5TE6L 5T5NG 4LCCB 1SMOA 5CSZB 2JE8A 4P9HC 4MXQC 3GSQB 2WMPA 4ZSOA 3HC3H 3ZTNL 3KYNA 4PRDB 1K8IB 4UNVA 1OT2A 1KELL 3RNQA 2ADFH 4NYLA 1KCRH 3PWPA 3KPLA 1ZOXA 4JFOB 4Z76B 1LEGA 3H9SA 3RY5A 4UINH 5HHNB 1FIGH 4JFXB 5IB3A 3MOAH 1UB5A 3KS0H 4O4YH 1BVKB 3T4YA 2WINB 3S96B 1NMAH 4WHYG 3BZDA 5F96H 3I84A 5K33A 2HLFD 4LCWD 1YMMA 5JLZA 3MSPA 5ACLA 3LKOB 4GRMB 1A0QH 5D7JD 5D2LE 3VFNB 3FT3A 4PLKC 1UH3A 1QBLL 1P2CB 1T1YA 2ZP0T 4O9HH 1G0YR 5KAQF 3NTCH 3MBEA 3RVVC 3QNXB 5EA0H 2RJMA 2NY6D 1F11B 3FB5B 1C5CH 2YPLA 3PXJA 4NRXB 4P46C 3L1OL 4NN6B 2OR9H 4M5ZL 3X3GH 2XZCH 3ALXA 3DVGB 4OF0A 1GHFH 3QEUB 2ITDB 2DIBA 4MDIB 5GSRA 5I1LA 2I9LB 4GKSB 1F6LL 1MCJA 1O7SA 3O41B 4LSTH 3SQOH 3VWKC 1A2YB 5BZWA 1W0WB 5GJSL 4TVPD 1H3PH 1FNEB 3HR5B 4OZFB 4OM1L 1GL4B 4U1HA 4GMSH 1RAMA 4WTZG 3BAEH 1ZMYA 4OF5A 2P48B 4UT7L 4J1UB 1W72A 2IQ9H 4HW6A 3MV9D 4HKZA 3QI9A 2ORBH 5LAXB 3QEGH 2ZPKL 4NZUH 5EUOB 3W0WD 1WITA 4FNLH 3RVUC 4HUVB 2OCFD 3CK0H 1IVLA 4DZBA 3EFDL 4O5LH 3LEYH 1P4IH 4ZUTB 3DSNA 2DLGA 3VFTB 3ARDC 3QHZL 4G80B 4UZGA 1IE5A 3QDMB 3DUSA 5CGMA 4QRUA 5KJRL 5IQ7H 2VXUH 2Z4QA 2IANA 5CIPB 1NGYA 3ZKNC 4WHTA 1NC2A 2IBZX 5ETUB 1LWRA 3SE3A 4BZYA 4IRJC 3QA3B 4XXDB 3SKNB 4U2ZA 3TT1L 3RGVC 25C8H 2FZ3A 1KBGH 4OAWB 1JK8A 3UTZB 1MCOL 4F7EB 4W68A 4NNPH 5F89B 3A67H 3HPLA 3IVKA 4U6YA 2ADJB 4KKLC 3TBSA 3TBWB 3OKMA 2NY5H 2BY1A 1N6QH 1UADC 3KDMA 5GGUA 1N4XL 1QYGH 4JFQA 3BQUA 4GS7C 3PWUA 2ESVE 2WW8A 2ADIA 3HC4L 4V1DB 1I1CA 3QUZD 1BVLA 3VXPB 3SE9H 4OLZL 4L8DA 4OZIF 1K6QL 4P2CG 5JHDE 3VGGA 1J1XL 3GI8H 3CCHA 5DMGC 3MLUH 3UTTE 5HDQH 3FTGA 4RFEB 4LHQB 3SGEH 3QDGB 4AIOA 1J10A 4N8VB 4HS8L 5K9OB 4LLWA 4XX1G 4M5YH 2Y72A 2F58L 4J2XA 2ICWA 2JIXA 3D18A 1DVFA 4L8BA 3K7UA 1MRDL 4LLYA 1OSPL 3TN0C 1OCWL 1MWAL 2ZG3A 3IDUA 5EZJA 3T0XA 2AV7A 