2HT3D

Structure of the escherichia coli clc chloride channel y445l mutant and fab complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synergism between halide binding and proton transport in a CLC-type exchanger
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
total genus 44
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3D01
4PGDA 1WZMA 3BZ4A 3X12A 2Q76B 4IOFC 1BGXH 1CFTA 4JHWL 3FT4B 4NQDB 4HLZG 3TA3D 3Q6GL 1ZTXL 4GT7A 3MREA 1C7TA 3ZE2E 5HI4D 3VFOA 5EUOB 2UY6A 1BHGA 4UNVA 1NC2A 3PABB 4X5XA 3IVKA 3UTTA 1WBZA 3CK0L 1XZ0B 8FABA 1Z5LA 4W6YB 1I75A 3TZVA 4BK5A 1IQDB 2GITB 4V2BA 5FA3B 2KQMA 3HFML 3SGKA 3RX5A 4AL8L 3DUSA 2JB5L 1F2XK 3WXVH 3MRDB 3HE7A 4M6OL 3KJ6H 1A02N 2IQ9L 5CINH 2CDFA 2VXUL 4R8WL 4WHYH 1RJYA 2VDOL 4LSQH 1IKFL 3STZA 5E0QA 3RGVD 4RGMC 3NIFE 2OR9L 1SEQL 5SWZB 1RU9H 1KIRB 1VFBB 1U42A 4PRAB 3MOBL 1T7YA 2CJUH 3PWPB 3S4SB 4OCRH 5D2LB 1BVZA 2BRRL 1NBZA 4NKDA 2CO7B 4L3ED 4NHUA 1B4RA 3K8LA 3RY6A 4K2UH 1GPOH 4HUVB 1IGCL 4K7PL 3O3EA 3B8YA 2WWMC 1K8DA 5J6HB 1BBJB 4XPAL 1U8JB 1MCLA 5DZLA 5DD3H 5I1KH 4PRBB 3UTQA 2AXFB 2Q8BL 2A6DB 4NDMB 5HHXL 1FNGB 2XZQH 3BSZH 3W11D 3RDTA 1U93A 4ZQKB 1RULL 3RY4A 4G9FA 4X4YB 1C08B 1QVOA 1X9QA 2IG2H 2VLRA 4AIZA 3FTGB 3HE7D 3PDGA 4KHTL 4RGND 4LLVA 5K9KA 1GGTA 3IU4H 4CMHC 3DURA 3DOSA 2VDML 5F7WC 3HUJF 3DVNA 5IJKA 4XCNB 1JPTH 1PQZB 3TBYA 5BVPH 4GAJL 1J0YA 5GSVA 3LRSB 3MJ7A 1UACH 1MHCB 3G5ZA 4JG0H 2YA2A 3O2VL 1U8PB 3VD4A 1MFCL 1M71A 3ORJA 1A6TA 3CU1A 3OKDA 5IBTL 3KJ4B 3MA9L 3EJJX 3HG1B 1G0YR 3FQTA 1LE9B 1B0WA 1UKQA 4M6ML 3KYOA 3W0WD 5ITFA 5KSAC 4G8EA 4U1MA 5JDJA 3PL6C 2RQ8A 3BRGC 4X4XA 1UM4H 4PRIA 5CJXA 2FB4L 4M93C 3MUGB 4X98B 3E6FA 2IH1B 2FJFB 4H1LH 1LD9A 2OLDA 3MLTA 3IJSB 3QQ3A 2F54D 3ARPA 4Y16B 3ARBB 1UADC 1ORQB 5AZEL 1BBDH 3I02A 5KVMC 3GJFA 4WO4A 4UUJB 2WP3O 4F2MB 1AY1H 4MNQA 5K59E 1IGJB 1UXSB 5C0BA 3SDDB 5TE4L 3HLAA 4YHZL 3C5ZB 2AXHA 2FX8H 1YN7B 5F72S 2ZCLH 2EIEA 3D85A 3DV6A 4ELME 3VRJA 4MJ6B 1FJ1B 1FVCA 1E4KC 3NZ8B 4OAWB 1ACYH 4NOFA 1QBBA 3U46A 2DDQL 5I8OL 1H5BA 4J3TA 1HOCA 1U8NA 4JGUA 2EDRA 1JCKA 3EW3B 4K3DL 1BM3L 5FDYA 4HPOL 2VZOA 3GBML 2B1HH 1CL7H 4A2MA 4HKXB 4K8RC 5E4IA 4F37F 1HKFA 4GKSB 5FM5O 2EXWD 4JZJB 2AV7B 4O4YH 4DK3A 3SGJA 3WS3A 4UOW0 1YN6A 4XHJD 1JZ6A 1S7SB 1J1OH 1XGUB 4K8RH 1IAII 3RFZC 3QHZL 2X1QA 4R3SB 4D9RD 1P7QB 4Y4FD 5FO7A 3U48A 4RMVA 5F1NB 1IAKA 2BCKB 3N1PC 2H6PA 1UWEL 2NW2B 4ENED 3BH8B 3B9VA 4F7MB 4JM2F 5C0DB 1G7MA 1JNNH 4EVNB 5K9OA 3CD4A 3CUPB 5DEZA 5DD3L 5I1KL 1JN6B 3QYCA 4L3EE 2EE9A 1A3RL 1L0XA 4HXBH 1FRGL 4ACPA 3WUWB 4CNIA 4LSSL 3MGTA 1BWMA 1T5XB 2X4QA 4YUEH 5DR5L 4F15B 2CRZA 4PRDB 3H7BA 3GM0A 5KG9B 1XF5B 4OZIA 1SJHA 1KXTB 1INDH 3VFNA 3HMXH 5B39G 4JO2L 5J11C 2BDNL 2NZIA 4PRNB 4ZPTA 1AP2B 3PHQB 1CWVA 1DVFA 5I1JL 2GJJA 2P44B 4KUCF 3WHE0 2NX5A 1QSFE 3A6CL 3AU1A 1F4YL 4J8RA 3DV4A 2WIIA 3MLUH 3OG6B 5C09E 2YPVL 1U3ZA 4LMQI 4OFYA 1LEIB 4P9HH 4LVOC 5EO9B 3C60D 2V7HA 3STBA 5HHQB 1QEWA 5IVXF 5LBSL 5FFLA 3O81A 4YFDB 3WNLA 4P46D 4AENB 3B9KC 4P2RB 4Y19B 3HI1A 1DSFL 1KG0A 4HIJA 4NN6B 4JFYA 3OKEA 5B3JF 4F58L 4NFBA 2VWEC 2MKWA 5HVHC 2YPLE 3AS1A 1YEJH 1MCOH 4OCLC 3RDTC 4LSDA 1YEHH 2X1WL 4W81A 4IS6A 5CJQH 4I77H 4JDVA 3THMH 1RZ8A 3VDCA 1AGCA 4KPHL 4RX4D 5JO5A 3NCJH 5E8NB 1HYSC 2GK0A 1G7PB 3S5LG 3W81A 3WXWH 4OIIH 1T5WA 3QRFM 2DM4A 2I5YH 3HHRB 4RWHA 3P9MA 1UJTA 3QEHB 1ONQA 5J12C 5CGYD 3Q5OA 1MPAL 4X8XA 5JOFA 5IJVB 3NIFF 3ME0A 3RX8A 5EA0L 4CAGA 2BXZA 4MS8D 1KIQB 4YHKL 1AD9B 3QB7C 3QIUD 1B0GA 3DTXA 1JNJA 1BQLH 5CLTA 2DYPB 3OHXB 3HS0A 4KY1H 1BOGB 4X6DE 3MCKB 1JRHL 4G6ML 3CFBA 4YDJA 2EZ0C 4IOIB 3DNKA 1UGNA 5IQ7L 3SKMB 1J1PH 3H0TB 3VWKC 1G7QB 3VA6A 5EH1A 4N5UA 4OJFH 3L3DB 3RWIA 3MC0A 5CMAB 3BWAA 2DQIL 3TV3H 1T7VA 3CZJA 1NLDH 2UWEE 2VDQL 4YAQB 1NGXA 4NCC1 1Y6KR 1A6PA 1T6VN 4XZUA 2BSRB 5IHUH 1ZHLA 1AGDA 1T04A 1ZLWK 2BX5A 3QWRA 4JR9H 1BZ7A 4HFWA 4I2XE 1OOAA 2ICEB 1CLYH 3A6BL 3VW3L 3EOAB 5I9QC 4GS7B 3N1QC 2WLZA 1FGNH 1PDKA 4Y5YB 3IYLW 3QULB 5A43C 3RNKA 4DQOL 4WU7B 1T66D 1XGYH 4FP8L 3MLXH 1KN4L 3PP3K 5F3HB 4X7SH 4XMPH 4P57B 3ZKSD 6FABH 3S88L 1H8NA 2CRIA 3CFBB 4YDJB 2X4OB 1HXYB 1MIEL 4IDJH 4N5ED 1Z9OA 3IETA 4XPFL 3SKNB 1CE6B 1AD9A 1KJ3H 2Q8AH 1CQYA 1MNUL 3KAAA 4QOKD 2EYRA 2IGFH 2FATL 3V0VB 4P4KD 5DMIH 1I9RH 5KANI 2EDXA 4BQ9A 4U1SB 3REVA 3B43A 5ICXB 4WHDA 1QFUL 3DO3A 4NCDA 5CILL 5HGHA 1EGJL 3RTQD 4Y4KA 5IV2B 4M7LT 2P8LB 2H1PH 2WUCH 2XPGA 1ZA3A 1OAQH 5E8NA 1VACA 1U3HC 3K2UL 1L4IA 3NABH 4K3JL 3RWGB 2P24A 1CCZA 5KS9E 2E7LC 1DCLA 3CC5B 3DMMD 1NMBH 3V5KA 3ZSTA 4LU5L 4P2RA 2HFFB 3HRZA 5DD1H 1XR9B 4LVNC 2Q20A 4JO4L 3DVIA 5GSRA 4Q9CA 1IM9A 1LDPL 5IEKA 2FBOJ 1T1YA 3HPJB 5B8CC 1LEIA 4GKZA 4KKNA 2R69H 3V8CA 1C5DA 5E2UL 1DFBL 3ALPA 2HFGH 4L3EB 1G9NC 3WNOA 2NZ9D 3A0OA 4PP2B 4Q6IA 1JF6A 4MJ5B 4DOHB 3AM8A 5EZJB 2Z35A 1S7TA 3BYTA 1KCVL 3HAEG 3MRHA 5HHMD 3UJTL 3GBLA 4RAVA 4DVRH 3BHBA 4XP5L 3G5YA 1G9NL 3BEWB 5KZCB 2V7NB 4Y4HA 4LRNH 4CN6A 4OLYH 4N0UE 1FL5B 1QSEA 2RHEA 1BJMA 4JM4H 5KG9A 5E5MA 4LPWA 4QGYA 1SYSB 4AL8H 3MJ9L 1QPPA 2VIRB 3C08L 1NCDL 2H2PD 3TIDA 2QADD 4Z78A 5LKNA 1YEFL 