2HT3D

Structure of the escherichia coli clc chloride channel y445l mutant and fab complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
b'DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Synergism between halide binding and proton transport in a CLC-type exchanger
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 44
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht3D01
5J1AA 5D6CA 5I73B 2QHRL 3C8HA 5KSBB 1A7PH 1BD2D 2XN9B 2DQDH 4I77H 1GPOL 2B0SL 2A83A 3QEQA 3ORJA 3CX5J 3FT2B 4XH2B 4QEGA 4OTXL 4HGKC 4G9FA 5CJ8A 5T1KA 3MFFB 1S9YB 5AWNH 5I8CB 4LF3A 1DQML 4X6DB 3BSZH 3CFJB 1ZTXH 1K85A 1P7KA 2PR4H 1P6FA 3QCVL 1FYTE 4G7YL 4HKXB 4PGZA 4ONFL 3MROB 3ZSTA 5SV3A 4IMKC 4U1GC 5EPMA 3RWFA 1FZOA 3DV6A 3DUSB 4BZ2L 3K81A 4Q9RL 5BRZE 4ZD3L 2MWCA 5DJ8B 1F4WL 3GHEH 4YDVA 5FUCE 5JHLH 1ZA3B 1D5IH 3QXAB 1A64A 4P4KA 3I3BA 3VFWB 4B5EA 3MRDA 1E27B 5F1IB 4RA3A 2CDGA 2P4AB 5IVOA 4HC1A 3LKPA 5I15H 1IQDA 3F7YA 2H1PL 3ZYIA 2QQQA 5GHWL 4JFHD 3HMWH 3CZJA 5TE6H 5KJRH 2Y6SC 3LS5H 1CGUA 4K8RD 5CSBA 2AXFB 1ITCA 3DRTA 4JGMA 4P2RA 3OXRB 2AV7B 1A6VH 2CQVA 1T3FB 2A0LC 3KPQB 1CCZA 3BQUD 3QXUA 1UM4H 3VXSD 3STLB 4EEEA 3HAEA 4H25A 5J6HB 4Z8FH 4U6HA 1KCLA 3DBXB 3QNZB 3L6FB 1IBGH 5B4MC 2Y25A 1NJ9A 5HVHB 2YWYA 1KYOJ 2JIXA 4MB5A 3HS0B 3SGKC 5KSVA 3WYRA 1FL5A 2GEEA 1MCFA 1FG9C 1P4IH 2Z92B 5C6TH 4WV1B 3KXFB 5C0AA 4F9PA 1IKFL 1ZHLA 3RIFF 4QY8B 4HEME 2DKMA 4M43H 5I1DB 1P4BH 4D94A 4F7EA 4R7DA 3DUUB 2CD0A 4EUPB 5C7XL 2PXYC 5CUSH 3V95A 4WJ5A 5FYLE 4X6FB 1AP2A 5F3HB 1MF2H 5D7IB 3HHRB 4XPAH 5D71H 2ZJSH 3TZVD 1FV1B 4IRJB 1OF2A 1S78D 5HHMD 2I25N 3NN8B 2X89D 1X7QA 4ZXBC 1P2CA 2VDQH 2R56H 3R0NA 2X4OA 4MCZA 1JZ2A 2P7TB 3ILPA 5K9OB 5E00A 4EBQH 4UUJB 3KPOA 4NWTL 4ONHA 4WW2B 1BOGA 4PRDB 4PJIB 4CW1B 3NIFE 1ND0B 4NPYB 3B9KA 1RK0A 2E9JA 2HTKD 4KMTL 4PLJD 1J1PL 2DTMH 2QQNH 4M6NL 3E2HB 1QBLH 1LK2B 4Z7UF 4IDJH 1U95A 2EDWA 5IB4B 4U1SA 2AJ3B 1F00I 4WEBH 4GAJL 4KPHL 4BFEA 5EFIA 2C1PA 5EO0A 1MQKH 1T1ZA 1NAMH 2EXYD 2VKXA 4ZS7H 4WI9A 3VDBA 1KT2A 4WO4B 1MFAH 3OV6A 4CVZB 3FQTA 5K9KA 3RVVD 1P4LB 3CCHA 3O81A 2CPCA 4XP4H 5KVGH 4WFED 3L3KB 4NBZB 5GS3A 2LAAA 2IAMB 4QXUH 3L3IB 1BWWA 4HBCL 2C5DC 4XMLL 1N3NB 4NOFA 2AJVH 1N4XH 4PGBB 2YUWA 2NY7L 3GSNL 2J4WL 4YH6A 3H9SA 1HSBB 5LGJA 1I1FB 5DR5H 3F5WA 5I1KH 1BVKB 1CXEA 1KFAL 3VD3A 4NC0B 1AJ7L 1BBDH 4MJ5A 3TBWA 5J12B 3X14A 3MREA 3MRLB 3IDXL 4HKZB 5IB5B 1BPVA 2QBWA 5L9DL 2PYEE 2QQLL 1IM9B 1MCPL 3HB3C 2G5RA 2IANA 5LG1A 3DTXA 5HVWA 2V7NB 3O6FC 3BD3A 1HWHB 3HNSH 4L4TE 2YPVL 5GS2H 3ZKXC 1Q94B 1RVFH 2BNRA 1MRFL 5D1QD 1FO0A 3QQ3B 5DVKA 4ELME 4PJFE 2F54B 1TVBA 1Q9OA 5DEFA 3LKSB 3Q5YA 3KLHC 3OGCB 1KN4H 3MXVL 1KIRB 1J0HA 1DBKH 4PR5B 2V9QA 1NANH 2ICWA 4M1CD 3EJYD 3V2AR 4X4XB 4M7KL 3OR6B 1LO4L 1R5VB 3RWJA 4JFOB 4HCRH 3GMOA 1CDBA 2XACC 3VD7A 5J6GB 5E0QA 5T33H 4WY7L 2XI9A 2P44B 3ET9F 1F42A 2WWMD 3WD5L 4Z77B 1IARB 4HS6B 5HGBB 3S3JA 2W0FA 2VB5A 5SWZD 3ZKMD 3RTQA 3TVMB 3JTTB 4PJHB 3MRJA 3AXLA 5DHVB 3DJ9A 3LKRB 4L4VD 2FR4B 3MOAH 3L5IA 1YEJH 1Q72L 4YBLB 5DRWA 1MCWM 4QOKA 4ORZC 2QTEA 4YXKH 5JPNA 2XOTA 5IVXE 1KXVC 3P4OA 4GAYA 4K8RL 3W11D 2GI7A 2GK0A 1VKXB 4NWUL 1XGUB 4HH9A 1XIWD 1WZ1L 3IDUA 4W4OC 5TE4L 5F9JB 1OAUH 3SBWC 1FVCB 2AK4E 1B0GB 5TDNB 3M8OH 3RDTC 2CJUH 2L7UA 4DEPC 3M07A 1RUAL 1RZ8A 3QEGH 2X70A 3JBG7 4YDKL 2VMFA 2JB5L 3KYOA 3SOBH 4WEUD 2BDNL 3FO1B 12E8L 3LKQB 4AJ0A 4MA3B 5E2TL 2ATPB 3VRLE 3C2AH 2R0LL 3WS6A 2X4PA 3JVGA 5D6DA 3V6FA 4PRHB 2FECL 2F74A 1YEKH 4LCIH 1R3KA 1RU9H 4M93C 3M1BB 2R4SH 1E6JH 3U0WL 1DEDA 1U8OB 3DMMA 4MD0B 5DFWH 5E2WL 2QL1A 4ODXB 5L6YH 3P9LA 5DHXB 4YHMH 4FQXA 4KTYA 2IPUK 2YD7A 4QRUB 1DN0B 1A3RH 1FDLH 2WM0A 1AKJB 3BUTA 3S37X 5DYOA 3UROR 4BYHA 1F6LL 1MCDA 5F3BA 1X3DA 4E41A 2GSIB 2J8OA 1FGVL 4RDQG 2PNDA 4ZUTA 4U3HA 2ZSWA 3MX0A 3N1PC 1XCTB 5KVDH 3LMJH 3RWGB 5HYIA 2OR9H 5FEBA 3UAJD 5FYKD 5ALCH 2AXGA 4JO1L 1U8PA 1QZ1A 2ZG3A 3V9FA 1ETZB 4P2OD 2P5WE 5IKCA 2Y6SD 4FFYL 1TJIH 5DT1H 1U92B 2W9LA 2YSSB 3STZB 4MDIA 1A14H 2CMRH 1KCUL 5EN2A 4PLOB 1DUZB 5EUKA 3TPKA 1TJHL 3JV6A 2A0LD 3EAKA 3U79A 4BQ8A 1EO5A 3ARXA 2A6KA 4U1MB 3R06B 5TE7H 1BEYH 2NW2B 5MERA 5MI0C 2R8SH 5A16B 1QBBA 1A6PA 4R0LB 1RIHL 3J7HA 3GSNB 5C0NC 3QYCA 4I5BA 4DN3H 3O2WL 4ZQKB 4QRSB 2DQIL 2YKLL 5TF1H 2MHAA 3U6RA 3P77B 4QHMA 4UV7H 3NIGE 4MDJB 5ERWB 3QEUB 3H3KA 4N0FB 3JWNC 2R1XA 2L7JA 