1NFIB

I-kappa-b-alpha/nf-kappa-b complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
b'SNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NF-KAPPA-B P65
publication title Structure of an IkappaBalpha/NF-kappaB complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (transcription reg/ank repeat)
total genus 19
structure length 107
sequence length 107
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfiB00
1FZMA 1GGYA 2CSPA 1CGXA 2IFFL 2DTMH 3GJEA 3E3QE 3ES6A 5C0DB 3JWDH 1QRND 4PJFA 4RMVA 1NQBA 3GSRB 4F9PA 1WICA 4OLXH 3RZCC 3RUGF 3KPPB 5DUML 1BVZA 4CU6A 3I2CL 1UH4A 4MHHG 4HKBB 5HVHC 1G6RH 3FQTB 4XT1C 4OQTA 1UB6B 1CFBA 4KXZI 2Z93B 4LQFL 3DX9B 3VMNA 3BRDA 3GMNA 3NABL 4QCIA 3H8NA 4WCYH 5J13C 3S97C 4OFIA 4WHTA 1RZFH 1OAYL 5D4QA 3LKPA 3HUJE 4LHQB 3EBAA 1IBGL 1C5BL 1FORL 5D7JD 3RU8L 4G80B 4EJ1C 3FRPG 3HUJB 1N59A 2R4SL 4LSUH 2VDNH 3W5NA 4XPAL 5C0AE 5EDXA 1A9EB 3QZWG 4UINH 3KAAA 4Y2DB 4FOMA 3FFDB 5I2IB 1W72B 5IG7B 3BGMB 5IQ9A 5MP6H 2NZ9D 4J4PA 1ORQB 1RQ5A 5TFSH 1S7SA 2YC1A 4E41A 3MRKB 3QDGA 3TVMA 4P4RA 1IM3B 4GW1B 4XPBH 1R0AL 3RNQA 1DQDL 3EYUL 2BNRE 5FGBA 4MA8H 3IRPX 4N8PA 4FZ8H 3CXDH 1JPGA 1L6XA 4KKLD 5DD5H 2BNRB 4HLZG 4HQQL 2ARWA 1BBJA 3G5VB 4P5TB 2YD2A 1RVFL 5I1KH 4O51A 2F54E 3QEQA 1WZLA 1SM3H 3QWQB 3U4BH 1YEDB 3WKML 1G6RA 3ARFA 2DM4A 4KZEH 4GMSL 2H32B 2ZOLA 5D7KE 2WM0A 2F54B 4JFFD 1U3HC 3UTZA 4HK0A 4EUPB 3ZDXE 3VI3F 1JNHA 1LP9F 4JR9H 5IBLD 3GGWB 3B8SA 4OIAA 2HMID 2B8OT 5ERWA 2FB4H 4NQEE 1OLZA 1Y18B 3HC4H 1BZ9B 3UDWC 2ESVD 1I1AA 2LTQB 3CAFA 4OI9A 3QUXB 1C1EL 4NQEB 4IRZH 2VR5A 1QSEE 1VACA 1JK8A 5FIEA 5T1KD 1KXVC 3MGAA 1TJIL 3OXSA 2I25N 3O6FB 3NFPB 4AEHH 4U6HB 1QSEB 4P23A 3BRFA 3BDYH 3QEGL 3L3KB 4IDLA 1A14H 2HVKA 4MYWB 5I1DA 2HWZH 4BFBD 4IMKC 3WFEL 4GRWE 1CIUA 4Z7VF 2VISA 1E0OB 3VXME 2H9GA 4GRWB 4LKXA 4M7KH 3T3PE 4WW1B 2NY2B 5DMKB 5SWSA 3VXMB 3GSUB 1DEDA 1EFXA 1V7NL 4MJ6A 1IKNA 4WI8A 3MBXH 4TRPL 5DMIH 2R0LL 3PGFL 4DN3L 2VABB 4F7EA 4MVBC 1FCGA 2R2BA 1FG9C 1BMGA 4V2CB 4I0PC 4LHUB 5C70A 5DJXA 2DMKA 4O2CA 5JPNA 1DLHA 1MHEA 1WCQA 1P7QD 3KLDA 1QSFD 2IAMD 3GO1H 1U92B 4JO2L 5H94B 4I18C 12E8L 3PQYA 5J6HB 2BJML 3L6FA 5DWUL 3VE0A 1I8LC 4NP4H 5GRJL 3O8XB 4CNIA 2A83A 2DKMA 2MOVA 2ERJB 3GBNH 4M93B 2C1OB 3O0RL 4X0KB 3BHBB 2CDEA 5T5NG 3BH9A 4WW2C 4KAQL 1KIRA 4M62L 1KIPA 3QH3B 3FQUA 2BSSA 2IGFH 3V0WL 3LS4L 2DQFB 4WIQA 2QSVA 5E2WH 3DGGA 2P5WA 1YECL 3HZMB 4JLRB 4JM2B 2CMRH 2J8HA 2CPCA 3RVWC 4N5UA 4YHLH 4LKCA 4Z7UF 2IPKB 3MV8E 4JO4L 4WHYH 4KRPD 3BRGC 5F8QC 1AE6H 4KGLA 5E7BA 1OSZA 3O4LD 4K8RC 2XPGA 3MV8B 4NRXB 3LQZB 3IVKA 4X6BB 4R2GB 3VWKB 3SY0A 4UOW0 5GGTA 5FDWB 5C9JA 3CJJA 5E8DH 4PRBA 5C08E 3CC5A 4OSUL 5TGBB 1EO5A 3QJFB 1KJ3H 2V9RA 3IJYB 4JZJA 3OKMB 1PGRB 3QA3A 5C08B 4Z0XA 1NEZA 4AQ1B 4DAGH 5JIIA 1F3JA 1AHWA 3L5IA 4TPRL 2KPNA 4NRZA 3TJEL 5ADPH 3V4VL 2XG4A 2I07A 1RIHH 2UY6A 3VWJA 3RZCB 4XP6H 4M5ZH 1DEEA 4GBXC 3O6LH 3RVVC 4Y5YC 5HVHB 3PWVB 2P45B 5GHWL 1BAFH 5A2KH 4LVHC 4XCEB 2WP3O 1LO4L 5GXBB 4XCYB 3BDBA 3VFWB 1UWEH 2WW8A 4FQCH 4JFDD 4PGCB 1I9EA 3SJVD 3PL6D 4ZTPH 2XN9D 5J13B 4Y4HA 4S1QL 3ARSA 3CXHK 4JPVH 2EC8A 3BZ4B 4LLWA 1XH3B 4NQVB 1YEKH 3R0MA 1HILB 1AXTH 2CDFA 1M1SA 3H0TA 1P5VA 2H26A 2NW2A 1JHTB 5IVZB 1Q9KA 4UQ2A 1AD9B 2AEQL 3O6KL 1XCQB 1GHFH 5C71A 3PP3H 3RWGB 4V2BA 3D6GA 4OZ4A 3QO0A 3BKCL 3QUYA 1JI2A 4I0CC 4KPHL 1G7MA 2VIRA 3CZFB 4AT6A 4NJAH 1ZVSA 4ZMAT 3QRGL 3FCTB 3SDYH 1YJDH 4HUUB 5GGQL 1DSFH 1KPUA 3TA3D 3CDGA 2E9JA 4KJQC 3VFRA 3W0WA 3D2UB 3MX0A 3BKMH 3T3ME 5GGUA 2VDMH 4DGVH 4LASL 1F4HA 1Q72H 5E7FA 1MCBA 1K8IA 3OKDA 3PXJA 1ACZA 5GIRB 3QFJD 1U8QA 1U93B 5L6YH 2GHWB 3S98A 5ENWA 3L1OL 3VRIA 1AJ7H 5JR1H 2K9UA 2FEEL 2IPUG 3RPIA 4I1NB 1G9MH 1RZIA 2NR6C 4KTEL 1A1NA 2CXGA 4TUKH 3RNKA 3P11L 4DKAA 5K9OB 3L7EA 4L3ED 2Z35A 3CFCL 1LK3L 3BX7C 3DMMC 1WFNA 2X7LA 1D9KC 1LO5B 4HFWB 2CO6B 3CUPA 2HT4D 4NNPL 1I1FA 1MQKL 2J5LC 3N1GC 4HUWA 3E6FA 3TNNA 1UZ8B 1EO8H 1UKSA 3PWNA 2QSCH 1OAQH 5JW4M 5EZOH 3ZKQD 4Y16C 3WS3B 3QWOB 1OGTB 1T21A 4HIXH 5L7XH 2AJSH 5ISZE 5H8DA 2ATPA 4JO1L 5I1LB 2NW3A 3UTSA 3V7AE 3GHBH 5ISZB 4HGWB 4NNYB 4RAUB 4C56E 1KCVL 2DBLH 1DBJL 3DVGB 3LN4A 2BNQE 3ZT5A 4JFQA 1OSPH 4C56B 4OZFG 4WNQB 2BNQB 1JGVH 3TBVB 5KVFH 5IVXA 1MCJA 3CK0L 3K2UH 2RFXA 4OD3L 6FABL 4U6XB 5L8JB 4PB0H 3MRCA 5FKAB 3N85L 2VRAA 2ADGB 4P5KA 5A1AA 4U1LA 4AK1A 3KJ6H 4I0PB 1NMAH 2OYPA 4PJDF 2MHAB 3SKUD 5IQ7H 4WFFE 4RMQA 5C09A 2Q8BH 2AJXH 2ZSWA 4YDKL 3NN8A 5DRXB 1U8OA 3VH8G 2W60B 5HPOA 4LCCB 2AABL 5BS0D 1FLRL 1JV5A 4DZBA 3MJ8A 4D0DA 4RDQG 4GW4A 2Q87A 4R96B 3ZYIA 5ESAB 2XY2A 3V4UH 2Y1VA 4V1DE 2VLJE 4XB8A 4PJAE 1I7RB 1WZ1H 5E24E 4OFPA 4WW2B 3V79C 3PGCA 3KPRA 4V1DB 3ZE2F 2VLJB 2DQHH 3MOBH 5C0IA 3LEXB 4PJAB 1CFTA 1NUDA 3UTOA 4YGVB 1LE9A 5CZXC 3V6OC 3BPCB 1EDQA 3KS0H 4WV1C 1BQHG 1IC1A 4XXCA 4JQVA 1RIVL 2Y06H 5KG9B 3LPGA 4NQSA 2R29H 1P4LA 3HZVA 5J1AB 4CW1A 3SE9H 4NBYB 3TPUB 4LLDA 5I66B 3KLAB 1IAMA 3WFCH 4HHAA 1MFEL 2V2TB 1RK0A 2MQ0A 3E8UH 3LCYA 1A0QL 3O41A 2HFEA 3DNKA 5ALBL 2HVJA 1YEIL 3ARDD 3L7FA 3KLSA 4LPVA 4PLJD 2LE9A 1SVZA 4NC0B 3ZKSD 1U8LA 3LS5L 3GRWH 1HEZB 3C5SA 5JHDB 