3D39A 3MJ6A 2YD4A 3D87B 4HLJA 1HSBA 4OZFA 1KTRL 4K23L 1RIHL 4Z7WE 5HYJD 4JKWA 1I1RA 1LO4H 4LSQL 1E27A 3FO1B 3QJFB 1DEEB 5ESAB 3QFDB 4EI6B 1RUQL 5J06A 1ES0B 3MNWA 3C5ZC 2MCG1 2X70B 5JDSA 3FOMB 3BIAX 4LHQB 4TSCH 5DA0B 5IVXB 1LGVA 1KF9B 2KH2B 1VFOA 2YD3A 3HR5B 3MUY1 4JPVH 4ZAKA 2NY7L 3SGDH 1OL0A 2JCCE 1WAAF 1XGUA 4IRZH 5I8CA 4U1NB 1MWAH 3CFCL 1TTGA 1BF2A 4K94L 4F33A 4PJIA 1KLFA 2WUBL 2O61A 3RL1A 2G75A 3D2UD 2GCYA 1S7VB 2RIKA 3MRPA 5I6XC 5T33L 5C71A 4P4KA 3DIFA 3U4EA 4FQIL 1B6DA 5EDXA 5FYJL 5GGVL 4Y4FC 1VFMA 1H5BB 5D7KD 1JWMA 4E5XB 4KGLA 4KAQL 1KJ2H 4MXWH 1YPZF 1HQRB 1FJ1A 4NQCB 5ISZB 2VH5L 2EXWC 5D4QA 1I9JL 4LHJB 3QDMA 2BJML 2D3VA 3GUTB 5CIPH 2WUCL 1GHFH 1HCVA 4D8PB 2X7LB 4DN4L 3GSUA 1A22B 3KPLA 2HVKA 3DETD 4UUJA 4P4RA 2ZP0T 1YNLL 1LP9E 3TJEH 3IFLL 3KS0H 3PDOA 1OWRM 1NAKL 2X41A 7FABL 5FM4A 1HINL 5IIEB 4AIOA 2DOCA 3WFCL 4PP1C 1P7KB 3EOBA 2V5YA 3BKJH 2CO6B 3D39B 1UM4L 4PJCE 4P5TD 4G8EB 3QEQE 4YDLB 2BNQD 4OD2A 2XTJC 1A7PL 5CGYC 2AJYL 1SYSA 2J8UF 3O6FD 1V8HA 1B4JL 4L8BB 1INEL 3TT1L 3KPSD 2AI0H 4MXVF 4TSBH 5DEGA 1CVRA 4LCIH 1FE8H 2BMKA 1KB9J 1FNFA 1F97A 1W0WA 1BAFL 4GSDL 4GJTB 4Q6IC 3RJQB 4PJ8A 3VXMD 3RPIB 1CFVL 1E4WL 4QTIL 1KT2B 4KMTL 1O7VA 2GJ6A 5D72L 4X5WB 4ZO7A 2R1XB 4OGYL 1C16B 3CVHL 2ZG3A 3H6JA 3B9KB 4MYWB 2UWEF 5DJCB 3ZKXC 3TZVD 2CR3A 2SEBB 2VERN 1RHFA 4BFEA 5IVNA 2DQGL 3RDTB 4NZDA 1PFCA 1Q1JH 1ZHKB 2F53A 1MCJA 5E2WL 3QUML 4G8GB 1ZLSL 4F8TA 1XR9A 1G7JA 1GGBH 3HC3H 4WFGD 1ZVHA 1QRKA 2VZTA 2COQA 5C9JA 5E24E 4U4BA 1KPRA 4MCZA 4BZ2H 3L3HA 4XB8A 3OAZK 3PIQB 4D0BA 2NY7H 1Q9WA 4X7DC 1S78C 1BJ8A 4HUUA 3RHWK 4KDTA 3VG0H 1X5AA 4RGNC 3WUZA 3BJLA 3PNWB 2AEQH 5ANME 2YZ8A 2HJLB 2JE8A 1GGYA 3QHZH 5F9JA 1J18A 1J05A 4EDXA 4HWEL 3P4OA 5JOEA 5H35A 3JSSA 1KTDB 3PGFL 5H94A 5GPRA 5T33H 1DLFL 5T5NF 4G8GA 2L7UA 1DANU 2AJXL 3DVGB 3QQ9D 5F7LB 2PXYA 1PLGL 2J1KA 4Z5RB 2J3SA 2J5LC 5D6DA 1MFNA 3GKWL 1JRHI 1N5AA 3K8MA 3O2DA 4KRLB 5GGRY 3GSOB 4Z0XA 4ZUVB 1NC2B 4X5XB 1ND0A 5DUMH 3MLRH 4GLRI 4GG6B 2Q6WA 1NGWB 2DM2A 4E42B 3DGGB 3F8UB 3ARQA 4H8WL 4OF6A 1T03L 2GTZB 1FPTH 4MCYA 3PWUB 3IFLH 2XKSA 1EMTH 3WDHA 3SQBA 3CMOH 5DURB 3TN0D 2VAJA 1LEKB 1ZWIA 1DQJB 5C0GB 1F11A 4YBHA 3WS6A 4C57C 1TIUA 2VDNL 3FKUS 5FA4B 5KAQF 1GZQA 1BVLB 3HI6L 3R8QA 4PG9B 2OXHA 1U8QA 3N85H 3SCMD 3H0TA 3HC4L 3L5IA 2I9TA 2GJ6D 4NN7B 1R3KB 4ZUTB 4XWGL 3OF6A 1AI1L 3RU8L 4HMDA 1WIOA 2EEBA 5HVGB 5DRXA 1OF2A 2UZIH 4LSPH 1J0IA 2AK4B 4FTVE 3LKRB 1MCBA 3IDMA 1KNOB 2Z31D 3T2OA 1EVTC 1I8IA 3NCJL 5CJBA 1ZHNA 1ONQB 3AREC 4G8IA 2YEZA 3IGAA 1YMMB 4HIHA 4YBQC 5ENWA 5HVWA 1QSFD 5TF1H 2QSCL 4QOKE 3DX7A 4J23A 4LHUG 4F7CB 2Y06L 3O6FB 1A6AB 5D2LE 4JDVB 3ARDD 5JW4N 1G7IB 1EO8H 3RWHA 3VFSA 1P4BL 4XAWH 3U0TB 2ITCB 2R2HB 4QRPA 1S7VA 2IMNA 2R2BB 1WAAE 3JVGA 2R0ZH 5DF0A 3QFJA 1CT8A 3V52H 2R0KL 1H3GA 4KZEL 2ICCA 2OBGA 3NCEB 5BRZD 2XTLA 2NY5L 2LTQC 5DHVH 1WCBA 4UOW1 5CEXB 4RFNC 3ZTJH 4PLOB 3W11C 1QEWB 5DJ2B 3C6SB 2R8SH 3HZYA 1OTUC 1TETL 4M7JL 4M6OH 4L8DB 3HC0B 4ZDHA 1WAAA 2WIIB 1U6AL 1A7OH 5C7XL 1I7ZA 2DBLL 4I0PC 2ADFL 4MSWA 1KCLA 5J1TC 4P49A 4ZD3H 5ADOH 1ZLVH 5DVOA 4U6YA 1S5HA 3HUJA 3TPUA 3NZHL 3R1GL 2IJ0C 2AXJA 3ISWA 4NQXB 4XVUC 2B0SL 1AQDB 1FGNL 3U2SA 2HA1A 4ZO8A 3BP4B 4TQEL 2DM7A 2AJSH 5IROC 5EO1B 3CAFA 3FFCA 2LV4A 3HA0A 2ZUQC 4RAUB 1AD0A 2HWZL 1LO2L 3UBXA 5A3IC 1LP9F 4OT1H 1DQMH 4UTAH 4LVHB 2OTPA 4OZGE 4U33A 2WQRA 3ZE0F 3EYQD 3TO2A 1H5BC 5DJ6A 1S5HB 3HUJB 4KH2A 2H26B 3P77B 2C1PA 3F7RA 4WI6A 1YNTA 4YHNA 5GXBB 1FIEA 1Q9LA 2ARJQ 2AJUH 4LGSB 3MMEA 4YBLB 1BVKB 4M48L 3VMPA 3L7FA 4WVRA 4HJJL 1EGJA 2IGFL 1EGJH 3BH9B 4DGIH 2NXZC 2DI8A 4DFIA 3MV9A 4I4WB 2MCPL 2V2TB 1U8LA 5F1NA 4XPGL 5EFIA 2VSCA 3AC0A 3B3IB 5C07A 4OD3H 2VDMH 5C0NC 1MCEA 4YK4B 1OSZA 3VGFA 5T3XL 5D5ME 3WS3B 4NKMB 4EJ1C 1YMHA 4PJXB 3QZWG 4J6RH 1RHHB 3WIHA 1S9WA 5KOVC 4QRPB 2VSDA 3IXAA 1G9MH 4JKMA 1NJ9B 1T1XA 1HKLL 1TVHA 2A9ML 3T8XA 3EZJB 3NFSL 4PGCA 5JZ7D 2G2RB 4F7CA 1DN0A 4QRTA 4MZ2A 3FT2B 1GZPA 3QO0A 1CN4A 1UCBL 2E9JA 3QPQD 4XGZB 5DUBB 1MIMH 1B9ZA 2G5BB 3C87A 4WRLA 1RY7B 3BWUC 1OCWH 5F88B 1ZHNB 5HHMB 4CL7A 3V0VA 3GK8L 4W6WB 2BVQB 4JG1H 4Z7OE 1A8JH 4EI5A 5MERA 5J0BA 3BZEA 1DQTA 4S1RL 1OPGL 4OM1H 1EO8L 2P5EE 3QEQD 2A77H 2HLAA 3O4LE 3TA3A 4Z7UE 2AGJL 1S9VA 3UTTD 3G9AB 3EDDA 3KXFE 4NHCH 3RIFF 3ARBD 1A6WH 4LEXL 1L0QA 4LLMB 3SPVA 1REIA 2ZCLL 3QIWA 4G3YH 1FORL 3U0WH 1SJXA 1ZWIB 5F6HJ 2E9IA 4I9WE 5T1KA 1RUQH 1A7OL 3KXFA 3RWDB 1QR1A 3DX8A 4QY8A 3L5WA 5J6GB 1NAML 2DQTL 5BJTB 3KPQA 1YEKH 2VJXA 4AYFA 4MX7B 3CVIL 5CZVH 5TDOA 3Q6FB 1U3HB 5D93B 1DVFC 3U9UA 1NGWA 3V6ZB 4O4YL 4OQ1A 4XP4L 3H9HA 1D6EA 4HUNB 3TBYB 3OB0K 3U36B 3PV6B 3CSPA 3WE6A 3EOTH 1Q72L 5IBUB 3DVNB 5JIHA 4PGEA 1QBML 1S7UA 4M7KH 5DVNA 3M1BA 2H32B 2IC2A 3ROLA 1I4FA 3VXOA 1TNNA 4ELKB 2OTWB 3JBG7 1UQSB 3GHEH 2F19H 3OHXA 4HDIB 3ZKMD 3OKMB 1N3NA 2G9HA 4N8VG 4YXHL 4KVNH 2YKLL 4WTZA 2ATPB 1FV1B 2CSPA 3PQYE 4N0YH 1A3RH 3QUKB 4X7FC 1JHKL 4MD5B 2CRMA 3MBEA 4DKEL 3RZWA 3GSWB 3EO0B 2NY6B 4NC1E 1J05B 4MD5A 1KACB 1WZKA 3GNMH 2IBBA 3EYUL 1U58A 5HDOA 3RDTD 1U91A 4HUVA 3JWOL 2P8PB 1A1NA 5JXAL 1JIBA 1MCFA 