3RWFB

Rhesus macaque mhc class i molecule mamu-b*17-qw9
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
molecule keywords Major histocompatibility complex class I
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rwfB00
5FK9A 2OX5A 4NRZA 1KPRB 5D2NE 1ZSDB 5KSUB 4WWID 2F53D 4QHUA 1VERA 3DIFB 3SGJC 1U8HA 3VXOB 3WLWC 1JPSH 1QG3A 1TVHB 2HKHL 3DYOA 4HUXB 3VXTA 1H8SA 4DEPB 4AG4L 2LAAA 1BMGA 1JP5A 3QEQD 2R1YB 1QSED 2YA2A 3NCCB 3EDJA 1ZKAA 2FWOB 3L3IB 1OB1B 4E41E 5A16A 1RULL 5EZLB 6FABH 4JZJA 5AWNH 1EA9C 2AJYL 3G6JE 4F57H 1U8JB 4TUJA 1E4XL 1DEEA 4FQLL 3CH8A 1UZ6E 3FFDA 3FOMA 2HJFB 4N8VG 4ZUTA 3SBWC 3MBEC 3IDGA 1B0GB 2PTTB 3ZE1E 5HYIA 2ZKHH 2DDQH 4DN3H 4DGVL 1S9YA 3TIDA 3EO9L 3GI8H 2OK0H 1IEHA 5AD0A 4JFDB 2H3NB 4HUUB 3U79A 1G0YR 5LQBL 2JJSC 2VZOA 1IT9H 2F9BT 2R1WA 3IJSA 3L5HA 3V95A 4PRHA 2BY1A 3G08B 4JE4B 4DKDC 1AR2A 4WEBH 4DK6A 3LKSB 4EXKA 3M17A 4ALAH 2AABL 2CKNA 3HG1D 2Y7QA 5L2KE 5FYJD 2IWGA 1J18A 5CEXB 2WLZA 4JM2A 3FB7B 1J05A 5DJYA 2AXGB 3W39A 2FD6L 3LB6D 1QA9B 1BVLB 4P57B 5GRVL 5C92A 4PJBE 2IMNA 4XB7A 1PAMA 4BFIB 3UJTH 4L8CB 3QYCA 4D0DA 4AQOA 1AGBB 5L2JA 1HQRB 2MPAH 5EBWA 1N2RA 1CLCA 5TGBA 2AK4A 4RMWA 2GYSA 3P9LA 32C2B 1FE8H 2DQUH 3IXAB 2MTPA 4DUXA 4YE4H 1XGTB 1RIUL 2DKUA 1A7BA 3RWGB 3MLVH 2JJTC 4WI8A 2YPKA 1IBGH 4OFPA 5AZEL 1FO0H 3KPRE 4C83A 2XWTA 3QFJE 1SJEA 2P5EE 2R2HA 3FHQA 4P48A 4PRPA 1BVKA 4DFIA 1R3HB 4I4WB 4S0SD 1BJ1H 4Q9CA 1UM4H 4KTDH 1BECA 3IDUA 4F7TB 1AO7E 1JRHI 3ZYZA 2PXYC 4LCWD 4Q6IC 2V5RA 3K1KC 3WXWL 2ICWA 2I25N 1KLFA 1J7VR 5GS3A 4R2GC 3MRLA 1QBLH 1LEGA 3ET9F 5IJVA 4Z76B 3FT3B 2FJGB 1CGVA 3MXWL 1HHIB 2P5WA 4RA3A 2I60H 3ZSSA 1UWGH 1UWXK 2O5YL 1MRDH 3EOAA 4OQTH 2CXKA 3K2UH 4MHHG 3BJLA 5LGKA 5IFJB 4U6YA 3DMMD 5C0GA 4HG4J 1ZE3C 4GKSA 2Q6WB 3U4BH 4H0IA 4XP1H 1M7IA 2ZUXA 1N8ZB 4JGMA 2ESVD 5DJZB 2HT3D 4P2OC 2VDQL 1OAYL 4OV6F 4WTXA 1AH1A 2G5BB 3HMXA 2WM0A 3LRSB 1MH5B 4XMLH 1QQDA 1SQ2N 4I0CC 3HAEH 2PR4L 3PWPA 4GAYB 1N5YH 3GSVB 4RFEA 3EHBD 5E1AA 3PL6C 5EC1A 5CHNA 1I7TB 1FIGL 4NQVB 5FUZL 4NO2B 4KMTL 3F8UB 4NQDD 5B4MC 2R8SL 1MFNA 2AAVA 1JI1A 2N7AA 4JJHA 1D5ZA 4NWUL 5JQ6H 3BKJH 3WFBL 3W39B 5FA3B 1G6RB 3LPWA 1X5AA 1FL6A 2W59A 3BISA 4MB5A 4HKZA 4F7EB 3V2AR 3O2WL 1MJJA 2F74A 1QKZL 4HUVA 5C0AE 4C56A 2XWJB 5IK3A 4I0PB 3HMXH 4MJ5B 5F9OH 1D9KD 3KLHD 5IIEA 4LHUG 4MNHB 2UV3A 5CZVL 2JE8A 4FA8A 3NPZB 3ZDZF 3GMNA 1I1AA 1JGUL 1V05A 5GRYA 5TQ0H 1V3JA 4EBQL 3L7FA 1XGQA 4HUKB 1J87A 2KKQA 4MLIA 3W81A 2NR6D 2WINA 1RUPH 5JQHC 2GTWB 1X6NA 2XWTB 1GZPA 3X3GL 1NCDL 1UB5B 1P6FA 1ORQA 5J3HC 4M5YL 4XP6H 5EWIL 3UAJC 4QHNA 4PRAB 3LHPL 1S7UB 1FGVL 2P1YA 3U0TB 2W9DL 1KFAL 4FN0A 2Q8AL 2W38A 1N0XL 4RIRA 1S7QA 3V4UL 2DL2A 2HLAB 3VXPA 4PJ5A 3LDBC 2J88H 2J8HA 4JCMA 3WV0A 5I0DA 3L9RB 5IB1B 3MROA 4KK5D 1AD0A 3JV4A 3SOBL 4WTWA 1WITA 4P2QA 4L3AA 1KSRA 2GJ6D 4YHNA 1Z5LB 1IGYB 4ZPVB 4JHBA 4KMLB 1NDMA 4M6OH 5ANME 5KW9L 4P3CH 5DJ8A 4E41B 2AQ3A 4GRMB 5DJ0A 3KPRB 1WZMA 3O9WC 4PTUA 4JRWA 3OXRA 5J56B 2VDKL 2XZAH 4KKCD 5KSAB 4TRPH 1A2YB 3ZKQD 4I18C 5IR1A 2LQRA 4OCRH 4YZFF 5DSCA 4JKLA 1TVDA 2GEEA 1CT8B 1FCGA 1IZJA 1I1AD 3OG4B 5J57B 2R1WB 4OIAA 5CIPB 2FSEB 2C1OA 3V5KA 3PWJB 4PGCA 2AEQL 3TNMA 2JELL 4KI5C 3L1OL 4JN1L 1FYTA 4JHZA 1NCAL 1T4KA 1RZKH 1NC2A 1MCPL 5IHUL 3ZYOA 1ITBB 5TPWH 4K7FB 5DJXB 3SDAC 4WCYH 5CGTA 4WW2F 3KLAB 1U3HD 1XAUA 1ED3A 2AEPH 3B9KD 4MWFB 3HI6L 1CVSC 4ODTH 3KAAA 3BE1L 1DFBL 2EEBA 4OGXH 4LLWA 4MDJA 1RZIA 5E5UB 1WZ1L 5E2WH 3NCJL 2R69L 1LP9A 2X70A 4JFEA 1JZ4A 2QADC 5FO8B 1JZ6A 1KG0A 2DM4A 1VCAA 4YPGB 4YNYA 2BNQA 5B3JE 5DI8B 3ZSTA 1HIML 4QRRD 2Z91A 4XMKL 4HS3A 4LVHB 3FMGL 4KVNL 3DWTA 3PE9A 3PWPD 5I17B 4LPCA 5BV7L 3QQNA 1HSAB 4N5UA 5IW1A 1NQBA 5D7IF 4OLZH 4WU5A 5I30L 4ZFOL 2DI8A 1PX4A 4X6DE 4ZOAA 5ICZB 1XGTA 5I75B 1ETZA 1XGQB 1QBAA 4ZUSB 3I75B 2BHZA 1E27A 1S78C 4XC3H 3TJEH 4XBEH 5EA0L 4U05A 5E8NB 3OAZK 1F3JB 1WVZA 5K9OA 2PKDA 4RGND 4QHNB 3ULSB 4ZO6A 4JPWH 3U0TA 5DJDA 4LBEA 4Z7UA 5CD5C 2A2QT 5IMOB 4ELKB 2O5ZL 1K3ZA 5HYEA 2QR0B 1KCRH 4U1NA 5C3TA 5HGDA 1ZHBB 4QOKE 5FGBC 2AJ3A 3L7EB 3GJFH 1T7VA 5C0CD 3WIHL 1RZGB 1ITCA 2PN5A 4CVXA 4Z76A 5CJQL 1D6EB 4Q7DA 2ZCHH 2AK1H 4DKAA 4JG0H 1MUJB 2XKUA 3MJ7B 3MNZA 4Z78A 4K9EC 3FONB 2CR3A 3K7UA 4OGAC 1MVUA 4TPRL 3RVUD 4MJ6B 5GQBA 4N90D 4JM4L 5KVFH 3KPRA 4KDVA 5I76A 5LGJB 1JWSB 4R90H 3LEYL 3KJ4B 4I3RH 2DBLL 1HQ4B 2P5EA 4YXHL 3EAKA 3O6KL 5GS2D 3CSYB 3WIFA 3OKOA 3W0WD 4YHIB 4OSUH 3G5ZB 3EGSB 1AC6A 4NQCA 2Q86A 5DJ6B 1N4XL 1WTLA 5F89B 1OT1A 5KTEH 5I2IB 1RU9L 3FOLA 3P77A 4TSBH 3TYFB 1EJOH 4HJ0D 3UEZA 5DRWA 3S34L 1R3IH 3O3BA 5F9WB 4PGEA 3QXAA 4JLRA 2EIEA 2GITB 3FFCD 1EBAA 4K7FA 5I6XB 2ZP0T 2EIZA 5DMKB 5JOPE 5C3LD 5HHPA 2NXYB 3OKLB 1T21B 1N7MH 3K8KA 3S3SA 3KDMA 5D8JL 1SMOA 1J0HA 4NNXB 4JM2D 4WV1B 4WI2A 1NC4A 4HS8H 1WIUA 4DAGL 5I1EH 4KI5F 4XPBH 2QQKL 3W82A 4N8VA 1Y18B 4RWYL 4FTVB 4JO4H 5IT2H 1MHCA 3F12A 4PGDB 4U0RB 1WT5C 3S37X 4APQA 2FJFA 1RK1B 4LCCB 4P2OB 5I17A 1BQHB 2C4FU 1KPVA 2JJTA 4Y8AA 5BO1H 4AEHH 1U3HA 2DQTL 1LHZA 5A40E 4X7DC 4DZ8B 4PJDE 2Y5TB 3MNVA 1YECL 2XWBB 3L7FB 1PLGH 1I8KA 5JIKA 4OGYH 