2HT3D

Structure of the escherichia coli clc chloride channel y445l mutant and fab complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synergism between halide binding and proton transport in a CLC-type exchanger
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
total genus 44
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3D01
5T1LD 4E41D 1WSST 3ARPA 4Y0GA 1A9BB 3BN3B 5DS8A 4FQXA 2HJKA 2P48B 5D6CA 5DZNA 1LO3H 3VH8A 1T80A 3ARRA 4JRWA 3QXAB 4JN1L 2NX5D 4G9FB 4AL8H 3PV7A 4RDQG 2CXGA 3CZFB 2IF7A 4PGEA 2ICWA 2OM5A 4XWOD 1ZSDA 3CFKA 2HT4C 3BWAA 4Z7VB 1BBDL 3NBNA 3KJ4C 3P3YA 1SBBA 2EDTA 1C1EH 5JTWA 2HKFL 5BO1H 3KJ4B 4U1MA 1Q1JH 1ZXQA 3IU3A 4J23A 4WTWA 5MENE 3SDDD 1VFBA 1AHWB 3P77B 1QBML 4Y2DD 3TLRA 3P9LB 3G5ZA 2NYYC 4XAKE 1WCBA 1YDPB 4HULB 3AM8C 2ZUUA 3U2SA 5JW3H 4NIKB 5GGTL 2BVYA 4UUJA 3QDGE 3TT3H 5MEPB 3LKRB 1OP3H 1W0WB 4JJ5A 4PJFB 1H9VA 1G9NC 4B50A 5A16B 2NMSA 3QUXC 4HMEA 5ABDE 2BXYA 1UWXK 4LHUD 5C92A 4NN6C 2GSGB 2JF1A 3ULUD 5KW9L 4ZFFA 1QACA 5ALCL 5IB4B 1IL1A 1KJ3H 1F90L 4PP1D 1A2YB 1RJZA 5CMAB 5LG1A 1QSEE 2Y4SA 4OGZA 4UINH 5L2KD 1XF3A 1S9VB 1I3VA 1A6ZA 1CD0A 5DA0B 3U83A 5EA0L 4LPCA 2R2EA 3TZVB 4HS3B 4MDIB 4D9LL 5DQ9A 5HJ3A 5ID1B 1CGXA 3O9WB 3V52H 1U8QB 2YRZA 2CMRH 2J8UA 4N68A 4K9EL 3FB8B 2OYPA 1NUFA 4JZNB 4TULH 2R1WB 2BCKA 4YR6B 1HINH 1QKZL 3UBXG 2QADB 4C83B 2IJ0C 1TFHA 4NCC2 2C5DC 5DJ8B 1LQSR 4BA8A 4HS8L 4QXTB 1TDQA 4FXKB 4YNYA 1MJJB 3GIZL 1IKNA 4X0KA 3MNZA 3CDGA 4PJBA 4UZGA 1OPGH 3VG9C 4JG1H 2WUCH 3FZUC 2WIIB 1N6VA 5HHOB 4LSSH 1QA9A 1HXMA 2H6PB 4JM2B 5K59E 5HJ3B 5ID1A 2DBJA 1MH5B 3WIIH 3IFNH 4MMXC 4EOWL 1UM6H 4O58L 2CKBA 2D0HA 1KTKE 4LSPL 5HGBA 3MJGX 4HV8A 2R2HA 4KDTA 4MDJA 5TDPB 2HFGH 3BGFB 4RRPG 3P2TA 5I30L 4C83A 1KCKA 3S3JA 1H8SA 3RL2B 3TN0A 3X11B 5BRZD 1I8LC 1HILB 3O6ML 5LCVH 4P3WA 3SGKA 3EFFA 5DLML 4XMKL 1AGCA 1HNGA 3LH2H 3EFDL 3V4UH 3MNZB 5EOQH 2CLZA 2XA8H 3PHOA 1JGDA 1DQTA 5D1ZA 3OKNB 2IANE 3O6FD 1A3LH 3V0VB 2DM7A 4FFVD 3EGSA 5CGTA 2H41A 3QZWA 3UDWA 3U9PL 3QCUL 1MI5A 4KJQD 1BFOA 4I48A 1KLFA 3O4LB 3QB7C 1KT2B 2GSIA 2AJ3A 2XN9E 2PO6A 4LSTH 4Y16B 4PJHB 4U0RC 5IK3A 3SQOH 3ZTNH 2P4AB 2BX5A 4KDWA 4PGDA 3OJVC 5BW7A 3GKWL 3PNWA 4U6VL 4ODXB 5I15H 1RPQA 4YXHL 3SDAC 3E8UL 1QD0A 4RA3A 3BEWB 4DN4H 1GGUA 3MNVA 3QJFA 3QIWB 2BSRB 3V0AC 3BYTA 1S9WA 2YD6A 4QHLA 4RCAA 1WFTA 3D6GA 4TQEH 4YZFE 4M3KB 4J4PC 4NZDA 1E28A 2NY6D 4YX2L 5IGXH 1WVZA 3STLB 2GT9A 1C7SA 4Q6YA 5I8OL 4CKVX 4D0BB 3LQAL 4YHZH 1AP2A 4XT1C 3O3UN 2HVKB 3I3BA 5CIPA 4A6YL 2DKSA 5CJQH 4AT6A 5F9DC 1M7IA 4PJ7B 4KI5C 3MYZA 4WNQB 3W81A 1NUGA 3NACH 4UUJB 3MRFB 2PO6D 2LFGA 4K8RL 3ZE1E 3MXVH 5IJVA 3H9SD 1S9WB 5E1AA 1RK1B 1D3CA 4PJFA 1UWXH 3SGJA 3DXAE 1RURL 2EE6A 3SQOL 5JXEC 4X9IA 4KAQH 1IC7H 3VFPB 4ZSOB 4PPTA 3G6JF 5C2UB 1L7IL 2W0KA 4F58H 4N0RA 5AG9A 1S7XB 1J87A 5HYSA 1U9KA 4LF3B 3IDIA 3GNML 4JGJA 4JFEA 4C56B 2GK0B 2FHBA 4PJBE 2B0SH 3CVHB 3VDBA 1MUJA 2YMXL 4J7RA 3FFCD 1FG2B 2J12B 4FS0A 3UJTH 3KLAA 3QDGA 2ZUYA 3N1MC 4QRUB 5HYIA 4QY8B 3WD5L 3CXDH 3KYNB 3RIFK 3BP7A 1X6LA 5EZIL 4LSUH 5D2NC 1NFKA 4QHMB 3PDOA 3KPSB 5DZLA 3KJ6H 1ACYH 3P9WB 2BMKB 4IMKA 1F8TL 4OLYH 1O0VA 5FA4B 4LVOC 4ZTPH 3UO1H 3CVHA 2W91A 1GZQA 4S2SA 4KK9C 1E6JH 2R1YA 3LRSA 4OCYL 3UC0H 2ZG3A 2X05A 2KQMA 4OFIA 3BSZH 4LSVH 3GJFK 4NZJA 4FXKA 2VR4A 3DO3A 5IMKA 3U7AA 3S96A 3IDNB 5ADOH 1MREL 3ARDC 1ZT1A 2WIIA 3E6HB 1T0NB 2VXSH 3BEVB 3SCMC 1A7QL 2E7CA 4Z76B 5E8NA 4LCYB 3TBTB 4Z7VF 1IGMH 4JRXE 1ADQL 2W0LA 1UB6B 3GSNA 2EXYD 1B88A 2V9RA 4G42A 4L29A 3GSQA 4OCSH 3QUMA 1A4JB 4U1HB 4Z7WE 1CFNB 1ZEAH 3VFRA 4MZ2A 3BKJH 1WZKA 5HYJD 3FN0L 4NKMA 5KJRH 2ZNWA 3QI9B 5INCA 2AEIT 1MQKL 5D7SH 4XB7A 2VISA 5DUBA 3LKQA 1SYSB 1KJVA 4JFOB 5GHWH 4ZS6C 5J9PB 4OUUB 3NGBC 4OM1L 2R23B 2R39A 2B1HL 1UJ3A 4Y5XA 3QISA 4M7JH 4TTGA 2EIBA 1IEHA 4E9LA 4XP9H 3FQXA 2CLRB 1ITBB 3NVQA 3ZHDA 5KSAB 3MNWA 4WCYH 3V52L 3MV7B 5A2IH 1DVFD 3GJEA 3PWUA 2YBRA 1R3JA 5GRVL 2I9TA 1CFQB 3MRGB 4P46A 4U1GB 2CUIA 3SDDA 4BZ1H 4KI5F 1A1OB 3SOBL 5JQ6H 1OP3K 2F54E 5IP4A 3VWKB 1VFOA 4K2UH 4MNQB 5F6HJ 2NW3B 3HFML 4JPIB 2AJYL 1QFUL 4DKFL 2YC1B 3E2HB 1LO0L 5I1DA 1NEZB 4X6CE 5GRUL 1DVFB 2VXUL 5SV4A 4WU7A 3CH1A 3GI8L 4ENED 1ZA3A 3STLA 4W6WB 1I7TB 4E42B 5LGKA 1FPTL 3X17A 3RU8H 5D5MF 5J1SC 5JW4N 1IAOB 4NQEB 3DV6B 4O58H 1XR8A 4R7NB 1MFEH 4LKXB 3FONB 4WW2C 3R0MA 1R3IH 5BS0E 1II4E 5E2WL 1CQYA 4GSDL 4OD3L 3BIBX 2ZPKL 5D7IB 5F7NC 4LBEA 2BDNL 3VMNA 3SCMA 1RUKL 4HW6A 2WSKA 5F1OB 1PKOA 1XMWA 5F7UA 1B2WH 3GBLA 3RUGE 5FV2A 1KB5L 1HZHL 5EBMA 3JV0A 1FZKA 1AIFA 4OCMC 1IAOA 4NQEA 5CBAB 2HVJB 1BIIA 4NRXA 4TRPH 3TWCL 1D5ZA 3V95A 2F5AL 3L3OB 2ZUSA 2F8VA 4YDKH 1OAKL 1F4YL 1E4JA 4HZAA 5EG6C 4YR6A 2VLRE 5FYKD 4IRZL 4ZNCD 4YXHH 1N4XH 1QRNA 3BKMH 3NTCH 5CBEA 2IAMB 2J88L 4WW2A 1T6WA 1WT5A 1YN7A 3KPRB 4Y1AD 5FHAL 1D5MA 4WEUD 2Z31B 2BSSB 4BH8B 1K6QL 3RI5F 1NCCL 3S9DB 4NQCA 5HPMB 4RISL 5I1KL 5ILTH 1BIIB 4NRXB 2ITCA 5C0EA 1I8IB 1CVRA 3DPBA 2QR0B 4X5WA 4MJIE 4YHZL 4LPXA 3DETC 4OD2B 5T3XD 2XWBB 2DQFA 3BGMB 5KAQF 5I18L 4WHTB 1ZHLA 1JE6A 1LEKB 2YS4A 4YHLL 5FK9B 2LU7A 2E3VA 4RZCB 1KFAH 