5JLZB 2X4NB 4DN3H 5CD3B 1AGCB 2ATPA 3SCMB 3S3JA 2ZUWA 3K1KC 2QBWA 5TQ0L 3ES6B 4X80H 3VA2C 3ARDB 3PE9A 4FFWD 4YZFF 5KVGH 1X5HA 4MQTB 3IF1B 4EEEA 4DUVA 3CDGA 3GO1H 5C9JB 2H32A 3M1BB 4HHAA 3GSNB 1KTLA 1J7VR 4WUKL 4HPYH 3ULSB 3FOLA 1G6RA 4PJ9C 3ESVF 1FFQA 1RURH 1MLBB 3CXHK 2XWBA 4U3HA 2BHYA 3RAJH 3VD9A 1ZHKA 3V6ZA 1F8TL 2AK1H 4R9HA 2QHRL 5AZ2H 3L3JB 5KJRL 1AO7A 1S7RB 2AABL 2BP3A 2MHAB 4LARL 4NRYB 4J8RB 3AU1B 1Y0LA 3T1WA 1E4KA 2UZYB 4KRNA 4DZ8B 3NFPA 3PV7A 1BFOB 1C16A 3RWDA 1Z5LB 3DUUB 3WNMA 4ETQB 3QUZA 3ZLQC 1EVUA 3ILQD 4GUPB 4MAUH 5FUCC 4LNVA 4AQOA 3EYSH 4KKLC 3D69A 2AI0L 4GG8A 1U3JA 1GSMA 1E4WH 4Q58C 2X4PA 3MNVA 1OGAB 1KCUH 3P30H 4BSVB 3FHQA 2VXQH 4G43B 2J8UB 3THML 3AAZB 5DJZA 1J0KA 5DD5H 1YPZB 4H0IA 3D0VA 4LQFH 1MH5B 2A0LD 4JPKH 4WFFD 1KJMB 3LKQB 4WI3A 4Q9QL 5I1CH 4CN1A 4JQVA 1V7NL 4O2CA 5ICYA 5C8JA 4LAJH 4RMRA 3D0LA 5CCKL 5E8DL 4UBDD 3S97C 3BKMH 5LXGH 4AMKH 3MLSH 5D7KE 2VXUH 3O6KL 5EWIL 2IAND 3KLHC 1YC7A 1ZLSH 1I8MA 2FYYA 1W72L 2OTUA 5LGHH 1NBVL 1MLCB 3LDBC 4EUPH 3WFHB 3IFPA 4PJBB 5D1QD 3QIBB 5HHNA 5F1SA 3BVNB 4AH2A 3MGAA 4WV1C 4PJDA 4UT9H 4NYLA 1Q72H 4D8PA 3FB7A 1NJ9A 5HHOE 5F7YC 3UMTA 4HUKB 4PV9B 1LE5B 2BRRH 1YY8A 4PGBB 1QSEE 2F53D 4HKXA 4LRIA 3V5HA 5FM8A 1YY9C 2MKLC 4MHHG 4K2UL 4YUEL 4NO3A 4RIRB 2R56L 4FTVA 5L2JA 4X8JA 4MB3A 5JTWA 2X89A 4P5MA 1YYLH 5C07B 4QRRB 5GRZA 1OQXA 2VN7A 4Z0BL 3VH8A 4LPYA 4WI2A 5JA8B 3BO8B 4OD1L 4P2OC 4Q6YA 1UKTA 2WBJA 3L7FB 3ULUF 2R1WB 4ORGA 3FMGH 1AGEB 1WIUA 3FT3B 3T0EA 1KEGH 5J1SC 1KN4H 4PRPD 3HLAB 1X6LA 1D6VL 4YFEA 3MLRL 4F2MA 4U2ZA 2NY1C 3RGHA 2D31B 2DQHL 5I74B 1JYNA 2D7MA 1INQA 2V5SA 3R06A 4H25B 1UWXH 1OHQA 3GRWA 5EU6E 2PF6A 1NCNA 3UBXB 3TBTA 4X98A 2X70A 3GI9L 5JDSB 1KB5A 3LZFL 2F74A 2JJWA 3MJ8B 3RP1A 1DEEA 2AJ3A 4F58H 3N1FC 2B39A 4OBSA 2QHRH 5AZ2L 4U1MB 3VFTB 1FVDA 1RUPH 4POYA 1J12A 1HHIB 2YN5A 3GJFH 3OXSB 3MRNA 4L9DA 5ITFB 1HEZA 4L1DA 5C0AE 5L2KD 3K2UH 3IAPA 3P11H 2CMRH 2ESVB 2CUIA 3KPNB 5BO1H 3QH3B 4U6XB 3CFKA 3MOQA 2NY1B 4CVZA 5JIKA 3MLPA 2FX7H 1U3YA 2V2WA 5BZDB 4JFDD 5KSVB 4YEFA 1F58H 2F58H 3ARGC 4QKXB 5IOPB 2W60A 1JK8B 4ONHA 1XF2B 3MRHB 5HPOA 3QIBC 5DJ2A 1KGCE 4EQ2A 2VISA 4XCNA 2WBWB 1KCUL 1JYXA 4U7MA 3V6FB 4FFZL 5GJSH 4Q6IB 1FZMB 1MCSA 4PJEF 2AS5M 4WI9A 3B2VL 4FXGA 2FJGA 1A4JA 5IW1B 3TF7C 1WEJH 4C4KO 2YPLD 5J1AA 3RIAF 1MI5E 4D0CA 1JFQL 5IEKB 5EUKA 1A6AA 4X9FA 3P4NB 1QR4A 2D7OA 2VC2H 1KPUA 4QXGL 5TF1L 5HXMA 4XNUH 1BMGA 3TWCL 2HFFA 3HRZB 1PG7H 2R0ZL 5EOQH 5MEOB 4QXWA 4R2GC 4LCWE 5BS0A 3ULUC 5KSAA 4NHUB 5ALBH 4XCFH 3LKRA 2FSEA 4KI5F 4OF8A 3NAAH 1R5IB 4OZFG 3PWPA 4GBXA 4XI5D 2XPGB 4ZS7L 3MV8B 2IMMA 3S34H 2GT9B 3QI9B 4FMKA 1CLCA 1EZVX 3U7YH 4LSUH 3E2HB 4K71B 3BT2H 4FOMA 3BUYA 4JKPH 1GZQB 4PR5A 2XT1B 1HHJB 2ZWLT 4R7DA 1DANT 3OWEA 2A1WL 2DBLH 1YNKL 2VKWA 1IRAY 2F53E 4PJCB 3O6ML 4ODWA 1UZ8A 3SDAB 1DQJA 3NIGF 3GB7A 1HXYA 4IHOA 1KJ3L 2VL5A 1EAPB 3I6LE 3SKJH 1NCWH 4ONGH 5E1HB 4AEIH 1F6AA 5LCVL 2PW2B 3EDJA 4WU7A 1DEDA 4MJIB 3NVQA 4OF5A 2X4TB 3AFLA 5DUPL 3U82B 3ARGA 3HMXL 4FN0A 4UTAL 4JO1L 5EBMB 5HY9B 1GXEA 4JN2A 4OGAC 4Y19E 3FO2A 1EAPA 1KJ2L 3DJ9A 3VXRD 3SGJC 5D7SH 4LGPB 4QOKA 4PBWD 1UZ8B 4PUBH 3CJJA 4JJ5A 5D7JC 5TFSL 3JUYA 2NPLX 1V7ML 5FEBA 3PWJB 3OXRA 5E8EB 5H37H 5C0RH 4LSVH 1HHJA 3FN3A 4K7FA 4PJFF 4JQIH 1G7QA 1HNFA 3L7EA 3ARFD 1SM3H 2IF7A 5FKAB 1Z9MA 2P5ED 3VXMA 4PJ9B 5I1HL 3QI9A 32C2A 3SKOB 4C83A 3MV8A 3K80A 3DMMA 3MQIA 1B0GB 3O2DL 1LK3L 1U8MB 5AAMA 4NBXB 3GJEB 3V6OC 1NGYA 2FSEB 3FQRA 1X5KA 1P4IL 5CJOL 5FV1L 5EBMA 4CUCA 2QQNL 1KPRB 4M03A 4HEPG 5MEOA 1WWCA 4AY0A 3AY4A 2X4TA 5CZXC 5T5NG 3BD3A 4JG1L 1C5CL 1AC6A 2FIKA 2IBZX 2PW2A 4U0RB 1EUUA 5F6IC 3MBED 4NM8H 2QKIA 3CIQA 3HZVB 4H1LG 1TQBB 4RGOH 3VXTB 2I26N 3IKCB 3DRQB 4X6BA 1OAKH 5EU3B 5HJ3B 3FFCE 5D1QB 4YDLC 3N1GC 2OM5A 5C0EB 1D5ZA 4HH9A 2E3VA 4AZ8A 4R4FL 1T1WA 4PG2C 3DHJA 4L4VD 4NRXA 3NAAL 5CEYA 2YK1L 1SMAA 4Z7QE 3HNVL 3T2NH 2EKJA 5D6CA 1W72A 2V2WB 3PQYD 5IQ9A 3KYMB 4FQXB 5C08A 3TO4B 2NY1D 5L8KB 3ARDC 1QKZH 3MRNB 2DQTH 5GRVL 1SEQH 4KKBD 1DN2A 1P7HL 4JFED 4PB9L 4NRZB 1WT5A 3JUZA 5F7DA 5F9AC 4M9OA 2NY0D 4BSWB 1RIVH 3U1SL 3QIWD 4D0DA 3PWVB 5FB8B 1KB5B 2NX5E 1JZ3A 3P4NA 1J5OH 3CPLA 4PRDA 5J11B 3GMNB 1H3PL 1S8DB 4MD0B 1NFDE 4WGWB 4U6TA 4FZEH 3KHOA 5DSCA 4PY8I 3A67H 3L95A 4UU9A 4MAYC 3X14B 5HYJB 5IUSA 5K9OB 5LG1A 3P9WB 1ETZB 4DKEH 3RWCA 1D9KA 4ZSOE 1JK8A 4ONHB 4XCEB 1VFAA 4KI1A 5GRWA 3T04D 4GXVH 4U31A 5E08L 2DQFB 2JELH 2PR4H 2P5EA 3GKWH 2Z31C 2Y6SD 1R3IL 5I15L 3AS0A 2XNAB 4FTVB 3F7PC 5C07D 4R6UA 5HYSB 4LCWB 3UTTE 5F89A 1IEAA 1ZSDA 1RIUL 4Q97A 3T4AB 5I16A 4J4PD 3TIEA 5FHAH 4DTGH 2F5BL 2V5RA 4KTDL 3CXHJ 5KW9L 2XTJE 1OB1A 5DD1L 4KK5D 5F7EH 1ZTXH 4N1CA 2OI9B 4GSDH 2XOTA 3OAUH 2X89D 2FYYB 2V9QA 1I1YA 3FHAA 4DGYL 1S9YA 1EFQA 1A5FH 4NQEE 5ICZB 1RVFH 2Y5TB 1N7ML 3O3DB 3QDJE 5MHSD 4YDKH 4M9PA 3HG1D 2LE9A 4JHAL 5HGDB 1I1AC 1K8IB 2R1WA 4ORGB 4O2CB 4P46C 1OSPL 2PO6B 3QUXD 3C8DA 5ICYB 2WBJB 1CU4L 1X5YA 4Z77B 1Q9OA 2GI7A 1GRWA 4GAYA 3HE6B 1HWHB 4HUWB 5FCUL 3MLTB 3QUMH 5TE4H 1OARH 4PYHA 4PJ8D 1OTSD 3IFNL 1CGXA 3ZL4H 2YMXL 1HHKA 3QUYA 3Q48A 3H2WA 