1NFIB

I-kappa-b-alpha/nf-kappa-b complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
SNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (transcription reg/ank repeat)
molecule keywords NF-KAPPA-B P65
publication title Structure of an IkappaBalpha/NF-kappaB complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 107
sequence length 107
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfiB00
1R0AH 3P3YA 5AZ2L 3KPQA 3HZYB 1N5AA 1QBLH 1G9ML 4C59B 5GGSY 4KFZC 4R90L 3GJFK 4TYUA 2HWZH 4KK9C 5A16A 3QUYA 5DYOB 2X7LB 3OR7B 5FUZL 1NJ9B 4Q7DA 4KRMB 5MP6L 2GTWB 3PWPA 5C08E 3VXSA 1SMAA 1N0LA 4IIQC 5FK9A 1T6WA 3LRSA 1P53A 5KSAD 4JVPA 1KCVH 2J1KA 1JHTA 1E4XI 3VD4A 1IGIH 1H5BB 3FCTA 4G8EB 4PS4L 3C5ZB 1U92B 2E8YA 3HNVL 2F19L 5DEGA 3WO3B 5LGJB 4KMTL 2FX9H 2HJFA 3P30H 4NKDB 4F57H 4RWYL 5SWQA 4Z77A 1AI1L 1P4IL 5I1EH 1T0NB 2Y5TA 4RZCB 4EXKA 4YO0A 4MWFB 5GGRY 4OZIA 4HS6B 5B4MD 2C1OA 5DRZB 1BQHG 4F7EA 1MCPL 4K7FB 5LGHL 4M7KH 4PY7B 3H9HA 4LRIA 3VXSE 3WCYA 3BHBB 1RZIA 5IQ9A 3NFNB 2AKRA 4LVNC 1RHHB 2XA3A 3FN0H 4RGOL 3NA9H 4YHZL 4HWBA 5HPMB 1Z5LA 3V5DA 1FGVL 2HN7A 4KJQC 2NX5B 4MQXC 2ZG1A 4V2CB 5HGGS 1UA6L 3IJSB 4F15C 4UDUA 1RAMA 5D4QA 5T1KD 4GG6A 4NZJA 3S37L 4OZIE 5IMOB 3D0VB 4GS7B 3X12A 1AY1L 1VFBA 1RK0B 3L3HB 3SDXB 5FFLA 1JGLL 3V8OA 5EU3B 4U0RC 4MAYA 2F53A 5CEYB 2C3VB 5FIEA 2VR4A 4XVJH 4U0QB 2YZ1A 2VR9A 4HK0B 2PXYA 2N7BA 3L5JA 3STZA 1RUQH 5ESVB 4ZTOL 1AQDA 3CLFH 2PTTA 3LDBB 4KUZL 4PJFA 5AAMA 4GAJH 1IBGH 5K59F 3HG1D 5KVDL 1ERNA 1DEEB 1K8IA 1UZ6E 1S8DB 4RISH 4HIEB 4AQOA 5D1XD 5ESAA 3UYPA 3VWJC 4F15B 4E42A 4H0GA 1S7VA 4YK4B 1O7VA 4NCC2 3PQYB 1YY8B 4UTAL 3WXVH 4JFZL 2APXA 3RPIB 4AIZA 3WNOA 1T0PB 2D7MA 2QV2A 5I76B 5DDHB 1BQHA 3U2SB 1F42A 4XRCB 3HR5A 4TULL 3EOAB 2FB4H 4OFVA 1QEWB 2X10A 3BQUD 4RMSA 5CP3A 4X6CF 4LHUD 5GXBB 1IGFL 2YD6A 1L0XA 2XQYK 1JWUB 4OUUB 4PJFE 4PPTA 1IC4H 1EFXB 1JF1B 1P9MC 2GJJA 1ZA6B 4AH2B 3PG2A 1EO8L 1P7QA 4NQDA 4XMKL 3BIKA 1CLYH 3FO9A 3HFMH 1G1YA 3OJMB 2F5BH 2EDHA 2VL5A 1EK3A 2OTUA 1YNLH 5B39G 3L7FB 4D3CH 4YBLC 1IM9A 4TVPD 3R06B 4FQJH 3SDCA 1EO7A 1S7UA 2ILLA 4POUB 2IBGA 1KIUA 1PQZA 1G7MB 4LLUB 4YHNA 3RBSA 3ZDZE 4L8CB 4IOFD 3VWJB 3MGTA 4ZDHA 2FSEA 3V0WL 4U1GB 1DQLH 1O7SA 3IF1A 2C1PB 4LLDB 1GZPA 1DE4B 2HT3D 5EULV 2R0KL 3D3VD 2EDYA 3ULUD 1JGDB 4MXWH 4XP9L 1CFQA 3QIBA 3GM8A 5F93C 1AD0A 2E6JA 1XEDA 3EJZD 2AEQH 5E03A 3KGRA 4LSQL 4XWGL 3SGKC 1QSZA 1G9NL 2H2SD 1R24B 1FPTL 2M26A 4ONGH 1RUPL 4I13B 2VJXA 5I19H 3VXRA 5J0BA 4F9PA 3D18B 1H8SA 1M1SA 1XFPA 1RK1A 3KG5A 2CIKA 1JP5A 2RR3A 4L4VD 1AGFA 4HW6A 1S7SB 1K4DA 2G75B 1N3NA 4YBLB 3MCLL 3U7WH 2E9BA 2WQ8A 2Z31B 5FB8A 4JFHE 4JVUA 3K1DA 1MQKH 3JTTA 1EEZA 1D9KC 2W91A 3HPJB 4MX7B 1V05A 5GGUA 3B6SB 5GZOD 4ODBD 4NNPH 3NCCB 4NQEE 3RWFB 1IFHL 3U0TA 4Q0XL 2W38A 4PJHA 5HHNA 4DKFH 5BO1H 1MJJB 3VXRE 2FJFB 4ZS6C 5BRZD 2WBWB 3U0WH 1BQUA 3U0PB 4HQQL 2R1XA 4MYWB 1MFDL 1BWMA 3DVNB 4QCIB 5BV7H 2BSTA 2WW8A 5DD3L 5CZKA 1JPFA 5B39A 2BY1A 1IAOA 4Z5RA 4EI6A 3DV6B 4JN1H 1JYWA 1QFHA 4Q9CA 4WY7L 1RUKL 4KK6D 4MA1B 4X5XA 3CK0H 5F71A 3STLA 2DYPD 3QHTC 2BRRH 5DD5L 3TBSB 3BZEA 4O4YH 4JPIB 4PJHE 4ZPTA 4YUEL 5EOCJ 4ZS7H 1D9KB 3WJJA 2NY0D 1F8TL 2V5RA 1NFIA 4HS3B 2MPAH 4ORZC 3L5HA 4X8JA 3B9VA 2VDOL 4XMLL 3T65B 2EEDA 4LQFH 1I7RA 1MIML 4R0LC 1WC7A 1FNFA 1RUML 3QEQA 2D7TL 2QSTA 3QXWA 4U6VH 1LD9B 4GT7A 4HUUA 1JV5A 5B8CA 3BKJL 4GRWB 1SY6A 1CE1H 1OVZA 2R2HB 1JYXA 4U1KB 1XF3B 3ARBD 5AZ2H 4K8RD 2PYEA 1YY9D 4B7IA 4XPGH 1W0WB 2Z92A 3V8CA 3BW9B 3TNNA 5ACZA 4R90H 3CPLB 4MCYB 4R3SB 4XWOD 3RWCA 4GRLD 5GSVA 3N1FC 3OMZA 2A1WL 3RWDA 2CDFB 4PR5A 4MJ6B 4R4FH 4HUWB 1IRAY 2YRLA 4Z7UF 3QRFM 4HAFA 3RX5A 3O81A 3VFVA 4M61B 3S4SG 3QEQE 3CCHB 3PL6D 3G04B 1TQCB 4K3EL 4PS4H 3SJVE 3ILQC 1YEKH 2QADD 3V0VB 2F19H 3ARDC 2FHCA 2PYEE 3IFNH 2MNUA 4KMTH 4OZGB 3PIQB 3NOIA 4PRDA 2O5XL 3O3UN 1AI1H 5C92A 1CR9H 1A21A 1FAKT 3QH3A 1ZLSL 3KYNA 4D9QE 1MCPH 3SE3A 4TSAL 2ADJB 1HILB 4DEPC 2H32B 4X7SL 3VU2A 5T5NG 4LLYA 5CGYD 3TO2A 1EX0A 2NY7H 4QXTA 1R5WA 1TCRA 1J1XL 2P7TB 3DYPA 1JHKH 1CK0L 2BVYA 4HV8B 4RGOH 5EOQL 4YAQA 1MH5B 3CLEL 1I9IL 2D31B 3RU8L 1FGVH 2ARJQ 2P5WD 3NIGE 3CDYA 1LILA 4DUXA 1X4XA 3TBWB 2BNUA 3LN4A 3C5JA 4UNVA 5T3ZD 3QRGL 4NOFA 4V2BA 1T7VA 4Y16A 1NC2A 1CGSH 3MOAL 1LO0L 3MRJA 3S37H 3O8XC 3DECA 5C0IB 3BT2H 3AGVA 3L7EA 4U33A 1NEZA 2GIYA 3IU3B 3ARDB 4I2XA 5E99L 1FIEA 3I3DA 3IDUA 1YA5A 2XV6B 5CHNB 4P2QD 5ENWB 2R2BA 4XP6H 4DEPB 5J7CC 1CICA 4WW1A 3LKSB 1GXEA 4PTTB 3N0PB 4RGNE 1RZKH 4ZTOH 3HZVB 5J06A 2DTSA 4ZYKA 5IB1A 4OD2B 4KUZH 4YHYB 4R96B 3LS5L 3TBTB 3S4SA 3RDTC 5KVDH 5HGAA 4Z7NE 2HVKA 2I5YL 2XACC 4I2XE 1TVHB 1FC2D 1OTUC 4L8SA 1A4KA 1JGUH 4U1SB 1GGBL 1ZSDA 3S5LB 5IEHB 2OS7A 4UTAH 3L9RA 3UO1L 4DK3A 1DQML 1Q0XH 2PYFA 3E3QE 4KZEL 1QUNA 4TRPL 3SDAA 2KPNA 3LPWA 1QACA 4WFFD 3V79C 1JZ2A 4ONFL 4TULH 2AXFA 1CFTA 2M1KA 4JG1L 4Z7VF 5T3XL 2NYYD 2FX7H 3VXMB 3QT2A 4U6HB 1ACYL 5HYJB 3MYJB 1IGFH 3VFGL 1U8MB 2FEDC 1YMMD 1DN0B 3CX5K 2I07B 1WWBX 1EO8H 3UTZB 3UBXB 5KW9H 5E8DL 4DZBA 3MCKB 1CBVL 4N8VA 3X13A 3E6FA 3V6FA 1TZHA 4OF0A 4MJ5A 3QZWA 4CW1A 2COQA 4EQ3A 4G43A 3FAXA 