2HT3D

Structure of the escherichia coli clc chloride channel y445l mutant and fab complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Synergism between halide binding and proton transport in a CLC-type exchanger
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3D01
1NMCC 3O6LH 4BQCA 1MCSA 3FRUA 4NO0B 4MAYD 2VZ3A 4L9LB 3D9AL 5I0ZA 1MLBB 3OHXB 1FL3A 4WIQA 1NUGA 2EDOA 4CU8A 2BY2A 1RIHL 4QNPE 1QG3A 2NXZD 4PRIB 1A4JA 2CUIA 5IESH 1AE6H 3SCMB 2FRGP 3QQ3A 4Z7VE 1WC7B 2DQCH 2F19H 3SDDB 3U2SB 5FGCE 1GZPA 5FYJD 1V3LA 1AO7B 1FIGL 4J3TA 3LH2H 4DN4H 4G8FB 5BVPL 3KLSA 1Q9OA 4X6FB 1KTKE 3PP3H 3E0GA 2R8SH 5EBLB 4JFFA 5SWZE 4X5XA 1RZIA 4OBRA 2ZCKL 3KPPA 3K2UL 4LPYA 4U1SA 1MCWW 4JCLA 2JCCB 3QYCA 3PWVB 3WN5C 3GSVB 4WY7L 4HEME 4O9HL 3DRQA 4M3KB 3C8KA 3O3DB 3R06B 5CS7A 3BP6B 3HCVA 3OKOA 4LARH 2EDDA 5CFHA 1NJ9B 3L6FB 2UUDH 5IT2L 1TZHA 4WI5A 2H6PA 4G9FE 3ZDZF 1G9NL 4RZCB 5JNYA 3ZYOA 5DEZA 3WS6A 1OAUL 4HS6B 4CL7A 5CEZL 3BP5A 3EOBA 1D9KA 3UEZA 5IB4B 3PQYB 4ETQA 1C5CH 1IL1B 1N6UA 3ULUC 4YJZL 2XN9B 4M5ZL 1VEMA 5CSBA 2EYSA 1OQXA 3KJ6L 5DHVA 2APVA 3LQZB 1ZT7B 4YO0B 4P4RB 3ROLB 3ZSSA 3FZUC 3VFTB 4RAUA 4CN4A 4HUUB 1B0WA 2VITB 4HKBA 4ZS7L 3MLSL 3NZHL 4GRWF 1NMBH 5A1AA 4OD2B 4H20L 4JDTL 1HH6B 3DX8A 5E0QA 3BVNB 2QQNH 4PP1D 5EU3A 5FYKE 1ZLUH 5HYSA 3T2QA 5D7IF 2EIDA 4K8RL 1T20B 3D5OF 5I74B 3D87B 3MRNA 1WZMA 5KG9A 4TPRL 4XTRC 3E6FB 1MCRA 1MFCL 2OP4H 3N1PC 1Z0MA 3BDBA 3V6OC 4IOSD 5FYJH 1JF1B 5IF0A 1GGBL 4OTXH 4NRYB 5FDWB 2IBZX 1U91B 5HHXH 3QEHA 1DUYA 1GVIA 2YUZA 3O6ML 2A38A 4C55A 4L3CB 4DZBB 3K81A 3IJHB 4OFYD 3QCVL 4HUWB 3TJHD 3B2UC 3H9HA 2PO6C 2YMXH 2E7HA 4OLYH 2VAJA 2BSTA 1SY6H 5DO2C 1UB6A 3FRUB 3NCJH 4X6CE 1AKJA 1IM9A 1QD0A 2YA1A 3AS1A 3O9WD 4L4TA 2MWCA 4TULL 3UYOD 2FH6A 2J8UB 1VHPA 2H2SC 1FL3B 2XG5A 4PJEA 4MDIA 5E6ID 2ZUTA 1IC4H 4F7PA 5D7JC 5KSAB 1IEBB 1MJJB 1BIIA 2M26A 1EHNA 2Z8VC 3QQ3B 1LDPH 3CX5J 3HE6D 3TLRA 4EZMA 1LP9E 3G6DH 5C08D 3WO4C 1DQMH 1GZPB 1YPZA 4J3SA 4NJAH 1Q1JH 5K9QG 1PG7W 1TJHH 5DUPL 1QBLH 3F12B 1Q9OB 3OF6A 3N50A 3HUJE 3L5XH 4OUUA 4JFFB 2DB8A 4X5XB 1RZIB 4JKLA 1TQBC 3GI9H 4LVEA 2A6IB 5C0RL 5SV3A 3X13A 4NUGL 1BEYH 3DRQB 1CLYL 2QHRL 3C8KB 3HCVB 3OKOB 4LIQH 2UV3A 3FHAA 4R4FH 4LPCA 3PL6A 5GS1A 4M6AA 1TZHB 4U6XA 2H6PB 3VWKA 3KG5A 5JNYB 1IVLA 5F3HB 1BHGA 4R4ND 5L8KB 5E9DA 1N0LA 2X41A 1KPVA 4ETQB 3MRLA 3FFDA 1U8IA 2F53A 5K59E 4WEMB 2EYSB 3TN0A 1S5HA 3JWOC 4G6FD 5DHVB 2HN7B 3KPNB 1BFTA 2ZCHH 3VD5A 3TF7C 2DI9A 5L2KD 5CAYB 4KDVA 3FL7A 3MRHA 3T08A 4RAUB 1F58L 4HZAA 1R3HA 2IBZY 3WIHH 1NCTA 2YPVL 1WBZA 1KTRL 5BO1L 2IPTH 4LL9A 5J4MA 2O5ZH 3JBG7 4WFHE 5TE7H 1C1EH 3DX8B 4JRYE 3QDAA 4AEHH 2PYEE 1J1XL 5HYSB 2XA8L 2YBRA 3V4VH 4YBLC 1OCWL 1CGSL 4P9HH 3MRNB 3QUKA 5KG9B 3CX5K 5D7KE 4U6VL 4GW4A 4MJ5B 3BMWA 3BP7A 5IF0B 3IRPX 1G7IA 1HHGB 3BKML 1RURH 3DOSA 4ZG1A 3P0GB 1T0PB 5J13C 1ZTXL 3IAGC 3MXWH 2LU3A 4PYGA 4LAQH 5FGBC 1NGWA 4XVTH 2RR3A 1I7TB 3UTOA 1AGFA 3GSQA 4XCEA 1D6VH 4GW1B 4QRRB 1EVUA 3RWEB 2FYYA 4NO3A 5C0EB 3RHWF 1T5XB 2V5TA 3H9HB 4OLXL 4RGNC 4PLKD 4X7DC 1UWXK 2A0LC 4GG6A 1UB6B 4JPIB 1ITCA 2F15A 1IM9B 3L9RB 2VDOL 4IRJB 3VGAC 5FYJU 4WCYL 4AK1A 4WUUE 1P4BH 2UVFA 2VR4A 5EOTA 1FIEA 1MHPH 4K3JL 4PJEB 1Z2KA 3ARTA 5FOBA 2RFXA 4F7PB 2AKRA 1ZT1A 1BIIB 4YAQA 4G42A 5JOEA 1DLFL 3GMRA 1IAIH 1DQQA 4HDIA 3EHBD 5E8EA 5HGAA 3TH4T 5IQ9A 1P4LA 1WBXB 5F7WC 3V0WL 2BDNL 4XI5C 2AK4D 1ACYH 1UKTA 3WYRA 4OGXL 4LASL 2FX9H 3S36L 1KEMH 3TZVC 4F3FA 1EMTL 4N0FA 1OOAA 1N3NA 4DKFH 4OUUB 2A9MH 2W65A 2HFGL 3O4OC 3MLUH 1WZ1L 1W72L 4M93C 2BXYA 4R7DA 1T22A 4KDTC 2V17H 1JUFA 4KTYA 3X13B 4JCMA 4QXTA 3ZT6A 2OLDA 1HYSC 1LO4H 4P2OC 3PJSB 1WFTA 4PLOB 3O11A 3PP4H 1X5AA 4ONGH 4Y19D 5GS1B 3UDWA 3QDGE 4LCYA 4U6XB 3C60C 3ULVL 4GFTB 4OCYL 4YHZL 3VWKB 3QFJE 3ECBA 3IDJA 1T1XB 3D2UB 1L6ZA 2Z4QB 3QQ4A 4NM8L 2C1OA 5DD3L 4Z0XA 1A6PA 3ZSTA 1D7FA 5E9DB 4A6YH 1VACA 1XGUA 2P49B 4TVPE 1KPVB 3MRLB 4M1GL 3IFNH 3FFDB 5I8KH 1U8IB 2NR6D 2F53B 4G6AD 4NQDE 3LAFA 3TN0B 2QEJA 3GSNL 1SYVA 1ODAA 3N9GH 3WFEL 3O6FA 5FUOH 1AI1L 2IANA 1T6VN 3G5XB 3MRHB 2GJZA 5C7XH 1E4XI 2PETA 1WBZB 5HYJD 4OZFA 2AJXH 2R23A 3JVGC 1QFWL 2D31A 4WW2F 2G9HA 1OARL 4LSQL 1YY8A 3GJEA 3TO4C 1SEBB 2C5DC 4PJGF 5E2VH 2YBRB 1EBAA 4NKQB 5H8DA 1FAIH 3HE7D 3OZ9L 1A5FH 3QUKB 3C2AL 1JZ8A 3T0EA 2J5LB 4GW4B 4JN2A 4OJFH 4QXGL 1IGFL 1W0VA 3BPNC 4B7IA 2FSEA 2ZUSA 4DJMA 1ES0A 1HKFA 3S34H 4CDHA 2VAAA 4LGRB 4LLDA 1AGFB 4OFIA 4GMSH 4RAHA 4XCEB 1YC8A 3MOBL 1YEJL 5IVXA 1WF5A 1UADC 3E2HB 5KVEH 2FYYB 4NO3B 1SQ2N 5JA9A 3PE9A 4GAGH 1IAIM 3MA9H 1SM3H 2EEDA 4ONOA 1F4AA 4M6OL 2VXSH 5EZOL 4L8CA 3KJ4B 2VDLH 4GG6B 3EYVA 3RWCB 5ESQB 2X09A 3STBA 1OD9A 1IGYA 3WO3B 2GHWB 4PLJD 4OZGF 4IOIA 5EOTB 3O2DH 2R9HC 1MCHA 4JFYA 5EBMA 2RFXB 5FOBB 2JTDA 2AKRB 3QIBA 1ZT1B 3S36X 4G42B 4N0RA 3GMRB 2HFTA 4WI3A 3QDJE 2EDXA 1DQQB 4HDIB 4CN6A 5IQ9B 3V5KA 3LN9A 2R15A 2W9EL 1P4LB 2D7TL 3BPLC 5D1ZD 5HHMD 4WHDA 1FN4A 4TVSa 3GHEL 5CJBA 1UB5A 3QHFL 1HQ4A 1MJ8H 2Z92A 4F3FB 4N0FB 1CT8A 1N3NB 3RY6A 1WAAE 4OZIF 1QVOA 2W65B 4FQXD 1H3PL 4PGCA 3U9PH 4UDUA 1JRHL 3HI1A 4R7DB 1T22B 