2FR4A 3KPQB 3WV0A 4FQJH 3FQUB 5ITBL 1J9CT 2DTMH 1KYOK 1X5LA 5HPMA 1A1OA 4X7SL 1I1YA 2DQDL 3BKML 2HFFA 1N6UA 4HH9B 4KMTH 4OLWL 5EZIL 2NY7L 1U8QA 4E5XB 1PKQA 1RZGA 4QXTA 3L7FA 5E8NB 4IRZL 4U2YA 3DX7B 2IADB 4C56B 4F7PB 2VOTA 1PFCA 3P0YL 3LN9A 5IEHA 2PTVA 4WU5B 5D96B 3VRIB 1QNZH 1CXFA 3MLYL 5C0DA 1WWBX 1AGCA 1RJCA 2YD7A 5D93C 4S1SH 2LU7A 2K9UA 3LS5L 1CICB 3KPNA 4HC1A 4MGXA 3BGFC 3WDJA 5EN2B 4WTZA 3U6RB 4QY8B 3FRPG 2OI9C 3H3KA 4E41D 5L8KB 2OL3H 2BVOB 4D0DA 5DUBB 1ZSDA 4WFEE 4S1QH 3MRRB 5DMIH 4WUUA 4YHMH 3BGMB 1Z3GL 2V2WA 5DURB 5DJ0A 3KJ4B 4XI5D 4WEBH 3MJGX 3V5DB 4GOSA 4BFGA 1XCQA 4LLAA 2XKNA 3B8SA 3IJSB 4TSAL 2V9RA 4MJIB 1FSKB 4XXCC 4OBSA 2HLFC 3UP1A 3SE4A 4CUCA 3H7BB 5E00A 3LKQB 4Q9QL 5D7JC 4U1SB 4ODXA 2EE6A 4Y2DA 2R1YA 3WJJA 2D7MA 3ZL4L 4DGIL 4CU6A 2IQAA 3FFCE 3PP3H 1PW3A 2OX5A 1D5ZA 4M1CD 3EYFB 1N5AA 1LO3H 3L95B 2NY6C 1FG9C 4JRYA 4WFFD 3VG0H 1SY6A 4POUB 2BMKA 1AD0A 2QHLA 3L5XL 4JZJC 1D6EA 5LCVH 3WD5H 2W9DL 2X4UA 4CJ0A 3QBTB 1EVUA 4PBVC 1KC5H 3HB3D 4JFPB 4WV1B 3ROLB 4LQ1A 3HMXA 5GZOD 4Z7UE 4OGAD 5D2LF 4Y1AA 1V3JA 3M45A 5LWYL 4NO0B 4YDVA 5L2JB 1CFNB 5I16B 5BV7L 2IH1A 3UTSD 5TDPA 2BOBA 1LEKB 3TVMA 2CIKA 4KVNH 1OW0C 1XCTB 2GTWB 2V5TA 3PDOA 5AD0B 2I25N 4QHNB 4ERSH 3SJVB 3ARWA 3T4AA 1YEDA 3BWUC 1OAXL 1IAOB 1EHLH 5AEAA 3RIFK 1QFOA 1KNOA 1CFSA 2ZCHL 3VA2C 1XZ0A 1Q0XL 4KZDL 3ARBA 3VXSE 4EXKA 1ZVSA 4XP6L 3X14A 3F7YA 1BX2B 5I1DB 1T83C 2VN7A 4NBXB 2VWEC 4HUUA 1HNGA 4J3TA 1NCNA 3QG7L 4QCIA 1KJVB 3RPIB 4L4TE 4HF5H 4RQQB 4OBRA 4PJ8B 1IC7L 1VADA 5ADOL 5HXMA 3DLQR 1AI1H 3NPZB 3MUZ1 1FYTA 1PGRB 5K9JH 2WV3A 4BK4A 3AY4C 1R3LB 4N9GA 2Z31B 5DJAB 2APVA 3LRGA 4S2SA 1F97A 3MRHB 4OKDA 1ZWIB 1YEIH 2UWEE 4L4VE 2EDYA 5TQ2H 2VDRL 1GOGA 2YZ1A 3CAFA 1BWMA 4NN5C 2QADB 4NQDD 3QEQE 1PYWA 4KWUA 