3RWFB

Rhesus macaque mhc class i molecule mamu-b*17-qw9
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I
publication title Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
pubmed doi rcsb
source organism Macaca mulatta
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rwfB00
1TPXB 1YJDL 1YEEL 2CIIA 2YPLD 2YR3A 1OTUD 3D5OF 5C08E 3UTTB 2FJFA 4WW2C 2Y5TB 3FT4A 1H0DB 3KPLA 5KSVA 7FABH 4IM8A 3I2CL 2V9QA 1AY1L 1FSKB 4G7YH 4GW1B 3SHSA 1KPRA 5FXCH 4DGIL 5D1XC 3EBAA 1BZ7A 1QLFA 4R97B 1PQZB 4YHZH 4J23A 5AAMA 4Y8AA 2D7QA 2H45A 1KXQE 5DHVB 1DVFC 4YLQT 1ZGLA 2YEZA 3HC0B 3BP5B 4JR9L 1R3IL 2BVQA 3KYMB 3T08A 2YRPA 5I8OL 2WWKT 4X4XB 4JLRB 4F3FB 2DQTL 4PG2C 4E41A 5IJVA 3GGWB 1A9BB 3LS4H 4TYUA 3L5XH 4NKMA 5F6HJ 1A2YB 2XZAL 4Z7NE 1ZGLM 5I6XB 1AGDA 3T0VA 3UTSD 5BZDA 2EKSB 3N85L 2GHWB 1SYVB 1RULH 4XVUC 1JNHB 2F74A 3AAZA 1U95A 1W72B 2R69L 3V5KB 5ESVA 4XZUB 1HIMH 1DSFL 2GQHA 1MJJA 2AEQL 1XR9B 3QHFL 1CFVH 4LRNL 5JR1L 4U31A 1SJEB 4QF1B 2OZ4H 5IOPA 2ATPB 2E6PA 4JPVH 1XIWC 3MRMA 2HG5B 5IJKC 1K8IA 4XP5H 1LO5B 2Y06L 4Y5XA 1AJ7H 1CGUA 4IRJC 3RPKA 4G80A 5E7FA 4ETQB 3VFUB 1IFHL 4PRHD 3L5HA 1RUPL 3K81A 2FECI 3VXUD 4DGYL 3KPPB 3VJ6B 5E4EC 4QRPD 5D7JB 4X4YB 1N6QL 3A67H 3CSBA 5D1XD 2RB8A 4GRWB 3UPAA 5EZOL 4JM2C 4PG9B 1DVFD 1IGML 5DR5L 1S5IL 4HUVA 3WSQL 1N64H 2AJUL 4PJXA 3D3VA 4JHWH 2P46B 3U7YH 2X9WA 4OFVA 1SEBA 5INCA 5A3IC 3Q3GB 3FT3B 2H32A 5I1KH 1TQBC 5DUPL 3KPQB 1DN0B 3HPLA 1OARL 1KG0A 2MHAA 2EDJA 2NY6B 3PNWB 4J12A 4X6CE 3O41A 3OGCB 5TPWL 3O4LD 4NNPH 5CS7A 4HUXB 1MREL 4UOW0 4R4BA 2VZSA 4XVUD 2EC8A 2VDLH 3JWOC 2C3GA 4Z78B 3K8LA 1FBIH 3AREB 5HHPB 2AGJH 3S37X 2C3WA 2G9HB 2W0FB 5DEGB 3QRFM 4WFGD 5C7XH 2ADJB 1HH9B 2JIXA 3GJFA 3PF2A 5D2NA 4U1KB 1MQKL 5HYFA 1B3JA 4UB0H 2P5WA 2J88L 2VKXA 5CJXC 5H94A 1I1YB 3M8OH 4XP4H 5IBTH 2HWZL 1JZ2A 5ENWA 5TE4H 1HXMA 1OAKH 4XAKE 3RVXC 3MLTA 1PKQB 2PUQT 3RL1A 3KLHC 4IRJD 3IXAA 5C86A 3CPLB 3ARPA 4R4FH 1FV1A 1U93A 3VWJC 5C0CD 4QHUB 5GPRA 1A7PL 2GCYB 1IM9B 4XNZB 4N8VG 4XNUH 1AGFB 3QHTC 3C6LC 4ZUWB 3VG9C 2A6KB 3ZT7A 1UCTA 1J87A 4IRSD 1QR4A 1H5BA 4O4YL 4P46B 3RTQC 2VWEE 4MX7B 1G7QB 3MBED 1ED3A 3TZVA 2BSSA 3W5NA 1EFXB 3IKCA 4LBEB 2EDRA 3UO1L 3OKMB 1KJ2A 5CIPA 5F89B 1T5XB 4PJXF 1HSBA 3D25B 2AV7B 5DRWA 5E6YA 3STLB 1MIMH 1XGUB 3KYNB 4GXVH 4OLZL 3UTPE 4DVRL 1LEGB 3MJ9H 1ZXQA 1HNGA 3H3BC 2BJML 3K2UL 1NUGA 4LCUB 1YYLL 1MWAB 1MAMH 2A6DB 3ZHLA 4CNIA 3BRDA 1UVQB 4GG6A 1AD0A 5GGQH 3MLYH 3TIEA 3TM6A 2GT9B 4FFVD 4X6BA 5FYJD 3VDCA 3DUHA 1HHJB 5IFJB 4HIXL 2UYLA 3K4DA 3O6MH 4DTGH 1CLCA 4BZ2H 5JDJA 1NGZA 1C5BL 3QDJD 4FABH 2HJLA 1OTTC 1YMMA 5BV7B 5INDA 1WCBB 5HY9B 1XCTB 2Q8BH 4DKDC 4MHHG 1P4BH 3UJIL 3W11C 1DBJL 2JJUA 2ZJSL 2J6EL 1X6LA 3UYPA 1I8LC 5IQ7L 4MZ3A 3BH8A 5D6DA 5DDHB 4GS7B 3GMRB 3G5YB 1WZLA 2XPGB 1GSMA 3SDAD 5LQBL 4NKDB 3BXNB 2IALB 1EAPB 2KPNA 1AXTL 4XPHH 4Y16B 5C0DA 3UTOA 1A6AA 1EPFA 5MEPA 1RMFL 3GBNL 2RJMA 3BDYH 3DGGA 4PJFA 3QUMA 4MNQE 5BOPA 1S7XA 2DMCA 4G6JH 5F7YC 3PIQA 1JUFA 2AP2A 4Z18A 3RTQD 5IVOA 4HZLA 4YHLH 2VERN 5E5UB 4EN3D 2NW3A 3RVUC 4NM8L 4AQOA 1R24B 3UYRL 3UTSA 2HRPH 4UT7L 3ZDXF 3VGEA 1A6WL 3CH1A 2CKBL 1I1AC 3LHPH 3KR3L 2BVEA 4MLIA 5EBMA 3U7WL 4FTVB 3O45B 4JFEB 4H20H 3FB7B 3AS2A 5IHZB 4PBWD 3H3KA 1TJHL 4PJAE 1I1FA 3EIFA 3J7HA 5EWIL 1UH4A 3C2AL 3TCLA 3QCUH 4LEXL 3U0TB 5GS0L 4KY1H 3R8QA 1FAKT 2QJDA 3G9AB 4GMSH 2VLJB 1ZE3C 3HAEA 4TN9A 1E6JH 1P7QD 4R3SA 4YHNA 2A1WH 1Z5LA 5JMOC 4NIKB 1I8IB 4XB8A 4PJ5E 3HUJB 4JRYE 1OTTD 4MAYC 4H0GA 1CFTA 4HUUB 1K9TA 4PRHA 5HPMA 3U79A 1FZMB 5DFVC 1CE1H 3DO7B 3PV6B 3TBVA 3SDCC 4EI5D 3EOTL 2GUOA 1DQTA 5IB5A 2VXUH 3MV9B 2OK0H 4FQ1L 5I18L 3RWJA 4PJEA 4QKXB 4B7IA 3HI1B 5HI3C 1CF8H 3EGSA 5DQDL 1G7JA 2VLLA 2BC4B 2YMXL 1P2CB 3ZTJH 5DHXB 4U49A 4EDXA 3PWPE 1CFSA 1OB1B 3UJJH 2CIKB 2QSTA 3NABH 4TOYH 5SWQA 4DKEL 4S1QL 2UY7A 4JY4A 5AAWA 3HZMA 1W8OA 3T0BA 3MNWB 5BVJA 2J3SA 2P5EB 4UINH 3DYOA 1EO5A 1NEZA 1UGNA 3O4LA 5IK3A 2BVTA 5JQHC 1IKFL 2EYTA 4YJZL 1UZ6E 3QAZC 1PY9A 3V0WL 1UWGH 4QTIL 5TDNB 2NZ9C 2PR4L 4R7NA 4WUKH 4ZUSB 1E4XH 5ITFB 5DSCB 5EC1B 2Q7YB 4HCRH 3BKJL 3P4NA 3RIFF 4ISVB 2C1PB 2FX8H 4FTVE 4HX1A 2E7MA 4E42A 1EDQA 3MLSH 3B9KD 4B53A 4FFZH 4KJWC 2FLBT 2VH5H 1F97A 3F58H 3LN4B 3RWEA 4I0CC 5CJBA 2C7UA 2YZ8A 3CFEA 5CZVH 5BRZD 2CDFA 4A6YA 5KS9E 4Q2ZA 4Y19B 3V5DA 1IAKA 2IAMD 4CU7A 3IS1X 2IGFL 3VH8A 5FHBL 1A5FL 5J89A 2L0DA 2B1HL 3EO1B 3SEPA 1OP5K 4WUUD 3FOMA 3MBEA 1EXUB 4XBPB 5DEFA 3SPVA 2A0LD 1IGTA 5CZXD 3TBYB 5HVFB 1MRCL 3BSZH 5B8CC 2J4WL 1XEDA 3LB6C 1SJHB 2W59A 4ZS6D 5EOTB 2CDEA 3MTRA 4ZDHB 4Y2DC 5IHUH 5HGHA 4ZTOH 2M26A 4YDVA 1R5VB 3T1FB 2AV1A 2EDBA 4K23H 2YC1A 2R0LH 2UVEA 4O51B 4WI3A 3QO1A 1O7VA 3VI3F 5C0AB 5DJAA 1REIA 1G84A 2XKUA 2YD2A 4HJJL 4TUJA 2Y1VA 4LF3A 3LQZB 3B5TA 2I60L 1N6UA 1XF4A 4LARL 4AEHL 4E0RA 1TQCB 4CMMA 6CGTA 2GSGB 3QIWD 1F4XL 1YECH 3WCYA 3RZCC 1Z9SA 3VWKC 1ZT1A 1KGCD 4PJ8B 4EDWL 4OAWA 4X9IA 3LSOA 1A21A 4DZ8A 1YNTA 3WUWA 5JDSB 5BW7C 3WYRA 1I3GL 3OHXB 5L2KE 1IEBB 3P0YL 4L8DB 3JWNC 1JGLH 3QXTA 1UACL 3T0EB 4KRPC 5C08D 4XNQB 3WHXA 5B39B 3F7RA 3EYFB 1T89C 4IEFB 1DFBL 