3RWFB

Rhesus macaque mhc class i molecule mamu-b*17-qw9
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I
publication title Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rwfB00
1S5IH 1KT2A 1B2WL 1WGOA 4AK1A 2NXYC 4OQTH 3CIQA 1I8LA 3BWAB 2ICWI 1JNJA 2YXFA 2HTLC 2ICEA 5HGHB 5IVXE 4P0DA 3MJGX 3FQRA 1NFDE 2YD2A 4K07A 1BEYH 3GSRB 2P5EA 2NY4D 3BZEB 4D0BB 3O45B 4HF5L 4N0FA 5CWSA 4F37F 4MDIB 3T1WA 4Z76B 3D87B 1KTDA 4BFEA 3X13A 3TBWB 3K4ZA 3CMOH 1RIUL 4Y5XC 4Z77A 2FH8A 4HFUL 3L7FA 4WTZA 1I1YA 2EDJA 4OZHA 4DGYH 3QQ3A 3BEVA 3V4UH 4D9LL 2C3VA 1FPTH 5DO2C 2V2TB 5ENWB 3SY0A 5C86A 1FYTB 2J88H 5HHME 1EUTA 5MENB 3U48A 4UI2A 3JUYA 3QUXB 4WUKL 3D2UB 4HIEB 4QRTA 3VXUD 5DZOA 4GKSB 4IRJB 2J5LB 2JKXA 3VWJC 1BFOB 4KQ3H 4X7SH 2PETA 4UDTA 1KIQA 1UFUA 4XNQA 1DQDH 3OB8A 5SWSA 4AIOA 1DBJH 5TE6H 4KHTH 1KB5B 4ODXB 1F4YH 3BZFA 4HK3J 1A3LL 1NFIB 2VAAB 2NY3B 1E4WH 1JGDA 2IANB 4O00A 3OAZH 4UNTA 4P2QB 1FGNL 1BJ1J 3QDJA 4XCYA 1QRKA 5JNYB 1YEFL 1WFNA 4JFFA 5T1KB 3F58H 3TYGL 4U31A 4U3CA 3RVTD 4J3XA 3QEHB 2IEPA 3VXUE 3CVIL 5E5UB 4F58L 4R26H 3B9AA 3MFFB 4FOMA 4NGHH 4FXKA 2BHUA 2G9HB 2W60B 4NO3A 1PQZB 1IRAY 4Z95L 1VEMA 1YEGH 3F6LA 2CMRL 4U3HA 3RX8A 2M8XA 1DQQA 1N7ML 2VXVH 1DANT 1QA9A 2FO1A 4PLOB 3S36X 5B38B 1G84A 4BH8A 4GFTB 3WLWC 5K9QI 4H8WH 1CDCA 1Z5LA 5D7LB 1I8LC 3DO7A 3U30B 4GG6B 2A9NL 3T2QA 4N8CL 3ARED 2BRRH 3ARBD 5DMKA 2R56L 3VXNA 5IMKB 4Y2DA 2E6JA 2FBJL 1MCWM 1HWHB 2H8PA 1FZJA 1OAYH 5DMIL 3VXRA 4WNQA 3H6JA 2X9XA 4BFGA 1F6LL 4OLUH 2J7LA 1YN7B 3LHPL 5GRJL 2JELL 4KPHL 3MRNB 5HHNB 3V6FA 2NXZB 3TPUA 2DQDH 4PR5B 3K4DA 2E7HA 4CL7A 4FQIH 2WWMD 1CE6B 2P24A 3GMQB 3L7EA 3GKWH 4EEEA 3BKJH 3QCTH 5D1XB 4MJ2A 2W92A 3N9GL 4QCIA 1AY1H 1G6RL 3OTTA 2W1NA 4HKXA 4BSWA 3MYJA 3P9MB 5IIEB 3NIDE 4LHUD 2HFGL 2OTWA 4Y8AA 5KAQG 4WW2F 5J1SC 2OTUB 1SYVA 4XP5H 4J3WA 3SDDB 1YPZB 3NACH 4PV8B 3T4YB 1A2YB 2AK1H 2CIIB 1QFWI 1GHFH 5F7YC 2D4FA 2DBLH 1YA5A 3OMZA 5EUOB 2Z31B 5M94B 4FG6D 4LRNL 1OAZH 2XQBL 5FO7B 1ORQB 2DQIH 2Y6SC 4X83A 4JFPA 5CSZA 5FECA 1OAXH 1HWGB 3I2CL 3QISA 4KUCF 5LKNA 1BAFH 1YECL 4ZFZB 4PJDA 4ZUUA 4BJLA 3QUZA 1Q72H 1S7QA 4YXKL 4KRMB 3BGMB 4RGOH 4PJXE 4HWEL 3HRZA 4LEXL 3MLSL 1OWRM 1I7RA 4K2UH 1IAOB 4QRRA 2Y4SA 4Z8FH 3RP1A 3CSYA 3RWDA 5JORB 2DQJL 1OWWA 1P2CB 3ZT5A 4HIJA 2VLKD 2MKLC 2VLMD 2X70A 4G7VL 3FHAA 1R5WA 3M8OH 1XGPB 3C5ZB 5D93B 4K9EH 2R0KL 3K2UL 5I1DA 5GGVH 2ARWA 3B5TA 3UXFA 1RUAH 1Q9WB 5J06A 1AO7B 5HHXL 1TIUA 4Y2DC 5F9OL 3BYTA 3U4EA 5I1CH 3W82A 3VXQA 3OKNA 2ADJB 3HHRB 3VXSD 1V3JA 1TNMA 3WEXB 5DFVD 2YS4A 2OXGA 5CBEA 3MXVH 2UYLB 3PGCA 1N3NA 3GIVB 1CXHA 2WQ8A 3RWIA 4EXKA 2VLKE 3KHQA 4KTDL 3DMMD 3OJMB 5KANI 2EICA 2VLME 1CTOA 2BFVH 4M03A 1K6QL 1CTNA 3O4LB 4HAGA 4D0DB 2VR4A 1S7UB 2XXCB 4N0YL 3VG0H 1HQ4B 4Y1AD 4QOKB 1IILE 4LBEB 4MMZC 5CKAA 5I66A 4Q6IA 4JDTH 3KPQB 5J6HB 1FP5A 3X12B 1T3FB 3TH2T 3BEWB 4P4KA 5HGGS 4FABL 3VXSE 3BWUC 1BFSA 2R23B 3HC3H 1A7QH 3C8KB 1AXSB 4G8GB 4RIRA 3SKMB 4LCYA 1Z9OA 3GSUB 2AI0H 3LN5B 4Z0BL 1E4XL 4PJEF 5C0BE 4XWOC 3FFCB 4TUJA 3QUZC 4XP4L 1OGTB 2CH8A 3N85H 3QFJE 4NUGL 4Y1AE 2DMCA 2DTMH 1OAQH 3K8MA 3HCVA 1VFMA 5C0IA 3EJYD 1JCKA 1MF2L 3WNPA 4JRXB 5JO5B 5HY9A 5FGCE 1WV7T 4FQXD 2P5WB 3BHBB 4Z78A 5C0RL 4G80A 4PGCB 5F88B 3WKML 4G5ZL 4LLUB 1TQBB 3GSQA 3MUGB 1AXTL 1HE7A 4U49A 3X14A 3VFMA 4ZNEA 4PGDA 3Q2CA 4LHUG 4RBPK 5I8EB 1L4IA 3BP4B 3RY6A 3I6LD 2H26A 1FC1A 4L3CB 5GZOC 1GCFA 4LKXB 4WU7B 3G6DH 4WI4A 4CVZB 4Y4KA 5KSAB 4ZFGH 4CADB 2PXYD 4JDVA 1MCWW 1WLHA 3GHBH 2J8UF 1ZMYA 1V7ML 5DJ6A 3SJVD 1F4HA 2DS4A 4PREB 1G7QA 4MVBC 4H1LG 1JK8A 5C08E 1ZVYA 1G7LA 2EYTA 2KPNA 3QYCA 5E8NA 4YGVB 4RDQF 5I1IL 3IS1X 3FTGA 3NZHH 2GITA 4Q6IC 1RJCA 4U7MA 2HVKA 4JO1H 3I6LE 3GSWA 2ATKA 2MHAB 5T3ZH 1EO7A 3O2WL 4H88H 4XH2A 3ZL4L 5TFSL 4P4KC 1CE1H 2VISA 4PJEE 5TGBA 3O41B 3VXMA 1TTUA 4YLQT 4O4YH 3OWEA 3STZB 1AQKL 1JTPA 1T0NB 5I1JL 2EDOA 1R3JB 2NNAA 1FNFA 4JFOA 4FQ1L 4JPVH 4M8QB 4UTBH 3QWOA 4ODHH 4OJFH 2J2ZA 3RWHB 4QYOA 4MNQA 5ERWB 1BZ7A 4EN3D 5DD0L 1DLFH 4YDIL 4JO4L 2B2XL 3L9RB 4PRNB 4MD0B 5E7BA 2VDLH 3JWNC 4NZRL 1U0QA 1QLRA 2CXKA 3EIFA 2XTLA 3VRJA 3EDEA 4GJTB 4MNGE 4CJ1A 1KPRB 4U1HB 3PDOA 3ZKNC 1AJ7L 2XA8H 3R06A 1CR9H 2HJFA 3MRBA 4G6MH 1CXLA 4HBQA 1CK0H 3OKLA 3PP4H 2NR6C 2NY6D 4HUWA 3U36A 1QSFB 3CVHB 2IFFL 3GEWB 4WCYL 5BS0B 2Q7YB 2NX5D 4GQ9H 4LEOA 1CZ8L 2V5YA 3IXAB 2P8PB 1IMHC 1KTKE 3NFPA 2X41A 1RVFH 1SBSL 3DX9B 5C07A 3RY6C 1AGDA 2DN7A 1GL4B 4LMQI 4PBWD 4PLKC 3RJDA 1NLBH 1WWCA 1A6AB 1KBGL 3PV6B 4Y4KC 4HPOH 2AJ3A 2EYSB 3VFRB 5DD1H 3P30H 5EO9A 2QQQA 4ODWB 1CBVH 2UZYB 3AVEA 4X99A 1RIVH 5ALCL 1OLZA 3VWKD 3KPOA 2NX5E 2Z92B 5DDHB 4PRIA 3DUHA 4KI5C 4JN1H 4V1DD 1J1PH 3BPCA 5LCVH 3D18B 3EFDL 4JY5L 4YHNB 4JVUA 4P9HL 1RZKL 1KPUA 1XGUB 3OAZK 1X4ZA 4LLVA 3ZSTA 1SMAA 1NC4D 1LDSA 3UYRL 1IGFH 3OXRA 4JFXB 1J0IA 2IMMA 5KVFL 3G04B 4YBHA 3EYOA 1A7PH 3L5WA 4O2FA 4R96B 1KELL 1JZ6A 3VE0A 3HE6B 3A6CL 4JR9L 4UILL 5IESL 3O6KL 4A2LA 3KGRA 2PO6D 4R8WH 5AEAA 5IVOA 4PJCF 5MP6H 1VGEL 3THML 3V6BR 5K9KB 2GJ6D 3LIZL 3P11L 4ZFOB 1D5BA 5GGRA 1S5HB 4V1DE 5GS0H 3H9SB 4P3CL 3BFOA 