4PJBE 4PUBH 3TYFA 1JUFB 2KZWA 4G8GA 3ARGA 1BJ8A 1TIUA 2F54D 4I0CC 3CXDL 4NPYA 4ODWB 4Z7VB 2FLBT 4XVSL 4P3CH 3GMNA 2Q8AL 2Y07H 5C09A 3O11B 5GRYA 5C3TA 5LKNA 1U42A 1FO0H 3B3IA 4LCYB 5FO7B 3HB3C 2B2XH 3ECBB 3IDJB 1QA9A 3QQ4B 3PNWA 4M7ZC 4WI4A 1J8HD 5DT1H 4J3WA 2VXTL 4HH9A 4M6ML 4ZO8A 3DV4A 5ICXA 3FMGH 1N6VA 1FYTD 3SE8L 1XF2A 2ZUQB 5J8OA 5TE4L 4ELME 2BOCB 4NCC1 4ZS6D 5KS9F 3MLWH 1UYWL 3O6FB 4UDTA 4HW6A 4F7TA 2IANB 1EUTA 2QKIB 3QWQB 1AHWA 4MJIE 4M6NH 2BVTA 1Q0YL 3DO3A 5DD0H 2WW8A 3AS0A 4OZFB 3L3KA 2R23B 2ENSA 2VSDA 2G9HB 2VKWA 5AYUL 5DD5L 1YY8B 2CXGA 3RGHA 3GJEB 5BS0E 3FO0H 3V6FA 4QHKI 2APXA 3ESUF 4LFHD 1ADQH 3ULUL 1QSEE 4XC1L 3DHJA 3GJFB 2IQAA 1VFOA 4MNHB 4JHAH 1QSFD 3DX9A 5MP6H 1U3ZA 3A6BL 4JN2B 1W0VB 1MWAA 2OZ4H 4ZUWA 1HZHL 1GL4B 1A7PL 2FSEB 4J1UA 3MBXH 1ES0B 3U7YL 2YPLE 4NQVA 1QSVA 2VAAB 1MCLA 2HFEA 4KC3B 1PAMA 4JFZH 4M43H 2DYPA 5GJSH 3UJIL 3CFDB 1WISA 5IVXB 2E27H 4NBXB 2K7PA 1NAML 1GH7A 1FRGH 1OLLA 4XB8A 1PW3A 1UM5H 2EE3A 3QDME 1EGJL 4L8CB 2G75A 2XTJD 3SQBA 1T0MA 3ARDD 3EYVB 3RDTA 5CINL 3ILQC 5F89B 1IGYB 5FECA 2YRPA 3QQ9C 4DN3L 4IOIB 2EIEA 4KI5C 4JFYB 3QIBB 3DYMA 1KELH 1CFTA 3VGEA 4Y7MA 4UB0L 5EN2A 2ADGA 1V7ML 2QR0A 3V5KB 5IK3B 1T66D 3LRGA 4BJLA 3T3PF 3ARPA 4UINH 2NY5H 1FN4B 2FWOA 3HG1A 3MA7A 1UB5B 5DSCA 1HQ4B 4OB5L 4LSPH 6CGTA 4K9EC 1HN1A 5CEZD 2Z92B 4N0YL 5DFTA 4JQVA 4S2SB 3HC3L 1QVOB 2PR4H 3ZYZA 3QUYD 4KQ4L 5GGSY 4UDUB 5D7IA 2Y36H 3TYFB 1I3VA 1YEHL 3IJSA 5DHXB 1G9MC 4PV8B 5EO9A 4G8GB 2HWZH 3ARGB 5IHUH 1L0YA 5HHOE 5I6XB 1LP9B 3P4LA 3GMNB 4Z7QE 4LLVA 5C09B 3I84A 4XNZB 5B4MD 1AGBA 1VEOA 4FABL 2I24N 3B3IB 4LHUD 2MKLC 3AB0B 3TT1L 3HKFA 1I7UA 4Z7WF 1QFHA 3RJDA 1CTOA 2D3VA 3ARXA 1CFNA 1QA9B 3U82B 1OGTA 2KL6A 3PNWB 1I1AA 4G43A 2VDKH 2E7CA 2J6EL 5DK2A 3JUYA 3WUWG 1I1CA 1QYGL 3EOAB 4K8RD 1GC1C 2IALA 5ICXB 1RIHH 2JIXA 5D8JL 5HYEA 3H42L 4WFGE 4JRXA 4Y5YA 3Q6GL 3ARBA 4ZAKD 1XF2B 4NFCA 5B3JF 5IW6A 2G5BA 3MYJB 3OAYK 4L8DA 2K3TA 4UDTB 4F7TB 3IKKA 1FIGH 1UH4A 3IU4L 1AHWB 1VDGA 3MRIA 1RZGA 3BEVA 5BVPH 1L9NA 5IFHL 4DOHB 3LIZL 5H35A 3T09A 3L3KB 4NC1E 1RUKL 2NNAA 2IAMA 3IT8D 3A0OA 3SDAD 4MXVF 2ZCKH 3NAAL 1KFAL 3K2UH 2VJXA 3D85D 3QO1A 5FYJE 3Q48A 3DMMD 4MZ3A 1JZ5A 1QHOA 3MV9A 4GW5A 1KNOB 5KSUA 3V6FB 4PS4L 2RBLA 4WY7H 2EH7L 3EYSL 2IQAB 1N6QL 5INDA 3JWOL 4Y2DA 1RJCA 3DX9B 5IT2H 4QRPA 4KK8D 5I1HH 1MWAB 4ZUWB 4NQED 1G9NH 5CEYA 5TDNB 3MSPA 4J1UB 5FM5O 1OAUH 2VC2L 3R1GL 4HKZA 3RWJA 2A9NL 5CEZH 2R4RL 2HFEB 1A1MA 1TTFA 2HVKA 4JRYB 2DYPB 3DURA 3UCRA 2VWEC 1Z9LA 4UNTA 2EDTA 4M5ZH 4PJ8A 2SEBA 3BIKA 5D1QD 1BD2E 1OTTC 2ERJB 3KJ6H 4CADB 3VI4F 2QV2A 2FEDC 1T0MB 1FNLA 4YHPA 2LVCA 3RDTB 3U36A 4ZS7H 3MLSH 4IRJC 3NZHH 4IEFB 4KWUA 5FECB 5F1KC 1A3RL 4Q58C 1CXFA 4FFVC 4H20H 4JDTH 4J4PA 1HSAB 1CFTB 1KYOK 2PXYD 3TP4A 3IAQA 4K8RH 5EN2B 1X5XA 2AEPL 1F4WH 2QR0B 1FNEA 2NW3A 1AFVL 4LEXL 4TPRH 4KK6C 3BISA 1L7TL 1MFCH 3HAEH 2J12B 5DMKA 1AP2A 2I9LA 3QEGL 2FWOB 4GRWB 1UCTA 1GGBH 4NDMB 4I3SL 5DSCB 3UTTE 3V6BR 2E8YA 1ZAGA 2YXMA 1GSMA 2C3XA 4JLRB 1IAMA 4WUUB 4ODVH 4PG9A 1FH5L 1TZIA 4MNGE 4TSAL 5D7IB 5EO9B 3IJSB 4F9PA 3W5MA 2X44D 3DJ9A 3O6MH 5BV7L 1SEQH 4Z7UE 5CZXD 3QCVH 2X9YA 3QUZA 5CBAB 4KJPD 1AGBB 3V0AC 3KPOA 4LVNB 4WI6A 1Q38A 3QIWC 1A7BA 2Y5TB 2FGZA 1CFNB 1CBVL 3LKSA 1OGTB 1E4XL 5D2NE 3CVHL 1I1AB 2ARJA 4JHWL 4R0LA 4G43B 4ZUVA 3V95A 2IALB 1JFQL 3T1FA 3QJFA 3LOWA 4JRXB 2DS4A 4Y5YB 1BVKA 1FJ1A 3DUUA 4OCLC 4JY4A 4F37K 5FO8A 2WBJB 5IW6B 4L8DB 4LPTA 2PCPA 3C5ZD 3L5WA 1FSKC 5GZNC 2EYTA 4HAFA 2DQTH 3MRIB 5I15L 1RZGB 1DTUA 3B5GA 3QFJB 3MLVH 3HMWL 4ALAL 5DUPH 3NH7L 1CS6A 5H35B 5FA4A 5JUEL 2NNAB 4L3EA 1RK1A 2J4WH 2IAMB 3B9KA 4P48A 3QO1B 4GRLC 5C0RH 2VERN 1JE6A 3PWUB 1ZE3C 1ZLWH 4GW5B 1WWCA 5KSUB 3ARFC 1ZT4A 1KIUA 4NUGH 5E5UB 3AS2A 4NQDB 3P77A 2X10A 1CLYH 4XCNA 2QHRH 3JV0A 3KS0H 5INDB 2EYRB 4Y2DB 5EUOF 1DBKL 1BF8A 3HTLX 3DUSB 1QBML 4QRPB 5CEYB 4AG4L 5HD8C 4O2EB 4PJ9D 5DJ0A 3IJYB 3SKJL 5HDQH 4OLUL 4HKZB 3RWGA 3RWJB 2HH0L 4UV4L 4P59H 2HVKB 3LPWA 5E7BA 5C0BD 3DURB 3L3HA 3IDYB 2F74A 2NY0C 5J11C 1MCJA 3RUGE 4PJ8B 2SEBB 3BIKB 4J3VA 1HXMA 2PNDA 3FONB 1MFDL 4JKPL 5A2LH 4YHPB 2YD3A 4APQB 5JORA 1F58H 1P9MC 3CC5B 3EYQD 4LNVA 4CVZA 1CXKA 3U36B 2YPVH 3KVQA 5BO1H 4LFHG 3TA3D 3UPCA 3RY4A 4HCRL 3EOYG 1J8KA 4UI2A 3KYKL 3HR5A 2AVGA 4M62L 3D0VA 2XA8H 4DUXA 3D69A 1OCWH 1CGSH 1FNEB 1NGXA 1I8MA 5EIQA 4HD9A 4D94A 4IMKC 4U6VH 3ULVD 3TESA 1ZSDA 5DJ2A 5DMKB 1A7QL 1AP2B 2I9LB 4YR6B 2JKXA 4AEIL 2YRLA 5C86A 3NIDF 4WW2A 4I0PA 1MPAL 2NY4C 5DVKA 4PJGA 1ZTXH 3VXMD 4PG9B 1TZIB 1AQDB 3OBAA 4KROD 4OF3A 3EOTL 1PKQE 5EU6E 3GMQA 3RQ3A 5K93A 1T04A 5E8NA 3MGTA 2VZTA 3RKPA 2E5EA 4E41D 3QUZB 4OLXH 2VH5L 4C56E 1MRCL 4HUXA 5B39G 4Z7NF 3K4DA 3S35X 3CXHJ 3D39A 2MCG1 3ABZA 2VDOH 3UO1L 4X6BA 3VW3L 4WCYH 2CDEA 3WIFA 2X4UA 2ARJB 3KYMB 1QOKA 4R0LB 4ZUVB 2DN7A 4I5BA 4PJBB 4K3JH 1TJIL 2HFFA 1MCPL 3T1FB 4LSUL 3QJFB 5MENA 2D7NA 4N1CA 3OAZH 3KWWB 3DUUB 3WNLA 4JY4B 5FO8B 4H88L 3MRFA 5F3BA 3K8KA 4F8QA 2CSPA 3L5WB 3V0WH 2BDNH 2EYTB 4OGXH 3L95B 3S36H 1FFNB 4OZGA 1X5GA 5FA4B 1EMTH 2YD6A 4P4KC 4L3EB 1RK1B 3E3QC 2HFGH 