3ARFC 4P3WA 4DCQB 4PS4H 1MRCH 4P5KA 4N90E 4GW1A 1I8KA 1JF5A 4XVTH 2EDEA 4U1LB 4Y2DB 1C1EL 5TE7H 4NT6A 3S98A 3QXDB 3VRIA 1R5VB 5CBEB 4NRYA 3QHTC 3O8XB 4NN5B 4M6NH 3CH1A 3RWEB 1RZGA 2UV3A 3Q3GA 3VXNA 2CGRL 4WU5B 1MHCA 2ED7A 1AR1C 4FQHB 4QCIA 3PDDA 5SWQA 4X83A 3GMLA 5GSRB 5C6TL 1T4KB 3MRCA 3LPGA 3QUMB 1FNEA 3C5SA 4NN7C 1RFDH 4DUWA 3V5KB 4X5LA 1JJUA 5I8EB 2R56H 4NSKB 4X4YA 3LD8B 5HBBA 3V5DB 4H1LA 4KUZL 5D9SB 1D9KD 1CR9L 5C7XH 3UYRH 5IB2A 4KK8D 4R90H 43C9B 4NDMA 3L1OH 5DYOA 3OKLB 4M7LL 3VXPA 1U8JA 1FRGH 3MNVB 5T3ZL 4H8WH 1T03H 5L6YH 1X44A 1FFPA 2DBJA 3S96B 2BNRE 5B38G 2Y72A 3L6FB 1FNSH 1A21A 4GUPA 4HX1A 4IIQB 1ZT4B 1QBAA 3EFFA 4AM0B 5E4EB 2G60L 4TNWF 4YC2C 1DBML 2A6IA 3WIIL 2Z91A 3O4LB 3IDXL 1D6VH 1YY9D 5C0BE 3RVVD 4XB7A 1KIRA 1A1OA 4P2QE 5DJYA 3LMJL 1I8LC 4P57A 4PV8A 4N68A 5FUOL 1IC7H 3LN9A 2EO9A 1D6EB 3A6CH 3FOLB 2ZPKL 1KTLB 5EZIH 3ULSA 1N64L 2CDFB 3UP1A 2FR4A 1EV2E 4DGIL 3Q6FA 4FFYL 1JTPA 1MI5D 4LSPL 3WSQH 1WC7B 4OM0L 3P4MA 5BJTA 4HFWB 3O4OB 5EC2A 4AQ1B 4YHLL 4EIZC 3NCCB 3SCMA 3KXFB 1J1XL 3MACL 5C3TA 4UT6H 4NNYA 3TH2T 4CW1B 2Q7YA 2CXGA 4JY6B 2Y4SA 1U91B 3L6FA 4PLKC 1UFUA 4LCIL 2DTSA 1YQVL 3EYVB 3JV4B 3HTLX 4TOYH 3QUZD 2A6KB 4NFDA 4BELD 5D7JB 1BM3H 4FG6D 1U95A 5FYLE 4KROD 2A83A 2W91A 1Q0XL 2YXFA 5F7KC 1S3KL 2GJZB 5F1OB 4AIXA 3UDWC 4Q74A 1CI5A 3HNTL 4HQQL 1V3KA 1KIQA 2DQGH 2XIDA 1IL1A 3BZEB 8CGTA 1BGXL 1AO7E 2C7UA 5IBLC 4HKJA 1M6OA 1JNHA 4QXGH 4QCIB 4Y4HC 3M8OL 2A77L 1A14L 4CADA 3BRFA 1G7PA 3SN6N 3NCFB 2YC1B 1RZKC 4U1HA 4Q9RH 3LKNB 3FT2A 1J8HB 1NDMA 2ZG1A 4MDJB 4P0DA 4QF1A 1CDGA 1WZ1L 3L5XL 3QI9C 1D3CA 1EEUA 1OTSC 3L5WB 5J6GA 3D25A 3RGVB 4NO2A 4PJEB 4OFPA 1TTUA 3RVTD 3FONA 5ESQA 3SDYL 2HFTA 3R1GH 4JFYB 5DJ8B 2DICA 1II4E 3QUXC 4O2EA 1EHNA 4LLMA 3SPVB 2IQ9H 5CINL 5K9QG 3PGFH 3GMOA 4P2OD 2HRPH 3GFUA 1R0AL 5GZND 1WT5C 1S9VB 3MRLB 1IAOB 4O02L 4XTRC 2D9CA 4POZD 1E0OB 3WN5B 4WFHE 1M7IB 3DV4B 5DHYB 1FN4A 4PBVC 2C3VB 4XP4H 1S7XB 1J0ZA 4WFED 3P73B 1IGFH 2DQJL 5BRZB 2QADB 1A9BB 3GSVB 2A6JB 4JAMB 3C6LA 3SKJL 1EA9C 4AEIL 2J8OA 4BSJA 5CP3A 4P9HL 2NY2C 4WJ5A 2WK2A 4CRPA 1QD0A 3SJVD 2VL4A 4OD3L 2ZKHH 3ROOB 4EOWH 3B9EA 2R23A 1S5IL 1DN0B 4QRTB 3EHBC 3NCYS 4XPTH 4ODXA 1H3XA 1X7QA 4PGCB 3HAEH 1EMTL 3W0WA 2GUOB 2ZPKH 4M3KB 3TFKC 5DRWB 3QIUC 3TPUB 4WFFE 3JWNC 1A3LL 3T3MF 5IB1A 5DFWH 4IRSC 4IJ3B 4MA8H 4PJGA 4CDHA 4WHYG 3HE7C 4MSWB 4P3DB 1FNHA 1SM3L 3ARGD 4EI5C 4X6DF 4K3EH 4ZXBA 4UT6L 1MIML 4QXTA 5D2NE 4L8DA 3AXLA 1T2QH 2MPAL 1A9EB 3S35L 3V7AG 1MHEA 1CGSH 2E7HA 4QXTB 1ZHBB 1J11A 4GKOA 4NQCD 5ISZD 2BVOA 4MQXC 3FQUA 1GOGA 3CFEA 1QRNA 2UZIL 3LCYA 3F6IA 1Z6JT 4TVPE 1H3UA 2JB6A 4ZO6A 2R2HA 3ARTA 4PJ5E 1CGYA 1P4LB 5C0IB 1X7QB 2R4RH 4Y1AB 2DIBA 3O6FA 4LL9A 2FZ3B 4RAUA 4UV4L 5AG8A 2UUDH 3GHBH 1C5CH 5CP7A 4D0DB 2VABB 3GGWA 5DMYA 1AQDA 1KCVH 2HFEA 3WNNA 5I75B 3WL9A 4XPHH 4DGVH 2YHGA 3GSXB 4ZTPH 1N8ZB 1UVQA 1ZEAH 4KQ3H 3D85B 3UC0L 4P2YA 1VGEL 4U6YB 1JL8A 5F3BA 1LO5B 2D03L 2IQAA 4R0LA 4G8GE 1JZ4A 4NUJA 2NTFA 5H8DA 4MVBC 5J3HC 2DWDA 3QZWB 3V4PH 3VXQA 3MRRB 5C0BB 5EO0B 3SDDA 5CZVL 4M6AA 3K7UA 4KZEH 4Y5VC 5DD5L 4XAKD 1OD7A 3GJFB 4XMKH 5EU6B 3VCLB 5MEPA 3TFKD 4OLUL 3GMRA 1IEBA 1R3KA 1FNLA 3MOBH 4HIIB 3QCUL 2OZ4H 3C6SA 1XCTB 1JMXA 5DJDA 3R8BB 1MEXL 2XWTA 3P9LB 1T6WA 2BNRA 4O2EB 5GRXG 5B4MC 2YA1A 2ZSWA 3ARFB 3GMMB 1OY3B 5E6ZA 2OK0H 3CCHB 3UDWA 4H0HB 5IF0B 2WQ8A 5C0AB 1MJUL 4NZTH 1X4ZA 3RL2A 2HT4C 3MRGA 1K5NB 4YXHH 2IAMC 5F7UA 3ZKND 2ESVE 4NZUL 1CS6A 3D25B 2YN3A 4OLXH 2Y07L 3P0GB 3BYYA 3WIFA 1N6VA 4WHTA 2AKRA 4Z76B 1CBVH 3CFIC 3BGAA 1P69B 4OCSH 2GTZA 4PTUA 2IFFH 1FBIL 3H8NA 5EIIA 4BFIB 4ONOA 4X7CC 1CK0L 3AB0C 3IDYC 3RVUC 4KKCD 2EXYD 4DN3L 2V5TA 3NABL 1F3DH 1FYHB 1KB5L 3DURB 4P2OA 4GG6E 2VAAA 4Z0BH 3VDAA 5EZLB 3BGFC 4OV6F 3BW9A 1DBKL 4GRLD 4Z5RA 3VXUE 1RZ7H 1QG3A 3H42L 32C2B 4X0KB 4HPYL 4PGZA 4I2XA 4WTWA 5FKAA 5E8PB 2X4UA 1JYWA 2HKHL 5CEZH 1CICA 1JHTA 2BY1A 4JDZB 5DI8A 5D7JA 1MHHB 4MMXC 5FA4A 2R69L 43CAA 5ILTL 1GGIL 5FOBB 5E8OB 5F9JB 5FHAL 2MPAH 2QJDA 1W0VB 3T65A 4X9GA 1WBYB 4YFLF 5D2LA 5GS0D 4NBYB 3OR6B 4G80A 4Z7WA 3PIQA 2CDGB 5I9QB 2NYYD 3G6JF 3RA7H 3PWUA 3HRPA 2OQJB 2DIAA 4KROC 1RJCA 5ID1B 2NY5C 2J7LA 4M62H 1BZQK 4I13B 2AEWA 3T0VA 1A5FL 3TVMB 4HZLA 2CIKB 1FFNB 4PV8B 2F53B 1LNUA 1INEH 1AGFB 3O0RL 5FDWA 1E28A 2F58L 4R96A 1DSFH 4OLVL 4XPHL 2PXYB 1LO4L 2GTWA 1GVIA 1QFWL 1HHHB 2EYTA 4RWYL 3TZVB 2EICA 1TNMA 1EEZA 3EUUA 3MRBA 1LQSR 2KZWA 4HZLB 5IVXE 4G6JH 1MJ8H 5JXEA 1HQ4B 2OR7A 3RPIA 2MNUA 1MJ7L 3GBMH 4HPOH 4N1HB 4K94C 1UM6H 1TZHB 3UPCA 3IDNB 3WJJC 5ID1A 4OV5B 3ZZ1A 2B4CL 1IC4H 1I85C 4Z7WB 3W2DL 2OZ4L 4UT9L 4IOSD 4NQDA 2A0LC 43C9A 4OZGF 4NCC2 3T65B 2CD0A 3KPRA 5EPMA 1NAMH 4PGDB 5D7LB 5I8EA 4FFWC 1JV5B 3QRGH 4M1GL 5GISH 4M6NL 5DVLA 4WTXA 2HTKD 1FO0L 4OLXL 5IBUG 2Q86A 3N1MC 1SY6A 3QIUA 2QLVB 4N8CH 4F9PC 3J7HA 4OCSL 5J57B 2AW2A 1U2CA 3RWFB 1JI1A 3O8XA 4PRHD 2SEBA 4ZUWB 2F8OA 2GY7B 4XC3H 2X05A 1DLFH 3GHEL 1KCRL 4MD4A 1QLEL 3MRFA 2X7LA 4KJYA 3SDCA 4H8WC 2R1XA 1H15B 3PL6D 4OCXL 5E99H 1CLYL 4GW1B 2CUMA 4M7LH 4X7EC 4PJ8B 1FNSL 2VLKB 2IPTL 4GQ9L 4HBQA 2NXYD 