4AMKL 1KB5H 2D7NA 1R3LB 2JLLA 1I1AC 1NFDE 1X44A 3BPOB 1T1XA 2CXKA 3A6CH 3RFZC 1CBVH 2CGRH 1SHMA 1MRDH 4P2OB 4OT1L 2QADD 1XT5A 3RZCC 3T0ED 1JZ8A 4ZS6D 2PCPA 3FTGB 4KMQA 3RPIB 5E08L 3B9KB 4Y7MA 1ONQA 1U8HB 1T7YA 4EBQH 4X8XA 3IU3B 1LP9A 5EUOA 1CFVL 2R56H 3MRKA 2EDRA 4A2LA 4X5XA 3VMPA 1B0RA 1CTNA 1MCJA 1JNHB 2B0SL 1MCQA 5H94A 3C5JA 1AHWA 5FDWA 4Z7QE 4ZYKB 1HQ4B 4FTVA 4ODTL 5EO1B 5HHPA 5ILTL 1OGAA 1N26A 5J12C 1VEMA 3SKMA 4I18C 3VXMD 3ZE2F 4NT6A 4LKCA 2I26N 3KPNB 4LSQH 2P5EB 4HBCH 4LP4A 5L0QC 2X4TB 3D85A 1HH9B 1DANU 3ZKXC 2DTMH 3P11H 3MUY1 3KPQB 4FHBD 2BVUA 3KJ6L 2D7PA 1JN6B 5BQ7B 5FB8B 5GSRB 2PW1A 3V6BR 4U1JB 3JVGA 4HWBA 3RGVC 5FYJU 3C60C 1KB9K 5IJVB 4Z7NF 4U2YA 4FQIH 1ZGLA 1YEFL 1A6TA 4LDLB 5IW1A 2VO5A 4FMKA 3HNTH 4J6RL 3ZDYE 2HKHL 3RQ3A 4BZ2L 5KSBB 4MAYC 3BUTA 3H9SA 3P0GB 2G2RA 4UU9A 4PGJA 2R56L 1BM3H 3FQTB 3WIHA 4ZUWB 5I1IL 3HUJF 4JO1H 1HCFX 3GSNL 5FKAA 3F58H 3L3DB 3MBXH 4QHUA 3BIAX 4LCIL 2CO6B 3REVA 4N1HB 15C8H 4N0UE 1S7XA 3ALWA 3QUML 4XCEA 2UWEA 3FO2A 3TA3A 1UKSA 4G6AC 4OCSL 3PP4H 4ZXBB 5KSVB 4KZEH 4OCRL 1MHPL 1WBYB 2FATH 3WJLA 3MUGB 5ENWB 3K7UA 5C0BE 1R6VA 1QLFB 3MUJA 3EZ8A 2HRPL 2OMNA 2PXYB 1YNLL 1HHKB 4RQQB 2NY3B 1GGBH 1AJ7L 3HI6H 2YA1A 3ARDA 5F7EL 2O5XL 4MQXC 1BQUA 3VG0L 3FT2A 3OX8B 2PYFB 1A6VH 1PLGL 3DLQR 3LS4L 4UIKH 2UZIH 4IMLA 4WFEE 4QGTA 3GSOA 4MD4A 1KELH 2P24A 1EAPB 5HHXL 2I5YH 3ARZA 1I7UB 3MXWL 3OZ9H 2VDNL 1CD1B 2XXCB 2HG5B 1HXMB 4P46D 4YC2B 1KIUA 1G7QA 1RULH 3KLHC 1ZANH 4I4WB 1Q9KB 5D2NA 4HBQA 4L8SC 1AC6A 4WUUE 5J57B 1FVDB 3D2UB 4K55A 5D2LE 3MROA 3GZKA 4PRPB 4DVBA 1EDQA 1MJ8H 3IU4L 4L4VE 1K8IB 4HWZB 4MWFA 3C2SA 1GSMA 1FORH 5JA8B 1K5NB 1QFUH 1RJYB 5SWZA 3B5GA 5BRZA 4NQSB 2N4IA 1WF5A 3RWEA 1AQKH 4ODUB 1UH4A 2PYED 5JIKA 2BSED 2FWOA 5DJ0A 3WDJA 1FPTH 1YMHB 4NOFA 3NAAH 3OKEB 4U1KB 2C7UB 1LHZA 3IKKA 2Z9TA 1U36A 5EC1B 1MI5B 4BJLA 2RHEA 1S8DA 3CSBA 4TUOB 1FHGA 1FZOB 2IALA 3CCHB 2VOTA 1DSFL 4QRSA 2UY6A 5GRXG 5TDOA 2FEDD 1ZVHA 3B4NA 3QP3A 4OD3H 1BQHA 1SYSA 5HHXH 2N7AA 2EKSB 3RP1A 2F74A 4AEHL 2ZUQB 4L9LA 1P84J 1T89A 3D0VA 5DWUL 1U8PA 4UOW0 3MODH 4NPYA 4AIOA 2E6JA 1WIPA 4D0DA 4KTYA 1QLRA 3S5LG 3VFUA 2IPUK 3U9UB 8FABB 5MEQB 4LHUB 1KNOB 2VITB 2E6PA 4RGMC 2ORBL 2X1OA 4UAOB 5FOBA 3EYOB 2JJSA 3JV5A 4JLRB 5L2KE 4GRWE 4XPAL 4KTDL 1PKQE 3GIVB 5DJAB 1A6WH 2JIXB 3U7WH 4NN5B 4NKOA 4Y16D 1UEYA 3CMGA 4KRNA 3NTCL 5IVNA 3FL7A 5IQ7H 5J8OA 2H3NB 1AY1H 3HAEA 4LIQL 1JUFB 1NGWA 2H8PA 2NY3C 3L1OL 2QADC 3PWLB 4QTHB 3L3JB 3SDCA 2H2SD 3DV4B 3EYFB 1BJ1J 1RVFL 1OCWH 3OKOB 1IGJA 1EV2E 1A7PH 1EHXA 4EIGB 3E6FB 3QDJE 4HT1H 4MDIA 4DZBA 4HH9A 4LNVA 2PO6C 4S0SD 5I73C 1S78D 1MHCA 4F7PA 1NGQL 4OLVL 4IHOA 5I16A 3ARGC 4GXVL 4NO3B 3S88L 4U3CA 3QIBD 3V6OA 3WJJC 4F2MB 3RY5A 3B3IA 5L9DH 3OGOE 4YQXH 2R1WA 2VIRB 1X6NA 2FHCA 4PY8I 2R1XA 4YBLC 5IBUB 4MMZC 4UT9H 2E8ZA 2LE9A 4E41B 4YE4H 5ESAA 5F9JA 4LCCA 2YPVL 3L3DA 1YPZF 1W0YT 4QY8A 3AC0A 2EEBA 2EDNA 5DHYB 2QQNH 3X12A 1YNTB 4PJ5B 1T89C 3DVFA 4XMLL 5FO8A 5D2LA 1YNKL 1QBAA 4RWYL 2FLRT 3DBXB 3OAZH 3DX7B 3KPMA 2ZCHH 4NFBA 3IDGA 3O8XD 1G0YR 4QHNA 3P9MB 3HCVB 4CUCA 3O81A 1KEML 4OFDA 3PL6D 3QDMB 2HJKB 4Z6AT 1WCQA 2H26B 5D7JC 3IDMB 4LSDA 5ECJE 4XP6L 3C5SA 3QH3A 4LQFL 4FQXD 1JHTA 3GK8H 4MJID 5I1JH 4X6CF 1YECL 4QRRB 5I9QB 1P5VA 1TZIB 3GSWB 3C9NA 3QUXA 4NN6B 4X5LA 1A3QA 3TYFA 3MLXH 2WBWB 3SKJL 3CPLA 4BH7A 5SV3A 3C2AH 4H8WH 4AK1A 3VRLF 4HUWB 2ICES 1FSKC 4N9GB 5F3BA 2EE9A 1WCBB 1YDPA 3AXLB 1FYHB 4J6RH 1D5BB 1ZT7B 2EZ0D 3BEWA 2IQAA 3NPZB 5IF0B 3BI9X 2DIBA 3B9KD 5D1ZD 3RPIA 2W60A 4LAQL 3QWOA 1M71B 4Q9CA 3QIWA 2WNGA 1LP9B 5DMJB 4P0DA 3HLAA 4JHAL 3QZWG 3TNNB 2VDRH 4NQDA 4OF5A 3NMEA 2FATL 5CP7A 4HUVB 1RZFL 4E5XB 4LEXL 3ILPB 4LQFH 4LPVA 1UXSA 2YBRB 4RAUA 2GUOB 4PD4K 4MJ6B 7FABL 4W4OA 3OAYK 1GGIL 2IPKA 1LWRA 3DOSA 5IB1B 3MCKA 5D2NE 5DJXB 3AY4A 4HIIB 3ULVL 1G7LB 5SWZE 1NH6A 5HVWA 3S4SB 5JHDA 2AV1A 2I60H 2DTSA 2YSSB 2QSQA 1Y6NR 5KN5B 2AAVA 1OHQA 1KPRA 3NACL 5TE4H 2RCSL 1IMHC 1QR1B 2WUBL 5DMKB 4W68A 3QPQC 2VDOL 2FGWL 2R2CA 1PSKH 1DEDA 4EZMA 1B90A 3BXNB 3WUWA 1NCNA 4K94H 3C09C 2EIEA 1A7OH 4XNUL 4I9WD 1Q9OB 5E8DL 4FA8A 2IADB 1N3NB 5EFIB 4PBXA 5L8LB 4PJAF 1U8JB 2YPLA 2AEWA 5IEKB 3L7EA 3ZKNC 2X6MA 1AGEA 2XQYG 3R8BB 5JHDB 5IM7A 4CADA 4XNYL 4KXZI 2YPKA 1KPRB 5LAXA 1RUMH 3R06B 1AQKL 1QSEA 3QDGB 1RZFH 3KLAB 4PJ9A 5F1IA 3VD4A 1AI1L 5DJ8A 5ESVB 5HHNA 4DJMA 5KVEL 3QUZC 3UTZB 4HH9B 2GTWB 2GY5A 1FZKB 5ALCH 1WBYA 1N8ZB 3VFNA 5DD0L 1SEQL 1A8JH 4O51A 5F7HA 4IRJD 1RZ7L 3U0PA 4YO0B 3KPOA 2FECI 1Q9LB 5DRWA 1TETH 1ORQA 4DN3L 2G5BA 1TVHA 2DQUL 4MA3B 4LPYA 5DJZB 4Y4HD 3RVUC 4XI5C 2JB5L 4X7SL 4PGCA 1MVUB 1PG7L 1S7WA 3PHOB 4TVPE 1BJ1H 3HZKA 1ADQA 3VXRE 1FH5H 4X6CB 2HFFA 4DKAA 4YHYB 1MHEB 1IC1A 1RJLA 4JG0L 1WEJL 1FYTA 3WV0A 3ZT7A 2NW2B 3MRCA 5ADOL 4XCFH 3CU7A 4HC1L 3ZTNL 3HC0A 1UCBL 3WNMA 4MQTB 2AGJH 1A7QH 3BVNB 4DKEH 4OZ4A 3E8UH 1S3KL 4L29B 3PGFL 5EU5B 1VKXB 1AO7D 4GS7B 5CSZA 3K8KA 3ARQA 1S7SB 4JY6B 4ZO8A 4UOJA 1MLBA 5DQJB 1QSFA 2FX8H 2HFTA 5DD0H 5E95B 3HZKB 4PBVC 4QHLB 2ADFH 4OCLC 4ZAKD 4YX2H 3QJFB 1FJ1B 43CAA 4JFOA 4PV9A 5ITBH 3T3ME 4TUOA 