4JFQB 1PKQE 3BZ4A 2FX7L 4M7LL 1CQKA 3GSVB 3MRHB 4Z0BL 2VXQL 2Z35A 3GIVA 1UYWL 3T0DA 1FFNB 1NKOA 1YNKL 3L5XH 1U8MB 3QI9C 1CG9B 3RIFK 3JWDC 4ZXBD 3X3GL 1BD2B 4Q97A 2H45A 4OLYL 1T7VA 5DJ2B 4DN4L 2SEBA 4YZFE 1ZK9A 1PVHA 3RIAK 1X4XA 1T4KB 3QUMH 2AJZA 5TPWL 2F53A 2GJ6E 4KHTH 4Y89A 1VENA 3ROOB 3VXMA 4XBGA 1G1CA 3X3FH 5SWQB 1YEDB 5DUMH 4WEMB 3UJJL 1RZKL 5F7KC 2VH5L 3FONA 1N5YH 4IJ3C 1NPUA 1ZWIB 1BFOB 3VXTA 2OR8A 2CO6B 3GRWA 1I7RA 3BVNB 1A4KA 4XB8A 3OKLA 2D7OA 3LPWA 3EHBC 3SKMB 5IR1A 3VFRB 5DWUL 2H9GA 1K8IB 1HKLH 3I6KA 3K0WA 1NFDE 1SMOA 1U93B 2VDLL 5D7SL 3BPLB 2RIKA 3U4AA 1BM3L 1XR9B 2WIIB 5JO5A 1NFIA 4PJBE 3CK0L 3P73B 3FT3A 4P4KC 4DGIH 1T1WA 3MO1A 4LVHB 3A6BL 5LCVH 1B4JH 4OB5H 4BSWB 4QGYA 5BQ7A 3TNMA 1A3LL 2GAZB 5TGBB 4OCYH 1OAZL 3MJ6A 1KLUB 1IQWH 4EXPX 2VISB 4ZFGL 3W5NA 4K71B 2Y07H 2HMIC 1B3JA 1H0DA 3BQUB 4NN6B 3TCLA 2WSKA 4XVUC 3R8QA 3HB3D 1NMAL 1JVKA 3VXSB 4PG9A 1NCTA 4L4TD 4J23A 4UINL 1KG0B 3PP3K 1Z9SA 3HE6D 1F11B 4KRNA 1CL7L 4D0CA 4AQ1B 5CBAA 1S7TB 3UTSE 2DJUA 3RHWF 5L7XH 2AXHA 2OCFD 3GSUB 4Y4FC 2Q76A 4JKPL 4QRRA 1E4WL 2XPGA 2QKIA 2AJYH 4EDXB 5I6XC 1XZ0B 3VFTB 1Z3GH 4Y2DA 1YNLL 1OP3K 2ENSA 3BHBB 3MLWH 3WKNA 4LVNC 4F9PC 1LP9E 4FZEL 2OS7A 3BN3B 1FIGH 1XT5A 4JANB 1AR2A 3EKCA 4U6YB 2VN4A 3WKMH 1CDJA 4OT1L 5ALBH 4OCMC 1OAXH 3TZVB 1TCMA 1U6AH 5HHMB 3MLVH 3MRKB 4LOUD 2HKFH 4LLDB 1KLGB 1QTYT 3NTCH 2FLBT 2PW2B 5INDB 1FFPA 1R3JA 2HJLA 4PY8J 2B4CC 5CZXD 1QPXA 1EEYB 3ZLQC 4P4RA 1VGKA 2HFEB 4ZO6A 3CSYB 1MCHA 3IB4A 4OIIH 4WFHE 4OGXL 1BIHA 5FYKL 1FSKB 2ARJA 4U0QB 3RU8L 4C4KO 2EDLA 2X7LA 4JHBA 1TCRA 3B9KC 4JR9L 1YC8A 4TNVF 5CIPB 1RQ5A 3MLUH 1A9EB 1DQDH 2EIDA 3OKYA 1IAKB 1EHAA 3ULVC 4UDTA 2AK4D 4ZOBA 2VXVL 4D9RE 1IGJB 5AZEH 4HIIA 2PO6A 5BCAA 1CI5A 1NSNL 1G7PA 4FS0A 4KDWA 1UGNA 4FFWC 1X9QA 1J1XH 1AFVL 2J3SA 2EDQA 3I02B 3HC0A 3NCEB 3VXOA 5IQ7L 3VH8A 5D7LE 4FQJL 4R9HA 1G84A 4NQDA 5C9JA 1G0YR 2CR6A 3VFSB 2NX5E 3ARDC 4JEGB 3UTZA 2VN7A 1JPGB 1X5YA 4X98B 1BVLA 3DIFB 1A1MA 1YPZB 4YK4B 2JJWA 1WBZB 4HJGA 3T09A 5KVEH 3I3DA 3NABL 4ZFZB 3HUJE 4N5EC 5F7NC 3N1FC 2AJUH 4UILL 5BRZA 3GIZL 5D1QB 1S7UB 2FX9L 5MHSE 2W9DH 2Z9TA 3MCKA 1FVDB 4Z7VB 3I6GB 2BFVH 4LLVB 3B5GA 4FP8H 4LEOB 3A67H 2OL3H 1UQSA 4DAGL 5GS2D 5D70H 2G75A 3ZO0A 1I9RL 1H3UA 4Q0XH 4H1LA 3MRNA 2EH7H 4HKJB 3G5YB 3D39D 4Y88A 4YHZH 2A6JB 3U7WL 4HIHB 4X6CF 1CDIA 2DQDL 3C09C 1R5WA 4HK0A 2CLRA 1KUMA 2YPLE 4GW5B 4LLQB 5FHBL 3GBLA 1NCNA 3T1FB 1MHHA 5SWZB 4M00A 2ED8A 3B3IA 4LKXB 4LLYB 4XAWL 3BUYA 3U4BH 1JGUL 1MI5E 4NC1C 4PY7A 4X99A 1R0AH 1NBZB 3CAFA 3RTQC 4L4VB 4R3SA 3BSZL 4PGDA 1S5IH 4P9MH 3RI5F 2PR4L 3RGVA 5EUOE 3KWWB 4HUMB 5B38B 2BSSB 1A7OH 2XQYK 3VDAA 4XPHL 4KHXL 1LE5B 5BXFA 3ARFA 5ID0B 1YMHB 4ALAL 2EC9T 4E42B 2CKBH 3GHEL 1XIWB 1HHGA 5JNYB 3PQYD 5IF0A 1U3HA 1U8KA 1YC7A 3CXHK 5EC1B 5HD8C 3HC4H 4OCXL 4WU5A 3FQRB 1MFCH 5E2VH 1NCBH 3QDJD 4I2XE 4LSQL 4I13B 1W0YT 2W59A 1M71A 5KJRL 3ZYOA 1CTNA 4U1JA 5HYSB 4HPOH 1GXEA 1INEH 1OGTB 2R2HA 4I3RH 3PWUB 2IQAA 3HNTL 4EVNB 3NCYP 2I9TA 2ICES 4GKNB 3PP3H 3REWA 5ENWA 1H3XA 3QEQD 4Z8FL 4NQXB 4HXAH 4JPVH 4NNXB 1IBGL 3MRPB 4BFGA 5D4QA 5E70A 1AR1D 1DLFH 3WS6C 3HI6L 3JVGC 1YYLL 5D6DC 1D5XB 1F8TH 3LDBC 3TH4T 4U1GB 3UZQA 1R3HA 3GMQA 4F57H 1Z0MA 3MRCA 4JKLA 3DMMC 3BDXA 5C6TL 1M7IA 1UWEH 4XVJH 4JAMA 4ODUB 1S9WA 4AH2A 1OPGH 3H6JA 4CN6A 3BEVB 3MMEA 4HHAA 4K94H 4JHWH 3F6LA 5CINL 4MQTB 5LGHL 2IJ0C 4ZFFA 3RWHA 4JCLA 5EULV 4ZTOH 1EAPB 1QA9A 5AAWA 1UVQB 5EU4B 2VDNL 5EC2B 3GSQB 4P2OB 2IMMA 5F7DB 4HMCA 4FQQB 5D71L 4PLKC 4EDWH 1NLBH 3FB7B 4YHNB 2XG5A 2DYPA 2BOCA 5E5MA 2OTWB 3BO8A 4RAVB 2N7BA 5IJKA 2R56L 4G8FB 1A6TA 4WDIA 3TEUA 1J05A 5DJXB 3UZEA 5EBMA 4W6WB 2VKWA 3OKMB 3HZVB 4YPGA 2XXMB 3GMRA 2A6IA 1RK1B 3MR9A 1CD8A 1PYWA 1YYMH 2DDQL 4OCSH 1EUUA 3IDJA 5EORL 5EOTA 5DDHA 5IV2B 5F88B 4CN1A 2PETA 3MLZL 3AFLA 3FN3A 3AB0B 2VDOL 4I48A 5J1SC 3NGBC 4HJJL 1QBLL 4EI5D 3SJVA 5GS1B 4MWFA 4LCWA 3ZL4H 5KSUA 5KBNC 2JIXD 3OB8A 1Z9LA 3CU1A 3U4EB 3VI3F 3PGDB 5FF6A 3VXRA 4ENEC 1NAML 1UXWA 4MXVF 4CMHC 1HQRA 4OD1H 3VG9C 1Y0LB 5F89A 4TUJA 3RUGB 5BV7C 1MPAH 3HFML 1NAKL 4PJCB 3P11L 4X4YB 2XG4A 5C0EA 1U8NB 1MFBL 4Y0GA 1A7RL 4UOW0 5DR5L 2AEIT 2Q7YA 5AUMB 4PJ5E 5I76B 3MXWH 4ZXBB 4Z7UE 4ZSOE 4DW2L 5I1KL 1U58B 4QKXB 2W65B 1FGNH 1BBDL 3N1GC 3C60A 1Z6JT 1UCBL 5DD1H 1UH4A 3I2CH 3REVB 4HUWA 2IQ9H 3TWCH 4MNQE 5MENE 3UTTE 