5FM8A 1MFAL 4N0YL 4CDHA 2YA1A 2FGWL 1IAIM 1M7IA 1U58B 2YC1B 4Z7QE 1XGUA 5KG9B 3ZE1E 3T3ME 3PP4L 1NKRA 4OIAA 2ADIB 4LIQE 2A6IB 3V0WH 3MLVL 4Y4FD 1T2QL 3ROOB 3A6CL 2EIEA 3MBED 3QI9C 4EQ2A 2WBJB 2R0KH 2EZ0D 3HTLX 1NAMA 1QBMH 1J1OL 4XP9H 1YN6A 3P77B 4M48H 4LCCA 4YPGA 2ZOKB 4LSQH 4XWGH 4PBVC 4P9HC 5L6YL 5I73C 4JM4H 3OKDA 2EDDA 1RIUH 5E2WL 4NGHL 4WI7A 4ISVA 2XG5A 2VLKD 4YDVA 3MRDB 3Q5TA 4UOJA 3GRWA 3FT4A 2V2XB 3ZYIA 2OTWA 3NZHH 3BRFA 1QZ1A 1A2YA 3T8XB 4JKPL 4HUXA 5SWSE 1MVUA 2K7PA 3S34H 3PHOA 4R26H 3X14A 3MV8E 5ERWB 1U93A 2DLFL 3RPKA 2NW3B 1UJ3A 5A3ID 3GMLB 3ZKMD 5F1SA 1AGEB 5F44A 1TLKA 8FABB 5IVXB 1CWVA 2V7NB 2Y1VA 5BJTA 2D03L 2P42B 2XPGB 2OZ4A 5CP7A 1MWAA 1P4LA 1Y18B 1VADA 1IFHH 4OQTH 4Q0XH 3CXDH 2SEBA 5F96L 1CGUA 1LVEA 3QEUA 4PREB 2WP3T 3RL1A 5LQBH 4C57C 1E6JL 1WAAF 4ZQKB 4OD3L 3O6LL 5I73B 1MCOL 4L4TA 3WL9A 3SKOB 4MMZC 2ICEB 4U3CA 1GC1L 4DN4L 2XN9D 3IVKB 1FGNL 4WTZG 5FYJE 2PO6D 3H9SE 3G9VA 3MRIB 5JOFB 5FOBA 3ULVF 4WY7H 1RUKH 4WI8A 5IHZA 5GIRA 3LB6D 2FHFA 5JMRA 1RJZB 43C9B 1TNMA 2EC8A 1WCBB 2APWA 4G6FD 4PJ9C 3FO1A 1ORSA 4LCYB 1FZOB 1G6VK 3MQIA 3BGAA 4WWID 3UAJC 1F8TH 4FXGB 4LSUH 5I30L 5DD1L 2VKWA 2BVOB 3QQ3B 4PLOB 2VDOH 4L4TE 4XMLH 2FL5B 1MIMH 5E56A 2B1AH 1K5NA 2LAAA 3BKJH 2PCPB 3P4MB 4WTXA 3K4DA 2FECL 4NP4H 1Q0YH 2PR4L 4HJGA 3KPNB 2AXHA 5ISZA 3ET9F 3P40A 2NR6D 2A1WH 4JFFA 2VXSL 2CUHA 3VXTA 2E9JA 1XR9B 2B39A 1NEUA 1OGAB 4NQSA 2JF1A 4ZOAA 1ONQA 3PWVB 3E1F1 1XZ0A 1FJ1A 2IJ0C 3DROB 1L6ZA 3IDIA 4XNQA 4ODXB 3UTPD 2AS5M 1EUTA 4X6EA 4FXLA 4XNUH 3QFJA 4YXLL 4H5SA 4K3EH 1ZWIB 3RVTC 3MUJA 4L5FL 1N7ML 3F5WB 4UV7L 3PWJA 1EEYA 4OCXL 1KACB 5A40E 1FFRA 5F7EL 3SDDB 3IXTA 1AD9B 4N9GB 3I6GA 4NJ9H 5DA0B 3UDWC 3H3PL 5ALBL 4KRPD 4L3CB 4EUPG 1XGQB 3ARYA 3WS6A 4JFFE 4TSAH 1WK0A 1ZGLB 1S9WB 2VITB 3QCTL 1CXFA 4YXKH 3B3IB 1U8NB 2WSKA 4EDWL 4OLYL 3ES6B 4MNQA 5M7QA 2AK1L 2BZDA 1J1XH 4W4OA 1NGWB 3IKCB 3MREB 1CK0H 1HHHB 4QRPD 3CZJA 3QFJE 5EOQH 4HWNA 3VA6A 4P5TD 5D5MB 1FVCA 1QFWL 3CLEH 3RU8H 4GG8A 2I9LB 5EBWA 4F7PA 2OCFD 1HWHB 4KK8C 4FQHB 1WBXB 4RAVB 1T7WA 4NUGL 3LEVL 3MNVA 4PGCB 3QRGH 1I85C 4PP2A 4PRPD 5DHYA 5CBAB 4BA8A 4YBHA 3MOAH 4V1DB 1EGJA 1AGDB 5F3HA 5E99H 2H9GB 5ALCL 3KXFD 5D71L 2DQCH 1F6AB 1FCGA 1YQ2A 4NQVA 3X3FL 1WITA 3CGTA 4M00A 3FQRB 4YWGL 5IUSA 4JDTH 4ODHL 4F9LA 3ULUF 4UU9B 2AJYL 1FN4B 4CVUA 4WO4D 1DVFA 3FB5A 3RVXC 3QUMB 1MI5A 5F70A 1AP2B 1NFDE 2WLZA 4YBQD 1FV1B 1H3VA 1T7ZA 4XGZB 3BKCL 5IBLD 3LS5H 1X5JA 1QSEE 1ZHNA 4Q2ZA 4TQEL 5I17B 1YYLH 4CRPA 4QHNA 1C7SA 1OSPL 2BVPA 1KENL 4KKLD 5JQ6L 2A0LC 2JK5A 3O6FC 1BLNA 2GQHA 3WKNA 2GFBA 1KULA 1DQMH 4J12A 4KZEH 4TRPH 2D0FA 3VFTA 4EUPA 1YJDH 1P2CB 1X4YA 5DQ9A 3LQAL 5BW7A 3L3JA 4MA7L 1A7RL 3O2DA 1T5XB 5F6HJ 4JG1H 2C4FU 5IG7B 4LMQI 4PYHA 3QDME 1ACYH 1PSKH 2VUYA 1D5BB 3G5ZA 2IFFL 2PW2B 3VFGH 5AG8A 2VLRB 2XZZA 3DJ9A 4QT5A 1ZS8B 4X4YA 1T83C 1TTGA 1BOYA 5JOPE 2BRQA 4IRSA 3HHRB 4ERSL 5I8KH 1R6VA 3OKLB 1CBVH 4GW1A 3I6KB 1QSFD 4ZG1A 1XGTA 2AGJL 5TPWL 2WQRA 5C0RL 5D93C 4QNPF 3MX0A 4L3AA 3VRLE 4QRQA 5D96B 5D7SL 2V2TB 2Z35A 2ZUXA 3L5WB 5ITBL 4Z7WA 2CIIB 3PP4H 4FTVD 4W6XB 3DVGA 5B3JE 3MLVH 1T2QH 3PWUA 3ZTJG 4HKXB 2JJUA 3MOQA 3V95A 1AR1C 5K9OB 4X6BB 5HHOD 3U4EA 5DVOA 3DPBA 2ZUUA 1Q9OB 2ZSVA 3D85B 1QR1A 3AY4C 2JJVA 2YA0A 1I7ZB 5E2WH 3QDJB 1LHZA 2KL6A 3CAFA 4P5MA 25C8H 4PV9A 3BO8B 2J6EA 4PB9L 4JQVC 3BDXA 4NO0D 4L1HA 1VGKA 4M6OL 4I0CC 1J7VR 2JIXD 4XPAH 3VXUA 4Z7WE 2R4RL 4OF3A 4Z6AT 3CIQA 1FO0L 4HKZB 3MLXL 4ZUUA 5IM7A 2UYLA 3TESA 2HLFD 2DLFH 3NN8B 3O4LB 5J3HC 5TDNB 5F9OL 3RGVD 3E6HB 1NMCB 2OSLA 1JPGA 3RWHA 5IK3A 4P57B 4TSCL 2R39A 2HFGL 2BNRB 2OMNA 2D03H 1RUAH 1CXIA 4JG0L 3BPOC 2PTVA 1CU4L 4IDLA 2C5DC 4Y5VB 1PZUB 4MSWA 1E6JH 3VXUE 4OD3H 3RZCC 5I8EB 1MCOH 1CF8L 3PUCA 2B1HL 1YMHB 4YNYA 3ZHLA 3MYZA 1GC1H 4MQSB 4XP1L 4EN3C 2BNQA 3OXSA 5EZJA 4ZFOL 5HYIA 4M5YL 5FM5O 1FGNH 1VSCA 5EBGA 4HFWA 4PRHD 5IJKC 4Z7UB 3VFSB 4IJ3C 5AUMA 3QIUD 4GKZA 3REVB 1S7RA 2C4FT 3EYOB 4RA3A 2OM5A 5D7JD 2OMBA 3BP5B 5TE4L 2CLVB 4QEGA 3C6LC 2VWEC 1MHEB 4OUOA 5E2VL 1JMXA 2B7DT 1ZHBA 3QDGD 5I30H 5CS7A 3GUTA 1T04B 4BZ2H 5FUCC 2DL2A 4XAWL 4K2UL 1MFNA 3ZE2F 2BNQE 4LPTA 1G7LB 1S7TA 4I4WB 4PJAB 3MRRB 3ARFA 2PR4H 4HUMB 4DK6A 1MHCB 5IB3B 3DUHA 1FZMB 5EFIB 4ELMB 3OB0H 4QTHB 1UCBL 4XNMB 1HYSD 2VXSH 1BIIA 5FGCB 3OL2A 3T0ED 3MUY1 5DHXB 2O5YL 4PLKC 4LARH 3IXAB 1OB1B 2IADB 2Z93B 3HCVB 3W0WD 4XB8A 1T7XA 3CFBA 5MI0B 1FL5B 5JDJA 4YXLH 1T1WA 2Q8AH 4RFEB 4BSWA 4PD4K 1Q9KB 1N7MH 2D7PA 3G9AB 5CJOL 2NCMA 5F7EH 1C5CH 5C1MB 4H8WC 2OL3L 4HIHA 3KPRD 2J5LC 3RUGF 5ALBH 5DD0H 4LPXA 2HRLA 1IC1A 3S36L 5JPNB 1XMWA 1DBAL 2X4SA 3QCTH 3BRGC 1TJHH 4JCLA 5J9PA 4E5XB 3FO2B 2NLJA 4N8CL 3WO4C 4TNVK 4FQLL 1A02N 4OLYH 4ODUA 2AK1H 4RFOL 4LRNL 3ARGC 2HFFB 3NZ8B 1V3LA 3C6SA 1HHJB 2F5AH 1QFWH 1UM4L 3WSQL 2JJTC 3AREC 4J8RB 2A6JB 4G5ZL 2X05A 4JFDB 5C0BE 3W9EB 2W1NA 5GJTL 4NUGH 4WUUD 1LK2B 1S7QA 3LCYA 2IAMC 2G2RB 2PW1B 4H1LG 4Z7VB 1IAKB 4TTGA 4C4KT 3KJ6L 2VYRE 5ALCH 2UY6A 5C0GA 3OKEB 5D71H 2J5LB 3TJEL 4P9ML 4R7DA 4PRIE 4LOUC 2GITA 1B9ZA 5C0FA 4YWGH 2RQ8A 3WXWL 2DDQL 3QUKA 4KUCD 1N2RB 5C09A 4BUHA 1U2HA 