1TVHA 3B9KB 1WZ1H 1W72H 3WXWL 1NCDL 2JK5B 4WTXA 4GS7B 4YIQB 2O5YH 4LHUG 5TJWK 2VLLB 5BXFA 2P8PA 4MAYA 1I7RA 3P77B 2FHBA 4XCNB 3KPMA 4L8SC 4X98B 1XEDA 1EHAA 1CDYA 4NHCL 1U8MA 3V2AR 3K3QA 3ULVH 4N0UA 3O8XA 2VLKD 4OCYH 4YHZH 4URTB 4WWKD 4HWNA 1CLZL 2EXWD 5DJ0B 5C9JA 4NM8H 4GOSA 3RWGB 4HLZH 1CGWA 4L4JA 1KCVL 5DD3H 2VLRD 2FHFA 3HAEG 3BN9C 5BS0B 3L3HB 4M1GH 4Y19E 4F2MA 2Q3ZA 4JM4L 2UWEF 1H5BC 1OL0A 1FFQA 1S7WB 2P24A 4Y16C 5SX4I 3GSNH 1VGKA 1HXMB 5ABDE 4W4NA 3JTTA 4ZO6A 3WFEH 1AI1H 2ESVD 4L9DA 1A21A 4CVZB 3KPLA 5F7KC 1UVQA 3CXHK 4AL8L 4AH2B 2DQDH 2YPLB 1QFWH 1OARH 1SY6A 4LSQH 3HR5B 1ROWA 1MVFA 5KS9A 4LLUA 3MLTA 4TSBL 5GRJL 1S8DA 3OZ9H 3I9GL 1LEKA 4HHAB 1ZSDB 1INDL 4AEEA 5DJ2B 4CVXB 1B6UA 1KB9J 3WE6A 3EZJB 3O45A 4QXGH 1IGFH 3UTSE 5I76A 1I85C 3L3DB 2NY2C 3RNQA 1J1PL 1KLUA 2JF1A 4I0PB 5E8DL 2FJHA 1ONQA 2X4QA 4PJGB 3VFMA 3T0VA 4ODBD 3VG0L 3GMQB 3I6LD 3MOBH 1T04B 1YEJH 5GGRA 3MGTB 4GAYB 1BIHA 4HWZA 4ENEC 3STLA 3L1OL 1UJ3C 4HUXB 5EZOH 4M6OH 4JFED 4KPHL 1ZGLM 3HRZA 2QSTA 3D39B 4X6EA 2IFGA 2FX8L 1IEAA 4HUMB 4X6BB 4JFOA 5IWLC 3WIFB 4K9EL 2P5EE 4P2RD 5F1IB 5F9WC 4B50A 5JHLL 1LHZA 4I5BB 9CGTA 2HFFB 5IROA 5D6DC 3ULUD 3UTQA 2C3HA 3H9SA 3W11C 1G9ML 3WUZA 3NFSH 4QTIL 4LCCC 1T7XA 5K33A 3MRFB 1IKNA 3CAFA 4W68A 2W9EH 2ICWJ 2MNUA 2D7TH 1CIUA 1FGNL 4EKXA 3FZUD 3GHEH 2XICA 3QHFH 3RP1A 5ACZA 4M02A 3BGAA 4OZGB 3RL1A 2D03L 1YEKL 1TVDA 1WCBA 4OFYA 2JJTC 2LTQC 1H3PH 4OIBA 2Q3AA 1JRHH 3O3BA 1NBZA 5D72L 5ID1B 4QOKE 2VXUL 4I48A 2PW1A 4LVHC 3WIHA 3CXDH 1T4KB 1GC1L 1A6ZA 4LEOA 5I9QB 2P8PB 4ISVA 4MAYB 4PRBA 1S9VA 4XVSH 2Q8AH 2ZUXA 3VG9B 4M48L 3KPMB 3O9WA 4NC2B 4XTRD 3ESVF 1J1OL 4GXUM 3TYGL 1NGQL 1U8MB 3SDXF 4N0UB 3GSUA 5IMKB 1KB9K 3TBWA 5L7XL 2NXZB 2F9BT 1INEL 5C9JB 3KNBB 4PJFF 3HE6A 4O4YL 1P7HL 3EFFA 1DDHB 3ES6A 5C08A 2VXTH 1QFWM 4M6MH 3G5ZB 4F2MB 3G6JE 3PG2A 3AS3A 2P24B 3SE8H 4PJ5A 5TE4H 4ORZC 3ZYIA 2ICWA 3AREA 1UYWH 1CK0L 4KDWA 1I9EA 4HQQL 1ZANH 4Z7WA 1NDMB 1QP1A 2VNCA 1I1RA 2LE9A 3SE3A 5DO2D 1WEJL 1OW0C 1Q0YH 3KPLB 3BO8B 2OI9B 5IVZA 2RCSH 1OSPL 3EO0A 2H2SD 5AYUH 3MJ7A 5DD5H 5TDOA 3RZCC 1ZS8A 5D7JD 4QLRA 4JM2C 5L2JA 3BW9A 3MLTB 4X80H 3NIGE 1T1YA 3ULUH 4XC1H 4NNPH 1LEKB 4CRPA 1BFOA 3VFGL 1A3QA 3A6BH 2A77L 3WE6B 4MA7H 4DCQA 2Q1EA 5I76B 1HZHH 3RNQB 3MRKA 5JTWA 3Q6FA 1KLUB 4LCWD 1HH9A 1U92A 2FJHB 1ONQB 2X4QB 2RGSA 1NCNA 3OB8A 5CP3A 3VFMB 2YWYA 4G6KL 3C08L 2FO4A 2R39A 5L2KA 1YA5A 3UJIH 5MEOA 2BNRE 4ZO7A 4U1LB 5TPWL 3FN0L 4PBXA 4FFZL 1NAMH 4LLAA 2ZUUA 3STLB 4PJDF 5HGDA 4PTUA 1JGDA 1EGJH 3FT2A 4HKJA 3SDYL 3AY4C 1ZXQA 3UJJL 1X6NA 2DMCA 4X6EB 2EDEA 4KHTL 5CINH 1S7RB 1YMMD 1IEAB 3FTGA 2DIAA 2NTFA 1JGUL 1IC7L 1IT9L 4JFOB 1YNLL 4JVWA 4S1RL 4MNGB 4UT9L 4DN3H 4MS8C 3INUL 3PWPE 3GMLA 1H3VA 3UTQB 4PGDA 5D96B 2DMBA 4Z9KB 3F5WA 4UB0H 4HLZG 4EN3C 1V7MH 5SWSA 4P23C 5E08L 4OCNC 4A6YA 1IZJA 3BKCL 4WEUD 4A2LA 1IFHL 5EZLA 5JPMB 4HFWA 4OB5H 5T1KD 5ACZB 4N0YH 3UBXI 1YEDA 4RQQA 3HC3H 3L5IA 3B5TA 1JNHA 3VRIA 4KQ4H 2VLJD 4KGJA 3O3BB 1YEHH 3FO2B 1G7PA 2DM4A 4U33A 4RBPH 5ERWA 1A6ZB 4LEOB 4ISVB 4PRBB 4QHNA 1MIML 1S9VB 5CEZE 3NPZB 3O9WB 4N9OB 3DTXA 3VFRA 4FABH 5F1SA 5E6IB 3TT1H 2C9AA 3GSUB 2YRZA 4I3RL 1E27A 1JK8A 3TBWB 1Z9MA 1HE7A 3HE6B 4ZTPL 3EFFB 3AMKA 3ES6B 5EU5B 4JPVL 2J6EH 5C08B 3WUWA 3OKLB 3S5LG 1QLRA 1QYGH 1NUNB 5D8JH 3RY5A 4TTGA 2AK4A 3H42H 5IB3A 3S6CA 4HFUH 2BVQA 4XRCB 1LEIB 4LGSB 4PJ5B 2ICWB 4HK3N 1FAKT 2R4SL 4RGND 4Y4FC 2Q6WA 3C6LC 1GZQA 2A0LD 1P69B 3IU4H 3MJ6A 4I18A 4DKEL 2VKXA 5IFHH 2Z91A 3LIZH 1Q9KB 1RUKH 1FCCA 3TBTA 3O41A 1T1ZA 3EO0B 2CDFB 3MJ7B 1KFAH 3NAAH 5TDOB 2F8XC 1ZS8B 5LWYL 4BSJA 3I3DA 4PS4H 5L2JB 3CX2A 2EH7H 1T1YB 1U8NA 3EYSH 1N6QH 3SJVE 3CFIC 2E8ZA 1BFOB 3JWOH 4XI5D 4K7FA 4DCQB 1KENH 2BOBA 4KRNA 3MRKB 3Q6FB 2VC2H 1HH9B 1U92B 3R1GH 3BT2L 2A9NH 4IMLA 2R4RH 3N06B 3D6GA 4G6FB 3V7AG 2YD2A 2X70B 4JG1L 2FO4B 4NYLA 5L2KB 5HYQA 4R3SA 5MEOB 2P45B 3VXUE 3ULVF 1AIFA 4NQEE 3OKDA 4F15B 1HYSD 5EUOA 5HYJA 5HGDB 4PTUB 1JGDB 1WZLA 4Z6AT 1PKOA 4HKJB 3W39A 3C60D 4MNQA 2D7OA 1KV3A 3BQUC 2NTFB 2AI0L 1OY3B 2VYRE 3HE7A 3WBDA 1FO0A 3G5YB 5FEBA 4BH7A 1PKQB 1M05A 1UWGL 3GMLB 2VQTA 3LKOA 1TMCB 5SX5K 4U2YA 4PGDB 4P2QE 3F5WB 1YJDC 2AEPH 1ZLSL 3JWDC 1AFVH 2R2CA 3AC0A 4LEXH 4A6YB 1G7HA 5KVFL 1L7TH 1FL6A 3QEGH 5EZLB 2IJ0C 2WQ8A 4I3SH 1A4KA 1KSRA 4FTVA 4P5TC 1YEDB 4RQQB 4PGJA 1ZK9A 1JNHB 1FC2D 2EDQA 4TSAH 1FH5H 4IJ3B 2C3VA 1G7PB 1MNUL 2FECL 3H0TB 1F90L 5ECJE 2DLEA 4NZUL 5ERWB 4YUEL 2FZ3A 4QHNB 4N5EC 2E9JA 4RMTA 5CJXC 1OT2A 4OAWB 4WW1A 3UTZA 5ISZE 1NC4D 3V4PL 1E27B 1JK8B 4DUVA 1FZJB 2WLZA 1CBVH 3BI9X 3VWJC 5CBEB 1E4XH 3CVHH 4JFHD 1VESA 2H32A 3HNTL 4JHWH 3EJZC 5I1DA 2HP4A 4K23L 3WUWB 4OLZL 5D5ME 1QLRB 5GZOC 2Q7YB 2OZ4A 5IMLA 1JFQH 3F7YA 3S35H 3S96A 2AK4B 5IB3B 2RHEA 4IDLA 5HHPA 4UMGA 4G9DA 2R0LL 4E42A 1KN4L 2Q6WB 4FQXA 1YDPA 4MCYA 1S7VA 4FZ8L 4Z7OF 4I18B 3SO3B 4ALAH 3HMWH 3MBEC 1BX2A 1NPUA 2F54A 3NH7H 5JUEH 1CI5A 1IQWL 4X83A 3O41B 1T1ZB 5D1XC 2E6QA 3VFUA 1MFNA 2R9HD 4WNQB 4HIHA 1RZ7L 1XR8A 4Y19B 3DX7A 5FYKL 1A7RL 1CL7L 1DBJL 1U8NB 1CXHA 1FC1A 4O51A 1J8HA 4YWGL 1NGYA 1DBKH 