2VLLA 1T66D 4M93C 4B7LA 2E7LC 4MD0B 4P2RB 2VO5A 1NBYA 3V6FA 3RWHA 2VLJD 4D3CL 3BE1H 3ILQD 1KCUH 4NKQB 4GSDL 1H3PL 4PRAA 4JRYB 2FX7L 4RGOH 1CDBA 3BGMA 1AXIB 4KZEL 1RZJH 3U30C 4EOWH 3HE7A 5HGGS 1JYNA 1P7QD 3O6FB 1IMHC 2A83A 1VGKB 4AT6A 1RJZB 1PX3A 5ABDE 3AUVA 4PJGA 4RCAA 1L0XA 3SDYH 2X40A 5HHOA 5KVMC 2ZOLA 1MF2H 2EO1A 4ZG1A 4WGVB 1D6EA 1SMAA 1C08B 1BD2D 1U92A 3S7GA 5F44A 1A6VL 4O2FB 1T1YA 3CLEH 4G6MH 1MHPH 3UXFA 2ZUWA 4M6NH 5LAXB 3HZYB 2B1HL 2UWEB 4E5XB 1NBQA 5AG9A 1ZGLP 4OQTA 5K9JL 5DK0A 3NABL 1K8DA 2Y06H 1UZ8A 5KTEL 4LCIH 3UC0L 4Q0XL 1ZGLB 2YMXH 3VDCA 4P59H 5IV2A 3BP4B 1R6VA 5MHSD 3D2UD 4KTEH 4P9HC 4UTBL 2E8YA 3TN0D 2W0FA 1R0AL 2MQ0A 5EC2B 4YXHH 4YWGL 4XNQA 4P4KD 4L8BA 5EUOF 3QXAB 5DK2B 5JHDD 4I3SH 2LVEA 4WRLA 1AD9A 3O0RH 4UILL 1BZ7A 1GOHA 2Q8AH 4ZTOH 5JXEC 4PJEF 2FNBA 2OL3L 4BSWB 5HXMA 3WD5H 3M1BB 3OSKA 3P4MB 4NT6B 1SEQL 2BNRA 4NC2B 4PGBA 3WIHH 5FHBL 4XX1E 3UYRL 3S96A 3FTGB 3I02A 1QSZA 5DEGA 3B43A 4WI4A 2ZOKA 3FB8A 4P2QE 1RUAH 1LGVA 2P48B 1DN2A 1LNUB 2O5ZH 2X4TB 3SBWA 1BOGB 1BZ9B 1FNEB 1LP9F 5F3HB 4R7NB 2XTJD 1KTRL 2G9HA 3CPLA 3W0WE 2A74A 1P4LA 3T0EB 4Q9QH 4M7ZB 4LLYA 2DBJA 1B90A 3ARFB 3QNXA 2J6EA 3D3VA 4PJGF 3SKJL 3CX5J 3F65A 4XBEL 3D69B 3HG1B 5EBMA 1NGYB 1OAKH 3G5XB 2FL5B 2F15A 1UXWA 5I30H 3GJFB 1DANT 3V5HB 1W0VA 3BKJL 5K9QI 1LO2L 1C8PA 4NWUH 5JQ6L 5D72L 3BUTA 4CMHB 4H1LB 2YHGA 3DECA 4YUEL 4HEPG 3WDHA 2W65B 5BZDA 4H20H 2ESVA 2VE6B 4NKOA 1UXSA 3PV6A 2OJZL 1BZQK 4LDOB 1EDQA 4WY7L 1J11A 3QT2A 4N0RA 5BO1L 3MODL 4G80B 1M4KA 3RWCA 3MV9E 3DX7A 4PTTB 5SV4A 1FFOB 2AV7A 3ARGC 3GM0A 1KTLB 4LHUD 3DUUA 1IGTA 1WJ3A 1CL7I 5IP4A 2E9JA 4V1DE 5FV2A 3ZTNH 1I85C 4JO4L 5CEYA 4K3HA 2DLEA 2HFFA 5C0AA 1S7VB 4NJAL 4XPBL 4JRXA 1BWMA 1Z2KA 4YHMH 3EYFA 2XV6B 2R2BA 2OR9H 1GRWA 1HQ4A 4WJ5A 1XIWD 4IEFB 3N1FC 3NCYP 1FNGA 3I84A 5J13B 1EPFA 4R3SA 3LEXA 5HYJA 1FNAA 2BNRD 4OV5A 4WU7B 2VLJE 2JKXA 4XNYL 5AUMB 4HWEH 3S34H 3WSQL 2K7QA 4G7VL 3RX8A 2FECI 1YA5A 3RY4A 4FQ2L 4BQ6A 4KZDH 2HJKB 4G43B 2ADJB 4WO4B 3QDME 3MLPA 5B39B 3QDJE 4MJIA 4IRSB 3T3PE 3FQRA 3TN0A 1T04B 5GGVY 3IFOA 3T08A 4ZOCA 4LHJB 4X6CF 2WANA 1F4XH 3OPZH 3QUKA 5JPMB 3ULUH 1DP0A 1BD2E 5E8DH 5HYSA 4PG2A 1C1EH 3X14A 2L7JA 5B4MD 2HH0H 1IAIL 3LS4H 1MCFA 2Y9RT 1XR9B 1FNHA 3BWAB 2Y6SD 1FNSH 2IPKB 1IAOB 2BVQA 4NFCA 4NZRL 2YMXL 2HT3C 1PYWA 5T3XD 3E3QE 4P5TD 2W9DH 2OZ4A 3JTSB 4N0YH 3O3EB 5HGHB 1MCNA 2BXYA 4F7PB 3OJDB 3C6LA 1V3MA 1NGZB 1H3GA 2JB6A 1NCDH 3QNXB 4EI6A 1OSZA 4P2OD 3D69A 3HG1A 4X83A 2V2XB 5KOVC 1OW0A 2R23B 1AR1D 4NFBA 5F93C 2R29H 2FL5A 3VXRE 3QDGE 5IWLC 3L5XL 3QZWB 1OPGL 1UG9A 4LPWA 4MAYB 3V5HA 2ILLA 3DVNA 3RFZC 4YK4B 1CLYH 2V7HA 4X6CA 3I3DA 3WLBB 4GAJL 4L3EB 4PJ8B 4M8QB 5ANMB 2JK5B 4YGVB 3IJHA 1S9WB 3WHXA 3CFEA 1ZT1B 4MA1C 5IB4A 4EOWL 5AD0B 4G9DA 3L95B 4GRWB 3RQ3A 3FN0H 1S9XA 4UOW0 1A7OH 3OZ9H 4QXTB 1S7VA 1ADQH 1KXTB 4PLNC 4XNUH 3TBSA 1PKQE 3FT2B 4F33A 2W0KA 1QEWA 1A47A 1AQDB 3LQAL 4R97B 2FX8L 5BS0D 1A1NA 4K9EH 3U7WH 5D70H 1A6PA 5HJ3B 3HI6H 3VXSB 1OGAE 2VLRB 1OCWL 2C3VA 4WU7A 5EU6A 1SYVA 1RV6X 4UT9L 3HR5B 1B0RA 3QEQE 5L8JB 5D2LF 4NN5B 4NUJB 2W0FB 4XPGL 2CIIA 2V5SA 4K2UH 2H6PB 2XA3A 4I0PC 5DK2A 1VPOL 5C0RH 32C2A 1CR9H 1YEEH 1F4YH 2YR3A 4ZAKA 3D9AH 3H9YA 4YLQT 5CD5D 2AKRA 5EUOB 2MWCA 1KOAA 2G2RA 2PF6A 4KV5F 3D85D 1GC1L 4YDKL 3QWRA 4J6RH 5D2NC 1BEYH 1OY3B 4MB3A 4LP5A 3TF7C 3T04D 3S96B 4X7TB 1XR9A 3QUYC 2FJHB 1KJ2L 4CKVX 3VXMD 5EUKB 3KPRD 3D25A 1UACH 2JF1A 3DBXB 3FQWA 4UB0H 4ZNCD 3VRLF 5EU7C 4BKLB 5KG9A 5I1IL 2BVPA 3L5IA 3HPJB 2ZPKL 1CD1A 3F58H 4YEFA 3T0EA 5IJVB 5TH2B 2J88L 2YRZA 5DVLA 1MAJA 1MFEL 2OTPA 5CWSA 3V4UH 4GBXC 3VG9B 2Y72A 5DTFA 3KPLB 3GJFK 3THMH 3T77B 5C0EA 5I19H 5IB3A 4PJIE 1JV5A 1FGVH 1B3JA 4XP6L 2AK1L 3SY0A 4MNQE 3U2SA 3UTTE 1W8OA 3ILPA 2W92A 4G7YL 5CJQH 4ZFOA 1EGJL 4IRJA 3O4LB 2LE9A 1IGCL 4GKSB 1JCKA 3W9DB 1MCEA 4HDIA 2V9QA 3I85A 3MYJB 4QNPF 4WVRA 1NFDF 5F1SA 4ZO8A 1ZS8B 4MD5B 1XF2B 4WUKH 2NYYD 3RWCB 5KN5B 2V7NA 3KYMA 1GGBH 3QPXL 4OZFA 2B5IC 5ESAA 2VQUA 4KMQA 4KJWC 1RZ8B 3RUGB 4XXDA 3B2UC 5EC1B 1QPPA 4HUWB 4PRDA 5M94B 3P11L 3DVGA 3LKQA 1H3WM 3L6FB 3U6RB 4Y16B 3PV7A 3C5SB 1JYWA 1QEWB 4PV8A 5ESVB 1PQZB 4QRUB 4KKNA 3PL6B 2Z92A 4WEBL 1JWMB 1OAQH 4Z7NE 2GJZB 2ZJSH 1CGSH 3LZFH 1QA9A 2WUBL 5TJWK 1EHAA 4KAQL 1B0RB 4JM2B 2BNUA 5TE7L 3EDEA 4NOFA 4U1LB 5HGAB 5JXEA 2BDNL 4Z7WF 5IJKC 4JDZB 1F8TH 3RBSA 4Y5YB 3HTLX 4OLVH 1YY8A 5AAMA 3V6OC 3EFDL 3QUXB 1T0MA 2XZZA 1T0PB 1X5XA 4DQOL 3OGOE 1TQCB 5ID1A 4Z8FH 1LO4H 1ZVHA 1ZV5A 4P49A 5IW6A 4Z7QE 1BHGA 3MYZA 3PGFH 2A0LC 3MCKB 2DTSA 5DD3H 3PWVA 3L1OH 4TUOB 1UKTA 4B7IA 3UDWA 4EUPB 3UJIL 1QFHA 4LVNB 3GMRB 1JF1A 1F3DJ 3NN8B 4OUUA 4U6HB 4AG4H 4LCUA 1RI8A 4IRZL 1S7UA 1S8DB 1PSKH 1SJHA 4MA1B 4PJBA 1MCWM 4GW5B 4HWBH 4RMRA 5T33L 3IDJA 2DQIH 1OAUL 2YPKB 3T8XA 3DGCR 2Q7YB 4PUBH 3QXDA 4KROB 1JHKH 2DF3A 3FZUD 2WSKA 1T7XA 1KJVA 2AK4E 1KXVC 1MJ8H 1NMAH 5T1MB 4Y4HC 4IOFC 1NKOA 1OT2A 1T1ZA 4X98B 4OZGA 4F2MA 1L6ZA 2Z8VC 2EE3A 1NUFA 4D8PB 4JZOA 5DRNA 2GJJA 1FCCA 1ZA3B 3BP7A 1FNLA 3MRQA 2G75B 3IU4H 1KT2A 4I8DA 4LMQE 4RNRA 1I7UA 1GPOH 