2YN3A 2VN7A 2VC2L 3WO4B 5H35B 3FMGL 2HVJB 3PGCB 3BI9X 5DQDL 4C54A 5LXGL 4JM2D 4M1GH 1XF5A 5KSBF 1CIUA 1U8OA 2JB6A 1AH1A 1XIWB 2NW2B 4QXWA 5D1QB 4TQEH 2VDRL 4MXVE 2Q76B 4Y5XC 1R3LA 2GK0B 5KSAC 1OSPH 3BN3B 1ZLVH 5DZOA 1NBZA 3SCMD 2AQ2A 1KCUL 1KENH 2ATKA 4RQQB 2GCYB 1HH9B 2NY6D 1JWSA 2JKXA 2MFNA 5HY9A 2I60H 2IAMB 3QXDA 1BHGA 3MROA 4ODVL 1T6VN 2YBRA 4GKNA 4YXHL 3CFJB 1SEQL 2VABB 4HZLA 3V4UL 3U4BL 3LQAH 5CIPB 5DQJA 1A7RH 1I7TA 2I24N 4GO6B 5IP4A 5EOTB 1OAKH 2IFFH 4KAQH 3FQUA 1IQDA 3ULVC 5DGRA 5GS0D 1IILE 1NMAL 3KPTA 1JYNA 4ERSH 4XP4H 1A6AB 3GHEL 3MV11 3ECBA 4U1HA 2ZSWA 1S9VA 2XTJB 2IPUK 1CXEA 3WHXB 4MDIB 4L3EA 5C0RH 5KVGL 1JE6A 3GDBA 2XT1B 4XI5D 1G6RB 3GSRA 4Y5XB 1I1YB 3FB8A 4J3WA 5LBSL 5I66A 2NY4D 2MHAA 1C5DA 3FONA 2GJZA 3ZKXC 2DWEA 3WJLA 1CFVL 3GJFB 3BXNB 3MR9A 4XP5L 4LDEB 3JVGC 5HJ3A 3AAZB 2CD0A 2F74B 2AJZA 3EOTL 1JPSL 4FFVD 4BH8A 5SX4H 4AEEA 3PGDB 3ZYOA 3S97C 2JJWA 3QXVA 4PJIB 1EAJA 3JZ7A 4UAOB 4OZFH 2VL4A 3PABB 2HLAB 4JZJC 2H3NA 1KB5L 1ZA3B 4LDOB 4PB9H 4JVWA 3E2HB 5TDOB 1SJHB 4QHLA 3MLPA 4OB5L 5M95B 1IE5A 3QCUH 2P1YA 1FO0H 3UTOA 3MLXH 1P1ZA 2AABH 4NWUL 3D39D 3EW3B 4BSVA 2P5EA 1OLLA 3O45B 4K71C 1SY6H 4PGBB 4JREC 4NWTH 3RTQA 3TVMD 5F9OH 3MRMB 5D1XC 3QWOA 4TSCH 4AEIL 3BRDA 5T1KB 5D70H 3GSVB 1S7XA 3CFKA 5EPMA 4AY0A 3LKRA 4JG0H 4Y2DD 2X09A 3ZKXB 1AO7D 1CU4H 4NT6B 2CR3A 1F4AA 1GSMA 5EN2A 3EKCA 2AW2A 3EHBD 1UWXH 4DKAA 3BQUC 3ZTNH 4H26A 3HI6L 3MLYL 3V0AC 3TT3H 2DQHH 4GKOA 3DO7A 2E7LC 5DMIL 2FEEL 4JZJB 2VSCA 2P8LA 2DI7A 4IM8A 1FZJB 5FCSH 3UJJL 1G9EA 4NPYA 1EIBA 2IGFL 2W60A 4XBPB 4M5YH 4HGWB 3HZYA 3NFSL 5TE7L 3GHBL 2YR3A 2Q3ZA 3NIDE 1MRFH 3MOBL 3VRJA 3HB3D 2X7LA 3CFEA 1U91A 3OR7A 4G7VL 4N90E 5GHWL 5TE4H 4NQCD 1NJ9A 1CD1B 2GTWA 3PWLB 3CMGA 4CMHB 1WWCA 2NXZD 4IOFC 5FA4B 1MRCL 5ACLA 3I50L 4Y1AB 5D7LB 4KHXL 2HT3C 2C4XA 4PYGA 1H5BA 4AIXA 3ULUC 3C5ZA 4IMKC 1OD9A 5C8JB 4L8DB 4U1LB 3EJZC 5LGJA 3IAQA 1ZVYA 4RGMC 4C56D 5MENA 4NHUB 1ORQB 2H2SC 3ISWA 1B2WL 4LHUB 1T0NA 4RZCA 1TVDA 4D9LH 1KELL 43CAB 3O9WD 2IAND 2GJ6D 4TUJB 1YEHL 1UCBH 4PY7A 3W82A 4X6DB 3AFLA 4JFQB 3WHE0 3EJJX 3BHBA 2BSRB 1U3JA 3F12B 2V5YA 2B0SL 4WI9A 1RIHL 1G7HB 2FX8L 2CRYA 5D7IB 4JKLA 4OCWL 1T2JA 5E6ID 1AIFA 1YC8A 5HPMA 2ITDB 2NX5A 1RIVL 4NKMB 5HYQB 5MENE 1XCQA 3IJSA 5EBMB 5JXEC 4I18C 5SWZD 1FAIL 3U82B 5IMOA 1WVZA 3D0VA 4DUVA 2VLLB 1RK0A 3L3HA 4LDLB 4RGMB 1DBAH 1D6VL 2VIRB 1OAYL 2AXGB 5EU3A 5I75B 4N8CH 2X4NB 4FQLH 4M8VA 3QIWD 5CBEA 3LEYL 4OLXL 4O9HL 5CEYA 5CEXA 2C3VA 2ICCA 4RFOH 5B38B 2CO6B 3GMMB 5FAAA 3HE7D 4KMQA 4IOIB 2NX5E 2J4WL 4KK6C 1UM4H 3WSQH 4BFGA 3O2DL 3P0YL 5KOVC 4LIQH 4G5ZH 1IMHC 1BAFL 4U4BA 5GJTH 1L4IA 5DJ0A 2UUDH 3SE9H 1BVLB 3EDJA 1U2CA 1KEML 2NY0C 3P4NB 2OXHA 3G5VA 4KRNA 4D0DA 1S8DA 3BZ4B 5D6DA 1T5WB 1R3JB 1ZMYA 3KJ6H 3L3IA 2BVUA 5ADPL 2PTUA 4AYFA 4O58H 3TJEH 4P9MH 3WFCL 5I76A 3HC0B 1BOGB 5DDHA 1CGVA 1P7HL 3OG4B 3WXWH 2DDQH 1HINH 4LCIL 4XRCA 1DBJL 3GSNA 5JPMB 1F00I 5IT2L 1YPZB 4DJMA 1P4BH 2VC2H 4LPWA 3FMGH 2GUOB 2QHRH 4GRLC 3KDMA 5LXGH 5CFHA 1EFXA 1JF1A 2GTZA 2Q3AA 1ZA6A 4AH2A 1YEDB 1NAMH 3QQ9D 4GXVL 2NZIA 4JR9L 3W5MA 2VDRH 5FDYA 3V2AR 1G1CA 1XGRB 3L7FA 1KCUH 3PQYE 2IEPA 3PL6C 5IB5A 4F7TA 3MJ7B 3R06A 4K94L 4M3KB 4KXZH 1NCAH 2QADC 5D2LF 4YXHH 2AJUL 2MQ3A 3GRWH 3LSOB 1G7MA 2DWDB 2XWTB 4LLUA 3ZE0F 1PGRB 2XA8H 5JIIA 3WIIL 4L8CA 3V4UH 3U4BH 2YSSB 4XXCA 3WLBA 4XAKE 2IH3B 4PUBL 2C1PA 3LKOB 5IEKA 4LLDA 3R8BB 1DE4A 4KV5E 5E70A 5FGBC 1CFNB 3GI8H 5CGYC 2FRGP 1NMAH 4R8WL 1R24A 2EYTB 5BMFL 1MWAH 3GHEH 1I3VA 5TF1L 2FO4B 3D18A 5CJXA 1ETZA 4S10A 3VRIB 3ARTA 4HIJA 4OIIL 3VJ6A 3VFMB 1FFNB 1S7SA 2G75A 1INEL 4I1NB 5LBSH 3PL6B 4UINL 4RIRB 4NC0B 5C9JA 4IRJA 2Z31A 2EDBA 2JJSC 4AT6B 4MX7A 2BXZA 1CFVH 2ZCKH 4QY8B 4XP5H 4YEEA 1FSKC 2YD4A 4YLQT 4ZMAT 1NBYB 3B6SA 4OZHF 2XFXB 1ZEAL 5F9AC 3RWFA 1JPSH 3ZL4L 2FECI 1A6VL 3QNXB 3WKMH 2DICA 2AV7A 5FF6A 2F9BT 3DMMD 1MJJA 2A2QT 3KJ4C 2FJFA 1KB5H 3PXHA 5C3LD 4P49A 5BRZA 5EU6D 3U0PA 4OB5H 3MJ8B 4KTEL 1R5VA 1F6LL 4NWUH 4WFHD 3VDAA 1D5MB 2PETA 2P5WB 4JGMA 3DV4A 3ALPA 4U6YB 4S11A 4JZOA 4N1HB 2J3SA 4ZXBC 4HK3N 1OCWL 4UQ2B 4AEIH 3CXHJ 3TBSA 3SKNA 5I1KH 4S1DC 2EYSA 4JPIA 2MTPA 1A7NL 1D9KA 4P2RB 2DQEH 1WT5A 3QSKB 1CTNA 4HS3A 1ZLUH 4G6AD 1OSZB 3TWCL 5INCA 1NPUA 2FLBT 5DHVB 5DR5L 1IARB 3MLYH 3S8WA 1SVZA 4O2EA 3JXAA 3TA3C 4YHLL 3SPVB 1MAML 3KJ4B 5DMIH 5A1AA 3T0DA 3WBDA 2Y25A 3UJJH 2R2HA 5HBBA 1XF3A 5FYKL 3ARBA 1W0WA 4LCWD 2E7HA 3BW9A 3NFSH 5TE7H 5AG9A 3GHBH 1QFWI 4KGLA 4MCYA 5J1TC 2EDNA 4RMTA 4G7VH 5GHWH 2CDFA 1J12A 1P84J 5IKCB 4X5WA 4MJ6A 3VGAC 4HUWA 4ZXBB 4X0KA 3NCFB 4Y4FC 1N8ZA 2E7BA 3RUGB 4KHXH 5E8EB 3CCHA 2L7UA 3IRZA 2EZ0C 3G04A 1HI6A 5C08D 3KPLA 4GRWE 2Q8BL 5I15H 4WI2A 1A3LL 5E8OB 3S5LG 3C60D 4TNVF 2KH2B 4OZGA 4AG4H 4X9IA 3PIQA 4ZFZB 2CQVA 5KZCD 1B2WH 1FNSH 3SGDH 5J12C 3TA3B 5MEOB 5LG1A 1WWAX 5DVNA 2ADJA 1DUZB 1HILA 1YEHH 4ZODA 2H32A 3DUUA 1EGJH 4HHAB 2ZP0T 4KUCF 5HYEA 4I48B 3DYMA 4I77L 1FL3A 3X11B 3O3EA 2YS4A 4YDJB 2CDEB 2EO1A 2P7TA 3EO9L 3QUYD 3ZYJA 2FX8H 4HV8A 3CSYB 3UPRB 5I9QC 4OCWH 3UBXG 2O61B 4JM2F 3VXSD 3ZKMC 1MH5A 4YR6B 3UZQA 3RWIB 3VGAB 1RIVH 