5JO5B 1QFWM 3MOBL 1MEXL 1TPXC 2H41A 1S8DB 3DXAB 3KPSE 5KSBF 2HYMA 2BRQA 5KJRH 4LSVL 43C9B 5EIIB 3GMNA 4EN3A 2YA1A 5IMMB 4YHOH 1IGYB 3FFCB 4M43L 1F90H 1IGJA 4RGOL 5FA4A 4ZUTA 3F6LA 1FSKC 5FOJA 4K3GA 2HKFH 3ZKSD 3IVKA 4XNYL 1L7IL 5HHOB 3QXAA 4IMKC 3WXVL 4LHUG 3LB6D 1HH6B 4MB4A 1II4E 3EYOB 1FO0H 3MV01 2BNQB 1TDQA 4Y2DD 1HQ4B 5JHDE 3DRTA 4XC1L 1DUZB 1UJTA 5CJQH 4YEEA 1I85A 4PJ9D 5J1AB 1U8LB 5D5MA 1AXSB 2ZOKA 2BZDA 3DV4B 3OKEB 5DJXB 2A9ML 3WFCL 3QULB 2WP3O 4NT6B 1U8HA 4RZCB 4RISL 4G6FD 3L3IB 2OR8A 3I50H 4XNMA 1MHPL 2V2TB 5MEND 1GC1H 1YPZA 1U8MA 3DSFH 3BEVA 1YC7A 3RZCD 3VWKD 4X80L 1IQWL 1S7WB 3OJDB 3CMOL 5ELIA 2VE6A 2FHFA 2X7LA 4EI5A 3DYMA 4YHMH 1TXKA 1WT5C 1VDGA 1FE8L 1FFOA 1ZANH 1HSAA 1QLEH 2EIBA 2V9RA 4QRTB 4JFQA 1X6NA 5GZND 3MZGB 4L3CB 4KRPD 2OL3H 2R8SL 2W91A 1KEML 1NMCB 4U7SA 3VD9A 4YPJA 2ZUSA 4PGEA 3T0EE 3UTTD 4XBGA 3HS0B 4F8QA 4KK6C 3WLWC 4GUPB 3FN0L 4CVXA 1UENA 5DK2A 4BKLA 3V5HA 4K7PH 4KGJA 4GH7B 2DIJA 4A2LA 3BRFA 1TLKA 1RAMA 1S9YB 2AQ2A 4AIZB 3GBLA 5FCUH 4Y4KA 1ZT4B 1NGWA 3P11L 5TF1H 1BQHG 1RU9L 4Z6AT 4CVUA 2FHBA 5AWNH 2OS7A 4KKLC 5HHOE 5LGKA 1BF2A 3ARGB 4Q0XL 4Z7UB 1NGPL 3BGMA 4I3SH 4RAUA 3TYGL 4QRRA 2BNQE 1V7NL 2FSEA 4ZS7H 3EJJX 2MPAL 1U0QA 2DN7A 3B9KA 2X4RA 5TE6L 3OG4B 5TGBA 2NY6C 5CINL 2HFFB 3H9HA 1A4JB 4NNYB 3GKWL 5BRZA 2BCKA 2HVKB 4PR5A 4PRDB 4M61A 5DUML 3ES6B 4FZ8H 2IAMA 1RJLA 5HYJA 1FJ1A 3MLRH 4GXUN 1N2RB 1BD2B 4ZODA 3AREC 5ESQA 5IFAL 3DRQB 5I1AB 1RZ8B 2X4QA 3V4PL 4GW5A 2QADC 2P24B 1HHKA 3OR6B 2IBGA 2L7UA 1AIFB 1QZ1A 1K5NB 5GSRB 1OQOA 5AZEH 2CH8A 4HUWB 1V7ML 2BOCA 3P40A 4Y5YB 4MS8D 3O3AB 5FO8B 4M5YH 2AEPL 1NC4A 4Q9QH 4KZDH 4N5UA 2G2RB 4NPYA 3A6CH 5EA0H 3RZWA 1ZA3A 3V4UL 1NCNA 4M48H 3MJ8B 4LSPL 3WLWD 3VFOA 2I5YL 4XNZC 1SYSB 2EDQA 1IAIL 5F1SA 2VQ1B 3JUZA 3IF1A 4ZXBA 5D7JD 1MCRA 4OIIL 4U33A 1Q9OA 2NY0B 1CZ8L 1QFPA 1J1OH 1C08A 1DR9A 2DQFA 1B0RA 2NXZB 4FQXB 4OLXL 3UTPD 5IB4B 1I9IL 4O5LL 4MJ5B 4FFYH 3FMGL 3PL6B 4KKLD 2AS5M 3RWIB 4JVWA 5KW9H 4AEEA 5DZOA 3QB7C 4ZO6A 1S7QA 3TBTB 5HJ3B 1WC7B 1QSFB 3RDTD 3VXQB 3IETB 4MA8H 2EYSB 4ZAKD 3S5LB 3O6KL 1B88A 4NRXB 4TNVF 2NY6D 2YD3A 5GJSH 1A14H 3EYSH 2HFEB 3WO3B 5JNYA 1JV5A 5C08A 4U3HA 4LDLB 2V17H 5DFTA 4UNVA 5CSBA 3WIIL 4HPYH 4JDVA 2AI0H 5BV7C 4I0PC 3GRWL 5I2IA 1VADA 3FFDA 4P5KB 4OD2B 5DMGC 2J12B 1LQSR 5AZ2L 3B3IB 3K4AA 3TNMA 2FNBA 5I75B 4KTYA 4UI2A 1MRFL 1IC7L 1DBKH 2VZTA 1FDLH 1SHMA 1XGRB 1PDKA 4JHWL 4RAVB 4X6FB 4BFEA 5TDOB 5KVEL 3F5WB 4N5EC 1LE5A 4MNQD 1KCRH 2ZP0T 5E1AA 1F11B 4NQSB 1NEUA 1RK0B 1UEMA 4Y16C 4WDIB 4HT1H 1XH3A 5I9QB 5CGMA 3QUKA 4M8VA 4FQQA 1IM9D 4PJ9A 4TPRH 1ITCA 4P46D 2J8UA 3VRLE 3Q1SL 3WFZA 4NRYA 1QHPA 2VUYA 4MJ6A 4YDIL 3MRLB 4AH2A 1EFXD 1N7ML 3B5HA 1NDMB 1X5LA 4H8WL 3RL2A 3B6SB 4Y5VA 4G6AD 5DJ2B 5GRZA 4FQCH 4UIMB 3SDDB 4EUPG 4CVWA 3I6LE 2C4XA 3DVNA 5HGAB 1G7PA 2EXWC 4JB9L 4CJ1A 2R2EA 3G5VB 2D7TL 4X5WB 1Y0LA 2J7LA 5CSZB 1D5BA 5GGVH 4KVNL 1OD7A 2FWOB 1YNKH 4F7PB 1FH5L 3OKDA 5E2UL 4PJ5D 5GIRB 2H26A 3VFRB 5K59E 1NCAL 3S36H 3FRPA 4KVCH 5ALBL 1A6VH 2GYSA 1N0LA 1UB6B 4XPFH 4GLRI 2QQLH 5ID0B 5GGRY 5CBAB 5SWZE 4LSTH 2JJTA 3HR5B 5F9JA 4NZDA 4L9LB 4UILL 4OGYH 1FYTE 3IAGC 3OR7B 1GZPA 3ULSB 2I9LA 2Z93A 4LEOA 5DRXA 5F96H 4RGNB 1B6UA 3B8YA 1PGRB 1FQ9C 2XZCH 1HI6A 3MC0A 1AP2B 4TSBH 2YK1H 4JHBA 4J3OC 5FDWA 4N5ED 4O9HH 3D39B 4WJ5B 4WENB 3F7YB 5DHVA 4XCEB 1ZHNA 4G3YH 5FM5M 1BOGA 1HHHB 1T03H 1RHFA 1U92A 3FOLB 5LBSH 2F8OA 4Y16D 1JPSL 2GW5A 4NGHL 4OQTH 1YYML 4X98A 1KOAA 5I1DA 4X6CA 1G7HB 3CK0H 1ES0B 2E7LA 3MRBA 5EZLA 5CP3H 1A9BA 1VFAB 2IBZY 4P5MA 1A2YA 3PWJA 1S7UB 2Q3AA 4OLEA 4XAWH 1OP3H 2Y6SC 3MJ6A 5CJOL 2R1WA 1HXYA 1HHGB 1O7SA 2Z4QB 3BZFB 2NLJB 1T7VA 4NKOB 4R96B 1P4BL 4FTVD 4JFED 4O02L 1U8IB 2I25N 4XZUA 3MLXH 1AFVH 2F58L 5FUZH 3VA6A 3V6OC 1QKZL 4F9LC 1Z3GH 4FN0A 3T4YB 2FJGB 3H9YA 1VGEH 1IM3B 1TZHB 2HG5A 3QWQB 1QRKA 3U0PB 5E9DB 3C5SA 4M1CC 4NZTH 1LO5A 3SJVB 2VLJD 4LNRA 5D2NC 5IEKA 3STZB 3G5ZB 4KKAD 3T65B 1XF5B 5TFSH 4JFDE 5DK0A 3W81A 4YHPA 5ILTH 1XGYH 5K9KB 5GRXG 3V52H 3GSWB 1UYWL 1I8MA 4HUMB 5BMFH 1XGTA 5E56A 1Q9WA 2HJKB 3DVGA 2V5RA 3BIBX 3KPPA 3V0VA 5J9PB 2XV6B 5D7JA 2IANE 4LLUB 4PLJD 5IR1B 3OXSA 3FQWB 5MP6H 3RUGA 1WBYA 3LQMA 1X7QB 2VC2H 1F3JB 4DAGL 1ETZB 2NY5C 4NKQB 4ODBD 4CMHC 3MRFA 2DM3A 2WQRA 2VIRA 4UQ3B 4JRXB 3DVFA 2BXZA 5FYLH 3HCVB 4JREB 4V2CB 3BT2L 1ZGLP 5F7EH 2DYPB 5DJCA 4U7MA 1SEQL 4NUGL 2AK1L 3KPOA 4X7EC 1AC0A 4YDKL 2DQJL 1P5UA 3GDBA 3ECBB 3RDTA 1KTDB 4ZAKA 2WBWB 1V8HA 4JAMB 4GMSL 2R23A 3O3DB 3PNWA 1E6JL 1MHEB 1OAQL 2DQIH 5JIPA 2Y6SD 1F3DH 1DLHA 4NJ9L 4PY8I 3BPLB 3IDIB 4LLVB 5CHNB 1EO8L 4NO3B 5DJZB 4JO2H 1CGXA 5T3ZH 4HS8L 4QXTB 4DN3L 2E6QA 3I9GL 1TQCC 3O4OC 4F9PA 1JWUB 1DZBA 1YNLH 1NAML 4KROB 3NIFE 3RKPA 4LLQB 1B9ZA 5EU7C 1MLBB 3GJFK 5H37G 4PJ8C 2R0WL 5L2KD 5HD8D 1MCIA 4U1KA 2NW2B 1BEYL 3G5XA 1W2KT 5B4MC 2VKWA 5AYUH 3OF6A 4XCNB 3TEUA 4PYHA 4JDTH 4QYOB 4I8DA 4HKXA 5C0BE 4MNQA 4M6OH 3BKMH 4GAYA 4RIRB 1L7TH 3MXVH 5D1QA 3KPSD 1LHZA 4WFHE 5DWUH 1HILB 3SJVE 4OZGE 3Q5YA 3ARUA 3KLAB 4HWNA 4Y19D 1RZJL 1MUJB 3AU1A 4ZUWA 3WN5B 1IJ9A 2A83B 3GHEL 1E28A 