3ROLB 4OCYH 4P46D 4XH2A 1MF2H 3O3AB 4GBXB 4X5WA 2BSTA 4PJ8D 4Y5YB 2YWYA 5SX4I 4U1JA 3V5DB 3B9AA 4LVHB 1XF5B 5F1OB 2FHFA 1CGUA 3H9SE 2A2QT 2PO6D 1NSNH 1WSST 4QWWC 3H7BB 4DCQB 3H9SB 4OI7A 2XRAL 3KPNB 3VXUE 5K59F 1I8KA 3LSOB 1ZAGA 2AV7B 1CGSH 4ETYA 1LWRA 4ZOCA 3QJHB 8FABB 2A9NH 1T1XA 3VXUB 1CXIA 3QXDB 3T65A 3LVEA 2Q7NA 1DBBH 1WCBA 3WXVL 5LXGL 2HLFD 3WD5L 2OLDA 4LCUB 3ZKXB 4FABL 3GMPB 3A6BH 3STZA 2QKIA 1M05A 5IHLB 2OL3H 2IPTH 5F1NA 1OW0C 5F7HA 1ZVYA 3BIAX 3O2DH 3GJFB 3Q5YA 3SDAD 3MRNA 4KDVA 1AGDA 3RA7L 1EZVX 4XRCB 2FJGB 5FYKU 3L3HB 3VCLB 4MNQD 2Q8AL 3C60C 3C8KA 1X5IA 3W5MA 4KQ3L 4LSQL 3SOBH 1EVUA 3L3DB 3QPXH 1F8TL 3K1KC 5DJ0B 1MHCB 1KGCE 2CLZA 1JGEB 4U1KB 3MLWL 3B9KB 1IC4H 3BAEH 1IARB 2NX5D 1DVFD 5CJOL 1LEIB 2HA1A 4HLJA 3U0PA 4PRPD 5B4MC 3V4PL 4HUKB 2IH1A 4MJ5B 1QNZH 1NC4A 2F53A 4LNRA 3O45A 4UT9L 2WBWB 1HH6B 3MNZB 2VXUH 2NZIA 5I17B 1CICD 4KK6D 2EDJA 5CINH 5EOCL 4MD5B 1A6ZA 4G7VL 4LOUD 1UQSB 2VDLH 4B7LA 4L5FL 3ZSTA 1QG3A 3F6IA 4DKFL 3VXRE 1YN6B 4G8GD 3RWDB 2R1YA 3GSQA 1D9KB 3UC0L 3VXRB 2OQJA 4XB7A 2FATL 3O2DA 4KU1A 1T6WA 4M00A 3BISA 1XIWD 2HT2C 3T1FB 4FFWC 3RZWA 2R4RH 3D0LA 3CCHA 3ZTJH 1KLUA 4Y16B 4R97C 1BZ7B 1F4WL 4N9OB 5D71L 5HGGS 2VLRA 4YZFE 5BZWB 3ZMRA 4TTDD 3MBEA 1FFQA 4GQ9H 2E8ZA 1RJLA 3IS0X 5EN2A 3SCMC 4UT7H 1K8DA 1A2YB 3AVEA 3KYAA 5E94A 1JE6A 1LNUA 4M6AA 3GSVB 5ITBH 4KV5F 1NBVL 1QA9B 3EYVB 5DJ2A 4OCNC 1ADQH 5E1HB 3VGDA 2VL5A 1RZKH 1MFDH 2PCPB 4HXBH 3U46B 3GKZA 1BOYA 4L8SA 2GIYA 3G6JA 2GI7A 3JTTB 4JPKH 3AREA 3O2VH 3HZKB 4P3WA 2AJ3A 3DVFA 3VJ6A 2PUQT 3RIFK 4J3XA 1A3RL 1RZ7H 1DLFL 2DJ4A 5AUMB 1YQVH 5J1TC 2IJ0C 4PRIE 4YO0A 2WWMC 4W4OC 3GSNB 4UB0H 1T66D 3MUGA 3R0NA 1FZJA 2HKFH 2YUVA 2DQDL 4PRIB 4DFIA 3V6OE 5D93C 2VZ1A 5BCAA 4KKAC 4YHPB 1I9JH 1A4KB 4PJEE 2X1OA 3GSXA 1T0NB 3EYSH 1AY1L 1GZQA 4U31A 3BW9B 4ZFGH 4P5MA 4S11A 5DF0A 1HOCB 1MCKA 5EU4A 4JRYA 2OR9H 5T3ZE 2BVOA 5SWZD 4X5XB 5JZ7C 1AXIB 3LKOB 3QDMD 4P4KC 1D7FA 4TVPH 1I7ZB 1HI6B 3DBXA 5FO7B 2ZG1A 2X2YA 3MTRA 4RX4A 3FN9A 4N8VB 2QLVB 4QRQA 5B3JF 5BVJA 5EOTA 4WJ5B 1T03L 3WCYA 3T2PA 1KELH 1KN4H 5T1LB 1NLDH 5H2BA 1DL7H 5EU3A 3WLBB 3RDTC 4O00A 3S34H 3RWHB 4KI5C 4WUUD 3NTCL 1RSFA 1RMFL 2YD6A 2KZ1B 4WWKA 1VESA 3QNYA 5IMMB 4S1RL 4L9DA 1EUUA 1WK0A 2XQYG 1CYGA 4K7PH 2BY2A 1YEJH 1NFDF 1R3LA 4JZNB 1FFRA 3FQWB 5CSZA 4JFPB 5TDNA 1RIUL 2H6PB 3BXNB 3T0ED 4QTHB 4XCNA 4G5ZL 5I16A 4MQXD 2X89A 3Q1SL 2EDLA 5I71C 1PY9A 2XFXB 1MI5A 4KH2A 2B20A 4M7LL 5JW5A 1LVEA 2ADFL 3RIAK 1P4IH 4QHKI 5F89A 3SO3C 1PZ5B 4AIZB 4MAUH 5EZJB 4YXLH 1NAKH 1P1ZB 4GXUN 3C60B 1BGXH 4EVNA 3C08H 1QTYT 3VXTA 4FG6C 4M03A 3THMH 2EYSB 1H5BA 2VC2H 1D5BA 3O4OB 4JGJA 4BKLB 3HS0A 2CIKB 1NFIB 4GAYB 5F7YC 1NGQH 5TQ0L 1KB9K 1KUMA 4HIJB 4OD2A 4W4NA 1IC5L 5IB1A 4KK8C 4L29B 3QG6A 3ARWA 1HHIA 1JF1B 2Z4QB 4R7NA 3LIZL 4XBGA 4YPGB 4TYUA 2X4SB 5DI8B 2V17L 2PYEE 1A3LH 4UT6H 1WFUA 2OZ4L 3DHJA 3P2TA 2Q86B 2PYEB 5I1IL 5TE6H 3CX2A 3MRMA 5EO9B 1NCAH 2XOTA 2ADJB 3JTSB 1FFNA 5GS2H 4MS8C 4PJBF 4HSQA 1U3JA 3HN3A 5I1AB 3FJTA 1NMBH 1EGJA 4Q2ZA 2IFFH 4G6JL 4HWBH 4J4PD 1AGBB 1Q0YH 1H3TA 4E41D 2BNUB 3TVMD 3JWOL 2P5EE 4OLYL 4Q74A 2W59A 4HS3B 4GAJL 1DR9A 2OTUB 3ULVD 2A0LC 1Z0MA 4R90L 2P5EB 3MNVB 3SCMB 3H42H 3U4EA 5LWYL 1T7XA 4PJGA 5HTSA 1DQQB 5IROA 3AY4A 4LPTA 1SY6H 4P2CG 2R23B 3KPSD 3VMOA 4HKXB 3ARQA 5ESVB 2HT3D 1J5OL 2W92A 4JHAH 3U6RB 1C5BH 4Q97A 3DIFB 2VLKE 5GSVB 2R1XB 1FL6B 2NY1C 2ZKHL 1AQKL 4ZSOE 5FGSA 1NC2A 4DKEL 2GKIA 4AM0A 3RVXD 4LPCA 5DQJA 3LRSB 3TZVA 4ZSOB 43CAB 2GFBB 4OCSH 1MAMH 4X4YB 2AI0H 1CD1B 4ZUVA 1MY7A 4O2EB 4Z7UE 4CMMB 4MDIB 4F33B 3CPLB 1U6AH 1FFPA 3FAXA 3OX8A 1I1AD 4MQTB 4DTGH 4YWGL 3S36L 5JQ6L 2CK0L 4Z7UB 4OUUA 1DQDH 3EYUH 1ZK9A 3FZUD 1DP0A 2GAZB 2AKRB 3BVNB 4HQQH 4ONGL 4X5LA 5D8JL 5D93B 2DTSA 3FHQA 4X6CB 1BQLH 5FA4A 4ZUSA 4XNXH 4F7MB 2OR8A 5D7JC 3P40A 3P73B 3CFKB 4JKPL 3BQUB 4GMSH 5C0CA 4G7YL 1QLRB 1U3ZA 5SWQA 5F1KC 2R2HB 2FWOB 1IAIL 4O9HL 3C5ZD 4TNWK 1SY6A 1Z9LA 3GUTB 1CL7L 2NZ9C 1GC1C 4H26B 5DQDL 1H8OA 1INQB 3U7WH 3MLSH 2DLEA 5GRVK 4P4KB 3T77A 4YE4H 3MRLB 4R3SA 3LV3B 4ZD3H 4HIHA 4AIXA 1DBAL 4QXUH 2FHBA 4K7FA 4YDIL 1FNFA 1KPRB 1C12A 2HRPH 3WFDL 1YPZE 4KI5E 4G43B 3HAEB 4KKLC 2F74B 1TJIH 5E8NA 5EBLB 4LF3A 3D25B 3ROOB 4YPJA 5ESQA 1YPZB 3CH8A 5IIEA 5E1AA 2DIAA 2YPLA 5DTFA 3LQAC 4D9QE 3QP3A 1E6JL 3WHE1 2VZSA 1NGWA 4LLQB 5DJZB 3WFEH 1ROWA 4DW2H 4OZIA 3F8UB 1L9NA 1JWSB 1N5AA 1IGCL 1AGEA 4RQQB 1KCUH 5F71A 5IJVA 2CGRL 1XGTA 3HMXL 2NY0D 5JA9A 5IBLC 3CDYA 2HKHL 4LSVL 4NO5B 1V7NH 2HMIC 3V52H 3KPPA 2F58L 1QFUL 3MJ7A 2ZOKB 2W65B 4HKBA 2R0LH 3FQTA 2OMBA 3CX5J 4YFDB 4DN3H 1UB6A 1JZ5A 2P5WD 5IHUL 4XVSH 2Z93A 5EU5B 5L9DL 4WY7L 5I71B 3VI4F 4HD9A 1G6VK 2YPKB 2R1WA 4HLZH 4KZDH 2EE2A 1UXWA 3SO3B 4QXTB 1ZLSL 4G80A 1NL0H 3HUJA 4JJ5B 1FBIH 3N9GH 4YX2H 1CFNB 4JO2H 5C0FB 4PV8B 1A9EA 4N0RA 4Y2DA 3FFDA 4CN4A 1W72A 5I2IA 5C0AA 5IG7A 2L4OA 4HJ0D 1P6FA 3JV0A 2XI9A 4PLKD 1D6VL 3O0RH 4PBVC 3VFSB 4JFHD 1JMXA 4MZ2A 1IM3A 4KK9D 1J11A 1NCDH 4XBEL 4GW1A 3LS4H 5T3XE 2VXQL 3OR7B 2V5SA 4XPGH 2BNRA 5FGCE 4TNVK 2NNAB 1ZANH 3SGJA 3OAUH 3G5VA 4P5TA 4RMTA 3DYOA 5CJXA 5FGCB 2IAMC 3EDEA 