3NA9L 4GQ9H 5GIRB 4Q9QL 1IQWL 5HHMD 2C1PA 1QQDB 4KTEL 4MA8H 4PB9H 4QRRD 3O41B 1VSCA 4Z7OE 5C09A 2APVA 1ZOXA 1LEGB 2O5ZL 3JTSB 4XP4L 4OF8A 1LNUA 3ARBA 4HHAB 1GPOL 3DETD 3LH2L 4X6DA 3FB7A 4WDIB 5CP3H 3SJVB 4HKXB 2ICEA 5BV7C 3LPGA 5FHBL 4D0DB 1H5BA 5FCSH 5LJYH 3U9PH 2XWTB 5D93B 3OKLB 4NO2B 3WUZA 2BSTB 1PFCA 1CDGA 4U49A 1Q8MA 1JPST 2XTJB 2Z8WC 1YUHA 4KU1A 4RGNE 4BFIB 2EYTA 2ZSVB 2JTDA 4E42A 4NOBA 4CN1A 3BRFA 4P2YA 3Q1SH 4G6FB 1QRNE 3GNMH 1WC7A 4GW4A 2OLDA 1NBYB 1HSAB 4HWUA 2H2PC 1LNUB 2YKLH 3MRPB 1Y6MR 4NZTH 4ONGL 5IMLA 4KVCH 1U8QA 1DBBH 25C8L 1X5LA 2HLAA 3SO3B 4LRNL 3Q48A 4TNVK 3WIHL 4Q58C 2X9YA 1A47A 3QCVH 4ZUWA 4YXKH 1LDPL 1HQRB 3EYVB 4JQXC 5E9DB 3EHBD 2LQRA 3GBNL 1X3DA 2NYYD 3L5WB 2BFVH 5F21B 5TQ0L 3ZE2E 1NAML 2APBA 1WZMA 4P5MB 1T04B 2B4CL 4YHYC 3O3DB 3CFBB 4Y19B 4Z0XB 1EEQA 3LQAH 5C0ND 5KSVA 1CFSB 1QSED 2XV6B 1ORSB 4PJ9D 2ARJB 3WUWB 2GITB 3GMOB 4FZEL 4WO4B 4XXDB 2DL9A 3SDYL 5I8CA 3GJFA 1F3JA 4PY8J 3W2DL 2VDLH 3EDEA 1NBVH 2AXFB 4WY7H 2YUWA 1RJCA 3RVXD 4FQQA 4OCXH 3T08A 5E8PA 3PIQA 1NAKH 4POYA 4UTAH 2VL5B 1MFBH 1X5HA 4POUB 3ZHLA 4UMGA 4RMSA 2M8XA 3SE3C 4KRLB 2YD5A 4LLWB 4NZTL 3MRDB 4HJ0D 1JWMA 3NFNA 3X13B 3CLFH 1TMCB 1X5GA 2WV3A 5MERB 3JBG7 4DZ8B 4NN7B 3GSRA 1U3HD 5HDQL 5ADPH 4DOHB 1ZEAL 3NZ8A 3EJYD 1YEIL 3BHBA 4FQJH 3GSXB 3ULSB 3VWKC 1F3DH 4KUZL 1MFDL 5D7SL 3EO0B 2BRRH 2DBLL 2BY0A 4R4FH 2BP3A 5CD3B 1NANH 2WWKT 4LPUA 2VLME 4MWFB 2RBLA 2HYMA 2FWOB 5DQDL 5I1LB 5IB2B 5JZ7D 5BOPA 3ROLB 4AMKH 3UZVB 4Y5VC 4WHYG 1JJUA 1MVFA 4Z18A 2K3TA 1EPFA 1FNGB 2OJZH 2OK0H 1NMBH 2HT2D 3QIWD 4OLYL 4G8IA 4PJEF 1E28B 3MRIB 5C07D 5C0NC 3B9KA 1PZ5A 1QLEH 1AP2B 3ZT6A 1FZOA 1T7WA 1SJEA 4IOIB 1LO5A 5T5NG 3DXAD 4N8PA 5T1KD 3O8XC 3EDFA 3C6SA 2MTPA 1JYNA 1JFQH 3E1F1 1S7TA 1I3GH 4H20L 3I50L 4X80H 3OKMA 3W9EA 3S34L 1A1OA 3SKMB 4R7DB 2RFXA 5HHPB 5JPNA 5K9OA 1JHKL 5DUPL 5CEXB 5IHBA 4O2CA 4G6ML 2D03H 4CMMB 1JF5A 2D9QB 2A6JB 4MNGA 3UPCA 4P5KB 4ZSOA 4WV1C 1JWSB 3KDMB 4OAWA 3UDWC 2ZUXA 4HBCL 2X70B 3M45A 1GIGL 3DXAB 2PW1B 3DSFH 4ZO9A 5E2WH 3SEPA 1YZZA 1KJ2H 4R90H 4LCUA 4MCYA 2ZWLT 1NMAL 4XBEH 5DJXA 5JLZA 4K07A 3IDIB 5C2BL 4Z7WB 1WITA 3KNBA 1OP5K 4P46C 1A14L 3O8XA 2ZG1A 2VZSA 4WI6A 3HNSL 5A2KH 5JHLL 4I3SL 4KKBD 5KSBA 1CWVA 4R7DA 4L3EB 1JPFA 5FM5O 4FG6D 3STZA 4BUGA 3KXFD 3QA3B 4OGAC 5C9KA 2B4CC 4L4TD 4PJBB 5GGTH 4AH2B 4HX1A 2EO1A 3VXME 5IUSA 3AS0A 2I9LB 5HYSG 1I3GL 4H20H 4OFYA 3RX7A 3A6OA 4NQDE 1X5ZA 1OAYH 3B3IB 2QKIA 4JFZL 4NUJA 2V2WB 5EZJA 4MX7A 1NCWH 1AGEB 4M48L 3QUMH 4G8EB 5MHSD 1J1OH 1JGLH 4UNTA 3EYVA 5E9DA 4ZPTA 1G7PB 4WI7A 4XBGA 5D8JH 5CBEB 5C0GA 4CBPA 3CFCL 1NEUA 3QQ9D 1HWHB 1KCVL 4K7PH 1QFWI 1B0GB 3MOQA 1EBPA 4K71C 2OL3H 4XNQA 4OB5H 3T2NH 2XKUA 3JV4B 4N0FA 5K9KA 5DHYA 4GRWF 4Q9QH 2X4PA 5E2VH 4MAYA 3UJJH 3F7YA 3PF2A 3Q6GH 4CU7A 5L2KB 3HNSH 2HG5A 2ADJA 3P9MA 2H1PL 1CLCA 3BUYB 2QR0A 4ZQKA 1BF2A 4JE4B 1U3YA 4R3SA 1VACA 3PNWB 4XVTL 4AEEA 4LLDA 2AJ3B 3BZDA 1RIHH 4Y16A 4X4ZA 3ETBF 1PY4A 1F6FB 5MP6H 4HCRH 3QNZB 1K5NA 1RJYA 2VLKD 3CFEB 2FH6A 4XVSH 2V9TA 4RX4A 2HRLA 3NZ8B 1EEYB 2D31B 1RZKH 2CLRA 2BNUB 4YIQB 5EU3A 3MRKB 1CXKA 1FIGH 4B7LA 4TSBL 4WWKD 43C9B 5LGJA 4JY6A 1DBBL 3RHWF 4OIAA 5FYJH 2F5BL 2G75B 2I24N 4QRSB 1QSFB 1OSPH 5DT1L 1K2DA 4X6BB 4GAJH 4J3VA 1BLNB 1MRFL 4NQVB 1IAIH 3P73A 1IKFL 1P4LA 5B8CC 1MJUL 3T1FB 4PBWD 3DRTB 4FRWA 4GH7B 2VITA 4XTRD 5DWUH 2PYEA 3VFUB 4MNQE 2CUHA 4N8VG 1ERNA 3BDYH 2DDQL 4OIIL 5D1XA 3P4NA 3MCKB 4HKBA 2Z8VC 3IB4A 5I8KH 1TZGL 5BV7H 3BZEB 4F7MB 1AXIB 3T3PF 2Q7YB 3QDME 4RGND 4PJXE 5I1IH 3IETB 4APQA 5C8JB 1B4RA 3WS3B 2W1NA 3FQTA 1LO2L 3FOMB 1VFMA 3NPSC 5B39B 5DMKA 4JB9L 3E3QC 9CGTA 5FYJL 4ALAH 4WHYH 1CFTB 4OGAD 1JWSA 4D9QE 4DFHA 1OSPL 1FNHA 1MCFA 4PJCE 4RRPA 4HIHB 4JZJB 4CVZB 4X0KB 4ORGA 4LVOB 5E4IA 3X3GL 3IRPX 1E4WH 4HEME 4QXWA 4F7CB 4JN1H 1CGVA 1CZ8L 3H42H 2FRGP 4D9QD 3KLDA 3T0EB 4RMUA 5HD8C 3QUKB 5KVGL 2DQJL 5CWSA 2EDHA 3F5WB 4P3DB 3HMWH 3QDJD 5CJXA 3S88H 3ZL4L 4PRHB 3QPQD 3RJDA 5IB5A 4GW1A 1BF8A 4QLRA 1BZ9A 1A6UL 1FGVH 3RI5K 2C3XA 3VU2A 5L6YH 3IKCB 2HWZL 2UUDH 4OFKA 1OARH 1PQZA 5DK0A 2P5EE 2R4SH 3AGVA 3HE7B 3T65B 4UI2A 1FFNA 1QBMH 5GS0H 3HE7C 4RDQF 3CZFA 2ZOKB 3DRQA 1I8IA 3ULVF 4JPVH 5TQ2H 4NGHL 3QFJA 4ZO7A 1T4KA 1T5XA 3I3DA 3FQNB 4ELMF 2WLZA 3SO3C 4TTDD 3V4VL 2EDXA 5ISZE 4RAVA 5LQBL 5E2TH 5E8EB 3L5HA 1TJHH 3BP6A 2YK1H 4PLKD 2HAZA 3U36B 2MCPH 4IOFD 4MA7L 4RGMB 2FO4B 2BOBA 1NC4A 2YUXA 5JPMA 2AJZA 5K9JL 5JOPE 3WS6C 5D72L 5DK0B 4P49A 5KSAD 3WEXA 5FYKL 5HI3C 4A6YA 1U3ZA 2GYSA 3MFFB 4NKIH 5JQHC 3D85D 5AD0B 4HGMA 4UT6L 2F54B 4PY7A 4Y1AE 1I1RA 3VGHA 3OKEA 4HK0A 1DDHB 4OI9A 1XF4B 1JTTA 3FQNA 5F6HI 2RR3A 1KIQB 1R5VB 5GS2D 5ERWA 4TUJA 4H1LB 4M7LT 2XG5A 4GS7C 1X5JA 3IXTB 4F33B 3KXFA 1RFDH 4JFHD 3HZYB 3U0TA 1RIUH 5T33H 4WGWB 4I2XE 1R3HA 3DECA 1AQDA 5C6TL 4X6FA 4YEFA 1H0DA 5T5FH 4Z77A 4LVEA 4PRBB 1OB1B 4NGHH 2YC1A 3UXFA 4POZC 1H3PH 5C09E 4IS6B 3VMOA 1MREH 2X4TA 2YD8A 2NW3A 1LK2B 2Z8RA 4FQLL 3DYPA 5FYLL 5KZCD 1T21A 3IJSB 5BZDB 1NGZA 4LAQH 2IG2H 3QUYD 3QEUA 3T0AA 5LGHL 4PJXA 3B9EA 4U1JA 5GRWA 4EQ3A 1WIOA 4M6AA 1DBKL 2VXQL 2WAHA 2X4SB 