3MLRH 2HKHL 5DRXB 2X4OA 4HIHB 5FKAB 4ZDHB 1BD2D 1RZJC 4JPKL 1G6RA 3TBVB 3WFBH 3RWJA 2DIAA 3PWVB 3JTTB 3TESA 2ERJC 3CFEA 1UCBH 5IEHA 3RUGF 4HUUA 2UZXB 3U83A 1T22B 2W38A 2ZOLB 4PJHB 2OLDA 5JPNA 2W0FA 1FL5A 5MEPA 4PJ7A 2AJUL 4ODSH 4LCIH 5JIPA 1EDQA 1NFDA 1U6AL 1KJ2L 2WBJD 4OCSH 2NXYB 4KKCC 1T1ZA 5E8PB 2CLVA 2GJ6E 5JW5B 1RJZA 5BMFH 4IRSA 4X5XA 3SDYH 4Y5VA 3ZE2E 3VFNA 2UVFA 4DGIH 1NAMH 2MWCA 1BD2E 1JF1B 4YHPA 5IFHL 2JB6A 4RFEB 1BBDL 4DN3L 5DEFA 1YNKL 1XGRB 1HXYB 3OR6A 4G43B 4Y5XB 1HDMA 2PW2B 1NGPL 4OD1L 4WFED 3RZCD 1M7XA 1S9YA 4G9FD 2D2OA 1JYVA 3C60D 3OJ2C 1QO3A 1UKSA 4XPBL 5CILH 1KG0A 1UGNA 3SBWA 3TM6A 3PWLB 4HWZA 1CDYA 1VCAA 4O2EB 4J1UA 4BUHA 4MWFB 2R1WB 1S7VA 1UM4H 3DETC 3I84A 2BK8A 1DEDA 4QHUB 5DC9B 1R3KA 2VH5H 3NCEB 3VWJB 3FO0L 1NBZA 12E8L 1TZGL 4KVCL 5HYSB 4YWGH 1L7IH 3ARGB 4PJAF 43CAB 5JZ7D 1ITCA 3BQUB 4HBCH 5LWYH 4RMWA 4Y4FB 5INDA 3VGGA 1T1XB 1WC7B 2P46B 3SDCD 3L5XH 5I16A 4G9FE 5EPMA 3QUMB 5F89B 3LPFA 4ONGL 1NCBL 4LLQB 5GGUB 2GK2A 4UT6H 1AD0B 1ZHLA 5I30H 5E4EB 1JHLL 2FZ3A 5E00A 1H3PL 1F2QA 5B8CA 3TYFA 1OW0A 3CFDA 2CO7B 1JF6A 4WUUD 4NT6B 1Z3GH 5K9OA 5FHAH 2VDRH 5EFIA 4YBQC 1UYWH 1PEZA 2VSDA 1ZSDB 1AR1D 3K1KC 1ZLWH 4U6VH 3CH1B 2B8OT 3U0TA 4QKXB 3QUKB 3SDXF 4CNIB 1ZGLM 1MWAL 2VABA 4HDIA 1KT2B 2EO9A 3OQ3B 2ESVB 4NIKB 3UAJC 4K3EL 4W4OA 4Y2OA 3HI5H 3AMKA 2CKBH 1T7YA 4IRSC 2ICEB 4TSAL 4KRPD 3TPKA 2CR3A 1YYLH 2HT2C 1ONQA 3FQRB 4Y5VC 3UTQA 1EZVX 1E28A 2HFFA 2P5EB 4IJ3C 1URLA 1T89A 2VXQL 5F3HA 5D96C 1DBKH 5K9JH 1DQML 4N0FB 5D7JB 1BQLL 3UTPD 1KTDB 5GS0C 2ZUSA 4LSQH 4XI5D 3VFPA 3X13B 1WQVT 3MV01 5I8KL 3MRIA 3EYVA 3LKSB 4NZUL 1MCLA 3DUSB 4Z77B 3QXAA 3BO8B 3L7FB 3QFDA 4P9MH 3O11A 5L8LB 4KK6D 4OZHB 2D7QA 1PLGH 3ARBA 3EKCA 1MAKA 1VEPA 4WTZG 4KV5F 4PJAE 3SBWC 3SY0B 4QHMA 3PGDA 2KBGA 2X40A 1OHQA 2A6KA 4RQQA 2DQGL 5GGQH 3C9NA 1F45A 4APQD 3PXHA 5DF0A 5I1LA 4WU5A 4DZ8A 1Y6NR 5CEZD 2ZUUA 3N1FC 2MKWA 4UDTB 4DGVH 4XNQB 3FN0H 4P2RA 2P7TA 5C6TH 5LXGL 4PS4H 2O5XH 4YPGB 2PCPB 3U6RB 5D7IF 3ZDYE 4MAUH 2J8OA 1L0XA 3UZVB 5J56B 4YHOL 3UCRA 5KS9F 1CL7H 1MHCA 1NUGA 2CLRA 4OFYA 4JZNA 1S9KC 4XCYB 5B8CC 2NY2B 1OQOA 3O3DA 4JFFB 1OW0C 3QIBD 3SDXE 1S5IL 4RAVA 5BVPL 5KVEL 4PIRF 3DX8A 4NN5B 3GMRA 4NO3B 1TCRB 5ACZA 5C7XH 4XPHH 5CEZE 3IU3A 1IM9D 4WEBL 1Z9MA 1FNEA 5D1QA 4DWHA 1DQQB 1R3HA 3TO2A 3Q1SL 2OCFD 4BH8B 4IMKA 3RVTC 1Z5LB 3ZYOA 3OKDB 1EJ6A 4W4OC 2CO6B 5BOZG 4DGYL 1QLFA 1OP5H 3KG5A 5DMKB 3VXNB 3X3GH 4Y2DB 2WWKO 2FWOA 4U7KA 5I1GH 4WW2A 4X0KA 4X6DE 1JFQH 1T89C 1UXWA 2J88L 3E6FA 3O6LH 1M7DA 1XGQA 4XPTL 4NKQB 3ESVF 3QHTC 2AXGA 3E6HA 3SOBL 3TO4D 2YRLA 3BP5B 1GGYA 4HX1A 3TPUB 4CKVX 3OPZL 4CN1A 1EHLL 4NO5B 5CZXC 3ARBC 2P24B 3MNVA 1J0ZA 5F1NA 3NTCH 5SV3A 4F7MA 5TE6L 1F4YL 4HKXB 4BSWB 2EH7L 5ACMA 4UBDD 4NNXA 4WI7A 5T5FH 1B0GB 1B4RA 1A22B 1SYVB 3MLWL 3W2DH 4OLXH 5IHLB 1NCAH 5MERB 2AAVA 3MNZA 2AJYH 3KVQA 3DMMA 3HMWL 5HYQA 5CD5C 2H6PA 3FL7A 1I9RH 2I07A 2DWEB 4NGHL 2KQMA 2BSSB 2BNQD 4JFPB 5CSZB 3WLBB 5FECB 2EE9A 4X80H 5DUML 1X5KA 5J11C 2PW1B 2VLJD 4NO0D 1EFXA 2WUCH 3QUZB 5KBNC 1S7QB 1I75A 5F9WC 4HGWA 1ZK9A 3HRZB 5GS2H 1F58H 2FCBA 1HIMH 4FG6C 1I7RB 1N5YH 5ICZA 3CSYB 2BY0A 5DVLA 3DROA 3UMTA 1TETH 3D5OF 2W9DH 1QEWA 1J1OL 4HIJB 4QTHB 5ILTL 4GXVL 5I76A 5D1QC 3AMLA 1CIUA 1OAYL 1WBZA 2X70B 4U7SA 1R5WB 5EC2A 5JA9A 1ZANL 4OGYH 1Z2KA 4OLUL 4IMKC 2K7PA 2Y36H 2BNQE 1P4BL 5I1DB 3GDBA 3MRFA 3JWOH 3BDBA 3LRHA 2IPKA 4ZOBA 1OTUC 3FQNB 4FQXA 3BKJL 4WW2C 3U4EB 1P5UA 3HAEH 3GUTB 3NCYS 1AGEA 1F3DH 3OKNB 3QEQD 1A6VL 1AGBA 3WSQH 2QQNH 3REVA 4ESKA 3HB3D 3T0VA 2EDBA 5D7KD 3PGCB 4ZSOE 1WZKA 3RWIB 1CFBA 4LCWB 4H0HB 3VD9A 1DTUA 1T7ZA 4XCCH 5CEZL 1MAMH 4P2YA 2PYFB 5F72S 1UXSA 1HEZA 4PJEA 3MJ6A 4Q6YA 3C09C 1NFKA 4K71B 4R0LA 2F19H 4Q6IB 4N0CD 1KSRA 2PXYA 3RL1A 1S7RA 1JGLL 4LP4A 5DFVC 4AIXA 5TE7L 1ETZA 1LWRA 2YD9A 2YHGA 4OIAA 5D7SH 3SJVA 4P4KB 4L5FH 3QEQE 4QRPD 1TJGH 3DMMC 1LK3L 2FX7H 3DI3B 3BT2L 2B0SL 4M9OA 3WD5H 1NSNH 1KCVL 1ZLVH 3W0WA 2XWTB 3ECBA 5D7KE 3HAEA 5H2BA 5EC1A 4N1EA 4RIRB 4OCRH 4LCYB 5D2LE 5CEXA 4TUJB 1OCWL 1CLOH 3M8OL 1B9ZA 4MHHG 3V4PH 3HCVB 1X5IA 4OF0A 5C0IB 2ZCLL 4ONOA 4UIKH 2HG5A 5J1TC 2XRAL 2Y06L 5HYFA 1OAUH 4Z78B 4AEFA 4QRPE 2X4NB 4G80B 5I1CL 4FZEH 2CD0A 2J8UA 5KSBF 4EN3A 4HMDA 4TPRL 2BNUA 5J57B 1FLRH 3GSQB 4NJ9H 3O2VH 1JHTA 3MV9A 3X14B 3VFMB 5IQ9A 4PGDB 3QJFA 2ZSWA 1GAFL 3FB8A 4UTAL 1U91A 2H26B 3CMGA 4JY6B 4NHUB 2CIKB 3PGFH 4FQXC 1VFAB 1XF5A 4FRWA 3LB6C 3V4VL 5KVDH 1U3HA 4NZJA 4F37K 1MLBA 3NFNA 2AERT 1EBAA 2NX5A 4I3SH 1NMAH 2N4IA 5BRZD 3DUUB 1C5CL 1D6VL 1G7QB 1XF1A 3FRPG 4FFYH 4FXLA 2EYTB 2IQAA 3EO1A 4ZXBD 3RRQA 1EAJA 3AGVA 1IQWH 1I4FA 1VA9A 1MHHA 1A1OA 1A7QL 3FTGB 3GZKA 3OR7A 4R0LC 2GITB 3Q5YA 1MJJA 2PXYC 2G5BB 4S1QL 3T2NL 3GSWB 2ATKB 1MCBA 3GMPA 4L8SA 5HDBF 4PJIF 5FUCC 4MYWB 1K5NA 3BX7C 4X98A 5TGBB 4YPJA 3VXMB 1NL0H 5GGVY 4DOHB 2VL4A 3JWOC 2DF3A 3VWKA 2OI9B 1JNNL 4UT7L 2NNAB 1QNZL 4S0TD 4JFOB 1KIPA 3ALPA 3EBAA 3P0GB 1FRGL 2VMFA 5BRZE 3EFFA 1Q9LA 1A7RL 4S0SD 4V1DA 4JFYA 4MD5A 4MNQB 1U58A 1BZ7B 1ZLWK 1T21A 3TH3T 1W72H 1MRCL 3QPXH 4KROC 2IH3A 