1Q94B 2FIKA 1NLBL 3X14A 4PJGB 1RY7B 4GRWF 5J3HC 1JYVA 1EFXA 2IBZX 4PV9B 1UWGL 1BJMA 2EE6A 1E4XL 4HKZB 4L1DA 1HOCA 3DUUB 3NN8A 3AXLA 4JFYA 4Y7MA 5D70L 4PJAA 3K1KC 2VXVL 3MNZA 2DQEL 2R4RH 5FA3B 5FB8B 1OF2B 2HLAA 4Z77B 1UB5A 3MFFA 3LRGA 5SX5H 4LCUA 2VDKH 4ONOA 3R06B 4HIIA 3MR9B 2EIZA 3TBWB 2GJ6E 2E8YA 2X89D 4PJ5A 5DVNA 4JRYA 1C8PA 3BJ91 3S8WA 3FO2A 2ZPKL 1L0QA 4I4WA 4HJGB 1LDPH 3H3PL 2FX7L 4ODSH 4IS6B 4RRPA 1T66D 4M7LL 2N56A 4KTDH 3DMMA 1FZKB 1D5MA 3C08H 1WEJH 3H7BB 1NC2B 4OD3L 4NHUB 1KCUL 1C5CL 4Q9RL 2OTWA 4NO2B 3EO0A 5B4MD 5KZCB 5C3TA 3GMRA 5DRNB 4G6KL 3PWPA 1MJ8L 2R9HC 5I66A 4GKOA 1EAPA 3SDYH 3T0ED 4LVNB 3JZ7A 2X4NA 4ELKB 4OD1L 5FECA 3KLSA 5CBEB 2R0LL 1RIVH 3QUXA 1SQ2N 2BNRE 2UUDK 4JKKA 4MNHB 8FABB 3S88L 3DXAD 1GGBL 3PV7A 3DO3A 1F6AA 5GISH 1D6EB 2X05A 3ZE1E 4AEIL 2WBJA 1T7ZA 1N59A 1T3FB 2IH1B 3IT8D 3IFLL 4IHOB 2QHRH 3OAUL 4WCYH 5J3HD 1JFQH 4NHCL 4YUEL 3SOBL 4PLNC 1EH9A 4MB5A 3MA9L 3GIVA 3D18A 5ISZB 4PY8J 4TUOA 1E4WH 1U58B 2AABH 1YECL 5HHOD 15C8L 5HDQH 4OZIE 4FTVA 3RIFK 2DQGL 2BNQD 2SEBA 1NBZB 5EUKB 3HLAA 1FNHA 1ZLVH 2IH3B 3SGKC 2IQ9H 2PTTA 3CLFL 3TYFA 4ENED 3Q5OA 3W0WB 1PKOA 1XZ0A 3SE8H 4OZ4A 3EYUL 5KS9A 4LCWA 3VD7A 2WK2A 3RIAK 5FCSH 2OR9H 3OKYA 3NA9L 2HTLD 4ODWA 2NY1D 3GSNH 4HUUA 2BP3A 2FJHB 1FZMA 3QQ4B 4JY6A 1F90L 1OTSC 2VLME 3PWNA 4NJAL 3UZVB 4FQIH 5GRVK 5CCKL 1BQLL 1QFHA 4N8VB 5IW3A 1FO0L 2R9HD 1MFBL 4G9FE 4HFUH 1UM6H 2H2SD 2VDPH 2VXSL 4L8BA 4Y5YC 4PIRF 1FL3B 4XPGH 4HAGA 4N0UB 3FB5B 3K2MC 5JIHA 1OB1A 5I1LB 1TFHA 3O6LH 1CD1B 3QDMB 1K6QL 4GRMA 4FMFA 4HHAA 4I3GA 1IGIH 3RGVA 4OTXH 3HNTL 1BLNB 2FX9H 1KIRB 4OGXH 4XMPL 5C8JB 2X9YA 2Q76B 2NY0C 3H42L 3GMMA 4ZUUB 4FQXC 2NXZC 1JF6A 4JQVC 1I7ZA 4PP1C 4UV4L 5DRZB 3OGOE 1LWRA 1LDSA 5L0QB 2NY2D 3B8SA 5JLZB 3PL6C 5L2KA 2ITDB 3ARGD 4KDVA 4LLDA 4N0CD 1QTYT 1CU4L 4LNVA 4QWWC 2OSLB 1R3LA 1ZWIB 1DQJA 4HDIB 3HE6B 4URTB 3MJGX 4XPAL 3BX7C 2NZIA 2A74A 1ZHLA 3LN4A 1RK1B 2WWMC 3MLWH 3V0AC 3P9LB 3HUJF 3KPSA 4Z7WB 1XCQA 2V7NB 2CUMA 3RWFB 1EHLH 3ZE2E 3MLPA 2ENYA 3RWGB 2CKBB 3RA7L 1HE7A 4GKZA 4WHCA 3X3GL 5HI4C 3S97C 4AMKH 5D71H 1OCWL 5C09B 4JFPB 5HGBA 4OV5A 1WFNA 5L6YL 1NCCL 5I75C 3P30H 4NCC2 5A16B 5JHDA 3GSXB 5DVMA 3BZDA 3WD5L 4KMQA 4O2EA 5GSVB 4UAOB 1SJHA 5DD6A 1WJ3A 4LSRH 5SX4H 2VB5A 4HIEA 1MCHA 1RZGA 4BSJA 3CFIC 1JPTL 3RPIA 1T4KB 3ZE0E 5I9QC 4UDTA 3ARRA 5ADOH 4P57B 3VRJB 1FVCB 5C0GB 3INUL 3QUZB 2X89A 2EDWA 1CFNB 1R3KA 3QDME 3LEVL 2R15A 5FK9B 4YXLH 4Z7QE 4P9HH 1EEYB 3CFCL 2NY0D 3QCVL 4FQXD 2NXZD 3EFFB 4O2CA 4PP1D 3GNMH 3MLRL 2Z8VC 2CDGB 5DTFB 4HWEH 2ZUQB 2XQYK 2YBRB 5LGHH 3M17B 3SDDC 4OFDA 2G5RA 1KN4L 1NCDL 1ONQA 4P49A 3BUYB 4UIKH 1H8SA 1QSFD 2BY0A 3ARXA 4NC1C 4L8DA 2G60L 3WV0A 2F53B 4LAQL 4R26L 1G6RA 2J2ZA 3HFML 2DLTA 1XGQB 3T2NH 1CE6B 2JB5H 2R2BB 4J6RL 4XNQA 5E8EB 1T0MB 1B0GA 1BVKB 1IT9L 1XGPB 3ZL4L 5JO5A 4NBZB 2R2HB 4QRQB 3LN5B 1S8DA 3C5JB 4L8SA 1LO4H 1UJ3B 2OJEA 1KB5L 2NXYD 4UMGA 3PP4L 3BESR 4P2QE 1Q8MA 1S7TB 1CS6A 1P4LB 1BOYA 4XP1H 2C3VA 4HWUA 1H3XA 3NCCB 4RGNC 4JKPL 4NUJB 3FTGB 5AG8A 4WTZG 2A6JA 4X7FC 1G9MC 2BNQA 2Y36H 2Q6WA 5GGRA 4OLVL 3KYKH 4FA8A 4Z8FL 2ADFL 2RCSL 4MA8L 1R5IA 5DO2C 1D5XA 2W0KA 3ULUE 4J4PD 3WS3A 1HHIA 4KH2A 4LCIH 3EOAB 2BNUA 3FO1B 1EUTA 1CL7L 3QULA 4L4TE 5A1AA 4NT6A 4XC3H 5GS1C 5BS0E 1DTUA 1DL7L 3IDYC 3T3ME 1GAFH 1DE4A 4I1NB 2VZUA 4QCIA 5ESAA 4KFZC 4OT1H 1PJ9A 2Q3ZA 3ULUL 4G6MH 3SDDD 3ZT6A 4J3UA 4PJCB 5IW1A 5B22A 3X13A 3ARWA 4RBPH 4QGYA 4HMEA 5DF0A 2J1KA 5L88L 4JZJA 2JCCB 3SE4C 4XNXH 2V7HB 3WHE0 3NACL 3G6JB 5FEBA 4OI8A 4FQJH 2OTUB 1PFCA 5I74B 3OAYH 3RI5F 3RFZC 1FNSH 3CFKB 3CDGB 1UKTA 4K7PY 4D0DA 1YN6B 2OZ4A 4GG8B 3BAEH 1JGDB 3F62A 2IPUK 3VXRE 1MCPL 4DEPB 1F4YH 1UQSB 4RNRA 2MQ3A 3FONB 5JORA 2BHYA 2ZCHL 4HAFA 4AIZA 1GH7A 2HN7B 1AH1A 3DHJA 5F7UA 4HIHB 1JTOA 5HDLA 3O9WC 4RGMB 5MHSE 3EJYC 4Y4HA 2XTJB 4P59H 1ZLWH 5HHMB 4ZXBC 4XX1G 1WLHA 3L3KA 5FUOL 5E2TH 3U4BL 2B39A 3GRWA 1TJGL 4JREC 3TO4A 3VFVA 3CFBA 1YQVH 4M8QA 3PDGA 2KZWA 1AI1L 1YNKL 4LASH 1YJDC 3TPUB 3QXWA 5C0IB 5K9OA 4M93C 1NFDE 2WUBH 1XR8B 4L29A 4TNVK 3FQXA 4KVCL 1MIEH 1EO7A 2KUTA 3ZTNL 3Q5TA 1FNFA 4OCRH 4Y4FB 2EH7L 3MV8E 2Z92B 2FD6L 3CXHJ 2VLKE 4I2XE 1OWRM 4U4BA 2RAMA 5IMOA 5SV3A 3QISA 4NQEB 4J1UA 3NCJL 1C12B 4WU5B 5DD1L 4MHHI 2P8LB 1MAKA 1MNUH 3CVHH 1AQKH 9CGTA 5FOBA 3MV7E 4F7MA 1U3HB 4NN6C 1ZLSH 4P23B 3GJEB 1LD9B 5I1IL 5L8JB 3JV0A 1K5NA 3QEQE 4G3YL 4XPTH 3BUTA 2GJJA 5FUCE 2M8XA 4WFHD 1G0DA 3SJVD 5JUEH 1OGTB 5DGRA 4M1GH 5IV2A 4D0BB 1GGTA 1E4KC 5IQ9A 1S9XB 3G6JE 3CC5B 4HGWB 3QDGB 5KVDL 1P9MC 3IJYB 4LHUB 2NYYD 4M5ZH 2VO5A 5I8KL 3QCTH 3EYVB 3S34L 3ARQA 2X1PA 4CAGA 4MSWA 1Z9MA 3EW3B 3JV6B 5HDBE 1HQRA 1LILA 4ZSOE 3ABZA 3MNVA 3BFOA 2D03L 5BJTB 5DMJB 2ZG1A 4P4KB 4CVZA 3EJYD 4XXCA 3UBXB 4ZFOA 1F8TH 5JXEA 3P4MA 3DETD 1NBVH 2OXHA 3KAAA 1A0QH 3V6ZB 4MJ5A 1O5DT 1MSPA 4Z7UF 3FRUB 2GJZA 1WFUA 4GKNA 4JRXD 3MOAH 4ZPTB 2DYPD 3DNKA 1MCNA 2DS4A 1WGOA 3JXAA 2AERT 3TBTA 2ZG3A 1FPTL 4UV7H 1JN6A 4AG4L 2DM4A 5F7LB 4UT9L 2ICWA 5JOPE 3I6KA 3KYOB 1NUNB 3LEXB 4JFZH 4K9EL 4KV5E 3QNYB 3DSNA 4N8CL 3RBGA 1RVFL 1MLCA 5SWZA 