3TBWA 4OZGE 5IOPB 4PJDF 5IMKB 2HJKB 1CCZA 1TPXB 1FAIH 4FMFA 1II4E 5C0IA 1KYOJ 3IU3A 5E9DB 3V6OC 5GISL 1I8MB 1QLFA 1FYTB 1D6VH 2BVEA 3WN5C 4F8TA 2QSCL 5CHNA 1OAYH 1EVUA 2DIJA 5J12B 5KSBB 4WIQA 2F15A 2ATPB 4O9HH 4FXKB 3LKSA 3EYUL 3VXQB 3H9ZA 4G8GB 3AM8C 4PTTA 1MRDL 2DBLL 2J4WH 5HHPB 5C3TA 4KJPC 2AJVL 5KAQG 3FB6B 3O2DH 4HJJL 3LB6C 4EOWL 5INDA 4N0RA 5AYUH 5ITFB 1P6AB 3HZVA 4OD2A 1UKQA 3U7YL 2BVQA 4R96A 4HG4J 3TBTA 5JHLL 4YIQA 4JANA 1TVHA 1XF4B 5KVEL 3D2UB 3DVIA 4U1SA 3S5LA 5IEHA 1NGXB 5ADPH 3MRQB 3DIFA 3WIHA 3WFCH 1G7IA 5SX4I 4M6NL 3VE0B 5HDOA 3GIZL 3RKPA 4HSQA 4LBEA 3IFPB 4LCIH 3X17A 3WN5B 4MAYD 5IT2H 2F53D 2VLME 5HSFA 1JN6B 3VXMA 3MRNB 4EEEA 4U6HA 5HYJA 3MYJA 1S9XB 4TOYL 3VWKD 5LJYH 2L0DA 4NDMA 3BWAA 1A3QA 1DN0A 5EUOB 2I07A 1YMMA 4GXVH 4WTWA 3UTZA 4JR9H 3AS3A 2PXYD 4P4KB 3U46A 5EO9A 1W72B 3MCKA 3QR2A 3BYTA 1NDGA 3QUXB 1Q1JH 1PY9A 2AJ3B 2QSQA 2YN5A 4M7LT 1E28B 3IGAA 4S1SL 1A1OA 4K94H 1U58A 3VXOB 2J6EH 1U3YA 1HDMB 2H8PA 5J89A 1TENA 4XB7A 5KG9A 2IC2A 2R23B 2AJUH 5CZXD 2ADIA 1MAKA 2CXGA 4WU7B 5HHQB 3S88L 2ZUQB 4PUBH 3ROOA 3VXME 3W2DL 5HYJE 3INUL 2WBJA 2WBKA 1BM3H 1IEAB 1K8DB 1GIGH 3C5SB 3NCJL 3P77A 4GAYB 4MHHI 1JPTH 2H26A 4L9DA 2ZOKA 4W4NA 4R8WH 2JTDA 3JTSB 1SYVB 1H3UA 4CN4A 1VFUA 4PGEB 3SE4A 1P7QD 2VLKA 3MRDA 4P5TC 5TF1H 1U41A 5FUOH 1MOEA 2V2XA 3AS1A 4ODTL 4OIIH 4O51B 1IKNC 3LV3A 4WW2F 1IM9D 1INEH 5LCVL 3QXAB 1ZLVK 5CLWA 4ORGB 3SDCD 4UINH 5ERWA 4O2CB 2NW3A 2OI9C 2UZYB 4K7PY 4LLWB 1HNGA 4N68A 5A2JH 1Q72L 5GGTA 3VW3L 5E6ZA 1UH3A 3M8OL 4LLVB 3ZL4H 3FFDB 1TTFA 4JFHD 1A6VH 2Y9RT 2DLEA 3QIBD 1HCFX 1AQKH 4YDKL 4P5KB 4E41B 5KN5A 5IWLC 2EDFA 1A64A 4PREA 4WO4C 4OCSL 2BX5A 2EE9A 4NQED 4ZQKA 5JA9A 3NPSB 3RHWK 2LABA 5F72S 4I3GA 4P2YA 4FQ2L 1OP5H 3SKOA 3VXRD 2ICEA 4X83A 3QG7L 3MNWB 2CLRB 1A6ZB 5JOFA 5IVXE 2DQGL 3LD8B 3M17A 1V8HA 4KKLC 4BQ8A 4YHOL 1OCWH 1RJZA 1LEIB 5DI8B 4KQ3L 1JNLL 1WCBA 3DRQA 1YN7B 4N0UB 4LCYA 2EXYD 4HXAH 3OGCB 2FBJL 2EECA 3TWCH 2DQIL 5DRXB 3QQ3A 4FFZH 5GRWA 3G6JF 3RVUD 5JR1L 1SVCP 3EDEA 1DBBL 4YHLH 1W0VA 2HFEB 1S9YB 3C8HA 4U6XA 2PCPA 3P4MA 1GYAA 2VXQL 1C7TA 5AD0A 5ID0A 2P47B 5MEQA 2J8UA 5HGBB 4YGVB 2YA2A 1UYWL 1HSAA 3QQ4B 3ABZA 1TVBB 2WWMC 4WJ5B 1K85A 1J0JA 2YPLB 3V9FA 1MJ8L 2AK4A 3PWVA 4TPRL 3DROA 4MD0A 4PJ8B 4ODXA 5FYLE 1X7QB 1RURL 1C16A 3O6ML 4I0PC 1KCSL 1ZWIA 2Q8BH 3F5WA 5F1NB 1A3LH 5I1IL 2OQJB 1FBIH 3SDDA 1UWXK 1LO2L 5D2NA 1RJLB 3QEQD 3EFFB 1HHKA 3VGDA 3AS0A 1MHHB 4L3CA 4JFYB 1XGQA 3HC3H 1DBML 5DJDB 5CEZE 2PYED 1ZGLA 1KJMA 1S9WA 1H15A 5F7DB 3DBXA 2AK4E 4I77H 3RVWD 3B3IA 1ZHKA 1U8NA 4D9QD 2VNCA 1NGWA 4Y4HB 3IKCA 2HLFC 1TCMA 1CZ8L 4F3FB 3RGVC 5D5MA 1TXKA 2I9LA 4ACPA 2GI7A 1FE8L 4XX1G 3GSNL 1P7KB 2VH5L 4KMLB 4CMMB 1WBXA 5D2NE 2WWKO 4KI1A 4PGCA 1S3KH 2X4QB 4JLRB 5JMOC 2EDQA 5FECA 3I75A 4I0PB 2QBWA 4XCYB 4V1DA 3FQWB 3H2WA 1BVKB 1AGDA 2H9GA 2UWEB 2FJHB 2X40A 1RULH 4OAWB 2QSCH 3WUZA 3KYMB 3RWEB 1VFOA 4I5BB 1PJ9A 4TVPL 2NY3D 2OJZH 1A1MA 2ITCB 5D5ME 3EYUH 1FN4A 1T22A 3QIUC 1MRDH 2DBLH 2KKQA 4G9DB 3RIAK 1F90L 4UILH 2AJVH 4WWKC 5JXAL 2DD8H 1TJIL 1X5AA 5D2LB 4XGZA 3U7YH 4V1DE 5ESQB 5FHAL 5C71A 5JO5B 2EKSB 5JUEH 2IPKA 4RGND 5I17A 5HDBF 1QKZL 2VR5A 3GGWB 1QHOA 1S5IH 5A2LH 2CUMA 1NC2D 1WLHA 1C12B 5EO0B 3RA7L 1RD6A 3N1QC 5KVFH 3JWOL 2JE8A 5H8DA 1E4XL 2WIIB 3GIZH 1BF8A 4PB0H 3DO3A 2W9DL 4K7PL 3HZKB 3DUSA 1YEFL 1T5XA 4ETQB 4APQB 4EBQH 2W0PA 3QG6B 2ZOLB 4NM8L 5CGTA 4XCEB 3Q0HA 4TOYH 1HYSC 1FZKB 4G8FA 5IQ7L 1X5HA 1A6WL 2VLRA 1NQBA 3T0EC 1ZS8A 4JHBA 3CDCA 3RNKB 3QIUB 4R4BB 3SKMB 2VZSA 4WWKB 2D9QB 3OKLA 5I16B 1Q38A 3I6KA 1MCNA 2CKBL 2X1XR 5JW5A 1GGIL 3RBGA 4S1SH 3EO1A 4CJ0A 2UUDK 1VGEL 4ODWA 4DQOL 1MLCB 5CJQH 1MJ7H 2GW5A 5BV7C 2CIIA 3DETC 2VISB 1OP9A 4LSDA 3KNBA 3BGMA 5L0QC 5MERB 2E7CA 2OXGA 3FOMB 4FFYL 4JQXC 3BEVB 3OX8B 3INUH 3SDAD 4X6BA 4Y4KB 1TFHA 2VLRE 3GBML 4B41A 2P46B 3NCJH 5EC1B 1Q9OA 3BE1H 3D85A 5DO2C 4GBXA 5C9KA 4XX1E 4RX4A 5H37G 1I7ZA 4BK5A 3U36B 2W65B 3BO8A 2VXUL 1N5YL 1T83A 1TNNA 1NLBL 4FOMA 3SY0B 3ZDYF 4BUGA 3DXAB 5LCVH 4EIGB 3O4LA 5TDNA 5I8CB 3E6HA 1G7QB 4K8RL 1OW0C 4P57A 3TZVB 5BV7B 2BNRA 4U3XA 5H2BB 3K4ZA 1Q72H 5L0QB 3MV8D 3M8OH 3QDJE 1OHQA 2MOVA 2VDKL 1WJ3A 3PNWB 1ZK9A 3IU4H 3JSSA 5EZLB 3DRTA 4YDKH 5GS3A 4Y5VA 1A1NB 3CFDB 2C3XA 5I8EA 2AQ1A 3IDYC 4FQ2H 4JM2C 1C1EL 4FNLL 3RVVC 3P0VL 1KOAA 4P59L 1VFAA 3QO1A 3O4LE 3E8UL 3DGGB 2GT9A 3WEXA 1C08B 4NM4L 1GGCH 4Z7UA 3VFSA 4PRHA 3TH2T 3SQOL 2C26A 5DTFB 4N0FA 1NGYA 2BNRE 5E08L 1M6OA 3SCMC 3AMLA 4KI5F 2V2WA 3FTGB 4ENEC 4YHOH 3EYOA 4UB0L 2NY6C 4UNTA 1QRNB 4NN7C 1KXQE 1JNLH 2X4TB 3GB7B 3BP5A 5FYJD 2CLVA 4LU5L 5D7JA 4FQ1L 1UXSB 3BYYA 1MHEA 3UCRA 1I8IB 5KSUB 5LGKA 1A3RL 1EVTC 1DL7L 1T04A 2A83B 4K7PX 4PLJD 5C07B 1QP1A 1DBBH 5GS1B 3TYGL 5TGBB 1ULVA 1KFAL 4G80A 1G7LA 2ZWLT 4UTBH 3QA3A 4Z7UE 4PJAA 4L4TD 4M93C 1CYGA 1RZ7L 3TNMB 5F88B 2VXQH 3IDYB 2Y36L 5T3ZL 5IB3A 1JUFB 4OZIF 5EFIA 4ELMA 4TNWK 4QTHA 1UYWH 3IETB 2CDGB 2YEZA 4AL8H 1RZFH 1HEZA 4XI5C 1OM3L 4I0KA 4PJDB 1UVQA 2D4FA 3SDYL 1MJ8H 1BMGA 3IXAA 4JY6B 1OB1A 3HCVA 4G8IA 5I18L 3W0WA 4TPRH 5IW1B 2NY4C 3W5NA 4NN7B 3B2VL 5D72L 1RURH 4PIRF 