5KSBE 1ODAA 1XF2A 4LHJB 1QLRB 2G60H 4NZTL 4F7TB 1S78C 4GAJL 3VRJB 3HUJE 1BJMA 4OV6F 1UWXK 4XPAH 3PDOB 2V7HB 4I0PA 3R06B 2HJFB 3FO2B 3VU2A 4ZUWA 3OKLB 3P0VH 4N0UA 4XNYL 4XXDA 1VADA 4HUWB 1KXTB 3G6DL 3GSNH 3G5YA 3CFIC 4EN3C 1SBBA 5ESQA 3H9ZA 1CFNB 3TNMA 4LEOB 3GHBL 2Q76A 3WNLA 2VOTA 1BMGA 3RL2A 2APWA 1ZGLP 1BQUA 4PRPE 1PG7L 1AGDB 3DOSA 4U1IA 3KJ4C 4O5LL 7FABL 1U8LA 3GNML 1BD2A 4LLMB 5B4MD 1QRND 5FOBA 2NY6C 4PJ9A 2J4WL 2YK1H 4GAGH 2BDNL 1U3HC 4P57B 3NZHL 4WHCA 2AJ3B 3X11B 4S1RL 1G0DA 4JO1L 3KJ6H 1W72A 4UU9A 5EO9B 4ZOCA 1F8TH 1MCOH 5KN5A 4YE4L 3MACH 4X99B 5HDBE 4PJIE 5CHNA 1CE1L 2H41A 4EKXA 2WBJA 3RDTD 4IEFB 1JJUA 3KPOB 4NCDA 2D7TH 4PRIB 2C9AA 2F54D 4AEHL 3MROA 4JLRA 4DZBA 4PJCA 4EVNA 4ODHL 5F1SA 4OJFL 5EIIB 3K0WA 1FSKC 2FIKA 4ETYA 4G42A 4L8SC 4YXLH 5T1LB 1KPUB 1QRNE 1KJVB 4LLVB 1LO2L 2HVJA 1NEZG 2N1KA 1TLKA 3OXRB 3VWKC 4L8CA 2GSGB 5I1HL 3D25A 1IGJA 1U41A 3EYOB 3L5WB 1AFVH 3M17A 4O2FB 3RUGA 3C60A 3RU8L 3VE0B 4X6EA 1A14H 2KKQA 1N6QL 1P6FA 1QBMH 3BDYH 1QPXA 3GJEA 5FO8A 4HJGA 2VIRA 4NM4H 2F54E 2YWYA 1D5BB 5GGRB 4C83A 3MGAA 1Q94A 2OQJB 4J3OC 3S97C 4X7CC 2Q6WA 1QYGL 2X4OB 4I0PC 2XKNA 1OF2A 5IVZB 2BVYA 4XCEA 1G6RB 1OP5K 3PHQB 4NDMA 3RWJB 3QH3B 4IRZH 2XZCH 2F8OA 3I3EA 5FYJD 3WV0A 3IGAA 4ZYKA 3T8XA 4KHXL 3DIFA 3SDCA 4Q74A 4HPOL 2DLEA 3VW3L 3P4MA 2XA3A 5JPNB 2W0FB 4R6UA 5MEPB 4PJ7B 4W6WB 5IVXB 1OY3B 4O02L 1CDGA 5DVMA 1NFDB 1S8DB 4W6YB 5CJBA 1RIVL 1R5VA 4ODTH 2V5SA 4OM1L 1FE8L 1T1ZB 4WUUA 1ZVSA 1D9KB 3U9PH 4LPUA 4PJ9C 1XGTA 4IRSB 1RU9L 5EO0A 4K8RH 4Y5VB 4JN1L 3VFNB 1J1PL 5BV7C 1MJUL 4KKLD 5LCVL 4YHPB 5D96B 2JB6B 4G9DA 4X8JA 1DVFD 2YUWA 3DURB 4LVOC 5FYJE 3OR6B 4MCZA 5D9SB 4PJAA 2WBJC 2E9WA 1ZA6B 1RFDL 4M48L 4NNPL 4LQFL 1A7OH 1HDMB 4JG0H 1GC1L 1GJIA 1Z9SA 1S9YB 4PRHD 2PN5A 3SE4A 1EBPA 4LPYA 25C8H 1QO3B 4HKBA 1S7XA 3UPRA 1KG0B 3I9GH 4JVPA 3RX5A 4HWZB 2JCCF 4R8WL 1HHKA 4J1UB 1IGCL 4PJGE 3IKKA 4CDGC 1S7VB 2O93L 2RBLA 1JZ7A 5EOTA 4X4MA 1R3KB 1FBIL 5FXCH 1N2RB 1NBZB 2DM3A 1FVEA 1N59A 1OT2A 3C60C 4QXGL 2BJML 2NY1D 1LE5A 2DDQL 4OLEA 3WIFA 5INDB 3HC4H 2BVQA 5I16B 2FJFA 4PRHE 5EPMB 4YJZL 5GGRY 4MA8L 1ZHLB 5JW3L 5B8CB 2VJXA 5E00B 4D9QD 4FS0A 4JB9L 3CFDB 4YDKL 4DEPC 1WBYA 2COQA 1ZLSH 1NBQA 3KR3H 4KTEH 4P59L 4NKIL 3D3VD 1EPFA 1G9NH 5EFIB 2YSSA 4GUPA 3SDCC 2Z91A 1B0RB 2VR5A 5D2NA 4DGIL 1NAML 2VZVA 5FK9A 3IAPA 4GMTH 3NMEA 1JV5A 1M7IB 2VABB 3QIBA 1YEHH 3F7YA 4HS3A 1MELA 4HMCA 4JO2L 2GAZA 4GMSH 1EMTH 5DMYA 3IDXL 4MDJA 1ONQB 1RUMH 4D9QE 1F6AA 4U1KB 5CILL 4MCYA 3LEXB 5GXBB 4XAKD 1ZHKA 2MMXA 3BDXA 1K4CB 1L6ZA 1IM9A 5CMAB 5F3HB 3D39D 5SWZD 1D5XA 4G6FD 3IT8D 2YRPA 3D3VE 3J8F7 3VFPB 3VGAC 3KPMA 5E56A 2EEDA 2OMNA 1SY6H 2LTQC 1RSFA 3NAAL 2H32H 1R6VA 3QFDB 3O11B 3CFCL 1YNTB 3R0NA 3GBNH 3SE4C 1F4XH 4IM8A 5D7IA 1IGYA 2W9EH 4EDWH 3AREB 3ARBB 1J0HA 1ZLVK 2CDFA 4L3ED 5KS9A 5H35A 4QHMB 4TUOB 3PGDB 3SQOL 1AIFB 1NGYB 3LS4H 3OBAA 2UY6A 2ILLA 4WHYH 2A6KB 4RQQB 4CW1A 2H3NA 1MCNA 3C9NB 1MCFA 3B2VH 4EBQL 1NCWH 5I1LB 3R1GH 1MCEA 1IC4L 4XAKE 3BRFA 4KK6C 3HKFA 4K3GA 2ZNWA 4DZ8B 4CN4A 3D39E 5SWZE 1ZXQA 1PDKA 3O81A 4YQXH 1ZLUH 4F15B 2X4PB 2P7TB 5JW4M 4HS8H 2VC2L 4K8RC 3PJSA 3ARQA 3B9KD 2VDRL 3IDIA 4M6OL 4BFBD 2HYMA 3HZMA 4ZUVA 5IFJA 2XY2A 1UYWL 2XY1A 3UBXA 5FYJL 2FECL 5FM5M 2DJSA 3EYUH 1MHCB 5CJOH 2CLRB 2BY3A 1WBXA 4JZNB 5IB3A 4FNLL 4E9LA 4OGAD 4L3EE 1T5XA 3O3DB 1PKQA 2GW5A 4X6CE 5F9WB 3RBGA 3GO1H 3GSXA 3LKNB 1FCCA 1FL3A 4S1SH 1JHKL 5CINH 3MLTA 3DX8B 3LDBC 2CKBL 5IBUG 5EU7E 3GMRB 2DD8H 2BNRD 2BNQA 3A0OA 3IU3B 5D2NC 3DRQB 5IMOA 1FNEB 3L1OH 4QY8A 5C92A 2VLJA 1N6VA 1DBKL 4WI2A 5D1QB 4NO0A 4UV4H 5IUSA 3WS6A 5K9JL 1NCDL 1R3HB 2H1PL 3TO2B 4XHQA 3QIBC 4K3JH 4XCFH 4N5EC 4JAMA 2YUXA 2WLZA 2FDBP 5EG6C 2R0ZH 4TSBL 4ERSH 3MRKA 3RWFB 1QLFB 2DQTH 4WTXA 4N5UA 2VITA 1I9JH 3L5HA 1WIOA 2FWOB 1BVKA 2M2DA 5DHYA 4WW2B 2I9TA 4G8EB 1UXWB 2AEIT 1CLYL 3FONA 2A6DA 3BPNC 4GRLD 1M7DB 1XGQB 4JANB 3E8UH 5GGQL 3ELAT 1F2XK 1K9TA 3E6HB 1L6XA 1M1SA 3H9YA 4HX1B 2BNRE 1CS6A 2X44D 3UTTA 1W8OA 4QGYA 4PJFE 4HC1H 2ZUVA 3TBSA 1NDMA 3VGBA 1TVHA 1G9NC 3IDJA 5FCSH 1XAUA 5F1NB 4F7MB 1XH3A 2XQYK 5LBSL 1T6WA 4HUXA 4M62L 4W68A 3AXLA 1XT5A 3C09B 2NW3B 3QEQA 3VXSB 4NNXB 4ZUSA 1MFBL 3VCLA 4HG4K 4JQVA 5EBLA 1F3DJ 2HFEA 4ZPVA 3MNZB 5AWNL 5EORL 4ZQKA 1VSCA 3DMMB 5HYQB 4LIQE 3ARFA 3IJYA 2H6PB 2I07B 4DCQB 4Y1AB 1A1MA 1H3UA 4URTB 4F57L 2AEWA 2PYEA 5ALBL 3QQ9C 4P5MA 3SE8H 4XVSL 1GGBH 2G2RB 5FGCB 4HGWB 2RCSH 4QRPA 5DRNA 2LE9A 4S2SA 3H8NA 2VKXA 1YMMD 3KPRD 5JOFA 5L88H 1YDPA 5ICZB 1P7QA 5ESAA 3S96A 3DROB 4JFED 1QFHA 5DWUL 2R4SH 3X3GL 1HN1A 4YHKL 3KPPA 1QEWB 3GMOA 5E03A 5I76B 3PNWA 4L8BA 3WS6C 1L7TH 5EC2B 3AC0A 1LHZA 4Q0XL 4W81A 1V7NH 4XC1H 1DBBL 5AG9A 3GMNA 1YUHA 2P8LA 1IEAB 2H9GA 2C1PA 4IOFD 3KYAA 3V6OA 4FQXB 4LLDA 3NTCL 1JZ4A 5DHVH 1LDPH 1YMME 3KPRE 4GOSA 5HHVL 4XBPA 3AB0B 4NFBA 2KH2B 3AAZA 2ZUXA 1VKXA 4JFEE 3ARSA 3ZE0E 4B41A 3EO0A 4JG1L 2YZ1A 3FO1A 5L2KD 1VGKA 4JKMA 2A83A 2G5RA 4UB0L 1KPVB 3MJ8B 2AJYL 2CGRH 5M95B 1E4XI 4LFHD 1ERNA 4OCXH 1Z6JT 3I3DA 1UXSB 3FOLB 3QBTB 2GSIB 3EOTH 5CP3A 3BW9A 2R69L 