2APTA 3MJ9A 1VGKB 2BOBA 3QIBA 4MA7L 1OT1A 4Z0BH 1FYTA 5DD5H 4ELME 4PJIE 5FYLE 1ADQH 2O5XH 2VDML 4KROD 4XRCB 1CXFA 5F9OH 1JCKA 3DUSA 4NQEE 1K4CB 4K7PX 2DLIA 5C3LD 3QP3A 4HQQH 2EXYC 4KUZL 4XMLH 3EHBC 2YD5A 1OAUL 2DTML 1R3HB 2CLVA 3U7AA 3U4AA 4W70A 4APQD 4LOUD 1TITA 1J1PL 5ANMB 4NQSA 5T3ZE 1YEKL 4LVNC 5CEYB 4WNQB 1NGXB 4JKWA 1X5YA 2PCPA 1QLRA 4RX4D 1YEIH 3EKCA 4J4PA 1BGXL 5GGUB 5I16A 5I19H 4HV8A 1BQHB 5FYJU 3QG7H 3VFTB 4KJPC 2DM2A 3RRQA 3H9SE 4MYWB 3KNBB 3QDGE 5DZNA 3DOSA 5FYKH 4CW1A 2ARWA 4PJDB 2P44B 4JFOB 3WO4B 1MPAL 2GK0B 5DYOB 1QPXA 3D69B 4LCYB 4KC3B 2WAHA 2GEEA 1KJ3L 5D2LB 3PQYB 4LVHB 4UIMA 3QIUA 4U3CA 4HLZH 3BD4A 1J0IA 1QBBA 5GGVY 5K59F 3SE3C 3G5VA 3A6BH 4L3EE 1FIEA 5AYUL 4XP9H 1QO3A 2YUVA 4D9RD 5TF0A 4KK9C 4F7PA 4JFDA 4WEBL 3S35L 1HWHB 2DBJA 3BGAA 1J10A 2A77H 4LSQH 4F8TA 4Z7VB 4BZ1H 2H9GA 4GRLB 5C07E 4BFBD 1JHKL 1I9JH 4G8FA 4X5XA 4Z76B 3LKOA 1J8HB 4CADA 1K3IA 2XFXA 3UDWC 2RFXB 2PTVA 3HR5A 2IANA 5JOEA 4U1HA 2ORBL 3SQOL 1NC2D 4L9LA 2JK5A 2EXYD 3BO8B 3EHBD 3HMXL 1T1ZA 3MRNB 4WU7B 1T22B 5EOQL 1RZ7L 4EOWL 4W68A 4OKDA 3GSNB 1INDH 3LPGA 4DN4H 4O2FA 2DLGA 1YEGL 4X0KA 1FL5B 3PXHA 2ADIB 4JPWH 3BVNB 5E8NB 2XXMB 4G42A 4TTGA 4ODHL 1FNAA 3QPQC 2RBLA 2ZCLH 1QPPA 3E3QC 3L5WA 3TP4A 3BOVA 4HXBH 3SE9L 2ZUVA 3OKNB 4DW2H 4JN1H 4N0YH 3IU4L 4QOKB 3VU2A 4X6DE 5AUMB 5ISZD 2X44D 1I3RA 3MRQB 2ZG2A 4PJDE 4PUBL 3TWCH 2Y07L 3SGJC 2VXQH 4FQHB 1PSKH 5C2BH 3ARBA 1CDUA 3P0VH 3S4SG 5L0QC 1KNOA 2B8OT 3PQYE 3HE7B 3W9DB 5C0BA 2R0KH 2BRRH 1F3RB 4JDZA 3W0WD 2JKXA 1CBVH 3HE6C 3SJVA 4OZGA 1M7DA 2VDNH 3GMQA 1LE9A 3HC4H 4NP4H 5DQ9B 4RFOL 5I1HL 1MJ7L 4M1DL 4QRUB 3G6AB 1JGEA 3BW9A 3MRDA 4J3WA 3QXDA 2F5AL 3QJFA 5A2LH 2PXYB 4LAJH 5T1KB 3MA7A 3ZDYE 1U8NB 3SCMB 5DJ0A 1K8DB 4MXWL 4PRNB 4U6XB 1C5DA 4YHKL 4MD4A 1M6OA 1FFNB 3K80A 3NFSL 4G43B 4Z5RB 1U8OA 2CK2A 1YEDA 5E4IA 1DBAH 4JGUA 2M2DA 5C9JA 2YPKB 2C3HA 5KAQF 5B38G 3MLVH 2FH8A 1NMBL 5JW4R 3MRKA 3KVQA 2LE9A 1GOHA 2GJ6A 4KI1A 3QDMD 3PGCA 4J2XA 1OY3B 1XF3A 2LAGB 4I3RL 3UBXI 1QR1A 1IEAB 2F15A 5T5NF 3LD8B 3WJLC 2VISB 4U1GB 4X83A 4WHYH 1PLGH 1KN2H 1X3DA 3QUZC 4EUPB 5ERWA 3S36X 3SBWC 4OSUL 1EVTC 1OPGL 1SY6H 4YH6A 2CRYA 4CL7A 4NQDB 1S9VA 1KLUA 2YN3A 3TO2B 4I18A 4QTHB 1IAOB 3VGGA 1HINH 1PAMA 2A2QT 2C3XA 2ZUQC 4R90H 3IDXL 3BIKA 3PHOA 2XRAL 1A7OH 4S10A 5DI8A 3SKNB 4LSSL 5EBWA 1OGAB 4JJ5B 3AB0C 2HTKD 3WS6A 2UWEA 3DMMC 3JTTB 3BH9A 4HFUL 2VDPL 3HE6D 3HMWH 2CD0A 4YC2C 4B5EA 4APQA 2F19H 4S1SL 4KZEL 2BNRA 4P2OB 4ODUB 2R0ZL 2UZXB 4WFED 2YWZA 1MFAL 1F58H 1WBZA 3KLAA 5CILH 3UC0H 4FNLL 5I1JH 1I7RB 1R3JB 4LLMB 3TVMA 2P49B 1W0YT 2P47B 4RX4A 2XNAB 4PJ7E 3WN5A 4G8GB 4HS6B 1BVZA 2APFA 3GSVB 3OTTA 3C8HA 2EDHA 2XI9A 2AJYH 3GM0A 4TNWF 3G04B 4H1LA 4OZIA 5C09D 2A9NH 1WAAF 1BIIB 4PV9A 2ADGB 3MYJA 1MCOL 2X41A 3TV3L 4NQCB 2CK0H 1F2QA 4HUNB 3V6FA 1QYGH 2WBJC 3IDMA 3KPRB 3O2DH 2B2XH 5HI5D 4OUUA 1OF2A 1EEUA 4QHNA 5GJTL 4P3CL 4WHTA 2AKRB 1N6VA 1NL0H 3NAAH 4L4TD 3CFJA 2XWBA 3FCTB 3OSKA 1RZFH 3DROA 4HFWA 2VZ1A 3TBWA 1HKFA 3QUZD 4WHDA 1HKLH 4F33B 1FO0A 1UZ8B 4MWFA 5E08L 4PGDB 1IGCH 3DJ9A 2ZUTA 5HYSA 1XF2B 5LCVH 4YXKH 1KXTB 5C0JB 4IS6A 3I3BA 5HGGS 3DIFB 4BQ6A 1F3DJ 3MOQA 1G7LA 1KTLB 4YFDB 4GBXB 1YZZA 3GSUB 1EGJH 1FZKA 3TC9A 3QZWG 2Z31B 5DLML 3P4OB 1AGEA 4ODTH 2JJSC 4PLKC 2AJSH 1GYAA 3GM8A 4G9FA 4TVPE 3BP4A 3QI9B 4QY8B 3OJMB 1A9EA 3HNSL 3NFNA 1E6OH 2F53D 3RNKB 3MGOA 5IBLC 4YR6B 4C58B 4WY7L 3VFMA 5CBEA 5ID1B 5I74C 3LRHA 1X5XA 1T04B 4HBCL 3VXRD 2IFGA 5H35B 4HWBL 4MNHA 4PTUB 1A1MA 4TVPL 1A3LL 8FABA 4KI5C 4W6YB 4MCZB 4Y1AE 5HHXH 1NAMB 2MKLC 4PJGF 4YFEA 5LKNA 5EO1B 4M3KB 4PFEA 3QRGL 2OL3A 5T1LD 1H15A 2VQUA 4G8GE 3GBMH 4MD5A 5MHSD 1A3RL 1TCRB 3GK8H 1MCCA 5ICYB 5IVXB 4RGMC 5EB9A 2XTJC 4P5TB 4NQCE 5DQJB 1NBZA 2Z91A 4MA1B 1S7SB 1F45A 3WIHH 2HT2C 3BN3B 3RAJL 2IEPA 4M7JH 1TTGA 2XN9E 1Q0XL 5FIEA 4M9PA 3MV8D 5D7IE 2EDKA 5FGCE 4KTEH 2H8PA 3L95A 5FGBA 4KRNA 1AGCB 4P3DA 5I0ZA 4DQOL 1N26A 4G8IA 4Y4FC 5CZKA 3MSPA 1CXIA 2UZIH 4N1HB 1AKJD 1CFQB 1J1XH 1TIUA 2DWDB 1TVHB 3S3JA 4UDUA 3C9NA 2O5ZL 4CKVX 3O3UN 2B4CC 3QPXH 2ARJB 5EU6B 1SBSL 1JPFA 3SKJH 4FQ2L 3WFEH 5I2IB 3MROB 2AK4B 5L2JB 3H6JA 1U3HC 4JO3H 4KKBD 5I17B 2Z35A 2ZSVA 2W9DH 2D3VA 4UTBH 2OTPA 1M05B 1YY9C 4G5ZH 1JRHL 2CR3A 1FRGH 2QQNH 1JWSA 3GIZL 1FL3A 4L4VB 3WKMH 4E5XB 2D4FA 2I9TB 3N06B 1JGUL 1CD1A 3U1SL 3QDMA 4LCIL 1CGTA 1BVLA 1WSST 1N5AA 4OCXH 3REVA 4BH8B 5C0NC 2IFFL 4J3VA 3WDIA 4PRAB 1HDMB 1D6VH 5F88B 4HJ0C 1T83A 1QBAA 4ALAH 3U30B 3B2VH 4DWHA 4HGMA 2FLRT 4G6ML 4LPVA 4N0FB 3GO1L 4P4KC 1GGIL 4X9FA 4PRIE 4YEFA 2PO6B 1OVZA 2V9TA 4LPYA 2AJ3A 3UAJC 4WVRA 5BVPH 1MHHA 1WVZA 4YDJB 2OCFD 5JLZA 2J5LB 3R4DA 1VSCA 1KB5A 4MQXC 1DQMH 2HT2D 4EEEA 3FZUD 5SX4I 5JOPD 3MUGA 3P3YA 2XA8L 3FQTA 2VDQL 3BZEA 4JZOB 2E27L 3MXWH 1EHXA 4WWKA 4KHTH 3P9LA 1QQDB 4Y4FD 4ZQKB 4F58L 5FYLD 1S7VB 3DARA 4U6HB 1VFOA 2DWEA 4JO4H 2ZSWB 4YX2H 4NQED 1RUMH 4KUCD 5CMAB 4P2QA 4C55A 1DBBL 2HH0H 3SKUD 5C70A 3EFDH 3GMLA 2GITA 1I8KB 1WZ1L 4P23D 2IADB 3BP7A 1FGNL 4K94L 2VOTA 2XZQL 3ROOB 1O0VA 3H2WA 3MLUH 1I9RH 4YWGL 3MRIA 5T3ZD 1PEZA 3DV6A 1JF1B 