4G6AC 4U6VL 4YO0B 5DLML 5C08E 4URTB 5KSVA 1U8IA 1FLRH 1NAKH 2B20A 4JM2C 3QWRD 4P46B 7FABH 5CEZL 1RQ5A 3WLWC 3HE6A 4HUWA 1B88A 3H3BC 3HAEB 4NM4H 4YDIH 5C0FA 3K46A 5HHVL 4NC0B 4YXKH 3U4BH 4LLQA 2JCCA 1CICC 4OUOA 2P1YA 4YXLL 4L9LA 2Z92A 1P7KA 4Y88A 3VWJB 4XBPB 2PW1B 3O3DA 2DRUA 4U1NA 2W0FA 4WUKH 5DT1L 4YNYB 5DD6B 3PDOB 1AE6H 4P3CL 3D18B 3QBTB 1AGBB 3G5XB 4RMQA 2ENYA 5TDNA 4Z7UA 5JW5A 3E3QC 1WWAX 3MA7B 4XNQB 1INQB 4QTIH 4B7IA 4YNYA 5DD6A 3FOMA 1BIIB 5C0RL 1MCHA 4X99A 3CSBA 1B3JA 1G6VK 4ZSOA 5T1KD 5GQBA 1RZJL 1MFEL 4OM0H 2HJFA 2XXCB 4BQCA 4R0LB 1CTNA 4EN3C 4E0RB 4XVUD 2HN7A 1HZHL 1IJ9A 3GSRA 3UBXI 1SBBA 2E7BA 3WL9B 5C0FB 3V8OA 4FABL 1TTFA 2P5EB 2OSLA 1T83C 2VXQL 3ALXA 4NQED 5D7IA 2DMKA 2DQDH 5L2JB 1K4CA 2R4SH 4NNXA 1B90A 5GGTA 1IC5H 3ZDXE 1JRHH 3U6RA 1C5BL 1YEIL 2ED8A 2VLJA 3MRPB 3RWCB 2RB8A 3MJGX 5HYJA 4MJ5A 3HNTH 4PJIB 2OYPA 1NANI 3BKML 2IEPA 3TT3H 1YJDH 1EEYB 4WEBH 3T0DA 4HJGB 3W5NA 4I0PB 5HI5D 5GS1B 2OTUB 1T1YB 3HPJA 4MA1B 4ODTL 3ELAT 5C07E 4JY4A 2AK4D 4OLYL 2XY2A 2YD2A 4ZFZA 3KPPB 4JM2D 4WO4D 4P3DA 2H2SD 4TULH 5K59F 4MNHA 2FRGP 1JGUH 3MJ9A 5C8JB 3AMKA 5FYJU 4JZJC 4XC3L 5JZ7C 4KRPD 2Z4QB 4QXUH 3WFEH 4KV5E 5IR1A 4UI2A 2EDBA 2AQ1A 3AAZA 4HCRH 2VDKH 5K9JH 1HSAA 5TPWL 1HH6B 1ADQL 4O58L 1UZ6E 2X4PB 1R0AH 3F7VB 3BEWA 3T08A 4PRHE 4XX1G 4RAVB 2JJTC 4U1SA 4XX1E 1MQKH 3VXSA 5FHBL 5GHWH 4F7TB 3FQWB 4YPGB 1TZGH 4IRZL 2ID5A 4PP2A 4LPCA 4JFEB 3R0MA 3QQNA 4OUUB 4WWKD 2GTWB 5DQJB 5BMFL 3CH8A 2X5PA 2Q1EA 3DRQA 4X6BB 5EU3A 5T1LB 5B39A 3L5JA 1R3JA 1FFNA 1OAQL 4HFUH 3OSKA 5FO8A 4O5LH 1TPXC 3RNKB 4EXKA 3GSNA 4HHAB 3BD5A 3IAGC 1EO5A 2EXYC 1SVZA 2DQUH 1AE6L 4P3CH 5DC0A 1KLGB 1T89C 2G5RA 1RZJC 3CC5A 3WDJA 2XFXB 3NN8A 4U1KB 5IK3B 3QDJD 1RUPL 2FJHA 2EDKA 3F65A 3RWGA 3D5OF 1U8MA 2O5ZH 4DN4H 4QF1B 1DQQB 1IQWL 1R3IH 3VWJD 5I15H 5KN5B 4IIQC 4GAFB 3MX0A 4C83B 3SKOA 1EJ6A 3T0AA 2IANA 3MV8D 3DO7A 3KDMB 5E9DD 3LEYH 3MBEB 3RWIB 4WUUA 3QUKA 4NKQB 4OIAA 4TNVK 3GBNH 1QOKA 5DHVA 5E1AA 1M6OB 1IFHH 5E8PA 2ZUYA 2WLYA 2GSGB 4LKCA 5IB5A 1SBSH 3OJDA 2Z8WC 4L29A 4M1DL 4P59L 4QRQA 4EUPG 3I9GH 5IFAH 3VXOB 2WINB 2J5LB 4U0QB 1BP3B 3QEQB 3FO2B 2DD8L 4MXQC 3QEHA 1LDSA 3GHBL 3I50H 2IADB 3KDMA 4X9BA 3DO7B 1VGEH 5EC1A 2DJ4A 1T21A 1QRND 3MBEC 4ZTPL 3UZQA 3O45B 4JKLA 3RZCC 4U7SA 3ZDZF 3VI4F 4LPUA 3FO0L 5I6XB 1RUKH 4QY8B 1AKJD 2VL5B 3WUWG 5MP6H 3P4MB 3GKZA 5C1MB 1WV7T 1JVKA 4GMSL 3V4PL 4KJPC 3HFMH 4PB9H 4YAQA 1JGUL 4Z7VA 3KPSB 1QFWI 1CZ8H 1EO7A 1QFHA 2BNRB 2EE3A 5CKGA 3ARYA 1MWAL 1AIFB 1Q8MA 5GS2D 5EBWA 3MV9E 2OI9C 4KKAD 5JMOC 1JPGB 4NZTL 2C3XA 4FXLA 1BREA 5EU6A 5A2JH 3MCKA 1UH3A 1B0RA 4Z7VE 4FQIH 1IGTA 4LBEA 1MJUH 1CDJA 3MRIB 4YJZL 4OUUA 3GMQA 3QZWA 2B4CC 1R5IA 5CZKA 5I1IL 4NUJB 2VZSA 1ZT4A 2D2OA 4YPGA 4IIQA 4HX1B 4GMTH 1ZVSB 1RFDL 4ZPTB 3VD5A 1N8ZA 1UVQB 3B5TA 5GRJH 4CVXB 2ZOKA 5HD8C 3V6BR 3DYOA 5E08H 5DUPH 1CD0A 5ALCH 5CP7B 2XZCL 3QO0B 1FHGA 1HSAB 5JO5B 3DWTA 3H7BB 4XRCB 4G6KH 5DTFB 3ZYJA 5C0CE 1MCWW 2P48B 4PJAE 4U3XA 3TN0A 3MGTB 5T3ZH 1S9WB 3FCTA 5D7SL 1D5XA 4JANB 2YPLA 5IHZA 1RZ7L 3BQUA 5HI3C 3DETC 3CFEB 3QWQB 3BFOA 2X1PA 1X6NA 2YD9A 1CD8A 5DJ0B 4NJAH 2LABA 4FG6C 2HKHH 5EFIB 5HHQA 1GGIH 1ZHBA 2H6PB 5BVPL 2W9EL 1NDGA 5KS9B 1NUFA 4M61A 1RZGB 3LS5L 3Q3GB 4I0PA 2HT2C 4CVZB 3UXFA 1F3RB 3ULUH 1YC8A 3CSYA 3SQOH 5E56A 3NFNA 4PB0H 5FUOH 5KSAD 3WO4C 1DP0A 5HHOA 5F1IB 3O8XC 25C8H 4NN5C 1IZJA 2JTDA 1OM3H 3ZDXF 4X6EB 4M6MH 4U1LA 4GS7C 5FGBA 1FVDB 1YEJL 2C9AA 2RCSL 1UYWH 4HD9A 2EDQA 2NR6C 1IAIM 4FXKB 3RA7L 1YEHL 5CJQL 4BKLB 4XP1L 2JJSA 4KKBC 4FNLH 3MJ8A 1HOCB 3TESA 3VE0A 3GEWB 3GSNL 1MRDH 2QR0A 2R23B 4NFCA 4UDTA 4TUKL 2H45A 2CLRB 1WCQA 3O9WC 1AHWA 4OAWA 3NZ8A 3QDGB 2DWEB 3BP4A 4PS4L 2YUXA 3QUXA 2DD8H 2FX9H 4JFXA 4TUOA 4W68A 3R06B 4RCAA 1BZ9A 2LTQB 4PD4K 2DM3A 3WUWA 4GBXC 4L3AA 3DXAA 5EU7E 2I27N 2XYCA 3GSVA 2BFVH 1F45A 4XVSL 4HBCL 4A6YA 4I18B 3RNQB 3FB5B 4G8FB 4C55A 5GS2H 1CQKA 4R4FH 1KYOJ 4RQQB 5BW7C 1AGEA 2OR9H 1KTKE 4MQSB 3I02B 3BH8A 4PP1D 4L3CB 2L7JA 3WFDL 5CHNB 1IM9D 2BCKA 4JFZL 3SE4C 2BOBB 3HZYB 3TH3T 5FO7B 2O5XH 4NNPH 4NWTH 5GRVK 2ZOLA 5L9DH 1BLNA 5FIEA 2QSCH 2W0FB 4LDLB 5T1DL 3N9GH 3SDXA 1UZ6F 1PGRB 3EDKA 4G6FD 4MLSA 4WGVB 35C8H 3MV7E 1N4XL 4HT1L 2B1HL 4LAQL 4F9LC 4RFNB 5F89B 5C0BD 2CLZB 3LSOB 4OCNC 5DQDH 3DX9A 3KNBA 4MDJA 2C4FT 5IHBA 5HHXH 3SDXE 1AKJA 2OMBA 4U1HB 2YC1A 4PJBA 1U8PA 4M5YH 1YEEH 3UTPD 1RZFH 5SWSB 1YMMA 1N2RB 2C1OB 1F4HA 5E6YA 2Y6SC 3QDHA 4ZOEA 1XGYL 3JWOH 5GRJL 1I8MB 5JXAH 3KYAA 4J3UA 4OF3A 4OI8A 5ADPL 4PJ7B 5EUOE 3LQZA 3RUGA 4U1IA 5JQ6H 3IDMB 4JVUA 5DEFB 4MJIE 3AGVA 3WIIH 3BAEH 3VGEA 1N6UA 1XH3B 3FFDB 5GIRA 1NEZA 1A6UL 3MLWL 1QVOB 1ORQA 4JY5H 1EHAA 5E2TL 1MNUH 5ACZA 1U8OA 2ARJB 4N1EA 1CDBA 1SMOA 4HWNA 3RVWD 3E6FB 2FLRT 3X13B 2AJSL 1DUZA 5EUOF 4BSVA 3VWJC 4NJAL 2A6KA 1FVEB 1FFOB 4WDIA 2JKXA 5HHVH 4LP5A 4AEHL 1QP1A 1EJOH 1N26A 4C56B 2EH8H 3UBXG 1P2CB 4MNGB 3U0PB 3W5MA 3FQTB 3IRPX 5EC2B 4PB0L 2F5BH 4N9GB 2VB5A 4NQCE 3RHWF 5ISZE 4EBQH 1ZT1B 5MENA 3OKDB 4WI5A 2MHAA 4MCYB 4YHOH 4PJHE 1VFBA 1TQCB 1JZ7A 4LLDB 2A73A 3PJSA 4GG6A 4JGMA 4WW2C 2E9BA 4XPGH 