4U1LA 4KI1A 4YUEL 4JHAH 5T3ZL 5FYKU 1MFAL 3TO4A 4Y5VA 1OPGL 1QG3A 2XWTA 3RBGA 4CN6A 2F53B 3MLUL 1RVFH 4ZNEE 2D0FA 4K71B 3AAZA 4JFFB 1BOYA 4HJJH 1QYGL 3TH2T 4P5KA 3QUZB 3GBMH 3L5XL 1LO4L 2UWEB 3HE6A 3NCYP 5IMLB 2UY7A 3ALPA 3D3VB 4YDVA 5F7DA 2E9IA 3NABL 4LVNC 3K1KC 6FABL 2F8XC 3B6SB 3OJ2C 1LILA 4G7VH 4NWUL 1EJ6A 1D5ZB 2ZCLL 1TQCB 5CEYB 1DQLL 4PJDE 4RFEB 3OXSA 4P99A 4XB8A 4H8WC 5D7JD 2KH2B 4MJIB 5IHLB 1OAQL 2YXMA 2J4WH 5ITFB 1IGIH 4UV7H 5AZEH 5C0BB 1WAAE 2QQKH 3D3VD 5DDHB 4LSTL 2J8UE 2I9LA 4P4KA 2MHAB 3I6GB 3RWHA 3VWKD 3BPLB 4OCWH 4HKJA 1I9EA 3O6LH 1J1PH 2WZPD 4QOKD 4F7EA 4POZD 2GTWA 5EUOF 4LCWA 1NFDB 2P5WE 4TOYH 2AJXL 3C8HA 5IQ7L 1U3HC 1ITCA 4X8JA 5JDSB 2ENYA 3S36X 4GRWB 5IQ9B 5B3NA 4HJJL 4FFWC 2DQDH 5FV1L 1SJXA 3RNKA 3GBML 4RZCA 2DQEH 1MFEL 3BW9A 3K1DA 5I19L 3BH9B 1F02I 3VFOB 4CRPA 3IFPB 4ODVH 5FYLD 3QUYB 1QR4A 3W82A 2X4PB 4IJ3B 2VL5A 3RGVA 3KLSA 4HKJB 2VISB 5DJ2B 1MIML 3VRLE 1MVUA 1FFNB 1IGTB 1JWMB 4G7VL 5CJQL 2BNQE 4QNPE 1GHFL 3MRCB 2ERJC 1JNNL 1I1CA 4KROC 4YFEA 5EZLB 1DCLA 4GG8B 4GAYB 4AQ1B 2OI9C 5GZOD 3H7BB 3MUHL 3VFMB 1IGIL 5HXMA 3FQXB 4DWHA 5I8KL 4PB0L 4U6TA 2N56A 3TCLB 3DO7B 4HC1H 3KG5A 5T1DL 3MNWB 4KV5F 2F8OA 4NO0D 5DS8B 1UCBH 1BP3B 5E0QA 1BQHB 4X5XB 2LAAA 2WP3O 3PGFH 1YN6A 4BSWB 4QF1A 3LSOA 4XGZA 3LEXA 5AZ2H 4F9PA 2DQDL 3QXDB 4BK4A 5E1AB 5DC9B 1KCSL 5F6IC 4WW1A 3RTQA 1YPZB 1W72B 1OSZB 4P59H 1QBBA 2XQBL 3OXRB 3MJ8B 4Q6IA 2NPLX 1KGCE 3PABB 3PGCB 3CZJA 4HFUH 5BW7C 1K2DB 4LSRH 4X6BA 2CDGA 3ARBB 4HHAA 5HD8D 4G43A 2HJFA 3CXDL 1I85C 1UFUA 4EEEA 1S9XB 2DQJH 4N0UB 3FT3A 4OKDA 1KLUB 5EZIH 3PWPA 1LE9A 2H3NA 3HAEB 2XKSA 1QFWH 4KK6D 3W9DA 2R0ZL 2IPTH 4NWTH 3RWCB 2BCKB 3VE0B 2OP4L 3ZYIA 2X10A 2ED9A 1CBVL 1EH9A 1F4XL 1AGBA 2VN4A 3D18B 3ULUL 3NFPB 4NN5C 4DUVA 4M5ZH 3UPAA 2D0GA 3WXWL 4JPVL 4MQXD 1Q9WB 4DGYL 4U31A 4XZUA 4UDTB 4YXLL 4OZIF 4KJPC 1Z0MA 3UYRL 2M1KA 5E6IB 2BMKA 4AEIH 1N6QL 3LHPH 5FGBA 1YQ2A 3VD9A 5C8JA 4OLZH 2VC2L 2FD6L 3VXUE 1KCSH 3DUSA 1JK8B 3NN8A 3MCG1 4P59L 2G5RA 5DHVA 4IDJL 1RZJL 2VXVH 1ETZA 1C7TA 1HH6A 2MQ3A 4I0PB 1AGCB 4P23A 5EU6B 4YXKL 1P2CB 3WHE0 4WUUB 1D6VL 3TZVD 3FB6A 1TENA 1FE8L 3W0WA 5TQ0H 1J0HA 5B3JF 2EDLA 3FOLA 3TBSB 5L88H 4O51B 1HEZA 4X9BA 4P4KD 1KPUA 1GGIH 1V8HA 1L4IA 3GJFB 3ULVH 3FFCA 2G5BB 4NHUA 4QRPE 4Z5RA 4GW5A 1J18A 1DR9A 4G7YL 3PQYE 1U42A 1CFNA 1GVIA 4D0CB 4KRPB 2VLJE 3QDAA 5D2NB 4KVNL 1UKTA 2VR5A 1DQJA 1AR2A 1MNUH 2NQCA 4P4KB 1MJJA 3MNVB 5EZOL 1XZ0B 3DROB 1HWGB 4OUUA 1BWWA 2EICA 4LPWA 2OXGA 1MFBL 1HHGA 1DQDL 2AEPH 4X7TA 3QULA 1NMCC 2FX9L 4C4KO 3LRHA 1IEAB 3OJDB 1I8KB 2AJYH 2IBBA 3CLFL 4Y4KD 4Z5RB 1IVLA 4GMTH 1FRGH 1LO0H 4R0LC 2NY0C 4Z7UB 1T5WA 2DWEA 3I02A 3HRPA 4GMSL 2NY1C 4FQ2H 2X5PA 2ZSWA 4U6HA 5I1CH 3H3PH 3SKNA 1PKQB 4ISVA 4KUZH 4L3EE 4NPYB 5D7LB 4LLMA 3CFJA 4M93B 3QUXD 1G9MC 1OGTB 2VLLB 1B0WA 5CLTA 4GOSA 1IQWH 3LAFA 1PX4A 2BJML 1WWAX 5HGAA 5JMRA 3VXMB 2BVPA 1HSBA 2GTZB 1C5DB 1M7DA 1RI8A 1ZVSA 2Z4QB 5CHNA 2JB6A 5HDLA 3OZ9L 5I76B 4LAJH 3IXAB 4PGDB 5IJKC 4M8VA 1OOAA 2DWEB 3I02B 3LRGA 2MWCA 5CJBA 1X9QA 2H32H 4HXAL 5CZXD 4PRBA 5KANG 1D5XB 2CDFA 5KVFH 1INQA 5EN2B 5EBGA 3VFVB 5IV2A 12E8L 1JHLL 3HR5B 2R4RL 4JJ5B 3UJIL 1HI6B 4BFIA 4IRSD 4R96A 1J1PL 2FR4B 4PLNC 3EJZD 3L3JA 5DURB 1QBLL 1FQ9C 4GKZA 2Z91A 3W39B 1UC6A 2DYPD 4MVBC 4U1LB 3ECBA 4E41E 1IGJB 25C8H 5BOZG 1G6RL 3IXAA 3WNOA 2X9XA 3GMPB 4P4RB 1T2XA 1DE4B 3WHE1 1M7IB 5KS9B 1F5WA 2KUTA 4MD0B 4NO5A 1FFOB 4WI4A 4ZOEA 4L4VA 3TBWB 1M05B 4IIQA 5ITBL 1R5IA 3SJVD 5J56B 4APQB 4KQ3H 4EDWL 3QIUA 3SPVB 3MRNA 1A14H 3U1SH 1P9MA 5DMIH 2O5ZH 4O2EA 4JRYB 5JHDE 5JW4R 5J13C 4AM0A 3S6CA 5IBLC 3HZVB 1ORQB 3BAEL 1IM3A 4I77H 4RNRA 2XKNA 4UBDC 1JHLH 3KPOB 3IDGB 1S7VB 1VADB 4K9EH 5F93C 5CD5D 5GGSA 4L4TE 5IESL 4KKAC 1NAKL 4GW1B 1OAYL 4JFZH 2PNDA 4ZPVA 4EVNB 2DLEA 1PZUB 1J0IA 4FTVE 4QWWD 2Q8BL 4MLSA 1T83C 3I84A 5DSCB 1X4ZA 1G6RH 3MA7A 4LGRB 1JIBA 2ZNXA 5IT2H 3EOBA 4HC1A 2JJUA 5INDA 1DJSA 3GSRB 1T6VN 4ZTOH 3T0WA 1IGCL 3AS3A 1UJ3B 4Y5XB 3ZKQD 5L2KA 3MLZL 3GMMB 4MAYB 4PJBF 1ONQB 2DJUA 2J6EL 4YDIH 1U93B 3D69B 3M1BB 3MX0A 3VXRB 4XVJL 4HD9A 4CMHC 1G7IB 4EDWH 1OQXA 2DLHA 3MCLH 2IFGA 3BQUC 3SGJC 4MDJB 5LXGL 1WT5C 1CTOA 1ZLSL 4GO6B 3WE6B 5D5MA 3BDBA 5IHZB 3MV01 2GY7B 5D70L 3RVTC 1CLYL 3BRDA 4XVTH 5F1NA 4OQTA 3BAEH 4PRHD 5ACLA 1OGAB 1V5JA 4PJCF 1BAFH 4OJFL 3HZMB 1AXTH 1W72L 4ELME 2YUZA 2VZ1A 3CVIH 2JCCA 3OJMB 1NDMA 3MRBA 4KMTH 3OGCB 3HC3L 3V5KA 2ENSA 3BE1H 4C59B 4JO4L 2CRIA 3EYOA 4P57B 2EECA 4BYHA 1LK3L 4OCXL 3I50H 3LIZL 2GAZA 3T0EE 2X1XR 1IGYA 1L0YA 1UB5A 4YK4B 3B9KC 1IGCH 5GSVB 2X4QA 5ICYA 1IM9B 3MLZH 2V2TA 1G9ML 1U8OB 5B38B 5FCUL 4YHPB 4JKKA 2V6HA 4S1DC 1YJDC 5FGSA 1A9EB 3MLWH 4OZFG 5CEXA 2D4DA 3ULVE 2BHYA 3ARDD 2G60L 2VWEC 4XCCL 1AJ7H 2VLKA 5IIEB 2NY2C 5BZDA 2HJFB 4LMQI 2W59A 1MY5A 5IB4A 4WEBL 2FLBT 3WFEL 2DN7A 3C60A 4LASH 3FO2B 1ZMYA 3O2VL 1A2YA 3CSYB 3O11B 1MHCB 1U8JA 2YPLB 1KN2L 1KELL 2KPNA 3PXJA 1Q94B 3PGDB 3M17A 4P4KC 1C16B 5IBTH 2NY4B 2Z93B 2YUVA 4KMTL 5B38A 2DB8A 2X4NA 2ATKA 3D25A 1NSNL 1RULL 1OD9A 3OSKA 3HS0B 4JDTH 2P47B 1NKOA 3G9VA 3NFSH 4L5FH 4ENEC 