5CSBA 1HEZB 5GGSB 4PJEB 2N7AA 1K8DA 3B2UD 1U3ZA 4R0LB 2WUBH 2PXYB 1BIIA 4OCLC 3RL1B 1S7RB 5A16B 1XR9A 4X80L 1BIHA 3FB7B 5HYJE 1ETZB 3ORJA 3HB3C 5IW1A 4JQVC 3GRWL 2XPGA 2WUCL 2VXSH 3SJVB 1MCKA 2QSCL 4WGWB 1TJIH 1YPZF 4OUOA 1P4IH 5IOPA 3ARFC 1HIML 1FZKA 3L6FA 5GRVL 5EUOF 5KSBA 3MRJA 5H2BB 5L2KE 5DHVA 2VE6A 5EC1B 4BA8A 4GW1A 4TVPD 2W9DL 4NWTL 3WUZA 1X5GA 4MNGB 4PUBL 5CEXB 2VDKH 3WBDA 1A47A 2CUIA 3HAEG 4AM0B 3K1DA 2EDRA 4KROB 2D31A 3UC0H 1TZIA 3NABH 2Y36L 2KZWA 4NC1C 1FG2A 3WXVL 4JM2D 2HG5B 1T20B 4ORZC 2OJZH 2Q86A 5JXED 1JTOA 3CFJB 2J8UB 4EN3B 1G7MB 1OT1A 3K2MC 1B4JH 3UZQA 1U8PA 2BNUB 1MIMH 2DJUA 3HA0A 4XNXL 2O5YL 5H94B 1W0WB 5EH1A 4BZ1L 1JHTB 1GIGL 2BSRB 4HW6A 4N8VB 1I9EA 1EFQA 4LIQL 4TVPE 3D9AL 3FB8B 2VXTH 4O9HH 2VZ3A 4JQXA 5I2IA 1MJ7L 1U91B 5ADPH 2CRYA 4NO2B 1VFOA 3CX5K 3EOYG 1MAML 4LGPB 3V6OC 1XF5B 2NY6B 5J89A 5LGHL 4LSPH 3NCCB 4PJIA 1MFAL 1R3LA 5GS3A 1R0AL 2ID5A 1MLBB 3NFNB 4OKVA 3Q48A 1KN4H 1EHNA 4XVTH 4ETQA 2NX5B 2NY7H 3ROLB 1KCRH 2VDOL 4N9OB 4OT1H 4QWWD 1KC5H 3ZMRA 4HWBA 4L5FL 2EKSA 4LLWA 1A9BA 3CD4A 2BC4A 3EO1B 2FX7L 1WCBB 5IHBA 1QRNA 5DA0B 4EOWL 5KTEH 3OR7B 2NY0D 2ARJB 4PYHA 2WZPD 2QR0A 1FG9C 5I0DA 1Q9OA 1FDLH 2BY1A 3GMPB 1NQBA 1MWAB 3MJ9H 1K5NB 3IDGB 3UPAA 4X98B 1RZ7H 4FQQA 2OK0H 3WNKA 3VWKB 1K3IA 3RDTA 4HUMB 1A7NH 4BQCA 2VQTA 3P73A 1PG7W 1KIPB 4UIKL 5IB4A 2F54A 4JPWL 1Q9LB 4EQ3A 4G8FB 4V1DB 5KG9A 1F5WA 2MOVA 4MD5B 2DI8A 1C16A 1U58B 3HFMH 3MLVL 1T21B 5IK3B 1FLRL 2IH3B 4QRSA 5ECJE 5GJTL 5HD8D 3NCJL 3BGAA 1NC4B 1GC1C 2CRIA 5FYLD 2DKUA 4WWKD 2WM0A 4I0PB 4XPFH 1T2QL 3JV4A 4RA0C 4YO0A 4ZUWB 3BRDA 2LVCA 4N0UB 1NANH 4PY8J 1VADB 4ZD3L 1BPVA 4TQEL 3G5YB 2PO6B 4R2GD 5ESQB 1JZ5A 5KVDL 4NQCD 3MJ9A 5FFLA 5E4IA 2GJ6B 4YDJB 2E8ZA 1YEIH 2Q76B 4JRYD 3RL2B 5E8EA 2XWBB 4KH2A 4JQXC 2YBRA 1WJ3A 4CN6A 3TT1H 3ZKMD 1BD2B 3KPSD 4U2YA 1LO4L 4OCMC 1A5FH 1DDHA 1FC2D 4YK4B 5FYLE 3TZVD 4JFHD 1ZEAH 2XQYG 5BV7B 4UU9B 2YKLH 2F74A 3IAGC 1KFAL 4BSVB 3G6JF 5E2TH 2FSEA 5KN5B 5CIPH 3LMJH 2XTJD 4EI5D 2WBJB 4NQCE 3O8XD 3RBSA 2CRMA 4C58B 1EHAA 1ZLUK 2I9LA 2L4OA 3MV7A 4P49A 5AZ2H 3MROB 4MJID 3Q6GH 4JLRB 4JRYE 3VFGL 3EYQD 4DZBB 1QKZL 1VHPA 4PJCB 4EVNB 3GK8H 4Q58C 2NTSP 1NUNB 2FIKB 1MFEH 4G42B 1MFNA 4TVPL 4UMGA 3V0VB 1P1ZB 1ITBB 1T66D 5F7DA 5E8OA 3OB0K 4K3DL 2P8MA 2F5BH 1DVFA 1RUKH 3W9EA 2DYPD 2HVJB 1KXQE 1XIWA 3EUUA 2FJHA 1OSPH 3RDTC 1NDGB 3MRMA 4JFHE 2P4AB 3D25B 1X5XA 5T33L 3VMPA 3LKPA 5L6YH 3RZCB 5FHBH 4KK8C 4PRHA 3GKZA 4G9FB 3M17B 4XP6L 4NHCH 3RUGB 5DQJA 3C60B 3WE6A 4X6EB 5MEOB 4MXWH 2CK0L 2XTJE 3IDMA 4TTDD 1M05B 2ICWA 3GJEB 3GSNL 4OZFH 3GSVA 2EXWD 3B8YA 4HJGB 3O9WD 2VIRB 3O3BA 2C7UA 1ZHBA 4M1DL 4MJIE 3P40A 4C83B 5ETUB 1Q94B 4PLJD 4NJAL 4GXUM 3JV5A 3L3IA 2XKNB 1OF2B 3I50H 4AG4H 5DK2B 2FEEL 4WRLA 4DEPB 4XCEB 4DAGH 3SCMD 1PYWB 4NDMB 2Z93A 1NGZA 4M7KH 4I3RL 2VWEC 1T0MA 2EZ0D 2X9WA 3HNVH 3DIFB 4Y89A 3SDCB 1CI5A 4UV7L 4OCWL 3H42L 4KAQL 5CJ8A 3P4MB 4HFWA 3WFEL 4WI8A 1X5FA 4I2XE 3WFCH 4P46A 4I18A 1JZ2A 3MACL 5IVNA 3ARDD 1T7VA 1R5VB 2B1HL 2B4CL 3G6JE 3VFOA 5DI8A 1M71B 3PQYA 4WUUB 4LPCA 3DRTA 2GCYA 1S9XA 2JCCA 2JJUA 1WK0A 5EO0B 4B50A 2C3XA 5KVGH 4OZFA 4ELKA 1ADQL 1SM3H 3MRCA 3OGOE 4G9DB 4MS8D 4X8JB 4YXLL 3VGAB 4Z7VF 2X9YA 4MCZB 4PJAB 3L3GA 1ZTXH 1JWSA 5HHOD 2LTQB 5KW9H 3MRPA 2A77L 4YHZH 1R5IA 4TULH 2EEBA 2I60H 3IDYC 4KRPB 4HKBB 2X1OA 2JTDA 3VDBA 1PFCA 1I7UA 2GUOA 2VZTA 1I85A 3FKUS 3HNSL 4AQOA 3EGSA 1QBML 1WCQA 3BDYL 5GIRB 5IMMA 1LEIA 5E2WH 2HA1A 2LAGB 4Q9RL 3D39A 4CMMB 1HHKB 3FAWA 4KXZI 4WFHD 1DVFC 3EYFB 4MQXD 2R8SL 1NJ9A 4NM4L 1XIWC 4KZDL 5EOTB 4I1NB 1QSED 3Q6FA 1FVEB 4HKJA 5FYLL 3IFPB 3LZFH 3FO9A 1N59B 4LCCB 3MLZH 4H0GA 5HI4D 2MQ0A 1SMOA 1LE5B 4POZD 4L3EA 5DEGA 2XZCL 3WIFB 2W9LA 5HHOE 4O51A 1DANU 2HTKD 4D0CA 4KDTA 2BVQB 3MV11 4NCC1 3SDXB 3WNOA 4XRCA 4U2ZA 2J6EL 4A2MA 1GPOH 4LVEA 1JUFA 4MNHA 4ONFH 4HIIB 1J5OH 4APQB 2GTZA 1UG9A 3RQ3A 1U95A 3ZLQC 4PGBA 1MCIA 3FZUD 3RPKA 1WBYB 1FFOA 4WFHE 1F97A 2ZPKH 3RIFF 3SE9L 2WAHA 3LDBB 2YSSB 1QSEE 4P5TA 3G9AB 2Z91B 1MCHA 2R2BA 1YYMH 2P48B 5D2NB 3GRWA 4MQ7A 2B39A 5FK9B 2B1AL 4P46C 4I18C 3G5XA 1JV5B 3QULB 1BQHG 1FH5H 3S4SA 3QIBB 5INCA 3F7YB 4X6DB 4Z7VE 4JKPL 3MOBH 4JG0L 4LK4A 3CXHK 3RWCA 3L3JB 4GKZB 4MDJB 3RA7H 2DI9A 1F6AB 3EJZD 1I7ZA 4MCYB 1ZHKB 3C5SA 5B39G 1IM9B 3TV3L 3RI5K 3LKRA 1D5XB 2DLFL 5I18H 2HKFH 5DQ9A 5FF6B 2DQFA 2E5EA 3MRHB 3KPMB 3DYMA 3WN5A 3UP1A 5J0BA 4FMFA 4GW4A 4E42B 2X1QA 2CDEA 4H5SA 5DYOA 5D7IB 2AJXH 1IT9L 1A21A 4J2XA 1I85C 4TSCH 5KS9B 5H35B 1KTLA 2DQUH 3EOBB 1KENH 3KYNA 6FABL 3BKCH 3VDAA 1CGSH 2JJSA 1DQJA 2H3NB 5CJXA 5TQ0H 3GMLB 4HQQL 2XFXA 1JPTH 4GRLA 5BQ7A 4G7YH 2EDXA 4Y19D 1H9VA 1WIUA 1JI1A 1IFHH 1T1WA 5CEYA 3TO4B 1QR1A 2O26U 1MQKH 1A3QA 3MYZA 3H7BA 2YUZA 1UM5H 4XB7A 1ZT4A 1NMBL 3W39B 1YEDB 1QBBA 1J86A 2VYRE 3IDIB 1EHXA 4KDTC 4ZUVB 1AE6L 3SO3C 3UBXB 5CBAA 5IJKA 2DIJA 1HNFA 3REWA 2OR9L 3TH4T 2E7BA 1WBXB 2HJLA 3V0AC 3TIEA 2XKUA 5DJ8A 4ZUTA 1WEJH 4HEPG 5T5NF 4V2BA 2XACC 3MV8D 3ZDZF 4Y0GA 3GSXB 2YC1B 2JJVA 1EGJH 3AU1A 4RFNB 4Y19E 3MLTB 4LAQH 1OD7A 3ZDXF 3TA3D 2CPCA 4P5TC 