4RZCA 4L4VD 4KK9C 1I4FB 3W9DA 1DANU 2A38A 4HC1L 5JHLL 2I5YL 3H9HB 1MNUH 1N8ZA 2LAGB 2W07A 3WUWA 1RIUH 3QSKB 1JRHH 1G1YA 2C3WA 2CSPA 1RVFH 2YC1A 1BVZA 1OOAA 4OZIA 4MJID 1UJ3A 5CEZH 4ZXBC 4U1SA 5HY9A 1G9MC 1VSCA 4JB9L 2NYYC 4M5YH 5EWIH 5L7XL 3DMMC 1MJ7L 3OAYK 1F3DH 5CHNB 1YEGH 4U1MB 5C09B 1F58L 1QVOB 4MQXD 4ZSOA 2AV1A 2FYYB 3VU2A 1C16B 1N59B 5DJ2B 5IQ7H 4UV7L 2DQHL 4CDGC 3JSSA 5A3ID 1CF8L 1T1WA 4IIQA 1KN2H 3RTQA 3VGAB 1MLBB 1VEOA 3VXSE 5C0DB 2F19H 4C56E 1KJ3H 3BEVB 4X6EA 3HMXL 5F9OL 4JFYB 4TUKH 2BNQB 5J4MA 1OTTC 4MJ5A 43CAB 2XQBH 4PJAF 1H9VA 4QOKB 4W4OA 1YUHB 4J3WA 1F6FB 2OM5A 5DFTA 3MLWL 4QTHB 5MENB 1YPZF 4HQQH 1I1AB 2C3XA 1TNMA 1A1OB 2GY5A 3UTQB 4ZAKB 1KN4L 1PJ9A 3EOBB 4FFVD 5L9DH 3VDAA 3PWUA 1ETZB 2APWA 3OF6A 1ORSA 3NMEA 4NZJA 1UCTA 1CZ8H 4N90E 1KB5B 3WNPA 1H5BC 3GM8A 3G5VB 1NBVL 3O3DA 3QDAA 1WFTA 1VGEH 3KHOA 2CDFB 2BXZA 2PR4H 1QYGH 5F9DC 5T3ZD 2F53E 1A21A 3FB5B 3VFOB 1T89A 1OAYH 3N1PC 3P0VL 3TO4A 3ZDXE 5GGSB 3D3VD 3U82B 4U7MA 2EC9U 1EUUA 5IB2A 1TCRB 5GSRB 1JZ5A 4YAQA 4JFXB 3CIQA 2F19L 5MEND 5HHXH 4X9IA 2BC4A 3G6DH 1NPUA 2OZ4H 3KPQA 1QFOA 5I8OL 1QR4A 3B2VL 3TLRA 1SY6L 5DT1L 3BUYA 3IDIB 2I9TA 5BRZD 1I1YB 3F7VB 3HNVH 1IGYA 1AIFA 4ZPVA 3PNWB 1AQKL 2X41A 4XH2B 4NKDB 4KY1H 3GIVB 4NUGL 4HW6A 5IQ9B 1JWSA 5IHZA 1P7KA 4OM1H 3QUZD 2JJUA 2E6PA 5KSAA 2A6DA 1C7SA 3EYVB 2ADFL 5HYJE 1DQJB 2Y4SA 2VISB 5ERWB 2HWZL 4PJ7B 1KJMB 5EZIL 2I9LB 3O41A 4PGCB 3WEXB 3S36L 2X4SA 3VFTB 3VE0A 3RWDA 1ODAA 4CVZB 3F6IA 2EDNA 3QULA 2FGZA 5I71B 5E2VL 5EFIB 1M05A 2BJMH 4BQ9A 2X7LA 1OTUC 4LSPH 1TJHH 4GBXB 2J8OA 3VG9C 3D0VA 1BAFL 1PW3A 1MJ8L 2V2WB 2Y36H 1JPST 1HXMB 3G04B 4KDTA 3WUWG 3WFDL 2BMKA 1Y18A 5DRZA 3GKWL 1IM9A 1QLFA 4OZFG 3EDDA 1MLCB 2X1PA 1JFQH 4S0TD 5HGAA 4FQQB 3JV6A 3LN5B 3PQYA 5KOMC 4P9MH 2JJWA 2DQCH 3BZEA 5HHOD 3SDXF 2R15A 2R56L 3TNNB 3IDNA 5I1LA 3LEVL 5D7JA 3UTOA 4MGXA 5FO8A 1TPXB 4NKMB 5DI8A 4X7CC 1DQMH 4AM0A 3R8BB 3TZVC 3R0MA 1EBPA 2CLRB 3HC3L 4L3CB 1UWEL 4G8GB 1NANI 1Y6MR 3GMRA 3NN8A 1JGLH 4U6HA 1S8DA 1T3FA 2VKXA 1DVFD 4R7DB 1F02I 5TF0A 4R2GD 3O6FA 3BYTA 3MOBH 3ZLQC 4AT6B 3V6ZB 2DDQL 4DN3L 4YHLL 4R4FH 3OL2A 4YAQB 1BBDH 1V3LA 4TSCH 4FXKA 2GSIA 1EEZB 3EYOB 4OTXH 2PTVA 3DARA 1CGSL 3LZFL 4HWUA 5E56A 3AM8A 4N0UB 5IMMA 4NQTA 5KS9A 2FWOA 6FABL 1UH4A 4PR5B 1JJUA 4UOW1 5EZLA 5E6YA 2DWEB 2JLLA 5DK3A 2IGFH 1ZA3A 3BP7B 4XNZB 2XZQH 1DQLH 1CDIA 5IHZB 1CFSB 2E7BA 3MV9A 3O3UN 1KIPB 2XA8L 3G6AB 1Q9OB 1S9YB 4MXWH 1A3QA 1KCLA 4I2XB 5A2JH 4XBPA 1A4JB 5E4EB 3TBTA 4WI9A 4OCSH 1VFAB 2CK0H 3MLSH 2DWDA 1BD2B 1K4DA 4L1DA 1YNTA 5IOPA 2ADGA 5I2IA 1YNKL 3RU8H 4B53A 1Q72L 2VXTH 5JMOC 3O3BB 5MHSE 2X1QA 4JFFD 4AEFA 2EIZB 2YXMA 3NIDE 2YD3A 1AXTH 3G5YA 5I19L 1J1OL 4MNQA 4G9FD 2BY2A 5BVPL 5JHDE 4Y4HB 1N5AA 5C08D 5EU4A 4X6CE 5I9QB 1A7NL 4RFNC 4BFIA 1HHHB 3SDAD 4H8WC 4UIKH 3UO1L 2RGSA 1J1XH 3I50L 3KYKL 3TYGL 1MI5D 1UVQB 4NO3B 5HHPB 3V6OA 3BN9C 4K8RC 2GQHA 4BUGA 4LLVA 1ES0B 3BDYL 3S98A 3BZEB 5A2FA 4L4TB 4HAFA 3ULUC 3MBED 4FQJL 4ODXA 2F5AL 1WT5A 2APBA 1INDL 4KVCL 4AM0B 1I8KB 1UCBH 1A6ZB 3QXTA 4X9HA 1AQKH 1KJ2B 1YEHL 1U3HC 1BQHA 1RUKL 2DQJL 4JPKL 1MIML 3VWJB 5T1LB 2EH8H 4PRPB 4N1HB 4AZ8A 4XVJH 1PBYA 4I4WA 2EZ0D 3CFIC 3VXQA 5IFAH 5SX4H 4GW4A 4LFHG 3T3MF 4R2GB 5GGSA 1HH6B 5HGBA 2QSVA 5ACZA 15C8L 1BQUA 3PHSA 4NBYB 2VXUH 1FPTL 3OHXA 2KQMA 4HBQA 1U6AH 1B4JL 1MAMH 4TVSa 1FORL 4ZUUA 2IEPA 3QIUC 5EN2B 1QYGL 3NFPA 1WAAE 4RQQA 1IGTB 4R4NC 3CDFA 1YYML 4ZFZA 5KS9B 4ESKA 1UJ3C 4JQXC 1U92B 1A7PL 4C59B 4RA0C 4W4NA 5D6CB 2VQ1A 2O26U 2X1WL 4H0GA 5FA4A 3GMPA 5J3HD 4KU1A 4WFEE 1GHFL 3W0WB 4KTYA 2DTML 4Z9KB 4I9WE 3MV9B 4JO2L 1VEMA 5DZOA 2A6DB 4OBRA 3NH7L 4N9GB 5H94A 1P1ZA 5CSZB 5E9DD 2X89A 1LD9A 4P2CG 2RAMA 4L8SA 1KUMA 3ARVA 2OYPA 1U0QA 1FYTD 4TUKL 3ECBA 4ZPTA 2DYPB 2IF7A 4B5EA 4EI5C 3E8UL 1D9KC 5IWLA 1Q9KB 5SWSA 5DFVD 2NTFA 2BP3A 2V9RA 3QCVH 1I9RL 4QYOA 1U8PA 2A1WH 4G9FE 2EDYA 4P46A 4L3ED 5DF0A 3FHAA 5HVHC 3NZHL 4Y4KA 5EC2A 4XB8A 3CVHB 3U0WH 1F58H 1XCTB 2QKIA 1CQYA 4L8BB 4G42A 1NMBL 5E6ID 2SEBB 1MI5E 5IGXL 4XAKE 4HFWA 4OCWL 2YD2A 3EO1A 5LG1A 1HEZB 2BVQB 1IGFL 3C5JB 4DCQB 1CFNB 4IRJC 3PWPE 3TH4T 4HZLA 1Y0LB 5TDPA 4CU6A 5BZWA 15C8H 3LQZB 4BH7B 2BNRB 4PRIE 4D9RE 1MQKH 1PG7L 5JXAH 3T0VA 5I1LB 5TE4H 4EI6B 5FOJA 1HNGA 4HHAB 4OF5A 2BSRB 1IC7H 3MRKA 4OZFH 5D1XA 1F4XL 4O4YH 1U3ZA 1MIMH 1BOGA 2CUHA 3OB0H 2HT4D 3ZDYE 4L3CA 3QJFA 5F3HA 1ORQB 1UXWB 3FAWA 1JVKA 3SKMA 1J5OL 4J4PC 4HV8B 3NA9L 4KVCH 5DD5L 1H3TA 2P43B 3QRFM 5DEFB 2FBJL 3CMOL 3EYSL 4Y89A 4YXKL 4A6YA 4DKEH 1W72A 5AZ2L 4JZJB 1CICD 5ID0B 5HPOA 2JTDA 3W9EB 1LEKA 3C6SB 3GSWB 5JW4M 2YZ1A 4N0UA 3TBYA 1F4AA 5I1HH 2VDOH 4NBZB 4UDUB 4XAWL 3CDGB 4F7CA 3Q2CA 1M1SA 1T20A 2A9NL 3PGFL 4PP1C 6CGTA 4NDMA 3ARGA 4HWNA 1FP5A 1ULVA 2NZ9C 1BX2B 2H3NA 2WK2A 3OX8A 2NX5B 4X5XA 3GSNH 1YPZB 3DUUB 5DHXB 3NCYS 4YX2H 3V4VH 4ZFGL 1U8KA 3IETA 2CMRH 2YD8A 43C9A 2DD8H 3I3BA 4FTVE 3RWIB 3QIUD 1U2CA 3IYLW 4NQDA 3QXVA 3OKDA 2YK1H 5L2KB 3TBTB 4P23C 2PNDA 5E94A 1AGCA 3ZHDA 4QNPE 3WBDA 3S35X 3MRMB 4PJ7F 1X3DA 3QUYD 4LSVH 3MV8A 3WJLA 1NC2B 4YFEA 1JNLL 1WTGT 