3LEYL 2X05A 4CGTA 1GJIA 2H32A 5KZCD 1A5FL 3MRPB 3S37L 3WNPA 3MV9A 4BQ6A 3MLVL 3NCFB 2XZQH 4OSUH 1TPXC 2SEBB 3R1GL 4OLUH 3ARXA 3GGWA 1BFVL 5DA4A 2VTFA 4YHMH 1EGJL 4YAQB 7CGTA 1DE4B 1DN0B 4TPRH 5CCKL 3V5KB 1Y18A 3V4VH 1BZ9A 5DT1H 4YHKH 3KPMB 1ZSDB 3MRHB 2C1PB 3QUXA 4NQEA 3TIEB 3JVGA 1BIIB 4K9EL 5HD8D 4G6AD 4I77H 5FHAH 4ZFOA 1UCBL 3O6FA 4GKZB 1FPTL 3NFPA 1R3JB 3QXAB 1QSEA 4KRPC 5EUKB 3L3KA 2P49B 3UPRB 2CO7B 4G3YH 2WWKO 2N4IA 4LP4A 5F9AC 5DHYA 4WW1A 5CILL 5DMKA 3UTPD 3VXMA 3GSUA 5SX5H 1JZ7A 1KTLB 2VLMD 1QRNE 5FYKL 4GFTB 1TNMA 2DBJA 5F6HJ 1FGVH 2AEQH 5ICZA 1HINH 1RU9L 1QRNB 2VABA 1IGIH 2B1AL 1CGWA 4KY1L 1NGXB 2WUCL 5ANME 4W6WB 3BKCH 3RL1A 3SE4A 1AFVL 4LHUA 5C86A 5I18L 1IL1B 5DSCA 3V8OA 2K1MA 4L9LC 5ANMB 3QRGH 3PL6C 1U92A 4X7DC 2AGJL 1N7ML 3IDIB 4XNZC 2O5ZH 3B5HA 4U7KA 2Y5TB 3ZT6A 1UM4L 1S9VB 4Q0XL 1HSAB 4DZ8B 4EDXB 5D7JB 2YSSB 4PUBL 4HJGB 3O8XA 1RUAH 3MUY1 2C1OA 4X0KA 3W11D 5EORL 3L1OH 3SGEH 2RHEA 1SBSL 3O9WD 4NHUB 1IQDB 2DQFA 2A6DB 2NLJB 3EO9L 5GRWA 3WFBL 3UTTE 1B0GB 1F6FB 1PJ9A 3KG5A 4FHBD 4JM2A 3UJIH 4LU5H 1FNGA 2PN5A 2IPKA 4NPYB 2AJVL 3U9PH 5K59E 3MV8A 4NRXA 1KB5L 4HUVB 3E6HB 1K85A 1JPFB 1XF3B 3B9EA 2ICCA 1MQKH 3TA3C 1WF5A 3LRGA 5FDWA 5GRVL 4EUPG 4JFFE 5TGBA 3QJFA 4Z78B 5JW4R 1BHGA 2VXTL 3IJYA 1PD6A 1ZMYA 5BXFA 4DVRH 4NZJA 3S88L 5C08A 1JRHL 4JFFB 3U2SB 2IQ9L 1EFQA 3QUKA 1B2WH 1TJHL 1MSPA 5EIIB 4EOWH 2NMSA 3OBAA 4LLYB 4XWOD 1IAOB 3ULUH 3IFLH 1ED3B 3RZCA 2C4FU 1MFBH 3NGBC 3PWVA 2ZUUA 1QRKA 1QLEL 1VEMA 3MUJA 1PKQE 3CK0H 1H3UA 4OGXL 5EZIL 3VFWA 4NGHH 4PGCA 3N85H 2NY7L 2WLYA 4OGYH 1PKQB 5T1KB 3HE6D 1FO0B 5CIPB 3SN6N 3T0BA 4E0RB 2HT4C 3TO4D 5JW4N 5DD3L 3BZ4A 4OCLC 1XH3A 4ODSH 3BIKB 3C8HA 4NQVA 4YDKH 4HS6B 4IBLT 5DFWH 1T89A 2Z31B 2AABH 1FLRH 1QFWI 1F58L 3LRHA 1GGIH 1CLZL 5BO1H 4TVSa 5CAYB 5JHLL 1JHTA 2ZZUT 5IVZA 4OCRL 1AD9A 4URTB 4APQB 4JB9H 4PTUA 1I75A 3OXRB 1NGPL 4Y2OA 3RWGA 1OAXL 4HMDA 1T4KB 1X5JA 5AAWA 3P77B 2YA2A 4GH7B 2B4CH 4F80A 5C2BL 1EJOL 3RL2B 4PB9L 4X6FB 4GG6E 3SDDD 3QCTL 3EJJX 3FCTA 2DLFL 1Q0XL 4HUUA 1EA9C 4I3SL 4JQXC 1LILA 5DLML 3ZE1E 4GG6B 3WUWG 1RIVH 2IQAA 1CIDA 3D2UA 2QQNL 3X17A 1P7QB 3QNXB 1I7TA 1U2CA 3IDJB 1QSFB 2IAMB 3VFGL 4BZYA 2X9YA 2EECA 4GJTB 3P0YL 3IFNH 3L3OB 4Z7WF 4ZUTB 5DHVH 2OI9C 1I8MB 3U0WH 4CADB 1TPXB 4KV5E 4RGOL 5B39B 4I13B 1XF4B 3TP4A 1OWRM 1OAKL 1OCWH 5K9OA 3UDWA 5DYOB 3EOBB 2R0KH 1N4XH 4WTZG 1LO5A 1JIBA 1MRDL 4HFWA 3O4LE 5CSBA 2VAJA 4KRPB 2BP3A 3O4LB 1HN1A 1UZ8A 1HQRA 5FK9B 1EK3A 5IFJB 4IMKA 4DQOL 5HYSB 3WS3A 3QWOA 3KR3H 1N6VA 3C6SB 5I1LA 1ZKAA 5KN5B 4FZEH 2DQUL 4HGWA 4U2YA 3UROR 3DX8B 4RAUA 5BOPA 1NC4D 2F53D 3QUZD 3DVGA 4IS6B 5A2IH 3ARDC 2RGSA 1ZGLM 3DV4B 3VW3L 5BV7L 4C56A 4WNQA 5GGSY 2BNQA 3TBVA 3T8XB 1Q8MA 3U79A 5DHVA 5E5RB 4U6XA 4P46C 1QUNA 3CD4A 5FKAA 2ADGA 4B5EA 4PJ8C 3BPOB 4JFDE 5IFHL 2Q8AH 3QIUD 3SJVE 4LSQH 1PEZA 2MHAA 2XN9E 4L9LB 2PO6C 1U8JA 1TFHA 4JFDB 4LSTH 4OJFL 4PS4L 3SJVB 3CSYB 3PL6B 3IU4L 2XN9B 4OB5H 3GI9L 1X5FA 4KHTL 5DRXA 1ZOXA 15C8L 1E4KC 2XTJE 4LCCA 3WV0A 3ZYZA 4BH7B 4G8FB 4KQ4H 2NPLX 5ESAA 2HLFC 1I7RA 5FYJU 4WW2A 3V2AR 3RX7A 4V1DA 3WIFA 3LEXA 4PJAA 1AO7D 1OB1B 1OF2B 5D70H 3PV6B 3SDAC 1KCRL 4G7VH 5EUOE 1DQJB 4YGVA 2YPVL 3AFLA 3X12A 4BQ8A 4L5FH 2EE3A 5EUOB 5DK2B 4R4FH 3LB6D 4NSKB 4MJ4A 3X13B 3WL9B 1TMCB 2OK0L 1JWMA 3P0VH 4TQEH 5J1AA 4WVRA 2G9HB 3GNML 5I66A 4ELME 2V2TA 4Y89A 1DVFC 3ARED 3FB5B 4ELMB 5MEND 1F4WH 5E00B 2G2RB 3HE7A 2EKJA 1V05A 2FGWH 5D72L 1A8JH 3BD3A 4OGZA 4AEFA 4NC1C 1CICC 4KK6C 1HEZA 3TV3H 3ROLA 4MB4A 1OLLA 2J6EL 2FR4B 4LOUC 3O3AA 2XKUA 4ZUUB 4L3EE 3ZDZF 1S7UA 3UBXB 3V5DA 2WQRA 1BPVA 1XF5A 5DVOA 4L3EB 3MLRH 4K23H 3GJFK 3H7BA 4DCQA 1UH2A 3H9SA 5B38B 3NACL 3T2NH 2AS5M 4JRYD 3MYJB 2WSKA 1XIWC 3LSOA 2AV7A 2CJUH 5EOQH 3TWCL 4JFOB 1BM3H 4RWHA 5E2JA 3QJHA 4U1NA 8FABA 3VXUA 4M5YL 4JVUA 1UYWL 3QXDA 1IKFH 1ZT1B 2ZUWA 4EZMA 5HXMA 4RX4D 1TCMA 4LCUA 3U48A 1BBDH 1GPOL 4TTDC 5JA8B 4OBRA 1GAFL 3RVTD 4I5BB 1WLHA 4BSWB 5DK3A 5BVPL 1FC1A 2DQDH 3CLFH 4XRCA 1K9TA 2FJGA 1ZHBA 5C0GB 3DVIA 3L3HA 3OPZH 3VCLA 3VMPA 3IF1A 3L3DA 3W9EB 5DJ0A 4U1KA 1XGUA 1JGEA 4P3DA 4XTRD 1U8IB 1EHNA 1IT9H 2YMXL 5HYJE 2EYRB 4NZRL 3B9KA 4KDTA 4KK5D 5AZ2L 3W39B 3E0GA 4GKNB 5HYJB 1LEIA 5BS0E 4C4KT 1T7YA 3EYFA 5CJ8A 5TF0A 3TJHD 1HKFA 5BS0B 2OI9B 4MJ5A 5E03A 4QYOA 5D9SB 1MIEL 4WU5B 4XP9H 4Q9QH 1SYSB 4L8DB 1HH6A 2AAVA 2DDQL 4ODVL 5I17A 3BT2H 4AG4L 1T03H 2ZP0T 1T66C 1MI5D 2J4WH 4PJHF 2X4UB 1TVHB 1T0MB 1NKOA 4HCRL 5EBWB 4NQUA 5MEQB 1YN6A 3NTCH 2I5YL 5CSGA 4BQCA 2W0PA 4NM4H 2V5MA 4W6XB 1NUFA 4LRNL 1L9MA 4FN0A 3H3PL 3V8CA 3T1FA 2J8UA 5E4IA 1NAML 3IAPA 4HJJH 5EBGA 3H9YA 1BZ7A 5BZWA 2GSIA 3SKOB 4GXVL 1G7QB 2DRUA 3AXLB 4NZUL 3SQBA 2X1QA 1OT2A 2I60H 3QNZB 4QHKJ 4J23A 3SKJH 5BJTB 3ARDB 5E6ID 1CFVL 3GSVA 5F88B 1QFOA 4P9HH 4M7LH 2ADFH 3HB3D 1QA9A 5GS0H 5T3ZH 1REIA 4PGEB 4M3KB 4P46B 3KDMB 3BO8A 4PJ8B 2QHRL 4MNGE 3VDBA 2PO6B 3U46A 4U0QB 4AENB 4G6KH 2VDKH 3CDCA 3EDDA 3WFHB 4MNGB 3DO7B 3JTTA 1GIGL 4DOHE 4G9DB 4JKMA 3MA7B 3HZKA 1G7PB 1Q9WB 3UZQA 4DOHB 32C2A 5AUMA 2IADB 1IC5H 5HHOE 2FO4B 1IC7H 1L4IA 4GAGL 4LDOB 4MQXC 3GSNA 2CR3A 