5HGHB 5BS0D 3M07A 1RK0A 3U6RB 4PREB 5EO0A 5JORB 1U2CA 1ZHKB 2AJSH 4B41A 3ZKMC 2EE3A 3H9SE 2APFA 1U8NB 4WI2A 1UZ6F 1FORL 5E5MA 4M7KH 4JHZA 1LEIA 4JZJA 2ICCA 3VXSA 4RFOH 3I6KA 3EW3B 2NY1B 4RBPH 4MS8C 2A74A 1M05A 4IIQB 4HAGA 5DUPH 1MWAB 2ESVE 3KPSD 5J11C 1E4WL 3BH8B 5EDXA 1BZQK 4H26A 1P2CA 2AXHA 5E2VL 3BPNB 4XAWL 3TESA 4LASL 3KYKH 4JRYA 4KQ4L 3ZTJG 1BHGA 4NRYA 4IRSA 1NCAL 2DQCL 4YWGL 4R90L 5DTFA 2FSEA 4I3RH 3UTPE 1A64A 3QO0A 4PD4J 3VXSB 3K81A 2OR9H 5I74C 1N59B 4K3JL 3SDXB 2QSCH 1RHHB 1M4KA 5HYJB 3MRQA 1T7XA 4HGWA 5FOJA 1FYTE 4JANB 5GS0L 2GIYA 1DZBA 3IGAA 3RNKB 3TFKD 4Y4FB 4LLUA 4H26B 2JIXD 3M8OL 3ROLA 2XYCA 5DSCA 2BNQA 1JNLL 5EUOE 5IVZB 1RHFA 3JUYA 4R4BB 4WGVB 1I9RH 4S1SL 1TJHL 1UH2A 2OL3A 4V1DD 2ITDB 1DL7H 4PJAA 3U9UA 5ISZD 4P2QB 3EYUL 3FO9B 4KROB 4HS6A 2ICWB 2ARWA 5K9JH 3D3VE 4GAFB 4H5SB 5EIIB 3DVNA 2PUQT 4OD2A 1OAXL 1EAJA 2DS4A 1R0AH 4OLUL 2XTJE 4RGNB 4GKNA 1A7RH 4Q2ZA 4V1DE 4X83A 1KF9B 1FL6A 3ZT5A 5D93C 3G5XA 4PJDB 3AM8A 3DSNA 4OKVB 1MCIA 3QIBC 3UJJL 4EXPX 5FGCB 4OZIA 4O2CB 3KPTA 1NGPL 4X7SH 2XZCL 3AFLA 5GXBB 2O5YL 2V17L 2FECL 3VRIB 3MRBB 3KDMA 4OAWB 1K85A 1UENA 4FQHB 1KCUH 1E6OL 2BVTA 2P1YA 3TA3C 1C5CH 1KXVC 1M1SA 3TJHC 5TE6H 4LU5H 5I8EA 1RIVH 4P57A 5IOPA 3BFOA 3LPWA 1T83A 2X70A 5M94B 3TPUB 3U4AA 4DQOH 2B20A 4X7EC 4JPWH 5DJYA 4GRLD 2F58L 3TO4B 4JB9H 1HXYB 1YEKH 4JFDD 2YEZB 4HEPG 3HNVH 1RY7B 1XGPB 3TZVA 1FIGL 5KBNC 1NLDH 4XRCB 2VE6B 5EBWB 2IAMC 3QQNA 1CDJA 5EIVA 3RU8L 5HHQB 4GKSB 5GZOC 5I1KH 4KJQC 5DD1H 2QKIB 4BSJA 1RZ8A 4WIQA 3BQUB 2EDJA 1MRFH 5ISZA 1B6DA 1CICB 5E03A 1ZS8B 1NDGA 5T1MB 4GSDH 4F9PC 3QUKA 1CICC 2DM2A 4XNXL 2ADIA 2JELL 3BZ4B 2ZPKH 3QIUB 1T1ZA 1ULVA 1C08A 3TIDB 1TVHB 4M61A 3QDMA 3HS0A 2DMBA 4JVUA 1UADC 5I73B 1B0GA 3O4OC 2A2QT 3AREC 1PQZB 4X7DC 4ONOA 1U92B 5E8OA 3REVB 1DUYA 1BZ9B 3MC0A 4N1EA 4WUUA 4XXCA 4OZFH 5E8PB 3HI1B 5HI4C 3GHBL 3QEGL 5ALBH 3I6GA 3RWHB 3W0WB 1GL4B 1UWGH 4WENB 3AVEA 1RJLB 1SY6A 2Y25A 1FFPA 4DTGL 1CFVH 4S0TD 3OKDB 1XF2A 3WDHA 1F4HA 2C3GA 5JOPD 1BEYH 2Q76A 2VLKE 3JWOC 4L3AA 4WHDA 3B2VH 2WLYA 2X89D 3TT1L 1NGXA 4O5LH 4XPFL 1WTLA 3BH9A 3ULUC 3MJ9H 4QWWC 2BSSA 5FYKH 3GFUA 4AL8L 1K8DA 3GI9H 3O3AB 3EDJA 3FMGH 5SWQB 1MRCL 2P45B 1NCBH 1DLFH 4HZLB 5GGRY 4HJGA 1S7UA 4L3CB 2SEBA 4KI5D 4XX1G 3P0VH 4HUUB 1AGFB 5HYJA 3RNQA 4L4JA 4JQIL 4Z0BL 5JW5A 1OF2B 2YZ8A 3S97C 3REWA 1EHLH 1JNNH 4U1MB 1KN2H 4JGMA 3SDYH 5TE4L 4LK4A 3QQ4B 5DUBB 2NY3D 1S5IL 1MRDL 2RFXB 3NCBB 3O3AA 5JPNB 2BY1A 1BM3L 1TZHA 1QFPA 1RU9H 3DRTA 3JWOL 4HPOL 2DMCA 4NBXB 5LWYL 4OF3A 5GRVK 3MJ8A 2IPUG 5CSBA 1ZT4B 3VFNB 2O61B 5CHNB 1B0RB 2ESVD 2GAZB 3KPSE 3MRGA 4P46B 2RB8A 1KJ3L 1NAMA 3P4NB 1WIUA 3PG2A 6CGTA 1JNJA 1I3RB 1ZVYA 2VDQH 4RA0C 5BMFL 1FNFA 1QVOA 4M6OL 1U41A 4CDHA 1YNLH 4M62H 2DF3A 3MSPA 4L9LB 1N3NA 5EFIA 3LQMA 1T0MB 5JR1H 3MJ7B 4CVWA 5ANME 2V9QA 3L5XH 4MJ4A 1V3LA 3VE0A 4ZFOL 5IBLD 5F97E 1FZJB 3VRIA 2NX5B 4G9FD 1BFVH 3T4AB 1EHLL 4K3DH 2MMXA 4KUCD 1WZ1H 4S11A 3FFCE 1HHHA 3GGWB 1XR8B 2R2EB 2UYLA 2ADGB 1FO0B 3BO8B 4I1NB 35C8L 5ICXB 5D7JA 5C0FA 3U7YH 4GAGL 2XFXB 3RZCB 3DWTA 1XGQB 2B5IC 3QEQB 4S1DD 1ZANL 1J8KA 3BPCB 2IH1B 4PUBL 1ZGLB 4F57H 3VA6A 2BVQB 4S1QH 3WSQL 1EFXD 3O45A 5AUMA 4P9HC 3RWDB 5SWSB 4DFIA 4OZIE 1JPTL 2VAAA 4HKZB 3IKCA 1JK8A 1N6QH 4ZNEA 5A43C 2VZVA 2DL2A 1RK0B 1C5BH 4PFEA 4FQQB 1XGUB 5A40E 1CE1H 4LCCC 3OF6D 5T3ZH 5HHOA 4X8JB 1F6AB 2HN7B 1P7HL 3FB6B 3TYGH 3HZVA 2PKDA 5E56A 4S2SB 3WD5H 1I7RA 4DZ8A 1R0AL 5GGTA 3ZDXF 1FDLH 3OR7B 1MWAA 2Y06H 5I19H 2CJUH 3OPZL 3WFBL 4KMLB 1DBAL 3ZE0F 4LSUL 4DUWA 1XGTA 3O45B 3BHBB 4K3DL 4N9GA 3MRRA 3EDKA 5C0AE 5CEZH 3EYSL 5E8EA 5CP3A 3VDCA 3RL2A 3TN0B 3QUYA 1NJ9A 1KSRA 5TDPA 4JFFE 3S96B 5HPMA 5DEFA 3T09A 1EXUB 4HWEL 1QOKA 1HILA 5I2IB 3WS6A 5MEND 1E6OH 3HHRB 3ZDZE 5FKPB 1F6AA 2HN7A 2X44D 4PRID 3SGKC 1X7QA 4HMDA 4U1SB 5EOTA 5IVXA 2IQ9L 1KT2A 3O2DL 1E4KA 3MMEA 5GGVH 1DQQA 4R4NC 4AENB 2P5ED 2EYSB 1PZ5B 5F3HA 5KS9E 4XPBH 2A73B 4LIQH 1JF1A 4H88L 3FHAA 3MR9B 4P2RE 1F2XK 2CIIA 4P2OD 4PLOB 1U91B 4HIIA 1L6ZA 2WUCL 3O6FA 4P2QD 3L7FA 1SBSH 3P4MA 3ARSA 2YKLL 1PKQA 1MCOL 1TPXC 2YSSA 5GS0C 3S4SG 3ARFD 4KPHH 4IS6A 3UX9B 4F3FB 3LN4A 1W72A 1X7QB 1MJ7H 4U1SA 5EOTB 3QEUB 3HN3A 3WLBA 4PJXB 1IGFL 3P0YH 1QNZL 4PJEB 5EPMA 1JGVL 5C0JA 1ZVSB 2Z4QA 3SKOB 5F9AC 5T3XL 4M6ML 1ODAA 4Q6IB 2W9DL 5GSVA 4HPYH 5FDWB 2X4QB 2FJFA 2PYEE 4Q6IC 2EDBA 3F62A 1H3XA 3BZEA 2F19H 1P53A 5KSUA 4ODVL 2BC4A 2IPTL 5HYQB 1OL0A 2VLRB 5IWLA 1KC5H 3QFJD 4MCYB 5IF0A 1CDUA 4JM2C 1DN0B 4U6YA 1T22B 4G80A 4M8QB 1ZA3B 5D2LF 4EDXA 3K4ZA 2W65B 3OG6B 4LVHB 3QEHA 4WFGE 4L3ED 2Q7NA 4LHQB 5BJTA 3IT8D 3FOMA 2PTTB 1UCTA 4J3UA 2XWJB 1KJMB 3FONA 4DTGH 1IBGH 5CP7B 5FUCE 1K4CB 5K59F 5FUOL 1JZ5A 3OAYH 1QZ1A 4GRLC 1QBLH 4W4OC 5GZND 5JUEL 2NTSP 3GI8H 1SBSL 3NIFF 4OF7A 2P8LA 4O5LL 4JHWL 4XPFH 1YEGH 1REIA 5EZJB 4GLRI 2FH8A 2EC8A 1I8LA 3IJHB 3C6LA 4Y4HC 4NNXA 4CNIA 4M7LH 4YNYB 4NFCA 2NR6D 2XZAL 2MOVA 4GKSA 1MPAL 1YECH 4J8RA 2XRAH 3IDYC 3MRNB 5EU7C 1DTUA 1I7ZB 3ABZA 5K9KB 1J0KA 3U48A 1HIML 1VGKA 4KJYB 2ZOLB 3HPJB 3FOLB 1TJIH 2AQ2A 2YRLA 1EZVY 2PTUA 2R69H 3BVNA 