1KB5H 1RUML 1J8HD 3GSRA 2BNQB 3BZEA 2YPVL 2ATPA 5F3BB 2VLJB 4NO0B 4MA1C 4OGAC 4LSTH 3RKDC 3TBWA 1SEQH 4J6RL 3LEVH 4WHYG 3ARRA 1GGIL 4JAMB 4JQIH 4QTIH 1MFDL 4M6ML 3MRKB 4BZ2L 2VITB 1CXKA 1SJEA 5IQ7H 4HJJL 4JFEA 5ENWA 3MV8E 1BVKB 1HYRC 3LVEA 5DHYB 2I9TB 2HLAA 3FONB 4PY8I 5ACLA 3D2UA 4M93C 2A6DB 1WAAE 3ZKSD 4GKSA 3WN5C 3B2VL 1J8HE 3BN9D 3T2PA 3CDYA 1UADC 3E2HC 5C71A 3UJJL 3AUVA 4RWYL 4G6JH 4OD2A 1TVHB 4YQXL 3L3KA 5HGBB 3IDJB 4HHAB 3ZE1F 5FDWA 1XH3B 4ODXA 1E4JA 3D0VA 4HUXB 4FXGB 1MVUA 3QEQB 3SGEI 2JJSC 4OAWA 5CJXC 2QJDA 4GRLC 5BO1L 4M43H 2IANA 3WO4C 4DN4L 1Q0YH 1X5LA 3MLUL 4ZUSB 4H20H 3QNZB 5EBLB 4ZPVB 1CICD 2LQRA 2X1PA 3MQIA 1YMHB 1A6PA 4IOSD 4ZQKB 2AVGA 1KEMH 3GO1L 3OHXB 3ZDZE 1YC7A 3MFFA 4NQXA 2C3WA 4ZS6C 1A1MB 4FQCL 3ZDXE 3KLHC 5JQ6L 5IJKC 3CXHJ 3ARTA 4P5MB 4NBXB 2ZCHH 3GM8A 3OZ9H 2Q8AH 4B0MM 3QUYA 4LSRH 4XCFL 4QRPB 4S2SB 4NPYA 5JOFB 4CBPA 1H5BB 3IJSA 5DR5L 1YDPB 2R0ZL 2VAJA 5ESAB 4ERSL 5EU4A 2DQTL 3S96B 3QJHA 1QLEH 2Z8RA 3KPLA 2AJZB 4X6FA 3KPPB 5EA0H 4NYLB 4Z7WF 4XPGL 1ZT7A 3PNWB 3AFLA 4L8BB 3PUCA 1YEJH 1KLGA 4OF5A 1IEBA 3MRNA 4Z7OE 5HHNA 2NZ9D 1YUHB 3DV4B 2P8LB 3C08H 4FTVD 1AGFA 3M1BA 1J05A 4HC1L 2A74A 2H9GB 1CE6A 2C1PB 3GMQA 4OLZL 4YFEA 1BJ1H 1DFBH 1DSFL 4LLDB 3IS0X 3EYSH 3QUXC 2IF7A 4HLJA 5IIEA 8FABA 1HINH 4XBPB 3AAZB 3MXWL 3WNNA 2OTUA 1VKXB 2OYPA 4C4KO 5JIHA 3EO0B 1YPZA 4R97B 5FA4A 3SDDA 3FO1B 1GVIA 4OI9A 2CIIA 4M4RA 2A83B 1GGCH 2W0PA 1JE6A 2JK5B 3ARPA 4YHMH 4XMPL 3C8DA 5EUOA 4TTGA 2A73A 4IOFC 1T2XA 4LLYA 4TUKL 2CLZA 3BW9B 1AGCA 1H8SA 4OUUA 5EZLA 1BOYA 2NY3C 5FKPA 4OGXL 2PTVA 4JKWA 1FNSL 4FTVE 3ARZA 1XR9B 3O3EA 1TTGA 4FZ8L 4RRPG 3U0WL 5IW1B 2XPGB 2EDEA 5BRZB 3ILPB 3BGMA 1GGBL 2J3SA 1MHEA 4JREC 4K7PH 2CK2A 1BVZA 3QDMD 3O0RH 2RCSL 1MRFH 3BE1L 5IOPB 5AAWA 3QI9D 3WUWA 4ZXBB 1LILA 1FZKB 5L88L 2FO4B 3L6FB 3DI2B 5KSBB 1TVDA 5GRUH 3CAFA 2VE6B 1BF2A 2V9RA 4XGZB 1P2CA 3HUJB 5DQDH 3IDNB 3TF7C 4PRAA 1WZLA 3QUYC 4HLZH 2GFBA 2BOBA 3TJHC 4XMLH 1TZIB 3STBA 3NBNA 3T09A 4Q2ZA 2BVUA 4XNUH 1FG2B 1KJMB 2JIXD 4PBXA 4PD4K 2IGFL 3BPOC 3F5WA 5C6PB 1ZT1A 4I77L 2Q86B 1J9CT 3QDME 2ADJA 3QXUA 4NM8H 2WV3A 1LDPL 3FCTB 1U8PB 1JGUH 5FV1L 1JNLH 2JB5H 3AY4A 5EULV 5GHWH 1KN2H 3GIVA 4FQ2H 3VFSA 1ACYH 1YEEH 2ZSVB 5I2IB 5ITBH 1N8ZA 1A64A 1DE4A 5I17B 3QWRD 1S7UA 2FGWL 1HQ4A 4QOKA 4LBEA 4PJIB 5C0CD 2J6EA 1R3LB 3TEUA 2MPAH 1GOGA 4OKVB 3KPQA 4NQCA 4ETQB 5J6HA 3SDDC 2ENYA 1IM3A 2DBJA 3LCYA 3VA6A 1KCKA 5SX4I 2EKSB 3CGTA 3MRRA 4ZTPH 5FGBA 1JGEA 5D8JL 2VDNH 4LU5H 5J3HD 3KPSA 3E3QE 1JBJA 1QRNB 2R29L 1RUQH 3DXAD 3LQAL 3TBTB 2DIBA 2QR0B 3RAJH 3ULVF 2E27H 2C1OB 1C1EH 3TGXA 4DTGH 1F4WL 2VDKL 3H3KA 4ISVA 2ICWJ 5C0CE 4FQQB 2EDWA 4EI5A 3NABL 3RDTB 2EDNA 3O8XA 4RZCB 3P73B 1UKQA 4JRXA 4ZO7A 1YY8B 3FMGH 1BVLB 5IB4B 2F54B 4KMLB 4WI6A 5D1ZD 3BHBA 3ZHLA 5KG9B 2BXYA 1MI5D 1I7TB 2DJ4A 4Z7UE 1KLFA 4R90L 2HWZH 3C5ZC 4K94H 4LOUD 5MHSD 5D93C 1MIML 4QRSB 1KEGL 3DXAE 2DYPA 2MQ3A 3PHSA 1BHGA 4CAGA 5I8EA 3PWPE 3BP4A 3PHOA 1UA6H 2KDGA 1BGXL 2ITDA 2V17L 3V5DA 3JV4B 3MFGB 3H2WA 4YO0B 5FM4A 4N90D 4ZS7H 2XI9A 3ULVD 4I2XA 1DZBA 3U2SA 4CVZA 5KSAA 5IP4A 3T4AA 1AD9B 3G6JA 3O9WA 1KN4L 3AY4C 5DD6B 2NY7L 2V5TA 4YX2H 4QXUH 1AH1A 1IAIL 1KCRL 1MI5E 5CGYD 1UT9A 1YJDH 1DBMH 3QHFL 4OSUH 1UEMA 2CR6A 2V7NB 5JIIA 2NYYD 3SCMA 1I3RA 4U3XA 3MA9L 3HMXA 1XGYH 5F8QC 1DDHB 1DQLL 4XX1E 2FJGA 1EEUA 3S88L 4R2GC 5D6DC 3WIHH 3CVHH 1AQDB 4YFDB 5DEZA 2MHAA 4N90E 4JPIA 4NQSB 2F74B 3G6AB 5JPMA 2QQLH 2FSEB 3O41A 4MA7H 1JRHL 1RZ7L 1WVZA 5FGBC 4GSDL 3A6BH 5TE4L 3CFBA 3STZA 3ZKMC 3ZYIA 2ZP0T 1T0NA 1WWAX 3S35H 4M8QA 2I9LB 3BJ91 3T0DA 4XVJH 3RWHA 4JO3H 5JR1H 3PIQA 4MA3A 4X9BA 5ERWA 4YZFF 4D9RD 3AROA 3L9RA 5FUZL 4D3CH 4HIXH 5E8OB 4LARH 2P8MB 1DP0A 1DVFB 3QNXA 3W9EB 4Q9QH 5GJSL 2ORBH 4EI5C 3MNWB 1NCUA 4KK5D 2YWZA 5I15H 3O8XC 5HHOA 2PF6A 5IKCA 4P5KA 3WNMA 1F90H 1TJHH 3MRGB 4PRHB 2DTSA 3EYQC 3WE6B 4X7EC 2OSLB 2CRZA 2FIRT 3WIHA 3BD3A 1QSFA 4JHWH 4YEEA 1YNLL 3GSVB 4CU7A 5BS0A 3QIWD 3I3BA 4CUCA 2Q7YA 1TQBC 1T66C 1JNHB 3O3BB 2C7UB 2IPUG 1ZHBB 15C8H 4OD3L 5IB5B 4YXHH 2QLVB 3DX9A 1QSEA 4D9RE 3MLXL 1TITA 3L3IB 1U2CA 4IDLA 2ICCA 4R4BA 3RY4A 2DMKA 2NY1B 5EZJA 2Z93B 1WSST 3PV6A 4ZOEA 4JZJA 1CU4L 5KSAC 3CUPA 1T0MB 5F7WC 5DLMH 4Y4HD 4M9PA 1IC7L 2H2PC 3VFRA 3O9WC 4RAHA 4X4YA 3AS0A 4JCLA 4Z7VA 2VO5A 2ARJQ 4R4NC 1JYWA 2BSTA 1R3IH 2IALA 4PLJC 4I18B 2LU4A 3UROR 3O2DH 5DI8B 4YUEH 5DDHA 3SCMC 3DRTB 4LASH 3D3VB 4H26A 3QPQD 4AQ1B 1SJHB 4ELKB 4KJQD 2Y23A 4KMTH 4YHNA 1MFEL 1EZVY 3CNKA 3MRCB 2F58H 1XGUA 1EJOH 3LV3A 5JIKA 4YZFE 5E8DH 4TRPL 1LNUA 5LGJA 5C8JA 2HT4C 3L3GB 4NNYB 5FCUL 1JWSB 1RZGA 4HXAL 1BQSA 4KUZH 4B7IA 1R5IB 5L6YL 3FQTA 5IFAH 1UH3A 3B8SA 3WL9A 3HE6A 4OLWH 2GUOB 2HLFD 4GRWF 1PW3A 1YC8A 3WIIH 5IMMB 2JF1A 5CGTA 3D39B 5SWZB 1TDQA 5KOMC 4G6FB 1NJ9B 1JVKA 1Y6KR 3EAKA 3ZHDA 1S5HA 2BCKA 2H2SC 3Q6FB 3TP4A 5EZIL 5E0QA 2EO1A 3MCKA 2PTTA 4HIHA 5FKAA 2ZG2A 4HKJB 3CXDH 4AG4L 4WGVB 3TBVA 5L0QC 5F71A 3CC5A 1U8QB 3JTTA 1INEH 2VUYA 4L3EB 1FYTD 4POYA 4X6CB 4O51B 4D0CB 2OXHA 5JXAL 1PX3A 1ZWIB 3SO3B 4XRCB 5K9QG 4OLYL 2X4RA 