2LFGA 4Q74A 1A0QL 1QBMH 3ZKQD 5I8CA 2BOBB 3SBWC 1IGJA 5GXBB 3QWOA 4Z78A 4F58L 4AG4H 1FYTA 3OR6A 4OLUH 2HH0H 4UV4H 4YQXL 3AM8A 4ZXBC 3QULA 4WO4C 3ARUA 1UACL 4NYLB 5HYQB 4R3SB 2XKNA 1WSST 1LO2H 2VDRL 4YBQC 3OKDB 5EUOB 3FQNA 5L9DL 5HYJB 5DC9B 4PJHF 4RDQG 1VFAA 3W39B 1MFDH 1MELA 4JKPH 3NBNA 4NZRL 3WLWC 1EFXD 3WXVL 2B5IC 5LGJB 2AGJL 1NBYA 4HULB 5KTEL 3HE7B 1FO0B 4JJHA 3FFCE 2UWEA 4BH7B 1M05B 1PGRB 3EUUA 1JGEA 1U8PA 3KYKH 3LKOB 4Y4KC 1QSFA 2C4FT 4M62H 5ICZA 1M7DA 2VZ1A 3C8HA 3WMSA 4QRUA 1IGCL 5IW3A 1P7KA 2HKFH 3T2NL 4J3OC 1G7HB 1ZWIA 5F7MC 1FL6B 1A7QH 3MLRL 2NZIA 5IJVA 4Z8FL 1IBGL 1A4KB 2ATKA 3TCLA 4RX4D 3B8SA 3MACL 1BWMA 4YFLI 1MPAH 1RJZA 3ULUF 3VXRD 3EOTH 4EQ2A 2C3VB 3SGKC 4FXGA 5J3HC 3OXRA 2FZ3B 5CGYC 1XR9A 4YDKL 3VG9C 2VH5H 1MRCH 4WW1B 5B39A 3F58L 5DJDB 3VXME 4D0CA 1X5HA 3UTZB 1IGTA 5JPNA 4XPBL 3GIVB 3NOIA 2D4DA 3G5VA 2DI7A 2X4TA 3UO1H 3VDAA 4QCIA 3VW3H 6FABH 1QFUL 4O2CA 2H32B 1Q72L 1SJVA 3GIZL 3SHSA 3DVFA 5I1DB 5FDYA 4UTBL 1N26A 1NGZA 5E99H 1CD9B 5D1ZB 5HHMB 4LSUH 3RWFA 3S96B 1KGCE 3OGOE 3C8DA 4H88H 3A67L 1UEYA 3VH8G 4G9DB 4E42B 3WNKA 4FQXB 3WHXA 1YDPB 1OM3H 1GAFL 3QUYA 1S7VB 4KJWC 1IARB 5C3LD 4MD0B 3ILQD 1BX2B 5AG8A 3RVXD 2F54B 2WQRA 4FQQB 1T21A 3VXQA 2VSCA 3HRPA 4FN0A 3VFUB 3WXWH 4KI5D 1NCDH 1KG0A 4HIHB 2VO5A 1XR8B 3MV7A 3G6JB 4NN5B 4LHUA 1RULL 3MZGB 5BQ7B 4EQ3A 4WV1A 1BJ1H 2CR6A 4NN7B 1PQZB 2XV6B 1CICD 3I6GA 2AJZA 3J7HA 4BFGA 2X1XR 4O51B 5GRUL 5AZ2L 1J8HB 1NGYB 2EEBA 5EFIB 5E94A 4NHCH 2D9QB 5I8CB 1K2DA 2KZ1B 1X4ZA 4PJCE 2OL3L 4RDQF 2GJ6E 3HN3A 4Z78B 1G7JA 5JA8B 1CLZH 1FYTB 2A6JA 3OR6B 4ZAKA 1KCVH 3WD5L 3HAEA 3ALPA 1FLTX 4B41A 4PG2C 4S1SL 1PD6A 2Z8SA 3WNNA 3I3BA 5I73B 4JM4H 4D9QD 5BW7C 2VLKE 3LMJL 3FQNB 1CGVA 3MLZL 3SDXA 4QWWC 3SGJC 1U8OA 2VLRE 1VFAB 1I9RL 1YEIL 3TIDA 4U6TA 3OJDA 1GOHA 3DMMA 4HUVA 4PP1C 4AL8H 1NBYB 4N1EA 4YHYB 1BBDL 4XNQA 3U7WL 4R2GC 2ZUVA 1U8PB 5ICZB 1QSFB 5A3IC 2ESVE 4TSBH 5GRJH 5C07D 4QRUB 1P7KB 3I9GH 1MRDL 5K9KA 2QSCL 4Y4HC 1QPPA 1MQKL 2P8MA 1ZWIB 1RIVL 1INDH 1Q9LA 43CAA 4OZIE 3ILPA 4HWEL 1KJ2L 5IJVB 3ZKXC 2ATKB 3QH3A 2HA1A 4BA8A 1J1PH 2W0KA 3FT4A 5D2NC 4BQ9A 5E8DH 4X9BA 3X14A 4Q0XL 1RJZB 4P9MH 3ZO0A 4JHBA 1JJUA 3LQAC 1DANT 3TJHC 5D1QA 4PYHA 2XPGB 3WIIL 3VXNA 2XTJB 4Q6IA 5JXEC 4FXGB 3OXRB 3QNYB 5CUSL 5E24E 2VABA 3MODL 3WSQL 3L1OH 3VFOB 3NCMA 3DXAD 2O5XL 4NQCA 5FFLA 4D0CB 1IGTB 2AK1L 5JPNB 5J12C 5KSBF 3I3EA 3KPQA 5EZIL 2FX8H 4P9HC 2PXYA 4ZQKA 2X4TB 3FB7A 4QCIB 4K9EH 4RAVB 4XPGL 2Y5EA 5JHLH 1GGTA 1NGZB 1N0XL 4JFEE 4ZMAT 5DDHA 4PJDA 4TVPL 4Y8DC 1G9MH 2WNGA 4QTIH 4YZFF 2HRPL 1OTTD 2C3GA 3TM6A 2WK2A 3BGFB 5FHBL 3QAZB 1WVZA 2FEDD 4P2RE 3QUYB 3T8XB 1G7LA 2MSPA 3N85L 2GYSA 3FRPA 5L6YL 3VXSE 1JPSL 5I16A 3KPTA 1KLGA 4P5KB 1T21B 3VXQB 2D03H 1YEKH 4G80A 5EB9A 4FFVD 4O2FA 1KG0B 5D72H 4JZJC 3MO1B 2VXUH 4LHUB 3SPVA 5C0CE 5KW9L 1T1WB 1GC1H 4WV1B 5D2LE 1RUPL 5DRZA 3H8NA 3DV6A 2BVYA 2AW2A 5SWQA 3I6GB 4M48H 2AJZB 5L8JB 1J1OH 2WANA 4JFPB 5E94B 3BIAX 1K2DB 1NGQH 2BVUA 2HTKC 2PUQT 1R3KA 1G7JB 5IB5B 5L7XH 4S1DC 1VADA 1LD9B 3KPSD 1IAOA 4OD1H 2A6JB 4ZAKB 4O4YH 3HAEB 5GIRA 4JN1H 3C5ZA 4F7MA 2E7BA 3V6OE 3RX5A 3CDFA 1SYSB 4EI5D 1NSNL 4X7SL 3X12A 4RNRA 4ZODA 3LKRA 3SDXB 1CK0H 1U8OB 4NIKB 3SDAB 3LN4B 1WEJH 3TIDB 3D85B 3OJDB 3RIFF 3QIWD 3DMMB 3UPAA 4HUVB 1KCSL 3R8BB 4Z0BL 3IU3B 1YEEH 2C4XA 2EDLA 4IDJL 4LRIA 4NWUL 2CLVA 3CU1A 2XZAL 1OSPH 2WBWB 2P8LB 1UFUA 1VGEL 4MD5A 5LG1A 2BSSB 4V1DE 4NQEB 4PJ9A 1H15A 5K9KB 5ESVA 3VRLF 3DBXA 2MFNA 1BWWA 2P8MB 3EYFA 5GZND 3MGOA 1Q9LB 2I26N 1ORSA 3VFGH 3ILPB 43CAB 2FO1A 2A77H 3ZE0F 5H2BA 5C0BA 5HHQA 1NFDE 2WIIA 3FT4B 5GRWA 1ZGLA 3X14B 2VZOA 3PHQA 5FYLD 1HCVA 5D1QB 4G6KH 4GRLD 4IJ3C 3U4AA 3VXNB 2QADC 3C08H 4Q6IB 2B39A 3ARFD 2WBKA 5HJ3A 2CKBL 3TJEL 5TPWH 2Z8WC 5MEQA 3FN0H 4FFZH 1QFOA 3NGBB 3QG7H 1W72A 1YJDL 3AUVA 3TA3A 1AQKL 3JWDL 4ZNEA 1ERNA 4FQIL 4N0CC 2FGWL 1EVTC 3SDYH 5JDSB 3RZWA 1CE6A 1EZVX 3UJJH 2D7MA 3CSBA 4KHTH 3KPQB 5HD8D 2PXYB 4ZQKB 1JGUH 1IC7H 1LEGA 2VRAA 1IT9H 1YNLH 3VFVA 3EHBC 4UT9H 3INUH 2WM0A 3PABB 1I1YA 2ILLA 4OT1L 5TGBA 2NY0D 5DDHB 2HLAA 4PJDB 4C4KT 4KKAC 2P5WA 4ODUA 3KYNA 1OGAE 1YMME 5E08H 5B8CA 3BKCH 4X9GA 3ZTJH 3CPLA 1UQSB 2BZDA 2GSIA 5IFAL 4N8PA 1IFHH 1JPGA 2BRRL 1AGEA 2YD8A 5I16B 1N7ML 5MHSE 1EV2E 3RKDC 5L8LB 3DGGA 3GSNA 1PVHA 4E41A 3RVWC 1UZ6E 5D5MB 5CHNA 1VFBA 5GGSA 1Y18A 5JW4M 3FOLB 5CJQL 3WLBB 3DV6B 1MIMH 1OLZA 1N4XL 4X8JA 5DC0A 4KFZC 2WUCL 1RHHA 3DWTA 1C12B 1TETL 4NOFA 3F62A 3IDUA 3NA9L 3TVMC 4CUCA 3B9AA 5CKGA 4I3RH 3LB6C 1FZKA 4JKKA 1IAOB 2YWZA 4J8RB 5E00A 1ZVHA 2NY4D 3C6SB 4XP9L 3NPSC 4ZTPH 4K71C 3TNNB 4JPVH 1O5DT 3S5LA 4JGUA 3C5ZB 4U31A 4U1JA 4F7MB 5HGBA 2XTLA 2EIZB 2AABL 2P1YA 3K46A 4HMEA 3PF2A 3X12B 2DBLL 4RNRB 1RZJC 1OP3H 4NNXA 3LKRB 2R4SH 1BBJA 3MQIA 4LF3A 1AY1L 1MI5A 4PPTA 5DUBB 1O7SA 3GI8L 1NCCL 4DKEH 3EJYC 1RJYA 5KANI 1AE6L 1MEXL 5T1MB 3DIFA 5KN5A 5SWZD 3I02A 5IMMA 4K7PL 1U8LB 4PRPA 4LKCA 2DQGH 5F6HJ 3EKCA 2XZZA 3TO2A 1BQHG 4MQSB 4PJ9B 1H15B 3J8F7 3DBXB 3EYFB 5E5MA 3MGOB 4RGOH 1VFUA 3DARA 5H2BB 4G9FD 5C0BB 2OR9H 5HHQB 3V5HB 2WIIB 