4ERSH 4XNMB 3TGXA 3OAYK 1N5AB 4TUKH 1RZIB 5C0AD 3X3GL 1MY7A 1X4YA 5T3XH 3HZKB 1MFEH 3VFMB 4G7VH 1FZOB 4XC1H 4YDKL 1IARB 4AIZB 3IF1A 2C5DC 3JTSA 3CFJA 3B8SA 3D9AH 2EDOA 1E28B 4UILL 4RDQF 1Z0MA 4O9HH 3VXTA 3HG1E 1FNGA 2ADIB 5I1DB 3O6KH 5EWIH 5JOPE 3NGBC 4PPTA 3CDFA 3B9KD 1IGIH 2CLVB 2P8PA 4KPHH 4XAWL 3IFNH 3MUHL 2IBZY 1KTDA 2MJWA 1WEJL 1ZGLB 5A2IH 4HS8L 2HJLA 2OL3A 3I2CH 4WENB 4UV4H 2E5EA 1XF4A 5ITBL 4P5TA 3EFDL 3WJJA 3RGVC 2BXYA 1C1EH 2FHBA 2VDRH 3MRKA 1V3LA 4QNPF 2DLFL 3DMMB 1RJLA 2W9LA 3MLZL 35C8L 3ULUE 4Z7VF 3T0ED 2OTWA 2R2EB 3C9NB 4KQ3L 4PJ9A 4PRIE 5IW3A 3H7LA 2CGRH 1G7JB 1YYLL 1U3HD 4G6AD 3L7EB 4MS8C 4TYUA 2QTEA 4KU1A 5SWQB 1RJYB 3STZB 4JFFA 2DLHA 1AFVH 4GW5B 1T3FB 5EBLB 3SBWA 1DLHA 1OT2A 3AMLA 1NEZG 3HE7B 1LEGB 4YHML 5TDOB 2CDEA 3G6AB 2LVCA 1ZAGA 3BPNB 1RZKL 4QRRD 3HPLB 2RFXB 3L1OL 5HY9A 4JO2H 1I8KB 4ZTOH 3VFOB 5HDBE 1FFRA 4XP6L 5FHBH 4TTDC 1W0WB 3QUYB 3M17B 5J12B 4IRSA 4KAQH 1H3TA 1S5IH 4MXWL 2AKRB 5I76A 4RNRB 4ESKA 4GRWE 3BZ4B 3X12B 4TRPL 3GB7B 4PJFA 4M93B 5C70A 1QBLL 1T0PB 4PJCA 5IF0A 3G6JA 3SGKC 2OMNA 4K8RD 5GZOC 4QGTA 3D1MC 4YPJA 5MERB 1L7IL 3ARBC 2DB8A 3KG5A 3QQ4B 3IDIA 4HWBA 1S9YB 1I3GH 3QNZA 3RVXD 1C7SA 3PGDA 3T1FB 1AXTH 4GRWF 4ETYA 1JYVA 4P4RB 2DQUL 1NMAH 4G5ZH 4M4RA 4TSAH 1FLTX 2OJEB 1OTTC 2ERJC 5DRNB 3H9SE 2O5ZL 1XFPA 5EO0A 3PL6B 4B7LA 4X6CE 3IKKA 4OZHE 4WCYL 4YHLH 5DJAB 3WLWD 1OAZL 4D9QE 2EIBA 4KI5D 3K4ZA 1IEAB 1ZSDB 1R24B 3DHMA 4JHWH 5TDPA 5FYKD 2FHCA 4HF5L 2WAHA 1UJ3C 4P23A 4BH7A 1DDHA 1LK2B 3O2DH 3LEVH 1XGTA 2V2XA 3NA9H 5M95B 3H9SA 5F1KC 3UTSB 1KPUB 4JQVC 4LCUB 2DQFA 5FGRA 4RA0C 2V2TA 2YWZA 4M1DH 4P59H 5EOQL 3T77B 3BH9A 4YZFE 2AABH 4ZUUA 1JTTA 3R0NA 2DS4A 5H2BB 2FJGB 5BV7L 4XTRD 1QO3B 5JHLL 1QRNB 4EIGB 4CMMA 2XTJD 1QQDB 1NPUA 1PAMA 2V17L 4M5ZL 3KJ6L 1E4XL 5IG7A 2D7QA 2YBRB 3BQUD 5JUEL 1QTYT 4G3YL 4ZAKB 1A9EA 2A74B 4PJDF 3CFDA 3NTCL 3GMNA 3RI5K 4NOBA 5J4MA 5JXEC 4ZXBB 1N0XL 3SDXF 4JFQA 1XIWD 1HK6A 1YEKL 1OAYH 4QHUA 1DQDH 2Z93A 4RGNE 4ZFFB 1SQ2N 5DRWA 3VG0L 2Z93B 5C08B 4R7NA 1OGTB 3EOTL 3L3KA 3BZFA 5LGJA 1HE7A 2YSSA 3FQXB 1SY6H 4LASH 4J3SA 2CXKA 4XWOD 5IESH 4ZDHB 3QG7H 3VJ6A 4NQSA 3M07A 3TO4C 5LGHL 2VR9A 5FGSA 4O02H 3I75A 4ORZC 3LY6A 2APVA 2XKNB 1G1YA 2HP4A 3QI9D 4GMTL 1CXFA 3VXSD 5E2VH 5C0EA 4I48A 3T0EB 5EORH 1NCTA 2DL9A 3C09C 3FN9A 3T77A 1G1CA 4DWHA 3BO8A 1T0MB 3RWHB 3RX7A 3CGTA 2F8VA 1QNZH 1KN2L 2E6PA 5FUZL 2R0LH 5ELIA 5FYJH 4WFGE 1ZANH 3UTSA 2FIKB 1L7IH 1G0XA 1OGAD 5ENWB 3K4AA 3TYGH 3O4LD 4KKCC 5C3LD 4Y89A 3U30B 1P1ZA 2R0WL 4PV9A 5CD5C 3GJEA 2AK4A 4ZG1A 4JO4H 1GL4B 3D2UA 5DRNA 1SYVB 4P23D 1J8HA 1CYGA 1NDMB 1R3HA 2NXYC 5EOCL 4WWKC 2P8LA 1I9IH 3FFCD 3WFHA 3EDEA 4YXLH 4F37K 1O5DT 5D7IF 5CS7A 1ZLVK 3GI9H 1OM3L 4X7TA 1ROWA 2FCBA 4HK0A 4HWUA 5D1XD 1MRFL 3TBWB 3C9NA 2NCMA 2PYFB 3UJTH 2Z31B 2IPKA 1KJMA 3LKQA 2NNAA 3PG2A 3ZTNH 3EYOB 1GGCL 2AXGA 1N7MH 2FX8L 4G6JL 3HCVB 2E27L 4PRHB 3L9RA 3INUL 2YUZA 3ZHDA 1NFIA 4UB0H 2UUDK 4GRMB 3UTZB 3SY0B 3ECBA 3OV6A 2NQCA 2CIIB 2Q7YB 2APWA 1WFNA 5BS0D 4MNQD 5CKAA 2WBJC 1BZ7B 2FWOB 1WVZA 3TLRA 2ORBH 4U1GB 4N0UA 4Q0XL 2OP4L 3DYMA 1DQLL 2M26A 4KWUA 3HI5L 2FH6A 3VXRE 1DBAH 4KJWC 1I7RB 1I7UA 1WJ3A 2XWBB 4XNMA 5HDLA 2R1YB 1EX0A 2AV1A 1P84K 3MLVL 1Y18B 2AJVH 4OZGA 1GIGH 2OX5A 5F9OH 1U9KA 2FO4B 1ZT1A 2YZ1A 3KWWB 5MENB 1N6QL 1FSKB 1RJLB 4OLZH 4LAQH 5TF0A 2A6IB 4ZD3L 3Q0HA 4KK9D 4LMQE 3LDBB 1QLRB 1MCQA 4OCXH 3EFFB 1CFNB 4AM0A 1RMFH 1BQSA 4RFEA 3OF6D 1RUML 3EJYC 4Y7MA 3SHSA 3P9MB 1KJVA 1K9TA 5KVEH 5I30L 3LKSB 4TQEH 3UTPE 3EO0A 4HWEH 1T5WB 4CDGC 5L2KA 2X10A 1LO2H 3OKLA 5DO2C 3G5VB 1MY5A 1RZ8B 3MRMB 5IW6B 2VLRD 4P48A 3LIZH 1TZIB 2XRAH 4ODUB 3C8HA 5J1AB 2X09A 2EIDA 3FZUD 1A4JB 3OKEB 4LRIC 1PLGH 1D5MA 3FB8B 3QDJA 4YX2H 5GRYA 3VFMA 4UDUB 5KSBE 5D1QC 3U79A 3GIVA 2R0WH 4QHNB 1FDLH 1PZUB 3LQZB 3RUGB 3SE8H 1DBJH 3TBVA 1ACZA 4RMSA 3QQ9C 1XF2A 5EO9A 2W60B 4BQ8A 4FQHA 4WY7H 1NBYB 1I3UA 3PJSB 4GAGL 4LLDA 4HS3A 3JV6A 3UCRA 5ILTH 1AKJB 3E3QE 2E9WA 1A7PH 4MX7A 5KSBA 4NQVB 4O5LL 1NFKA 3I85A 4LNRA 2HJKB 2QQLL 1PKQB 1P2CA 5FM5M 3KYKL 2HRLA 3VFTA 1EHLL 4K07A 3C8KB 2HTLD 1FFOA 5C0JB 1KBGL 2X4RA 2F74B 1IM3A 3NPSC 3VFRB 4PLKD 4XNXL 4JQIL 3TBTB 1F3JB 2E7LA 1C12B 1U8OB 2M8XA 5IB3B 4K3HA 3NOIA 4NJ9H 4O2FA 1Q9OB 4F57L 4L3CA 1XR8A 3SDCD 2QSTA 4XBGB 3VD7A 1QSVA 3WD5L 4OLVH 2F15A 2PO6D 5DEFA 1HILB 1UH2A 3ETBF 4RSVA 3TT3L 4R2GB 3DXAB 1YJDL 2FECI 1X5JA 1UENA 1D5IL 5C0DA 4F7MA 2KUTA 4OFDA 2DQCL 2P5WA 2AGJH 2GY5A 3OKKA 4O2FB 2JJVA 5DUBA 1AXSB 3LQAC 1I1FB 4RA3A 4FQLL 1U41A 2XI9A 3UO1L 4U1JB 4HC1H 4G9DA 1YN6B 4IRJC 3T8XB 3WHE1 5C0JA 1NCCH 3S34L 1OVZA 2CLZA 3LSOA 4NO3B 3C8KA 5EU6D 1VADA 3TV3L 3V5HB 4LHUD 4NO5B 3T4YB 1NC2D 2W0PA 4NYLB 3V52L 5IP4A 4JKKA 5TPWH 1RUKL 1BLNB 3WN5C 2D4DA 5L88H 3LD8C 4KTEH 1R6VA 3A6BH 3VW3H 3QHFH 1UEYA 1TJGL 5LQBH 3BP6A 4XXDA 5DO2D 1SEBB 4FQXC 3T2NL 3NBNA 1VFAB 1PX4A 4BFBD 2P8MB 5ID0B 5KVEL 2OR8A 4QRSB 4LDEB 3VXUB 3TBVB 3PWLA 4RQQA 5DJ0A 1M4KA 3QFDA 3OKNB 1FL3B 1A7QH 1E27B 5I1LA 3S36L 4ZTOL 3FB8A 2DF3A 5GRUL 5B4MD 3FO9B 4HFUL 1TDQA 3QQ3B 4JFOA 1LD9B 2IH1A 5DLMH 3OG4B 1E6JH 