4PRBB 1YN7A 1IAII 5CEZH 1VFBA 1NC4A 1IL1B 2Y72A 3QG6A 4OLWL 4PJ7A 1SJVA 1SVZA 4PP1C 3HNSL 4XCYA 4AIXA 2WAHA 5D1ZD 4O58L 4NQSB 3BPNB 5HHOA 5F93C 1MAMH 5B3JF 5DS8A 1S5HB 3VXUE 1EO8H 1QRNA 3LZFH 4RZCB 3SDXF 3P0YL 1T2XA 1MH5B 4J3VA 4HWUA 3MLSH 4NQCE 2EEDA 3ULVD 1SBBA 2BXZA 5ICYB 4OUOA 4L1HA 4WI4A 4LPUA 4LKCB 2BX5A 1CFSA 1OSZA 1MHPH 4TNVK 2YRLA 3V6ZA 2V7HB 1GZPB 1FE8H 3E6HA 1KPVA 1QFPA 1T83A 1SEQL 4YAQA 5JLZB 2BNQA 3SDAA 2X4SB 3CFCH 3PWPA 5CKGA 5DSCB 4YDIL 2N4IA 3L3DA 5I1AA 3IDYC 1M6OB 5I19L 2FB4H 3GKWL 1EGJH 5L2KD 4KJQD 1R5IA 3K7UA 1X44A 5I1EL 3OAUL 3NFPA 3OKOA 3MYJA 2EZ0D 2LABA 4JREB 1B4RA 4L4TB 3MOAL 4N5ED 4TN9A 1ORQB 1HNFA 4BQBA 5CEYB 1AE6H 5I8KH 4U1HA 3O3EA 1A9BB 2BXYA 3HE6B 5DVLA 4QF1A 1T0MB 3RL1A 5DK0A 4P3DB 1HNGA 4ELMB 1B9ZA 2XWJA 4PJFB 3JWDL 5E9DA 3LD8B 1ACZA 4KROC 1S7QA 5FV1L 3GM0A 1FZJB 3NCCB 15C8L 1BQHB 1A1OB 2P5WA 1QO3B 3QQ9C 4NP4H 1IAOA 3U82B 4HXBH 4OKVB 4OZGF 1ZSDB 1RHFA 1KPUA 3M8OL 1LMKA 3UXFA 1CBVL 3HMXA 5SWSD 2V9RA 4Y2DC 5CJ5A 5C2UB 4U2ZA 4JO3L 1DQTA 1AXTL 4PJEF 4OLVH 1ACYL 1U41A 1HXMB 4R4FH 3ARGD 1DJSA 3I50H 5KW9H 4H8WH 3SOBL 5L88H 2ZSVB 4GXVH 1RJYB 2VLJE 1VERA 3WSQH 1DQJA 5ANMA 3T1WA 4PJGB 1AQDB 3C2AL 1G6VK 3IKCA 1KGCE 4DVRH 1MI5D 2ARWA 1YJDH 4UIKH 4H1LG 1YEKL 1BWMA 4HV8B 4LCIL 1OGAE 3ZHLA 3DO7B 2NTSP 1HOCA 5L6YL 4JB9H 1EVUA 4M62H 3DX7B 3WFDH 1WJ3A 3QIWA 3L5WA 1KIQA 3C8KA 3VA6A 1G7IA 4OV6F 4QOKD 1OLLA 1EH9A 3P0GB 3QFDB 2VL5B 1IEBA 4KK8C 3V0VB 4MXWH 5A2JH 3B2UC 3FO9A 5L0QC 3RI5K 3OKNB 1HQ4B 5CWSB 2B5IB 1AIFB 1UB6A 2AK4B 4JJ5A 5HD8D 4MA1C 3S3SA 5KVDL 4BQCA 5CEZE 3LMJL 5EWIH 3QFJE 2OR9L 4Y16A 1MFNA 3KAAA 1CWVA 5ALCL 4KFZC 1U3ZA 1RI8A 1A7BA 4EN3A 1ZT1B 5HVFB 2PO6C 4HUUA 4DZBB 3O9WD 4BA8A 2UYLA 2MPAL 2DL2A 1AGFB 1NAMB 4JFZH 3FFCA 3WNPA 4LGRB 5CZKA 5D2LA 1BEYL 4OZ4B 3WFHB 5IQ9B 3G04B 4Y4HA 3LKOB 1CVRA 1AD9B 1L0QA 2YD1A 4LQ1A 4CU8A 4CVXB 3S36H 1I8KA 5D7JD 1U0QA 1X5AA 3TYFA 1J8HE 1SMAA 4DN3L 5DD3L 5H94A 2EXWC 1NFDA 4HKBA 4LCYA 4PBWD 5TF1L 4XWGH 1DUYA 1I3VA 4NO3A 3HI5H 3O2VL 5HYJA 4UT7L 4OZHA 4FQXD 2VUOA 2ZUTA 2AK1H 1FNGA 2WMPA 1EA9C 1J8KA 2I26N 2B4CL 1D5MB 3EFDH 1UJTA 2P42B 1WLHA 3CH1A 3O8XA 4N9GA 4XP1L 5CJOH 2X4TB 4PLKD 3U0TA 3CX5K 3D39B 2UY6A 1XF4B 1JNHA 3FQWA 1KIPB 2WUCH 3PGFH 1U8JB 4S1QL 4FXKA 2ZOLB 4ZPTA 3QQ4A 3CZFB 4XP6H 4U6VH 2Y4SA 4NZRL 3ULVL 2DICA 5CGYC 5MI0B 4UU9B 4P59H 2WBJD 5BVPH 4I8DA 3UTSA 4PJAA 1JRHL 4NO5B 1XF5B 4JO4H 3VWKA 1OAKL 1F4HA 4MNGA 3IFLH 4N8VB 1N5YL 4L5FH 3N85H 4JKKA 3BWUC 4IOFD 3RKPA 4JFXA 4KRPD 1T0PB 5T3XH 1V7ML 4HX1B 4JQVA 1KB9J 4ENED 1LP9A 3GB7B 3RGVC 3HCVA 3BISA 2HTLD 3LEYL 2FL5B 3VWJA 3IFPB 1K6QL 2R0KL 3PQYB 4HWNA 5JQHC 2W0LA 1EXUB 3ARFC 2EYSA 1QYGL 3SGEI 4WHYH 1FN4B 5KS9A 3QDJB 5EIVA 1S3KH 1U3HC 2EIZB 4PYHA 4DGIL 3AVEA 3DGGB 3QI9B 4S1RL 4DQOL 5FOBB 5LCVL 1B4JL 2HVJA 3EOAA 2C3VB 2FSEA 1UEYA 2O5XH 4HUVA 2V2XB 4KV5F 3OKKA 4OCYL 4Y5XB 1I85A 2XNAA 1G9MH 5EU6D 1IQWL 4ZDHA 5J11B 1EZVY 5MEND 3UTTD 1NGWA 2GITA 4N0UA 4I4WB 3ILQC 2A83B 3QEQB 4PP1D 4L8DA 3O6LH 5E08L 4YQXH 2HVKA 2F53D 2X4NB 5T1KB 3V7MA 1JUFB 3VXMD 1K4CB 2NY4C 3TT3H 4UDUB 5KSBF 4Z18A 3HI1A 2JCCB 3TBYA 3BPCB 3WNNA 4RGOL 3K1DA 5IBUG 2CK0H 2J5LC 2CIIA 1C5DA 4XAKE 4R4NC 4QT5B 2DS4A 2GJZA 2F19H 1NGPL 3LIZL 3WUZA 4PJBB 1ZGLP 2P8LA 2NX5A 2E8YA 1I75A 5IMMA 1AO7A 5JHDD 3WKML 4X6DF 4PTTB 2ADFL 1OAXL 5HYEA 1U6AL 2CDGB 1YN6A 3LKPB 2IPTL 4X0KB 1RV6X 2Z0BA 2APWA 4EI6B 4I9WE 4JM2F 2AEPH 4QTHA 3RPKA 3DHJA 3DYOA 4KZEH 3WLWD 5ESVB 5E56A 5IJKC 1ZEAH 1J18A 3OR7A 5ESQB 3Q6GH 1HI6B 2ESVA 5HDOA 2W9EH 1J0ZA 5F7EH 4OFIA 5AZ2H 1MCQA 4OIIL 4U6XA 3HAEB 4H25B 2HG5A 4M6OH 2AKRB 3TBSA 4EI5B 4UQ3A 5J89A 1A4JB 4ZO9A 2IGFL 4KROD 3S97C 4HIJB 5DHYA 2JIXB 3MLUL 3C5JB 3BGMB 5KSVB 1FL5B 3IYLW 3QQ9D 1U8LA 1NCDL 4OSUL 1ZANH 4LPYA 5CSGA 5BW7C 4QRRD 1DANU 4J3SA 2XTJC 4LVNB 1ZHLB 1MQ8A 1Z2KA 2LVCA 3CLFH 4MJ4A 5HDQH 2NW3A 3X11B 3GSRB 4P46D 1YEEH 1YA5A 3GSXB 4D0DA 5GRJH 4ISVB 4OLEA 4YC2C 1YEGH 3T77A 5T3XE 4WJ5B 2AV1A 5GGRB 1HE7A 2VLJD 2DM7A 1TTUA 4AT6A 1S9KC 3AUVA 1XGYL 4X8JA 1P2CB 1G9EA 2P45B 3ILPB 3C60C 4QWWD 3E0GA 1OGAD 4MGXA 4PRNA 4Y5YA 4LCUA 4PB9H 3R8BB 5D5MA 5F9DC 3JWOH 3KPOB 4FQHB 5D1ZB 3FCTA 3OGOE 4RFNC 5DRZB 1I9IH 5D7IF 1MCCA 5C09A 1Q0YH 3CFEA 2W9DL 1I3RB 1I1RA 4LLUA 3T0EA 2BFVL 2X9XA 3B8YA 3B2UD 1U95B 4FP8L 4NRXA 3QFJD 2OL3L 1LO5A 2GJJA 1V8HA 5EO0B 1T1ZB 1KCSL 