3A6CL 3QEHB 3QT2A 1IEBA 4PRIA 1CF8L 1OAZL 1MHHB 1ZLWK 4UV4L 2R56L 4UOJA 4YHPA 4XCCL 2QL1A 2V17H 2D03H 3SDAB 3VFNA 5ID0B 3V6OA 1KCSH 2XY1A 3K74B 1KIUA 2OZ4H 4PJEA 1DFBH 4K8RL 4MNQB 1HOCA 5DK0A 5GZOD 3HRZB 5GGVL 5FYLL 3C2AH 3LH2L 3LKOA 3RUGA 4J1UA 5DGRA 1I7ZA 1HI6A 1EEZB 4PRPE 5FO7A 3FAWA 4G6JH 2DJSA 1DVFB 3IDXH 4N8VA 4F9PC 5DJDA 5DEGB 4PRPB 3JWOH 4OLYH 1A6UL 5TE7H 5GS2D 5T1LA 3MQIA 1JMZA 2B1HH 3WLBA 1KACB 5CEZH 4OTXL 1WWAX 1A7NL 2WK2A 3IRZA 5FYJH 1CICB 3T0WA 4WEBH 5LWYH 4YHYC 4KHXH 4NC2B 3UZEA 1P84J 3ILPB 4LGPB 5IMMA 1J5OH 2QQKL 4G8GE 4Z7QE 2X1PA 1BWMA 1JPSL 1K6QL 3Q3GB 1BOGB 1INDL 3IETB 2ZKHH 1MCRA 4OLVH 4G8GB 1XCTA 4POZD 1S7VB 2E7HA 1MVUB 1OD9A 2FIKB 1CXEA 2B5IC 3FQWA 3OAYH 4JFPA 4JREC 4KROD 3BXNA 2H6PA 4J4PC 4PRHD 4QTHA 1VFBB 5TPWL 3ZHKA 2MJWA 4X4XB 3TVMC 4TULH 1MOEA 3ULVC 4YWGH 1RUMH 2XFXA 2CK0H 3IKCB 1DANU 4OF3A 1OW0A 2DOCA 4KKBD 1PZ5A 4OKDA 3EOTL 3F7VA 3JWDC 3KJ4B 1U36A 4AIZA 5DUBB 4ZXBD 5EZJA 3I3EA 1T83A 5T5FH 3OGOE 2ZUQC 1E4WL 2YPLD 2HT3C 4BK5A 5KSAA 3HTLX 2CKNA 2YS4A 1FJ1B 3KGRA 4PGDA 4CMHB 3RKDD 2CK2A 1NFIA 3RVXC 4GAYA 1N3NA 1T2JA 5IESH 1VPOH 2V2WA 3R06B 4K2UL 1PG7L 2Y9RT 4XC1L 4HIJA 1MLCB 2FSEA 5DQDH 5GS3A 5CJ5A 1B9ZA 4L29A 2L0DA 3UTQA 1L6ZA 1JF1A 2Z4QA 1MFCH 4OI8A 1I1AC 3GMRB 1YNKH 2C7UA 3RX8A 1KG0B 1M7DA 1TZIA 2X4SA 1DUYB 4HUNB 4U05A 2V7NB 4FQIL 4EDWH 1KEMH 3B4NA 5J57B 2Q86A 2PYEA 4J6RL 4Z7VA 2MKLC 3O6MH 1UB5A 2O5XL 2NTSP 5EO9A 3GI8H 3JTSA 4ODHL 3CVIL 4JFXA 1IGCH 4ODUB 5C0AD 5SWZE 4ZTOL 5FCUL 3C5ZC 3HMXH 5J11C 4A6YB 4YHOL 5SWZB 4N8VG 1IKNC 1KBGH 2AXJA 3RWCB 3W2DH 4HS3A 2OTUA 2FL5B 4ZO8A 3HI6L 1SEQH 2P5EA 5IHUH 2EDOA 3MNVA 4H0HB 3SCMA 2GY5A 2VXVH 5KAQF 1OPGH 2VMFA 5D2LE 5FUOL 1DQQA 1XGRB 3L5XL 5I8EB 3D85A 4WUUE 4P5TD 2R23A 4F7TB 5D2LB 3IDNA 5ESVA 4FQ2L 5GZND 2I27N 5DS8B 1ZLSH 4WUUB 1MWAH 1SJEB 1N0LA 2FBJL 5GSVA 1INEL 1K4DA 4Q58C 2BC4B 3MV9D 1Y6MR 2VLKA 5D7KD 3IXTA 2N7BA 3LRSA 43CAA 4ZSOA 2GFBA 4F7CB 5D7IF 2NY0C 4X9BA 5CMAA 1D6VH 1CD1A 5KTEL 4CMMA 3T0EE 4MDIA 4KJYB 4M6OL 5AG9A 4F33A 5IW1B 3LKNB 3CPLA 5I9QC 3GSNL 4Z7UA 3ZYOA 4P2RD 3T0EB 4OLEA 1JYVA 2DI7A 3VU2A 4H8WH 3BSZL 1FL5A 3UJJL 2VSCA 2NYYD 2GAZA 4OT1L 1FP5A 4BFEA 3BVNA 1RZJH 4R0LA 5E99L 3DGCR 4AJ0A 4KI1A 4F7MA 2AERT 2ICWJ 3GEWB 3P73A 1J1XL 3BQUA 5IB4A 4TUJB 1QLRA 4XMPH 3CSGA 1I7UB 2R2HA 2FWOA 3NCCB 5I30H 5C6TL 1JUFA 5DD0L 1T1ZB 4NYLB 4JZJC 4KTYA 4PRAA 5D7SH 4HJ0C 5C92A 1BFVH 2G60L 1S5HB 4H26A 5E9DE 2OX5A 4PLKC 2RJMA 2B2XH 3MLXH 4PJFE 3MMEB 2YR3A 4P4KA 5I19H 4S1SL 2YKLH 1G9NH 3MRLA 5E9DB 1T7WA 5IB2B 4KK9C 3LV3A 4PJFB 2UWEE 1MPAL 3MGOA 1KPRA 5GRUL 2UWEB 5HVFB 4DGYL 3O3DA 5GGSB 4G43A 1LEKB 3HAEA 2F74A 3HFMH 4OD1L 5EBLA 1FPTH 3D25A 4PJ7F 5ABDE 2NY6B 5F1SA 1YPZA 4YHYB 4WHTB 3NAAH 3AS3A 2UYLA 1F4YH 3UCRA 2VOTA 5DJZA 4LLQA 1QQDB 2HFGL 4WGVB 1X44A 2WBJD 4LLMB 3OF6A 4YFLI 2X41A 5T3XH 1PQZB 4DN4H 2EIDA 1CK0H 3NIDF 1MCFA 4NO5A 1CDGA 2B5IB 1FNSL 4E41E 3SDCD 1RK1B 2ZOKA 2W65A 2Z92B 1A1MB 4JREB 2P7TB 3BE1L 3IDGA 3ULVE 1RU9H 2B1AH 4E41B 5EU5A 3TYFB 1AXSB 1CLYL 4ZO9A 4JM2D 4KY1H 4H1LB 5HD8C 4G6AC 3UJTL 3TCXA 4IRSA 2YPKA 4QXTA 3KPSE 3I02B 4JJ5A 1N7MH 1CFNA 1BBJB 5C0FA 5CBAB 2C4FT 4PV8A 3KPSB 2ZUQB 5HHNA 1MRFL 1G6RB 3P30L 2EDEA 4LVNC 2WV3A 3QQ9D 5C08D 3L95A 2E7CA 1RZGA 2PR4L 4UIKH 1I8IA 2R2EB 1HSBA 2EH7H 5JO5B 1JNHB 5IGXL 2R39A 1MCWW 5LGKA 3WFBH 2O61B 5DJAA 2X44D 1RJZA 2OBGA 1CWVA 2GJZB 2L7JA 2E6QA 4GW5A 2NNAA 2DB8A 3EOAA 1AP2A 2CRIA 5ILTL 1H3PH 4R6UA 3S35X 1EEYB 1XGPB 3FO0H 1KB5H 5I1JH 5IBTL 2FX9L 3VXPB 3WFZA 2AK1L 3MRPA 4LSPL 3OWEA 4Y5VA 5CGTA 3EZJB 5JXEA 2UVFA 2AEWA 3VG9C 4N9GB 2SEBA 4Z7NF 1CDUA 4XNYL 1S7XB 4YAQA 1JRHH 2H9GB 4M43L 1YJDC 4OV5B 1DN0A 3DVNA 4LKXB 5TDOA 1JGDB 3TH2T 4M4PA 1TJHH 1CZ8H 3W11C 3B8YA 4XWGL 3C5ZB 1C7SA 5HDOA 3V5KA 5J11B 1ONQA 2PTUA 5D6CB 3O9WC 3KPMA 4MJ6B 3MRHA 2C1PA 3RY6A 2BXYA 4J2XA 4KTDL 5MERB 1BIIA 2F19L 1R6VA 3VRJB 4PJDA 4GKZA 4OLZH 1R3JA 3QXAA 4M9OA 1ZVHA 4EIGB 3WNNA 2R0ZL 3RPKA 5EUKA 3UPRA 3ULUD 2E7LC 3UMTA 5JW3H 1QHPA 3KYOB 1G9MC 1DLHB 3OV6A 4ZNCD 4HUMB 5DD3H 2R0WH 1ZLUK 3MC0A 1J7VR 5DMGD 3TEUA 3QHFH 3S4SB 4B50A 4YHZL 1JWUB 3KYNB 1A7PH 1MJ7H 4M6NH 3F5WB 3MA9L 3SGDH 3VE0B 1CLZH 1JP5A 5JHLH 1ZXQA 3I6LD 1X4YA 2NY0B 1LO2L 4FQHA 4XPFH 5DVKA 3OKOB 1QRNA 4XWOC 4ZS7H 1KIRB 4UV7L 1VFOA 2P5WE 2P8MA 2F5AH 1KN2L 3DYPA 3U82B 2HTLC 5I9QB 3AM8C 2P5WB 3HZYA 5ANMA 1V8HA 3IDIA 1RY7B 3HE6C 4I3SH 2D4FA 4JQVC 5FKPB 2MCG1 2Y5TA 1S9VA 3OB8A 5C0EB 2AV1B 1HSAA 2UY7A 3KWWA 4RWYL 4DZ8A 4EDXA 5D7JA 2YSSA 4OZGF 4HJGA 2LV4A 4UBDD 3SY0B 2Z8VC 4OF6A 3P0YH 1FV1B 5D1XA 1KIQA 1LGVA 4LCWD 1JF5A 4NHCL 1MRCH 3BP4B 5CUSL 3ZDZE 4NHUA 3QG7L 4RGOH 1IQDA 2A6DA 2NLJA 4I0KA 5HGAB 1U91B 2D0GA 4AH2A 1B0GA 3H9ZA 4NRZB 4C58B 4YFEA 1OARH 2BOCA 2I07B 2BNQD 4NQDE 3UTTA 4K7PY 4XMKL 2P47B 1DEEB 4ALAH 4NQDB 3SDDC 1YNLH 1RFDH 1HIMH 3E6HA 1JPFA 1XF3A 2E5EA 2H2PD 4HKZA 2V2XA 4N5ED 1S3KL 3RY4A 5GS1C 1D5XB 5KZCB 4MGXA 5KVEL 1DQLH 4JFFA 3U2SA 3CFJB 1DDHB 1URLA 5CKGA 5EIIA 2CDFB 3K4AA 3UX9B 4LLYA 1VGEL 3VD5A 4UMGA 4R9HA 1ED3A 1N5YL 4XP1H 1WAAE 1HYSD 2H26B 4PJIE 5A16B 4LAQL 1FGNH 4UQ2B 2D4DA 5T1MB 