3G08A 2P5EA 5I8EA 4QRPD 5I1IH 2NXZD 4P23B 4F15C 4Q9BA 1OGAB 2CKNA 3QUZC 3BXNA 1ULVA 3VFRB 4MA8H 3CPLB 3UZEA 4OD3L 2OJEB 1G7IB 2Q8AH 3PG2A 5MEPB 3HE7D 1IC5H 3CZFA 1JNHB 3ULSA 4UDUA 3VGDA 4Y16A 1KB5A 3CXDH 5ITFB 3HC0B 2OTWA 1PLGL 3FO1A 2CDEA 3OKNA 4OFIA 1Q1JH 3MFFA 1NCCH 3UAJD 5I74B 4POZD 3RIFF 3O4LA 1QP1A 2OQJB 5GGTH 2VE6A 4W6XB 3HE6A 3K4ZA 3R1GH 3IU4L 4PGCB 1DQTA 2OBGA 4S1DD 5F9JB 2IGFL 2BC4B 2FX8L 4WW2B 5DJCA 4XP5H 4KC3B 4XGZA 1KIUA 2SEBA 3SN6N 2Z8RA 3H9SD 4QRRA 4HHAB 3HAEB 2NW2A 1SBSH 2G75A 3EO0A 3BKJH 5EO1A 5A2JH 1XMWA 1NFIA 3ELAT 2VISA 2VDOL 3IFPB 5A2KH 1HQ4A 4UU9B 2XA8H 1T2QL 1KLFA 5FECA 1MFEL 3VU2A 1RFDL 2B7DT 2MCPH 4Z6AT 2AJVL 3D5OF 1CD9B 1BGXH 4KI1A 4PGJA 1ZLWH 1F4YH 3DSFH 1OARL 3MBED 1GOFA 3FRUA 5TF1L 1A3RH 1QFWI 2EH7H 1G9MC 2RB8A 2R1WB 4HLZG 4PJIB 4RWYH 2YPLD 3L3HA 1UM4H 4PRIE 1IAII 3EO1B 4HGWA 4YDKL 2ZWLT 3WXWL 3S4SG 1BD2D 2YA0A 4M7KH 1IQDA 4XCCL 1ND0A 3REVA 3I3BA 1BF2A 2MNUA 3PNWB 4XI5C 1G6RB 5MENB 1FVDA 3F7QA 1JTPA 1U58B 5F9AC 3QCVH 5F7EL 5FM5M 3X17A 5FKPA 3M1BA 2BRRL 1OVZA 2IPKB 4RDQF 3QI9D 4G5ZL 5GGRA 3FN0H 4XCYB 4MQTB 5E8OA 5GRJH 1N3NB 3FQXB 4R7DB 3SKOB 1KN2L 4FZEH 3SKMA 5ISZD 5IWLA 2O93L 4JQVA 1NDMB 1U8IB 3S35L 5HGHA 4OLXL 4M1CC 4LNRB 4WIQA 3MOBH 2AVGA 5EBWA 4NJ9H 2AXHA 1B6UA 3U79A 4FXKB 1UCBL 1NGQL 2Y25A 4EBQH 1IAKB 4HJJH 1L7IL 2UY7A 2AJYL 1LE5A 1A6AB 1HOCA 3KXFA 3U4AA 5IEKA 1BWWA 2GITA 3HZVA 3FO0H 2ERJC 1JI2A 3HB3C 4DJMA 4Y19E 5GZOC 4OGAC 1QSFB 2L7JA 4GSDL 5C09E 4U3HA 3LN5A 3O6MH 4N1CA 2GY5A 3GBMH 3OJDA 5DSCA 3VFOB 4G8GB 1SYSA 3BDYH 4C83B 4PJFE 3E6HB 3KYOA 1AQDB 4P4KB 1YECH 2FBJH 4NKDB 5D71L 3U1SH 5CD3A 4XNUL 5T3ZL 2AV1A 1DN2A 4LASL 2XTLA 3VXUB 2DICA 3T3PE 3BQUD 1A7BA 5TE4H 2F53B 1L7TH 4Z7UF 3ZHDA 5KVDH 3VGFA 1V05A 5CZVL 3ECBA 4JGUA 2NTFB 