4WW2F 1B2WH 2R4RH 5D70L 3NZ8A 4PJIF 5GGQH 3V6OA 3IDNA 4Q0XL 3N1MC 3ULSB 4K2UH 2PO6D 2EH7L 2FATH 4NFCA 4PBVC 4JQXA 4YHZL 1AD0A 3VRJB 2CXKA 2HT3D 1RIUH 4WUUD 1C5BL 4KKLC 3KG5A 3QNXB 4NYLA 1T83C 3OKEA 4FQ2H 4YEEA 1GAFL 3QJFB 3SDAC 3WFBH 2G60H 4CAGA 5L2KB 3F5WB 4RRPG 2XZAH 2R0WH 4AL8L 5C2BH 3LN5A 2RJMA 4GRLA 3U4BL 4MJ5B 3KPRA 3TBWB 3OAZK 1R0AL 1K2DA 2EH8H 3HUJB 3X14B 4YHLH 2YRZA 4X6EA 5BV7L 7FABL 2NXZD 5E8PA 1CD0A 1J8HD 5CSZA 5DD5H 2EXWD 1A7OL 1Q8MA 3DXAE 4BKLB 3KPPA 2VXSH 5EO9A 4X6CE 4F7PA 5GZOC 5C07D 5C0GA 4LDEB 1JTPA 3ABZA 1IGCH 3HC4L 4XNYH 2V2TB 5I1LB 1Q9OB 4X5LA 1NCBL 2DL9A 4GG6B 5F7HA 5FM4A 4U1LB 5SWSB 4N68A 1GRWA 4NM8L 3T65A 2ICWB 4HPOL 1BJMA 5ACZA 4POUB 4IM8A 3QUYA 1HYRC 1D9KA 1RHHB 3RWJB 4I3RL 1A7QH 3ARGB 5DA0B 4L8BA 4RX4A 1QKZH 2RFXA 1NC2D 3BKJL 3L95B 4HUNB 4JFEE 3S37L 3S8WA 5KAQF 1OM3H 2EICA 4N8CH 3GRWL 1MI5B 3LRGA 4KJWC 4HXAL 2YHGA 4JPVL 4EQ2A 1RSFA 3L3HB 4ONGL 2PTVA 3KGRA 1DLFL 3MRJB 1F8TL 2E6JA 2E9BA 5EUOB 1NEZA 3D6GA 5LAXB 2ZCHH 4JG1L 2XA3A 4F57L 3RX7A 5CBEA 4QOKB 5AD0A 1G7MB 1D5BB 3B9DA 5JPNB 5LQBL 2LTQC 4FXGA 2D7MA 4XVJL 3P4OB 4GAYB 3CFBA 2CIKA 4U6TA 3QIWC 4NDMA 4CJ0A 4K94L 5BOZG 2GK0B 4AEHL 4F37F 1NCUA 4PJHF 4HH9B 1XGRB 1QBAA 4FTVA 2DBJA 2DQJL 3HR5A 3HLAB 3NVQA 4EDWL 1IEAA 4U31A 1NLBL 4Y16C 3WHXA 2BHUA 3GJFK 3O9WB 5C0CA 3QULA 4EN3C 1L0YA 4U1IA 1TZHA 4CUCA 1OTSC 2HFTA 4DOHE 1I9EA 3IJYB 1FH5H 1RZ8B 3AS0A 2X70B 3MA7A 4U7SA 2IFGA 2VNCA 5E6IA 4PGEB 2ZKHH 1YYML 4F33A 1ROWA 1VSCA 1LEKB 3DX8B 4NQCA 4Q6IB 5D7JB 4YDJA 3V52H 3Q2CA 4Y4HC 4J12A 3ROLA 4M8VA 3BDBA 3GFUA 4X4MA 1R3KB 4K7PX 3SY0A 1VACB 3FKUS 1BZ9B 2JKXA 3W2DL 3P9LB 3ARTA 4UNUA 3N0PB 5ADPH 4TUOB 2XKNB 1I9JL 2AGJH 4OD1L 4XAKD 4FQXB 3DROA 4H0GA 1N8ZA 4M1DL 1F6AB 2HT4C 1OARH 2WIMA 4JHZA 3EDEA 2QSCH 2XQBL 1MPAL 2ZSWB 5ITBL 2X10A 2JJUA 4UZGA 1R24B 4PRPE 1DVFA 2OBGA 2AXGB 4AENA 5L2JA 3O8XC 4WCYL 3ZT6A 2V5MA 2MFNA 1QHOA 2RCSH 4O2FB 4OV5B 2OK0H 5DD1L 4X7CC 1BGXH 2OL3B 3VI3E 3TWCL 1SY6H 3NZHH 5EN2B 1EIBA 2KZWA 5EUKB 4MXVE 3TP4A 1G9NH 1SJEB 1J86A 1FLRL 3JV6B 1LO3H 4HEPG 5FXCH 1JWMB 1T80A 1HDMA 3NA4A 5C6WH 3ZDZF 1RMFL 2IALA 2WLYA 2ED7A 5SX5H 4QTIH 2NY1D 2J1KA 3QUXA 3QCUH 1EO8L 4G6AD 3LZFL 4ZO7A 4KKCD 5F44A 5C08E 4KRPB 3MLSL 3VWKC 5FKAA 3WIHA 4NT6A 5IB2A 3WDHA 1PG7X 3TYGL 3LKNA 4HD9A 4I5BB 4LCWD 4CMHB 3E3QC 3VG9B 5FB8A 3PIQB 1WFUA 1GH7A 5C6PB 3LPFA 2MHAB 4JQVC 3U6RB 4QHMB 4UAOB 3VXRD 3RVWC 2C3XA 4LBEB 1J9CT 1T2QH 5AAMA 4KI5F 3VWJC 5I0DA 4GXUN 1FE8L 2D7NA 5DC0A 4JM4L 4MJ2A 5T3XD 1KEMH 3BIKA 2BSRA 4Z7UB 4ZSOB 3CFCL 1JFQH 2Z35B 3GIVB 2DJ4A 3P3YA 5B3JE 3QDGE 4NNPH 5DVMA 1I1YB 4P2QE 4JFDE 3SDXE 4WHDA 2UVFA 4ZOEA 4LQFH 5EU6B 2FB4L 4LVEA 1EGJL 1LWRA 3MV01 3MLYH 4LCCA 4NM4H 3UTTB 3C60D 3EYUH 4OGZA 1UZ6F 2W38A 4Z7NF 4KUZL 1I85C 2SEBB 4G6JL 2QQKH 5FO9A 4ZUUA 4XPBL 1V3JA 3WXWL 2XZCL 4HAGA 3PHOB 1U3YA 2AJZB 4DKDC 1AE6L 1KJMA 3T4YA 3B43A 2F53B 5TDOA 1S9XB 4HBQA 3BFOA 3VXMB 2WWKT 1JGLL 2YN5A 3EO0B 2FJGB 2EYRB 2Q8BL 3FQNB 3IRZA 1R3LA 1SJHA 1X5HA 3U7YH 3VXTB 3TLRA 1I7RB 4NP4L 3NCMA 1A4KB 3OKLB 4YE4H 4DKFH 3W39A 4PPTA 3FB6A 3TJHD 4MYWB 3MJ9H 4YR6A 1C1EH 5F6IC 3RNKB 3UCRA 4XHQA 3N9GH 5J3HC 5DMKA 1J0YA 5C0DB 2K3TA 3O41B 4R90L 5JHDB 4KK6C 4OF5A 2DLTA 4OLVL 4RFOH 5JO5B 2XKUA 1T5WA 3I50L 5ICZA 2IPUG 5ITFB 4H8WL 1T1WB 3MO1B 4GXVL 1NFKA 3SKNA 1ZLUK 1QFWH 3PWPD 3RWDB 4JPWL 4YHOH 3WSQL 2R2EB 5E8NA 1KCRL 2FLRT 2FEDC 4UNVA 2DD8H 4E5XA 3E8UH 2VAAB 3RY4A 1OHQA 4Q9BA 1H0DB 5HI5C 4OZGE 1T1YB 4BH7A 4XWOC 4LSUH 4PG9B 4M62L 1GGCH 2GY5A 3WFDL 4ZUSA 3QJHA 4PJEE 4JRYE 3KPMB 1K5NA 2Q87A 3UP1A 4KROB 2DQTH 4D0CB 1T7ZA 5GZOD 3KJ4B 4TOYH 3C5ZA 4J4PA 4QRRB 1H9VA 3RBSA 2ICEA 1TMCB 1YY8A 3GJFH 3QA3A 2FGWL 5HHXH 2VZTA 5IHUH 4WWKA 4Y2DB 4JY5H 3VFGH 4G6MH 4P46B 2X42A 3QDME 3F7VA 1K4DA 1J0JA 2FDBP 1P69B 3U36B 1YEHH 3FJTA 1PQZA 4EQ3A 2VLJB 5ETUB 4JFED 4XZUA 5C0JB 5ISZE 1JNLH 3MODH 2VIRB 5FA4B 4LP5A 4GLRH 1GCFA 1KC5H 5L8KB 1OVZA 4CVUA 1T5XB 3MOBL 4QRQB 2LQRA 1BZ7A 2Z91B 1HHKB 1OP5K 4LSVH 4QXGH 4Y5YC 3VJ6A 3HZYB 1G6RA 1U8IA 2Q86A 1WAAA 4HUXA 5T3ZH 1LVEA 1LEIA 1NMBH 5FUOL 4M7ZC 3HI5L 2X7LB 3SKOA 1P9MA 3QIWD 4L29B 4D9LL 3F7QA 1CU4L 2YEZB 3QFJB 3PXJA 3T0EC 2V17L 3R0MA 4GRMA 4HK3J 1I4FA 3EJZC 3TH2T 5CILL 4WUKH 2OYPA 1K9TA 3D69B 1HHHA 2VLKD 3S88H 3VFPA 1NEZG 4O2EB 3IGAA 2PO6B 4Y1AD 4Y16D 3B9VA 4XPFL 1IGYA 2NZIA 3MLTA 3V6OC 