1PSKL 5FB8A 4UV7L 1FL5A 1QSEB 2APXA 3EYQC 1KIUA 2VE6A 4JZNB 1VGKA 3DECA 2V7NA 5GS0L 4XI5C 2JJSC 1I9RL 3T3PE 4NQXA 4OZ4A 3Q2CA 4QEGA 3ULVC 4GAGH 3F12B 3IJHB 1S7TB 2IPUG 2J6EH 4J4PA 1F5WA 1VHPA 5ERWB 4RBPK 3TZVC 1BFOA 1IQWH 1RJZB 3P0VL 4G6FB 4NQVA 4XXCC 5JORB 2FO4A 1TXKA 2BNUB 2GAZB 1A6TB 4S2SA 4XWGH 4WIQA 5DT1H 1C5DB 1W72B 4JFDE 5KS9A 2B1AH 3PWPD 5AYQA 2Y7QA 4M8VA 1IM9B 4FQJH 3GBNL 5I0DA 4KQ4L 1GOFA 3PHSA 3RAJL 3BDYH 2ZCHH 5HPMA 3MV7B 4X6FB 1D5ZB 4HH9B 4AEEA 5K9KB 1GC1H 4UDUA 3K3QA 5DA4A 1BD2B 1S3KH 1A64A 2Z8RA 4NJ9L 4H88L 3I6GA 3O6LH 2Z8VC 3U0TA 1MFDH 3RWJB 1HKLH 2A9MH 4L8SB 1TVBB 5D71H 1EFXD 4JHBA 2CIIA 3IDUA 2A2QT 1U58B 1FZKB 4P2RD 5EULV 4Y4KB 1BBJA 1Z9LA 1CGTA 1H8SA 1LVEA 1VDGA 4LP4A 2YEZB 3IGAB 3QEGH 2ZOKB 4JO3H 4DVRL 1P9MC 1EHXA 4LEOA 1IC5L 1ZVSA 1X5FA 2R0KH 4YHZH 3HCVA 5D96C 5E6IA 4GRWH 2AJZA 3CMGA 4J1UA 2G9HB 3VGDA 4HGWA 5E8DH 1CTOA 5I73B 5I1EH 3C08H 5LXGL 1MF2L 2CH8A 2LAAA 1PZ5A 4E41E 4YHYC 1S7UB 1J8HE 1GOHA 4TSCL 4M7ZB 4PRPB 4YWGH 1JGEB 3H9HB 4YFLI 1NBVH 1F13A 2VDLL 3MPCA 3JWDC 4PJEE 4TNVF 2IANB 3PWJA 3MRDA 1FORH 4YQXL 5EU4B 2B0SH 1T20B 4QOKB 4W4OC 5EOTA 2O5XL 3ILPB 1NQBA 5I1IH 4TVSa 4KXZH 4OFVA 2QQKH 2VTFA 1AQKL 1XZ0A 2WANA 4OZIE 1P1ZB 3SE9H 1A7QL 3IVKB 2OK0L 1NGXB 2BERA 4KROB 3IDJA 3ZT6A 3ARGB 5JIIA 5EU7C 5IEHB 5HI5C 1XIWB 5K9QI 4AT6A 3MXVL 4EOWL 3HNSH 2WW8A 1F6AB 3GSOA 1N5YH 3SKMA 3MRQB 4JFPB 3FT4A 2QL1A 4KJPD 5F93C 1YEEL 5T1LA 2BSSB 4AK1A 2EE6A 4QRQB 5EORL 1CXEA 1JI2A 2PYFA 3GRWH 1EBPA 4I48B 3MGOB 3TBWA 5FYKL 2EDYA 1O7SA 3UYOD 2YPKA 5ACLA 4PR5B 5J13C 1PX3A 4PJ5A 2BDNH 2OJZL 3MLWH 4H20L 3VJ6B 5H35B 2ZSVA 3TYGL 4ZPVB 4K71C 3FRUA 4DTGL 3NIGE 5IFJA 1F4XH 3QA3A 4ISVB 3QFJD 5KSUA 1TVHB 5HVFB 1OLLA 2FJHB 1LO0L 3VFWA 1RHHA 2RGSA 1I9IL 1L9MA 1OSZB 1WSST 1S78D 4NC2B 5I17B 3KPPA 3TCLB 2BVUA 5EU5A 2X9WA 2C3WA 2V7HB 5IWLC 1BAFH 5FYKE 3H9ZA 1T0MA 5GS1A 4HJGA 3BN9C 1YEDB 5DMGD 2CKBB 4KMTH 4D9QD 5DD0L 3E1F1 5EZOH 5CD5D 4FXGB 1QQDA 4KK6C 12E8H 1KCSL 3JWOC 1WFTA 3ZE1E 4GH7B 4R4BA 3MUJA 1QO3A 4KZDL 3W0WE 3O3AB 3TC9A 1X5ZA 3O0RH 3WXWL 2H26A 4N8PA 5I1AA 4PRNA 3SCMC 5IOPA 4GXUM 1KENH 4NNXB 4BUGA 1MVFA 1AD0B 2EO1A 4OB5L 1WTLA 3FFCB 3VFNB 1MEXH 1Q1JL 3BOVA 4HMEA 4OSUL 3WFBL 5D2NA 2PXYC 2YD6A 4DZBA 3HZMB 2RBLA 3DX6A 2WV3A 2FEEL 4ZFGH 3EAKA 4HS8H 1V7NH 4K7PX 2D4FA 3WNPA 3B2UC 5I71C 5IIEA 5FECB 1JN6A 3EIFA 1CD9B 2IALA 5IVOA 2VDPL 5F96H 1DBAL 2EE2A 4HKZB 4QT5B 2QQKL 2VDRL 2IFFL 2AJVL 1ZLWH 3HC0A 5IBLD 4RMWA 4Z7UB 5JW5B 4JFEE 1KFAL 3CFDB 5BZWA 3QNZB 4OLZL 3SEPA 2ADGA 2PYEE 1IVLA 1UB5A 1W8OA 3C6LC 3IRZA 4XXCA 2YKLH 1FO0H 4XPAH 4LCCC 2Y5EA 1JGDA 1KC5L 3BAEL 3HNSL 4CMMB 3RI5F 3T3PF 4ZYKB 1JHKH 3FT3A 3U7WH 3EO1A 2R2BA 5BVJA 1OD9A 4LOUC 5SWSD 3U6RB 1NC4D 2D7NA 4XT1C 2HT3C 3PWNA 1G7IA 5FYLH 1HXMB 2ADJB 3B5HA 5E9DA 2PTTA 4U6HA 5FYKH 2JCCF 3H9SB 3U46B 3LIZL 5JHDA 2BVYA 4XH2A 2WP3T 3K81A 3BGMA 4HIHB 3SOBL 4GAJH 3U4EB 1EJOL 1I1CA 2IPTH 4GQ9H 1JUFA 4YBLC 3DBXB 3WV0A 4PRID 1I8IB 1GJIA 1YY8B 4PGBA 1PEWA 2H2PC 3O2VH 2G75B 1LE5A 2HJFB 5GGRA 1VERA 1ADQA 2RAMA 5BRZE 4PJDB 2PXYD 5F7MC 3BE1L 1V7MH 4OTXL 3CVHB 4LCWD 1J0JA 4TRPH 1DBJL 3RWFA 1DLHB 2DQHH 2NY4B 1CGVA 3LV3A 5IVXA 2I9TB 3WSQL 4GXUN 5KVFH 1JZ5A 3QIUB 1OP5K 3MNWB 1U92A 5D6DC 4HUXB 1BX2A 3ZTJG 4PY7A 1PD6A 4XCCH 1T83A 5SX5K 3TH4T 5JA9A 1JV5A 2QV2A 2R2EA 2Z92B 5C0GA 3RU8H 2JF1A 3C5ZD 4UILH 1P53A 1WK0A 2DN7A 3KPRB 5EPMB 1MH5A 3MYZA 4LDOB 3HG1A 3LKPA 3MRJB 1XF4B 3B2UD 1SVCP 2IAMD 1NBQA 1Q0YH 4S1SH 4UAOC 3MNZA 3IDGB 4NQEB 5I19H 4K9EL 2J8UA 3RVXC 5F6HI 3BIKB 1MRDL 5BO1L 3MBXL 4JPKL 4LLYB 3MCLL 3G5ZB 4V2CB 3IDNA 4OV5A 2VLKA 1H0DA 4RGNB 4WEMB 5B3JE 5FK9B 4ZUVA 1PQZA 4HQQH 3W9DB 3QUZB 3QPXH 1J87A 2I25N 2Z35B 1A6ZB 1H15A 2ERJB 2CK0H 3MODL 5E7FA 1P4BH 2LFGA 4NWUH 2DLFH 4O51B 3PHOB 4LLVB 4MD4B 2EDNA 4Z18A 1JNLL 3TBSA 5L2KE 4XP5H 5I74C 4B41A 4GW4B 5L7XH 1LEGA 1FZOA 2FGWH 2WWKT 1WWWX 3WS6C 1GAFL 5ABDE 4KK6D 2A6DA 4JFZH 3ARSA 1G6RL 3QFJE 4LF3A 3TVMA 1CDIA 5B21A 2DTML 1XMWA 4JFDA 2ATKA 4ELMA 3N9GL 1F6FB 2R8SL 2WZPD 4EDXB 3WJLA 3BKCH 1B6UA 3UC0H 1JGVH 4OLEA 4V1DB 4N9GA 5DQ9A 1JNNL 4HV8B 3K2MC 4A6YL 4MNGA 5HYFA 3U0PA 2OL3L 3SE3A 5JLZA 1R3LA 4JRYE 1BFSA 3U7WL 4XCYA 5IV2A 4HULB 4I0CC 3EDFA 5C2BH 5HGHB 2NYYC 3GSWA 1F6LL 3B6SB 3FMGL 4L8CA 2HG5B 4WNQA 2JLLA 4QXUL 1JHTB 2Z8SA 2K7QA 4NQUA 2WUBH 5E95B 4DKAA 3L3GA 3MRBB 3S36H 4NKIH 3RY5A 4H0GA 4OFKA 2FL5B 5IROA 3TCXA 5HVHB 1S7WB 1NEZB 4YHPB 2EDJA 5EZLA 1OLZA 1XH3A 3FFDA 5GGVH 4PD4J 4P9MH 2HT4D 3LN4B 4NKOA 2Y23A 2GSIA 1NCWL 5FGBC 3VH8G 3PABA 4MHHI 2HAZA 3SJVB 5BMFH 3QULA 1N2RA 2C1OA 1HCFX 2A73B 2BJMH 1IKNA 1RK0A 3H3PH 3S35X 2IH3A 1MCRA 2YOCA 4L4VE 5DEGB 3S3SA 3BIKA 4FZ8H 4WHTB 1CL7I 2P5WE 4NQEA 4Y1AD 3KPQB 1XGPB 2EH8L 5IMKB 3TPKA 5DC9B 3C2AL 3DX9B 2VLJE 1W0VA 4V1DD 1LILA 4MQXD 2PO6C 3RL2B 3DSFL 5HYJE 1N59A 1T2QL 3VXRB 4EUPB 2YS4A 4FQQA 4PUBL 5FOBA 3BWAB 3QIWB 4RZCA 4HAFA 2ITDB 1MCOL 5I75C 4MLIA 4KMQA 3MLYH 2GIYA 1DUZB 1ED3A 2NY3B 4KK8C 4KQ4H 5GGVY 1GC1L 1CFSA 3BMWA 4EDWL 15C8L 5ACZB 4YLQT 4I3RL 3TA3B 3EYFA 5KVDH 1SJEA 4G7VL 4FQXD 5I1HH 5DK2A 1CGWA 5GIRB 