1JUFB 3HPLB 3VI3F 1PSKL 4IRJD 4Y19A 2GTZB 3IFLH 3KHOA 5DXWA 1UB6A 1U95B 3HNTL 3WFCL 1P9MA 3FOMA 4PGBB 3T65B 4KJPD 3F7VA 3GBMH 5HDOA 1FFOB 5JW5A 3FT2A 4TNVK 2OP4H 4JZJC 4POZC 3MUZ1 4XBEH 4P5TB 2QEJA 3ABZA 3ULUF 2X42A 3TIDA 4FQJH 2DQEH 4CVUA 4MQ7B 4P2QD 4PJ8D 5DVOA 5D71L 5I1AB 4RFEA 5D5ME 1UH2A 1LD9A 3ZTJH 4J8RB 3DARA 1FZOA 4MA1B 4AEIH 4F3FA 4RMVA 3G5XB 1FYTE 1I8KB 5INCB 4RBPH 5HXMA 3FZUC 3WXWH 4Z6AT 5TF0A 2I24N 5F7EH 4O58H 1NGWA 1ZTXL 3RVWC 3FFDB 3RWCB 4S1DC 3S4SG 4LNRB 3TA3A 3EO9H 5KAQF 5HVHC 1J8HA 1FO0L 4WENB 2BNRB 3C5SB 4FQLH 4OBRA 5GSRA 3W9DB 2IG2H 4DQOL 4PJFB 4DW2H 3QZWA 5E2WL 3T04D 4GS7C 4M93B 3EJJX 4TOYL 5DQ9B 4L9DA 3DTXA 3H3BC 4PJ5D 3WN5B 3CLEL 4GW4B 1BZ9B 4FMKA 4EDXB 4H5SB 4QGTA 2XN9D 4P2QE 3DSFH 2FECI 3N1QC 4ZO6A 3ARGA 1HSBA 43CAA 1K85A 1F3JA 4GH7B 3ROOB 1NKRA 1LO3H 3HE6C 3ULUD 3JWDL 4HUNB 3BQUA 3FQUA 4RGND 1GOHA 2EYRB 4Y4FA 1Q0XH 1KTLB 3SKJL 1U3YA 4M7ZC 1WC7A 1N64H 3HZVB 1FN4A 4Y88A 1DQJB 1WTGT 2QQKL 5BQ7B 5F89A 4GRLB 3QQ4A 4YGAB 3RNKA 1N0XL 2EDHA 4LLQA 1RIHH 5GGUA 3W11D 3O6MH 1AD0A 3SKOB 1IAKA 1T1WB 1VACA 5CEYB 1LEKA 1QR1B 5HI5C 2UZIH 1G1CA 3H7BB 1CD1A 3HN3A 4WO4A 5JDJA 1I3UA 4PJ5E 5D1XD 4M7LH 2R2EA 4M4PA 4W4NA 2XN9E 2HAZA 3MOAL 5E70A 2ZG3A 3ULUE 1A4KA 3TIEB 4ZUTB 4CNIA 1P9MC 4WVRA 1CICA 1KCUH 1KB9J 4K23L 3HPJB 4EUPA 2ESVA 5HHMD 2AEPL 3AU1B 1T03L 2BVPB 2YR3A 3K8KA 3RHWK 3MOBL 4FA8A 3IYLW 3RA7L 4L4VD 5DTFA 3QEUA 3S5LA 3JV6B 2ATPB 4EZMA 5D7JA 3MCLH 2KUTA 5DMGD 4LPTA 3D6GA 4RMQA 3LKSA 5GS1A 1NGXA 3DUSA 4IOIB 3BO8A 2ZKHH 5DD3L 3OL2A 1YMMB 3KPRB 4N9GB 4KK9C 4M5ZL 2F53D 2DI7A 3TA3C 3RFZC 1SJEB 4OM0H 4JFEB 4ONHA 1A6UH 2Z35B 5EU3A 2HLAB 3BPLC 4YHLL 1FFQA 1OTSC 5DJZA 3BKCL 1CGSL 4EI6A 3VA2C 3QG6B 5LGKA 1JGVL 1MOEA 4L4VE 2FYYA 3P4OA 3I85A 5KJRH 2IADA 1MQKL 3ARGC 4FTVA 1AO7D 4OD2B 5CKGA 3L3KB 5TPWL 3BQUC 1MEXH 3QXWA 5HHPA 4Y4FC 2EH8H 3NIDF 1E6OL 4YPGA 5FDWB 1J0KA 2PCPA 3U6RA 3D0VB 5A2IH 2R0WL 1MVUB 4WHTA 3BH8A 2OZ4H 4NWUH 4OAWB 4RMRA 5AZEL 3V0WL 2F53E 3NH7H 4ALAH 3QAZC 5E4EC 2NLJA 5GGTH 3BN9C 1IAIM 1OL0A 2YN3A 1X6LA 3OKYA 5DK3A 3KYMA 5TF1H 1WEJL 35C8L 4G6AC 4JREB 4WO4C 2XV6B 2OL3L 5F9DC 3U7WH 4EJ1C 4NQXB 4Z7WA 1TCRA 2R4RL 2VZ1A 1BREA 1AO7E 5I9QC 3QDGD 3IFNL 2EDKA 2A0LD 4PJXF 3RGHA 2VDML 4HZLA 3BD4A 3QUYB 3HE7D 2HT3D 2YN5A 4UT9H 5HSFA 3OKDA 4NPYB 3QDMA 5DC0A 3DO3A 4PTUB 4XVUC 4JQIL 1FIGL 5HI3D 3LQAC 3IJSB 2MNUA 5IT2L 1RZIA 5B38G 2DWDB 5EU4B 4DKFH 3BPOB 3QJHB 3KPLB 4X6FB 4G8GD 2OZ4A 5B3JF 1RURL 5DHXB 5D7JC 1YQVL 5L9DL 3LOWA 3QR2A 1ZT7B 4KKNA 2XWJB 2RFXA 3FFCD 4NRZB 4RFOH 1Q1JH 5GGTA 1KLGB 1HKFA 5GS1C 1IEBB 4I48A 3RVUD 4HXBH 3BP5A 1Y6MR 3FT4A 3F7QA 3IU4L 4NO5A 3QDGE 3DNKA 1AGFB 3AS1A 2JIXA 1J05B 3BKYH 2ED7A 2A74B 3M1BB 5IHUH 4JM2B 4F8QA 4YDLB 3CSPA 4KKBD 5IBLD 2OR7A 4OF7A 3BMVA 4KVNH 5T3XH 1BX2B 3ULUL 3KYOA 8FABB 2B5IB 3QEGH 1B0GA 2FX9H 2VDQL 5DSCB 5HPOA 4G8GE 5FA4B 5MERA 1RV6X 3QRGH 3LH2H 4E5XB 3UJTH 3FFCE 4FHBD 7CGTA 4OZIF 2FEDC 1KEML 2A73B 3BESR 4MJ6A 1UEYA 4LLYB 4GLRI 4NKDA 5ID0B 2CLZB 2DWEA 1AGCB 3EZ8A 4PB9H 4OUUB 5EZLB 1EERB 4XNZC 5FKPB 2BSSA 4WWID 4WI5A 2BY2A 3WLBA 1V3KA 2HMID 4Y8DC 4U1LB 4LSSL 2PW1A 3O3EB 4PTTA 1CFVH 1FAIH 2NY2C 3OZ9L 5GRYA 1MCPH 1MHPL 2UWEF 4HEME 3SDAD 2XXMB 1MHEB 2ZNXA 4HT1L 4LSRL 3KXFD 3NA4A 3WUWB 5EWIH 5J9PB 2GIYA 3MLYL 4NN5C 3DXAA 4L4TD 2NY0B 4MSWA 4QHLA 3CJJA 4QTHA 1LVEA 5CLTA 1S3KL 2BRQA 5B3JE 3VMOA 1U8NA 5DT1H 1IGMH 4PRAB 2A1WL 4OCYH 4ZTOL 3QDAA 2W65B 1LGVA 2BOBB 2GFBB 2ZZUT 3I6KA 1GYAA 1DBAH 4Q2ZB 5ITFA 3KDMA 4WIQA 4WY7H 3BIKB 3C08L 3F5WB 5DVKA 2YZ8A 1T5WB 3U0PB 4LP5A 1AKJD 2K3TA 4ZO8A 1ZT1B 3FQNA 1DFBL 3KXFE 3GUTA 1MREH 1HH9A 2I5YL 2ITCB 2ZCKL 1UWEL 3L95A 1WZ1H 5HGAA 4L4TE 1YN6A 3OAUH 5T1MA 4JFDD 3VFSB 4FFWC 4DKEL 4L9LA 2QHRL 4WWKB 4LCWA 3UJIH 5HDQL 4YHML 5C0BD 1FVDB 2PYFA 1N8ZB 3BGFB 1DE4B 4OZIE 1OTTD 3QFJD 4RX4D 2XZAH 4QEGA 2RJMA 4JY4A 1AR2A 2D3VA 4R2GB 5HJ3A 4NQCB 1RJLA 4B5EA 1OM3L 1DL7H 4OCNC 5E6ID 1EK3A 4ORGB 1IM3B 3PXJA 4JRYB 3QHZL 1LP9E 2NY5L 4AJ0A 4JHBA 3NFSH 3MRRB 3BXNA 4K7PL 4HLZG 1JGEB 1A3RH 2UWEE 2OJEA 3KPSB 5KZCD 5FUOL 4P23A 3C87A 3OV6A 4X9HA 1MNUL 2AQ1A 2YOCA 2XWTA 3KPNA 4YAQA 3GGWB 1DUYA 4JFDE 3TZVB 3QQNA 1RULL 5JW4N 4XBGB 2ZJSH 5DQDL 4ISVB 2F5AH 2A9ML 4M6NL 5I1EH 5CZVL 3TT3H 2BHZA 2XTJB 4XMKH 4P2OA 4EI5B 5EN2B 3BZ4B 2QADD 3K7UA 3O8XB 5J3HC 4HCRH 3RJQB 4KU1A 3N1GC 5FYKH 4MJIB 3UO1L 3LQZA 2X4NA 1XZ0A 3EW3B 4M5YL 2MJWA 1NPUA 5C08D 3V5HB 1F4AA 3GIZH 1FQ9C 5DZNA 2D7MA 1D5IH 2QHLA 1K2DA 1B2WH 2DYPB 5EBMB 1F13A 2D0GA 4LRIA 43C9A 1JZ8A 1KN2L 4NP4H 1Y0LB 3PHOB 4FQ2L 4ZG1A 3WHE0 4OQ1A 2DMBA 1YEEL 2ITDB 3V5DB 4JY6A 4NHUA 3NOIA 2CIKA 2FL5A 2V2XB 5EZOL 3CK0L 1VFAA 1ND0B 4QT5A 4I2XB 2FHCA 3U2SB 4L8DA 4GQPH 3IDUA 3QIUD 4JM4L 4HF5H 5A1AA 1QOKA 3ZTNL 3T4AB 3QIWA 3G6JB 3O9WB 2KQNA 4LOUC 2FLBT 4P99A 5FV2A 4EIGB 1RIUH 4K7PY 4BH7A 3BVNA 5IV2A 3DUUA 1N4XL 4JVWA 5F7FA 4L9LC 4HCRA 1MJ8L 5L8KB 3P0YL 1UWGH 2FLRT 4D9LH 5EOCL 4YR6A 2G75A 3SCMB 1I3RB 3ULVC 4NOFA 1RZJH 5CAYB 4X6BA 4K71C 5E08L 2FJGB 1RUQL 4WUKH 5I8OL 4Y4HA 1PG7X 2G5BA 3B43A 1A1NA 4IHOA 4Q97A 4JPIB 