4EZMA 3OKMB 5H37G 1OAKL 3L3DB 2VR9A 3VH8A 3ZKND 4Y4KB 4PJCA 1ZT7B 3QUKB 5GGRA 1XCTA 1IGML 5E0QA 1ZLVK 1DBKH 4LSSH 4ZFFA 4LKXA 2DLFH 4G8EA 2O61B 4JFEB 2PYFA 1KG0B 3PGDA 1QO3A 5JDSB 4UNUA 2Z9TA 2EIBA 1IGIL 5I1GH 2WP3T 1B6UA 4Z0XB 4YHPB 4LVOB 1SBSL 3SDCD 3WFZA 3P4NB 2YBRB 3DVFA 4I18A 1J8HD 1FV1B 3NCEB 2HG5B 4M9OA 3IVKA 3MTRA 3NVQA 2OBGA 4XZUB 5CJ8A 4PYHA 3FN9A 2JIXB 2PO6B 1T1XB 5SWSE 4GXVH 3KPLA 1MHHA 2F54D 4HKBA 4W70A 3P9MA 4N0FA 1ZAGA 2OL3H 3KPOB 4OGZA 2N7BA 4LASH 3G6JA 5TF1H 1T66C 3QIBB 1OAZL 4PGJA 5C09D 4WO4C 1EEQA 3U48A 2A9NH 3GBML 3MRLB 5CEZE 4XTRD 4XHQA 3O11A 2C5DC 4PJIF 2ZPKH 1G7LB 5IM7A 1WLHA 2P24B 2FATL 3V5DA 3JVGC 3UTTB 3CFEB 2ZNXA 4B41A 2ORBL 3D2UB 5FYLH 3SO3C 4OFYA 5F88A 3SDCC 4XPHL 3H8NA 3ARPA 4CVXB 2EDEA 2NNAB 4H8WH 5MEQB 5DHVH 4XGZB 4EDXA 5K9JH 4ODUA 4XVTL 3U9UA 1UEMA 1YJDC 2K9UA 1T5XA 5B39G 5K9KB 4XC1H 4PRID 2ICEB 2O5XH 5FO7B 3SE9L 1R3KB 1UA6L 4M3JA 2ITCA 3ZKNC 2HJLA 3L3HA 5KVGH 3GUTB 2Z35B 5E2VH 1NJ9A 4GRLC 3C5ZA 4OI9A 3AREA 3PDDA 5E08H 1MI5B 4HIEB 1PG7H 4TTDD 3C60A 1IAKB 2IH3B 4R8WL 4KI5E 5JIPA 1XGYL 4M1GH 3MA7B 5GGSY 3ARDA 4KROD 1EGJA 1CG9B 3LKOA 5AYUL 5HTSA 1JTOA 3QDMA 4WW1B 4ERSH 5ISZD 1OCWH 2VLRA 12E8H 4KZEH 5IKCA 4PGEB 3GMQA 3C09B 4Y19A 1AGEB 1FHGA 2V17H 4G8IB 3QUXA 5LGHH 4JFFB 4OLWL 1UQSB 4MNGB 2OMBA 1C5BL 1ZTXH 2MQCA 2M2DA 2NZIA 3LQAH 3HE6A 4M1CC 1T83A 2GCYB 4YHOH 1ZHKB 1PLGL 3CVHA 2VLKA 2YWZA 5D7LD 4J8RB 5JORB 3GMNB 1G7JB 4GMTL 3UYPA 5T1DL 2DQTH 2HA1A 3LVEA 3EYQC 1CGXA 3BO8A 4HLZH 3C5JA 4DCQA 1G0DA 4I3GA 2WINB 2WW8A 3C5ZC 1WUNT 3H3PH 3QEQA 1RAMA 2IANA 2NPLX 4U6TA 1FSKC 1T22A 3V0WL 4L5FH 2X4RA 1PKOA 2W60A 2Y5TA 2EIDA 1YQVH 4NP4L 5CWSB 2X4NB 5D1XB 3HZVB 2F53A 3GSXA 2XNAB 2X1OA 2YSSB 1HHJA 5C6TL 3QJFB 4J1UB 2HTKD 4UT7L 1IARB 4L8DA 2HLFC 3RL1A 1LMKA 3PWLB 2MJWA 4ZTPH 5GXBB 5ILTL 4OM0L 2CUIA 1KN4H 3HE6C 2WV3A 4M6AA 1CI5A 3P3YA 1E4KC 1RU9H 4HDIB 1CICB 4R4BB 3VXMB 2X4OB 3D6GA 2ATPA 1U6AL 1FBIL 4XHJC 5CP7B 5JR1H 1GGIH 3QDGB 2DICA 4MA3A 2QADD 2CJUL 2DJSA 1FL5B 5HI4D 4V1DD 3T2NH 3WJJA 3JWDL 1R3JA 4JY5L 2EO9A 4LCCC 2KL6A 3LMJL 3LS5L 4NKIH 4N8CH 1A8JH 5C2UB 1KN2L 2LTQB 3A0OA 4OD2B 4X99A 3TFKC 5FYJH 1A6UL 5E00A 1I9EA 1ACYH 1MCOL 5EULV 4X9GA 2BFVL 2CLZA 3MRRB 5TQ2H 3TZVA 5SWQA 3T0AA 5BVJA 4NQXA 1AO7D 1TZIB 2J8UF 2HRPL 3MPCA 3RI5F 4JGUA 2NCMA 3E6HA 2JCCF 1AGCB 1QNZL 3RUGF 4AENA 4GXUM 3A6CL 4L4JA 3VFUB 4A2LA 4HK0B 3RX7A 2H8PA 4OI8A 2EDLA 4M7LT 3SJVE 2VNCA 2XG5A 3KYKH 5IUSA 2P8LA 3NOIA 4HC1H 2VDMH 3S5LB 2YKLL 1TQBC 5F70A 5IBUG 3D18B 3S8WA 3HE6B 2NY6B 4I5BB 1IKNA 3MUGA 2P8MA 3W5MA 5C0FA 3MQIA 1XGUA 1CE6B 4NJAH 5E5MB 4GRWE 3QDJA 3G6JF 3HHRB 4MJIE 4CW1A 1NCTA 5GSVA 3TVMD 2LVCA 1YC7A 4WHYG 4LSUH 2Z93A 3IS0X 3HZMA 4XPTH 4QHUB 5H35A 5F7EH 1LNUA 1EMTL 3UX9B 3IDJB 4Q2ZA 3EJZD 3RA7L 4QHMA 2Q7NA 3BW9A 4OCSL 3CPLB 1IQWL 5IG7B 5BS0E 5HPMB 1WC7B 4NM4H 4NCDA 1CGWA 3ZDXF 1LO2H 4HPOH 4J4PA 1G0XA 1T2XA 4OZGB 3KPOA 1TJIL 2AEPL 1XCQA 3LB6C 4S1SL 4WCYL 5KANG 2AXJA 4F7MB 4PS4L 5BS0B 3W11D 4Y0GA 4F15B 1P53A 1F4WL 5I71C 3ULVL 3IDGB 3VW3L 3B8SA 3Q6GL 1B0GA 2PTTA 5MEPB 1J0IA 1MUJA 1HSBA 4Y2DB 1ZHLA 1CWVA 5CP7A 3L5WB 4Z0BH 4K7PX 4WHTB 1KT2B 3BHBA 1LE9B 1FL5A 2HJFA 3UYRH 5IHLB 5JLZA 5JDJA 5FHBH 3U9UB 2APTA 1GZQA 1QVOA 3SE8L 1UC6A 5TE6L 3TA3D 4WFFE 1MWAB 1KB9K 5DJYB 3GUTA 5AG8A 3VWJD 1FZKB 1H8NA 4J7RA 1CTOA 2ZZUT 3SKNB 3P11H 5I1DB 5C71A 2GITA 5BCAA 2HFGL 3SDDB 1GGBL 2NY5C 1MLCA 3KPSD 1ZT4A 4JQVC 2D7TH 5FEBA 1W0WA 1JFQL 2GAZB 1P2CB 3JV6B 1P4IH 1I8IA 4GKNA 5B39A 3E2HC 1K9TA 2ATKA 5ITFA 3RWGA 4CADB 2FGWH 3PWUB 4NZDA 5GRVK 4YK4C 4DN4L 1NBZA 2Z31D 1M7XA 1ZOXA 4JKMA 3CC5B 4HWZB 4WFHE 3WO4B 4G8GA 5C0NC 4EDWH 3U4EA 5JORA 2R0KH 1X4ZA 1T3FB 1MF2L 3RPIB 5KSBA 4MA8H 2O93L 2CKBA 3P30L 3FB5A 2EXYD 4JREC 4I2XE 3VFRB 2X05A 4CVUA 3MRJB 4C83B 1NAMA 3MUY1 3MRIA 3D39A 3BYYA 4HGWB 4MD4A 5HPMA 5FAAA 1HILB 3OKEA 1RZJL 2GSIB 1KJ2H 2AJXH 1NAML 4JFFE 3RVWC 1NUNB 3DRQA 2VITA 3IDIA 1KCUL 1T2QH 4D3CH 1EFXA 2X4QB 4Z7VE 3AFLA 3QEHB 1JIBA 4EIZC 1R24B 3N9GH 4JN2A 2R8SH 4PJGB 3DV6A 4YC2B 2OSLA 2C1PA 2CRZA 2QSCH 3H0TB 5IQ9A 4X6CB 4LOUC 3WLBA 1JK8B 4TVPL 3HI1A 1F4YL 1OGAB 4HZAA 2VLRE 4PJHA 5FDWB 5C0RL 3BKYH 3L3IA 5DJZA 3RDTC 1MCRA 2IFFL 3T2PA 1TITA 5A16B 1X44A 4KH2A 4KC3B 5D7IE 2QHLA 2JB5L 4JFDE 1KJMA 4N68A 2VRAA 3VXNB 1P7KB 3HC0A 4OAWA 1M7IB 3O2VH 3Q1SH 2IFFH 5FUCC 4R97C 1KTDA 4JY6A 3EYVA 4UOJA 1HN1A 4GUPA 5IF0B 3EJJX 2I07B 3OJMB 3JWOL 3MV8D 4UV4L 3UTZB 1S78D 3V0VB 2DIBA 4GAYA 3RP1A 1CZ8L 5HJ3A 3VGBA 3MLYH 1OW0C 4QRRB 4MAUL 1INEL 3AMKA 4NM8H 5ALBH 4HJJH 5E70A 1TZIA 3KGRA 2HFEB 4MAYD 3DVIA 4FOMA 3BD3A 4XWOC 4LAQL 4ZOEA 2KZ1B 2ID5A 3P0GB 5F9WC 5DURB 4HJGB 1JNNH 4OZGE 1KNOA 1J05B 2EH7L 4FHBD 4M8VA 3C8KA 5GRXG 3QIWA 4XVUD 2BK8A 4NT6A 1CU4H 4LLVB 3OR6B 2VZSA 5KVDL 3CSBA 4PGBB 4L4TA 4LQFL 3UPRA 3O6KH 4W6YB 5D5MF 3BDBA 1CLYL 3WO4C 3QHZH 5DUPL 4LFHD 3MRBB 3M8OL 3VG0L 4LSQH 3U7AA 1JZ2A 2R0KL 4UV7H 3U7YL 4FQQA 4K3GA 4UT6L 2MCG1 5IESL 1G7IA 4GS7B 4FP8H 1IC4L 4MA7L 3E3QC 4R7DA 3QFJD 4MQ7B 3HZMB 4EI5B 3BP6A 4HULB 1UM5H 2XY2A 3HG1E 4P0DA 5L2KD 1ZXQA 3VFRA 