3HI1B 3ALXA 4YDVB 4HPOH 1B0RB 4PJIB 3MODL 3VDCA 1AQDA 3X3GL 4DWHA 1BVLB 1KFAL 1YEHL 1KYOK 4G9FA 1PKQA 1G7MB 1FO0A 1A1OB 5CIPA 5JUEL 4E0RA 2AP2A 4YR6A 3FMGH 3SE8L 5J9PA 1FVEB 2AXFA 4LAJH 4WI3A 4X7TB 2AXGB 3FT2B 4PS4H 3WEXB 4XVTL 4LCYB 1RAMA 3IU4H 3DURB 2CD0A 2CLVB 1K3IA 2PXYD 2Z31A 5GGUB 1VFAA 2EZ0D 3UTPE 4KVCL 3PWJB 3OKDB 3WO4C 2VLME 4LVNB 4PJHE 5DFTA 4APQA 2Y07L 3HE7D 3OXRA 4O5LL 5ENWB 3QUZC 3HNSL 3L5JA 3JV4B 1T4KA 4M61A 3P77A 1UZ6E 2APVA 3BD5A 3RPIB 2APBA 1KCRH 1RZIB 3RL2A 4Q6IC 5C0RL 3K4ZA 4JN2B 4MMZC 3RNKB 4FQXA 5KSBF 4Y1AA 3L7EB 5AD0B 3FONB 4GG6A 3QIUC 1FHGA 4LHJB 2UUDK 3MGTB 5AZEL 3H9SD 1P7QA 3QNXA 3T2QA 2IAMA 3CUPB 3GNMH 1JFQH 3L3OA 4LSRL 1IAIM 4HUWB 3TNNB 1IFHL 4PR5A 5D7LE 4CADA 3VG9B 1TIUA 5B39A 2W9DH 4PD4K 1XF4A 3D5OF 2ATPB 5D72H 2WUBL 4R4ND 4BH8A 4NKOB 5D1QA 3CNKA 3O9WB 1GOHA 3DSNA 4K3JL 4DFHA 3N50A 2YD7A 2AEPL 3EOBA 2ZCHH 4P2QD 4RMWA 1ZS8A 4KUCF 4U2ZA 2RFXB 3LB6C 4NQCD 4I3RL 3Q48A 3MRCB 1YC8A 3RWJA 3OAZH 4P5KB 1BP3B 1W2KT 3O4LA 5EH1A 3QAZC 5FK9A 5IFJA 3LDBC 1KGCD 5IFAH 1OL0A 1HH9A 4L8SC 4Q7DA 2BHYA 2OJZH 3UO1H 1IGJB 5FXCH 3C6SA 2D0HA 3AREC 5KN5A 4XHQA 1T04A 5HDBF 2F8VA 1SBBA 3Q6FA 1JV5B 4TSAL 3DX8A 5DVMA 1TJGL 4IS6A 3DV4A 3HLAB 3S3JA 4B53A 3WJLC 3I3DA 3T8XA 3JV6A 4U1SB 5BVPH 3VG0L 4JG0H 2UV3A 1LE9B 2WIMA 4JFDA 3QHZL 1N8ZB 3SJVA 3HE6B 2YMXH 4NZRH 3TO2B 1KJ2H 4DGIH 3TO4B 2X6MA 2DL9A 4FFZH 4CW1B 4NKMA 3CIQA 4M1DH 4PJXE 4BH7A 5HPMB 1YEGH 1KENH 3VGEA 4MXQD 4MMXC 4PJXB 4YQXH 1VSCA 2HJKB 1RZKC 1QKZL 2ILLA 2XZCL 5IB3B 5JTWA 3O41B 3INUH 3TT3H 1OB1A 1OF2A 4RAHA 1F6LL 2HVJB 3QULA 3RVTC 3PV6A 5GJTH 1DQJA 4P3CL 1DBKH 2VH5L 1U8LB 4XPHL 2JCCF 5EUOA 1MAJA 4HCRH 2QADD 1EHXA 4NSKA 5F7KC 3X13A 3OHXA 3HNVL 4X5WB 2BSTB 3MRFA 3SDDB 1CI5A 2B0SH 2Z0BA 4W68A 5LKNA 4XTRC 2G9HA 3PIQB 3LQAL 3M1BA 3ZSSA 4KK5C 3FTGA 4NWTL 2Q7YA 2J88L 5INDA 5T5NF 3QIBA 1RHHB 3FB5A 1NAMH 4ELMA 1U58B 4WI9A 3ZTNL 5GS1B 2FYYB 4NUGL 3TJHC 2ZUTA 5E00A 2VWEC 3T65B 3F7PC 4NUJB 1MCNA 5L2KA 3HC3H 2DICA 3STZB 2QKIB 1CFVH 4ZUUA 4RBPK 3UBXA 5IBUG 4LPXA 1FO0L 3ZT7A 1AR1D 3AROA 2XWBB 1JYNA 1Z6JT 5HYSG 5IT2H 3MYJA 2CLZB 1H5BC 1X5ZA 2K7PA 4JFOA 5GS0D 5T3ZD 2NXYD 2W1NA 4HWEL 3AU1A 5I8CA 1ZT1A 3CVHL 1BVKA 2HN7A 3B5GA 4NRYA 4NFBA 5INCB 3IFOB 2F53E 4I5BA 3G6AB 3EYOA 4GAGH 2IH1B 4XMLL 1AH1A 3A6CH 1NC4B 2F53B 4LNRB 3O45B 3QUZB 3F58H 1GGCL 5E6IC 4UOW1 4OF5A 2WMPA 4KDWA 4WO4A 2PW2B 4Q6IB 5MEOA 4X6DF 2JJSA 5DQ9A 3W9EA 1IAKB 4NZDA 5I8KH 3MROB 5KAQG 1U8IA 1XF1A 2EYRA 3QIUB 3W39A 4HAGA 4QRUA 3AS1A 1DANT 3BN9D 2OL3B 5T33L 5HYJA 3UXFA 5L0QC 4FXKA 4F37K 2YRZA 2RAMA 5BS0A 4OM1H 1MJ8L 4N0CD 5D9SA 4WU5A 5CS7A 4L8DA 4K3GA 3E2HC 1I4FA 3S3SA 1CBVH 3RWIB 2CR6A 1AO7E 4BA8A 4YC2C 1C5DB 3GFUA 1RJLB 2WIIB 2X4UA 5EN2B 1T0MA 1A7NH 1K8DB 5E94B 3UYPA 2GUOB 2CKBH 1AO7B 2BDNL 2F9BT 1BFOB 4IJ3C 5IROC 4OZHF 4X9HA 4HX1B 2XZAL 3L5HA 4R26L 3FO2A 5ECJE 3D3VA 1RUPL 1Z5LA 3TT1L 5F70A 3N1FC 5CEXB 1E4JA 2HTKD 5KSAD 1JPSH 5GZOC 5CEZD 2FO1A 3DUUB 5FYJD 3GM8A 1YEFL 2VL5B 3QAZB 3GHEL 3KLHD 4YLQT 2FLBT 5I15L 5F1IB 5EU6D 1NCCH 5MENE 5IKCB 1RUKL 3AREB 1LMKA 4HC1H 1BQSA 4J7RA 3QNZA 5MENB 4IRJB 5BJTA 2BVPA 3ARDA 5BRZD 3IAQA 2VUOA 5F88A 1KPVB 4HFUL 3MXVH 3D0VB 3TBTB 1FZJB 4BSVB 2MCPH 4P46A 5K9JL 3JUZA 2PYED 3KDMA 2FDBP 1C16B 1VKXB 5B38G 1E4WH 1CFQB 2X5PA 1DBML 3GSXB 4HK3N 4U6YB 1N64L 4FA8A 1ES0B 4Y19D 4QF1B 5F7FA 1H9VA 4JRYE 4ELKB 5L8KB 2Y36L 3DO7A 4MNGA 2CKBA 4POZC 4G9DA 3MA7A 1E4KA 1IZJA 4JRYB 5DR5L 4Z77A 1G7PA 1Q9WA 2HP4A 3A67L 4BZ2H 4KROC 4Z95L 1ZLVK 4J3SA 2IADA 3CU7A 1EMTH 3SGKC 1ZTXL 4XVUD 4U0RB 3GK8L 3DBXB 5ACZB 5E2UL 2I9LA 5HHME 3QEHA 1V3LA 5HDLA 5HHOA 3C9NA 3F65A 4J3WA 5HHMB 1F4XL 4IOIB 3GIZL 3G08B 5JNYA 4NO0B 4HWUA 4KKBC 1YDPA 3D85D 5ID0A 1YA5A 1FC2D 3O3UN 4ZXBC 1WISA 4HC1A 4H0IA 4PJCF 4WDIA 3RQ3A 3SBWC 3VXQB 3HRZA 1GH7A 5FHBL 2QTEA 4RDQF 2VLKD 4X7FC 4ONHB 3RKDC 3CMOL 2EDFA 3KPTA 5IP4A 3NCYP 4K55A 1WEJH 2J2ZA 5CP3H 1R3HB 4K3EH 5DEGA 1R3LB 4PRPA 4N1HB 2OCFD 3V0VA 2JE8A 3D9AL 4ZO7A 4BFIB 5D5MF 1MI5E 5HI3D 3OKEB 3HI5H 3MLUL 4P0DA 2ZNXA 4ODWB 4TVPE 1MI5B 4JANA 4WI7A 3D18B 5JW5B 3OGCB 1NLBL 43C9A 1GYAA 3RBSA 1SMOA 4FQ2H 4FXLA 5C7XL 3VD9A 2GEEA 4XVJH 1BOGA 2D9CA 3IETA 3QO1A 3ZLQC 4G8GA 1S7VA 3KPQA 4FTVD 1MVUA 2FIKA 3ARBD 1T20B 1JYXA 3RGVD 1WITA 1H5BB 1NPUA 5DRZB 1VFBA 1ND0A 1TCRB 4K7PX 25C8H 4M6OH 4X4XA 3L5WB 5TF1L 4OD2B 1PX4A 3K80A 5IB1B 1FG2B 3VFTB 1HHIB 4R7NB 2D7TH 4NOFA 3X14B 1JNNL 5IMKB 5DUBA 4HWZB 5E6IB 4P5TC 3CXHJ 3ZDYE 3QDJE 4Z7NE 1FIGL 4I9WE 3WHE0 1A7RL 4O58H 1ACYL 3G5ZB 5GZNC 1EO7A 1I3VA 3SE3A 4LCIL 2H2SD 4XI5C 2JB5L 4FQLH 1FJ1A 5C6TH 1RULH 4QRRD 1R3IH 2ZCKL 3R06A 5EC1B 2AK4D 2DQTL 2G60H 5L0QB 1MLCA 3G9AB 3IAGC 4O4YL 1RURL 5CBEB 3OKKB 4PG9B 4AY0A 5IVXF 2ED8A 1A7OH 1VEPA 2LTQC 3GMRA 4ODTL 1HNFA 4S1DD 3E2HB 1KG0A 3U30C 1PSKL 3HRPA 4HW6A 3WIIL 3VXOB 2V7NA 1NGYB 2NYYC 4OIIH 4IRSD 4YC2B 4X7CC 3PV7A 5EOCJ 1A7QL 2ZG3A 3V6ZB 3GKWL 3U4EB 1QACA 1S8DB 1XR8B 1NCWL 2RIKA 4IJ3B 4Y5XB 4YK4B 1QFWL 1Z3GH 3OB0K 3WS6C 3SKMB 2HH0L 4PRNB 5ICYA 2HFGH 4ODUA 5L88L 3CDFA 1TETH 1KC5L 4OCXH 3V5HB 4GXUM 3MCLL 4A6YA 5D1ZD 4AM0B 3NZHH 4JFZH 