4HWBH 4F37K 3UPAA 2WUCL 4UT9H 4G8GE 4WUUB 3HC0B 4OQTH 3VXOB 1OD9A 3HG1E 4JQXC 3VH8B 1KV3A 2NMSA 2R69L 4XP6L 5IESH 4U6VL 5DGQA 4XNQA 5M94B 4P59L 3FFCD 3O11A 4APQD 3DWTA 5DI8B 2AVGA 1JWSB 5C70A 2BERA 1F58H 5GISL 4R8WL 1DSFH 4U05A 3EYOB 4HDIA 1A1MB 3H9YA 2NXZB 1HKFA 1L9NA 1J8HB 1OTTC 2H6PA 3N85L 3O2DA 4GRLC 5EZJB 4ZODA 3BKCL 4LPCA 5C92A 3UDWA 2EE9A 4OF8A 5T3XL 1UJ3B 5EU7E 3MJ8B 1PZ5A 2IADA 3EDDA 2BSTA 3PUCA 4I0PD 4EOWH 2EEAA 3QO0A 4TVPH 4Y8DC 5C07B 3UYRH 2A9MH 4LMQE 5HYJD 1YPZF 3RWEA 4V1DD 3TNNA 2MNUA 5I71B 1OB1B 5CLWA 3G5ZB 1CLZL 4DK3A 1UQSB 1T0NA 2G75B 3T8XA 2ICWJ 5EO1A 4ZS6C 3DRQB 1JPST 3RY5A 3NAAL 3O8XD 3JV5A 1UG9A 3IU4H 3OF6D 2DJSA 2FYYB 3MRNB 2UVEA 1J5OL 4XI5D 3DSFH 1BX2A 4BSJA 1KTLB 3QUYC 1NC2B 2YD9A 4Z7VF 1D9KC 5EB9A 4NKDB 4QCIB 2CLRB 2HN7A 1BQUA 1Q38A 3TC9A 4GMTH 1L7TH 3G08A 1KNOA 3B3IB 1GGBL 3BUYB 5FGBA 3SDCA 2BVPA 4YDLC 4PY7B 5C08D 4X99B 2DQUH 4KTDL 3TIEA 2W60B 1DBML 3EYVA 3GNML 4RIRA 4KV5E 3RGVB 2EDTA 1HXYB 2H41A 2GUOB 1RUQH 5IVNA 3TBVA 3KR3H 2H3NA 1N64L 1UT9A 1L6XA 5DF0A 2Y06H 4R97C 3RVWD 1WICA 4CKVX 3I75B 1IGTA 3VWJD 5EU3B 3MRRA 4QGTA 1HHGB 4LPTA 3INUH 5DO2D 4LSRL 4MJIA 5B39B 1ZLUH 4JHAH 1RZ7L 5E5RB 3MRIA 5IM7A 3D25A 2EDOA 5EZLA 4JFDD 1FZMA 5C3TA 4NZTL 3BP4A 2BZDA 2D7TH 3UTPE 2DAVA 43C9B 3LHPH 4K7PH 5KSBE 1Q0XH 4RAUA 1JMXA 2AEPL 2XN9E 3BH8A 2P5EA 4KZEL 1ZEAL 3GMNB 2IQAB 4FQCH 2H26A 2HLAA 1J10A 4HFWB 2I9TB 2CGRL 2UUDK 5F7EL 5AZ2L 5E6IC 5JUEH 2EKSB 2H2SC 3REWB 2AABH 2ZCLL 1YQ2A 1HILA 3A0OA 4RWYH 4YGVA 4X6DE 1LEGB 1JYXA 5GRVL 1MREH 1ZKAA 2QADD 3O3DB 3MBXH 6CGTA 5IOPA 2PTTB 5H2BA 2HJFA 2J5LB 4L8CA 2C7UB 4CVWA 4UIMB 3MRCB 1MIML 3BKYL 3BT2L 3PWNB 1WITA 1TDQA 4RFEA 3K4ZA 1S9WB 3MRGB 4AH2B 2P24A 3MMEB 4HHAB 2D0GA 1QHPA 5J3HD 1FFRA 1Q9KB 3RWHB 3MUGA 1A0QH 2E6PA 4FABH 1RZJH 1YEGL 3LRHA 4LRNH 2OXHA 1AO7D 5KN5A 3IJHA 2QHRH 4AZ8A 4JZJB 3P2TA 3BP6A 5KOMC 3C2SA 1C16A 2NY5C 1DVFC 1IC5H 4TVPE 3O4OC 2DYPB 1PG7H 3BO8B 2HWZH 1BIIA 1GPOH 2FEDD 1CR9L 3U9UA 1J05B 1M4KA 3BKML 3BGFB 3DXAA 2F5BL 5HI5D 1K8DB 4PB9L 4AK1A 5IFJA 2Q1EA 4YPGB 4K3JL 1FHGA 4YNYA 4MX7B 3GMRB 2A6IB 1H8SA 4KVNL 2IBZY 4X6CA 3MR9B 4NUJA 4YO0A 3D85A 4Z7WA 4FXLA 2NY1B 3IDJB 4Y4KD 5EOTB 5DDHB 1DQMH 3OB0K 4JRYD 3K74B 3QCVH 4G7YH 2OTUA 3EDFA 3QUXC 3ZKQD 2J8UF 1IM3A 2E5EA 1AGDA 2ID5A 4LCWB 2VZOA 4MWFB 4B50A 4J3TA 1EBPA 1F3RB 5DZLA 5KSUB 4ZUVB 4FN0A 2VOTA 2DKUA 5D8JH 4YFLF 1F4WH 3KXFE 4NO0A 4ORGB 3VXRB 2A6DB 1OY3B 3WLBA 1B2WL 1UXWB 4XPTL 3HZMB 1CGXA 4XVTH 5GGQL 3UPCA 4N0RA 2XWTA 1JWUB 4JGUA 2FATL 5IK3B 3QAZC 3GKZA 1FFOB 1TZGH 4PUBL 4MSWB 1AGEB 2H1PH 4HS8L 2XQYG 5D7IE 2OQJA 4RNRA 4GW1B 5CD3B 1M7XA 5C0EB 1F2XK 4HWEL 1DEEB 3BRDA 4HULB 5KZCD 3GMLB 2FWOA 2XZAL 4DUWA 2R0WL 5JW5A 1ZGLB 4NCC1 2E9IA 3C60B 1FVEA 4A2MA 1CXIA 1RJZB 5I30L 4YHLL 3KNBA 4FHBD 4NQUA 3RUGF 4LCCC 5IMOA 4PJCF 4PJIE 1YN7B 1ZHBB 2PYFA 2VO5A 1VFBB 2VLME 5DD5L 3CPLA 5JIKA 3RVTD 4PJ7B 4BUGA 1KB5A 3GDBA 5HHOB 2R29L 4X8XA 2VXSL 3WE6B 3BJ91 5DS8B 3AROA 4DFIA 3BYTA 4RGND 2JJSA 1BJ1J 1IGCL 1IKFH 3FO0H 3QUKB 3LOWA 3B4NA 3FAWA 3ULUC 4ELKB 5DJCA 4OZFA 4GUPA 5C7XH 2DWEA 1A6AB 1QLFA 3V6ZB 4ODBD 1A7QL 5GGTA 5JOEA 3TO2A 3WJLA 4K23L 4YAQB 2HT2C 3V8OA 3JV4A 3BPOB 3PWPB 3DX6B 2VXUH 1S7XB 1AH1A 1LD9B 3ZE1F 3L3DB 1VADA 5KSAD 3V5KA 1FL6A 1R6VA 2ITCB 5TH2A 5LXGH 4XNMA 3IVKB 1OTTD 2MJWA 3MYJB 3KPRD 5FYJE 1GL4B 4OM0H 4JN2B 5C0FB 3S4SB 5E7BA 1J1PH 1OL0A 4MCYA 4S0TD 4M6NH 4DWHA 5BJTA 1V7NL 5ESAA 4U1HB 3O3EB 5ABDE 5C8JB 1AI1L 5CHNA 3X13A 1E4XH 3RL1B 4NCC2 1PD6A 2R2BA 4PB0L 4GAJH 2F54E 5DTFB 1YEIL 1S7QB 1CD1A 3MJ7A 1BBJA 5HHPB 3SN6N 4ODVL 4NRZB 3C5ZC 4CJ1A 3IRPX 4J4PC 1X5JA 3EW3B 2O5ZH 5I75C 4HBCH 4XMLH 4ZS6D 4WWKC 3ECBA 3D5OF 2EE6A 2FBJL 3GSNH 2GKIA 1EEZA 1T22B 5ID1A 4PGCB 4JFEB 4KKBD 1JK8A 4M9PA 1AHWA 2UUDH 1AJ7H 2O26U 1MCNA 4YBQC 5E1HB 3SGDH 4RX4D 1EFXA 3MV8D 4B41A 1YY9D 2ILLA 2W0KA 3IDXH 3NFNB 1LQSR 5ANMB 3ARQA 4PJHE 1NKRA 1MCPH 2BY3A 2J6EA 3LSOA 4LHUD 1UEMA 4P3WA 3UX9B 4PTUA 3LEXB 5DMYA 5JA8B 4K3DL 4LK4A 2YPVH 1C8PA 5CEXA 2RAMA 4POYA 1HH9A 1OAQH 2IF7A 2LTQB 4WFGE 3KPNA 4JRWA 3PDOB 3QIWB 1JV5B 1YJDC 1KIQB 1S7VA 2H32A 3L5WB 3C8KB 1JPTL 5E8EA 1OARL 3QPXH 1IEBB 4PJGF 3S6CA 2QSCL 2K7PA 1P9MC 3W0WD 3CDGA 4BJLA 3QDGA 3D3VA 4NRYA 5AEAA 3GMPA 1QSED 5DRNA 4P2QA 2VLKB 3SDXA 3ZTNH 4NZJA 2C3HA 1GZQB 2Z31A 3BEWB 5T3ZD 4Y1AB 4Y16B 4FTVD 4TTGA 