3CDYA 4LIQE 2A73A 2ATKB 2YWYA 4KJQC 1UEYA 3K8KA 1AQDB 1HN1A 3VI4F 3ZYJA 4HC1H 4L4TA 3VXSE 3GSQB 5BS0A 4L4VE 3QDGD 1KFAL 4JFFE 1MCLA 1MIEL 2ZOLB 4HIJB 4K71C 4OCRL 3WIFA 5E6ID 4JHAH 4DZBB 4LIQL 5CKAA 1TJIH 3NCFB 1K2DA 2CMRL 5JW5A 1G0XA 3QT2A 2FO4B 5J4MA 3WO4C 3VE0B 2ZUWA 1C1EL 3QO0B 5K9JH 1NCTA 2CDGA 2VL5B 4C83A 4MQXD 4LVHC 1JI1A 3OAZK 4HKBA 3TESA 2GTWB 4Q74A 3W39B 4Q97A 2V2WA 3HB3C 4HLJA 1FIGH 4LKXB 5EUOB 4NSKB 2ARJQ 4PYGA 3MGTB 1EEZA 5I15H 1GGYA 4WRLA 1Q72H 4J8RA 1CLOL 3MRCA 4LSUL 2Q8AL 1VERA 1U6AH 4Z7WF 1MRDH 1Q9LA 1PX4A 2FL5B 5E8EA 5D6CA 3O11A 5CWSA 5T1DL 4XGZA 5JQ6L 4GRLC 2CR6A 3C8KA 2LAAA 3VXRA 3FB8B 5L9DH 3DX9B 4M6ML 4QRQA 4FRWA 4GKSA 5E8DL 5EO0B 3VXPA 4QT5B 3UPRB 3ZHDA 2D7MA 2BHUA 3GKZA 2FZ3B 5T1LA 1S7TA 1FAIL 1A7QH 5F9AC 1A7NH 3KG5A 1JP5A 1FFPA 3HG1E 5EU5A 3QUYD 1YY8B 4ONGL 1U91B 1U8JB 4KJQD 2LV4A 3GI9H 2W9LA 2IPKB 4TSCH 3IGAA 3BE1H 3MYZA 4MXQC 1NSNL 1NH6A 2E3VA 4MZ2A 1NFDA 4LCCB 1AHWB 3V7MA 2XWJA 3ZDXE 3MV8A 4NO0B 4UQ2B 5FF6A 4OZHB 1H3VA 4WI6A 1GPOL 2VLKA 4I2XA 4PB9H 4KHXH 5IG7B 2DDQL 3DX8A 3EDDA 3TO4C 5IVZB 3ARFB 4RFNB 3BD5A 1NFKA 5E99H 5DD3H 1AKJA 1IC1A 1QBLH 4PTTB 2O5XL 2OJZL 4XB7A 5DJDA 3I02A 1C16A 3MV7A 1CGWA 4FOMA 4FZEH 5EBLA 3FQUA 3PQYD 4PB0L 5CP3A 3MBXH 4LGPB 3VMNA 5GHWH 3O2WH 1FC1A 3OB8A 4WW2B 1OAYH 3QEQA 4XMLL 4NBYB 4F2MB 3RQ3A 1MFDL 3STBA 2LVCA 1JL8A 5KSAD 2YPLE 3HE7C 3P73A 4XVJH 1FZJA 1IC4H 4MAUH 5FYKE 4WEMB 1D5ZB 4HMCA 1P69B 1MVUB 2VZ3A 3CVIH 3FT2B 5EC2A 1J8HD 1T20A 3BZ4A 4XI5C 1PG7W 3IB4A 3S9DB 1BHGA 1TTUA 1YN6A 4S1RH 2XQBL 3FO0L 2AJXL 4YXHL 4H8WC 1RUQH 4NDMB 1KENH 5DS8A 1KIQA 4ZSOA 1KXVC 3I75A 2X4SA 1IGFL 1H3GA 2PXYC 1W72H 4L5FL 4XHJD 1QACA 3FONA 5T3XH 3WXWL 5E5MB 1QSVA 1R5WB 3OKOA 4M00A 2CJUH 3S96B 5JHLH 1OM3H 2ICEA 3PHQA 4F7TB 1IVLA 1T1YA 2DQUL 2E5EA 4XPBL 3L9RB 3A6BL 3RU8H 5JXEC 12E8L 1WCQA 3MFGB 4X5LA 1KEGH 1PG7L 3BQUA 5IESH 2A77L 3LD8C 4R2GB 5C0RH 3MRGA 1XIWB 2AJVH 1D9KC 5CEZH 2ZKHH 4ELMA 4PJIA 5KVGL 5IMLA 3HAEG 4UTAL 5CP7A 2BVOA 1DN2A 5GGSB 2DOCA 4OV6F 4AM0B 1VPOH 4UZGA 1KPVA 3RVWD 1RJZA 2IQAA 4NQEA 5ALCH 1UA6L 3RX8A 1UWXH 1IL1B 1P84J 4NZUL 1C12A 4GRWH 4PJCF 3L3DB 4XBEL 2P8MB 4XMKL 1P1ZB 2FDBP 1IRAY 5FFLA 3HE7D 3VXOB 4LLWB 2JCCF 4P9HC 4HEME 3G6JF 3O6FD 2D0GA 2FR4B 1GXEA 1SM3L 3H7LA 3C5ZA 4JM2B 3VXUE 2HA1A 2NNAA 2VN4A 1BX2A 2WBKA 4JN2A 4K3JH 5BZWA 3TNNB 1KLGB 3TGXA 3ZLQC 3V4VL 4QRPE 2X1OA 2VAAA 2A6IB 3RWDB 2HVJA 3ZKXB 3H9SA 3QDGA 1CICC 3IJYA 2W9EH 4KMTL 3O8XA 4F7CB 5E6IA 2PXYD 3NTCL 1YQ2A 4YNYA 5T1KD 5J0BA 2NPLX 3SCMD 2XICA 4BELD 4ERSH 4IIQA 5ETUB 2ZNWA 5DUBB 5F1IB 3LH2L 1NEZG 1BREA 5E5RB 4M6NH 4FQLH 5C2BL 1EEQA 4NCC1 3TCXA 3NCYS 4JO1H 4L3EA 4RWYH 2QSQA 1LVEA 2EDXA 1KACB 3VI3E 4BFIA 2Y4SA 1BBJB 1U8QB 1WUNT 1A6TB 1IE5A 1U8KB 3HMXA 1UM4L 3PWVB 4IOIB 5C07A 1W8NA 3ALXA 4P2YA 2HFTA 4NN5B 4IRZH 4PJIF 3TA3B 2F8VA 4MA3B 1CLYH 3LV3A 4YHIA 2VDOL 3JVGA 1MFCH 3VFGL 1VGKA 4S1DC 2F54E 2HRLA 5I73C 1FORL 1DQDH 4NQDD 3LPWA 5EO9A 5D93B 3WEXB 4GBXC 2BX5A 3KPNB 5BQ7A 1VFUA 3X11B 4MD0A 4C56B 1HEZB 3C6LB 1UM5H 3VH8G 4NKIL 2D7NA 2XG5A 1W0WB 3Q6GL 5C0CE 4BQBA 4XH2A 2NTFB 3MCG1 5J13B 4Q6IA 3KWWB 3QUYA 1FLRH 3QI9C 1FNEA 4ONHA 3HNVH 5DVLA 3UJTL 3AUVA 3VFSB 5KSBE 4NOBA 3OV6A 3MCKB 1SJVA 4P2OD 5D7SL 5DD0L 5HHNB 1NAKH 4Y1AD 5FO9A 3WLBB 4A6YL 4D3CH 1OAXH 4G8GD 2COQA 4XVTH 4KQ3H 5HHQB 3WFHA 4X6DA 1QRNB 3KDMB 3BEWB 1YN7B 2WW8A 3F8UB 2JELL 2VR9A 3G6DH 3I6GB 4PJDA 3D9AH 4JPIA 5L8KB 1ZVHA 2EDYA 4NQCD 1EJOL 4LCYA 4H26B 4YAQB 4U1MB 4I48A 3KPRD 2OP4L 5F1OB 1RJYB 4J3XA 1KC5H 4ZYKA 5FYJE 1LO3H 4IDLA 1QFUL 3D2UD 4P5TC 3QQ9D 1CGSL 2FEEI 5KSAA 4U2ZA 3PJSA 5JXAL 3QDJE 1P7KB 2Q86B 3W9EA 3WUWG 3JWDL 1BZ9A 2BSRB 5EOCL 1RZJC 3ARBC 1OOAA 2B1AH 1FVDB 5HGDA 1JTPA 4HPOH 4JM4L 5FYJL 3RKDC 5FAAA 4Z76A 2CXGA 5FKAB 1RFDH 5ECJE 4V1DE 1A7RL 1JNNL 3JWOL 4NYLA 3QFJB 2BSTB 3SDXB 5IT2L 3RX5A 5J11C 5C0FB 3O0RH 4FP8L 4QHMB 2FATH 32C2B 2Z31D 3IFNH 1UWEH 2ZWLT 1MJUH 2A9NL 2PW1B 2V2XA 4PY7A 3BO8A 4R7DA 5KSUB 3PE9A 5CUSH 3MX0A 5EZIL 3KPMB 1QFWL 4AL8H 1N5YH 1AO7E 3O2DL 3E6HB 4ORZC 1TENA 1N0XL 4WW1B 1I1AB 4FG6C 3NAAL 5DJYA 2VDRL 3EOYG 3SKOB 3U9PH 5C0EB 4XVSL 5F3HA 3L7FB 5E8NA 1EJ6A 1RIHH 2H3NB 4MVBC 2AEWA 2FYYB 4EI6B 5F1NB 1JNLH 2FGWL 1EBPA 4OF8A 3ILPA 3V6BR 4PJDF 1ORSB 4AT6A 4U1LA 3OKLA 3OB0H 1A6PA 5I1EL 2L4OA 4W6WB 4LHJB 2EDNA 4CBPA 5D2LF 4OJFH 3U30C 4OUOA 2PO6C 4P5TD 1NGQH 3VA2C 1CK0L 1FVEA 3S37L 2J5LC 4OB5L 1T21A 5MEOA 3R1GH 3CXDH 3PWUA 4R8WL 4QRSB 4WFFE 3D85D 1TZIB 2EIDA 4I18C 3O6FA 2OXGA 4Z7VF 4BSWA 2H6PA 4ZMAT 5CKGA 5HYQB 1H3PH 2D0FA 4PJ7A 1Q0YL 3FAWA 4OCYL 1FN4A 5KVFH 5E2VL 1D5IH 5B3JF 3LRSA 2Y9RT 3LKPA 4DCQB 3E8UH 2CGRL 2I07A 5EU6D 1TZGL 3QNZA 5D72H 3SCMA 3QFJE 3D1MC 3ARSA 3SDXE 1R6VA 2AK4D 4K3EL 2IPUG 1B6DA 1I7UA 5EPMB 1A47A 3IXTB 4G43A 1EX0A 5F3BB 1OSZA 2MJWA 3ARYA 3L1OH 3TT1L 3QAZB 5GGSY 4FG6D 3VXSD 1FCGA 2VL4A 4L4VD 4UU9A 1RV6X 4JFFD 1AE6H 1CLZL 1G7IB 1QNZH 4MVBD 3ZYIA 4IMLA 5KOVC 3TBSB 1EAJA 4RFEA 3WFDL 5T5FH 3ETBF 2JB6A 4HW6A 4FFWC 4ODXA 2EO1A 3ZKQD 1ACYH 4PREB 3MJ7B 4JG1L 5J1SC 3QH3B 5FGSA 3QWOA 3VFWA 1RHHB 3QEGL 2DI9A 