4YHIA 3TIDA 2XOTA 2AERT 4KVNH 4M93C 4HFWB 4KDVA 5E7FA 5C08B 5C07B 1MNUL 4WFED 5C6PB 3C5ZC 1F4XH 5ESAB 3PL6C 4FQXB 2L0DA 4R8WL 3TIEA 4Z95H 3HRZA 3PL6B 4IRZH 4O02L 4IOSD 2DQIH 1QEWB 3E6HA 4NBZB 5C0EB 3ROOA 3FQWB 3UPRA 1KGCD 1T66D 4K3GA 5JIPA 3DIFB 3BWAB 3MACH 4Z78A 4OSUH 1YEGL 3T3MF 4WI3A 4NCDA 3VFMA 2VMFA 5TDNA 3A6BL 4OD1H 3ARXA 4OGYH 1C12A 4J3TA 1VEPA 5F9OL 5DJDB 5J1AB 4PJDF 3O0RL 1HCVA 4FQ2L 2X4OA 5C09B 4BQCA 2BNQB 4IDJH 1CU4L 2YXFA 4HIEB 3MV8E 5FM8A 4Y4FA 3QUMB 4WWKA 1CZ8H 4ONHB 5E1HB 2NXZD 1CR9L 1YEEH 1U8IB 2IH3B 2ZSWB 4U6HB 1YN6B 4BSWA 3FO9A 1JPSL 1N7ML 4QF1B 4HS6B 4M7ZB 2O93L 2OL3B 5D70H 4ZS7L 2FJGA 3OKYA 3L5IA 3CIQA 4U1NA 3WFHB 4MVBD 3CDCA 1OW0C 2A9MH 5C9JA 1A3RH 4ZTPL 2Z35B 4KRPC 2FHFA 4U7SA 2JKXA 4K94L 3CVIL 4X4XB 5IR1A 3DMMB 3QQ3A 2JB6B 4EQ2A 4F57L 4JFPA 5E08H 2JK5A 2DQIL 4XX1E 3KS0H 4OQ1A 1XGYL 3MGOB 5DRZB 4F9LC 1FVCA 3MACL 3C5JB 1S9KC 2VH5H 4UTBL 4JFXB 2WM0A 1XF3B 4OGYL 5GRUH 4JFYB 1A21A 2HH0L 3TH4T 4Y8AA 1TQBC 2FZ3B 1HI6A 2CR6A 3V8CA 3G5VA 4HQQH 1MFNA 2Q86A 3FRPG 1NMCB 4NQXB 5KVEH 4LVNB 4GRMB 2OZ4H 4NJ9H 3ZKSD 3QJHB 5DQ9B 3KPQA 4HIXL 2FYYA 1AH1A 2W9EL 1N5YH 2J8UB 4BSVB 4JO3L 5BXFA 4NJAH 2G60H 1BBDH 5KS9A 3VXOA 2HFEB 3K74B 2GK0A 1G1YA 3MJ7A 4J4PA 4P4RA 4TSAH 5CEZL 5D71H 2HKFH 3C5ZB 3PV6B 3O11A 2VZTA 4M8QA 1DLHB 1JL8A 3ZE1F 3UTPD 3FT4A 1T03L 5DDHA 2R9HC 2A1WH 4NO0A 1OTSC 3SGDH 5HGHA 2GKIA 1BFSA 3FO1A 4AM0B 4O2FA 1LMKA 3G6JE 3NFNB 1J10A 4LOUC 4EXKA 4F7PB 4M43L 5HHQA 1ZS8A 1G7MB 2IQ9H 5IW3A 5FA3B 5JDSA 1ZWIB 4NHUB 3IS1X 1EMTH 3MLYL 4FP8L 1DBMH 5EU6E 2GFBB 1N4XL 3BKML 3BDXA 2LTQB 4XPBL 4RIRB 4V1DB 3S98A 2NXYC 4EI5A 1AR1C 5KSAC 5FFLA 1K3ZA 2ICWJ 2PYFA 3RKPA 4JFEE 4MNHB 4TYUA 3MUZ1 1FN4B 2X41A 3AREA 3DROA 3QNYA 4P5MA 2FX7H 1AI1H 2Y23A 4GBXD 3AUVA 1MIEH 4WTZA 1GGBL 1MFCL 1FZMB 1E4KC 3NA9H 2APXA 2VLJB 4GQ9L 4PG2C 1T0NA 1EAPA 4KTEH 1LO4H 4IRSB 4TVSa 1MCKA 5C0AD 2OR8A 1SEBA 1T03H 4XP4H 3RWJA 4PGEB 1GAFL 1T5WB 1UEMA 2YD2A 1CGYA 3MGAA 3BZFA 4QTIH 4K7PX 4JAMB 4ISVB 5CUSL 2OR9L 2XXMB 3QIBB 3BMVA 1K9TA 3ARVA 3C6SB 5IG7B 2XI9A 3N0PB 4M5YL 4F7TB 4LLUB 4RGOL 4Z7UE 4ODWB 2FJHB 1OGTA 2VLLA 3B2UD 5F70A 5D4QA 2AK4D 1HSBB 3JXAA 3B8SA 4IRJC 3HZMA 4GG6F 4HS8H 3V5KB 5D7LE 3LKRA 3ZTJH 4ZDHB 4EUPA 1YEHH 5EC1A 2LABA 1AKJD 3SN6N 4I0CC 1S3KH 3IAQA 2E7LC 1GOHA 3MLSL 4AT6B 3REWB 1QHPA 2HVKA 3FT3B 4TTDC 1X5FA 3FN3A 4ZSOE 4JPKL 4GUPA 2QV2A 2IMNA 5AYQA 4YHPA 4YBHA 3PDGA 5IVOA 1FJ1A 4FTVB 1HKLH 1NAMH 2DLTA 3O9WD 4CW1A 2UZXB 4NNPH 4LMQE 4OFPA 3LPFA 4D3CL 5J4MA 5IBUG 3MLTB 2C1PB 4EN3D 3VD7A 5I1DB 4GBXA 5F89A 1IZJA 3LQAC 3BJ91 4UQ2B 1H3WM 1P7KA 4ELMA 5KVDL 1G9NH 4KJWC 1I7TA 1Z2KA 2CKBH 4CVZA 2R69L 1IAIM 3SO5A 4KXZH 3GMLB 5HHVH 2COQA 5A3ID 4ZAKC 4G3YL 4L8DA 1FG2A 2CKNA 4NO5B 1CCZA 1XF1A 3O9WA 2OZ4A 5HBBA 1C16A 5I15L 1FL3A 5E94B 3F58L 4RFEA 2GCYA 4BQBA 2YEZA 3LZFH 4GRMA 4Y2OA 2EYTB 1UACH 2P49B 3W11C 1F45A 2X9WA 3DX9B 2UUDK 1O7VA 4JG1L 3EOAA 4LIQE 4XNMA 4FFYL 3LV3B 1AR1D 4PP2A 4ONGH 2VRAA 1JVKA 5DRNA 1CICA 5IGXL 3KXFE 2KZ1B 1KCRH 2IBZX 1MFDH 3WIIL 4GW5B 5FCUH 3DYOA 2BRRL 3UBXA 4F2MA 4YHOH 4D0CA 2AK4A 1NGYB 2O26U 3LS4H 2C4XA 2GEEA 3CVHL 5HGBB 2DQCH 4YWGH 1UZ8B 2EH7L 4L4TB 2OI9B 5GS0D 1CFSA 1I7ZA 2OP4H 4M4PA 4TSCH 3MXVL 2DIAA 1CK0L 1WISA 1HHIA 2K7PA 1UB6A 1KYOK 4PRAB 4LCYA 4PP2B 4NUJB 2YD4A 5C0AA 4OZGE 1YY8A 5DJZA 2IBZY 3CNKA 3DX7A 4I4WA 3VXTB 4U0RB 2HKHH 3VFWA 1I9IL 1ZA6A 2YPLE 2R0KH 3NFSL 3WJJA 5B3JE 1I9RL 4S1SH 3TBYA 2QBWA 5AAWA 5ANMB 1B9ZA 4OUOA 2C1OA 2QSVA 5H8DA 2Y5EA 5DEFB 1IE5A 4HQQL 3CLEL 4M1DL 3H6JA 4M7KL 4X4YA 2N7BA 4NQTA 5HDQH 3TPKA 1D6VH 1CF8H 5D1QB 3ZMRA 3GK8L 3FQRB 1JF1B 5L88L 5DD3L 5T1KB 2EH7H 3ILQD 4HUUA 2XZQH 1NMAH 2F9BT 2E8YA 4NSKB 4LCWD 3MODL 2UZIL 2V7HB 4NKDB 2XZCH 2EDQA 5DYOB 3VWKA 4APQD 1H8OA 4M00A 5DF0A 1A5FH 2Y5TA 3KPNA 3UTTE 1DVFA 4QXGL 1HDMA 5H2BB 1D5XA 3RWFA 1TPXB 3UP1A 1EVUA 1CXFA 2VDKH 2NY5C 1S5IH 5F7MC 2CMRL 2L7UA 1W8NA 4NRZA 1TTGA 4E0RA 1S9VA 2B5IB 3QG7H 1SJEB 4IOIA 4LDEB 4FP8H 1D6EB 4JFDE 4PS4L 3WBDA 1ND0B 2IPKB 5IB1A 4ONFH 3TVMB 1MJ8L 1BVKB 3IU4H 2EXWD 3CAFA 5HDOA 2E9JA 2BOCA 4X99A 1KUMA 5EUKB 3S37H 5DVNA 3D0LA 1J05B 2AV1B 3RGHA 4G8GB 5D8JL 5F88A 3OKLA 2DQGL 1QPPA 2Y07H 3BKJL 2C4FU 1U95B 5T3ZD 3DUHA 4XRCA 1XIWC 1X5IA 2JJVA 4G6KH 3T3PE 4AEFA 4EI6A 3E2HC 4JM4L 1A7RL 4P2QE 4Y8DC 3TM6A 4ZFZB 4S1RH 2B1HH 1BFVL 3TO4D 1IM3B 1CS6A 1PG7X 2P7TA 2C26A 3V6ZA 2VLMD 3K46A 5T1MA 2MNUA 1S78C 3G08A 5IEKA 3OAZK 1QSEB 3N06B 4PJ9B 1E27A 3WS3A 3QA3A 3RBSA 5MP6L 1GZQB 1F4WH 1UJ3C 2CPCA 2R1YB 2Z31A 1U6AH 3CXHK 4Y5XC 2Y9RT 5LKNA 2C4FT 3S37L 2X1QA 4XVSL 5HHNB 2Y72A 1JPTH 4YO0A 5HYEA 4YLQT 2GFBA 1CG9A 4XNYH 4DQOL 4JFFD 2FBJL 1F3JB 3LKPB 1KB5B 4TSBH 4WHTA 1E4XL 2AI0H 4BM7A 1ZHLB 1SYVB 5B22A 2UV3A 3O2WH 5DD6B 5CJOH 3TBTA 3BGMA 3QDGD 2Y7QB 4P9HH 1F13A 2Q76B 4H1LA 3KPMB 4TQEL 1U8KA 2LVEA 3LD8C 4HWNA 1AFVH 2C3VA 5CINL 3WFDL 4NQDD 2XQBH 1MEXH 3QO1B 4MXVF 2OL3L 1ZE3C 5E6ZA 3H9ZA 4FMFA 5SWQA 5CZKA 3SE9H 1XF5A 3MOBH 3F7VB 4HT1L 4HZLA 3B5TA 1MELA 4JQIH 4Z0BH 4Z78B 5B4MC 1P4IL 3SKJH 1G7JA 2JELH 2MQ0A 5FKPA 1PEWA 1YPZA 1C12B 1LD9B 3RIFF 