3G5XA 4NZDA 1IVLA 1IILE 4HUUB 5FM8A 2EEBA 3F7RA 4YIQB 4WY7H 2D7QA 3ESUF 1YDPB 2UYLB 1SY6L 3WD5H 4ZFOA 4GXUM 3L7EA 4HFUH 1LO3L 3FFCB 1QVOA 4Z5RA 4APQB 3OB0H 4PREA 1CFNA 1KB9K 2YXFA 4KKAD 2A73A 3TO4D 1KEGH 4QTIL 4WHYG 4YFLI 1Q72H 5E24E 4PFEA 1L0XA 1OAYH 1NBYA 5FCSH 2VTFA 3MV9A 3NACL 3BZEA 2Z4QA 3L3JA 4JM2D 1SEBB 1U3JA 1Y6NR 1HSAA 4I0PB 4K8RH 3UDWC 4QHKI 2PW1A 1LNUB 1WIPA 2C3GA 4NWUH 4LCYB 1X5GA 4XHJD 3ESVF 5I16B 1DUYB 4NO3B 3C6LD 5JOFA 1W8NA 2COQA 3SO3C 5HYJB 1JI1A 3V5HA 1T2QL 2YA0A 1JPFB 4OZHB 4V1DB 1FNGB 5TQ2L 1UB5A 4HAFA 4JDZA 3BN9D 2MCG1 3ZDZE 1QR1A 3OWEA 1JFQL 3CH1B 4U1KB 3QPQC 1S7RB 2D2OA 3KLSA 3BE1H 3O8XB 4NNPL 3P30H 1RUAH 2JELH 3U0TB 1F97A 3PWLA 2NY2D 4LQFL 4YDKH 2G5BA 4NM4L 5CP3H 5F9WB 1CLOL 1NUDA 1ZOXA 1ZVYA 12E8H 2Q6WB 3ZZ1A 4ZUWB 4JFPB 3PL6A 5EH1A 3CXDH 5B22A 1A6WL 1PAMA 4OI7A 2R0LH 5CD5C 3WDIA 4I18A 5CLTA 4PV8B 1UENA 3EYSH 4KI5E 5E8OB 3U0PB 5C08B 5JW4N 2DM3A 2Y23A 3U0WH 3ARWA 5E2WH 4LPVA 4ZTPL 5FGBC 4U0RC 4MNGB 3SDCC 3QHFL 5B21A 3RKDD 2I27N 4GAGL 3Q48A 3TIDA 3ZT5A 4PJ8A 3KXFD 2D3VA 2FRGP 3DGCR 3QDMA 4DKFL 5IHZA 3MJ9L 1DQLL 1HHJB 3HCVB 1UKTA 1IT9L 2OM5A 1UZ6E 4Z7NE 1C1EL 3VWJB 4K55A 2CDFA 1CVSC 3WO3B 4FMFA 4S2SA 2EYSB 1DQQA 5DQ9A 2YBRA 5ISZA 2O61A 1MNUL 1Y18B 2NCMA 2ZUQC 4JFDB 1ADQA 1REIA 3MYZA 3MRQA 2VITA 1H3PH 2HVJB 3EOAB 1KCUH 2FSEB 4J6RH 1QFWL 4M61B 1BD2E 1IRAY 1TJHH 2CXGA 4GJTB 2NYYC 5CIPH 2CDEB 4TUKL 1GHFH 5IMKB 3D2UA 4PP2B 1FNSH 5BOPA 3CLEH 1MHCA 4WI6A 3GO1H 1BQLL 5AG9A 1H8OA 4RWHA 3WNLA 1JF6A 1RIHH 1TQBC 4N0UB 5I1CL 1JYNA 4P3CL 5DJDA 1GGCL 1ITBB 4AEIL 4CMMA 2N56A 1L7IL 5IGXL 3KLAA 3O4LA 2QADB 2DQTL 5A40E 1CIUA 4JE4B 1CIDA 4R26H 4Y8AA 2DQIH 3W81A 3DURB 3S98A 4HGMA 3WL9B 1W0VB 3S5LG 4JPIA 4P48A 2W92A 3TBYB 1TTGA 1M7DA 5J9PB 4WO4D 1II4E 1H15A 1URLA 4WU7B 5HHXL 5IHUL 3HG1A 4M7LH 2FX7H 4G6ML 3VFGL 3IF1A 1VEMA 4KI1A 1YUHB 3BH9B 1EDQA 4Z0BH 4AYFA 2GJZB 1W0WA 2Z8VC 1UYWH 2P8LB 1CQYA 1YNKH 5BS0E 4LLWB 3FRUA 5E4EB 1YEHL 1AO7B 5K93A 4JFHE 4IRSA 1U8HA 3G6JA 2JCCF 4ETQA 4OLYH 4XCNB 1JNLL 1YN6B 3U2SA 2OJEA 3PXHA 4DN4H 4KUCD 2Y1VA 5D96C 5DA4A 3L1OL 5TF0A 4OZGB 4K9EH 2DLFL 5DXWA 3KPSE 3T0WA 3RWCA 1NBQA 1QSFE 4OFYA 2FO4A 4PJBF 3VXSE 4D2NA 1INQB 3DPBA 4LSVL 3MGTA 4L4JA 5HSFA 5IB3A 1KTDA 4Y4KB 4QXGL 4PJEB 3CIQA 1RZKH 4JRYB 2EO9A 5T3ZL 5DQJB 4NQEA 4U6XB 4JFFA 1NMBL 1MFEH 3TBSB 2D4DA 5D9SA 5JZ7D 3WV0A 5C0RL 3WS3B 4MJ6A 4U49A 4LU5H 1LE9B 2CLVA 1WIOA 3IXAA 3QXTA 4LVOB 3TN0A 3SEPA 5I1HH 4M02A 2IG2H 5DWUH 3CGTA 5T1MB 4W68A 4DGVH 5C9KA 1KULA 1U8LB 1KOAA 4ZYKB 3SDDA 1UXSA 2ZUUA 2FO1A 1DE4A 1QLRA 2R9HC 4WWKD 3EOBA 3UYOD 4HWBL 3RZCA 5GQBA 1CDYA 3GJFA 4BH8A 3GGWB 1MHEA 4OQTL 4D0DB 5HHME 2DLIA 4GT7A 4MD5B 3T77B 5KZCB 1OAZH 1FNLA 1ZAGA 1FNHA 2BY1A 3QHZL 4G80B 32C2A 1D6EB 3PWJA 2QR0B 5DJ0A 4AT6B 3FQUA 5ILTL 1F58L 1FZKB 4UNTA 1NMAH 2E3VA 2X05A 5BZDA 1PGRB 2DQFB 3KJ6L 3P9MA 2YC1B 4Y5VB 2OZ4A 4PD4J 4PRNB 4AG4L 1EK3A 4WFGD 3FCTB 1CL7H 1QSVA 4R6UA 2OP4L 3IFOA 4M7ZB 4MHHI 3MUHL 3CFEB 4CL7A 5DJAA 3UJTL 1HH6A 4EOWL 1CICD 4JKPH 5IMLA 2NY5L 1E4WH 3MV7D 3FT4B 4RGNB 3UYRL 2A9ML 1KJ2A 5IG7A 3PWVA 2FEEI 3AY4A 2D03H 4S1DD 1KPRB 1YNLH 1I7UB 4NRXB 4J1UB 4LDLB 1Y6MR 5KSBA 2JJSC 5T5NF 1J87A 4KXZH 4LRIA 4WFEE 3QXWA 1KELH 4JVPA 3IU4L 4DUXA 2A1WL 3FT2A 1VGEL 4XH2A 2YD8A 2A9NL 1AD0B 4X6BB 5A3IC 1AC6A 1PY4A 3ULVF 1S9YA 2ZCKL 4NYLB 2GHWB 3WJLC 3UC0L 3WIHL 2FIRT 5KSAB 4X6DA 4GMTL 4HG4J 4HKXA 4PG2A 3RPIB 3MROA 2VQUA 5EU5B 5BO1H 2DQEH 1YPZE 3MRBB 4OLUL 3LN5B 4Z0XA 1ZE3C 1A21A 3KPRB 4MAYD 1MEXL 2YMXL 4YFEA 1K2DB 1NANI 2DQUL 4M48L 5FA3A 3DUSA 3ARYA 5FYKH 4FNLL 3KS0J 2P43B 1GSMA 3K8MA 4A6YH 2FX8H 3GI9L 3RU8H 5I2IB 5DJ8A 2X44D 5DURD 3CVHH 1GOFA 2AI0L 3QXAA 4JR9H 2EYTB 3D9AH 4DKEL 1RUQL 3VFWA 1MWAA 2FD6H 1ZLVH 2VQTA 4Z7VE 1E27A 2Y06L 3PDDA 4J7RA 5EO9B 5DFVC 1DBAH 1CDCA 2VXVH 1S8DB 5KVMC 4TQEH 4TSBL 3BGAA 5C0GB 1NSNH 1EEQA 5I74C 4XNZC 2AXFA 5GGSB 4JHAL 1CK0H 3T08A 3D18B 2AV7A 5IW6A 5IQ7H 2D7TL 5GRZA 2GW5A 2ZUVA 4K7PL 4RMUA 4QXTB 5ACZB 2NLJA 3MNWB 5GRWA 3STLA 3MACL 2LAGB 3L6FA 3KYAA 2UWEB 3H7BB 2MMXA 4N1HB 3MV8B 5SWZE 1EJ6A 1GVIA 5CD5D 4PIRF 1AHWC 1I8IB 4WI7A 5FO7B 1BFSA 4GG6F 3L7FB 1MLBB 4LHUB 1R3IH 3VGEA 2IH3A 4YDLB 4M03A 1WC7A 4LL9A 3NABH 4HGWA 4XMKH 1XF2B 3WNKA 4L4VE 4RWYL 5JXED 4UILH 3GIZH 3UTQB 1CLYL 4G8IA 4BQ6A 3MBXL 4MXQC 1AQKH 1CFTB 1C12B 4NC2B 2R0ZL 5CBEB 