2YD6A 4DTGL 2AXHA 5JPMB 1IKFH 5CGYC 4YDVB 3VH8A 5H37H 3ARDB 1CLZL 3CFBB 3SGDH 4PB0L 2NYYC 4P23C 3QO0A 4MB4A 2GTWA 3FMGL 4KJWC 1A3LH 3HLAB 1FGVL 3TWCL 3PIQB 4MA3B 1IGTA 3BH9A 1FGNH 5C09D 2FEEI 1YEFH 2WP3T 1G9ML 4K94L 3QNXB 4F7TA 3MLPA 2YMXL 3TYGH 4P2OC 5HHOB 3CVIH 5IKCB 4G3YL 3NCBB 2AV7A 4P5KB 4F58H 5MEQA 1KV3A 2DL9A 2V7HA 3FO2A 5F7LB 4GRWH 4ZS7L 2D9QB 2VXUH 5L0QB 2E8YA 4Z95H 3U1SH 3K8LA 3NA9L 2CMRH 1MFCL 5I74B 1ZS8A 1CFNA 4XTRD 1MRDH 3Q5OA 4LRIC 3IAQA 4KK5C 4YX2L 1TXKA 4QXUL 1QSEB 3O4OB 2X89D 4N8CH 1YJDL 5C09E 2R56H 3U7YL 4R4BB 4LLMA 5EZJB 2FBJH 5FAAA 4JZJB 2BMKA 3CUPB 3DWTA 4P57A 4EXPX 5DMIH 3X11A 1KGCD 1MCRA 4U0QB 3UTSD 4X4YB 4Z7VB 2FATL 3LHPH 5GRJH 2JELH 4KKAC 4KPHH 2BSTB 2IALB 3GHEL 1VPOH 4G6KH 2QQLL 1G7HA 4GG8A 5EU5A 1NLDL 4TNWF 2UY7A 3NZ8A 4NQDD 3E0GA 3ZE2F 4LPXA 5EDXA 3S35L 3VXTA 1G6RH 4H26B 4R4FL 1JMZA 4Y4HC 2HFGH 5EIIA 5HVHB 2JJWA 5JR1L 3DPBA 5T1LA 4L1HA 1OLLA 4PJ8A 1KJVA 3LV3B 4GS7B 1HHGA 4LARL 3QCUL 5LJYH 3F7RA 1LNUB 4ODVL 5LGJB 2EXYD 5C8JB 1KGCE 2OI9C 3UTSE 3WLWD 1RZGB 2GSGA 3Q0HA 1XF3B 3FQTB 1U8OA 4GRMA 3WL9B 2XQBH 3QXDB 3QPQC 5HYEA 2PR4L 3H9HA 3I2CH 1CDHA 4JHWL 4M7ZB 1BWWA 3S9DB 3VD5A 2IPTL 1U3JA 3MC0A 4NQDE 1XCTB 1ZA3A 4HWEH 4JEGB 15C8L 2OQJA 3MLSH 4ENEC 5IGXL 2BCKB 4IIQA 2XZZA 3MCKB 2PTTB 5TQ2L 1A6ZA 5IVZA 4D8PA 3PHQA 1DLHA 3CC5B 3QH3A 3HI6H 4MZ2A 4AY0A 2JE8A 4OF8A 1JPSL 5GRZA 4Q7DA 5F9JA 4G7VH 5DLML 2LU3A 2X4RB 1MIEL 2ADFL 1INDL 2R0KH 4Y19B 1HZHL 5IVXA 1UB6B 4ZFOL 1S8DA 3CH8A 3FOMB 4BFIB 4CRPA 5I1KL 1A6TB 3ISWA 4M1GL 3F7VB 4CJ0A 4XXCA 4HZAA 3WS3B 4E41D 5SWSD 1D9KA 5F9OH 3FT2B 3IFOA 4LASL 3MMEA 4OZHE 2Y6SD 3TIDB 3DBXB 1KJ3L 2CUHA 3QDJD 2FB4L 1LD9B 1FZOB 2AJVH 3WFZA 1EJOL 3DURA 4F3FB 1RAMA 4JFFD 2BP3A 3NN8B 5D9SA 3D85D 3MV8B 1ZA6A 1NGWB 3QG7L 5CSGA 3MZTA 1W8NA 3TA3B 4Z18A 1P7KA 3JUZA 2AXJA 1B3JA 4L4VA 1J8HB 4OLWL 1RHHB 3DV6A 4ODUA 5GSRB 3BPLB 1GOFA 3WIIL 4PJ8C 4E41E 5C0NC 3QZWB 5SWSE 3L5IA 4JHAL 3DTXB 3S3JA 4FABH 4IS6A 1NAKL 1CF8L 1VEOA 3ARVA 5I19L 5F9AC 1N2RA 1Q38A 4WI9A 1NGQL 1D5MA 1HSBB 3QDJE 5FB8B 1F3JB 1U92A 1UM6L 4JFFE 3FQUB 4Y2DD 3QCVH 4X8XA 5HYSG 4Z0BH 1E4XH 1FN4B 1T0PB 1EUUA 2VTFA 3VXRD 4OTXH 4XP4H 5BZDB 1M4KA 3VXUA 3QQ4B 2VUOA 4NUGH 3RNKB 5IEKA 2YA1A 4IIQC 1IAKB 3QAZB 1VACB 1LEKB 2Z4QA 5C2UB 4PJDF 1MF2H 2FX8L 1OPGL 3ZTJG 1CD1B 4WO4B 1KULA 1KYOJ 3ZDYF 3ULUC 4Z7QE 4RGNC 5C0RH 4HV8A 3EHBC 3WKMH 2R2EB 4XBEL 1X6NA 1B0RA 2ICES 3MODH 1NC2D 5F96L 3OX8B 1AXTH 4J3TA 3W11C 4HK0B 5I9QB 1ZGLA 1A4KB 3FRUA 3QUML 4NBYB 3WFHA 4FFZL 1HNGA 2XT1B 1M7IA 1CICB 2SEBA 5J4MA 4EUPB 1UWXH 3VXRE 4XXCC 2DQCL 4AL8H 1D9KC 5F7EL 5E1AA 1X4YA 5T1DL 3Q3GA 1L0YA 1CDUA 4U1KA 5DTFB 4U4BA 3LEXA 3QEUB 2Y5EA 3EO9L 1RZ8A 1K4CA 3S5LB 1NBYB 5CMAA 1AI1H 3QDGA 2IG2L 4XWOD 1J88A 4BQ9A 1V7MH 3TCLA 3ILQD 4A6YL 5C0AD 3FQWA 2Q20A 3HE7A 5GS1B 1NGXB 1L9NA 1YY9D 5JHLL 3G08A 2HRPL 4U1SA 5GZND 5JOEA 1YNTA 1AXIB 5I1IH 4QRRD 3DSFL 3AREA 4X6DF 5M7QA 3ES6A 4ONHB 5EU3B 4C57C 4TUOA 1NUFA 2NY4C 2XG4A 1AIFA 4X4XA 1NCCL 1NGYA 4AMKL 5DJ2A 5DJZB 3O2WH 1YEKL 4EI6B 3AS3A 3ZL4H 5ADOH 5TFSH 3LD8B 5TDNA 2IH1A 1CXIA 1RIHL 1BFVL 4OLVL 3BAEL 2FYYB 2BSED 3P4OB 1AQKH 1HCVA 1HKLL 1IC5L 5HDLA 2IADB 3C5JA 4XB8A 2R2HA 4FQ1H 4FTVB 1JYNA 4PJDE 1OARL 2O5ZL 5C0AE 2X4PA 2YPLD 5GZOD 5HHPB 3WMSA 4OI7A 3EOAB 4M7LL 4PJXA 4XNZB 4WHTB 3BH8B 4YDIH 5DD0H 3T0BA 4JO4H 2B2XH 4LHUA 1S7TA 4QRRE 3ESUF 4NZRH 5IBTL 2WK2A 3DJ9A 3FQXA 3R0MA 4UQ3A 1OQXA 2X09A 2NLJB 5FYJU 1LEGA 3MUHL 1MPAL 3KYMB 3UPCA 1AJ7H 1N0LA 3LKNA 1T04B 4MVBD 1RUPH 9CGTA 1RK1A 4PY7A 4OQTL 1H3GA 3P4LA 4XT1C 3C2AH 4Z7WB 2IFFH 1GRWA 1MUJA 2X4QB 4WCYH 4CMHB 2EDLA 1MCQA 3C2SA 4GXUN 5I8CA 1BEYL 3DRQA 2Y5TB 1CZ8H 4H1LA 2YPLE 1LQSR 3MCLL 4ZMAT 4HZLB 1SBSH 3NPZB 3SDAA 3RVVD 3CMOL 3KXFA 4Q9BA 3QDMB 3PABA 4NC0B 2Z8VC 1RZIB 3RWFA 3V4UL 1QBLH 4N1CA 1FPTL 5C0GA 1D6EB 4G8EA 2N56A 2VLKA 2A0LC 4JZOB 2RFXB 2E9JA 2OX5A 4JANA 3O3UN 3HE7C 2HT3C 1BFTA 5ALCH 2ENSA 4I48B 5IF0A 3FT4B 1AHWA 5HI3C 2JIXB 4KQ3L 3AREC 4X7SL 1GGTA 1CXFA 4ACPA 4IDJH 1AKJA 3EZJB 1DQDL 3WDJA 3RPIA 1DBJL 2NR6D 4KHTL 2EH8L 4H0IA 3EFDH 3KYOB 2NW3A 3VGEA 5GSVA 3VXSA 2UWEA 1E4WL 1EVUA 3QSKB 3KYKH 1A02N 2YD5A 4PYGA 3NH7L 4QXTB 3UYRH 1KNOA 4NQED 1R24A 5KVFH 4JFDA 3NIGF 3F58L 2WWMC 2C3HA 1PKOA 3VD3A 3QO1A 4F15C 2MTPA 1KELH 4KKBC 4MJ6B 1ORSA 1I1RA 3KPTA 4PLKD 1UJTA 5C0BA 3A6CH 5IESH 4UILH 4NKDB 4R26L 3O6KH 3U7WL 3QFJA 1TZHA 4Y4KD 4DCQA 4Y1AA 5C0CB 3QNYB 1VGEH 3IETB 5DVNA 3P11H 4PTTB 1YEGL 5E6IA 2VXVL 2G2RA 4P3CH 2HKHH 3PWNB 4UQ2A 4H8WL 4JPKH 4Z7UB 5F7HA 3VD4A 5K33A 4ZNEE 5L7XH 2BRRL 5D2LF 1I8MA 3MRDB 4NQEE 3TCXA 3DXAB 1H3VA 1C12A 4MSWB 3MX0A 2FHFA 4QHLB 3MRLA 2HMIC 2CXGA 4G8IA 1ES0B 1U8MA 2YD1A 1U8NB 1IZJA 3SDAC 1U6AH 3I6KB 1X5JA 3P3YA 3F7PC 5ITFB 2DQDL 3KDMB 3DX7B 1IEAA 4QNPE 4FQIL 2A2QT 2RB8A 3GKWL 3V79C 3QCTL 1AY1L 4KVNL 1CIDA 1HH9B 3IJHA 5IFHH 4LGSB 1BBDH 4DN3H 5C08A 3L95B 3IVKA 3QEGL 5HGAB 1EVTC 4PGEA 1LE9A 4XP5L 1YN6B 5T1MB 3NACL 4OD1H 1AHWC 1NGPH 2AK1L 4YBLC 5DZLA 1KPVA 3MJ8A 4L9LB 1GHFL 3CDGA 2DBLL 2IFGA 4XPBH 2AV1B 3NIGE 3VXME 3FOLA 2GSIA 