2Y7QA 4P4KD 4MYWB 1ZGLB 4X6DF 4WGVB 1X4YA 3BT2H 4CMMA 4L3AA 4LARL 4MA3B 5I71C 4OI7A 4JG1H 4KKCC 3ME0A 5J1SC 4X4XA 5HJ3B 2DLHA 3U79A 5HYIA 5MEQB 4LVOB 1HK6A 3T0EC 5JHDE 1W72B 1UKSA 5CZKA 3TA3B 3BESR 2RB8A 3GKWL 1F4XH 1CE6B 4XBPB 1AC6A 4S0SD 5CJOL 1HHIA 1MH5A 5CLWA 5EA0L 1CDJA 2AI0H 3H2WA 4XAKE 2NYYD 5L0QB 4FXLA 3ZHLA 1IC5L 3BN9D 1R3IH 4P2CG 1UWGH 4LPWA 1GYAA 4FOMA 3PDOA 5TGBB 5FYKD 1CQYA 1DBAL 2P5WB 4ODUB 3KYNB 1U9KA 4PJHA 4Y16D 3T0WA 4ZFOL 3P4MA 1OP5K 2F5BL 2GFBA 3W9EA 2NZ9D 1ZLSH 5B8CB 2FDBP 1NMBL 5KVFH 2GSIB 4JQXA 3CH1A 3VXMB 4RGMB 4YDJA 1AGEB 3AAZA 4KROB 1TCRA 3O2WL 4U1NB 5HDLA 3GSNB 3C5SA 4WI7A 4E41B 4PRHA 3U6RA 5CHNB 1LNUB 5GGSB 1MNUH 4YGVA 3NACL 3BMVA 4GXVL 1VERA 5FYJL 4NZUH 4OFPA 4FFWC 4YUEH 3BZ4A 5SX4H 4X8JB 5CIPH 3LPFA 1RHHB 4W4OC 4NO5B 2WP3O 5DA4A 1RVFH 5JIPA 2XRAL 1F6AA 1RZFL 2NY2D 2YK1L 2J8UF 2BNQA 2HRLA 3HNTH 1QO3A 4AT6A 4K23H 3S5LB 1XF3A 2IQ9L 4OLZH 5FF6A 3UTPE 4U1JB 1LILA 5HGBB 3NA4A 3QEQD 5C2UB 1D5IL 4LSRL 4XGZB 1GGIL 4ENED 5IQ7L 4NNXB 2BFVL 5ANMA 2ADJA 5E70A 1BBJB 2QL1A 1KN4H 4K7PX 4LF3B 1EA9C 1XF5B 3TGXA 1CDUA 2H9GB 2ITCA 4FZ8H 1IC4L 4MJ6A 5DQ9A 2XNAB 1NAMA 2C1PB 3LEYL 3M45A 1RJYB 3W0WA 1IQWH 3DIFB 5KN5B 1OWRM 1EGJA 4DGVL 3I02B 5IMMB 4PRPB 4LKCB 3S97C 1RZ7H 1SBSL 2FHCA 2EDRA 3W11D 4EJ1C 1HEZA 2VLKB 1Q1JL 4ZFFA 5FYKH 4BFEA 2R29L 4G8EA 1ED3A 1CL7H 5ALBL 1DBJH 1QBLL 4WWKB 3TPKA 4Y1AE 2VLRB 3LRSB 4Z76A 1A0QH 2NX5A 2ENYA 3MV11 3ZE1F 1XCTA 2AEWA 2Y7QB 1P6FA 3CUPA 3MRRB 4R97B 4PJIF 1XF4A 4YQXH 3ZTJG 1J86A 2PO6A 2FJGA 1JZ3A 2FIKA 1NMCB 1UACH 4IM8A 5H37H 4X4XB 5CGMA 2ESVB 1OP9A 2VDRH 4Q7DA 3ARDC 4Z7NE 5MEPA 4KH2A 4GXUN 5L9DH 3VFWA 1HYRC 4JO4H 1I3UA 4WTWA 5F9JB 4HIEB 3QXVA 3JXAA 3WXVH 3EDDA 2AGJH 4NKDA 3DUHA 4U1KA 5KTEH 3BZFA 3L3OA 3LDBC 3SO5A 3PDOB 2BHUA 3LQAL 2PYED 1NC2A 3DROB 1UXSB 4PJHB 3O6KL 2GFBB 2CIIA 1F11A 1IGCH 3T2NH 4LCWA 2J6EA 1Z0NA 3R8QA 3CH1B 4YDJB 3MLRH 3AAZB 2JELL 1IQDA 1C1EL 3P9MA 3PWLA 4Z8FH 1IBGH 4NNYB 2AQ2A 1TCRB 4AEHL 3WN5B 5FUCE 3C5SB 3MACH 2VL5B 1ZHLB 3V4VL 4ZUSA 5GHWL 4P9HL 1JYNA 3ZTNL 2VDMH 3U6RB 3RZCD 2HT3C 1JF6A 4JFEB 4YGVB 1EEQA 1K3ZA 2W92A 2V7NA 5DD6B 3BZ4B 3CZFA 4K7PY 2BK8A 4YDKH 1C08B 4J2XA 5AYQA 4P2RB 2C26A 3F58H 3VXRE 4OFVA 3HZKA 4XPBH 1F6AB 3KXFD 2V5RA 4PJEF 1KN2L 5HXMA 3L5JA 1AGCA 1QFUH 4R90L 4X7EC 5IKCA 1WFNA 1Q72H 3GIZH 1QO3B 5A43C 1K3IA 3LEVL 1XF3B 4UTBH 1CLCA 1KUMA 5GGUB 2O61A 5BOZG 4XMKL 4BKLA 2Q76B 5JQ6L 5E8OB 5JDJA 2IC2A 3A67H 4MGXA 3VH8A 5ANMB 3QCTL 2ADJB 2IPUK 3QFDA 3EFDL 4YNYA 5KSBA 4NC0B 5JMOC 1GAFH 2VLJA 3FQUB 5BCAA 4HK0A 4MJ6B 3PDGA 4K55A 3RVUD 3DGCR 2GAZA 1WK0A 1NAMB 4JANB 5CEXA 4M61A 4GQPH 1CN4A 1H8OA 5DFVC 3MR9A 1V5JA 2GI7A 2R2BA 4MS8D 5C0JA 3RWDB 4P5MA 3OR7B 1L0QA 4Z18A 3PV7A 3ARBC 4GAFB 5A2FA 1RULH 3JTSA 1NCBL 1HEZB 4ZFFB 4EN3D 4G8EB 1ED3B 4P23D 1GOFA 5GRUH 5AZ2H 5JOPE 4NQSA 4Z76B 5FGBA 4KI5E 2V17L 5DMJB 4PR5A 2OL3H 1GCFA 1XCTB 3CUPB 5KZCD 1C5BH 3QUML 3WD5H 4U6HA 1JHKH 3QPQC 2PO6B 2FJGB 3PP4L 4TVPD 3H9YA 3EYOA 2FIKB 1Y6NR 4FMKA 3WS3B 3LMJH 1BLNA 1AJ7L 2BY3A 3IDMA 3VFWB 2A2QT 3WFDL 1BZ9A 5E5RB 1YEGL 1MY7A 1HHHA 1I9RH 1YEIH 4ODSH 2C7UA 1OHQA 5D7JB 1NFDB 2XWBA 1NQBA 1Z3GL 3V6ZA 4TNWK 1MAJA 4NKDB 4U1KB 4Z5RB 1BBDH 3BZFB 3L3OB 1RAMA 3U7WH 3WO4B 3CLEL 5FUOL 1J0HA 2NY7L 1Q94A 3CVHA 2MJWA 1A7OL 3TZVA 2FR4A 2CIIB 1F11B 1MCNA 3ROOA 4LCWB 4J3UA 1MRDH 4Y4FD 2AJXL 2VUOA 2QSCH 3C6LD 1MQKH 1FYHB 1RIVH 1TQBB 1TQCC 1HWHB 4OIAA 1ULVA 4KDTA 1KJ2H 3AU1A 3P9MB 1LDSA 3PWLB 4P3WA 4QHUA 1KIQA 1QBAA 3BZEA 2EDWA 4JFXA 1QRNA 4FQLL 5C07E 3BWUC 4Q0XH 5B21A 4P2OA 5T3ZE 4KRPC 2NLJB 3WIIH 3W2DH 1Z5LA 3WJJA 2Z35B 3C60A 4OJFL 5CUSH 3MMEA 4OIIL 3K1DA 1Q0XL 3MODH 7CGTA 1YMMB 3IDNA 3CZFB 3WSQH 3P73A 3A6OA 2DM7A 1UKQA 2DTSA 2O5XH 5TFSL 3HHRB 4PJFE 4WHYH 1I8IA 4OF6A 1BECA 2AK1H 4G8IB 3HZKB 3IXTA 3SGEI 3LN5B 5EZIH 4PGEA 4ZFGL 4TUOA 3U9UA 3OG4B 5KVEL 5IKCB 3VXPA 3QG6A 4XPGH 1U58A 2A6KA 5E1AA 1GXEA 1JV5A 3E8UL 1N0XH 3SGDI 5ACLA 2FX7L 4TVPH 4BKLB 3QDJD 4MX7A 5EIIA 2VMFA 5T1KB 1FORL 3VH8B 2HRPH 3QFDB 4PJXE 5FHBH 2PTTA 3S3SA 1TENA 4YNYB 5KSBB 4KVCH 2VLJB 3N85H 2YN3A 4N8VB 4ACPA 5D7LA 3O2DL 4ZPTA 5GSVA 3TO4A 5L6YH 1JPSH 2V5SA 2MHAA 5CEXB 2EICA 3BQUD 4M61B 4UILL 2VZUA 4OZHE 4YBLB 3T0BA 3MR9B 4QNPF 3MRCB 1JCKA 1T89A 2R2BB 2FNBA 3NCCB 1A22B 4WI2A 5C0JB 2Y6SC 4P5MB 5J6HA 4Z7VF 1FGVH 1S7SA 1U6AL 5LAXA 3JTSB 1NC4A 2DQHH 2JB6B 1RUPH 2YA2A 1R6VA 4UT6H 4HCRA 1WLHA 5K9OA 5E2UL 2IFFL 1RZJL 5J13B 4L1HA 4XMPH 4GKZA 3U9PL 4C83A 2PW2A 2Z93A 4GLRI 4PR5B 3ZYJA 4P5TD 1S78C 2UYLA 1J9CT 1WTLA 4HJGA 4RGNB 1EAPA 3EYOB 3BRGC 3SDCC 3RA7L 2FL5A 3M07A 1BLNB 1NSNH 3GMMA 3HNSL 4PJ7E 4X7SH 4N5ED 3VGAB 1BZ9B 1AD0A 2DM2A 4QF1A 5DR5L 1MLBA 4M9PA 1HHHB 3OHXA 4MJID 2ICCA 1KCSH 2XWBB 4PRIA 3VWJD 3SCMA 3WNOA 1WGOA 4IDJH 1S7UA 4NWUH 5L0QC 1D3CA 2X1QA 5T5FL 2XZAH 1CXIA 1PYWB 3EJZD 4X8XA 5JR1L 3SDDA 3U2SA 3BH8B 3MLWL 5GZOD 1VGEH 4L4VD 4M7LL 1YYML 3CVHB 1QSED 2FR4B 2XKUA 3ROOB 2EKSA 5M95B 3O4OB 4M93B 2D0FA 4S0TD 4BUGA 3O4LD 4HXAL 4KROC 1U3HC 2OTWB 4QHUB 3MBED 1KIQB 5I30L 2YD5A 3PWVA 5TF1L 1I4FB 4JFXB 1XFPA 4P2OB 1OT1A 