5AD0B 4R97B 4EUPA 35C8L 3P40A 1VB9A 4X6FA 3CFBB 5F3HA 2CIKB 6FABL 5D7IA 3CFKA 4NDMB 3T3PF 3W0WB 3CC5B 5T1LA 5K33A 1QSEB 4IRJA 4QHUA 1A1NA 3LN4A 4DAGH 4NSKA 4JY6B 3NN8A 3IFNL 2HRPL 1I9RH 1JP5A 4FTVB 1RZJL 4OAWB 4LRNL 2H2PC 2QJDA 3NH7L 2P7TA 4NKQB 5EUOF 5K9OA 3HR5B 1G7QB 1JN6A 3KHOA 4P5KB 2Z31C 4UUJA 3ZE2F 3U7WH 3WHXB 1IC5L 2CO7B 1PG7L 5FHBH 2HWZL 4PJIA 4J3OC 4CW1A 4KJPD 1EBAA 4NPYA 4HIEA 1F4XL 4NHUB 3K80A 4P23D 4XAWH 2YK1L 2P5ED 1T7YA 3SKJL 1JGUH 4KDVA 2J7LA 3TO4B 2F5AH 4N0YL 1X5XA 1FRGL 2AJ3A 4KMLB 3D0VB 4P9HC 4UQ2A 1T20B 2OSLA 5FKPB 3GZKA 4CADA 4MNHA 3EOYG 3UPRA 1ZT4B 4CVZA 4UTBH 5H37G 4XPHH 4M7LT 4KHXH 4QYOB 4JM2B 1HEZB 4ALAH 5D8JL 3AU1B 2IAMA 3L3IA 3C6LB 2YN3A 4O51B 2ZNWA 1N3NA 1KBGH 2BNUB 4XVTL 1WCBA 4OCXH 1WBXB 3DROB 4UT6L 4X5WB 2HKHL 1N8ZB 1RJLB 4F7CB 1FNAA 1HSBA 1I1FA 1E28A 1NQBA 4LSQH 1TZGL 3I6LD 3BMWA 1BVKA 4P5TD 3QIBA 5BS0D 5FYKE 2X1QA 1JYWA 2XY1A 1EPFA 3CMOH 4HS3B 4K07A 4NJ9H 3JUZA 4BK4A 3MRLA 1PSKL 1H3WM 4HKZA 5IB5A 2NY2B 5HHVL 3O4OB 4WENB 4AENB 5L2JB 2J8UE 3QG7H 5H35A 1G6RL 3HNTH 2VERN 3V0AC 1MCEA 3QRFM 2GCYA 3KPSD 1Q94A 1QSFD 2EDHA 4Y19D 5JORB 1DDHA 1LO2L 2XV6B 5K9JL 2DQCH 5HI3C 4RGMB 3PL6C 1MCKA 4XT1C 3L3GB 4Y4FA 3FO2A 8FABA 2O93L 3HI6H 1YYLH 1RZIA 4I18C 2W07A 3D85D 3PV7A 3OGCA 1B90A 1DLHB 2YZ8A 1KIRA 4PR5A 1G9NC 4M4PA 4X4XA 5SX4H 3MLRH 5FKAB 4NT6B 1B6DA 4KZDH 1QNZH 3FO0L 1R5VA 3LKNB 4MD4A 5CINH 1T66C 2E7BA 1EX0A 4PJ8C 5FDYA 4NO0D 4BFBD 4F15B 4Q58C 3RUGE 2OXGA 3DVGB 4TRPH 2R9HD 2VDNH 4PJCE 4I3SL 5I1JL 4URTB 1EZVX 4LFHG 4Z77A 1WZLA 5HGBA 1JRHI 2X4UB 2MQ3A 2HFGL 3JTTA 4PJHA 2BSRB 2VXUL 5FDWB 5DHVA 2BVEA 3F7PC 3LKRA 2NNAB 2FR4A 1YMMA 4NKIL 3EFFB 5FO8A 5LXGL 2DDQH 2J88H 5EORH 3MGOB 4OM0L 3JTSB 3VA2C 3MLZH 1UZ8A 2BRQA 4DKAA 2VZSA 2VDOH 2DMCA 1VKXA 4HJJH 1XGUA 3T4YB 4ZO8A 5TDOB 1RPQA 1E4XL 1NDMA 4N0CD 4IHOA 1FVCA 5FOJA 2MCPL 3OTTA 4LIQH 2B1AL 3K3QA 5TDNA 1LHZA 1NDGB 1R3LB 1SJHB 3MOQA 3ZE1E 1N5AB 3VXPB 3E1F1 4LAJH 4X7FC 4G42B 3HFMH 1NAKH 2O5ZL 1IGFH 3P11H 4KH2A 3GUTB 3ARDA 3FO1A 2WW8A 3HRZA 4GW4A 1MFBH 1PLGH 5DMKB 4MA3A 1A7RH 2EKJA 3P4MB 2ATPA 3GEWB 4DW2H 2Z8WC 3QCTH 3QDAA 1GJIA 1UCBH 4PRHA 3SE4A 4IRSC 1OTUC 2XRAL 1HK6A 3SKNB 5F8RC 1T2JA 4R2GD 4M9OA 1I1AA 2Y7QB 5E8NB 4JN1L 1MRCL 3BP5A 4ODXA 5F97E 2UV3A 1XFPA 3RA7H 4OLWH 1T03H 4L9LB 5JW4Q 5CAYB 1JHLL 2DQHH 4QRUA 1DN0A 4O58H 1AKJA 1CFVL 3HZKB 1OAQL 2I5YL 2ZUXA 5KG9B 2NR6C 3WEXB 4IIQB 3P0YH 1I7ZB 2KDGA 3RAJL 3QJHB 3VDCA 4Z6AT 3RWGA 2V5RA 3GHBH 2YZ1A 2PN5A 3QPXL 5GS0C 1JZ4A 5IW3A 4X7DC 1CS6A 4GRWF 5AYUH 5IROC 3ZTNL 1U92A 2R2CA 2YSSA 3TN0C 2PCPA 4R4BB 4MQ7B 1J88A 2P47B 3IU3A 4OCWL 4IS6B 4WWKB 1MJJA 5I0ZA 3BWAB 1SEQH 5I17A 3SDDC 3LQAC 3R06A 1WEJH 1WBYB 4YDIH 2ORBL 3H0TA 4XBPB 5A16A 1K4DB 1W72H 4R0LA 3RZCC 1PQZB 4JRXD 3RBGA 5I19H 1BFVH 3GKWH 4HFUL 3QZWB 2HFFA 5A2KH 5I1EH 5C86A 1OOAA 3OAUH 4PJGE 4GMSH 3OL2A 3GSNA 5I9QC 3FMGH 4DVBB 1UM6L 1KEGL 1YQVH 1H3GA 1KJVB 4ZQKA 5JW3L 5IB1B 1OAYL 3P77A 2FIKB 4MDJA 2BHZA 3V8CA 2G2RA 5ERWA 1HZHL 4KDTA 1IAIL 3QEUA 4N0FA 3JWDH 1RY7B 3VJ6B 3BZFB 4NGHL 2Q86B 1CICB 4HUXB 4F7TA 3GSVA 3MV7B 3LQMA 15C8H 1LEIB 5GRYA 5F6HI 1UH2A 2BJML 2NY6C 3C9NA 1CG9A 4H26B 2MKWA 5DJZB 4OCLC 2XZZA 3FB8A 1CBVH 1BD2A 3AY4C 2I07B 1I4FB 4WNQA 4WIQA 2YPKA 3RZWA 1HHHB 5DJ2A 4ETYA 3BE1L 5I73C 4JO3H 3VFPB 3P30L 1AXTH 2OI9C 2JELL 1ACYH 3K2UL 4LRIC 2RQ8A 1T4KA 4TPRL 2WBKA 4EUPG 3MLTB 1QPPA 3ROOA 4RMTA 2CR3A 5SWQA 3K8LA 3CXDL 4NQVB 3BW9B 4IOIA 2FGZA 1ED3B 3BRFA 3A6CL 1BFOA 3EYSL 2VYRE 4FQPA 3O11B 4LPWA 4MAYB 4AIZA 4MB3A 5IFAH 3V5DA 4C56D 4PG2C 3SKMA 4JG0L 4YUEH 2NY0C 3VFRA 1K8IA 5DURB 3VFUB 1UM5L 1MLCB 3IDMA 1U93A 4HC1H 5IJVA 2VZ1A 4GKZA 4MAUH 1KN2L 1PZ5B 1XR9A 2IADB 3QISA 1AXSB 5GJSL 3P73A 3VXNB 2BSTB 3QWOB 2QHLA 3HA0A 3QO0B 1N2RA 3QUZA 5I1IL 3OKDA 4HZAA 4BSWA 1IJ9A 4WVRA 5TGBA 3TNNB 3VU2A 1V3LA 4UBDC 1J7VR 1KLUA 1QRKA 2VISA 3VFOA 3HAEH 3D39E 1H3PL 1SYVB 1K3IA 3BQUA 4J6RL 2MPAH 1T0NB 1P1ZB 5GIRB 4XVSH 4LASH 3VXSA 5SV4A 5BVJB 3MLXH 3B6SA 1Z5LA 2D9CA 1ZXQA 4ODWB 1GHFL 3GBNL 2JE8A 1FNSL 3CLEL 1XGQB 2BCKB 3GO1L 1F11A 4PBXA 3F62A 1S7TA 3EZ8A 5B4MD 4OGYL 5HVHC 4M5YL 3G08B 1KNOB 4YFDB 5CKAA 5CGTA 4KVCL 4U0RB 4NBXB 4EDXA 3PABA 3C6SA 2BVPB 1XZ0A 3UBXB 5I66B 5DD3H 4R96A 4R26L 2ZUYA 3BHBA 3RX8A 2GTWB 1UACL 4YBHA 1JF5A 3O2VH 4RIRB 5GGTL 4UT7H 4JANA 1KTKE 1U9KA 3PQYE 1OQOA 