1J1PL 1QBBA 5IK3A 1OP3H 3RWCA 4GLRH 4AEEA 5IWLC 4PIRF 2VDPL 2VN4A 4N0YH 1HE7A 4YEEA 4ZUVB 1T7ZA 1QPXA 4PG2A 5T3XD 1YNTA 1IEHA 4MXVE 5CJQL 1RHFA 4X80H 2E27H 1U8PB 1XGRA 5I8EA 1HHJA 4OZGE 2YEZB 2VXSL 3T09A 1LE5A 5D2LA 2A6KB 3O3BA 1YMHB 1HZHH 4HPYH 4OZGB 4HS8L 1Z9MA 4XGZB 3NIGF 5FA4B 5JXED 4ZUSB 1MRFH 4XNMB 5T1DL 2WBJC 4LIQL 3M8OL 1B4JL 1CR9H 4OQ1A 4F7CA 3SGEI 1CTNA 4J3OC 1OM3H 3BP5A 1KT2B 2ERJC 3RX5A 4D8PB 2DQEL 2H1PH 4KJYA 4PRHE 5IW1A 3LKNA 1JZ4A 3DX7B 3SDCC 2Q3AA 1WVZA 1JHLL 4KROB 1AI1L 3HPJA 4PRHB 4KUZL 5SX4H 3T0EA 4ZDHA 3QCUH 1UH3A 4JM2C 4P2OD 1CDJA 4HIHB 3X11B 4LEOA 2DQJH 4K7FB 4GSDL 4P9MH 3C2SA 1N0XL 4X99A 3QI9B 3EFFA 2YPLE 5E8NB 4ZXBB 3CFIC 3BYTA 4TUJA 5ESQB 1TZGL 1I7UA 5E1AB 3BOVA 2YPLB 2DLHA 3ZKMD 1T1ZA 2XA8H 4NYLA 3T2OA 4WFHE 1A6TB 4XNYH 1FE8L 3QQ9C 1S5HA 1AC0A 4CVZA 4B7IA 1JNJA 3MMEA 1R5WB 5IJVB 1PVHA 1XGTB 1G7JB 3OL2A 5E9DA 5IB2A 1AGCB 1T80A 2H45A 3IU3A 4I4WB 2PNDA 1UWGL 3MNWB 1GGUA 3MJ7B 4RRPA 2UWEA 1C08B 3PWUB 1NFKA 5GGSA 1CDIA 1WIUA 4NWUL 4XBPB 1LEKA 4IHOA 3MOQA 1L0QA 2R0ZH 3WUWB 5ID1A 3C8DA 1L7IH 3RTQD 2R1WB 1QQDA 2HLAB 1UXWB 3MJ9H 4M6MH 1XEDA 3VRLE 3MCG1 4GMTL 2UZIH 4LLMA 2YK1L 5TDPB 1PQZA 3KHOA 4YHZH 1T89C 2FBOJ 5D1XD 4GUPA 5ETUB 2EIZB 3BPLB 4KVNH 3EW3B 1XGYL 3MA9H 3WSQH 5C0AB 1E4XI 1RK1A 2Z92A 1A1MA 2VDRL 3NA9L 3TPKA 2P7TA 1OHQA 2JJUA 3TYFA 1AXSA 1WV7T 3ELAT 3UTTD 4H1LA 1YYLH 1B3JA 3QXTA 1GZPA 3S35H 1ZHKA 5LGHH 3QZWB 2GYSA 4N1EA 2W9EL 3MXWH 1MJUH 3I02A 3I6KB 1J1OL 1JCKA 1QVOB 3ULUC 1P7HL 3MZGB 5CBAA 1WQVT 1ZWIB 3KPSA 4OCMC 2DQIL 1OVZA 3KPLA 3MV9E 5DMGC 1MHPL 4JKKA 2VDOL 2VUYA 3MV9B 1IILE 2CUIA 2R2EA 4M48L 5JO5A 4QXGL 5I6XC 4NHCH 1MCPL 2DQGL 3QG7H 5FUZL 4PBWD 3MJ9A 3H3KA 4MCYB 4JY4B 4P2RE 2O61A 5F8RC 4CN1A 1NCUA 5AWNH 1MFAL 2GJZA 5KOMC 4H20L 4P2RB 3U30B 3NFSL 5HJ3A 5C0BA 1OTTD 4UTBL 3VFOB 4G9FD 4JG1H 3MYZA 1EEYA 1XGPA 4ZFOB 1S78D 3VXPA 2A6JB 1CLOL 1YUHB 2B4CC 4N9GA 4UILH 5M7QA 2Z31D 3D1MC 4UBDC 1J0KA 4XAWL 3DROB 1S7XA 4P49A 5DHYB 4OV5A 1JGDA 2LAGB 5B21A 4APQD 3C5ZA 4BZ1L 2D7PA 2DIBA 1HXMB 5D6CA 3FN0L 1VGEH 2XKNA 5GQBA 5C07E 1PZUB 5IJKA 4LARL 5DGQA 2E6PA 4AMKH 5MERA 1HK6A 1P4BL 4MZ3A 5C07B 2X40A 1YMMA 2R8SH 5ICZB 3VRJA 3O2WL 4NZTH 3MODH 3X3GH 4FQXD 1CE1L 1SJXA 3RIFF 4Y1AD 1QYGH 3PHOA 2DKUA 1YEHH 3RL1B 5FGRA 5DSCB 1JGUH 4KKCD 3KYOA 1LO0H 2IG2L 2H2PC 4N5EC 4XVTH 4O02H 3FB6A 5GRXG 2L7UA 3S4SA 1JWUA 1UENA 1T0PB 2CH8A 3KYNA 4LCCC 3REWA 2CRYA 3CFDB 4PJ5D 3F5WA 2YN3A 2WBJB 4PFEA 5DMJB 4ZODA 1S9KC 1CS6A 2Y07H 4RNRA 3OKOA 4R4BB 2N1KA 5D1QD 3HNSH 2RR3A 1HYSC 1RZ8B 4PV9B 3SDCB 5J3HD 1Z9OA 1VB9A 2ITCA 2NY4D 5C0RH 2O5YL 3KYKL 3FN3A 5F7DB 3EJYD 3RWFB 1FNGB 4K3DL 5CLWA 1E6OL 5E2VH 5FKPA 5C0EA 2AV1A 5DFVD 1T2QH 1T1WA 1S5IL 5AZEH 4PGJA 4NJ9L 3VXSA 3T0AA 1TITA 4M3JA 5CZVH 4P59H 1FV1A 2PXYC 3LEVH 1IFHH 2EZ0C 3BYYA 3I9GL 3BP4A 1FL3B 5BXFB 3HE7C 5HGAA 1U91A 1UVQB 1D5IL 3QUKB 5LQBH 2LU4A 2WUBH 4WI2A 4YXKH 2YUZA 2AVGA 1LEGB 3DECA 5HHVH 4CU8A 4OQTL 1BD2E 4NQDA 5KOVC 2MPAH 1BD2B 2R9HD 1VHPA 4JY5L 2BXZA 2X4OA 5HVWA 1JNLH 2E9WA 4BFGA 2Z8RA 1Q1JL 1XAUA 7FABH 3TM6A 2EEAA 1D5XA 3RIAF 4NKDB 2RCSL 1F02I 4JHWH 2BY1A 2XTJD 3CFJA 1DDHA 1XF2A 5F3HB 2YWZA 4U3HA 5J56B 3ZKXC 1TJGH 3ARUA 3MRDB 5A16A 4R4NC 5T1MA 2JELL 5I1GL 3HI1A 4YDVA 1WAAA 4PTUB 1B0RA 5CP7B 3ULVL 1XR9A 2CDGB 4PJIA 5FEBA 4Q9RL 4EQ2A 4WI5A 1BVLA 2EDXA 4M1CD 3VGAC 4RFEA 5I8OH 1PW3A 1A1OA 2DTML 4PJ9A 3MLTB 3JWDL 3ULUE 1FVEA 3S8WA 4ZFZB 4OLXL 4X7TA 2AXGA 3FT2A 3WEXA 4LCYA 3DURA 3HHRB 1S7QA 1R24B 3RWEB 1G6RL 3B9KC 2CLVA 4KDTC 5H37G 2IQAB 4MJID 3QIBD 1I7TB 4LMQI 3MACL 3PWJA 2XYCA 4WCYL 3K8LA 1RZFL 1CVRA 3I6LE 5I6XB 3FT3A 3PP3K 4PJHA 1QKZH 1J88A 3JV4A 5L2KD 4L4TE 4LSUL 5HI4D 3Q6GH 1U3HD 4UINL 4JN2A 1H8NA 5DO2D 1AC6A 3BN3B 5KS9F 2KL6A 4DUWA 5AD0A 4UTAL 35C8H 3FONA 5C0ND 5MP6L 4YXHH 3HNVH 4LL9A 3MGTA 5TFSL 1JZ6A 1MH5B 2EE9A 2YOCA 4F8QA 3LQAH 4XPBL 5DD6B 5HI5D 4NWTH 5MI0C 3CMGA 5EB9A 2J88H 4D0BA 1KB9J 1HQRB 3PDDA 4MA8L 4QT5B 4UZGA 3MLZH 1UXSA 3CXDL 4WFGD 5D6DA 3ZTNH 4LCWE 5DD1L 5D7LA 4MXQC 2D7NA 5KVMC 1NEZG 1IQWL 4XP5H 5I1KL 4LCWB 4NKOA 3U4BL 1SM3L 1BREA 1JGLH 4XNUH 1RJYB 3O9WA 4QTIH 2DD8H 4KZEL 2A9MH 3QQ3B 3B2VH 1GXEA 2EXYD 1DCLA 4WO4D 1KEGH 4HBCL 5DHVB 1J0IA 2QADC 4JR9L 3FKUS 3PDOB 2FJFB 4N90D 3CLEH 2E7LA 1KXQE 3HC4L 3I6GB 1FZOB 5F1NB 1U8JB 5LVEA 5HYJD 2LVEA 5FB8A 1IGJA 5I76A 2ZSVB 3C09C 3WLWD 4IRZL 3QQNA 3M07A 4HWEH 3NPZB 2D0FA 3CVHH 4AEHL 3U7YH 1YY8B 4QHNA 3HLAA 1A14L 5ELIA 1MVFA 4YBQD 2HWZL 1HYRC 4XMLH 2NTFA 4U1SA 5E70A 2BSED 2LQRA 4MSWB 5EPMA 4TNWF 1GGCH 3WIFB 4B0MM 4RFOH 4M7KL 2Q6WB 3AM8A 3EDFA 1M6OA 4FS0A 3X12B 2P24A 5F21B 1AR1C 3D3VD 1N8ZA 3MBXL 5DMIL 1TDQA 3HE6A 3TO2A 3QSKB 3TGXA 3TYGL 1JWMB 3TO4A 1FDLH 2DM7A 4P9HC 5T33H 5GGTL 3SHSA 3GBMH 5HPMA 4F15C 5GS0C 2NXYC 4OFYA 5D5ME 2JTDA 5GJSH 2PXYB 4PJXA 4Z0BH 1MJ8H 1MCLA 2HJKA 3K81A 5D2NE 5D5MB 1BQHB 5IB3A 3GO1L 3W81A 1HHKB 3DSFH 3HE7B 5DUPH 2DLTA 2PETA 2BFVH 1FH5H 3P4MB 2PYFB 3HUJF 4OIBA 4RCAA 5K33A 5DC9B 3WNOA 3GBNL 1S7UB 3SDDA 4R26H 3WNMA 1FRGH 1RUPH 4S2SB 2C5DC 3PIQA 4CDHA 2IGFL 1UWXH 5E2WL 3MLYH 4D0CA 3AC0A 1RHHA 5DJCA 4KKNA 