3K80A 5IVXF 3FN3A 3R06A 3ZL4L 2D4FA 1NJ9A 3L6FA 1Z5LB 5MI0C 3C60B 2CKBH 3TJEH 3LCYA 3MMEB 2Q86A 1SJHA 4RZCA 1EFXA 4EDWL 4OKDA 1AO7D 1YJDH 2LVEA 3P73B 3QDMD 1AQKH 4HS6A 3JWDH 4HUKB 1KJ3L 4FQIH 5FYLE 4WW2C 4X6DA 5I18L 5DRNA 2CRYA 4MQXC 4HH8A 4PGEB 2E27L 5CP7B 3B6SA 4TUOB 3U9UB 3QG6B 3E6HA 1U58B 3MYZA 1IGIL 2A6KB 1UM5L 5E1AB 1JV5B 1ZT7A 2CRZA 4OT1H 4WO4D 2V2TA 5T5NG 4MX7B 5CMAA 1IJ9A 4YBQD 5HGGS 4M1CD 3RVVC 2PTTB 4WFFD 5IFAH 2BRRH 4ODHL 5GSVB 4ZPTB 3TO4B 3WLWD 1N7MH 4HMCA 2QJDA 3BVNA 3O3UN 3TC9A 3IFPA 8FABA 2J88L 1L6XA 4Y4KD 3RWIB 1LP9F 1S7SB 4HGWB 2XN9D 5HHOD 3BPNB 1NC4B 1U8HA 4JO2L 3OB0K 3R4DA 2WUCH 3ARZA 4FFYH 2ICES 4UOJA 1TETH 4GKZB 3RX8A 4C83B 3HUJF 1R5VB 2PW2B 4D2NA 3NA9H 3JUZA 2HWZL 1G84A 2N7AA 5IHUL 2OBGA 4L3CA 2UYLB 1OAQL 3IJHA 4XP9H 2Y23A 1UEMA 4HJGB 4PY7A 1EAPB 2A74B 4OBSA 2FJFA 2AABH 5J3HD 4WFGD 3MOQA 2FL5B 5DQDL 3GMMB 1GGCL 2DBLH 5CGYD 3AXLB 1AD0B 4QF1B 2J8UA 1AY1H 3O8XC 2VDKL 4LMQI 4DKAA 3GI8H 1NCCH 5KSAA 1IEBA 1MJJA 4YDVB 1MEXH 1S7UB 2CLZB 3PXJA 1JGVL 2W9LA 4K7PH 5K59F 3ORJA 3BPLB 3O3EA 4Y5VC 2MKWA 3F12A 3M17A 1TTGA 2EKSB 2YEZA 1TJGL 3DECA 2WINA 3OJ2C 4KJWD 5EOQH 2A6IA 3BAEL 1KTLA 1VA9A 2OQJA 5EG6C 3WFBH 3QXTA 2X5PA 5C0AE 5I1HL 1FP5A 1C7TA 2Q86B 1SJHB 1EFXB 1MOEA 5T5NF 5F3HA 1BD2D 5FXCH 2VDNL 4M7ZB 3E3QE 3GKWH 1URLA 3PGCA 5GISL 1RZ8A 3P11L 5F7FA 4X6DB 4PJIA 5DRNB 5CJOH 5KOMC 4DZ8A 2OMBA 1EH9A 3B6SB 5EA0H 4ZTOL 4RFEA 5C07A 3E6HB 1IC5H 2ZSVA 4JM2F 4B7LA 1CE1L 2HN7A 3KPNA 2V2TB 1ZVYA 3CVIL 2GJJA 1DBAH 5CMAB 5I66A 4P3DA 1E4WL 2F5BH 5HVGB 3MCLL 3VGBA 4QWWD 2JJSC 2IH3A 1G1CA 2YN5A 2DWDA 2ZOKB 4GJTB 4LRNL 1LO5B 3O2WH 3UTTD 4QXWA 4DGYL 5IW1B 3MJ8A 3IFPB 8FABB 1D9KD 1F4WL 4OGYL 5D71L 5CD5C 2ARJQ 4R2GD 4V2BA 5BVJA 3D3VE 3DXAA 4IS6B 3U30C 1ZA6B 3NACH 5C1MB 4MJ5A 5A3ID 4GXVH 2XACC 1HOCB 1U8HB 1HHGA 1H3GA 2ID5A 5BOPA 2OSLA 4Y4HD 4BZYA 4QXUH 4ODVL 1VSCA 4QEGA 1IMHC 1U93B 1BGXL 1I7TA 2XRAH 3BPCA 4NUJA 1RZFH 2YK1H 4GW1A 5A2JH 1SEQL 1CGXA 4QRRA 2ED8A 3RWEA 2IMNA 5C0EA 4NSKA 1T5XA 3D48R 4HMDA 4PY7B 2IQ9H 1QR1B 5I1IL 5JXED 2ZKHL 2FJFB 3MV8E 1G0YR 1D5IH 5I75C 4LSRH 1WV7T 4FQPA 4JPIA 1GGIH 4MXQD 3L9RA 5IQ7H 2HT4C 1CIDA 2BFVH 4EXPX 4IRJA 4I77L 4KV5F 3MRMB 4XXCC 1OTUC 1F5WA 4HSQA 3V0VA 3X17A 3PHOA 1AGDA 3S3PA 3QEQE 4HBCL 3LEYH 5LVEA 4DGVH 1CICB 3QCUL 1XGPA 3W82A 1FVDA 1WBXA 4BYHA 1SBSH 4QRQA 1NCUA 2AJYL 3O3EB 2DQTL 1HI6A 3RIAF 2MMXA 3MLVL 2R29H 1BQHB 5ALBH 3M17B 3KPSA 2IG2L 4OD3L 2J4WL 2YEZB 4IIQC 1OAYL 1BMGA 2WINB 1AKJD 1KTLB 2OQJB 4L4TD 2X1PA 3DRTA 4KXZI 4CN1A 1CDCA 3PJSA 4PREB 3B43A 4FP8H 5GS2D 3MFFA 3QIWA 3QT2A 4YE4L 3VI3E 1T1XA 3D2UA 5HSFA 4POUB 2Z4QA 4M7LT 5HDQL 4BELD 3PGCB 1RZ8B 4P59L 5LXGL 3RI5F 4LNRA 2HTKD 4PJIB 1Y6MR 1DQLH 5I1CL 4DZ8B 5K9JH 4QO1A 4S1DD 3QPXH 4RFEB 5C07B 1BVLA 2ZSVB 3BJLA 4G5ZL 1MJ7L 3LQAH 3NVQA 3HC0A 3Q0HA 3HPLB 4KKLC 4YHOL 2ZPKH 3G5XA 5I66B 4P3DB 3O6KH 4NQTA 4IRZL 1NEZG 4XHJC 2BVPA 2ICWI 4YHML 3PL6D 2DKMA 3U0WH 5JIIA 2IH3B 3VE0A 2DWDB 2QHLA 1MIEL 2JELH 4GRLA 1SEBA 4CMHC 2FD6L 3LV3A 1UJTA 3ARFA 3MJ8B 1KULA 4EIGB 5D6CB 5GHWH 1P6AB 2R2EB 4YPGA 4GUPB 5BVJB 1OQOA 3ZTNH 4NGHL 3DXAB 3G6AA 1EO7A 5EU6D 4QT5A 5GRZA 2FEEI 1RPQA 3H7BB 2OSLB 4C56D 3V79C 3VA2C 3TEUA 5AD0A 2CKNA 1WAAF 2I5YL 3BPCB 4NUJB 1WWAX 4RFNC 2P4AB 4XH2B 2IPKA 4UBDD 4OZHB 3UZEA 4PJBF 1DVFC 1KN2H 5DJYA 4R90H 1LGVA 4NSKB 2BRQA 4JPKH 5IB2A 3LEVH 2QADD 2YKLL 3EO9L 2DJUA 1NMAH 1GOGA 1QKZL 5T1LD 1WT5C 1CU4L 2UY7A 4XMKH 5JQ6H 1P9MA 3RWCA 5GS2H 3EGSA 5ESQA 3KXFE 3QCTH 2A83A 1TZGL 3EFDH 1D6EA 2ZUYA 4N0CD 3MRPB 1E4KC 3V0VB 3PHOB 1AGDB 3U83A 3BDXA 3U1SL 2IH1B 2YOCA 1G7MA 3CFCL 4KMLB 3SY0B 3UPRA 1XGPB 4IBLT 4IMKA 1FVDB 4YK4C 4ELMF 1J05A 3IKCA 3BZDA 4FG6D 4QRQB 4KKAD 2AQ3A 1VFMA 1HI6B 1NCBH 1IE5A 5EORL 1KJVA 3KPSB 4ZSOE 2P7TA 4JE4B 4JB9L 1BOYA 1FCGA 1CXLA 3ZE2E 1FFPA 1BZQK 3RKDD 2O5YL 3DRTB 4ODWA 4Z7VA 5JW4N 4XPFH 3QUMH 5AAWA 3RVWD 2ADIA 4TQEL 5I1GL 2VZSA 3UX9B 5E56A 3RPIB 5IG7A 3PGDA 5FO7A 3MFFB 3QIWB 2NY3C 1AJ7H 1X9QA 3WFDH 1RUML 4H25A 1YEGH 5SWZA 2D0HA 1CFSB 1CFVL 2DMKA 5DMGC 4LNRB 4XVJL 3TVMD 1HDMA 5ETUA 4ERSH 3LB6D 5DYOA 1Z3GH 3ARQA 1BVLB 4HT1L 1N59B 2BOCA 3CLEH 1FSKB 4N1HB 4OQTL 2DDQL 3HS0B 3HC0B 2NY7H 1IC1A 2QKIA 5BZDA 1KXTB 4G9FA 1I7ZB 1UWXH 1A7OH 1QLEL 2BVPB 4P4KA 2DQDL 2OK0L 1PEWA 3VE0B 1LE9A 2QTEA 4GRLB 3UTSD 2AJVL 3LV3B 4M3JA 5EOCJ 3EJYD 1N5YH 3ARFB 4TTDC 5BJTA 1QLFB 4FQLH 3ZDXE 4YPGB 2IMMA 3GJFA 4KJQC 1B3JA 1OAKL 4X9FA 3F6LA 1CVSC 3G6AB 5IBUG 4MNHA 2X1OA 4XCCL 4QT5B 3ARSA 3SE4C 4OIIH 1Q0XH 4W6WB 4I2XE 4MD4A 3IF1A 5AD0B 5TFSH 4MHHG 1EHLL 3IFLL 4UV7L 3QRFM 2NY0B 4HJ0C 2E7MA 2APFA 3CFDA 2IPKB 1H5BA 5J11B 4ZFGH 4TN9A 3MJ9L 5DJYB 4Y16A 2YC1A 2P5ED 5HVFB 2HYMA 5IB2B 1CGYA 1JNJA 3E8UH 4KKCD 4BZ1L 4KZDL 2FX7H 5DJCA 3VA6A 5FHAL 3GJFK 1OPGL 1T2JA 5F89A 3T0ED 3EGSB 1FORH 5F6IC 5JW3L 1P84J 1UCBH 2CXKA 2A83B 1D6EB 5I2IB 1J87A 1JNLL 2XQBL 1QUNA 4UILH 4OM0H 5I1JH 1AH1A 3NFSL 1RSFA 4U49A 1G7MB 4NO2B 4KVNL 3UPRB 2YXFA 5IK3A 5DS8B 4AJ0A 1KEGH 4IRSC 4QOKD 1J05B 1U6AH 3IKCB 3HI5L 2XKSA 4X6CA 1I85A 1TPXC 3G08B 1KJVB 1NFKA 2NY1C 2NY4B 2P7TB 