5GGSA 4DOHE 1HK6A 1OAZL 3DVGA 3L3OA 4JY4B 3BD5A 2DQIL 5T3ZD 5HJ3B 3GJFH 1RJLB 5A16A 1OAXL 1DUZA 3FB7A 1TNNA 1BAFL 3ARXA 1U8KA 1CG9A 1DN2A 1KJ2A 1Q72L 3FO0H 5C07D 4RGOL 5AD0A 3BXNB 1QVOB 3TVMD 5D72H 3OJDB 2OJEB 4KKCD 1MSPA 4K2UL 4P23B 1OTTC 5DRWB 1C5DA 4Z8FL 2GJZA 3C6SA 3KPNB 4P3DB 4YAQB 1DUYB 2AXFA 4KMQA 1SJXA 4MNGA 4NFDA 4ONGH 1MH5A 1NCBH 3IRPX 4UOW1 5E6IC 4AM0A 1JHLH 1H3PH 3W5NA 1OD9A 4RSVA 3F12B 1O5DT 4K9EL 4OFDA 2XIDA 4P2OB 3V95A 5T3ZE 2OS7A 1EIBA 4KXZH 5GGVL 1HYSD 2VLLA 4QHKI 1RUAL 2IWGA 4WY7L 1T20A 1WZMA 1FO0B 1PGRB 3BRGC 5C07E 3LQZB 4P9HC 1RZKC 3CFJA 1IAII 1XZ0B 3K74B 2DOCA 3GJFA 4OFPA 2X4TA 1G7MA 5J13B 5IJVB 4J23A 2F15A 1MWAH 3HUJF 5H94A 1W0WA 2BSRA 1K2DB 4N8VA 2Z8WC 3MXVL 43C9B 3EJYC 1B6UA 3OAUL 4TSAH 5FM8A 4NO2A 2BFVL 5EO1B 2FL5B 1EO8H 3FN9A 4QT5B 4JKLA 1A4JA 4L8DB 2P47B 3VG0L 1JRHI 3S98A 1FNHA 3NIFF 1CD0A 4RA3A 4AEEA 1SJVA 1BQLH 3AB0C 1HQRA 3OXSA 3QIWB 4PRIE 4JDTL 5I8KH 4O2CA 1DL7L 3ROLA 1A9EA 1UB5B 4NZUH 5DGRA 3P9WB 4BH7B 3BVNB 2YD3A 5IV2B 1FZMB 5CLWA 1CN4A 3NFSL 1PVHA 5FO9B 1I1FB 2B7DT 4Z0XA 4GT7A 1WCBA 4PV9B 4ZAKD 4YR6B 2G75B 5FGRA 1Z0MA 4J3VA 3HC3L 4X6BB 1B90A 4YBQD 2ARJA 5F8RC 2HH0H 4Y4HB 5JW4R 3T0AA 2APVA 1A1NB 3V6ZA 2DQGH 2B20A 4LAJH 4U33A 1WFUA 4IHOB 2AI0L 1MWAA 1G7PB 1SVCP 3IDGA 3STLA 3N85L 3VH8B 2QBWA 1NANI 4M7JH 2RAMA 5I1EL 2DTML 1FFPB 1OAQL 5KOVC 5HVWA 4LSUH 5LXGH 3QO0B 4NQDA 5C0DB 1OSZB 1UZ6E 2GTWB 2HT2D 4G8FA 4YHOH 4OB5H 4PRPD 1UZ8B 1IGTB 3BH9B 4A6YA 3T3PE 5BV7H 5IK3A 3OKMA 4NUJB 5GS0D 2D0FA 3ET9F 5IMLA 1NC4A 5BVPH 3RX7A 2AV7B 5MEQB 4NP4L 5KVEH 1KCLA 3F62A 3CU7A 4PJ7E 4WEBH 2PO6A 5DRZA 4ZFGL 4NRXA 1DR9A 1ZS8B 1P7HL 3NIFE 5JTWA 3Q1SH 2GJ6A 4YDJA 5I75B 3OF6D 1EEQA 2XWBA 4K3HA 2MCPH 1SYSA 1UWGL 1JF5A 3BP6A 5D5MB 5H37G 2BMKB 1RZJL 3HTLX 1KF9B 4XPTH 1G9EA 1UENA 4XTRC 5HBBA 2AK4D 3GSOA 5T3ZL 3SOBH 1LK2B 4H88L 2UUDH 4BSVA 3OKOA 3OPZH 2OL3B 1G7HB 3TNNB 8CGTA 1EHLH 4GG8B 1IKFL 4OQTA 5EU5B 5FA3A 1NEUA 1HOCA 4O4YL 1NKOA 3NZ8B 1MQ8A 4E41A 2R2CA 5BXFB 4GRWB 4HGKC 3VXTB 4JPVL 4OKDA 1P6AB 4OF3A 4UTBL 5ID1A 1UACH 2EH7H 4C59B 1J18A 5TDOB 4PJ8B 3MLWH 3V0VA 1DLFL 1P1ZA 1VFBA 1HHGB 1TPXC 2VDLL 3D85A 3HMWH 1NDGA 1WF5A 2VLRD 3VMNA 3MBED 3RZCA 1Q8MA 5L2JA 2AK4E 5MI0C 4G9FA 1U8OB 1CD9B 4GRMB 3S36H 3U46A 2XA8L 1CR9L 5EU6D 4G6ML 1CK0L 3PP4L 5MEOA 2VXUL 5DD5H 1K8IB 1KIUA 3H9HB 1M05A 3LKOA 4PJGF 3U1SL 5DUMH 4QHNB 3PWUA 5CCKH 1ZA3B 4GQ9L 1MRDL 5ETUA 4PJ5B 2EXYC 4UDUA 3SGEH 3WDIA 4IIQB 3P9LA 1PY9A 2AEQH 1RVFL 1A6ZB 2XN9B 5DK2A 5CZXD 3VG9C 4D8PB 1OP9A 1PYWA 1NLBL 5HTSA 1DLHB 4RGNB 5HGDB 1TQCC 2PO6C 1J1OH 5ILTH 4GXVH 5F9JB 3B5HA 2VLRE 1ZANH 5DD1L 3P30L 5EU6E 4W6XB 3CZFA 1CBVL 1P4BH 5DUBA 1VPOL 4G6KL 3FT3A 3KLAB 3TN0D 4AZ8A 1M71A 4P2RD 5CD5D 4L4JA 5B3NA 3IFOB 4YK4C 3KS0H 3MMEB 3V8OA 1D5ZB 1XCQA 4HWNA 4LDOB 3T08A 1A6VH 5ICXA 3WJLA 1NC2A 3LS5H 4LVHC 3L3DB 4OFYD 4E0RB 5F21B 5EBGA 1CFSA 1HCFX 2X4SA 3B5GA 3D0LB 3S37X 4TVSa 2R0LH 4LNVA 4U6YA 3DHJA 5HHMB 1IGFL 5CEZH 2R1XA 1A7PL 1LO5A 3LRSA 1P7KB 5EOQH 4L4VB 3DV6B 4ODUB 2C4FT 5GIRA 1JGLH 2NY4B 2D7OA 5TE7H 4P2RE 1EA9C 5D1QD 4CMMA 2W59A 3EYFA 5MP6L 5C0AA 1IAMA 4IS6B 5KVMC 4AIZA 1LK3H 5GS0L 3RZCC 3BT2H 3MLRL 2B0SH 1D5MB 3IFPA 1HSAA 1KCVH 1U92B 4LCCA 1EV2E 2CQVA 2F53B 1VERA 1OTUD 4I4WA 3WFBL 3H0TA 3HI6L 4AENA 1J8KA 2VERN 5EOCJ 1UCBL 4HGMA 3SDXA 5BJTA 1OCWH 4U05A 3VXUB 2L7UA 1QR4A 5IEKB 4MZ3A 4HIIA 4APQA 2ZCLH 2Z4QB 4ODSL 4FN0A 4LCIL 1F11A 3B9DA 4QXWA 4OCSL 2XRAH 5JZ7C 1ZE3C 2Y06H 4Q9CA 2YPLA 3FB6A 5A2KH 4HV8B 1HXMA 1C8PA 4KUCD 5CUSH 5BMFL 4JGUA 1JPFA 1E0OB 3SDYL 4TPRH 1XF4A 5JDSB 1VDGA 4X6CF 1ZGLB 3WFHB 3FRUB 1II4E 1GAFH 3QULA 2AJVL 2SEBB 1MLCA 4UTAH 1E6JH 1FNGB 4X6DA 2ZWLT 1I1AD 5E2UH 5E1AB 3DHMA 3MGOA 2K9UA 4PP1D 2WIMA 3Q3GB 3L3JA 4GKZA 2F8VA 3V4VH 5HPMA 4TN9A 3SQBA 1AR1C 1RZ8B 3WJJA 3WJLC 4AT6A 1U36A 5I6XC 3QWQB 3GJFK 3QDGB 1EFXD 1U8JA 3TCLB 5FF6A 3MRHA 3FQWB 3MREA 2AS5M 4H8WC 4CVXB 3I6GA 1C5CH 1D6VH 1UM4L 3HE7B 1NMCB 2EC8A 4AYFA 4E42A 3G08B 4U1SB 2VH5L 3X17A 4JGJA 2BVEA 5L8JB 4KRPC 4YWGL 1L7IL 4KJYA 2Q8BH 3ES6B 2PNDA 1X5HA 2VZUA 4FQHA 4HBCL 5LWYL 4S1QH 3T2NH 3GI9H 2EDDA 3EOBA 3FJTA 3QCVL 4X4XB 5DJ2B 3DSNA 2ADIA 3OSKA 3L5XL 3ILQC 3GMLA 4OTXL 4XI5C 4X7TA 5TDNB 2IH1B 4ELMF 2GT9B 4PJFF 1YY9C 4UT6L 5I30L 3TO4A 5GZNC 1JNNH 4UT7H 3C5JB 1F6FB 1QNZH 2R2HB 4LCCC 1FRGH 4QO1A 2GY5A 3W39A 1Z3GL 2IBZY 1YEDA 1A7RH 1DEEB 4GO6B 5SX4H 5FHAL 3LB6D 1T7WA 4PJXB 4YIQA 5ANME 4WV1A 4LHUB 1VB9A 1MRCH 1S7TB 3MODL 4K7FA 3H7LA 3FQXB 4NZTH 4U6VL 3OB0H 4APQC 4UQ3B 4GAJH 1LEGB 5GS2D 2FGZA 1NH6A 5C1MB 4NQEA 3DGGA 2YC1A 3BIBX 4F80A 1RK1B 1H3WM 4PY7B 4AL8L 3LEYH 4XNYH 3HI5L 1JI2A 1MUJB 1YYLL 5EIQA 5I8CB 1G7JA 2M1KA 2P43B 2XKSA 5GISH 5F3BA 3FRPA 4H1LB 1AI1L 3VFWB 4NSKA 2A6JA 1X4XA 3WFDH 4LSQL 3UTZB 5DFTA 3WHXA 1PG7H 3SDAB 5F1IA 4O5LH 7FABH 3KXFB 3BOVA 3GNMH 3PABB 4HD9A 4P9ML 2CDGA 2J4WH 1SEBA 3W0WD 1PLGL 2ZOKB 2BDNH 1OGAD 3WJJC 4S1RH 4L4TB 4ZSOA 5C0GB 2YPKA 4I13B 2DQHH 2VLKB 2WINA 1S7WB 2VSCA 4K9EC 2Y9RT 4YE4H 5ADOL 4KROD 3RVVC 4OZIB 1S78D 5IF0B 4TNWK 4DFHA 4ELME 3QA3B 1AHWB 4WFFD</