4OZ4A 1S7SB 4G7VL 3KNBA 4KGLA 3NCFB 3IKCB 4PJ9D 1IEHA 5HHQB 1N59B 4X99A 2FGWH 3UX9B 1U92B 3GSWB 3O2DL 1VPOH 2YD9A 1WWAX 3U30C 3K74B 3PGCA 1QO3A 2DWEB 2FJFB 1S7QA 2P43B 3PQYD 3LKPA 3OJVC 1EJ6A 5L9DL 3PABB 4RISH 1AHWB 4OUUA 4YIQB 1LDSA 3GKZA 4OTXL 4XPGL 2BNRB 5E2TL 5L2KD 1KT2A 1ROWA 2AK4B 4I0KA 4JY5H 5FYKD 3FN9A 4DGYL 2AJSL 5GPRA 3WS3B 1IC4H 2NXZC 4ORZC 4JFFB 4QF1B 1KCSL 3TFKD 1L6XA 3CFJA 1T7VA 2ZSVA 3LIZL 4XPAH 1IGTA 1RUKH 2BVUA 5IG7B 3RP1A 2ICEB 3HE7C 1P4LA 2AERT 1NL0L 1OPGH 4QLRA 5KTEH 1NFDB 1CCZA 3LZFL 1J5OH 1OGTA 4I9WE 2JJSC 1CVRA 5EG6C 3UAJC 3BE1L 1EO8H 2F19L 1EZVY 3CH1A 4N0UA 4POZC 4Z0XB 1CGSH 1EHAA 4LQFL 1MRCH 1BJ1H 5IVXB 3C5ZA 1S7VB 4S1DC 1P7KB 5MEQA 5KN5B 1XIWB 3LDBB 4LGPB 4JJ5A 1JGVH 5EUOE 3MJ6A 3OKEA 2P49B 43C9B 4D0BB 3T1FB 4BZ1L 3HG1B 3JWNC 2R2EB 5DUPL 1U93B 4DOHB 2DQEH 3MJ8B 5TFSH 2BX5A 4K8RD 3C8KA 5IW6A 3MNWA 2XNAB 4H0HB 1K4DA 2OL3B 3QDME 1MVUA 3GHEL 3WE6B 5F3BB 5GGQH 3H8NA 5FYLL 1NMCB 4LHUG 5HHVH 1P1ZB 2AEPH 3LKSB 5CP7A 4J3SA 3WDIA 3MBEC 2CK0H 2R4RL 4Q2ZB 4JRYD 1PDKA 3DGCR 3NZHH 2VUOA 5EU3B 5D1ZA 1WEJH 3LEVH 4KUZL 5T1KB 4WTXA 4RCAA 4TYUA 5J1SC 3FQNB 1AGFA 4Y1AD 4NHUB 3RWFA 5BW7A 1YN7A 2LV4A 4V1DE 1UKQA 1D9KB 1JPTH 4PRNB 3GJFK 3C60A 4LVOB 2DQTH 3SGDI 4B53A 4YHPB 4OI8A 1INEL 3VJ6A 3QI9C 3GMPA 2GSIA 1MRFL 4M9PA 5C08E 1T22A 5DF0A 4O2EB 1HI6A 2VQUA 1OAZL 1U42A 3KPRE 4JHBA 4Z78B 3CNKA 1N8ZA 3QDGE 4AEHL 5F7YC 4HMDA 4OCYH 3ARBD 5JXEA 3HNVL 1I7UA 5J4MA 1K4CA 1IGJA 2ICES 1CLZL 3HCVA 2D03H 1FNAA 2X5PA 3DURB 4P9MH 4WJ5A 3MMEB 2A74B 2C1OA 1QSEE 4H1LG 3SE3C 1EZVX 1BFOA 4MNQB 1FRGL 2HFGH 3A0OA 3F7VB 1F42A 2P44B 1TIUA 5T33L 1X5KA 3VWJA 4OQTH 2XV6B 3FAWA 4Z18A 1NC4B 2XZAH 4UAOB 4C56E 4ZOBA 1FZOB 3FONB 5ESAB 4M6ML 4PREA 1R3HB 5FEBA 1MSPA 2C3XA 3FL7A 4GQ9L 5IBUB 