5ABDE 5IGXH 1L9NA 3O2VL 2CLRA 2IPTL 5SWSB 4LL9A 1G9NL 5JW4N 1LK3L 1VACA 3TO2A 2BVPB 3C09B 1GHFH 1IAOA 2DQDH 5GS3A 5A40E 2C5DC 4QXUH 1VEPA 2NY5H 3SKNA 3QHZH 5TE7H 2YPVL 3LKQB 1N8ZA 3DYPA 5BO1H 5C6TH 1YUHA 1JPGB 3HI5H 1FC2D 5AD0A 5CIPH 5KBNC 4HUKB 1EMTH 2HT3C 4JY5H 1I4FA 4NO5B 3P9MA 5FO7B 5B8CB 2GK2A 4WUUE 4OKVA 2K7QA 1FG2B 4Y1AA 3P77A 4KKCD 4IDJH 2P4AB 4G8GA 3REWB 5IM7B 3VFPA 4UUJB 43CAB 2YN5A 1VKXB 1LO0L 4OLYL 3MRRB 4HK0B 1NMAH 5IIEA 4UNTA 2FBJH 3BRGC 3GMOB 3OBAA 4LQFH 1MI5B 4JZNA 1EFQA 4YO0A 5ADPL 1DLFH 1BIHA 2AJZA 2Z8SA 2D0HA 1QFOA 4ZD3L 4ZUVA 3IDJB 2CUIA 2FECL 4PBXA 2XN9A 3O3BA 3UTQA 4PV8B 4JQXA 1QSZA 3D2UA 2AKRA 4PGBB 1M71A 1NPUA 2FRGP 1GIGL 5D7IA 2ZUYA 1I75A 2DI7A 4U1SB 5I1CH 1YMHB 1AHWC 5MERA 2APXA 3HZKB 4FFWD 4GMTL 3IDGA 1DEDA 2NX5B 4M62L 4DKFL 1NBQA 4ZPVA 3RWCA 3S4SB 3N9GL 5TDPA 1JBJA 1KTKE 6FABL 1KJVA 4NM4H 1CG9B 3QUMH 3ARFC 1KCVL 4JGJA 4RFNC 1ZVSA 1NCWH 4GQ9H 3ARDB 3F12B 5GZOC 3ULVH 2O5YL 1KYOJ 1LP9E 4NWTH 3VXNA 3CXHK 2DLFL 5FGBC 3HI6L 1WISA 3H0TB 5GGTH 3QG6B 2VITA 2PF6A 5FYKD 1IEHA 1J9CT 2BDNL 4MNGB 3HTLX 5IMKA 1MCSA 1MCQA 2HT3D 1ORQB 4X4ME 1CD0A 2MQ0A 5KG9B 1NLDH 4NQVB 3TJEH 1JHLL 5J7CC 3QNXB 1YC8A 2EZ0D 2G5BB 2YKLH 3FB6B 5CJ8A 5EOCJ 3WNKA 4TRPL 3U9UB 3ZDZF 5FM4A 4M03A 4U6YA 4JHAL 4HXAH 4Q9CA 1RUKH 1WIUA 2PW2A 2V5MA 2UV3A 3HAEH 4Z7OF 5IB1B 3NPSC 2W65B 4O58H 1TCRA 2R1XA 1FNGB 4PRIA 3TIDB 4HH8A 5ICYA 1Q1JH 3VXME 3L7EA 4GLRH 3ZKNC 3PGDB 3D0VB 4JGMA 3U2SB 5E8OB 2I27N 3X12A 4ODVH 5D7IF 1URLA 4LP4A 1QBMH 5MENE 3VG0H 3VGFA 4F7EB 3THMH 4P48A 4KMLB 1BBDH 4JVUA 1A1NA 2VABB 3D85A 1JYWA 4LPXA 4NO0D 3DBXA 4BM7A 1S7RA 2KQMA 2WIMA 3PABA 2NY7H 4R2GC 5JPNB 5HVWA 4RMQA 3KJ6L 5A2FA 5LGJA 5DJ8B 3DPBA 1ZS8B 5D1ZB 3ARFD 3FRPG 4DFHA 1BAFL 5GRUH 4NQXB 2DWDA 1ZHKB 2MMXA 3L6FA 1WWAX 3CFDA 3NH7H 1I7TA 4WWKC 2ARJA 5T1MA 4U3XA 4F57L 1B4JH 4NNXB 5TQ0H 1ZSDB 5L2JA 2QKIB 4MLSA 5IHBA 3DHMA 5DEZA 1RURH 3UTTE 4EIGB 2GTZB 5IWLA 3EO9L 4QHLA 4MNGE 5DMIL 3K74B 1XMWA 5F7KC 4KPHL 3VXSA 3TN0A 4EJ1C 4L4VA 4E5XA 2YHGA 4I9WE 1LK2B 3CVHA 4JFFA 4U6VH 4P2RB 1BFSA 2O61A 3L3OA 1S3KH 3OKKA 4W4OA 2CLZB 3ZKXC 4NWUL 4XCYB 3BPCA 4PB9L 4TULH 1DBML 5SV4A 4EBQH 3DTXB 3MREB 1HZHH 1INEL 3AY4A 4OFYD 4YE4H 4Z0XA 3T4AB 5BXFA 1YA5A 2PNDA 4S2SA 5IVXF 4GSDL 1YDPA 4JFXA 2VXTL 4K2UH 5JOFA 3ZKND 2BMKA 1YEHH 4ZFGH 2X70A 4TSAL 1A64A 5DMYA 1BF8A 5CEXB 3K7UA 2R2CA 2WMPA 3GUTA 2APVA 25C8H 5F7HA 1X4YA 4DVBB 5ACZB 3B9DA 3UX9B 3RP1A 4I5BA 5IEHA 1V3MA 3VCLA 2VLRB 2QADB 2PYEB 4MJIB 1MFEH 1JK8A 1F02I 1T1WA 1S78C 4N1CA 3VFNA 1PYWB 4BQ9A 3CX5K 4RQQB 5T3XE 1K4DA 3O3EB 2FGZA 2F54D 1XIWD 1S5HB 4NN5C 3TA3C 2WUCL 3LEYH 4ZQKA 1J05A 1RSFA 35C8L 1E27B 3AM8A 1DANT 4CDHA 3MRJB 4X9BA 2EEDA 2DTSA 4H25A 2QQKH 4JCMA 4R0LB 5D93C 4ZNCD 2YD8A 3GSRB 1B2WH 5F9WB 1RZKH 1LMKA 3HG1A 3IFOA 2WM0A 3PGFH 5KOMC 4X7TB 4S0SD 4P9MH 4OLWL 3GSOB 1KJMA 3TH4T 4RWHA 1MHCA 4WO4B 2PKDA 5J13C 3X3FH 3C60B 3GI8H 4HS3B 1NBYB 2ATKA 4JM2D 5IW6B 5D7LB 5IFHH 2ZCKL 4KJYB 3U46A 4UT6H 1DUYB 4PJBB 3DX6A 3GHBL 3NFPA 4GRWE 4XWGH 1MH5B 3C6SB 5A3ID 4U05A 3UTZB 3VRIB 1NJ9B 4G7VL 2GSIB 4HIJA 1P4IH 5TQ2H 3N1PC 4YHYB 3EYQC 2CSPA 3AS0A 3BWAB 1PZUB 4HSQA 4KDTC 2QLVB 1J5OH 1BMGA 3QEUA 2B5IB 2IMMA 4NBXB 1KT2B 2YPLA 4QXGL 3L3HB 4D8PB 3LMJH 4FXGA 1WWBX 4I0PB 4ZFZB 5GRJH 4RA0C 4MDIB 3NZ8B 4ZFFA 5JPMB 2DQCL 2QEJA 3MQIA 4HWZA 4K3DH 4I77L 2YUXA 2CIIB 4TQEH 3ZHKA 3PDDA 4WV1A 1KCSH 2X4OA 2FJFB 3KYAA 2P8PB 4JANA 3FT4B 2VLRE 3KPLB 4V1DD 3NOIA 5KSVB 4G9DA 4Q6YA 4ONFH 3RVXD 4RSVA 1KPRB 3ROLA 3KLHD 1CDIA 4LU5H 1IKNA 1BZ7B 5EO0A 1QLFB 3OXRA 3VWJD 3QDAA 4C56D 4Y8DC 3C6LD 1CD9B 5J6HA 1ZGLB 1PKQE 2YEZB 1AO7D 3EAKA 5EORH 4HF5L 2BVQB 3P0GB 4Z95H 4G8EA 4D2NA 4OM1L 4E41B 4JO1L 4EQ2A 5I1GH 2BK8A 3LQAH 5C9KA 3EJZC 4NKMB 2IG2H 4K9EC 4JKMA 1NANH 2QSCH 4LCCA 1AGDB 5BZDB 1LO2L 4YBLC 3RY6C 5CFHA 4JPKL 1C7SA 2DMBA 1A6UH 1QRND 2F74B 2VRAA 3AAZB 5LWYL 3EYQD 2AXGA 2DL2A 5I71C 4U1JA 5ESVB 1WQVT 2FB4H 4QNPF 3G08B 2XA3A 5EZJA 1MJJB 3DX7A 3OZ9H 5EFIB 5C6PB 2WINA 4MDJA 3E1F1 1T2QL 4RRPG 5IOPB 3MRMB 4D94A 1K8IB 1G9MH 5EUOF 1V5JA 4WFFD 3KXFB 4WW2A 1CN4A 5I8EB 4CU8A 2YOCA 4Y5XB 3W11D 2ITCA 4K8RL 3VXUA 2HKHL 1MWAL 5DMKA 3WDJA 2APBA 4OZFH 5E8PA 4QRPA 4PS4L 4TTDC 5D1XA 1IC5H 2X4UB 4LMQE 4P4RA 3QEHA 4P0DA 3M1BA 1DVFA 1LEKA 4K7FA 4XP6H 5JW3H 3BHBA 3CLEL 3QFJD 1A1OA 3KGRA 4XCCH 5BV7L 4PG2A 3BKCH 2KKQA 2VYRE 4HUVB 1X5AA 1X5ZA 3D3VB 4PRBA 1KUMA 3CZFA 3LCYA 1SEBB 5INCB 3RVUD 5J12B 2C1OB 3H8NA 1R0AH 3HPLB 3BKYH 1GZQA 2F5BL 2YD9A 3L3GB 5L7XH 1KG0B 1I1AD 2MHAB 4D9QD 4E41E 3NZHH 5A2JH 3MCLL 2IJ0C 3O41B 4JG0L 1OAZL 2EH8H 4OZHF 4R4BB 1DEEA 4OLUL 4JFEE 5DT1H 1J18A 1CDHA 2X40A 3WNPA 2F54A 1XIWA 5IJKA 1GCFA 3LZFH 3BISA 1BPVA 1AGBA 2JIXB 5FHAH 5D2NB 5GGSA 2P7TB 4HKJA 2P5WB 2R4SL 1KIPA 1RIUL 2GIYA 4IRJA 4MAYD 1M7IA 2R29L 5H94B 4WW2F 5GXBB 2VLJE 5C0CA 3C09C 5ENWB 5D8JH 1HXMB 4PGCA 3PDOA 2BFVH 1I1RA 1EIBA 3QQ3A 1QEWA 2J8HA 5DFVD 3MLTB 4BH7A 4H5SA 4IRSA 3SDCD 3RL1B 3HUJE 3U6RA 5KSBA 3IXAB 1J12A 5F8QC 1ZHBA 3MODH 1U93B 3KXFE 5DA0B 4TTDD 1RUAL 4KAQL 3WMSA 1YJDH 1YEEH 1BFTA 4JM2A 2XACC 