4RFEA 2X1OA 3O6MH 3CSGA 4Q58C 1J11A 2BCKB 1RZKC 1WFTA 3WFHB 5I1IH 4PJAE 1ZLUK 3GSWA 3RWJB 3HZMB 4FFVC 4ZO8A 4GG6F 5CJ8A 3HPLB 5ETUB 5E2UL 4ELME 4PG9B 1DBMH 1LDSA 1JZ5A 3CVHL 1LO5A 5FGCE 1HH6A 1FLTX 4P46A 5FDWB 1BFOB 1ZHLA 4M93B 1IEHA 1UWGL 3HMXA 3ZZ1A 4WFEE 4G42B 1MNUL 3WIHL 4JFFD 4EDXB 3FB7A 2HFFA 3R4DA 3NZ8A 5DUBA 1CZ8H 2VWEE 1YEGH 1HHJA 5D9SA 4PRAA 3OGOE 1RPQA 3EZJB 2DKUA 1FE8H 3GSNH 4J8RA 2VH5H 3BSZH 2OX5A 4JFDA 1KPRA 2NY4B 3QFJD 1JZ4A 4Y2DC 1LK2A 3IDNB 3MMEB 5FO8B 4L29B 4YDIH 1T1XB 2G2RA 4MNGA 4KKCD 4OJFL 4UMGA 3EHBC 3TH4T 2PW1A 2MQ0A 4Z7VA 5D7KE 4HBCL 4LHQB 4WUKL 5F7YC 5HYSA 4WU5B 4CKVX 3OKNB 5JLZB 3CC5A 5CKAA 4H0HB 1T89A 1T0MA 2V7HA 4TVPH 3MRPA 3P4OB 2YWZA 4CU6A 15C8L 3F58L 5DVLA 1MVFA 4WW2C 7CGTA 5DRWA 4MNQD 5H35A 4ZTPL 4JFDE 4JO4L 2HVJA 4OCRL 3PGCA 3NABL 5JXAH 5CUSL 3V5KB 5L2KB 3NCEB 4HGKC 2ID5A 2YD1A 4PRBA 5CILL 3NTCH 3WS3B 2J88L 3QJHA 5FHAH 1XIWA 1EAPA 2CRIA 2NXZC 5D1QA 4Z7VE 4MMXC 1QKZH 3WE6B 2Q76A 2GK0A 5IV2B 1I1RA 4RQQA 4JFEB 1HH9A 2EDJA 2BOCA 3TPUB 4AZ8A 4EKXA 4DUWA 1QSED 4F7MB 3JWOH 1I8KB 4OQ1A 5IESL 3CFJA 2HA1A 2BHYA 2VABA 1B0GB 1NMBH 5CIPA 4FFWD 4K7PH 4O2FB 1ZGLM 4F58H 1YEFH 4JB9H 1FVEB 3O9WC 2XTLA 5GRXG 4YDLB 1A9BA 4NM8H 5EOTA 4UDTB 2R0WH 1KTDB 1A6WH 4BKLB 4WW2B 1ZT1B 5GGTL 4F33B 2XWBA 1U8KB 1A6AA 1J88A 1D5XB 2CKBH 3ARZA 1HK6A 3MA9H 3WHXA 1GGIH 5HVFB 3PP3H 4MDIA 5JOPD 1TQBB 1VGEH 2NXZB 4WI4A 2NNAA 3KWWA 5FHBL 1I1YA 4M7JL 2F8XC 3M45A 4NQUA 3AXLB 2ERJC 5LAXB 1AC0A 4FFYH 4TUKH 2CRZA 3SEPA 3GMQB 3NACL 4EI5B 3AAZA 2J7LA 3S6CA 2VMFA 1MCCA 3RHWF 4NFCA 2LU3A 2QQLH 5GGSB 2OBGA 3D5OF 3HAEH 3QIWC 5I1JH 3PGDA 4LLQB 5EZIH 4PJHF 1JK8B 2E5EA 4PJIA 3MRLB 4AENB 3PABA 2HLAA 2XTJE 4JGUA 4WEMB 3OJDB 2D9CA 1KIQB 4IRSD 3OKKB 3TYFB 1SJHA 4LHUG 4LKXA 5F9WC 1XF1A 3JWDH 5C0CB 3QWQB 4LVEA 4FA8A 4FQXD 1ZANH 1I4FB 5ID1A 3BUYB 1ZGLP 3MJGX 5FO9B 1U3HB 3TVMA 5SV4A 4K8RH 3G6JB 4XNXL 3K74B 5J13B 4JPVL 2ERJB 3FHQA 1HOCB 1FFOB 2FGZA 4JPWL 3GSVA 3GBNL 4NT6A 4PJIE 1BGXL 2XQYG 2VDKH 2W9EL 4Y8AA 3ULVE 2HTLD 4R4ND 1OARL 4HD9A 1OQOA 2DB8A 5F7LB 3C2SA 3SBWC 3QUZB 1C1EH 4S2SB 3P0VH 1FZJA 4XBPA 4U49A 1ZV5A 2AI0L 4HGWA 4LEOA 4U7MA 3VXUD 4NM4H 3UJIL 1KTKE 1MCQA 5F9WB 3SQOH 5L9DL 4Y5YA 4BH7B 5B38G 3WIFB 2YWYA 5F6IC 1MUJB 2ARJB 4LU5H 1R5IB 1CD1A 4FQ1H 2NXYD 3K81A 2VERN 4HUKB 4U1NB 4NYLB 5FA4A 2Y06L 4XHQA 4Y1AA 4HWUA 1A3RH 1OY3B 5C6PB 4NO5A 2V9QA 1QVOA 4RMWA 5EU5B 3DLQR 1EHAA 2LU7A 4PJBA 4M62H 4NQXA 4L8DA 1KC5H 4U1LA 3NIGF 3T0VA 2FR4B 1KFAH 2NTFA 2AV1A 4NHUA 1ORQA 4BK4A 3QPQD 4JY5L 5DK2B 3UZEA 2DMBA 4XBEL 3SKUD 43CAA 3WDIA 2BNQD 4P2OC 2IANA 4NZUL 1OP5K 2MSPA 3QFDB 1ZT7B 2P45B 4X6DA 1NDMA 4JRYA 1G7JB 5HGHB 4JFQA 1ES0B 3MODL 5DUPL 3LH2L 3F12A 5FO7B 2R9HD 4Y1AE 5D7LE 2Q7YA 5I18H 1G7HA 1SJVA 4Q74A 3HE6B 1MCBA 1SM3L 2QTEA 5D7IA 1EUUA 2C3WA 1EJOL 4N0CC 4XT1C 3B2VH 2X6MA 2X4PA 5DVMA 1FLRH 3QNYB 5E6IA 2ITDA 1PG7X 5BCAA 1AJ7L 2XZCL 4X98B 3ZT6A 4NKMA 5HYQA 5F7MC 4LSSH 3TC9A 1G7PA 1KCVL 1EBPA 1I1AB 3QPXL 2FYYB 1IGIL 2YOCA 2YD7A 2X1WL 3DMMC 4LHJB 5EIVA 2IALB 4ZNCD 1KXTB 2F54A 5K9KB 1CDJA 3T08A 1AKJA 3GSOA 4X6DE 3RIAF 4JRYE 2VLLA 4Q6IB 4Z7NF 5ICYB 4LPCA 2NY5H 3CVHH 1AHWB 2AXGA 4HKJB 1KEGL 1S5HB 1UWGH 3LOWA 4NRYB 3DHJA 3W9DA 2EH7L 2X4NA 2LVEA 4P2OB 5D7IE 3WIHH 1NUDA 2QR0A 3UTSB 1YJDC 3GMMA 2VAJA 5C0ND 4QOKA 4IOIA 2UZIL 5DMKB 2QQNH 2VZ3A 5IFHL 3NA9L 4P23A 1AGBB 1BVLA 1INDL 5KANG 1QOKA 3P4NA 2F54E 3TO4C 4G6AC 1KLUA 1JIBA 5C0BD 4KKAD 5JXEA 4WUKH 1F3DJ 1JTOA 1Z6JT 3N85H 3FQXB 3I6LD 3AU1B 3ULSB 5F9JB 5EUKB 1X5GA 4R2GD 4WHTB 1BOGA 3J8F7 5SV3A 3NFPB 4Z7QF 3LN5A 3ZE1F 15C8H 5DURD 3T3MF 1BREA 5DA4A 5JPMA 4E0RB 1YPZA 3L3GB 5T5NF 4ZTPH 2ZJSH 2GUOA 3VXNB 1D3CA 1OGTA 5HDLA 1RQ5A 5I6XC 4XVJL 1RJYB 1RFDL 3CFCH 1YEDA 1TZGL 1UCTA 5HI3C 4C83B 3B9KB 5DJXB 2J88H 5BQ7B 2YMXL 2YKLL 1RUQL 4LVOC 5DJ6B 2ESVB 5T33H 2PKDA 4GUPB 4ELKA 4GAJL 4HX1B 1HQ4B 5EBLB 3MJ7A 2DQJL 2X4UA 1P5VA 5EO1A 1PYWB 2OR8A 3TO4B 4RISL 1CIDA 3RRQA 5IESH 2DWDA 2XWTA 3C60C 2Q6WB 1YPZE 2YSSA 2BY2A 3WXVL 3LKOA 3LQZB 3F7VB 3GMNB 2R15A 3H42H 4L8BB 1RV6X 4QNPE 5AWNL 2R2EB 2DM4A 3LMJL 2MMXA 1M4KA 4LCWB 1CFNA 1OT2A 2WP3O 3EDFA 3KLDA 3Q1SH 5C0AA 2EDEA 5GGTH 1IGTB 3O0RL 5DSCB 3QUYC 2BY0A 3RNQB 4OFYA 2GAZA 5MEPB 4QXGL 1CLYL 2FO4A 3T2PA 3HFML 1UT9A 3LRHA 3VRIA 4ONHB 4LVOB 3QBTB 4LF3B 1K4CA 4C55A 4CVZB 3VFMA 5FHBH 1YNLL 4GW5B 1FFNA 3TT1H 2VXTL 4BELD 1GC1C 3O11B 4FQJL 2NZ9D 4RIRA 3VMPA 3U6RB 4OLUL 2ZPKL 3K0WA 4AT6A 4QY8A 1KTLA 1EXUA 1SEBB 5F3BB 1XAUA 3GMOB 1KPVA 1NBYA 4PD4J 3UTQB 1NBQA 2XWJB 2IMMA 5C0AE 4OIBA 2XFXA 1GCFA 4ETYA 3QNXA 2YD3A 4MXWL 3RP1A 4FQCL 4XNZB 4LRIC 3DGCR 4PG2A 1KTRL 1WV7T 3BP6B 1UM5L 1S78D 4Y19A 4OTXH 4QWWD 4UT9L 5I19L 3PWPB 1D5MA 2C3HA 3P9MB 1A9EB 1KT2B 1UB6B 5FK9B 2H1PL 4U6YA 4JKWA 1JHTB 1X4ZA 4XNXH 3U7WL 2V5TA 4JPVH 4JPWH 1JGVL 4WI5A 3TV3L 1NCBL 1ZTXL 4NO3A 4HFUH 4ZUWB 5DEGB 1MQKL 5FKAB 3MPCA 2GSGA 2E3VA 5CEZH 1BGXH 1QHPA 2W9EH 4P2RA 3DX8B 1I7UB 4NNPL 2ZUSA 4F2MA 1OARH 4S0SD 4MAYC 4YO0B 1B6DA 1VA9A 4Y19E 5DHVA 2C1OB 1T80A 4TNWF 4DKFL 5BO1L 3R1GL 3H9HB 4JDVA 3GNML 3U0WL 2PXYC 4NJAL 5A2KH 5JA8B 4WGWB 3CVIL 