3MOAH 4S2SA 2IFFH 5E2UH 1RZJH 4NRZA 1NANI 4PV8A 1FFPB 3PXHA 3OMZA 3U0TA 2NY6C 1HHKA 1LP9A 5C8JA 4YHKL 2ADIB 5FM8A 5FGCB 4XHQA 2NCMA 3SEPA 1UJ3A 1RMFL 2EIBA 5DK3A 5F71A 2WZPD 5F44A 5IG7B 3QSKB 3PGDB 3RA7H 4FFWD 3O81A 4BQ8A 3HNSH 3HUJA 2EC8A 5IWLA 3EJJX 4H25B 2YSSA 5SWZB 5F9AC 5DR5H 4LLWA 1XGQB 2VDQL 4WFED 3EOAA 1HDMB 5ETUB 5D6DA 5DYOB 4X7FC 3MRGA 1WITA 4NOBA 5FUCC 2I25N 5CIPB 1PJ9A 5C0IA 2L4OA 5T5FH 3RTQC 3VFPA 5JR1H 3MYJA 2X05A 4PJAE 5BZWB 1ZANL 5AG9A 2X4OB 1RUQH 4Q9RL 3VGFA 5BZDB 4M7LH 4G9FB 1YYMH 2H1PL 3S7GA 2E9IA 2HVJA 4S11A 5IVNA 4P4KB 2MQ0A 2V5MA 4MMXC 2JJTA 4Y5XC 5FGRA 1P84K 1F13A 2RCSL 1HCFX 5HDBF 4L29A 1M7XA 2ZG2A 4B5EA 1LE9B 4NWTL 4HXAH 4JFDE 5KVDL 1RZKC 3FO1A 1T83C 4XZUA 4L4VE 5D93C 5BRZE 1KNOA 2I60L 2R56L 5TF1H 4UTAL 5I30H 5F21B 5BJTB 3L3JA 2AV1A 4X80L 4E5XA 5C70A 1JHLL 1FFOA 1RIUL 1FNFA 4NNPL 3ZL4H 4WWID 4L8SB 2BNRD 3O4LE 4MA7L 4J7RA 3CDCA 5TDNA 4EDWH 4MD4B 3T4AB 3IF1B 1F3DH 4OGZA 4UAOC 4UZGA 1KJ3H 5AWNL 5I18H 4JRYA 2PYEA 2DQJL 1H5BB 1NCAL 4Y16B 1PY4A 4DTGL 2YC1B 2XXCB 1AO7E 1IGIH 3PWPD 4Z7UF 2HMIC 4X4ME 1FVCA 4CADA 2OL3A 5DJCB 1VKXA 5DD1L 1OW0A 1G0DA 4BSVA 5DMIL 2HT2C 3RVXC 1KJMB 4ZOAA 5DJXB 4ODHH 1QSZA 2JCCE 2H8PA 3IGAB 3IRZA 1HSAA 2QSVA 5CSZA 5J56B 4JM2A 3VMNA 3GKZA 4AMKL 4QHLA 1IEHA 1U3JA 4GSDL 1CICC 2J88H 4JKMA 2ZNXA 4D0BA 4I3GA 4WFFE 3OGCA 3TH3T 1ZEAH 4Q9QL 4X6CB 4NDMA 2NY2B 4L8BA 4WU7A 4JO2H 1PX3A 4GBXC 4ZFZB 4JLRA 4HG4J 4WUUA 1HILA 1NCWL 3PQYE 4NRZB 1SVCP 2XA3A 1A3LL 3O3AB 4PRDA 2ITDA 2XN9E 3U0TB 1HHKB 1OAQH 1FNHA 5C8JB 5CBAA 4BSWA 3RL2A 1T2XA 1UJ3B 2HT3D 4U3CA 2G2RA 2CMRL 3AY4A 5DQDH 3CSYB 2Y5TA 1DL7L 1GGCH 4E0RB 3FT3A 3HUJB 3FAWA 4OCSH 3V8CA 4ZPVA 2YSSB 4HC1L 5F9WB 3SKMA 4U1GC 4LLWB 3HG1D 2XQYK 3KYOA 3MRGB 1BF2A 4RWHA 5E1HB 4HFUL 4LCCB 4MLIA 1OD7A 4EN3A 5C0IB 2WBJA 3FQRA 4P23A 3VFPB 5FA3A 1JGVH 2H41A 3RUGF 3QDGA 3QFJA 4NKMA 2HVJB 1T7YA 2GQHA 2JJVA 2IGFL 2NXYC 3SJVD 5KBNC 2LTQB 4YXLH 3S88L 3HI6L 2H2PC 4LPXA 1TJGH 4L29B 5F8RC 3BAEH 3FO1B 4XZUB 3PWUA 4LVHB 2QQQA 4OF7A 2GTWA 5B3NA 3QI9C 5DFVD 3L3JB 2AV1B 3L3GA 4NQDA 4E5XB 1XIWC 1FFOB 2GY7B 1F02I 3UYPA 1BVZA 2JIXD 3S4SB 2EYRA 3ARBD 3DUSA 5EBWA 1A6VH 3VXUD 1KENL 1BP3B 5D9SA 1VPOL 4EOWH 3P30L 4Q2ZA 4O2EA 3IJYA 2D9CA 2CRIA 2VDNH 2CPCA 1JBJA 1G1YA 1UWEL 5GISH 2E3VA 3P11H 2PYEB 2E6JA 1T03L 4ZTOH 2X89A 4U6YA 1X3DA 1M1SA 2EDFA 2XWJB 3C2SA 3QPQD 2V2XA 1CE1H 3HZVA 3MV9D 3C6LA 1FVCB 1UENA 3W81A 2OL3B 3CVIH 3PIQA 3FONA 1VKXB 1BPVA 4P2QD 4WRLA 3KGRA 2YUVA 4Y88A 2ED9A 4APQA 4BSVB 3CC5A 3EYUL 4RA3A 1E4WH 1JN6B 3RIAK 4JFFE 3MCLH 3HFML 4N9GB 4DVRL 3C5JB 1N64H 1WICA 3RZCB 5HI5C 2OS7A 2H8PB 4QHMA 4KTDH 4LRNH 4LSTL 2YA0A 5CSZB 4JM2B 4DGYH 4QHLB 4OGYH 5D71H 4OFDA 1PSKL 1FVEA 1JWSA 4I1NB 4D0BB 3OGCB 4DAGL 3OAYH 2KH2B 4YR6A 3UBXB 3E1F1 5EH1A 4L8BB 4WU7B 3KXFB 4PTTA 3EIFA 1CG9B 1A64A 4GT7A 4KZEL 2X4SB 1HILB 2F8OA 4KY1L 5EC2A 3LSOA 1AQDA 5ISZD 3NTCL 4OV6F 1BGXH 4W81A 1DR9A 3RI5K 1HKLL 4MA1C 4PRDB 2ITDB 3X11A 1QPXA 3ET9F 3PGFL 3QDJA 2DL2A 4GAJH 4EI5C 2K9UA 5EIVA 4KRPD 4BSWB 1EBPA 3RL2B 3GFUA 3GB7A 1KJ2B 4R26L 2G2RB 5I1IH 2ZKHH 1CR9L 2L7JA 2W1NA 1NBVL 2LABA 4DFIA 3FT3B 1MHCA 4HGMA 1WAAA 4ZPVB 4HZLA 3KYMA 4I77H 3SKMB 3VU2A 2A6DA 3RBSA 1KF9B 5GGRY 3KYOB 4PJBA 4NZTL 2CKBA 2QLVB 4NN6C 4HBCH 5I1AA 3S35L 4DQOL 3KWWA 3D18A 4EN3B 2ADFL 3FQRB 4P23B 2Y25A 3QCUH 5FA3B 5TQ2H 3K1KC 3VMPA 1HIMH 4D9RD 3QDGB 1KC5H 2AJYH 1CYGA 1ZLVK 3CU7A 3L95A 4NKMB 1G6RL 1A47A 1U8JA 1FFNA 4P5TA 5GS0C 5KAQG 2IG2H 5KZCB 4OD3H 4OLEA 3U0PB 1J5OH 1OAYH 1UA6L 2JK5A 3SGEH 4KUZL 4YIQA 5KVGL 3WFHA 2GTWB 5F96L 5CILL 2VLLA 3L3GB 3BD4A 4ELMA 4S1QL 3ZDYE 5CJXA 3RHWK 2Y6SD 1MRFL 4X98A 32C2A 4MJIA 5EBWB 4YE4H 5D9SB 4ZOCA 3P4NB 4Q2ZB 4L4TE 5ESAA 4LAJH 5GGTA 3VWJA 1JI1A 4PJEE 2EZ0C 5LXGH 5IV2A 1NH6A 4R7NA 5BS0A 5I1CH 3IS1X 4JREC 4EDXA 1LO2L 1JI2A 1S78D 4U6YB 5A2IH 1S7WA 1QSEA 4KRMB 3FFCD 2V2XB 1YPZE 4Y4FB 1H8SA 3HZVB 3C6LB 4G5ZH 5E2TH 5A40E 1MJ7H 4AQOA 3PIQB 3NCEB 3SDCD 3O4LA 4YHOH 5C6TL 3MBEA 4IRZH 1NEZA 2M2DA 4DEPC 3GSWA 4YHMH 3ARRA 4AH2A 2YPLA 5D1XA 2R0KL 3CGTA 5ELIA 1MIEH 2VLME 4R9HA 4QHMB 2FD6H 4GLRH 1EEUA 2HKFL 1JHTB 2QSQA 1FVEB 1JWSB 1ZHBA 3QDMA 4NGHH 1F6FB 3BP4A 5FO9A 4HHAA 4CVXA 4HWBL 3SBWA 5FOJA 2OJZL 3L3DA 1U8KA 4PTTB 1CGTA 5IHLB 5E9DE 5EC2B 4MAUL 3LSOB 1IAKB 4H5SA 1U3HD 2I5YH 4Q9CA 4ZXBA 4WO4A 3HZYA 2F53E 3X11B 1UM6L 3TBYB 3QDJB 4KQ3L 5FCUL 4GAYA 4YPJA 3WFCL 3WHE0 1X5IA 3GB7B 2YKLH 1QBBA 3EO9H 4MQ7A 4WHCA 2KPNA 1QKZH 1CU4H 1KGCD 5DWUH 1SVZA 3QA3A 3IDGA 3BQUB 1A7NL 4R8WL 1MHCB 4HS3A 4U0RC 6FABL 1TZGH 4HZLB 2A6DB 5F1IA 2CKBB 2EC9U 4Y4KA 5E99L 4MQXD 1I9IH 5I1AB 5EU7E 3U1SH 5HHOA 1I8LC 1MHEA 3D18B 4NJ9L 4G7YL 3CFCH 3G6JF 3T04D 3BFOA 5F1OB 2AEQL 5C0GA 3UMTA 4MZ2A 4LHJB 3PP3K 1OM3L 4HIIA 3CIQA 1J0KA 2ZOLA 5EORH 3T0AA 4RMWA 5DI8B 1U8JB 4P5TB 4OCMC 3RVVD 4O5LL 5DJAA 4W6XB 4JB9H 2J7LA 5ID1A 4POZC 3WJLC 3SGKA 1VENA 2GJ6D 4ZFOA 3WFHB 1T4KA 2UUDK 3Q3GA 4POYA 1MAKA 4ELMB 3QHTC 4PJAB 1BFVL 5MEND 5I19L 4TQEH 2L7UA 5I1GH 1DJSA 3NIGF 4GG6E 32C2B 4M00A 5EC1A 4CVUA 4MJIB 3H6JA 2HLFC 2CUHA 5IMKA 1MREH 