4RGNE 3MV11 4F9LA 4QHMB 2Z31A 1MCSA 5DZNA 3TH3T 3GJFA 4OB5H 4ODSL 4WNQA 4NN7C 4H1LA 1RMFL 2YPVL 3QUMH 3VJ6A 3U7YH 2HFGH 5JHLH 3QPQD 4P2QB 1FAKT 1PG7X 4NKOB 3IAGC 4FMFA 5EA0H 4LOUD 5B22A 4KK6D 4KUZH 3O6LL 3FCTB 3GJEB 4IRSC 2NMSA 4ALAL 3CUPB 2D03L 5DMYA 1CXKA 3EYOA 3BZ4A 2EKJA 5GGTL 4UTAH 1OGAA 4NO0B 4R96A 3WN5A 3MUJA 3T0DA 2OR7A 5FM8A 3QO0A 3ROOA 3G6AA 3R06B 5LQBH 1GSMA 2CDEB 2Q20A 1CK0L 3EOAB 1CT8A 1XF1A 4HJJL 2L7UA 4NM8L 5ALBL 3ZZ1A 4JFDD 4PUBL 3KR3L 4ZPTB 3PJSB 4O9HH 1ROWA 3MLYL 4V1DB 2Q6WA 4XXDB 1X5LA 5CD3A 2IBBA 4XWGH 3RVVC 1FNGB 5J7CC 2NXYD 1GZQB 1MOEA 5C0IA 4Y16A 1IM3A 4ORGA 3X11A 1HOCA 2VL5B 4XBPB 1BQLL 4ZS7H 2HVKA 1MCJA 2PYEA 2ADGB 1U8MA 4JDVB 1CDYA 1NGWA 1RZKL 1LO4L 2Z8WC 4JKPL 3SDDD 2KZWA 1NLBH 2JELH 3FRPA 1FFNB 1I3GL 4M4RA 5EU3A 4XP9H 4XNZC 3O2DA 4MVBC 7CGTA 1TIUA 1XGRB 3TPUB 4XWGL 4FFZL 4MNQB 1CFNA 3MRPA 4MDIA 1P2CA 2VKWA 2D31B 1U58A 2X4UB 4JDZA 1HSAA 4BZYA 2XZAL 4OD1L 2PO6D 4FQHA 4ODXB 3CFBB 2XZCH 1BM3L 5ICZA 2VXQL 4POUB 1WK0A 1T2QL 2FCBA 1BLNB 4TUOA 3O3EA 3ARFC 1S9VA 5SX5H 1FC1A 1N6QL 4O5LL 5DO2C 2FBOJ 2JB6B 3O6LH 4KUZL 4ZO7A 4P2RD 3SE3C 3SOBH 1LO3H 5JZ7C 3BRDA 4MQ7A 1HXYB 1IRAY 4PP2B 3I75A 5ADPH 2W0LA 4XXCC 3QUYB 1EXUB 5EZJB 2XRAL 1XMWA 2OTWB 3DX9A 2ZUQB 4PJHF 3BN3B 2J6EL 1RUMH 2GTWA 3QXDB 1A3RL 5I73B 3VWKA 3WNLA 3Q3GB 1CXLA 3AS1A 4U1KB 4HGWA 4JG1H 4FZ8L 4J3OC 5DD1L 3SDDC 5I73C 4M7JL 1ONQA 5DJDB 1TZHA 2BOCB 3B3IB 4K71C 2EDKA 4X6DA 2R1XB 1XIWC 2H2PC 3HS0A 4Y5VA 3MJ7A 2NLJB 3FCTA 3GJEA 4IHOB 2ZUVA 4JO3H 2AJZB 1RK0A 5D7IB 5TQ0L 3GI9L 1WISA 3PQYE 4UILH 2CDGA 3HI1B 4YGAB 4IS6B 1HDMA 4R4ND 1MFEH 4WHCA 1ZVYA 3QHZL 3ROOB 2ENYA 2AW2A 4ODHH 5CSGA 5HVGB 5FA4B 1KBGL 5FKPA 1I85A 2GHWB 1MVUB 3NAAH 3B4NA 2CJUH 4U1SB 1J8HE 2PXYD 1NCUA 3P4OA 4UB0L 5F7DA 1QBML 2DYPA 5C08A 4AL8L 4FTVD 3KPPA 5FF6B 4OF7A 2X44D 5DRWB 4OAWB 2YD1A 2BVTA 5D1QB 3OKOB 3DRTB 1KTDB 4JY6B 2XT1B 4H26A 2IPTL 5IF0A 4QEGA 4HT1L 4MYWB 2B1HH 2CD0A 2VXQH 3BQUD 1BM3H 4FFVC 1GC1H 5CIPA 3W5NA 5B38A 2J5LC 2GSGB 3ALWA 1BVLA 4P57A 5SX4I 2KQNA 3QIBC 4HFUL 2YEZB 1K5NA 5J6GA 2NTFB 1JNHA 2UZYB 4Z0BL 5F7UA 3B2UD 2QQLH 5BXFA 4FFZH 3SGKC 1YQVL 4L4VB 1T21A 3U30B 2P45B 1YNLL 4I18B 2ZUYA 5C0CB 4DKFL 4NHCH 1P6AB 4G6JL 1II4E 2BRRH 4HUNB 1N64L 4ZSOE 3EOTH 5CCKH 2VLMD 3GMOA 1NMCC 1NAKL 4ZDHB 3Q6FB 2BSRA 2K1MA 3I9GL 1WCBA 4JO1L 4TVPH 5BV7C 4MQXC 1X5IA 3MRNA 5J06A 3X13A 3PXHA 5KAQF 2VH5L 5SWZB 2BVPB 3CD4A 1L9MA 2YPLE 3I6LE 2OCFD 1XZ0B 3LN4B 1F11A 4CU7A 5HVWA 1CVRA 4LPUA 1VGKA 1HYSD 4M02A 5GGUA 3BFOA 3QDGD 4BH8B 2YZ8A 1EVUA 4KTDL 2NNAA 5ALCH 1XGYH 4M1GL 2F58H 5JZ7D 3HB3D 4RWYH 4DGIH 1FVCA 5ELIA 3BKML 5E6ZA 1JUFA 5HGDB 5KJRL 5D7JD 8FABB 3MCLL 3K3QA 5CJ5A 3P0YL 4MXQD 2MCPL 2PW2A 3QUML 1RZGA 1RMFH 1KELL 3NIGF 3PQYD 4IMLA 4KXZI 4OUOA 4UQ3A 4E42A 5DK0B 4NO0A 1AKJA 1HDMB 5K33A 43C9B 4JFHE 1IEAB 1QRNB 3QHTC 3B9DA 4HUWA 2CDEA 3IT8D 3F7YB 4JRXE 3L6FA 3U6RA 2HRPH 1SVCP 2IH3A 3AB0B 4KJPD 2NQCA 4LIQL 3P2TA 1IVLA 1NEUA 1IC4H 2I9LA 3O41B 1AKJD 1OSPH 1KB5H 4IOIB 1UZ8B 3IAQA 4OSUL 2WIIA 2FATH 2X4SB 3WIFB 4UT6H 3NIDF 1IAIH 3LS4L 4N0UE 4P99A 3EGSA 1KIQA 4NC0B 5JMRA 1OVZA 5L2KA 3RVTC 2J7LA 4BFEA 1MQ8A 1E28B 1QFWI 2DM2A 4ZAKC 3QCTL 4I13B 4TNVK 1NGPL 5TE6H 2B2XH 4XBGB 1VFOA 4Y88A 2CQVA 1U41A 1NCCL 4WTZA 4HBCH 5JW3H 5DHVB 1T0MB 2EDDA 3ARBA 2J8UE 4I0PA 5E5RB 3BT2H 2OK0L 1CDHA 4R0LC 3GSUA 5IW6B 4DVRH 4G7VH 4O2EB 4LLQB 4X0KB 4MAUH 3ESVF 4WI7A 1KCRL 4XNYH 4J3VA 4CMMA 2OTUA 3R4DA 5FGCE 1EUTA 1EHLH 2PYFB 3PGDB 1X4XA 4NRYA 5JDSA 1E4XH 1FAIL 4HKXB 4GKOA 3JWOH 4KPHH 2HTLD 4LEOA 1YYLL 4OD3H 3P9MB 1RULH 4YDLB 1BLNA 1NGQL 4ELMA 1IGMH 3A6BH 4MXQC 2A74B 2CRYA 3BIKA 1JPFA 1Q38A 3CFCL 3O11B 4NCC1 1TZGL 3T1FA 1T1ZB 2VB5A 2KBGA 2RBLA 5GRJH 2QSQA 3G6JB 2DQDL 1AXSB 4LHQB 3LKRA 1WAAF 4HKJB 4KDTC 3CCHA 5T1DH 1HIMH 4XMKH 3MRQB 1B4RA 3C9NA 3N1MC 2B4CC 4RNRB 3DXAB 1EMTH 4WO4D 4XGZA 5B21A 5IMMB 2R1XA 4JQVA 1G9NC 3JVGA 4JDTH 2C3HA 3GHEH 3BD4A 1OM3H 4NJ9L 3BKCL 1PEWA 4GXUN 4OGAD 1TPXC 4HUUA 4DW2L 3CSPA 4AK1A 2R2BB 2C4XA 3SQOL 4KQ3H 4M93B 1YEJH 4M1DH 3B6SB 3LEXB 2Y5EA 2VWEE 3VXME 2HFFB 2XTJB 5E2UH 3WNKA 4KGLA 2JJVA 3OXSA 5J0BA 4N1CA 4NHUA 3ZDZE 3H7BA 3GKZA 2WQ8A 4Y16C 1FVDA 5IBLD 5I1AB 2FSEA 4ZD3L 3TO2B 2E27L 3PWJA 1MY7A 1RUAL 5L8KB 3A6CH 4GMSL 1SHMA 2A73B 4Y19B 1FDLH 1E6OH 2JCCE 4FQXB 1PEZA 4XCEB 4LPTA 1MFAL 5FYKH 4QXGH 3WS3B 2FGWL 1OP9A 2AXHA 4LPXA 2BOBB 4M62L 4HGKC 3VI4E 3ZT7A 3CK0H 5HYSB 3QUXC 4QHLA 3INUL 5FUOH 5FYJL 5IW3A 5EO9A 2OQJB 1D5XA 2IPKA 2OI9C 2ZSVA 4XNMB 5H35B 3QEGL 1PGRB 2VABA 4L4VA 4RSVA 3K4AA 2UWEE 1QHOA 4KTEL 2ZG1A 3O3DB 5JW5B 2ZUTA 4LVOC 5C07B 3U9PH 4UNTA 5SWZE 2NY6D 1ZEAH 3RHWF 1WC7A 2A9ML 1C7TA 3QIBD 1FVEB 1R3HA 4LASL 4J12A 2P46B 2JJSA 2HYMA 3Q48A 4J3UA 4ENEC 4GS7C 4NO0D 4GG8A 5GS0H 1DL7H 4S1RH 5HGHA 2AGJH 1Q9LB 1G6VK 3T0EE 1T22B 1S7RA 1MWAL 4KKAD 4LU5H 1GXEA 2VC2L 3L3JA 3D3VB 5JO5A 2FHFA 3CZFA 1QR1B 1QSEE 1A6AB 2F53B 1I7RA 1DQDL 3O4LD 4Y2DA 3QI9C 3QZWA 4JFZH 4OJFH 4P46D 2IBZY 3S35H 2V7HB 3GRWA 5DDHA 2WZPD 3SKOB 1QRNE 3DHMA 4QY8B 2YA0A 1OGTB 1WWBX 1S5IH 2BHYA 3O9WA 4BFBD 5EOCH 