1P6FA 5L9DH 2RFXB 5DFVC 1IKFL 4PBXA 1E4KA 1Z5LB 2P5ED 3RL2A 3ZE2E 5ICXB 3KPMB 1A5FL 3HKFA 3RTQD 3GSUB 4P2RE 4GJTB 5DJ8B 3QHZL 3CK0L 4UDUB 4U1IB 5CZXC 1XH3B 2ORBL 3HMXL 4GG6B 2FHBA 3RUGA 4PP1D 5E8EA 4N90D 1MEXL 4ZS7L 3O41B 2G9HB 2Z4QA 3GSQB 3KPSB 1VFBB 1NSNL 2DQDL 2MPAL 5E8OA 3HRZB 3T3PE 4LQFL 2F53B 4ZFZA 1DSFL 1SHMA 3DURB 4JY5H 3TA3A 4XBEH 5MEOA 1CE1L 3BVNA 4NZUH 1T4KB 5F7WC 4XPGL 4ZAKC 3FZUD 4HHAA 1JBJA 3JBG7 1RHFA 1DANU 3MODH 5DUPH 3ZKSD 4YDJA 2WUBH 3LH2H 4F37K 1J87A 3RUGE 5C7XH 3CSYA 1F02I 1SM3H 3UPRA 1EJOH 4OV5B 1K8IB 4UBDD 5FV1L 2O61A 1X5YA 5I1CL 4YR6A 1DTUA 1G0DA 2A9ML 1VDGA 4R4FL 2E6QA 1AJ7H 5F6HI 2XZCH 3W11D 4M02A 1JVKA 4KGJA 3QPXH 3G6AB 2EDWA 3U4AA 2HJKA 3QIBC 3C5ZD 4PJEF 1Q94A 1EEQA 1YEKL 4XPFL 1T1ZA 3HR5B 3IFNL 5MEND 2WV3A 3OB8A 5E9DA 1I8MA 5C6WH 1CR9L 1FYTA 1QLEL 1KEGH 1LEGA 1KJ2L 2Y7QA 5I1HL 2EH7H 4F9PC 4NQDB 2ATPA 4UIKH 1K2DA 1BQSA 4FXKA 1QNZH 4ZAKB 1JZ8A 3VXQA 3LQAC 4G8GA 4BFIB 1HWGB 2UZIH 2NY7L 1OF2A 4P4RB 3ARWA 1JHKL 4QO1A 5IFHH 1R3HB 5ITFA 3HRPA 3L1OH 1S7UB 2NX5D 4YHNB 1INDH 3K3QA 4XVSL 3MGTB 4IIQB 4ZDHB 1G84A 4WCYH 1QD0A 5E9DE 5GS0L 1XF4A 3D2UA 1FYTE 1GZPB 1WICA 1MCKA 1IT9H 3RVUC 1NGXA 1CGSL 1CFQB 5KSBE 3ESVF 1AD0B 3UMTA 3BT2L 2KQMA 3MXWL 2APFA 5T1LA 3VRLF 4G8GE 1UB5A 1RY7B 3IFPA 3QCVL 4KU1A 4XP6L 1ZAGA 5IBUB 1JN6A 3VXRB 2DAVA 1S9XA 4GMSL 3S35L 5F7UA 5E8NB 3VWKA 4CAGA 5EUOA 4GAFB 1RFDH 4D0CA 1X6LA 3T4AA 1TZGH 2KZWA 3P11L 4P4KA 1RZKL 2YMXH 3MACL 3PDOB 1W72A 2YKLH 4LVNB 3KVQA 4OLVL 3QUXA 2JELH 4QTIH 2AJ3A 3JTTB 3WJJC 1E28A 1KB9J 2DQJH 4MQXD 1HKLL 5GGUB 2V5MA 5IROA 3VXOA 3B9AA 1HDMA 1RU9L 4GQPH 4HWZB 1JGUL 2R23A 3FRPG 3V6OE 2MKWA 4Z7WF 1ADQA 3U0TB 4KJYA 7FABH 4WU7A 5HHQA 2JCCF 3PQYD 5B8CC 5IFJB 4NN6C 2C7UB 1OAXH 5I1DB 1Q0XL 1IEAA 2BOBA 5DD6A 5KVMC 5EUOE 5AWNH 5IJVA 3LMJH 1AXSB 1EHXA 4XAKD 3RVWC 4U0RB 2DQFA 2FX7L 3JTSA 1SYVA 1QTYT 1J8KA 3O0RH 1EFXD 1IAOB 4PGEA 5CWSB 2WANA 4QXGH 4OCYL 1EZVX 5KW9L 2XY1A 1VENA 4X5XB 3STLB 4D0BA 3FQTB 1OAQH 5I74C 4YJZL 1SBBA 4O51A 3BZEB 3O3BB 4J3TA 2VXTH 1NUNB 4OZFB 3QXAA 3ARVA 4ORGA 3WNLA 4MD5B 4OLUH 4JFOB 4O2CA 2ZPKH 3GKWL 4XHJD 3MA7A 3VWJD 4LLWA 1CDGA 5CSZB 2RB8A 1FO0B 1PEZA 4LCUB 1JV5B 3CSPA 4PJGB 4LLVA 3SE3C 3FFDA 2NY3C 5HHXL 1QBML 5EB9A 5JTWA 4JRXB 5HXMA 1ZVHA 4FQCH 4UZGA 4X5LA 4M48L 3W39B 4P5KA 3K8LA 3EOBA 1P69B 3K8MA 4KVCL 1BD2B 1UM5H 4JM4L 2MCPL 4NQEA 1RIUL 2F8OA 4IHOB 1A7OL 3Q48A 5MHSE 4UT9H 3VG9C 1I1CA 2ADFL 4MJIB 1NBVH 5H37H 4R6UA 3MNWA 1A6ZA 2H1PH 4RGNC 5I74B 3PP3K 1KIPB 1NC4A 3NZHL 1ZT4B 4DAGL 4Z0XB 5GRVK 3FRPA 4Y16C 1HIML 3S34L 3MGOB 3H7LA 3NPZB 2X44D 4IRJD 4R26L 2Z31D 1LEIA 4WHYG 1JGVH 5DI8A 4QRSB 3TV3H 1NCBH 1ZTXH 3PDDA 4ZFOB 1YN7A 5ICZA 4BFBD 4N0UA 4MAUL 4E41E 4AJ0A 3G08B 2JLLA 1PZ5B 3MSPA 4P3DA 4NO2B 4OQTL 4FMKA 3MLWL 3CXDL 3E3QC 3F6IA 3Q5YA 1CICC 1YEIH 3R1GH 2HFEA 2ZCLH 5LQBL 4GAGL 3GNMH 4BJLA 2EIDA 2ED9A 3S35X 4QXTB 2UVEA 1DLHB 4NJAH 3CVIH 3ALXA 1NGZB 2CMRH 1IM3B 4YAQB 3VG9B 5HGBA 1IKFH 4YGVA 3DYOA 2AEPL 1T7YA 4N0UE 1OT1A 1A5FH 2HYMA 3QQ4A 4AEHL 5FEBA 3TF7C 1TVBA 4L8SC 4WJ5A 3D9AL 3LN4B 3QHZH 5B3NA 2ZUVA 4NFBA 1I9JL 2ORBH 3HMXH 2DLGA 4OSUL 4Y7MA 4Y16B 1NC2B 3MRJB 4PJ8A 4JO2H 1JWMB 1X7QA 4KRLB 1MEXH 4G3YL 1D9KD 3L7EB 1VPOL 1NEZB 3I2CL 4FQQB 3SDAC 2W92A 4OCMC 1NSNH 2DQDH 4LSUL 4RRPG 4K55A 4ZSOB 3IYLW 1RZ8B 2OQJA 3CUPB 1DSFH 3EFFA 5F7KC 1MHHA 1CICB 2B1AL 4WW1B 1WZLA 3BN9D 3MRKA 3SJVA 5DJDA 3TM6A 1LO4L 4NP4L 2FJGB 3D48R 32C2B 1Q0YL 5F7DA 4A2LA 1FNGB 1MLBA 2YPLE 2OL3B 2R69H 3RFZC 4WEBH 4N1CA 5IB1B 4RMQA 2V9TA 5J6GA 4NN5C 1OQXA 4Y4HA 3WFDH 2M8XA 4ZD3H 1L9MA 5HGAB 5CINL 4F3FA 5I1CH 1QPPA 2A9MH 1X3DA 1P7KA 2PF6A 1ZVSA 3TJHD 4PBWD 4WRLA 4Z76B 1J0ZA 1MF2L 3EJYC 4CMMA 3L9RB 4XNUL 1R3KB 3GJEB 1WQVT 4W6WB 2BHUA 3FQWA 3ILPB 2P4AB 4XPFH 4LCCC 2AXFB 1OWWA 1UC6A 4MXVF 1YZZA 2UWEA 1HSBB 3TP4A 1HZHL 2FJHA 1QLEH 4NJ9L 4U7KA 2ENSA 4R0LB 4X99A 3KYMA 1T20A 1KJ2H 3RWEA 1CTOA 4I5BA 5I1HH 5L7XL 3QEGL 3LS4H 2ITCA 3LY6A 1OL0A 4N8VB 4YXKL 1HE7A 3E6FB 3ROLA 5JW4N 2GY7B 3MV7B 4G9DA 4XVTH 1TZHB 5IW3A 5CIPH 4I9WE 5E5MB 3QZWB 3FRUB 4CW1B 3KLSA 4G43B 4NN5B 3ELAT 2O5ZH 1M7IB 1UJ3C 5TJWK 3BDBA 1IGYB 3VFPB 5ESQA 5JO5A 4XVSH 4M1DL 3VMNA 1AE6H 1UXWB 5GS0H 3GGWA 4RRPA 2UWEE 2XKNA 4X4XA 5J11C 4QHMB 4PLJC 1URLA 1C12A 2QL1A 3IKKA 1GHFL 3MXWH 2WIIA 3OKDB 3CMOL 2DQCL 3QCVH 5HVWA 4L1DA 4ETQA 1JTTA 2H2PD 4YDVB 3RAJL 3EYVB 2YXFA 4JDTL 4OGXL 4APQA 1X5FA 2ZOLA 4XCEA 3VFOA 4GMSH 5D2LE 1FZKA 3S35H 2IMNA 3RNKA 3P11H 4R4BA 2VLMD 3SKMA 1A2YB 2A77L 2AAVA 4HUXB 4WWKA 3MACH 1MVUB 5GGVY 4OKVB 3X14B 4OLVH 2HT2D 1WEJL 2XIDA 5EC2A 1PW3A 1HKLH 1YYLL 3EYSH 3FO0L 1RU9H 1MLCA 5BJTB 4RFNC 1IGMH 3RY5A 2Y07L 3BP7B 4MJ2A 3F7PC 1P4LB 4KZDH 3MZGB 3EGSB 2XOTA 2SEBB 3ZO0A 2O26U 5MERA 1H3PL 2EDKA 4OFKA 3O8XB 1LNUB 3OX8A 3P9WB 1YJDL 1QO3B 4NNXA 4Y4KA 1FFPA 1IZJA 5EC1A 4L4TB 4CNIB 4DKDC 3VXMD 1DDHB 2W0FA 5HYJD 1PSKL 1Y0LB 1JHLH 1F3JA 3IDJB 1BFTA 3P9LB 2ZUTA 1I8LA 3U36A 5TH2A 1WFUA 4F7CA 4OCYH 2VE6B 3A6BL 3QEHB 4MCZB 3S7GA 5IHZB 2I27N 5I8KL 2R1YB 4MDJA 3DXAA 2N7AA 1BJMA 3BZFB 1KB5B 3RDTB 4LK4A 4HBQA 5DJCB 5E1HB 5I8CA 4KKCC 1OTUD 