5HI3D 3ARTA 4PRPB 1H5BB 4CMHB 3LKSA 3MV9E 2BSSB 4Q6IC 3I2CH 4OCSL 3IKCB 1AY1H 2EDTA 1JNLL 3CX2A 1G6VK 1KJ2B 2GY7B 5CIPB 3IDNA 3GMPA 4DGIH 1HSBB 1FGVL 5DRWB 1S9WA 1B0WA 4AENA 5D4QA 5ETUA 1JJUA 5HTSA 1KLFA 3MMEB 4JR9H 1AR2A 1QG3A 3F6IA 1R3IH 4M7KL 3DECA 5I8OH 2DQTH 3KS0H 2P5EE 4CNIB 2NZ9D 3O4OB 3QDJA 4GG6B 1AD0B 3TIEB 4X6BB 4QLRA 2XZAH 1N4XL 1U8QA 2UYLB 1J88A 4M6AA 1EZVY 1NGZB 2BERA 3N85H 2HJLB 1YMMB 3CJJA 5INDB 4N68A 3QWRD 3V6OE 5CJXA 3O2DA 4PPTA 4KJWD 4V1DA 4M02A 5IKCA 2R69H 3SDAA 4H88L 5SX5K 1ZTXL 1NFIA 1FZOA 4F37F 1DSFH 1MCWW 1YEFL 4HD9A 5SWSD 2AEQH 3BH8B 3QHFH 4LMQI 4LRNH 4MCYA 3S6CA 5JR1H 5T33L 3VWJA 5LXGL 3ARDC 5D72L 4X99A 2MCPL 2LFGA 2MWCA 3JTSA 3ZKMC 1AO7A 2XT1B 3U4EA 1D3CA 2Y06H 3RTQA 5C0DB 1A6AB 1CR9L 1PZ5A 5MEPB 4Y19E 4PJFB 1JHTA 3DGGB 3QUMB 2X4TA 4JM2F 1S7XB 4ORGA 4NRZB 5E2WL 4OCWL 3PIQB 1UCBH 1JUFB 1EGJA 3EOBA 5J6GA 4N9GA 1Z9LA 4HZLB 1IFHH 1CDGA 1BFVL 2NW3B 4D9LL 2VUOA 1RUPH 3QJHA 5GQBA 4DGYH 5B3NA 4PRPE 3MLZL 3UTSB 1U41A 2R56L 1N6QH 2CUHA 3CH1B 5EZOH 5EBMB 1UT9A 3SY0A 3KDMA 3OPZL 3F7VA 3MV11 3VXMD 5CD3B 1QVOA 1JZ7A 1IGMH 2IF7A 5DR5H 1S5IH 3WSQH 1T0NA 3WFBL 2AJUH 1NKOA 1I1FB 3D48R 4ZTPL 2H1PL 4XCFL 1UXSA 1NGYA 1SJXA 3TCLB 1DQLL 1P7QA 3IJSA 5DUPH 1F6FB 4MXVF 4OM0L 4YAQA 2D7PA 4GAGL 4KQ4L 5C0AE 3T04D 1RJYA 3CZJA 1OARH 4GW4A 4U0RB 3HAEB 3UZQA 1JGVL 3BYYA 5KTEL 4R3SB 1QA9A 4BQCA 5TPWH 1EMTL 4KXZH 3C2SA 1V3KA 1I8LA 1BFOA 4NZRL 1MREH 5EU7E 1IBGL 2YD4A 1CFTB 4YFLI 4PRHB 3ZZ1A 3TBVB 3QXVA 5F44A 3CSYA 3KJ4B 2GUOB 5IB2A 1X5IA 5D1ZC 2CO6B 1KPUA 1WWWX 3RWJB 4PJEB 3QFJA 3LS5L 1MQKH 1NDGB 4QHMA 3EGSB 3QA3A 4YQXH 1G7JB 1UXWA 2VLLB 2J88H 3LKRA 2HWZH 4NC0B 3QFDA 2PW1A 2OLDA 5D9SA 2DQHL 4EDXB 3CCHA 1CFSB 3KPMA 4GOSA 3UROR 3VW3L 4MB3A 3DXAE 4I9WD 5SWQB 1DP0A 1A7PH 5LAXA 4JY4B 3U36A 1G6RL 4PJFE 4JQIH 3FFCE 1X5HA 5BVJB 4O4YH 4L8CA 3BIAX 1NEZB 5I1CL 1TETL 3O4LB 5IK3B 4XT1C 3WJJA 3PWLA 5F1NA 2W60A 3UO1H 3OX8A 5KN5A 4R7NB 3P4NB 3F7QA 2LU4A 4LK4A 2P48B 2Y7QA 2XWTA 1EZVX 1GOGA 4DVRH 2DBLL 4OLZH 4LKCA 1T1XA 2X1QA 4HX1B 4E42B 2BJMH 3FN3A 3K2UH 4RMTA 4CUCA 4MAYA 3B2UC 1YYLH 3BPNB 5EBGA 4CN1A 3Q6FA 2N7AA 3RWEB 4BA8A 3SDCA 2C7UB 7FABL 5IB3A 3CFEB 4NQTA 5T3XD 4DUWA 2YA0A 1AD9B 2VJXA 4G7YL 2CDFB 4GT7A 2XOTA 4WUUA 3OQ3B 4Q2ZB 4HIXH 3V5DB 1IAKB 5CGYC 1C5BH 4YGVA 3VXTA 3CU1A 3VH8B 4YHZL 5DJ6A 1ZLUH 3FOMB 3MBEB 4FXLA 3UJIH 5J8OA 1DBJH 1LNUA 4P99A 2ZJSH 5DEFB 2J6EH 3SDXF 1IGTB 3U48A 4DCQA 4XXDA 1FL6A 5IQ7H 3CDCA 4R0LC 4KK6D 4L4JA 5LQBH 3LS4L 2CDEB 3L5XL 3WNLA 5F9WC 5CEZD 3RX7A 1AXTH 4YDVB 2AV1B 2D31A 2YC1B 1RMFH 3FQNA 3GBNH 1ND0A 3G9VA 2NMSA 4WO4C 1RULL 3C60C 4CU6A 5K9QG 3QO1B 3U83A 5DJAB 3QIWA 1CT8A 1G7IA 4N8PA 3QSKB 4P2RD 1HIML 4LF3B 4X6EA 2LTQC 2EEAA 4MMZC 4NM8H 2HJFA 1CFVL 5EU3B 3UYRH 1AR1C 1XF4B 4E0RB 3T77A 4CMMB 1A6ZA 4UT7H 1Z2KA 2OZ4L 4JPVL 3GB7A 1A6WH 3QWRA 2CKBH 3KR3H 2Z0BA 1ZT1B 4XP5L 3U7WH 4AY0A 4Z7UE 3RNQA 1MCFA 4OAWB 4YHYC 1LP9A 2DICA 5E94A 1ZA6A 3LSOB 1AJ7L 1TJHH 4DKAA 1YNTB 3WUWB 3B2UD 5EWIH 1JMZA 3C2AH 3RWHA 2B5IC 1Q9KA 4LEXH 5GS0H 2QR0A 3T3PF 2YSSB 3WHXB 1SVCP 4LFHD 3ARED 4X4MA 2VLRD 2QADD 2PYED 4MJID 3A67L 1Y18B 1BD2E 5B8CA 5EU4A 1KIUA 4U1NA 1N64L 1IGJB 1JZ5A 4ZUTB 3U7YL 5CD5C 3EOTH 4Y2DA 3LKNA 4PP2A 5I1KL 3HRZA 1DQQA 3IVKB 4FQ1H 5I18H 3QXAB 7CGTA 5F7DA 4LLYA 1VESA 3VXMA 2AXHA 4OF0A 5DQDH 3T0AA 5E00A 3VGHA 2YMXH 3CUPA 3DRTB 5A2KH 4NNPL 4WO4D 3GZKA 5D5MB 3C60D 5MENA 2VDLL 2ZOKB 1CFBA 5D7LD 3L5JA 4K3HA 4S1QH 1U8HB 1IZKA 1FBIL 5DURB 2AGJL 2NQCA 3QYCA 3RZCA 1H8NA 3VWKA 5C7XL 1AR1D 1VENA 3CAFA 1YPZB 2PTUA 1IKFH 3BEVB 5TH2A 1HCVA 5BW7A 4UB0L 3V0WH 1RZIA 1Y6MR 3M8OL 4QTIH 4XP4L 1ZKAA 1LP9F 2PR4H 5IBTL 2VE6B 3JV4A 3FHQA 2X7LB 1OAKL 5TE4L 4EI5B 1T5WA 1FFOB 1QSFE 2RR3A 1HSAB 1T89A 3BPOB 2GFBA 4R4FL 1MELA 4ZFOL 4JFQB 4M4PA 2NY4C 4XNUL 1Z0MA 3UTTA 3T0WA 1GGCH 4I0PD 1P84K 2Y5TA 4MNGA 1H0DA 4Y5XC 1A4KB 5DMGD 3L3JB 4PGEB 2ZUXA 1J8KA 4GW1A 3FN9A 4XBGB 4IMKA 4KRMB 4CVXB 2X4PB 5DK2B 4BKLB 3V5HB 2IGFH 1MIML 1PQZA 2ED7A 4GXVL 5FHBH 1A5FH 2ED9A 2B1HH 3MJ9L 3FB6A 3R0MA 3HC0A 4RBPK 3BP5A 4HG4J 3KYMA 1KSRA 4OZFB 1XFPA 1MAML 4RMSA 4Y4KB 4X4XA 1MRCH 4JLRA 1NGWB 4F3FA 4RA3A 5F7MC 2J4WH 2W65A 1KB9J 3GGWA 2FEDC 3OAYK 4LDOB 1G9EA 5GGQL 3MLYL 1D7FA 5GS1B 3IDYB 5J1TC 3BGMB 4RAUB 4TUKH 4QRRB 5J12C 2FSEB 4QEGA 4E41D 3O6ML 4DTGL 4BZ2L 3AY4C 3B9KB 2EEBA 4FABL 2EKSA 3NPZB 2X4RB 1WK0A 1WTLA 1SYVA 5TGBB 1OL0A 2Q8BL 2J8OA 1JNHA 1W72A 3V5KA 3H9HB 1WZKA 1JWMB 4K3DL 4HJJH 2CPCA 2BCKB 3HA0A 4PR5B 2EXWD 4M61B 1XR9A 2I60H 3RVTC 2Q1EA 4AEHH 4LARH 1ZLWK 1SJEA 2IAMB 1RJLB 4QF1A 5HYJB 1FJ1B 1OP9A 3IDUA 2ATPA 1F4XH 2QL1A 3K1DA 4JRWA 5ESQB 1ZS8A 2X4QB 4GW5B 4EDWH 4XPHL 4NC1E 1HHKB 1ZHKA 3BDYL 3OG6B 2BOCB 4G6JL 4WI7A 3SGDH 1I3GH 3P0YH 3M45A 4ETQA 3KXFD 4Z95L 2UZYB 3VFUA 4YHLL 1ZSDA 1UACH 1NC4B 4NPYB 1ZA3B 1BECA 3VJ6A 2HRPL 3VFOB 4X4YA 1YEJH 1DFBH 3MV9D 2IG2L 3LHPL 3MOBH 1MEXH 3CNKA 3O9WB 1H5BC 4LSVH 4PG9A 1LK2A 4H20L 4Z9KB 4RGNE 4N90E 4ZXBB 2EC9T 2D9QB 4M43H 1S9KC 3TZVC 4RGOH 2DQFB 1C08B 4WI5A 1B0RB 2BVYA 1A6UL 3D39E 3Q3GA 3FT3A 2AEIT 3QCUL 4P2CG 4XNYH 1L7IH 