2JCCB 1QO3A 3IAPA 2AJUL 1C5DA 4ZYKA 1JZ2A 3GJFH 3OB0K 3ULUH 4Q2ZB 2VQTA 1XH3B 2ZUWA 1DEEA 1MSPA 1UA6L 3IDJB 2WBJC 3O2DH 1KIRA 3QQ4A 3EJYC 2VERN 3JWOH 1F58H 3WLWD 2OJEB 1JYWA 3X3FH 3D85B 2LVCA 1CL7I 1T2QL 3T8XB 3HFMH 4H88H 3VXNB 5MENA 5JW4Q 5CJOL 4YDJB 1YMMD 5AD0A 4P2OC 2F54A 1T66C 3VD5A 1KNOA 2FX8L 4TVPD 1MCOH 1CYGA 4RISH 1TVBA 4BKLB 4X9GA 1FBIL 2F5BH 2XQYK 5DJYB 5MEOB 1UVQA 1JP5A 3WUWG 2JE8A 2VLKB 5IIEA 5BVJB 3IDJA 1NLBL 3FN9A 3MCLL 5T3XH 3FJTA 2HTKD 3MZGB 4XWGL 3SDAB 3S5LA 1FLRL 1P5UA 1Q94A 2AJUH 5D7IA 5TFSL 4PJFF 1DQML 2VDOH 2YA2A 5ID0B 4BSVA 2ATKB 1P7QD 4FQCH 3UROR 2ADGA 3UO1L 1UA6H 2NY4D 2NY6C 1EO8H 4DOHE 1J11A 4LSVL 1TZGH 1F58L 1EFXA 4DAGH 1KPUB 5D1XD 1QLFA 5BXFB 3DHMA 4JN2B 4CJ1A 1U8NA 4WI9A 2HVJA 5AUMB 2XTLA 1F2QA 3HG1B 3IETA 4PRDB 2DI8A 3STZB 1I8MA 3I6KB 1A6AB 3A67H 4QHKJ 2H32B 4PR5B 4HX1B 3CLEH 4M1DH 2A77H 2FEEL 1EK3A 2VTFA 3UTSB 1JYVA 1DUYB 1J0ZA 3LKOA 3W0WD 1D5MB 5IROA 3UTZA 5I8CB 3ORJA 5D2LB 3DVGA 3VXPA 3SDCD 3VI3F 1GC1C 4KJYA 4L9LC 3WL9B 1HYSC 1UM5H 2GITA 4PJ5A 3VXRD 3SGDI 3RX8A 4YZFF 3FO0H 5E8NB 2ID5A 3VWJA 3S7GA 3UTQA 4XPTL 4XC3H 5E7BA 4XBGB 1WTGT 3H7LA 4WV1A 2DJ4A 3W0WE 5I18H 2J5LC 1YEDB 1VFBB 2XWBA 4DKDC 1KEGL 2Y6SD 5C0BA 5FAAA 4U1IA 4MJ5A 3U30B 1XCQA 3TIEB 2CGRL 1PSKL 4WY7L 5IVZA 4ODUA 5I1GH 4FQLH 4JDTL 1NFDA 1AGFA 4M6NH 4PS4H 3NCEB 3RL1A 4JO1L 4OCNC 1HYSD 12E8H 1T1WA 2XACC 1TCRA 4Q9RL 2R15A 1RZIA 3UJIH 4GT7A 5IJKA 3LEVL 4D2NA 5DC4B 5J1AA 5EOCH 5B8CA 4NUGL 2KDGA 4MAYD 4U3XA 3U46B 1LE5B 4AIXA 1U8PB 1MJ7L 3JTTA 3MRMB 2X40A 3MFFA 4P5TC 3T0EC 4M4RA 3DYMA 1MCDA 3HMXL 5GJTH 4JM4H 2Y06L 3QXTA 3OKKA 5FOBB 3O41A 4R9HA 3BKCL 1I1YA 4HUVA 2H9GB 4PJEA 5EPMB 1FV1A 4J2XA 4R97B 2XTJC 1YYLL 4NQDB 3WN5A 2OK0L 1QSZA 1Z0NA 3QDHA 3ZSTA 2A9ML 1VHPA 5HYSB 1RIUL 1MHHB 5DFWH 3C60B 1AD9A 5GSRA 4XH2A 1A6TB 1Q0YH 2GJ6D 3TJEH 1FH5L 1M7XA 3MLTA 4PTTA 3U0WH 1NPUA 3MRMA 5F7WC 2W65A 3RX5A 4W4NA 5EULV 7CGTA 3TT3L 3HNTL 4XCFL 5K9OB 3PHQB 3O3BA 1OAKH 4JRXA 5FYLH 3PWVB 2AS5M 3IJSA 4GBXB 2CO7B 2J88H 2H9GA 4OZHB 3QDMD 4NDMB 3EYUH 2GSGA 2FB4L 2Q8BH 4OF0A 4FABH 2OZ4L 4NJ9L 2P8LB 1PEZA 5C0CE 5KW9H 3PP4L 1WC7B 4KZEL 5F88B 3FFCB 2C3HA 4ZUVA 1JPFB 3DGCR 3WDIA 3L3OA 1S7VA 3VXOB 5FA4A 4X6EB 4E41A 1H3VA 4KPHL 1MPAH 1XFPA 4XI5D 3ARWA 4JKPH 1XIWD 2RQ8A 3QR2A 3CFBA 2OS7A 5C0CA 1JZ3A 5I0DA 3KPRA 4M6MH 3GSOB 5CZVL 4ZFZA 1CLOH 4AH2A 3QG6A 4G5ZH 5SWSE 3GHEL 3X12B 3OR6B 3ALXA 5TF0A 3VXQA 1I7RB 4MAUH 4UDTA 5AEAA 3QCUH 2OTUB 5JOFB 1J8HA 1QUNA 4ZPTB 4IBLT 3CFDB 4NCC1 1WK0A 5I1AA 3OJDA 1RV6X 2PO6B 2WWMC 4YC2C 3UBXB 3DGGB 4DVRH 1A4JA 5HGGS 2PN5A 1G9EA 3TGXA 1RQ5A 1N64L 1EXUA 3SKNB 3ME0A 5DJCB 1FL5A 1IC5L 1HOCB 1XCTB 2WW8A 2NY2B 3FQWA 4PRPA 3R4DA 3G6DL 1L0QA 2IFFH 4QRPA 5JNYA 3SE8L 4K3EH 5C0AB 4HJGB 1CXHA 4P2RD 2QQLH 4X98B 2H6PA 4JM2A 5DD6A 1U58A 3L95A 4L8CA 3S37X 2VLJD 1YEJL 2V5RA 4Y16C 3CFDA 2EYSA 5F3HB 4XP1L 4X6DE 4JKPL 1S7UB 4L3CA 4LSPH 4N8VB 1KN4H 3RWJB 4LLDB 5DQDH 1NC4B 5JPMB 3UTSD 1E4XI 4GKNB 5HI5D 5C86A 2W60B 1MWAH 3G5YB 3IDXH 5EO1A 5KVMC 5IB2A 2BZDA 4JY5H 5DHXB 3FQRA 1ZHBB 4P2RB 5FIEA 1A9EA 3Q6FA 4M5ZL 5L8KB 1MY7A 1KIQA 4EI5D 3TO4C 3W5MA 4DGYH 2VDLL 3GIVA 5DJAA 2JIXA 4DAGL 5IK3B 1IT9L 3KYMB 2NX5E 1U8LA 2VDPL 3FB7B 4WDIA 4WFGD 3CFIC 4ZO6A 5EC2B 4O02H 1P1ZB 3BP5B 2ZCHL 4G80B 5A1AA 3OBAA 2YMXH 3LEXB 2RIKA 5KAQG 1FNEB 1YEJH 2A77L 2P44B 3QEQE 2GJJA 3MJ9L 4HJ0C 1ED3B 3MRHB 4JFYA 4JPKH 1T0MA 1NBZA 5JIHA 2W9EH 1N5YL 1EZVX 4NRZB 4NQXA 4G8FB 3QXVA 2Q86B 5FXCH 1MCNA 3QUYC 4XPGH 3DTXB 4PRPD 1DLFL 2AABH 4N9OB 4NNPL 3DX6A 3ARUA 4ZFFB 1K4CA 5DD5L 5DMGD 1PLGH 3KHOA 2J3SA 4XH2B 1CXLA 3SE3A 3ARYA 4L8DB 4EIZC 3LS5H 4H8WL 3VXSD 3EAKA 2A74B 4LHUG 3AS1A 4QEGA 3MGTB 3RA7H 2OJZL 4MXQC 3BZ4A 5I6XB 4RQQA 1T04A 1Z3GH 5I71C 2LU4A 3NFPA 1YA5A 5HI5C 2OQJA 3DX8A 5BS0A 1AXSA 1P4BH 2R1XB 4I18B 1KLGB 1X5KA 4GLRH 1FNSL 1DBML 1OTUC 3BEVA 3MRJB 4F7CA 2QQNL 4JN2A 3NCFB 3ARBD 5DRWB 3NCJH 3RTQC 4D8PB 1E0OB 1OAZL 2OTWB 2UWEF 5I17A 1I7UA 3S34H 4YHIB 4P9ML 5DJ6A 3C09B 2EZ0C 4MA3A 1BBJB 4EI5B 1NJ9B 1MCHA 4H25A 1CL7H 1F00I 1QEWA 5ACMA 3C5ZD 3LKOB 3WKNA 3HRZB 3PL6A 2DKMA 2EE2A 1OW0A 2APTA 4Z7WF 3LEYL 1KIPA 3K4DA 4F8QA 4N8CH 5ETUB 2ITDA 3BKCH 1WZ1L 4FNLL 4UNUA 1NDMB 2GW5A 1ACYL 3C87A 1YYLH 2RJMA 2HWZH 4EKXA 1GXEA 2PETA 4JO2H 2OR7A 3U7YL 5IVXB 2R2HB 1EBAA 3U36A 2VABA 2O5YH 3O4LD 1E6JL 3QSKB 4OV5A 4PUBH 2ZKHH 3EO0A 3U0WL 3QXUA 4CL7A 4KHXL 1PYWA 4P5TA 1V3JA 3G5XB 5LBSH 4J4PD 1O7SA 2BOBB 3AXLA 1U3JA 1RZKC 1ZTXL 5TJWK 5GGRB 5B38G 4IMKC 1NEZA 4P9MH 5IMOA 4PV9B 4Q9BA 1EEYA 1RUML 4PJ7F 3CK0L 3EO9L 3G6JB 3PXHA 4OBRA 5F7LB 4WUKL 3TCLA 1N6UA 4ZAKB 1B6UA 3IXTA 1FAKT 3STBA 4GMTL 2DLIA 4MJ2A 2BNUA 1XEDA 3G5ZB 2K7QA 4JCLA 4K7PL 1IAIL 3GSVA 3QI9A 5INCB 2CJUL 4U7MA 4E5XA 3QBTB 5T3XE 4UNVA 1MF2H 3M17B 3KVQA 2A6IA 3O6KL 3SHSA 5TGBB 4KKNA 1KXTB 2L4OA 1ZHBA 4QGYA 1G9NL 1J5OL 2ED8A 5I66B 4GXVH 2FZ3A 4AZ8A 5J89A 3BDYL 2V5YA 2KZWA 3P4OB 5GGUA 3QWRD 2R2BA 3U6RA 4RMVA 2A6JA 3QEHB 5JW3L 4Y5VB 3RIAF 5DI8B 2P5WB 3V6FB 3IYLW 1WEJH 1H3PL 4G3YH 3G6AB 1KLUA 2MPAH 2PR4H 4YHKH 5CIPB 4QT5A 5BVPH 2IADA 1ZLWK 3ULVD 