3GKWH 1G7QA 1M7DB 3TZVA 5IR1A 3NIDF 1RZJH 1VESA 5H2BA 5IMLB 3C87A 5SWSA 3B5HA 2WBJD 3MV8A 1WIUA 1X5XA 3WS6C 2FIKB 2WMPA 2X89A 4OM0H 4HMDA 5HHXH 4R7NB 3PNWA 1IAMA 2O93L 2EEAA 5ISZB 4KVCH 1A1NA 3CFDA 1SQ2N 1V7MH 2MCPH 4W4OC 4Y88A 5FGRA 4U1JB 4UI2A 1A7OH 3DXAE 3VXTB 25C8L 2ADFH 5IF0A 2DJSA 3DGGA 1ONQB 4XPAL 2QKIB 1FJ1B 4XNQB 4M43L 3IDMB 3V7AG 5DJAB 4X6EB 5CLTA 2X9WA 4DAGH 3MFFB 1HIMH 3HI1B 1KCKA 4CU7A 3MV9B 1XGPB 3GB7A 5E00B 1U8HB 3C09C 5BXFB 2VXVL 3H9SA 4XZUA 4MAUH 3OQ3B 3VG0L 9CGTA 5KSUA 3WNMA 2LQRA 4FFWC 4PJ7F 5DMYA 1RUAL 3TCLB 3QAZC 4YGAB 2CR6A 2EH8L 3QI9B 5IW6A 3REWA 2HRPH 2A83A 3MLWH 3UXFA 2YPVL 4F9LC 5GS1A 5F7HA 2FCBA 5ANMB 4WV1A 3VFNB 2IPUG 1DVFC 1YEEL 4GAGH 5JOEA 1WGOA 4F37F 5I71C 4MNQB 3TNMA 5F88A 4PGJA 1N6VA 1XR8B 4GLRH 1Z0NA 1JUFA 1D5ZB 1QRNE 4X7CC 3IETA 2CDGA 2AEPH 4AEHH 2C3GA 4DVRL 1N64H 3D9AH 2VDNH 3MNVB 1I9JH 4JY6A 4PP2B 4OSUH 2APVA 3U83A 3OG6B 4PJEB 5IW1A 5HVGB 2XZQL 4AM0A 4LNRA 1CFSA 3F7RA 5C07E 3C09B 4G3YH 1VPOH 3I2CH 2DQUH 3UPCA 5BW7C 2BCKA 2BMKB 3IFOB 4BZ2L 3RWJA 5FYLD 2VQUA 1LP9A 4LLMA 4HWBL 3HPLA 4TVSa 5ETUA 5JORA 5C6TH 3CDGA 5HVHC 4I3SH 4PG9A 4YQXL 1DVFB 3FB5B 4IRSC 1LO4H 2ICES 5TFSH 5FDWA 1MI5B 3MRBA 5L88H 1BFOA 5I71B 4PJDE 4OBRA 5E6YA 4JHAL 1IAIL 1IGCL 3K2UL 4JRWA 2ADGB 4EDXA 5CEZD 1ZHNB 2GKIA 3R8QA 4HUVB 5EORL 4X4MA 4M6MH 2LTQC 5CINH 4WFGD 5HHMB 4KJWD 4J6RL 2AK4D 2BVPB 3OXRA 4LARL 4NBXB 4JO1H 1HKFA 3GSXA 4OZ4A 5FV2A 1MF2H 5E4EC 1KF9B 1LP9E 3B2UD 4PJ9B 5GGVL 3T77B 4Q97A 2Q8AL 5I1LB 3IDNA 3MMEA 3MC0A 3VFTB 1T1XA 3C8KA 4Z7OE 3JV0A 2HTLC 4J4PA 4R4NC 3SDDD 5DZLA 4KHTL 1C5CL 1W72L 1AGCB 3GIVB 4JHZA 1HZHH 5JLZA 3BPCA 3G5ZB 4LEXL 3UTTB 4K94C 3V7AE 4HIXH 5DD0L 4HPOH 5L7XH 3QEGH 4KC3B 4X4YB 4X4ME 5D1ZA 4YPJA 4G9FB 1FYHB 1TJHL 1HQRB 5I0DA 4WTZA 2ICWB 2R4SL 1JF5A 1FG2A 2UV3A 3U9UB 3BWUC 5L2KA 1XGTB 3C08L 4WDIB 4KV5F 3EO0B 4JO3H 4QRQB 2F5AL 3AS2A 2NXYC 5J6HB 1BBDH 2MJWA 1ED3A 2JCCB 4M1DH 3WE6A 1NFDA 2YD2A 3PWUB 5IV2A 5E4EB 3CNKA 4JFEA 3I3EA 3TPUA 4V1DD 1EHNA 1KLFA 2Z9TA 3LN9A 3DX6B 4F7MA 1QSEA 1OD7A 3P73A 5JIHA 3TFKD 4POZD 1I8KA 3LQMA 2EEBA 5CZVH 1GHFH 1QR1B 4X6CB 1B0GA 3CMOH 3QPQC 4O2FA 1E27B 5HGDB 4P5MB 2VUOA 3RAJH 5L2KE 4OGXH 4LVHC 3QHFL 3IDXL 1JJUA 1CLCA 1KTDA 4BKLA 2EIZB 4X4ZA 4WW2A 4ZUUB 1KNOB 1ZT1A 2A77H 3H7BB 4F33A 4PY8J 1U8KA 1ZLWH 2UYLB 2BC4B 3QDMA 4M1GL 1L7IL 4JFEE 4LPYA 1AC6A 1WEJH 3RWHB 5IK3B 2IQ9L 3KHQA 2ZKHL 3GFUA 2EXWD 3FO0H 2R0LL 2QLVB 2Y07H 3NA4A 3AXLA 5LAXA 4S0TD 1H3PH 2I60L 1NGQH 3BESR 3GMQA 2G5RA 1SYSA 3QYCA 1B4RA 4EI5A 3ARFC 3KPOA 2XQBL 4FZ8H 5L2JB 3N9GL 4KKBD 1LMKA 2BNQB 4LLQA 1UM6H 1OAKL 2UVFA 3MRLA 4HFWB 2VLRD 4KAQL 5ILTL 5IGXH 3OJDA 5C0NC 5EG6C 1KIQA 4KWUA 5HD8D 3A6BH 1S7RB 2R2CA 3KYKH 4XP4L 1B6UA 3VI3E 5DHVH 4Q9RL 1T3FB 5C0CA 4TUOB 4NSKA 1I9RL 2HT4D 1PKQB 4FQXA 1I4FA 4ZFFA 1U3HA 2XNAB 4KKAC 1JZ6A 3WV0A 2OJEA 1HOCA 4UNUA 3O4OC 3O6FB 1YECH 1YDPB 4U31A 4R2GC 4A6YA 1S7TB 4GRMB 5EIQA 3ARFB 3LIZH 3K7UA 4QLRA 1E6OL 3FOLB 3D85D 1FH5L 4GBXD 3IS0X 4RX4D 4ZPVB 4AMKL 3QDJD 4IDJH 5C0CE 1LQSR 3GMRA 2LE9A 3QUZA 3T0XA 4U2ZA 1J8HB 2BFVH 1WSST 4FHBD 1MIEL 1NCWH 3TBVB 3QCUL 3G6JE 4M43H 1Z0MA 3ZT7A 1GZQA 2VLJA 1EEUA 2AABL 4HEPG 1T1WB 3V52L 3NAAL 3O4LD 1SY6L 3OKOA 3TN0A 1U8QB 2J2ZA 2ARJA 3DHMA 4NWTL 5D93B 5JHDB 1R5IA 2DIBA 2VXVH 1E0OB 2BNRD 3O6KL 1CGWA 5EA0L 3VG0H 4HIHB 2Q20A 5D70L 1CLZL 5E94A 3O4OB 3NCYS 3IDGA 2EH8H 4X7DC 4UT6H 3SGJA 1DZBA 4R2GB 3FFCB 3FKUS 5EU5A 3PJSB 4UUJA 1KPUA 2YPVH 1CXLA 5DVKA 2DI9A 2RIKA 1AXTL 1YEEH 3BEWB 4FZEL 2APBA 1LK3L 3ZTNL 1TDQA 4ODUB 4X7EC 3TT3L 2DQHL 2VLJE 1D6EB 4M4RA 4XPTL 4OFIA 4ZOCA 5EU4A 1JZ7A 4XTRD 3OF6A 4MA8L 3NIFE 4KQ4H 2XXCB 1ZT7A 3S96A 1GRWA 12E8H 1G7JA 3BPNC 4DVRH 3CXHK 1MRFL 4DVBB 5FO7A 3HE6A 4K3HA 2CJUL 2XZQH 4JPKL 3ZMRA 4R97C 2P43B 4MD4B 5DJYB 4R7DB 1I1AA 4NC1C 4ODSL 3BPOB 4PV8B 2FYYA 2Y6SD 1PKOA 4H88H 4HWBH 3TEUA 1WBZB 5C09B 2IALA 4S1QH 4YQXH 5ICYA 5D6CB 2QHLA 3MUGB 4L9LA 4Q6IA 5J1AB 1S78C 1BJ1J 4X7TB 1KN4L 3RZCB 1AHWA 4HKJA 4JHAH 4NRYA 4D9LL 1IAIH 4XVUD 1IGCH 1P84K 4EN3B 4P2OA 1JRHH 1D5IH 3K2UH 3RY6A 2DTMH 3UTSA 1UACL 3VH8B 4MA3B 5EORH 2XXMB 3BPNB 5DRNB 3PXJA 4IJ3B 1C5BL 3L3DA 5DMKA 4J6RH 1YUHA 3AB0C 1NBZB 2WWKT 2ATKB 4WFED 3B83A 2NY2C 5HY9B 3QXDB 5GGVH 3WJLC 4GKNB 1AGBA 1B3JA 3C6LB 2A38A 3T0AA 4R97B 1VCAA 1JPST 1AXIB 4KHTH 5C0BA 1W72H 4D94A 1OTTD 3PWNA 3F7YB 1EFQA 4M6AA 3AU1A 5F9JA 4LEXH 4QHUB 1ND0B 2A73A 4U2YA 2YD8A 2Y5EA 3UTSE 2XKUA 3NFPA 3CH1B 4P46D 5D7KD 3RKDD 4JFPA 3ARSA 2W9LA 4E0RA 2R4SH 4U1MB 4PRIA 4U1HB 3VD9A 3VXNA 1HNFA 1NAKL 3C08H 3MO1A 4L3EB 1RJYA 3RTQC 4UQ3A 3FB8B 4C83A 3B9KA 4KPHL 3AB0B 5BQ7A 5BS0B 4OLWL 5GJSH 4LIQL 3WNPA 5I66B 5DJ6A 4JFDD 2ESVA 3ARRA 2NY2B 4PP1C 4GUPA 5CP3H 3RGHA 4OCNC 2XYCA 2DWEB 2R56H 3SE9L 1KYOK 1N6QL 1HQ4A 5EBLA 3MR9B 1PYWA 3TO4A 1EH9A 1GGYA 4M7ZC 1A7QL 2B4CL 4BH8B 4O58L 3LQZA 3F7VA 3WYRA 3GMNA 2H3NB 2AEIT 2FLRT 3G5XB 1EDQA 3ZKND 4L8BA 4PJ5B 1I3GL 1N4XH 1U0QA 3IDXH 3QHFH 5HI4D 1EV2E 1HINL 3FZUC 4IMLB 1H8NA 3IAGC 1P4BL 5T3XE 3VCLB 2ESVE 3GK8H 1P1ZB 1IGTA 2QHRL 4BSVB 4HG4K 4Z8FL 2P5EB 5DSCA 3RWGB 5KAQF 4FG6D 4QRRB 3ARGB 