2HT4C 4CMHC 3U46B 1FO0A 3IFLH 1HKFA 1VB9A 1JNLH 2APFA 3HLAB 5FECA 4EKXA 4G80A 4JFOB 5C8JA 1GHFH 3WNOA 4UQ3B 3MJ6A 3QEUB 1WFNA 35C8H 3CSYA 3VXSA 4BSJA 3F5WB 1D7FA 1C5CL 2G60L 4XP5H 1YZZA 3RJDA 5EU6B 5LGHL 4XCNA 4F33B 3QULB 1N5YL 3VFGH 4JAMA 5HDBF 1M05B 4JVWA 1OAXL 3GGWB 2AEIT 5H8DA 5CKAA 5LJYH 3WS6C 3MMEB 2ZCLH 4BQCA 2IAMA 1DLFH 1V7NL 3FQNB 3VWJC 2FO4A 4QYOB 5EU5A 5DRZB 4YO0A 4AENB 4I5BA 5CINL 4POZC 2YKLH 5JOFA 3TVMA 1MRDL 2GIYA 3IU3A 1UWGL 5F1OB 1BFVL 2HJKA 4G43A 1GC1C 4JPVL 3FZUC 4CW1B 2M26A 5GIRB 1LEIA 2BSSB 1UH3A 3EO1B 1KV3A 4O58L 1D5XB 3VD5A 1QNZH 1RFDL 2FBJH 1EJOL 2P8MB 4HZLB 3S4SB 2BY3A 3QFJA 2DYPD 3WXWH 4X0KA 4H8WL 4I77H 5CGYD 5KVEH 3IKKA 4JRYE 3ULVF 1U8IB 4QCIA 2DMKA 5FYLL 1RUQL 1HILA 4RFOL 3T4YB 1MCOH 1N6VA 5D93C 1HKLH 2FJHA 3PP3H 3SEPA 4M03A 1A6UH 4F7TA 1KCVH 3T77A 2YD4A 4RAUA 4AIZA 4Y1AB 4YDIH 3GNML 5FDYA 1G6RL 4GRWH 5AZEH 3K1DA 4ENED 4NKIL 1CIDA 4WUUE 1Q9LA 2Q8BL 4KGJA 5CEZD 4GKZB 4JRYA 3AROA 5MENE 3H3BC 4OF0A 5E6IB 3MLTA 3QPQC 1FBIH 2ZCHL 5JR1L 5GRUH 3EHBC 3GSRB 2J4WL 1Z5LA 3HRPA 4TTDC 3VMNA 1SM3H 5D1ZB 2MPAL 1YPZE 4L4VE 4D9QD 4FQ1H 1AE6H 4P5MB 5F21B 2LABA 4K23H 1TETL 2YPLA 4FFWD 4PY8J 5EOTB 2MHAA 3HC0B 4L9LC 3UJTL 4U1HA 1FO0B 3OJ2C 3QRGH 4N0CC 3WDJA 3DUSB 1T2JA 2XA8H 1XH3A 3IXTB 1URLA 4GRLD 4KK6C 5LAXA 1MH5A 1VFAA 1DQLL 3CAFA 1JWMA 3V0WH 2I27N 3S88L 4ETQA 5HDOA 5F6HI 2D2OA 2NY4B 3WL9B 4AEIH 1I7ZA 3LKQB 5I1CL 5JW4Q 4OLUL 1MHEA 5EU6D 5HYQA 5F6HJ 4XP4L 3H7BB 4X6BA 1A5FH 3CJJA 4MWFA 3G5YB 4KVNH 4XCYB 3CH1A 1BGXL 4PJDF 3RZCA 2DTMH 3DV4A 4F3FB 4PJDA 4RMTA 2KUTA 3ULVC 1MWAH 4LF3A 4OT1L 3WN5C 4NO3A 5H2BB 3WFEH 5ICYB 3VA6A 3TVMB 1CE1L 4DTGH 3BXNA 1CLOL 1QRKA 2PYED 1A02N 4Y5YA 5D7LA 4C55A 1JF1B 5INDA 4KHXL 2E9BA 3GMMB 4XAWH 5DEGB 3QDHA 3BAEH 5J1SC 4RGNB 5I16A 4MZ2A 4I0KA 4XNMA 2AKRB 2HKFL 4Y8DC 3SCMA 2C26A 3MJ8A 2DQCL 2VIRB 3JTTA 5CZXC 7FABH 1T5WA 4EUPA 3HAEG 3HUJA 4JZNA 3T0XA 2A6IB 4NYLB 5F7WC 3K46A 3SGJA 3T4YA 1HHKB 4EJ1C 1YEHH 3GKWH 3UJJH 4DZBA 1ZSDA 5KSUA 1YEFH 1U8HB 5CSBA 1UCBL 3O8XA 4HX1A 2HLAA 5DEZA 4DJMA 3RWJB 2BVYA 2Q7YA 3VGAC 4DK3A 2X9YA 4WWKA 3WDIA 1J5OH 3C6LD 5DMGD 3RL2B 2YD6A 3MLZL 2WBJA 5EN2A 1DTUA 4MSWA 4LCWB 2OP4L 5EIIB 1QR1A 3DLQR 1AHWB 5EH1A 3OR7B 1V3KA 4Y7MA 2CRIA 5GZND 1JTTA 4CGTA 5BW7C 3CMGA 3V5DB 4WTZG 2CO6B 3VGHA 1R24A 4JN2B 2OS7A 3BPLB 4X4XA 1J1XL 5JA8B 3U2SB 1ACZA 4MJ6A 1U8JA 2XKSA 4TUJB 4ZFOB 3FO9B 5CJXA 3TV3L 5I76B 5LGJA 4EDXB 4QY8A 5D7KE 3EYQD 4O00A 5GISL 4DVBA 3TT3L 4L9DA 4C58B 4ONGL 4YXLH 3BRFA 5KS9E 1IM3B 3TIDB 2L4OA 2NY1D 5CEXA 1QFWM 3V7AE 1JN6A 4LEXH 4PJXA 4NO5B 3RDTB 1D5BA 3IJSB 4OKDA 1WIOA 3ECBB 5F89A 1JNJA 1A6TB 1A6WH 1R5IA 4YFDB 4YHKH 3SHSA 4YDLC 3S3JA 3WL9A 2GT9B 5KSAD 5F7KC 1FYTB 3HNVL 3EUUA 2GY7B 2DQDH 1QLEH 3KYOB 3RGVA 3EOYG 3MNWB 3VFMB 4OLUH 2X5PA 2WAHA 4X4MA 1YUHA 1I1RA 1XGPB 3FQTA 4D0CA 3RNQB 1K6QH 4JHWL 2EYTA 4G42B 4E41D 3BSZL 4MQTB 5D1ZC 5TFSL 1X5HA 4N8PA 4U1IA 4JFYA 3QH3A 3N50A 4S10A 1MHCB 1XF5A 3F12B 4FQCL 1YYLH 4OD3L 4PGDA 4PJ8C 4BYHA 1LE5B 2P4AB 5EBWB 1A1MA 3BPOC 2HT2C 1UZ6F 4YHYC 4NQSB 1FAIH 5BZWB 3ZE2E 4LSVL 4HH9A 3FO2B 5C6WH 4HPYL 1U8NA 3P9LB 3BEWA 3S36X 4X4ZA 5J89A 4OZHA 1K4CA 3GMMA 4WIQA 1FIGH 3T4AA 5T3XL 1CD0A 5CS7A 1YMMA 1FSKB 1FZMA 2HP4A 1ZVSB 3MLWH 2FIRT 3Q5OA 3ZKXC 5D4QA 1EJ6A 1U8IA 4QCIB 5MP6H 2IG2L 5FCUH 1AJ7L 4NYLA 4U7KA 4Z7WB 2CDFA 4NGHH 3C8DA 5CZKA 4PREB 3QI9A 5CBAB 2IH1B 2APXA 2NLJA 2VDOL 2GI7A 2DQHH 3U83A 1NGXA 2O5YH 3MRDA 5IQ7L 1YN7A 4Y2DC 4P9ML 1RIHH 1XFPA 2I60L 4RFOH 5TDNA 3REVB 3MLTB 3NIGE 4PJ8A 2PW1A 1RPQA 5GJTL 5F1IA 1E6JH 4Z5RB 2JCCA 2YUVA 1INDH 3K0WA 4OKVA 1HNFA 3PNWA 1UADC 3WHXB 1MRFL 2DQGL 4HC1A 2E6JA 5L7XH 5GJSL 2RJMA 5J1AA 5A43C 4EUPG 2FIKB 4OCNC 1DEEB 1K3IA 3EJZC 3H7LA 3HZKA 4LHUB 5IVZB 3TPKA 2AEWA 3DX8A 4EN3A 4PJEA 3J8F7 3ZHLA 4HIHA 2WBKA 3ZTJH 1S9KC 1KELH 1K8IB 4PV9A 3DUSA 1NFDB 2MCPH 4NO2A 4CVZA 5KSBE 3P0YH 2GFBB 4RX4A 3UO1H 4LDEB 1ZGLA 2YXFA 5E00B 3MCLH 1GPOL 5IMKA 5CINH 5DJAB 1FO0L 5LBSH 3VFNA 3QG6A 1IBGL 5FIEA 5TE4L 3WE6B 3BKMH 3MRCB 1C12A 1YJDL 3WEXA 2UZXB 3TT1H 4G6FD 5BV7B 5C0IB 4F7EA 1I7ZB 1T0NA 5D6DA 5F96H 2CKBL 3KYOA 3MOQA 1Q72H 3KS0H 4X6BB 5DMKA 3MBEB 1D9KB 1S7SA 2X7LB 1Z6JT 3OKLA 3ARWA 2D7OA 2ICWI 4OM1L 1MRFH 3QZWG 4XP5L 2G60H 2V2WA 1DSFH 4G8FA 4TOYH 2DQIL 4IMKA 4XNXH 1AP2B 3ARUA 2A1WL 4MXWL 3FRUA 2XWJA 3B9KC 5IBTL 1I9RH 1QSFA 3TPUA 2ZUUA 4Z77A 3MLXL 3QWOA 1SY6H 1MRCH 3I9GH 4MNHA 2NW3A 2FJFB 1YMMD 3EKCA 4YDVA 4UINH 1YQ2A 3BP5A 4FXLA 3QUMB 5DVMA 1A1OA 2AABH 4H88L 1IE5A 4Y4KD 4DQOH 1YNLH 3S35L 1NLDL 1EK3A 5EUKA 1I1AC 3UTSB 1AJ7H 3KYNA 4XRCB 5MP6L 2CLRA 1ZLVH 5F7MC 1GZPB 4E0RA 2V9TA 4U1KA 4JJ5B 3EO9H 2D7MA 2R2HB 1MY5A 2R9HD 4YHLH 5TE7H 1RJYB 5JIIA 4HFUH 4KAQH 1OL0A 3VFOA 1NDGA 2AGJL 4M00A 3HE6D 5IM7B 2Y25A 4EUPH 2M8XA 1U8OB 3SGEH 2YA1A 5GS0L 5IB5B 1TCRA 4D0BB 1JGLL 3RGVD 4L9LA 1OWWA 1YDPA 4NN6B 1B9ZA 4KJQC 1AD0B 2VLRD 1RJLB 3DURB 3OXRB 1E4WL 2H26B 1AHWA 3BSZH 2NY4D 1S7XA 3FL7A 3NPSB 3C60D 3VMOA 4I2XA 3LEVH 3EFFA 4JRXB 3QEGH 4NKDA 2ED8A 2V7NB 2VWEC 2ITCB 1DBMH 5CMAA 3HZYA 3KXFD 3QPXH 4U6XB 4LPYA 