2XPGA 3K2UH 3BPCA 1IM9A 4L3EA 3ES6A 1A0QL 4RBPK 3EO9H 4JPIA 3VWJD 1AGBB 4IRJB 5BV7B 5HGDA 5J6GA 3FQUB 5LAXB 3ARDB 1YEHL 4O9HL 1HE7A 3VFTA 3O3DA 4Y19A 3MLVL 4Z0XA 3F6IA 3Q0HA 3L3HB 3AU1A 4NQCB 4S10A 4GXUN 5F1IB 2HTKC 4HIHA 1HHJA 1LVEA 1WLHA 4H0HB 4LPTA 4PG9B 4XP6H 3V6ZB 3FB8A 3GI9L 2HJLA 5JIIA 5JW4M 2XN9B 4FQXC 4MB4A 2W38A 4PJHE 2CIKB 3TBWA 5DHVB 1NGYA 3G9AB 5EA0H 3ES6B 3U0PB 2VYRE 3ESVF 1FSKB 4UILH 1KFAL 5M7QA 2NR6C 4LBEB 1ZLUH 3B9AA 4QRUA 4GKOA 3ARFA 4TSCL 5L6YL 2ZJSL 1CLYH 2FDBP 2DYPA 3MO1A 4OGXL 3QG6B 3VXPB 3HUJB 2MPAL 4OJFH 3ROOB 3G04A 1K8DB 3PE9A 4OIIH 4CVUA 3QH3B 2OTUA 1J8HB 4LFHD 5TQ2L 4XPHL 2VUOA 5BV7L 1KXQE 3ZKMD 4PRAA 3BPLC 1CE6B 3DIFA 4KZDL 2F5AH 3MA9L 1IFHL 1Y18A 4L9DA 4WHCA 5E2TL 4G6MH 1YY8B 4I5BB 4LLVB 1TJGH 1CGUA 1U8KB 4R4ND 4FQ1L 2BVEA 5LWYH 2J5LB 3BPOC 5I1LA 1LO3L 4Y5YB 4KVCL 2NTFB 2XA3A 2AXGB 3UEZA 1IGTA 1CGWA 3MO1B 3IFNL 3FRUB 2EKSA 4WTZG 5FECA 1NCDH 5ANMA 4IRSC 3LDBB 1LDPH 5I1EL 1DN2A 3EGSB 3HAEG 3WEXB 5D1ZC 2I27N 2EC9U 3N1GC 4K23H 3EUUA 3LCYA 2HFGL 4U1NB 3WFHA 2XZZA 4LHJB 5AWNH 1QQDA 5CKAA 3ESUF 2XZQL 1H15B 1LP9F 2V2XA 4NN7C 4OI7A 3V4UL 2J7LA 5BO1L 2CK0H 1HIMH 3MRQB 4HGWB 2AVGA 2ERJB 4JANA 2NXZB 2X42A 2P46B 4OTXL 3CVHH 4YHLH 4HKXA 2D3VA 5BCAA 3DMMA 4FQIL 3VXUB 4MB3A 5KSUB 2Y5TB 4XPHH 4XWOC 1QSVA 35C8H 2V7HA 1HXYA 5DYOA 1H3TA 3T8XA 4QRRE 5K33A 2VKWA 5T1DH 4NQUA 5HSFA 1KBGH 3SY0A 2FBOJ 3DV4A 4U6VH 3VJ6B 4FQPA 3EYFA 3VFSB 2Y36H 1FV1B 2NY6B 1IRAY 5E8DH 4ONFL 2AJSL 2I07A 3DURA 3GMQA 3PWPE 1JI2A 5CKGA 5F71A 4B0MM 1F3DJ 5CD5C 1UVQB 4Y4KC 5CILL 3QJHA 3D39E 1KB9J 4Y4KB 5D5ME 1DP0A 1B3JA 3MLRL 1QFHA 5JOEA 4PLJD 3ARBC 1GJIA 4JVWA 3GMRB 4Y2DC 2Z31C 4C58B 5L8JB 5DURD 4JFFA 5CEZE 3MV9B 3MOAH 3QNXA 4DN3H 1WAAF 5E4EC 3NABH 3R06A 1I1FB 2XNAB 5DRXA 2YRPA 3MXWH 4D9LH 5FUZL 4PRIA 4XXDA 3CSYA 1FP5A 4JREB 3S36H 4MX7B 2ATPA 1ORSA 4ACPA 3T0EA 3MGTA 2X4RA 4ZUSB 3K80A 2A83B 2YHGA 5JZ7C 2DI9A 3DX8B 4XNQB 1A1NB 1W2KT 1KPVA 3CD4A 3VGFA 3QNYB 1CXIA 4UTBH 3UTTB 1A7NH 1I9JL 4DCQA 2VC2H 4MNHA 3UTSA 1FVEB 3CDGB 4M1GL 3MBEA 4D8PA 3DVGB 4RNRB 3TF7C 3B9DA 2D03L 3QI9D 2YD9A 5T3ZE 2IWGA 1GOGA 1F4AA 2CDEA 3LN9A 2Q6WA 2VLJA 1RUQL 3BUYA 1DSFH 4GXUM 3ARGB 4CVXB 1ZA6B 4U05A 2VZ3A 4NJAL 4LVHC 1A9BA 1BD2A 5EWIH 2CRYA 4GRWH 3O6MH 3GMNB 4XPTH 4Z7QF 4EJ1C 3PWNA 1J12A 5D9SB 3MQIA 5FUZH 1MIMH 3B43A 3G04B 2RAMA 2QQQA 3CFEA 3L3IA 5IB3B 2FO4A 3HB3C 5DUML 1W0VB 1NCAH 3PJSA 2AJVL 1HYRC 2VXTL 2AEQL 3MZTA 5D6DC 3BSZL 3HG1D 1KOAA 1BD2E 4QXUH 5TE6L 1D9KC 4PJ9C 3L95B 5IFHL 3HLAB 4NWUH 1D9KB 5TF1L 5LVEA 4KUCF 3DNKA 4M6NL 2FIKB 4G9FE 4EUPB 2D9CA 1R5VA 4FZ8H 4JPWL 4NKOB 3UTOA 3VWJC 4Y1AB 1QVOB 4FFZL 4P23D 2GUOA 3BISA 1LE5A 4Z7NE 3HZYA 1XIWA 3L3GB 3U0TB 3NIFE 4LEOA 4OCWL 3VH8G 2DIJA 4PV8A 1YYMH 3DHJA 4E0RB 3QHZH 2NX5A 1YMHA 5J11B 3VXNA 3FN0H 3T4AA 5KJRL 5E70A 2QLVB 3NAAL 4YDLB 5DO2D 5I76A 2XTJD 1WZLA 3RUGB 1O5DT 4FXLA 4KGLA 1M7DB 5D6DA 1OLLA 2XWJA 5SX4I 4HUXB 5T1LA 4OLVH 4WO4C 3HKFA 1MEXL 1CIDA 4X7CC 3ARGD 5IV2B 2A9NH 3FKUS 1FC2D 3QYCA 4PJFE 4YHML 4XP9L 4XBEL 3FB5A 4JFDB 4IM8A 4HK3N 1JCKA 5DLMH 3W9DB 4R96B 1Q72H 4I9WE 4UT9L 1FNEA 3HR5A 3OMZA 2DLGA 1UH3A 2IGFH 1HQRA 2EIZA 4G8GE 3HAEH 5L7XL 3QUZA 2F53E 2ORBH 1VCAA 3D3VA 1FYTD 4RFNB 3ECBB 3DJ9A 1YNKH 3KYAA 4MD0A 2V2WA 3ZYZA 5KANI 1JRHL 3GMPA 3PGDA 32C2A 4FFWD 3VGAC 1YQVL 5DA4A 3RTQD 4G8EA 4WO4A 3QHZL 1UT9A 1WBXA 3U30C 4X6EA 4OSUL 3HCVA 2KL6A 2ICWI 4M7ZC 5HDBF 5CWSB 3KYNA 4BQ9A 1KV3A 4U6XA 2M26A 3B5HA 3H3BC 1LDSA 1OCWL 3RUGF 2WBKA 1P9MC 2E6QA 1OGAE 4FQJL 4ZOCA 5MI0C 1AE6H 5I1JL 4PJGB 1IKFH 4AIZA 5JXED 1KB5A 4U3HA 4KROD 5C7XH 4QHMA 5EORH 3OR6A 1MH5A 2ATPB 3VXQB 2DI7A 2R0LH 3WL9A 2ARJQ 4NM8L 1G6VK 4WW2B 5C0DA 5DMGC 2HT3C 3LMJL 2C3VB 3KS0J 1T1ZB 4C55A 5L9DL 2FCBA 1WBZB 1J0YA 3D9AL 2MKWA 5HHME 1RIHL 4LLYB 3ZDXE 5I1GL 3ZSSA 5IFJA 5C0BD 3ULUE 2YR3A 5DQJA 5IESH 3BD4A 5JO5A 5JDJA 5E2UL 4YDLC 4R97C 1VGEH 2X1WL 1U8MA 1ZK9A 1KTLA 4TNWK 3QULB 2ILLA 5FHAH 3LD8B 1CT8A 1NEZG 3RL1B 3V7MA 4NNYB 3QZWB 3M1BA 4GAYA 2NLJA 4PJ5D 3VXRA 5EU4A 3RWGA 4PJIB 3JWNC 1VB9A 2CRZA 3SDAD 5JHDD 1YMME 3CDFA 4GMSH 1IEAA 1U3HB 3MLRH 4QOKE 5IFAL 5D9SA 1BLNA 4NQVA 4JM2D 4Z8FL 5GGRA 4P2CG 4GAJL 2G75A 4J1UB 5SX5K 1MCLA 2I60L 2LTQC 1BVZA 3BJLA 3G6JA 2OMBA 2SEBB 5L2JA 1M6OA 4XC3L 4N0CC 1S8DB 1I1AD 3CJJA 2B1AL 3T1FA 4ZXBC 5A16A 1CT8B 1OARL 2GT9B 2PTTA 3IJYB 1MCWM 3CPLB 5JHLH 4G7YH 5DO2C 4XMPH 4DGVH 5FGBC 4LARL 4OCYH 4HXAH 3VXUA 1PGRB 5KG9B 5CGYD 4D0BA 4WFHD 4G8GA 4QO1A 3MJ6A 4LEOB 2CH8A 4EBQL 4ZFOB 2BOCB 4X99B 3VFVA 4CDGC 3R1GL 5J06A 1A7NL 1I9JH 4NNXB 4U33A 2DWDA 2BY3A 4MQ7B 5C0CD 3V5DB 2Z92A 4JKLA 1NCWL 4QRQB 3L5WA 2FB4H 3WFCL 4XC1H 4FOMA 5IFAH 3J8F7 2VQ1A 4OZGA 2GJ6B 5D7KD 1CFTA 5IHUL 3C60D 5IWLC 3SDXE 2Q3ZA 2VDQL 2ZG2A 3OPZH 1MIEL 3O3EA 4LKXA 4HWBL 2PTVA 1A6AA 5TPWH 2VB5A 5JR1L 5ITFA 4NHCL 3VI4E 3UZQA 2BJMH 3OXSB 3Q5OA 4J12A 5GRJL 3U4BH 5CLWA 3R8QA 4PRPE 3BQUD 1LGVA 1HN1A 5FEBA 4PR5A 3P30H 3SCMB 1AIFB 1MCCA 3ZHKA 3VFTB 2XNAA 3SPVA 1UZ8A 4GFTB 2WUBH 4I18A 5CJ5A 1S9YA 3LKNA 4HLZG 4HXBL 5C0RH 5TF1H 4IHOB 4WV1B 4ETQA 4N1CA 2CKBB 4L5FL 3INUL