4QHMA 5E70A 5J8OA 2NY0C 1MCPH 3DI3B 5F71A 3MRRA 3GK8H 4Y4KC 1TCRB 2W9DH 4U1IB 4M5ZH 3ZT7A 4HEME 2BVQA 4WEBL 3V9FA 1CU4H 3OAYH 3QDMB 2C3GA 4C4KT 3D48R 1CDCA 1HQRA 3BGMB 2GFBA 3FB6B 4PJ7F 4YH6A 4WTZG 4HCRA 4U6HB 1MWAA 2G2RA 4PJAA 3IS0X 2BVPB 3CK0H 2PN5A 4LSRH 4KTYA 1CVSC 4LSUL 5C0AA 3MLZH 2VQ1A 5JMRA 4IRJA 4AENA 1V3JA 4F33B 1DL7H 4MA3A 2K9UA 3EBAA 4MXQD 4PJ7E 5SX4I 3QG7L 1MCCA 4YWGL 1MHEB 1NGPH 5TE6L 1IEBB 4GRLA 1IKNC 2BC4B 1D5BA 5GHWL 5KAQG 3VRLF 1IGYB 4D3CH 4YHMH 4HKZA 4QT5A 5I66A 2IALB 3VXQB 5ESAA 2CQVA 4EI6A 3IS1X 4OCRL 4ZFOA 3LS4L 1Y6NR 4M7KL 5IHZB 5IB1B 2YPLB 1YNTB 4L4TA 1H3WM 1MAML 1HSBB 4OZFB 4F7EB 1VEMA 5F3BB 1I7TA 4D9LH 4KVNL 1NLBL 5T5FL 1IGCH 4B5EA 1QNZL 4NQTA 4KHXL 3O9WA 4YIQA 2HLFC 1G9EA 3I3EA 4YHIA 2VABA 4F9LA 1SJHB 5IFHH 3Q5TA 3VE0B 3LB6C 1OT1A 1UT9A 1WZLA 4Y4HB 3FQNB 4FFVC 4N8CL 2IG2L 2X4QB 3PQYA 5I30H 4WV1A 3RIAK 4FS0A 3SGDI 5HYQB 3C6LB 4JAMA 1GYAA 3R4DA 2G60H 3SE3C 1NKRA 4I18C 3VMOA 2XACC 4G8GD 4KHTH 4APQD 1ORSA 5KVGL 3MRIA 1JPSL 3X3FL 4K3JH 2BVOB 1B0RB 5IT2L 1IGYA 2QHLA 1YEDA 2EDLA 2XG4A 1D5BB 4TVPH 4MZ3A 1NDGB 4OFIA 3GO1L 1T2XA 4LU5H 1EUTA 1NUNB 4U6VH 3TNNB 3LH2H 1AXTL 5EBWB 5E03A 4R3SA 1LK3H 4MXVE 4ZMAT 1F8TH 2AK1L 4WI8A 4I1NB 4BZ1H 3BP7B 1G0DA 4UT7L 1T66C 2YUVA 4FFYH 1A0QH 3OQ3B 4BUHA 3V79C 4GKSA 15C8H 5IFAL 2WWMD 3LS5H 2WBKA 4IOFD 4CVWA 2VRAA 5DURD 3TN0B 2XA8H 4NO2B 4PJEA 3JTTA 1U8NB 3GJFK 4NP4H 5GJTH 5ACMA 1JPFA 5F9DC 3QAZB 5F7EL 5D1ZA 1OAKL 2RCSH 3GMPA 1ZGLM 4C56D 3LKOB 4JRWA 2Q3ZA 3P30L 3EYSL 1HIML 5E9DE 3VRJB 4CVXA 1VCAA 1DZBA 3REVB 1JWUA 4G42A 1TJIH 4PJ5B 5AZEH 3AVEA 5FAAA 4MGXA 1WF5A 2HKFH 1HI6B 4LIQH 3VFPB 4Y1AE 5MP6L 5BV7H 4F3FB 1CE6A 3F7QA 3GMQB 2MQ0A 2WINA 4MNQB 1MJ7H 2NR6D 1FN4B 3LAFA 4U1GC 3WO4B 4Q9QH 2VITA 3DGCR 4LSRL 3S9DB 1QYGH 1U95B 4Y16A 2XY1A 3OR7B 4ZUTA 4OKVA 1AC0A 1NKOA 5F3HA 3HE6C 4HBCH 5DHVB 3SJVE 1OARL 4RAHA 2UZXB 5DRZB 1K4DB 4JM2A 1QKZL 5ETUB 4PRIB 2EC8A 4Z7VB 5DMJB 1WUNT 4LLUA 1A7NH 1VPOL 1I1AA 1KELH 1ZS8B 3ABZA 1PY9A 4OLWL 3PF2A 5C09D 1OP9A 5KN5A 4R2GD 2VXSL 1RIVL 3U1SH 5L9DL 1XGPA 4PY8J 3ILPA 5EOTB 1RUMH 3O9WD 4WFHD 2XFXA 4PJHA 1JHLL 4WFEE 1NMCB 1BQHG 1EEQA 4LLWB 4XPBH 5EC1B 4CADB 2DMCA 5DQDL 2BOCA 1NUGA 1ZKAA 3LN5A 2HRPL 1RUAH 3MV9D 5C2UB 3E2HC 1XGRA 2KZ1B 3LN4A 4I9WD 5BOZG 4PLNC 3OR7A 1P7QD 1RZFL 2VITB 2GJZA 4LSTL 2W1NA 1S7WA 4YHPA 1C08A 4GXVL 4ZUSB 5HHOD 2A83B 4IDLA 3BPOB 3LVEA 5ADPH 4J1UB 4UQ3B 4OZHF 4Z95H 3DROB 3X11B 4MA7L 5KS9F 5I1GH 2ZUUA 5IJVA 5E1AB 4U49A 1PEZA 1U36A 3QAZC 4KJQC 5GRUH 2JJTA 2A38A 1FNAA 3P4OB 3GMPB 3SOBH 4IRSD 2GK0B 3LZFH 4WW2F 5DYOB 5M94B 1TVBA 3VFVB 5EIVA 4IS6B 1KLUB 4UV7H 4WI7A 2X42A 2WBJD 2BNQB 4W4OA 1OAUL 2HMIC 3NN8B 4UT7H 1BEYL 3TYFB 3ARUA 2W65B 3L3HB 3WFCH 2BSTB 1WWBX 3FRPG 5EOCH 4Z9KB 2KPNA 3IU3A 4OZHB 1AH1A 2NY2D 1RVFL 1EFXA 2FH8A 3QUMA 5HPMB 2V6HA 2HH0H 4JFFE 1IC7L 4JY4B 1F58L 1URLA 1CDYA 3S35H 3QP3A 3AY4C 5B39B 2J4WH 4OF7A 1A1OB 5HDQL 3CH1B 2PETA 4XCCL 4OGXH 4XVSH 5B22A 5JORA 3O4LA 2Z91B 2DMBA 1NCBH 4JFEA 5E94B 2H8PB 2ZCHL 4K9EH 1JWSB 4G9FD 5ERWA 5IMMA 3MBXH 4X5WA 2YMXH 1RAMA 3UTTB 1AP2A 3IJHA 2Z0BA 1BJ1H 2EH7L 3MO1B 1JFQH 3PQYB 1OCWL 4OZ4B 1FFPB 5DVMA 1IEHA 3EJYD 1K4CB 3F7VA 1WGOA 2X4SB 3RTQA 4LLYA 1QYGL 3MCG1 2JK5B 3LEYL 2CK0L 3MODH 5DFVC 4L8BA 2DKMA 1BQLL 4QTHB 3LKPB 5J9PA 3DRTA 1GH7A 3ZKQD 5IB2B 2Q76A 5EA0H 3AUVA 1J8KA 2EC9U 3V5DA 5AYUL 5CBAA 3G6JE 4F7EA 1G84A 1GAFH 4KMLB 3U30C 1VPOH 1BD2D 4GQPH 2VLRE 5DHXB 5I1LB 4PY7B 1BQUA 4TUJB 1XGQA 1BX2B 5LVEA 4L4TE 5A16A 2ZUXA 3CUPA 1FNEB 5ALBL 4XMKL 3AB0B 3IDYB 4LEXH 1KSRA 5J3HD 3PWLB 5C08D 3P0YH 4HJ0D 5EOCJ 2NW2A 3MA7A 4XNQA 3REWB 4ZS7H 4CU8A 2DTMH 4GRLB 2K7PA 1HNGA 4WU5A 4XXDB 2VXVH 1JGVL 2Y36H 1P7QA 4KVCL 3CVHA 1CFBA 2EDTA 2GK2A 1NEUA 3K74B 3RVTC 1N6QH 1NCUA 4ODSH 2D0HA 4XBPA 2E8YA 2VQ1B 3T4YA 5A1AA 5AEAA 2IFGA 2VDLH 3WFZA 1YNKH 3K8KA 1FYTD 3FJTA 4P5KB 5SWSE 1TLKA 4NQCA 5ISZA 3VXSE 4U1JA 2E7CA 5SWZD 3ZDZE 4R26L 3MLXL 1UJ3A 2ADJA 2Y9RT 5E9DB 4GAYB 3IDXH 3F6LA 1PJ9A 3S36X 2D0GA 5JIPA 4L8SC 3VGHA 4RFOH 3PP4H 3HR6A 1ETZA 1VB9A 5DSCB 4JB9H 4MNQE 5CSZB 5EN2B 1U2HA 2Q8AL 4IM8A 3Q1SH 5I8CB 5DK2B 3QDGD 3CMOL 5JW3H 1G7LA 3CXDH 4JRXA 4ZAKC 2FATH 4MD0A 4PG2A 2HVJA 4PREA 1BEYH 5TDNB 5TFSH 3EGSA 3WHXB 1NSNH 4OGAD 1T22A 3H3PL 4XVJH 4PJBE 1TQCC 4FZ8L 1ES0A 1JPTL 3FO1A 3QJFA 3TIEB 1NMBL 4H88H 3UAJD 1FO0A 3I6KB 4UIMB 2VIRA 1LE9A 1RURL 2N1KA 4QNPE 4LPTA 4P46A 1SBSL 4PJ9D 3DPBA 1M71B 1OAZH 3RTQB 2PYEB 4YO0A 2ZCKH 5I18H 1NBYA 4PJAF 5I0ZA 4Y8DC 5GSVB 1YYML 1FCGA 1RK1B 3SJVA 2R2CA 3QXWA 3VD3A 1VFUA 2C26A 5EBGA 4NRXB 3KJ4C 3EFDH 1ULVA 2W9DL 1T1WB 2GSIB 3NA9L 5KZCD 5MEQA 2VXTL 3DXAD 5KBNC 5D8JH 3MRFB 4PBXA 1V5JA 1BECA 4L3EA 2B8OT 3W39B 5I1EL 5I73C 2FECL 3K1DA 2VQUA 1MF2H 4ZUWA 1DE4B 3O2WH 4OQTA 4HS6B 4GKZB 2FL5A 1TZIA 1S8DA 3TN0C 1CLOL 1JGLH 1ZK9A 1UB6B 4CMHB 4FNLL 5E5RB 3G5VA 2QKIB 5MENE 1T80A 1EFXB 4LVHC 3KYNA 4GMSH 4X4MA 4HC1L 3MXWL 1YEFH 3LKSA 3O3EB 5EIQA 1EDQA 4PJIF 3QDGE 1CXLA 1KENL 2BSTA 3E8UL 3MJ9H 1UXWB 3BESR 3CLEL 1ZEAL 2J12B 2D03H 3FQRB 2BNQA 2P24B 1WBYA 3NH7L 3V6OA 3QA3B 4ISVA 5IFJB