2B4CH 3KPQA 2FEDD 1DN0A 4KY1L 3WXVH 4M93B 5T5NG 3D3VD 4Y0GA 3ZTJG 2A1WL 2P5ED 1S7QB 3OGCA 4XC1H 5MEQB 1G9ML 4HUXA 1JE6A 5JNYB 1JV5B 2A9MH 2H2PC 3WFCH 1CE1L 5C08B 4Z78A 4DVBA 5HHPA 3AREA 4MJ4A 2HT4C 2G9HA 2W0FA 2FHCA 4NN6B 1MHPH 5DEGA 5IUSA 3RVTD 2VXUL 2OK0L 2ADJA 4OQ1A 1HH9A 2OYPA 1OTUC 1CCZA 3PP3H 4JDVB 5K93A 2FBOJ 1CF8L 3V7AE 4WWID 4M1CD 1IQWH 1EK3A 1VADB 1I1YA 2VQTA 3CMOH 3FFDB 4X80H 1E27A 2X10A 2JIXD 3UJJL 1FE8H 1PKQA 5D6DC 2P5WD 3NABL 5E9DE 3CPLA 4TOYL 4EZMA 4QHUA 3GSRA 2GCYA 1IM9A 1LE5B 2N1KA 1AGFA 4IBLT 2A6KA 3I3DA 3ZT5A 3JBG7 4UINL 2WANA 4P46A 2R8SH 1KEMH 3GSOA 1H8OA 1WZMA 2X5PA 1XH3B 4MX7A 1Y6NR 1G7QA 4FQQB 1OW0A 3MUY1 4LBEA 4OBSA 1WFOA 3OKMA 4EXKA 4PRPD 3ULVC 2J8UB 4WUKL 4HCRL 5F89A 1T5XA 4R4NC 3FN0H 3CSGA 1V3LA 2FX8L 4NRYB 4ZO7A 3D25A 2AV7A 4C4KT 2EH8L 3BMVA 4AH2B 3STLA 1XGUA 3KYNA 1LEGA 4Y2OA 1WAAE 3RJDA 3RL2B 3RHWF 4D0CB 3MLSL 4Y5VB 1MWAA 4FFZL 4JRXE 5I0DA 4WTXA 2YXMA 2VH5L 3P11H 1RU9H 2A6DA 3F58L 4Y89A 1JIBA 2Y5EA 3DVNB 4HK3J 1UVQA 1G7PB 5C0AD 2E8ZA 4Q0XH 2GT9A 2R2EB 5CZVL 1NGPH 1Y0LB 3VGDA 3TYGH 1D5BB 4R6UA 1HHJA 2B7DT 5IFJA 2IWGA 2MPAH 2W0LA 4HZAA 3OKDB 2H26B 3CSPA 5TE6H 2GAZB 1LEIB 1WCBA 4U0RC 5HY9A 2HT4D 1XCTA 3EDKA 5CINH 4PJ8D 1NANI 3GKWH 1EVUA 5ACMA 1YMMD 3QDHA 5DDHA 2P8PA 5DUMH 3BSZL 1WITA 5F9JB 3G5YA 2XPGA 4FXKB 3RBSA 2GKIA 3ILQC 1H3TA 1GZPB 3T8XB 4NKDA 2I9LB 2Z93B 1IZJA 3KJ4C 3BXNA 4LEOB 2IALA 5DRXB 4RAHA 5IFAH 5IHUL 4ZTOL 3V4PH 1GOFA 4RMWA 1U9KA 4K23L 4Y16A 1HI6B 4F80A 5FDWB 1CIUA 1V7MH 1ZHNB 3FKUS 1BOGB 4I13B 1U92B 4H1LG 2EDLA 3AS3A 2ZNXA 2AEPH 2W1NA 4DOHB 3ESUF 4X98B 3FFCD 5I1DB 4X6CB 3V4UH 4ZOCA 1R24A 2MSPA 3ULVD 2QTEA 1VCAA 3MRBB 4LSPH 5EZLB 1QP1A 2I5YH 4PJBF 1UH3A 3NBNA 4P5MB 2QHLA 4R4ND 4PJGE 3PWJB 4PD4J 1ZK9A 1IAIH 5EDXA 4MJ2A 3O45A 4JFEA 2R1WB 4S0TD 1HXYB 3FB7A 2J8UE 1NCBH 1V3JA 5IHZA 2KDGA 2DKSA 4OIIH 5JA8B 1CZ8H 4OLXH 2W38A 1I9IH 4O5LH 1JGLL 3U0TA 1PBYA 3FMGH 3G08A 5K33A 5HYSG 5EFIA 2VLJA 3ZSTA 1JVKA 5M95B 4D9RE 1I8IA 1JTTA 2VSDA 3HUJA 3C5SB 3BPNC 4WGVB 3O6KH 5KJRL 1DCLA 3KXFA 4LNRB 5I8EA 1Y6KR 5IEKB 2ICCA 4YHOL 3VGAB 3DO7A 4C59B 3PV6A 5DK0B 1UCBL 4I0KA 4YHPB 1P7HL 2HKFL 1WIPA 3MV9A 1I8MB 3FO9B 1XGTB 1Q9WB 2X4UA 3ILQD 3HI1A 3WIIH 4IRSC 3DVGB 3GRWH 3V0VB 2BC4A 3MBEC 3AVEA 1P2CA 1H3WM 5AZ2H 3OXSB 5CJQL 3RUGB 1WBYB 2CIKA 1X5FA 1MRFH 1IC7H 3QXUA 3MRFB 2VIRB 5KVEH 5DJCB 3MNWA 3I50L 2P5EA 3KPOB 2C1OA 3RDTB 1UG9A 1GC1L 3DSFL 3JWDC 4ZAKB 1BWMA 3L3GA 4Q58C 2R23B 3SO5A 1U3JA 4DOHE 1J0ZA 2HAZA 5TDNA 1DLHB 4ZUSA 4EVNB 3Q1SH 5ITFA 5DSCA 2Q7YA 3BP6B 1X4XA 5EC1A 1ULVA 5ISZE 4ISVA 4YHML 2C1PA 4FFVC 1RZKC 4YDIH 4F9LA 3V6OA 1ZANL 2DF3A 2B20A 1N7MH 1QLEL 4WEUD 4H8WH 2OL3L 4RMRA 1RJCA 4DFIA 4F37K 4YFLF 3W0WE 4JB9H 2P7TA 3G5XB 4YQXL 2D7TH 3SDAC 4Y19A 4HBQA 4HKXB 4KVNH 4MNQB 1JF5A 1OD9A 4GAYB 1KYOK 1FH5H 5E2UH 4K7PL 5D1QB 1BD2D 1JMXA 1F4WH 1NCAH 8CGTA 3IKKA 3EO1A 2YRZA 5ALBH 1OTSD 2EO9A 1EXUA 4XBPA 3AU1B 4JQIL 5FCUL 4PRPA 1E28B 3TBYA 5TF1L 1MCWM 2FIKB 1EBAA 3X14B 4EN3C 4JHZA 5AWNL 4UILH 4EUPH 5EOTA 4I3SL 4ZDHA 1HOCB 3NN8B 4ZS7L 3AXLB 4JFYB 1R5VA 2W0PA 2LU7A 3T1FA 1G0YR 4PJAB 4JE4B 3MNZB 4N0UE 1J0KA 5KANG 3RUGE 2HLAB 4O51A 1UB5B 3MFFB 3MMEA 3VI4E 5C0AA 2E9JA 1CXHA 4ZOBA 1A02N 1JPSH 4NGHH 1YYMH 3E3QE 1FFRA 3LQZA 1I85C 4HIIB 3KPTA 2EIZB 3A0OA 4FZ8L 1MF2H 4PJ5B 5FDYA 2GSGA 4JRYB 1X4ZA 3FO2B 2EE2A 3BWUC 4I4WB 3IJHB 3PL6D 4PJ8A 5CJOH 3AB0B 4QWWD 5AZEL 2BY2A 3DMMB 5JDSA 1D5MB 4X7CC 3OHXA 4YC2B 1IEBA 3LQAC 4O02H 4B50A 4EI5C 2WWMD 5F8RC 4M5YL 5IROA 4Q9QL 4KZDL 2OTWB 3T0EA 2F58H 1QKZH 3A6CL 5EA0L 5B39A 3EO0B 3EYFA 3BPOC 4M48L 3PWPB 2EE3A 3WL9B 5I66B 3DXAA 4Z7WE 2X4NB 3O81A 4WFEE 5GS2H 5FECB 43C9A 5EIIA 4JJHA 5HI4D 3QUXB 5IMMA 1IGYA 3FFCA 1B90A 1J1OL 4KXZI 4NRZA 1F6AB 2XYCA 1UYWH 2WBJB 4FFYL 1N59B 5HHOA 5GGTA 5C09E 3AFLA 1HH6A 3EYOA 2K1MA 1WV7T 3TJHC 5KW9L 3GIVB 3D18B 1HQ4A 4WIQA 4TUOB 1DUZA 1G9NC 4OFPA 5JW4Q 5CD3A 5J1AA 4Y4KC 1U8LA 1AXSA 5GJSL 4DAGH 1A14L 3DV4A 5DJXA 3OKEA 3EYSL 2SEBB 3GFUA 3WJJC 4RZCA 3HLAB 2YRLA 3MUZ1 2V17L 3BT2H 2PTTB 3TYFB 3L3IA 1SEQH 4NUGH 2AK1H 4YDKH 2V2TA 4GG6F 1VB9A 2DQJH 1XZ0B 5FYKU 3B9KC 2CRIA 4HPYL 4OZ4B 2AI0L 5DURD 5KS9B 4LCWB 4CJ0A 1OAQH 1S7WA 3LIZH 3OJDA 1RPQA 4LVOB 4NJ9H 3KS0J 1UKQA 2R39A 4ODWB 1EO8H 4HS8H 1DBKL 3FAXA 4DN3H 3I9GH 1FDLL 4JY6B 4QRTA 2C4FT 2IAMC 1NAMH 1KCRL 4L3CA 3PWNB 2R0WH 1IILE 2A0LC 4HT1L 2F53E 1GJIA 2OMNA 1NDGA 5CZXC 1BEYH 4TPRL 4L8BB 3HS0A 4MQTB 4ZS6C 4PJFF 4GUPA 4O00A 3ZMRA 4CN6A 5I8CB 4L1HA 3ULVF 3CMGA 4GRMB 4RGND 1W0VB 4N90D 1S9YA 1RZJH 4HHAB 1VA9A 3RGVB 4FQCL 3GHEH 1WBXB 1ZT4A 3D39D 3TJHD 3B9EA 4H0HB 5H37H 1NLBH 1FHGA 2XY1A 3GMMB 5HYEA 3ARGA 3SGKA 4Z7UA 1I7ZB 1EHAA 5DO2D 5GGVL 4Y4KD 1VEOA 4WI2A 5D70H 3QIWC 3E2HB 2ZZUT 2VXVH 5L2KB 2DQEH 3S36L 4LLDB 2HFFA 4QRRD 1A6VL 4XPFL 1A4JA 4NNYA 2QQLL 2RQ8A 1R3LB 1L9MA 1DQJB 1GGCL 4LQ1A 4PRDA 2HVKA 1CI5A 4LSTL 2A74B 1ZHLB 3ES6A 3RIAF 1KBGH 4OGYL 1KELH 5BCAA 3KPSB 1N2RA 3EUUA 2XIDA 1BD2A 1CD8A 1XCQB 1AD9A 2ZPKH 5F96L 4LCWE 3DRQA 5I1AA 3H3PH 1RZ8A 2FX7H 3H9ZA 3KHQA 5HHVH 2P24A 3OR6A 2XZCL 4TSBL 1AIF