1U8HB 1U58A 5JOFB 2CMRL 5GS1A 2FYYA 4YHLL 5ALCH 1W0VB 1LD9A 3QUMH 2ZUYA 1AE6L 4FQ1L 4U1NB 1YYMH 4N0CC 2C3GA 2GITB 2QBWA 5DVLA 4C57C 5IMLB 4NUJA 1MREH 4N68A 5HHOD 4TSCH 2F8OA 3A6OA 4IOFD 5E8DL 3MRIB 4P2QE 2R2CA 1KJ3L 1M71B 2F5BL 4P2QB 1UWXK 1ZHBB 3FOMB 3NH7H 1T83C 3JWNC 4JM4H 3LZFH 4NQCE 4W70A 2XWBA 4DAGL 3OQ3B 3VGAB 5FO8B 3PDGA 3JWOC 5BMFH 3LMJL 5ADPL 3IF1B 4M1GL 3RHWF 1I3UA 1RIHL 2HTKC 4NQCB 4X8XA 4U1HA 3Q5TA 5KSAC 1XGUB 4P3DB 3ZDXF 2Y36H 1EVTC 3O4OC 4XCFH 3GRWA 4TNVF 5JOPE 3KLHC 1U8MA 3K3QA 3PABB 1ODAA 1BAFL 2ZPKL 2EIBA 1NGZA 1UWEL 4HIIA 4FQCL 3EYFB 5INCA 3IFOA 5FO9B 4RISH 5HGDB 3G6AA 5FV2A 5E2UH 4JPVL 4QYOB 4QHLB 3BPNC 3QUZA 2W38A 4D9LL 1F4XH 1YEKL 4H88H 5IVNA 3PWLB 4JDTH 1AXTL 3QXUA 2PW2A 4Q6IA 5E0QA 1IAKA 2X10A 5DJ6B 3MROA 1VFUA 4GRWF 3DRQA 3WIHH 3QIUA 2N56A 5E2TH 1GHFL 4BQBA 1IE5A 3T3PF 2OL3A 3FO1B 4LSSH 4Q9BA 4EIZC 2DQCH 2WBKA 4JN1L 2J8UE 1L7TH 4OGAD 5MI0B 3IGAB 2X4RA 1V5JA 4ZAKB 1MCIA 4NJAL 2GTWA 2J8UB 2XQBH 4Y4KD 3SDYL 1YJDL 1G7HB 3S5LA 1CDCA 4XVUC 1F5WA 4HXAH 2GSIB 3RWIA 2IH3A 3O3EA 1C5DA 2ZJSH 3DX6B 3IS1X 1TTGA 3BKML 4DGVL 1OGAD 2WIIA 2DMCA 1Q72L 2GUOA 2M26A 1AO7A 3MLUH 3RY5A 3ZKND 3NIGE 1BFOA 4CVUA 1JF6A 1EV2E 4LMQE 4HX1A 5FOBA 5L6YL 2A77H 2A74B 2BRRH 4BELD 3MRGB 1NLBH 5CWSB 1AJ7L 2BVUA 1RUQH 4GRLD 1S9XB 4GKSB 2QADB 4KGJA 5C7XH 5CEXA 3G6DH 5D7IA 4WRLA 3DUUA 1G9ML 4Y4FD 3BO8B 2X1WL 3PXHA 4JPWH 4TUOB 4TUKL 5KW9L 5F1IA 4EI6A 3DJ9A 5IKCA 5GISL 3C09B 3G5YA 4QRPD 3ISWA 3QWRA 5F9DC 5MENA 2DAVA 1G9EA 4IRJA 3AMLA 32C2B 3KVQA 5ADOL 2XXCB 4ISVA 1KPVA 2QSCL 5HI3C 3WJLA 4TSBL 1OAQL 3D0VA 5JXAL 5SV3A 3TBTA 5EZOL 1BEYH 4BSVA 1IEBB 3D39E 4HIXL 4R0LC 1NKRA 2EDKA 3AS2A 4Z76B 1C16A 1VKXA 3PP4L 1CFQA 3VFNB 3D39B 2FGZA 4U6YA 6CGTA 1ES0A 4AYFA 4QF1A 2DBLL 3BQUC 4PJEB 4ELKA 3NMEA 1W0WB 3MOAH 4YDJB 2YA0A 1F3DJ 5DK0B 2VQ1B 4ONFL 1OSPL 2FHCA 3ARBC 5AYUH 1JGVL 5KVFL 4AEIH 5IEKA 3RUGE 3K2UL 2HRLA 2A73A 4G42B 3RGVC 3GBLA 4PB0L 1NANH 4F57H 4F15B 3RUGB 2NXYB 3BFOA 4J1UB 3BZEB 5MEPA 1NMAL 1ADQA 5J89A 5ACZA 5IQ7L 2EDDA 4X98B 3ESVF 2Q8BL 4U49A 5DJDB 4P48A 2AJXL 5GPRA 4PJ7A 4IOIA 3WIIH 3G08A 4NO0A 4JCMA 2MTPA 2R69H 2V9TA 3EO0B 3RVUD 1TENA 3V4UL 3VXQA 4NN6B 4BUGA 1WZMA 3HNTH 3DTXB 5I75C 1J05A 4H8WC 1OP5H 2H2SC 3MOBL 4ONHA 2HH0H 4NKIH 2YUXA 1HHGB 1RZJC 3GSWB 4G6MH 1XCTB 2A6IB 2YXFA 1R3HA 1DUZB 2JF1A 4KMQA 3T04D 2GT9A 1MUJB 4L8BB 2DYPD 3WDJA 2Y06L 1HXYB 3WHXB 4F8TA 4BFIA 1ULVA 4S1DC 4HH9A 3SE9L 3OKEA 4U1MB 2JJVA 4ODWA 3WFCL 4WEMB 2MKWA 4IRSC 3KNBA 5JDJA 3D18A 4FQJL 3GIVB 1JN6B 3OGCA 3ZL4H 4YNYB 1TTUA 4H25A 4M9PA 3TLRA 3F7VB 1G9NC 3RP1A 3T3MF 4UDUB 1Y6NR 4HS8H 3VI3E 1BX2B 1LP9E 4FFYH 3SKNB 5CEZE 1CD8A 3NCBB 3PJSB 3BJLA 3PE9A 1JZ8A 5FYJE 2E6JA 3P0GB 3QHTC 1T20A 1S9WB 1OWWA 4LEXL 4ETQB 4LIQH 5KSAB 4Z8FH 1LP9B 2OS7A 4MNHA 5EU6E 1MF2L 4PGDB 5DRZA 3MR9B 5D1ZC 5EWIH 1TCRA 1J9CT 3LKQB 1N3NB 3DARA 5EU6B 5E9DD 4LVEA 2V2WB 3L5WA 1NSNL 1JHLH 4MCZA 2FSEB 3NCYS 1FG2A 3VFTA 3UTQB 5BRZE 3QBTB 3K2MC 3X14A 3BPNB 2C7UB 2VITA 3FOLA 5IMKA 2DI8A 4ZPVA 5BRZB 4HWZA 1CGSL 1M7DB 1TZIB 5E6IA 1V7MH 2NY6D 3S36X 5IR1A 4Z7VE 4R8WH 1DBBL 1N0XH 3G5ZA 2BHZA 3QDJA 4Z7VB 3A6BL 1TZGH 4Y19E 3HR5B 4Y5VC 1UB5B 5JXEC 3O2DL 1QBAA 3OG4B 3DI3B 3EIFA 4Y19B 4U6VL 1M7IA 4JFXB 1T5WA 5EC1A 1FE8H 4HEPG 5BQ7B 1GVIA 4XP4L 1L0XA 4NBZB 5CBEA 3OKKA 4PG9A 4ORGB 3SOBL 3QPXL 3F6LA 1UWGH 1WT5C 3RY6C 4Y7MA 1OTSD 4LRIC 1RV6X 4XX1G 2NY5L 2BSRB 5DUMH 3VXOA 3I2CH 3L9RB 1NGYA 1IC4L 3BAEL 2DM2A 5JIPA 4LQFH 4JO3L 4N0UA 3NABH 1MNUL 3V6ZA 4OCWL 1S8DA 1XR8A 4Y5XA 5F96L 2Y23A 1FNHA 1OAYH 3D85B 4HBQA 3IDNB 3SKMA 1IBGH 2VXUL 4PRNA 3ME0A 3RU8H 1FORH 4MDJB 1XFPA 3SGDI 2R4SH 3FFCD 1D6EB 1K4DB 3V5HA 3ZKMC 4XPAH 4WW2F 2VLKB 1NCBL 3IXTB 4PJAF 3R8BB 3QXWA 5CMAB 1JYWA 3L3IB 3OKLB 1NBYB 1QSVA 4FQPA 2JJTA 1U8PA 3PNWB 1R0AH 1U8NA 1FL5B 5C0BD 2YEZA 2A6KA 1YMHA 5DHXB 1E27B 4HWBA 2P8LB 1UA6L 4OZGA 4R0LB 3I50L 4CAGA 2JB6B 1MCOL 4XGZA 3RTQC 1RVFH 1ZGLA 3RJDA 2DQIH 3SQOL 3WKMH 4XNMA 1N6QL 2FZ3B 4FTVE 1MHPH 3TN0A 5IB4B 1UJ3A 1EAPA 2KDGA 1KT2A 5D1XC 2XV6B 1FZKA 1MAKA 4FTVB 5ITFB 3IDYC 1JUFB 4D8PA 3ARBB 3TBWB 4PRAB 4RGNE 3ILQD 1MCPH 3RGVB 3DX7A 3GMLB 1EERB 2V7HA 4DK3A 4PRHA 1AGFB 3CSPA 4RGNB 3SGKA 1RZKL 1MWAB 1MFDL 5DDHB 4MX7B 1AKJA 1ITBB 5FUCC 3GMOB 1YMMD 4HXBL 4WTWA 3X11A 4IIQA 1O5DT 1C1EH 1QO3B 3MGOB 4ONOA 2XG5A 1J86A 3QCVL 1JL8A 3O2VL 3F62A 3O3DB 3QI9A 5IEHA 2HFFA 4ZXBA 4K94C 4RIRB 1YQVL 4R7DB 3QEGH 3SBWA 2UYLB 1CLOH 4UB0L 5I75B 2HKFL 2DI9A 3RDTD 1A6TA 5EG6C 4QRRE 2AK4E 1I9JL 1R5WA 5E08L 2X70A 1G7JA 4BZ1H 3EYSL 1SMAA 2D7QA 1AGCA 1SYVB 4QRRB 4I4WA 2AK4B 4OF0A 2CLRA 3MNWA 3QEUA 4TRPH 3BZDA 1C08A 3PWUA 2OR9L 3PGFH 3IDGB 2HAZA 4XBPA 1XT5A 4U1IB 3O2WH 4JVWA 3WUWA 1OTTC 1P6AB 4NM8L 5C9KA 2EO1A 4IRSB 1X7QB 1S78C 2HLAA 3VXSD 1Q9LB 1KELL 1KN4L 4FP8L 5TDPA 1NLDL 2VZVA 1DL7L 2Z31C 12E8H 2BJMH 5ETUA 2EIZA 5HHNB 4ZQKA 1UKTA 4LPUA 5DWUH 3S34L 3T1WA 5GRJH 5E8OA 2GJ6A 4APQC 3L95B 1ZEAL 1RZGB 2YBRB 4HZAA 1I8IB 5KS9E 4CDGC 5D1ZB 1HSBB 1F00I 4KAQH 1CTOA 4M62H 2HJFB 3FRPA 3V0WH 5DEZA 4K7PL 4NQDD 5I1CL 1YECH 2FECI 2J8OA 1YEJL 3QZWA 1YZZA 3R4DA 3KYKH 