2EH8L 5LWYL 2EE9A 2RHEA 3VMPA 3RDTD 4ODWA 4H26B 3L3OA 3PIQB 5FKPB 1DUYA 5ESVA 1JN6B 3I6LD 4PJXB 2X4PB 2Y36L 5BMFH 4LEXL 1KEML 4KRNA 5F7DB 2WUCL 1JHLH 4YJZL 3QDMB 4GAGL 4WW1A 2DKSA 2ZG2A 3L3KA 4LLWB 5DFVC 1PY4A 2QBWA 5DD1H 3THML 3BRGC 1AGEA 3MZTA 4ZD3H 1FRGH 1HZHH 1ED3B 2XPGB 3DGGB 3I50H 4HXBH 5ADPL 3W2DH 4HUMB 3MNWA 5EZIH 3UTPE 3TBWA 1JGEB 2RFXB 4LIQE 3PF2A 4XVSL 1HHHA 1YY8B 2HN7A 4WU5B 5D1QD 4U1IB 2UYLA 1KLUA 1AXTL 3IJYB 4F8QA 1QLRA 3TZVD 4Z77B 2Y07H 1Z9LA 4JFHD 4RMQA 1A1MB 2YRLA 4YHZH 1QFWH 5C0CA 4KY1L 1JHKL 3BEWB 2XOTA 1F5WA 4YQXL 5CFHA 4PLJC 4LCYA 3GEWB 1OAUH 3T0EC 4ZUSA 2X4NA 1NFIB 1A6ZA 1FZMB 1RZ7L 5EBMB 4OZ4A 4OZHF 1PSKL 1DE4B 1HHJB 2ZUSA 3LKRB 4GLRH 3L7EA 1FN4A 1UB5A 3TWCH 1RJYA 4ZUUB 4JM2C 2VDPH 2DMBA 3RVXD 4JKPH 4PRBA 4PREA 3LN9A 3LSOA 3KVQA 3QQ3A 3VFSB 3ARQA 3S4SG 2VAAA 1DBAH 2BSTB 4U2ZA 3RVUC 2DIJA 1YC8A 2MQ3A 4PJ9A 4K9EL 4ZODA 1OTUD 4CL7A 1F8TL 1IAIM 3MV9D 4PJAB 5FOBA 3JV4B 5K59F 1JK8A 1EHLL 3RIAF 1LWRA 1PZ5B 1CQKA 4MJ4A 3ALXA 4O9HL 5F1IB 2FR4A 4XNUL 4ZXBB 4Y5XC 5L9DL 3TBSB 4Z7UF 1YMME 2DQFB 1F90H 2DWEA 3GIZL 3ZKMC 1CK0H 4E41A 3BT2L 1WICA 5I74B 2D0GA 1TTUA 3BIBX 3QUZC 4Y4FA 4F9PC 1OAQL 5EOCJ 1X4YA 25C8L 3LKPB 5CLTA 2E9IA 3S88H 2IC2A 2X10A 1JPTL 5CUSL 2NY5H 1H3UA 2QSTA 1M6OA 3BH8B 4WEMB 3KJ6L 3NFNA 4G6FB 1K4DB 4NIKB 3OKKA 1NCWL 1UB6A 3MLXH 4WW2C 4F58H 1OPGH 3CVIL 3VD4A 3L3KB 2DN7A 1WAAA 1CDGA 3PWNA 3RGHA 4KUCD 3PGCA 3FQRB 2E5EA 1GCFA 2GKIA 4M61B 1MJ7H 3LOWA 1CFVL 4LLDA 4ZMAT 3KDMB 3HFML 4N0YL 2RFXA 4R9HA 2A77L 4P23D 4LSTH 1ZWIA 5JPNB 4RGNC 1LP9B 2X70B 4RAVB 3UTQA 1BFOA 4YBQD 3HN3A 4R0LA 1JRHL 2BJML 4OFVA 3GRWH 3IJYA 1A14L 1FLTX 2EYRA 4RMVA 1X5GA 1R5WB 3BQUC 1XT5A 5KJRH 2JIXD 3TP4A 3GNMH 3ULUL 2BVOB 3S36H 4L8SC 3KPMB 4BFGA 1XR8A 1YN6B 4WHDA 5BJTB 2OJEA 5DHYB 4X5WA 1HKLL 4H1LH 4POYA 4PJHE 1A7RL 4EI5A 5DTFB 3O8XD 3U36B 4WW2A 3KYNB 4XRCA 4D9LL 5I75C 5KVEL 1NMAL 4P2RA 4DGYH 1HI6B 1E4JA 3VWJA 5KBNC 4HV8A 1P9MA 3DVNB 1DVFC 3KPQB 1CDCA 5FM4A 4O58H 3SKOA 1ZLUH 3OBAA 4HWBL 5A1AA 3QIWC 4PG2C 2VH5H 4IOSD 1QTYT 4U7SA 5EO0B 1RURL 1ZHBA 5HI5C 1NL0H 5DT1H 1VPOH 3B2VH 2HVJA 5D7LE 1PG7W 3MGTA 1YPZA 1LP9E 5FYKU 1PZ5A 4RBPK 4JM2F 1KENL 3PHQB 4JEGB 5HHMD 8CGTA 3EFDH 1FFPB 4U49A 2X89D 4EXPX 5FO9B 4IDLA 1MFDL 2IQAA 3JBG7 5FUCE 3LV3B 2EEAA 4XPFL 3IETB 4LQ1A 3KPTA 1CIUA 3ZT6A 1NBVH 2ENSA 2P44B 3PDOB 2VXSL 4J4PD 1U42A 2DI9A 3D0LA 2FO4B 4JFQA 3N9GL 4NHUB 5DJ6A 1OTSC 4HT1H 5E8EB 1IQDB 2PYEB 4XI5D 5GZOC 5GS0D 1CN4A 3MRMA 4Y4HD 2CIIB 4GBXA 4FQCH 1IC5H 1IKFH 3PWNB 2NY7L 1RIVH 3KPNA 4KK5C 1HXMA 5EPMB 1MCCA 4LKXB 1INQA 1P69B 3WFHA 1K6QL 4GFTB 4HIJA 3FQXA 2Q3ZA 3SKJH 3K81A 3FO0H 1CFQB 3VH8B 3CXHJ 2ZNWA 4GOSA 3HNTH 1KJ3L 4OJFL 4LSRL 1FNEA 3P30H 1BIIA 1OWRM 2YBRA 3QQ9C 3CC5A 1FH5H 4YDJB 5BQ7A 2EICA 4PRHE 4RAVA 3QXUA 1QZ1A 2EXWD 2R0LH 4R0LB 4EDWL 2ZUQC 2JIXA 4FTVA 4WI5A 4FQXD 4NPYA 1P4BH 4LU5L 3UPCA 1MIEH 5GGVH 1PKQA 3QXWA 3QHFL 1RK1A 1IFHH 2F5BL 1JYVA 4LNVA 1XR8B 4Q58C 3HPJA 3D39E 4G5ZH 4P23A 3ARGD 3ZKSD 4PRIB 2N56A 4YXLL 4JB9H 2NXYC 3U1SH 3L3JB 4P5TB 5J6HA 1ZEAL 2X2YA 4NN5C 5JUEL 1AO7A 4JG1L 4GW1A 1A6AA 4OZ4B 3T3PF 1OB1A 5I0ZA 2XRAH 3VWKB 2I5YH 5FHAL 1R0AH 1WBZA 1J12A 4PRBB 2B20A 5T5FH 4OQ1A 4HIXL 1MCDA 3LSOB 1G9ML 5IFHL 2MNUA 4PJEE 5E8OA 3VFSA 1FC2D 5CEYB 1WSST 5EBLA 2P24A 2BSTA 3UZVB 2CGRH 3MLZH 5C9JB 1VKXA 3DXAD 2YC1B 4FRWA 3DROA 4LVNC 3D2UA 2HT2D 3HLAA 4HH8A 1FFOA 2AV7B 1S7TA 4PJ8D 1QOKA 3KYMB 4UQ2B 3CZJA 5I66A 1MFAH 3IKCA 1CD9B 5FYKL 1A3LH 3C87A 5D2LB 3SCMC 2B5IB 1CXIA 3HNSH 4QRPB 1OGTA 3EZJB 5C0JB 5F1KC 2PCPA 1T5XB 5DXWA 3DO7B 3LKSA 2IALA 3GSQA 4GMSH 2DQEL 5T33H 1Z3GH 1YEEL 2Q87A 2AJSL 3ULUD 1M7DA 1Q8MA 5AUMA 2HMIC 5KZCD 4PJFB 1N59A 5FM5M 1PQZA 3DTXB 4JFOA 4N9OB 4QWWD 1YEIH 3BPCB 1OP3K 2EZ0C 1KCSH 1Q1JL 4PLKC 4WO4A 1O5DT 4L8CA 4YHML 2EDFA 3U0PB 4UUJA 3L3GA 2FHBA 1MVFA 1TJIH 4GRWF 5EO1A 1U8QA 3OKKB 3OMZA 2FX9L 4Y4HA 2IAND 3IU3B 4XNQB 3BPNC 3HKFA 1UKSA 1D5IL 3MODH 3FQNA 1CGYA 1IQWH 5BXFB 4WY7H 3PDGA 3VFVA 3PGCB 3MRGA 1ADQL 3DPBA 4KWUA 1F3RB 1GVIA 3M1BA 1BGXH 1X5ZA 3ARSA 2WUBH 3JTSA 5GRJL 2VJXA 5HHME 3B5HA 3PWVB 3TCLA 2ERJC 2DL9A 4NZTH 4Y5XB 2J3SA 2FH8A 4OCYL 1HH9B 2X42A 2IJ0C 2OMNA 2FLRT 1I1CA 4Z7OE 3GHBH 4TN9A 2D7NA 4WFFD 3GSOA 3TO4B 2V6HA 3QUZB 5ESQB 4ISVA 2XNAA 3VFWB 5J11B 3T8XB 3X13B 1TVBA 4HMCA 2BVOA 5T1LA 3D39D 4M7KL 5GSRA 1NGZA 2VUOA 5D2LE 3ZE2F 4L8DB 4IOFD 1RHFA 3MGOA 4LLAA 3X3FL 1PDKA 4M5ZH 1T1XA 5CJBA 3QQ4A 5E24E 4KKLC 1AO7B 4GG6E 1P7QB 4K7PY 1P5VA 3LRHA 3VXOA 3C5ZD 2RCSL 1LDPL 3QCUL 1AE6L 5D1ZA 3VXTB 3IRZA 1TQBB 1SM3L 4GQPH 4P5MA 5IFJA 3EJYD 3PWLA 4OFKA 2J4WH 1DBBL 4HBCL 5JW3L 2CH8A 1G84A 3JUZA 5TQ2L 5DMIL 2BFVH 2MKLC 3GMLA 4UIMA 2XXMB 5DZLA 5I9QC 3GSRA 1FNSL 2YUZA 3S5LG 4YGVA 2D7PA 3BOVA 1ZLWK 1JWUB 1XH3B 1VFBA 4URTB 2X6MA 5IB4B 3M8OH 1C1EL 2Q8BH 2VMFA 4I3SL 3VG0H 5DUPH 5KSBF 3RDTA 5E8DL 3ORJA 4DUWA 4LNRB 4MXVE 2VZ1A 3FFDB 5EOTA 3F58L 4QTIL 4LQFH 4ETQB 4Y4FC 3ULVD 1D3CA 4LLUA 1A0QH 1DJSA 3DMMB 4ORGB 3X11B 4U3HA 3NCMA 2J8UA 3DTXA 5DJ2A 2B8OT 3OKYA 4IOIA 5DC9B 4A6YH 1U95A 3ROLB 3T0ED 3MRHB 1J86A 