4UBDC 1L7IH 1NAML 3QWRA 1N26A 4JFXB 1XIWD 3JV6B 5D1QD 2DL9A 4NRXB 5FM5M 2IQ9H 3AREB 3ARXA 2ZKHH 3W11C 4CVZA 1INQB 2R0LH 4GW5A 3LKRB 1BQLL 4XCFH 3O11A 1H5BC 3U6RA 4W81A 3C5ZC 1UG9A 1NCAL 1IC5L 5TDPA 1X5LA 3GRWL 3OAZH 1U6AL 4M7ZB 2XA8L 1QPXA 1SEBA 5F3BA 3ZDYE 3GMOA 4LCWE 3TPKA 2XQBH 3UTQA 1CG9A 1VKXA 2XWJA 4HK3J 2YD5A 3S98A 4LOUD 1T21B 3N9GH 5B4MC 4IRZL 4NPYB 2I9TB 4H25B 5FYJL 4GLRI 4K9EC 2Q86B 5ILTH 3GI8L 3BP6A 2OK0L 3MRFB 3J7HA 3DSFL 3TCXA 4LPVA 2OZ4L 2YPKA 3VRJB 1MWAL 1XF2A 3QNZA 4X6FA 4Q9RH 3CFEB 1U91B 1M05B 3BMVA 4KDTA 3Q6FB 2XTJD 4W6YB 1I9RH 4UV4L 3P9MA 1A9EA 2DM3A 1KT2A 5LWYL 1UB6A 3T4YA 4NFDA 2ZNWA 4PJ7B 5KSAB 3MJ9A 3DWTA 4H1LA 3WFEL 4ALAL 1FDLH 3MUHL 1B0RA 4EIZC 4GS7C 3VFUB 4ZUWA 5FKAA 2PUQT 4GQ9L 1U8LB 2ZCKL 5MENB 4LGPB 3ZHDA 3I02A 2VTFA 2KQNA 1EMTL 3DX8A 1I7UA 1NCDL 1E6OH 3G5YA 4KI5E 4XPBL 1FH5H 1LEKA 4DOHE 2HP4A 2UY7A 5C0JB 3MRGA 3WKML 4AMKH 1CDIA 2PNDA 1JGEA 1I3RB 3PWPE 3ULVD 1NUFA 2VAAA 5GZND 1U8JA 3U7AA 1MIEH 3Q3GB 3ZHKA 3MZTA 2R8SL 3LDBC 2RFXA 2DJ4A 5F89A 4JQIL 2J8UF 1AIFB 3RX8A 5C0DA 4LSTH 3R0MA 4U05A 4P0DA 5ICXA 3V52H 3KPMA 3NAAH 2BDNL 5D6DC 3GSUA 5JZ7D 1XCQB 5I0ZA 5DJ8A 4U1IA 3WNKA 2P24A 1XH3A 3O6KH 5EA0H 1A6UL 2F58H 4YK4C 5L8JB 4NRZA 1CLZH 3QXTA 5I1KL 1Y6KR 2LAGB 3O41A 1FIGH 5GS2H 2G9HA 1N0XL 3GSQA 3KPSA 2DQEL 1H0DB 5BZWA 4WHYH 5DS8B 1AXTH 3HRZA 3WNNA 5IHLB 2NPLX 5CBEB 4FZEH 1LK3H 5CEXB 3DURA 1SJEA 2H6PB 4XPTH 4JDZB 4MA8H 1M71A 1T4KA 2K7QA 4Y0GA 4YH6A 2CLZB 2AJXH 1BPVA 5IBUG 4GG6E 1I75A 2Q7NA 5DJ0B 1QA9B 3O3AB 5H94B 5DYOA 2A74B 2WUCH 3HG1B 1MHPL 2CJUH 4K71B 4OV5A 3G5VB 4D0DB 4JREB 1OAUL 3KPSE 4XHJC 5D5MF 5FYKU 4JPKH 2Y72A 5D1XB 3L3IB 1FVDB 4XC1L 4XXCC 2D3VA 2E9WA 2YK1L 4U1GC 4Y1AD 5D7LD 1T2XA 2F53E 3FAWA 3G6AA 4ODSH 5KANI 1RVFH 1L9NA 4G8EA 5I15L 3P4LA 2ICWJ 1U92A 5EU7E 3GSNB 4NKDA 4AG4L 3BQUB 3SOBL 1H3TA 1YC7A 1KN4H 1FNSL 2DBJA 3KDMB 2HMID 4MWFA 5A2IH 1N59B 2GTZB 4HS6A 4KTDH 5DRZA 1OAZH 4K7FA 4DGVL 5CJXC 3JWOC 4YHML 4JRYD 1EGJL 1UACH 4ZAKA 1CQYA 4BFIA 3EFDL 1F4YL 1C5BH 3LZFL 4MB4A 3NFNA 4P4RA 5IB5B 1RHHA 1QG3A 4F7TB 3LVEA 4IRJC 2Z31C 1R3HA 3VD7A 1F3DH 2ZZUT 2VB5A 3NGBC 1BFSA 3V6BR 1GJIA 5F9DC 1KUMA 4IIQA 3IT8D 3WLBB 5GZOC 4OZFG 5IEKB 3RIFK 4PGZA 3UYRH 4UIMB 4PJCF 5E95B 4HWEH 3D3VB 2GEEA 5CAYB 4NQDE 2F54D 2EYRB 2WM0A 1AKJD 1BWWA 3SDXA 3UEZA 4HLZG 5ELIA 3IRPX 2X70B 1FFQA 4RSVA 1ETZB 1NAKH 5E8NA 1LE9B 4QOKD 4HIJB 2AEWA 3VJ6B 4HK0A 4MA1C 4OLZH 1WTLA 2G5BB 4K3DL 4L4VB 4BM7A 2VN4A 2V6HA 3N1MC 4KPHH 4OLWH 3PDOA 5I2IB 4IOSD 5ESVA 5AYUL 5C9JB 4IRJB 2CGRH 3MLUL 4P23D 3GZKA 4LSRH 3VGBA 4C58B 3S37X 1N6QH 3NGBB 5GGQH 1WT5C 1DEEA 1WCQA 1ITCA 4HWZA 4HIEA 4QF1B 3SDXE 4QXUL 5JXED 3OHXB 4MHHG 4RA0C 3JWDC 1A7QH 5HPOA 2HTKD 2B4CH 4I18B 4JAMB 5BOPA 2AV7B 2CKBB 5IFJA 1IC7L 5FF6B 3PQYA 1YY8A 2C7UA 2V5SA 1MCWW 5I1DA 3RPIA 3BN9C 1A8JH 3HN3A 4G7YH 3FJTA 4NCDA 1V5JA 5BRZB 1I3GH 3ARBC 3U2SA 4K8RC 3ALWA 1YY9C 3GMPB 3EOAA 1AXSA 1QEWA 2CPCA 1R5VB 3D0LB 4XWOC 4Z8FH 1VEPA 4YFEA 4OUUA 1JWUA 2BP3A 4A6YL 3DV4B 4MGXA 4U6TA 5CWSA 2QJDA 1VEMA 4JZOB 3FQTA 2DYPB 3HAEB 3TJHC 1Q1JL 3O3BA 3SKNB 3IB4A 2EYSB 1MCWM 3UYOD 4OZFA 1GL4B 1TQCC 1BQLH 2B8OT 4LGRB 4MD5A 5C86A 2NY0B 4OLEA 3MLRL 2J6EL 4JFOA 2CUIA 4EVNB 1IC5H 5INCB 2DM7A 1U6AH 4ZUTB 3VWJA 3D87B 1H9VA 5CSZA 1FO0A 4O2EB 4X9FA 4LCUA 4N9OB 1BBJB 1NEZG 2XY2A 3N1GC 4PJGA 4XNYL 1BM3L 4KK5D 4IRZH 1JGDA 1GIGL 4JRXA 5FYJH 3ARBB 4YC2C 2XI9A 3W39A 1JPTL 1KLGB 1G9MH 8CGTA 2OK0H 5C0AD 1BD2A 3DSFH 3V4PL 2OZ4H 4GRLB 4IHOA 1K9TA 4OFYD 1ZLWK 1P9MA 2D7NA 3S3JA 5FUZH 5FUOL 5DJ2B 5MP6H 4L4JA 4MJIA 4UV4H 4X5WB 5LWYH 4PGDB 4X0KB 1KIPA 1N8ZB 1VACB 3QO0B 2CK0L 4QHKJ 1ZT4A 4Z0XA 3MGOA 3WFEH 4ALAH 1HI6B 3IS1X 4PJGE 3B5GA 3KPLB 4QRSA 1HXYB 4ZFOA 1U3ZA 3K2MC 3HNVH 4JRXE 2QADB 3HPJA 4GQ9H 3SO3C 4RWYH 5CJ5A 1P4IH 1EMTH 1KJVB 3G08A 1BD2E 1NCDH 1PZ5A 3LHPL 4XPBH 3ZSTA 4NO2A 2H2PC 3L95B 5T1MB 5LGHH 3VGHA 4JJHA 1WISA 1AQKL 1IAII 2IBBA 4FRWA 1V3KA 3DUUB 4RDQF 4YC2B 4MJIE 2A6DB 1FL3B 1JRHI 3O3EB 2Z0BA 3SGKA 1CVSC 4Y19D 4PJAF 1DLHA 2X4RB 3DVNA 3EBAA 4QCIA 1NGZA 2R8SH 2HT2C 1IM3A 4YHZH 4MXQD 4YHYC 5IVNA 4JQIH 4D2NA 2VQTA 4ELMF 4N8VG 5KJRL 3DV6A 2NY5C 1VB9A 2BDNH 1UA6H 5EOCL 3QZWG 1HHIB 1FNEB 2Y4SA 1HYRC 4YFDB 1UJTA 1A6UH 1N6UA 1JWMA 4X8XA 3OSKA 1Z3GL 2L4OA 3MNZB 2BJML 4OGYL 1N0XH 4FQQA 4HXAL 4P2RD 1AY1H 4HLJA 3SO3B 3U48A 1FSKB 1QLFB 5JDSB 1JGLH 4J23A 4ZSOA 4FFZL 1RZ8A 4P2QB 3T65A 3CUPA 2NYYC 4XH2B 1LD9A 1MJUL 1QSVA 1UKTA 2MKLC 4Z78B 2YUZA 4U1KA 1T66D 2FJGA 3B8YA 32C2A 1FNGA 1LO3L 5INDB 3VMOA 3NMEA 2OL3A 5IHBA 4MQ7B 3CPLA 3OKYA 1GVIA 3CDFA 4R3SA 2BVQB 4DWHA 5CD3B 1MHPH 3CVHB 4YIQB 3GKZA 4JANB 3WFBL 1OAUH 4ZXBD 5GSRB 4XC1H 4ZSOE 3FT3B 2YK1H 3DIFB 4Z76A 2E8ZA 1A0QL 4S1DD 3MBEC 4JFZH 4M61A 5DK0B 1MFEL 1R3KA 2WBJC 3GJEA 1G7IB 1L6XA 1WZMA 4PRNB 4DTGL 4LBEB 3ILPA 3T1FB 3V0VA 4O5LL 1FBIL 3WUWB 4JJ5B 1HSBA 3F8UB 3SOBH 1NGPL 4R0LA 3TA3D 3SE4C 1Q9WB 4NDMB 3BWAB 3HC3L 1YMMB 4DGVH 4XMKH 2IPTL 2R1WB 4YHMH 3U46B 2XRAL 5EO9B 4IS6B 1NDGB 2FDBP 1TZIB 1CS6A 3EFDH 1F4YH 3MV7A 3SHSA 3LZFH 5E5MA 3FRUA 4PJXF 3IGAB 4XCNB 1A1OB 4JKKA 1S7WB 4OI9A 4B50A