5DWUH 3D39A 1C08A 2G5BA 2UUDK 1S5IH 2P5ED 4DKAA 4IDJL 2FEDD 2VDLL 1UM5L 3BQUC 1MFBL 4WFHD 2PW2B 1ZLVK 3ARSA 1UB6A 1P6FA 3MRJA 2I60H 2XACC 1CF8H 1F13A 1WBZB 4UNTA 4NP4L 1CGTA 1S9XB 3BPNB 3ZHKA 2W65A 3WNLA 2CLRB 3T2NH 4PJAB 4PJ9C 4G8IB 4BFBD 5ICZA 1RUPH 4XRCB 5CLWA 4F37F 3C08H 3GRWA 1GGIL 1S5HA 3DPBA 2VLLB 4IIQC 4KHXH 4PP2A 3VFPA 1S7UA 2WWKT 1D5BB 1SMAA 5D1XA 3O4LD 2EDDA 4J3VA 4MJIE 3UYOD 1ZT7A 2UY6A 4QO1A 4YHLL 3HE6D 1UT9A 5FCUH 1CWVA 4MAYD 1NSNL 3SO3C 4MSWB 3BSZH 1FFPA 1SVCP 2R9HD 4LHUA 3GMOA 3MRDB 5EU7E 3Q6GH 4ZOCA 4N0YL 4QRRD 3TFKC 5F9WC 4K23L 2PTTB 4QKXB 1BJMA 1RZKH 4AZ8A 5D2LA 2OTUA 1JRHI 5FDWA 2PNDA 1W8NA 3E3QC 1F3JB 4MJ2A 5TH2B 4DW2H 1EEQA 3ULVL 3HI1B 5KSAB 1HHKA 4UMGA 4IMLA 3MBXL 4G8FA 4M93B 5FO8A 2GFBB 1W0VB 2NY4B 1DEEB 4NDMB 3V4UL 1AJ7H 4LGSB 3WFBL 4ZFOL 2FL5B 2AI0L 1DL7H 4YWGH 1RJZA 1YEHL 3G5VB 4HKBB 5IFHH 2LABA 4OT1H 1K9TA 3CFDB 5F7KC 3MODH 1AKJB 3SJVE 5KOVC 2H8PB 2KKQA 3M07A 5ESVB 1QLRB 5DC0A 2N7BA 2X6MA 2BJML 2ARJA 2J1KA 1K85A 3CVIL 2Y4SA 1OF2A 5GGVL 1DQMH 2XY2A 4K8RC 4IM8A 4NUGL 4XMLL 1JIBA 4G9DB 8FABB 5JPMA 4CNIB 4FFZH 4ONGH 1BOGB 1X5ZA 3BD3A 2J5LB 3QEHA 3DV6A 4MB3A 2DRUA 3WJJC 4LEOB 2HWZH 3OXSB 4H1LA 4EEEA 3MCLH 5FYJL 5EUOF 1NCAL 5BO1H 1BQUA 2Q7YA 1LO4H 4JPIB 1I3UA 1IQWH 3OZ9L 1JN6B 3VGBA 4PRHB 3KXFD 1HHHA 2HYMA 1AO7B 4NGHL 3GMNB 2FIKB 4OKVA 5JPNB 1FH5H 2PETA 4I3SL 3QH3A 2B20A 3K1KC 2Y5TB 1BVZA 1OGAE 4M02A 1MIML 2WP3O 4H0IA 5L88L 1YN6B 3HPJB 1M05A 1UEYA 2DQJL 3RBSA 3QSKB 3TA3A 1RIUH 1I9JH 3MX0A 2HLAB 2ESVA 4TRPH 4CDHA 4PRBB 5FHAH 1ZHKA 1XGTA 4HT1H 1T20A 3O2DA 1GXEA 3SKJH 5KSVA 1MNUH 3T65A 1R5IB 2HKFH 4R96A 4UIKL 2YD3A 4CU8A 2R0ZH 5JHDA 3RZCA 4YBQD 3ARBC 2NYYD 1GOHA 1QRNA 1VFAB 3EFFB 5E5RB 3BYTA 4YBLC 3UTTA 3G5XA 5GXBB 4ENED 1WQVT 4PG9A 2C3WA 