4H8WC 2MOVA 5ESAB 3VWJB 1GIGL 2BSRA 3KNBA 1R0AL 2CJUL 2NYYC 1RUMH 1LWRA 3KHOA 1DDHA 1CFVH 3FQWA 5I8EB 4XVJH 5IV2B 4PGZA 4HK3J 3G5ZA 4L4VB 4R7NB 1V7NL 1FL5B 4M8QA 4EDXB 3WDHA 1AD9B 1RZKL 4O00A 4OKVA 1FZOB 4NKIL 1QSEB 4HT1H 1PLGL 2NZ9C 5HI3C 4TRPH 4OI9A 1T2QL 4F9LC 3HC4L 3P9LA 5B22A 4LLMA 2MCPL 4I0KA 3LD8C 4OQTH 2DDQH 1NDMA 1WCQA 1X5ZA 2DIBA 3O4LB 4RWYL 5J1TC 2X4RA 5F7EL 3MBEB 1NEZB 3BO8A 12E8L 1QLEH 2QQLL 3GSWB 1KB5L 4Y8AA 1ZLUK 2OK0H 2I27N 3KDMA 5JIHA 5D1XB 4XBGA 3O8XD 2A1WL 5FKPA 2FBJL 5DC4B 5HBBA 3BEWA 2Y9RT 4HIXL 2AJVH 1AR1C 3N1GC 4XVUC 3X3FH 3T3ME 4UU9B 3OQ3B 1FNAA 3VFNB 1BD2A 1OAKH 2H3NB 1ZHBB 3QDMB 5F8QC 5FO9B 3BP4B 4OF8A 4XCCH 1A1OA 1G6VK 3RGVC 1MF2H 4G6JL 5F9OL 1CZ8L 5AZEL 1S9YA 1SMOA 1U8KB 1CGUA 2BHYA 4DUWA 5F97E 4XPHL 4JQXC 2LQRA 5HPOA 4P9ML 3GK8L 4H5SB 1EHLH 4ZXBB 4PG2A 3IFLH 4WO4B 3KAAA 3CH8A 3HZYB 4UV7H 4JJ5A 2QBWA 4U1LA 5BW7A 3MJ9H 1FQ9C 4ZNCD 2XOTA 1GJIA 2IANE 4MQ7B 3SGJA 1WIUA 4BZ1H 4KZDH 4LU5L 4YC2C 5FHAH 4UQ2A 1OPGH 3QA3B 3IDGB 3UTTA 4Y89A 2B5IB 1S7RA 4OF0A 4K94C 5JW3H 4HS3B 1J0IA 1JRHI 4XC3L 2VE6B 4MNGA 3LKPA 4H0HB 3SKNA 2NW2A 3LRHA 3VXSD 4Y4KB 1JNLH 2XQBH 3TCXA 5HHOB 5DEFA 1MHEB 4Z7UA 5EU4A 4YDLC 4BH8A 3T0EE 4KVNH 5M94B 5F6HI 2BMKA 2MTPA 4Y4HA 5C0GB 4HIIB 2E9BA 3HI5H 5D70L 2DQIL 5C0CD 2W91A 5JPMA 2ZOLB 1MLCB 4HPYL 4LKXA 3BDYH 5DJAB 5EPMA 5D2NA 4YXHL 3VMOA 2ZG3A 2B1AL 3IAPA 1UM4L 3NZ8A 3FO2A 2R0ZL 5IVXE 2HG5A 3KLAA 5JXEA 4ZFOB 3VCLB 3Q3GB 3BGMA 2DM3A 2AJSL 5E2JA 3S98A 5EWIL 4YHKH 5CD5D 4RIRA 1SMAA 5BMFL 3H9SD 1RMFH 2BX5A 5T3ZL 2GTZB 4MB3A 5EC1B 5E6IA 1MCIA 2J3SA 3QXDA 2BSRB 4OD1L 1X7QB 3FQWB 2VQUA 4JN1L 5EU5A 3OKLA 2VDQH 2MQCA 4FMFA 2OYPA 4M8QB 4OKVB 4XRCA 1LEIA 4TSCH 4UIKL 4EI6A 3P9LB 4LLMB 1K4CA 4Q9RH 2GKIA 1I8KA 4V1DD 2X4RB 4WFEE 2H1PH 1QR4A 5GRVK 2HT4D 4JFQA 1YEEL 2R1YA 1Q9KA 3KDMB 2DQFA 4XBGB 5FKPB 4GKSA 1OTUD 4G8GE 2CDFA 2GIYA 5E4EC 3G04A 3BEWB 4JZJA 4NWTH 5KVDH 4OM1L 1A4JB 4YFEA 3FB5A 4MSWA 4UTAH 2I60H 2R56H 5IFJA 3RUGA 4WUKL 5C09E 3ZT5A 2DLFH 1JHLH 1RIUH 3EDKA 1BD2B 4HS8L 5IBUB 1C16A 1JTPA 5FKAA 2YR3A 1A1OB 4PJ5D 3ARED 1S9YB 4ELKA 4ZUTA 3KPPB 4XX1E 4U1SB 2AXFA 5JQHC 5AWNH 2X70A 4JJ5B 2DQJH 1T7WA 2EH8L 1NCAH 2AS5M 4L5FL 4DTGH 3QISA 3QG7L 4ZD3L 3TWCL 3N1QC 5TDPA 4EXKA 2H26A 4XWGL 2ZJSL 1MVUA 1V05A 5DD1H 3GEWB 4UQ2B 4DOHE 3LQMA 1HINL 4XBEL 5DMIH 3RVUC 3UTTB 2X40A 1OGAD 3QUMA 1TVBA 3GUTA 3BP5B 4FA8A 3EOBB 2B20A 1D9KB 1OF2A 5IHZA 3LKPB 3G5YA 4R2GB 1NFIA 3SKNB 2NW2B 3L7EA 1PKQA 5EU6A 3GMPA 4OCRL 5MHSD 1Q8MA 5DEFB 5D5MF 4Z7UB 5EU4B 4OSUL 4AMKH 4BH8B 1DBMH 5T3XE 4JDVA 5IGXL 4KXZH 4XWOC 1ZKAA 2DD8L 2AXGA 4GSDH 3LS4L 5F93C 2BMKB 4RMVA 4C56A 4Y4HB 5DVMA 5IMOA 4DGIL 1RV6X 4KKLD 4DKDC 3ZKXB 4HKBB 4Q9QH 4XHJD 4LKXB 5EPMB 5D2NB 1P7QD 2CIKA 4JO3L 1CDGA 3REVA 1NCWH 1BM3L 3NZ8B 5EU3B 4JGJA 3RNKA 3C09C 5ITBL 3CFBA 1A3LH 2HG5B 3KLAB 4F37F 3H0TA 5T1LA 3GMOA 3IYLW 3HMXL 4D3CL 3BGMB 4K3DL 1JNNH 3ZDZE 1KBGL 4RIRB 3L5HA 4HBQA 2N7BA 4OAWA 4M4RA 5F70A 2CMRH 1DP0A 5SWSD 3RVTC 5J12B 3QB7C 1DL7H 5GPRA 1FZJA 3QXDB 4ESKA 5CBEA 3DLQR 1EJOL 3QWRD 4HC1H 3VGDA 5GS0L 3QEHB 1DUYB 3T1WA 5L88L 3QUXC 2Q7YA 1R5WA 5FYLL 3BH9A 5I17A 1DVFD 4PFEA 1KIRA 2Z31C 5GRXG 4ZOBA 3ZKND 1ZHKA 2VQ1A 4EI6B 2BSTB 2K7QA 1K4CB 3FB8A 4YEFA 1GRWA 3BPOC 3HG1E 4GRWE 3K8MA 1AKJB 1I8KB 3GNML 1EHXA 4L4TB 4NKOA 4JFQB 5ADPL 2W38A 2R1YB 5E8PA 2IGFH 2DQFB 5D7IE 4MDIB 5BV7C 3S88H 3HI6H 4GKSB 3THMH 3G04B 4JZJB 1NL0L 4WNQA 4HWUA 3MZTA 2DQGL 3FB5B 4Y19A 4MSWB 4G7VL 5IFJB 2KUTA 5HVHC 3RUGB 3MPCA 1YPZB 4XP4H 5CP3H 1YQ2A 3D1MC 1P5VA 1C16B 3O2DA 4RISL 4FQ2H 5FKAB 3VXTA 3CDGA 1XGRA 5EBGA 4RGOL 4U3XA 3TVMA 4PB0H 4F8TA 2OR9L 3WNMA 4ELKB 4ZUTB 1VPOH 5JHDD 3P30H 3DVNA 2AXFB 1A9EA 1UWEH 5F7DA 3WFZA 3WDIA 1DN0A 2YD4A 4JRXE 1T03H 2IADA 4MCZA 4XAKD 3CSGA 2HAZA 4LLYA 5DJZA 3PL6B 1B4RA 5TDPB 3WJJC 4CU6A 1F4XL 2H26B 4P99A 1MVUB 4KV5E 5IJKC 3UTSA 3QIUC 1CFBA 2B0SL 3EYUH 2NY3D 3QUMB 3CMGA 1TVBB 4HPOL 3GUTB 5LGJA 1B0RA 4RCAA 3UJTL 1A14L 1OF2B 5IHZB 3HFMH 4DK6A 5DMGD 4DVRH 1WFUA 1NFIB 3L7EB 1R3IL 3MV9E 5E6ZA 5EU6B 3GMPB 4Q6YA 5M7QA 4LSTH 5DZOA 5HYFA 35C8L 1FNGA 1S5HB 4AM0A 4WGWB 4JDVB 5C0FA 2AXGB 1F3DJ 1PSKH 4LOUC 2WSKA 2VTFA 4O02L 4C56B 5E95B 4QRPE 3GM0A 5F7HA 5IMOB 4DAGH 1R3HB 3VDCA 3WDJA 4KHXL 3CFEA 3GM8A 2CIKB 1KCUL 1EERB 3REVB 2P5EA 4KZEH 4MNQD 4KY1H 3WHE1 4YEEA 3RNKB 3NTCH 2QADB 1NGPL 3CFBB 4JQIL 3NCBB 3A6CL 5CSGA 1HKLH 5AUMA 5T1LB 3GMOB 3GO1L 4TTDD 1O7VA 3PGFH 1T89C 4OQ1A 3I85A 4KJQD 2LAGB 5ITFA 3UTPD 5IBTL 5F9DC 5IUSA 4R26H 3BP7B 1RVFL 1CR9H 5DJDA 5DJ8A 4CU7A 2PN5A 1G7IB 1NBVH 1J10A 1F8TL 3GIVA 1ADQA 1SJXA 4KMTH 1YZZA 4PJCF 1F4YL 3EBAA 1NGWB 3GSQB 4FTVD 4ZOEA 4NZTH 4F33A 4QOKA 1R5WB 4HJ0D 5D1ZA 3BH9B 3IETA 4YXKL 5I17B 1P4IH 4DQOH 4P46C 1R3LA 1KIRB 3FCTA 4J23A 2ADFH 3FOMA 1INQA 5JW4R 1ZHKB 2VQ1B 5F1NA 3ISWA 2VR5A 3FB8B 3F7PC 2YS4A 3V4UL 5LGHL 1JZ2A 1YNKL 3I6KA 3CFJA 2EE6A 4OF5A 4L9LC 4R6UA 4MD0A 1CWVA 1DSFL 1G6RH 1TXKA 4NKOB 4FQQA 5E8PB 4U7KA 4H8WL 4Y1AD 1KACB 1UA6H 4YAQB 1YMHA 4KUZH 3SCMC 3G6JA 5KVGH 3VRJA 4D9RE 5BQ7A 3EZ8A 3BRFA 1ND0A 5E8EB 5F96H 2OXHA