3WSQH 4YFLF 3B8YA 4YDKH 4Z7VF 1T7WA 1MI5A 3CLEL 4G6ML 4U33A 5KANI 4JR9L 1X5KA 4LSDA 1L0YA 3V6BR 4UV4H 3D9AL 5EUOA 1ZK9A 1HQRA 3A67H 2D0FA 1A9BB 3H42H 4G9FA 1I1FB 5EB9A 3HCVB 3JWDC 4YC2C 4L5FL 2APVA 1PD6A 3TNNA 3MA9H 5EU7E 4G8IA 4R26L 3VCLB 5JW4N 5E4IA 3MC0A 5I16B 3RIAK 2H32A 4OLZL 3F62A 2DM7A 1CE6A 1DDHB 5JPMA 3KXFB 4J8RA 1H3PH 3HUJB 4Z7WA 3AU1B 1YMHB 3BO8B 2DJUA 1IZKA 1P84J 4ACPA 4HMDA 4YHOL 3OF6D 4YUEH 4PJ5B 3QUYA 1IAII 3QEQB 1NCNA 3H9SA 1T5WB 1IGJA 1MAKA 2BHUA 4ODTL 4UU9A 2BNQD 3FB6B 5J12C 3OWEA 5I18L 1ZLSH 4JFED 4Z7WE 4IDJH 4XT1C 4JQIL 1B88A 3RWFA 3HZVA 2JCCB 5C0EB 2Y1VA 2AJUH 5BRZE 4OIBA 4X6DF 3B9AA 3MFFB 5DRXB 4GAJH 3W9EA 1LEGB 3NCBB 1ZLUK 5D8JH 3HUJF 2E7MA 3SO3B 5MERA 3DXAA 5JTWA 1N7ML 1B2WL 3FO1A 4PJEB 4APQC 4MCZB 3L5XH 3D87B 4OCRL 3ARBD 4V2CB 2B0SH 3VGFA 2NY1B 4P5KB 4ZQKA 3O4OC 4DN4H 1A4JA 3ARRA 3PL6A 2QTEA 4S1RL 4POZD 1H0DA 3FO9A 3QG6B 2HRLA 1CGUA 5JA9A 1RZ8A 4QF1B 5T5NG 4JRYD 4TSBL 4EN3D 5KW9H 1Q0YH 1W2KT 1R5IB 3VI4F 3MUZ1 2PCPB 3MV8E 3RWIA 2YS4A 2QLVB 2ORBH 3U9PL 4PV8B 5F1NA 4MX7B 1U3YA 3RI5K 3VGDA 1FG9C 3NTCL 2MKWA 3MJ9A 2UWEF 3NIFF 5E99L 5E1AB 1FGNL 3NTCH 3B9KB 4M7LL 4TQEH 2V2TB 4FQXA 3RGVC 3LQAC 4X8JB 5DJCA 3WFCH 4PD4J 1UVQA 3U1SL 5E7BA 4JO3L 1V7ML 4CVWA 4I1NB 3QWOB 2YD7A 3NABH 2VUYA 1G6RA 1IFHL 3CGTA 1XGPA 4U2YA 5B8CA 3PABA 1A6VH 1NFDE 5KSBB 4NKMA 4HWEL 3U4AA 1H5BB 3LKNB 5F72S 5I1GL 3MCKA 3KXFA 2CLVB 3SDYL 4LVHC 2NW2A 3U4EB 4NFDA 4G3YH 5L0QC 4LCUB 4KRPD 1UGNA 2PO6A 4M1DL 4HMEA 2Z93B 2GJ6B 4AMKL 3QR2A 2NY0B 1YMMB 4OLEA 2W0PA 4JQIH 3MOAL 3SE3A 3QUZA 5ESQA 2UZIH 1MCIA 2FX7H 3QEHA 2NY7H 4RGOL 5I18H 4OCYH 1IGJB 4D0BA 3BKCH 2FEDC 1OLLA 3MGOB 1RJLA 3NFPB 2LV4A 4LRIA 4KMTH 3H9HA 4JPIA 3GO1L 3DI3B 5DYOA 3RA7H 3KLDA 4N5ED 5B8CC 4G6AC 3RX5A 1HE7A 3CLFL 4AEHL 3F6LA 3QJHA 1JMZA 1JI2A 4LHUA 4IBLT 3I6KA 2PW1B 4MCZA 4UIMB 5M95B 2Z4QB 4YHNB 3LD8C 1HHGA 2ICCA 5ADOH 2UZIL 2HTKC 2QQKH 5D5ME 1MCPH 5IHUH 3LIZH 4JFDA 4K3EL 3WHE1 1NCAH 4OZFB 4WHTA 1NGQH 3V8OA 2MOVA 2DJ4A 4Q9QL 3BD5A 1NEZG 3VA2C 5J11C 3TNMB 1RURH 3RAJL 4RMSA 4LGPB 3BQUA 1MLBA 4LLUB 5DMJB 3MZGB 1K8IA 4PV9B 2NTSP 2AV1B 4UI2A 4EI5D 5DSCB 3DMMA 1R3IL 4HJGA 1I3UA 5IBLC 4NQEB 3HNSL 2AXGA 2CRMA 2C1OB 1EHXA 3VRJA 1VENA 2ITDB 1T1WB 1BFSA 2GTZB 5EOQL 2WBJD 5EORH 5C08E 3SKNA 3GMQB 3K4DA 2PXYA 4D9LH 1T4KB 1NC4B 4XI5C 1N0LA 1T0NB 4QGTA 4AIXA 2GK2A 2B2XL 1HYRC 2ED9A 4CN4A 4YO0B 3QCTH 1ACYL 3MBEA 43CAA 1P9MC 5DQDL 5ICXB 4QTIH 3QIWB 1YEDB 1N2RB 4QRTB 1IAMA 3OR6A 4M7LH 5GZOD 4LK4A 3N1GC 1FGNH 3KYAA 4DOHE 3LMJH 3LS5H 1A64A 1EVTC 5GIRA 3T2NL 4OF6A 1A14H 2YPVH 5ITFB 3STLA 1TTGA 1H5BA 4JG0L 4HKXA 1GGTA 3JV5A 4KROC 2IPUG 1OSPL 5DMIH 1N0XH 5JUEH 3BIAX 3IAPA 3MBXH 5IB2B 3MGAA 4F37K 1TJGH 3QNYB 1Q0YL 5IW1B 5HDLA 4P4KA 4YPJA 5E8PB 1EEUA 2R2EB 4OM0H 3VWKD 3TJHC 1KPRA 4IJ3B 3BUYB 4UT7H 3E6FB 2AK4D 4ETYA 3GSXB 4DFHA 2ARJB 2KH2B 2XTLA 2ICWB 3QIWD 1KXQE 5ACZB 5SV3A 1AXSA 2R0LL 3KPSE 1JGUH 3D39B 3RY5A 4L9LB 4QO1A 2VZVA 4NP4H 1G7QB 3SDCA 3F7RA 3UTPD 1HHIA 2P5WB 2FR4B 1NDGB 4ZFZB 3QI9D 3FO0L 2F58L 1AIFB 4UDUA 2A6KB 1DQJA 4KK8C 3H9SD 1T1YB 4XH2A 1IEBB 3C09C 3K4ZA 1DUZB 4PJ9D 5KSAC 5BV7H 3IDXH 2NX5A 4WFHD 3FMGH 4I9WD 5FYKD 4GMTH 3C2SA 3B6SA 1JMXA 4HEME 5DLML 3MXVH 4X99B 3GBLA 5J13C 3MNZB 3C6LC 1LD9B 4ODVH 4OGYL 3AREC 4OZIB 5FUZH 2DLGA 1YECH 3DHJA 1C5BH 1ZTXL 2DMCA 5HY9B 1FVDB 3RVTD 1HK6A 1F6AA 2AVGA 4Q97A 3BH9B 1SJXA 2YPLD 3D0VB 3EJYC 3BQUB 4Z7QF 5SX5K 1UT9A 3QIUA 3DYMA 2BMKB 1N64H 2YWYA 4YIQA 1REIA 3HPLB 4G6JH 1I9JL 4Q9RH 2C4FT 3OKMA 5EFIA 4JN1H 4FQIH 3UTZA 3N0PB 2AEQH 4XCYA 4KJPC 3TEUA 3MRPB 3TWCL 1ZT7A 2ITDA 2HKHH 3LRGA 4YBLC 5IFAL 5E08L 2X4UA 1JGEA 4OIIH 2W9LA 2G5RA 1FL3B 4NNXA 4XVJL 3UZEA 1AY1L 1BREA 4E9LA 4RGMB 1QSEA 5EU3B 1Z3GL 1QSFE 2HFEA 3V7AG 2IBGA 4JPKH 3MJ9H 4XAKD 1YEKH 4TRPL 2ZSVB 1AGBA 1KYOK 1NMCB 3SE9H 2X4TA 4MDIB 3FT4B 4QRTA 1Y0LA 1EERB 2D4FA 5CILL 4ZUWB 1NEZA 5E9DB 1UENA 5D7LB 4D9RD 4WV1A 2IPTH 1WFOA 3PABB 3BDYH 4KJYB 3TH2T 3ZKMD 4K94L 2R39A 3NGBC 3G9VA 1ND0A 4PY7A 5I1JL 4OZIE 1SEBA 1G9MH 5IFHH 1S3KH 4LARL 4MD0A 3BW9B 2LFGA 2XG4A 1OQOA 3MLRL 3TYGH 4UNVA 4M43H 3MV01 4FXKB 4UIKL 3D3VE 3LEYH 4I3RL 3HRZA 2BOCA 5F3BA 2XWBA 3OKNB 5D1XD 2Q76A 1UXSB 1EXUA 5EZJA 3PP4L 4PR5A 2VAAB 5EO0A 1Z9MA 3DETC 1UEYA 3KPSA 3CU7A 4ODBD 1KEGL 1J9CT 1EO8H 3G9AB 4LSTL 2F8XC 1DBBH 1G7QA 1RK0B 5D7IA 2ZOLB 4C4KT 1RZFH 1J0JA 1AR1C 4X6DB 4UAOB 2GJ6E 3RUGE 1FYHB 4NNPH 1TFHA 3QQ3B 5F8QC 1C5DB 1LDPH 4JZJC 5T1LD 4TVPD 4Y5VB 1RJZA 5C0AB 3H9SE 4M7JH 1NUDA 3WIIH 5GRWA 3NCFB 2QL1A 3NACH 4FZ8H 1IGIH 4FXGA 1XF3B 3QJHB 3ZL4H 5HYJD 4X80L 1KLGA 3LY6A 4PFEA 1WFUA 4ONOA 4JPWL 2CDGB 3HNTL 1NCWH 5BRZA 3PDOA 1L7TH 1IC1A 1GGYA 2KPNA 2IMMA 3D0LB 2DI7A 5E7FA 3LRSA 1JPTH 3BH8A 5SWSD 4MS8C 5KS9F 1G1CA 4HCRA 3O9WD 1YNTB 4CDHA 5IOPB 1J1PH 4X9FA 4O02H 3WFBH 3HI5L 5EU4B 4XMPH 4CUCA 5IKCB 1EIBA 3SDAB 3DRTA 3GI8L 4YIQB 1PFCA 2WBJC 3I3EA 1CLZH 1EH9A 1FJ1A 3AXLB 3O6ML 3P4MA 1U8MB 2R69H 1ZHKA 5CGMA 1XF4A 2BCKA 4MDJB 2GUOA 2EYTB 3VW3H 3CNKA 1BFOB 2VDQH 3OB0K 2HAZA 3I02B 1NLBL 3GMOB 1NLDH 5C1MB 2R0WL 1DBAL 4H88H