4PJCB 3BP4A 4JO1L 1LDPL 2FHFA 2YD6A 3D6GA 1N2RA 3BMWA 5JA8B 1RV6X 5C6TH 1XGQA 1Z5LB 2Z8SA 2K7PA 1CYGA 4LOUD 4WGVB 1FVCB 2VDKH 1B2WL 2ZUQB 5JZ7D 3TO4B 1J0YA 5ANMB 1C1EL 4RIRB 4GW4B 1VFOA 3VGHA 1ZT4B 3U7YH 4D0CB 2YXFA 1JVKA 3UPAA 1H8NA 2CMRL 4N8PA 4EDXB 5FA3A 1WZKA 5AG9A 3OAUH 3U9UA 3HR6A 2FEDC 5C0JB 5I1CH 3SDDA 1BZ7A 3GSNL 4FABL 5ERWA 3RWJB 1KCLA 1CDJA 4M48H 1DANT 1FLRH 4NWTL 4PJIE 3GGWB 1BQHG 1G0XA 4RGND 3MUGB 4IRSB 3NAAH 3AM8A 4L3EB 4CMHC 1FV1A 2V2TB 4GBXB 2EEDA 5IR1A 2IMMA 5HBBA 5AYQA 1NGWA 1PD6A 4XPTL 4FA8A 2DQGH 4HIEB 1Y0LB 1INDL 2EO9A 1MCLA 2VKXA 4NKMA 3DGGB 4I77L 3VFWA 1JNNH 4NCDA 1ES0B 3RTQB 5MENE 1RZ8A 2B5IB 4X9BA 3VI4E 4P2RB 2BCKA 4NPYA 1CQYA 4ZUUA 4PRAA 5CJOH 1RULH 2X2YA 4APQA 3ARGD 3C5ZD 4MZ3A 4XCFH 4XH2B 4YE4L 3HE6C 4PGZA 3O6KH 3U0PB 3F5WB 4MAYC 3QDJE 5D8JH 1D5XB 2EDEA 5DQJB 3UTOA 1BLNA 1HEZB 2R9HC 2IFFH 3EJZD 1DBKH 3ILPB 4O02H 4NNXA 3WIHH 1S9VA 5CEYA 2P45B 4DKFL 4U3XA 3ZTJH 4I13B 1N64H 4ZO9A 1OSZA 3U83A 5IV2A 4KKBD 2EYSA 3F8UB 3UXFA 5JW3H 3OB0K 4U1GC 3FFCA 5H35B 4P0DA 2XG4A 4HXBL 3NCJL 5I1JL 1TITA 2PW1B 1ZTXL 3AAZB 1JF5A 4LSPH 5LXGL 1YYML 5J11C 5M7QA 4R2GB 3JV0A 2CO6B 1QSFE 4JLRA 5CEZE 5C0EA 2MWCA 5E0QA 4OFYA 3RWIA 1C16B 5D1ZD 1XGYH 2VXSH 4G8GE 3VFVB 4N0FA 1P84J 4IHOB 4FS0A 1A9EA 4JPWL 1XR8B 1QSZA 1HNFA 3T77B 1U8MB 1J1OL 5EPMB 3VXUE 4XWGL 4K3GA 1M6OB 1NLBL 5EZLB 4JM4H 5JR1H 3SQBA 4QRTA 4RGOH 1AXTL 2F53E 2YKLH 1PQZB 5BVJB 3QULB 3C60D 5C2UB 2VLJB 2DYPB 4MXVF 2P5WB 4U1MA 5HDLA 2P8PB 3Q1SH 4JDVB 3H3BC 3D9AL 5FF6B 4QHUB 1HXYB 1YMHA 1PVHA 4TQEH 4UBDD 3VXSA 2ZG1A 5IWLC 3T04D 3V6BR 1WV7T 3OHXB 3MRGA 2PCPB 1T03L 1IGYB 4U1NA 5FO9A 3Q6FB 2ZUTA 3SEPA 4L4TA 1X5HA 4I1NB 4E42A 2DMKA 5FUCC 4JREC 4PJXB 5CJQL 5JXED 2VAAA 3L3IB 2FX7H 2GSGA 1TVHA 2BNRE 5L0QB 4LKXB 