1RJZB 5DJAB 3V6BR 4FQXC 4LGRB 3I6KA 3WUZA 5J6GA 4GW5B 1QVOA 4JO4H 5BZDB 3EOAB 1AP2B 1HKLL 2KBGA 2QQLL 3LOWA 3MV7D 4KKCC 1ZWIA 1BJ1J 2IAND 1MCDA 4CRPA 4YHNA 1I9RL 4Y5VB 4LBEB 1P4IL 4YZFF 4J3VA 4Q9CA 3BP7B 3AMKA 4M8QA 5HHQB 4MAUL 1NEUA 1NAKL 2WQ8A 3DVNB 5TDOB 4RAVB 1D5IH 4U4BA 3HG1D 4JY4A 1BGXL 4MCYA 3TJEH 5D1QC 4E42B 1ONQB 1EXUB 3P4LA 5J3HC 4P2RA 1CFSB 3MV11 2VC2L 4PJDE 2NY4C 3VFOA 5LGJB 1H15B 4PJ9D 3K4DA 4P2OB 1NGQL 5GHWH 4PJDB 4RSVA 3I85A 3N1MC 2XKSA 1LO4H 2A6JA 1T3FA 5FCSH 5DFVC 2IWGA 2IBBA 4S1QH 1YUHA 9CGTA 2QEJA 1KTDB 3WS6A 2XWJB 3DROA 5F44A 4UNVA 2RCSH 3FQXB 3T4YB 1A3LL 3PHQA 2VL4A 3JBG7 4UT6L 1CXLA 1A6AB 3ZE2E 3MV01 1WWWX 1HXMA 3SPVB 2VSDA 3P4NA 1VADB 4NN7C 5TE6L 5IWLA 1KB5B 3P9LA 3WXWL 5C07A 3O6KH 4FQHB 3ULSB 1J0YA 3EOYG 4CUCA 2P8MB 2ARJA 2DIJA 1EHLL 2LAAA 3BPOC 4KPHH 1NMBL 1NDGB 4X83A 4HWBL 2OXHA 3HZYB 2R9HC 3S3PA 1Q0YL 1CE6A 3KXFE 2FJHB 3DRTB 3NBNA 1IM9D 4OFKA 5GGQH 3KXFB 5CD5D 2D2OA 3RTQB 3UBXI 1WTLA 3KWWB 5SX5K 3CFDA 3D87B 3H42L 4LASH 3MACH 2XTJC 2WBJA 5E8EB 5D7LD 4EXKA 4FQQB 1SY6L 5D1XB 1OY3B 1KIQB 2BK8A 2C26A 4NKQB 4R4BA 3IDYB 4JHAL 2JCCA 5IM7B 1RZ8A 2YD5A 4PV9A 3SDCA 5FUCE 4AH2B 4K71C 4WU7B 4MD4A 3T0VA 4KTEH 5HSFA 2BOCB 4XPTL 2VE6A 3P11H 5F7DA 3RWFA 3UTTB 4M1CC 4OCSL 1MAML 4UTAH 3CFCH 4D9RE 1LK3H 2AI0L 2HG5B 1G0XA 4NNPH 1U6AL 4DTGL 2XNAB 4HKZB 2V2XB 2CUHA 2EDRA 5J06A 3QIBC 1R5IA 1FL3A 1W8NA 5FOJA 1BFTA 3BGFC 5DD1H 3WN5B 1F6AB 1UVQA 1IQWH 4JO1H 1BQLL 5C2UB 2EDNA 4XNXL 5KANG 1LEGA 5HI4C 1KCVH 1DBJH 3GB7A 3LN9A 4IDJL 1MIML 5DO2C 4P99A 1GGBL 1BD2A 2EDYA 4G9FE 4HBCH 4OD3H 3A0OA 5FA3B 6FABH 1AQDB 5C0NC 3MRQA 3U7WL 8CGTA 3MLSL 1QFWM 4G9FB 4YE4L 3VA2C 3ZE0F 4YR6B 5J9PB 2MWCA 4ZD3L 1HHHB 2AXFB 4NKDA 4QXUL 4U3XA 5H37H 2I26N 5HI5C 5E5MB 5F7UA 2HRPL 1TTFA 4OFYD 1W72L 5F3HA 1EEUA 3IT8D 4HF5L 2ICEA 3OSKA 1VFAB 3MJ6A 3VFMA 2D7OA 3U7AA 2IMMA 4Y0GA 2IALB 3MRDA 3HCVB 4BQ9A 3QRFM 4DW2L 5CP7A 2CDGA 4X6DA 1VERA 2EXYC 3BKJL 4M61B 4DEPC 1KCUL 3PUCA 4LHUG 3LKSB 2JK5A 4WO4C 4Y1AE 3F12B 3MLTA 2B39A 2JJSC 1Y6KR 3PWPD 4PP1D 4ZFZA 4FQXB 4MWFA 4Y1AB 3P9WB 3V52L 1YC7A 1R24A 3RWEA 4PY7A 4XVSL 3TYGH 4PYGA 3NZ8A 5BV7B 4X8JB 5GGTH 3WLWC 4PJ5E 1SJHA 1CDHA 1NMCB 2VR4A 1MFEH 4PR5B 4PJ5B 4KZDL 4M7JL 2FX8L 3QDAA 2WAHA 4S0SD 2IPUK 1TZHB 1S9YB 2D31B 1A0QH 1J0JA 1NL0L 1FBIL 3N9GL 1T6VN 1R3KA 3OZ9L 5ALBH 1YEIH 4YBQC 1MCCA 4YX2L 4Z7OF 1QBLL 3ARGD 4OZHA 1P2CB 2J12B 5FDYA 4BH8B 5D1QB 4L4TA 3DWTA 1X9QA 4WWID 3LS5H 2FCBA 2X4TA 5SV4A 1LO3L 4OZFH 2OM5A 4ZFOL 2EKSA 2NY4B 5C0JB 3LY6A 2JIXB 1ZS8B 1X3DA 3B3IB 1PAMA 1MH5A 2DWDA 2ICES 1NCDL 3RI5K 5DD6A 1K3ZA 1Z0NA 3RWJB 4QT5A 4XPGL 2H3NB 1VGKB 1CDBA 5DRWB 4GRMB 1Q94B 1A02N 2XRAH 1HH9B 1T5XA 1O7SA 4LLUB 1UCTA 1ZANL 2BVEA 3OAUL 4FQ1H 1IGML 4KJPD 4JFYA 3V95A 4LCWA 4NDMA 1T04B 3Q6FB 3WXVH 4X4ME 5LXGH 4QOKE 1RJYA 3WD5H 3QQ3A 1ERNA 4NN7B 4FABH 4X6CF 4JZOA 4L4VD 4PLJC 4QOKB 2XZQL 4NFDA 3MO1B 3JV6B 1C8PA 4OLUL 3RA7H 3PDOA 2P46B 4YHML 2F5BH 2FJFA 2PKDA 3OTTA 4JFEA 4JJHA 1N2RB 3LMJH 4KQ3H 3I6GA 4M1GH 3NCJL 1FZOA 3EJZD 4YHKL 1ZA6A 2GSGB 1F8TH 5DT1L 3QB7C 1O0VA 1J0ZA 1JTPA 3CGTA 2ZSVA 3MLWH 4GT7A 5JMOC 4I77L 4DK6A 5B3JE 4OZFA 1F4AA 1S7WA 5FHAL 2ZPKH 4QRTB 1YY8A 4NKMB 5CJOH 3ET9F 2BERA 2XTJB 1I1YA 4JPIB 2ED9A 3MPCA 3V4PH 4G3YL 4HG4K 3FHAA 4CU7A 4MSWA 3MSPA 4PP2B 3FL7A 4UT9H 1YPZF 4KI5F 4IOFC 4D9LH 3QULB 4PJCA 3JZ7A 1ZA3B 2Q6WA 5GGRY 5EOCH 4K71B 3VH8A 4HT1L 1XMWA 4XHJD 1FAIL 1K4CB 3MREB 2LABA 2X4QA 4DKFH 1FGVL 1NFDE 3OHXB 1HINL 3BMVA 1IGIL 3MRFB 4MJIE 3UC0H 3RFZC 1NFDB 1WBZA 1FCCA 2FATH 3B6SB 5F6HI 1CDYA 3M1BB 4JN1H 3U83A 3UPAA 4ACPA 3FTGB 2Q7YB 4MJIB 3BIBX 3HMWL 2EDWA 2PXYA 3R8QA 5INDB 3QIBB 3I84A 3VXNB 3QWRD 1H8SA 2Y4SA 4UNTA 3TNMA 5KSUB 5D5MA 1BQHA 3LN5B 3UZVB 3BGFB 1HHKA 4IRJD 2O5ZL 2BVQA 5D71H 4QEGA 5D2NA 4X7SL 5L2KE 4PGBA 4JRXD 1KJVB 3P4MA 2PYFA 1EPFA 5L2KB 1KJ2B 1RUAL 5TH2B 3Q2CA 1U3HB 1J8HE 1NBVH 1TXKA 4S2SA 3UEZA 4ZUWB 4LDEB 1UJTA 4UNUA 1J8HB 3BP6B 3OMZA 2APWA 3OKNA 5DA0B 1AIFA 4NO3A 5J0BA 1A6PA 1A4JA 1U8HA 5JOFA 3UJIL 5JDSB 4LU5L 5KW9H 3ZYJA 2ADIB 5E8PB 4WFGE 4OGAC 1W0VA 2DN7A 4G6FB 1EBAA 5GISH 3B43A 3U9PL 4WENB 3AU1B 5I8CB 4Y4KC 2GITA 5IMLA 1BVKB 2HN7B 1A3RH 3V7AG 4NRYB 1ZT7B 1DLFH 5HHMD 4XAKD 5ADOH 3ZHDA 5A2LH 3MRIA 1MCEA 4NO0D 4UIMA 3EYOB 3GMQB 4MA7L 4TSBH 4XXDA 5JXAH 1M71A 3ZKNC 3BWUC 2APTA 3KJ4C 4DVRL 4P2QA 5C8JB 1NAMB 3FOMA 4DEPB 5FO8A 1B2WL 4N90E 4YHIA 4PJBE 1JBJA 4WO4B 3PP4H 4GRLC 4EOWL 4KRNA 4F7PA 5MEOB 4L8CB 1AY1H 5DQ9B 4NQCA 5F7WC 3ULUL 3VFVB 3IFLL 4PLOB 4PJBB 3SE3C 5L2JB 2ZG2A 1OP9A 4Y4FC 1MFBL 4CMHC 4EI5D 5DJ8A 2PW1B 2YA1A 3PABA 4ONFH 5EO1A 4PYHA 4QRUB 5HHPA 1GCFA 4NGHL 4FXKB 5FO9A 1WUNT 4OGYL 5HGDA 4QHMB 3TH3T 4QHLA 2EDBA 1VA9A 4ODSL 1U95B 1I4FB 3I3BA 3LAFA 3PWLA 1U8KA 4C59B 4I18B 4RFNC 2EDTA 3CU1A 1GGIL 4TVPD 5DJ6A 1L0YA 5BO1L 1PYWA 3D3VE 3VGFA 1B4RA 1TNNA 4JRWA 4JB9L 4PY8I 1RMFH 3FO2B 3D3VB 3FO1A 1E4XL 2E8YA 4LGSB 1Z5LB 4S1RH 1BJ8A 4RA3A 2B4CL 3IGAA 2X4PB 4GLRI 4ZAKA 1FNAA 3F7RA 5E6ZA 1QLFB 1VDGA 1G7HA 1BLNB 1RIUH 4QY8A 3DX6A 3QPQD 5FYLE 2MFNA 4ERSL 5BOZG 2DJUA 4G5ZH 4PG2C 3IKKA 3TBSB 3Q1SH 1MLBA 2BVPB