2AK4E 1FFOB 3W9EB 4RFNC 2UWEA 1W72H 4L4VA 2H45A 1VGEL 4JFFE 1HCVA 1UA6L 3SDAA 5DQ9B 5C07B 1TTGA 3QEQA 2Y07H 4RAVB 5A16B 3PGFL 3VWJD 2DKSA 1KXQE 2Y1VA 1MJ8H 3RZWA 5C0BB 1JFQH 1YEGL 3D39D 1UJ3C 1MVFA 1NFDE 5IB4A 4Y4KB 4JFZH 2X4RB 2IPTH 2I24N 3O0RH 3KYKH 4HCRA 3MA7B 1JBJA 2AQ1A 3KPOB 4YBQC 4MJ5B 2NYYC 1GVIA 1KCVH 1R5VA 4ODTL 4WI8A 4XTRD 5DJDB 5AZ2L 2ZJSH 4ENEC 1YNLH 4AIXA 2VDPL 3FMGL 1QHPA 1UZ6E 3PL6B 5C9JA 4DVRH 1BMGA 3OKDB 1I1FB 2GUOB 2W0FB 2H1PL 5DJ2B 4NM4L 3WXVL 3ME0A 2ZCKL 3HG1E 4AG4L 4LOUC 1OLLA 4DOHE 2NY3D 5JZ7C 4XP1H 4ODVL 2F74A 4B7IA 5D1XD 3BRGC 3C09B 3RAJH 1WBXB 4CW1A 4GRLB 4UTBL 1P7QB 2WIMA 4XNMB 3FJTA 3Q0HA 2NCMA 5GSVA 3N1GC 3CFBA 1QD0A 1MLBB 1VACB 5KS9B 1T0MB 3H3PH 4R8WL 4WW2F 4GLRH 3V0WH 32C2A 3A6BL 3HZMA 3PUCA 5E6IB 3NIFF 2JELL 5TQ0H 5HTSA 4BH8A 3QISA 4GAGL 1ZANH 4RGNC 1LK2A 4EDWH 2XFXB 3UPRA 2CLVA 1MY5A 2M1KA 2GJ6B 3DX9A 4HIJB 4UQ2B 1HSAA 1OWWA 2BOCA 3KS0J 4PRIA 2X4QA 1A4JB 2VXVH 3EYSL 2FDBP 5ENWA 2HH0L 2V17L 1KIPB 2CH8A 1OP5K 3MLPA 3I2CL 5GISH 5FYKH 2GAZB 1G7QB 3ARGC 3C5ZC 3MA9H 1KEGH 4PJIF 4AEFA 5I2IA 2A6JB 1KG0B 4LSVL 3SGKA 1P6AB 3EJZC 3G6DL 1OP9A 4HX1B 1QA9B 5I9QB 3I85A 4J6RH 3EYUL 3EYQD 4KKBC 2FEEL 4ZYKA 2ENYA 4X6CB 5D5MB 4KRMB 1AIFA 2E27H 5C71A 4YR6B 3V5HA 5I8CA 4I0PB 1JI1A 4KRNA 3GSUB 4F3FB 3CVHA 3ET9F 4L3CA 4HC1H 4H5SA 4OLYL 4M62L 3EIFA 1U95A 4TSBH 1BJ8A 4P99A 4UB0L 3V4VH 1IAMA 3KHOA 4WRLA 3TV3H 3IGAB 2HAZA 4MNQE 4LMQI 1CFTB 4CVXB 1JZ5A 1FCCA 4U6VH 5JQ6H 1Q94A 3RL2A 4Y19A 5LGJA 3WIIH 5C0GB 2NY0B 8CGTA 2YSSA 5C09A 2VZUA 1YNKL 1OB1B 1FBIH 3I50H 2A2QT 4FTVB 4K8RH 4QHKI 4YHZL 3GJFA 5TE7L 1NCTA 2C3HA 4PJFA 5HHPA 5BW7C 1MUJB 3KPSB 1D5MB 4R97B 4RA3A 4X4XB 2P7TA 3C60C 4HBQA 2MHAA 2WBJA 3TA3D 2YD4A 3ZZ1A 5F6HJ 5H94B 3LD8C 2A9NH 2ESVD 1MCNA 4PJA