4U6YA 4YWGH 3TBVB 5IVZA 2H3NB 4KRLB 3QXDB 3TZVA 2B4CH 3ELAT 4GH7B 1JGDB 1TJGH 2PXYD 4IBLT 3QDJE 1IGTB 5KAQG 3MRRB 2VR5A 4XP1H 3MRKA 3O3BB 3BXNB 4IRJC 5DMJB 5EOQL 1KLGA 3JSSA 1P84J 3MSPA 5INDA 3S9DB 3QDHA 4S1QH 4S0SD 1MRDL 4KK9C 2HFEA 2DN7A 1WV7T 3CSYA 3WCYA 4ZNCD 1TVDA 4NZRH 3ULVH 1A47A 4K9EL 3V4VH 4P23B 5C0BD 2P5EB 5IW1A 1JYVA 3QEQE 1VEOA 3U83A 1JRHH 1BAFL 2IWGA 1OAKH 2BK8A 3E2HC 4G9FE 1IAKA 3CFDB 4N90D 4OZIA 4GS7C 1MFEL 5HPOA 2B7DT 1JF1A 4M5ZL 1V7MH 3MNZA 1ES0B 4YGVB 4LU5L 2RR3A 2JCCE 1RJCA 3O4LD 3B2VH 5I1HL 2IG2L 3LEYH 5H2BB 3KYMA 1WVZA 1SYSB 1K6QH 2R0KH 4L8CB 4YXLL 4DGVL 1QUNA 3I02A 3WIFA 1QYGH 3FB5A 4BZ1H 1X5FA 2IAMC 1QFUL 4ZOAA 4OCRL 5E2UH 4P5TB 5FGCB 5BS0B 1DR9A 4S1RH 4DQOH 1JPGA 5JXAH 4F3FA 1JZ8A 2A2QT 1GIGL 2J6EL 1L9MA 4X98A 4LLMB 2WK2A 3QIBC 1XAUA 1YPZA 1WBZA 2K1MA 4DK6A 5J12C 4IRSD 1SBSL 5D96B 4ZFZA 1FO0H 3KPLB 3WUWB 3FZUC 4M6AA 3THML 3KPSB 1P7QD 5IBTH 1BLNB 1IKNA 1UWGH 5D1QA 4GOSA 1QSFB 1LILA 2ITDA 3BI9X 4P2RE 4Y19B 1MJ7L 3FN9A 5D2NB 3O6FD 5IP4A 1A2YB 5E08H 4DGYL 5F21B 5IFJB 2Q7NA 4YNYB 2OTPA 2VUYA 4OFYD 4B7IA 3I6GA 4GKSB 4HF5H 1NL0L 4YO0B 1BF2A 2NR6D 3D85B 5GSRB 5HY9B 3CDYA 1NGXA 1YNTB 4ODHH 5E99L 4F8QA 3H9HB 4O00A 4NQED 4JFFD 4ERSL 3IDIB 3JZ7A 4RGOH 2OTUB 3VFVB 3U9PL 3Q6FA 3KLHD 5JQ6H 3F58L 1FORH 4JGJA 4L3EA 2D03L 3AREA 5TJWK 4HKJA 3G5YA 1ZVSA 1NGPH 4NO0B 3LIZH 5CMAA 4ZFOL 4OUUB 4XTRC 3BD4A 1ZS8B 1QFOA 4GW5A 3OG6B 3LEVL 4KWUA 1KELL 2X5PA 3SDDD 3T1FA 4P9HL 5K59F 4LHJB 2ADFH 4JFYB 5I8EB 2C1OA 1JZ3A 4LKXA 4LLYA 2IPTH 2GSGB 1TVHB 2Y5TB 3BZDA 1NBZA 2V6HA 3QHTC 4XGZA 1D5ZB 5BO1L 2DQEL 5JW5B 5JDJA 4DCQB 2APXA 3KWWA 3P4NB 1FVEB 4YBLC 5F8QC 2BOBB 1NCCH 3KNBB 5ID0A 1ZA6A 4M8QA 1YMHA 3CFIC 5B8CA 4A6YL 2FX8L 2EDJA 5FCUL 5J56B 1XIWA 3CVHL 5JNYA 3CPLB 3SKUD 5EC1A 3D9AL 2IGFH 2FD6L 3FQRA 4XX1E 3ULVE 1EEUA 1NCDH 1DBAL 4OSUH 4TQEL 5HYSA 3DI3B 1OGTA 3RDTD 3QH3A 4QRPD 3PWUA 1CK0L 4EVNA 4PJ7F 2DLHA 4OZFB 3N1QC 3ARVA 5DK2A 1QBMH 43CAB 1V05A 1UWXH 2QSTA 2XWBA 4NNXA 2ZPKL 1SM3L 1XGYH 3H9SE 4R2GB 1FYTA 5L2KE 2VE6B 4QHLB 1BVZA 3SE4C 3LRSB 3LV3A 1R3IL 1H5BA 2H8PB 2VZUA 3VE0B 3MUJA 4XMKL 1XR8B 1I1AC 4LPXA 5E03A 5AYQA 5E7FA 2NY0D 3T2NL 4XNUL 1HINH 2IANE 1AQKL 1INDH 5DZOA 3RL2B 2VDML 4YGAB 2P49B 4MCYB 3EYFB 4OI8A 5BJTB 3RX5A 4GQ9H 1EAPA 3FOLB 5CHNB 5EU4A 3X13B 5EC2A 4PJ9A 4P2OA 5F7DA 2R2BB 3MRMB 4FQQA 4WW1B 2YD2A 4AM0B 4XC3H 1NH6A 3FB7A 1KCSH 3TESA 4YHNA 5ECJE 1CD1B 2OTWA 3MJ7B 4GG6E 4RAVA 1BBJB 1MUJB 4G8FA 1XMWA 4KAQH 5D7KE 5SWSE 3X12B 2VLRD 4FQLH 5A1AA 5DJYA 5DJXA 5EBWA 4NFDA 4GAFB 4U7KA 3IXTA 3OKMA 3HZVA 2ADGA 4F58L 5ACMA 1BF8A 4PJDB 5BZWB 1C5BH 3ECBB 1CZ8L 2DIJA 4JRXB 1O0VA 5F88A 1GAFH 1EEZB 5ID1B 3QO1A 1GC1C 3SPVA 4AL8H 1LGVA 1AHWB 2IPKB 3GSOB 5DMGC 4KI5C 4R0LC 4U1NA 5LWYH 3T3PE 4NC1E 2F5AL 5GS1A 3DV4A 3O3AA 1VFAB 2XTLA 3OAYK 5BV7H 7FABH 2VJXA 4LNRB 4WGVB 3U4EA 3LSOB 3PGDA 5C0ND 3QQNA 5JR1L 2R1YB 25C8L 2JJVA 1CFBA 1Y0LA 3SHSA 5EIQA 4XC1L 5E4IA 4UTBL 3K2MC 3ZYJA 3V4PL 5CEXB 2DB8A 4QOKE 1DBJH 3ZE2E 2LU7A 3RUGA 3KDMB 1V3MA 4KDTC 1VPOH 1FL3B 3CDCA 3PJSA 2ADJA 2X4RA 4PRID 1KBGL 4X4YA 2H32B 1U8NA 4X4ZA 5DFTA 5HHNB 3VRIA 4XNXL 3AMKA 1TPXB 1CYGA 3S96A 1U58A 2W65A 3WO4B 5T1LD 3MLPA 4NM8H 3QI9D 5DRNB 2OX5A 2WP3T 3CMOL 1IGML 4NJ9L 1QACA 3REVA 2Z31B 5GGSY 5INCB 4KC3B 2XICA 4P5MB 4PRBA 1MCOL 3QG7L 1IL1A 1CGSL 3TA3A 2MSPA 3BKJH 3S37H 2IH1A 3VCLA 1BJ1H 3GRWH 4NQSA 2ADIA 1G0DA 4AEFA 4ZFOB 1S5HA 2DQCL 5JOPD 2BRRH 4RZCA 4O4YH 3G5VB 3TBTA 4ONGH 1ERNA 1IFHL 4G9FD 4PREB 3TPUA 5T1KD 4C56B 3ZKSD 1ONQB 3IS0X 5ICYA 4JG1H 2CK2A 1IC7H 3EHBD 5LQBH 4KTEL 1JZ7A 3MLRL 3JV0A 4KZDL 1QNZL 3BZEB 3E6FB 1HSAB 1BMGA 4NKMA 1YEFH 4AEHH 5J7CC 4GRWH 5JLZA 3BPLC 3HC3H 4E41E 5C0IB 4TRPL 4P4KD 4A6YB 2DQJH 4LVHC 1EFQA 3JUYA 5TFSL 3QUZC 3T0XA 3CVHB 1M6OA 5ICXA 1ZLWK 4JDZB 2ATKA 2PYEA 3QIBD 3GI8L 4D9QD 2J8UB 3FN0L 5GPRA 4K71C 2HMID 4L4TA 1CFQB 3FZUD 1XF3B 3PWLB 3VFMA 3BQUC 1ORQA 4NN6C 1G1YA 3EZJB 4XVUD 4P2RD 2G5BB 1A9BA 3AS1A 3HE6A 5FK9A 3QBTB 4OZHF 4P3DA 2J88L 5DEGA 4ELMA 4PJFA 2VXTH 1CTOA 1BQHA 1A1OA 3CSPA 5DVNA 1QO3A 4Q74A 4Y4FD 5BW7A 1DN2A 1ZSDA 4LIQL 3W2DH 3BIAX 4Z9KB 2YD6A 3O6KH 1I9JH 5F96H 1WWCA 3LN9A 4M1DH 1FCCA 1B0WA 5LKNA 5D93C 5C0AD 2CRZA 3RHWK 2XQBH 1HXMA 4XTRD 2PXYB 1G7JA 1PKOA 1IGFL 4W81A 5ITBH 4JZOB 2CDFB 4PJAF 3ARPA 3TZVC 1PLGL 1D6VL 3FHQA 5EZOL 4PJGA 1PY9A 4JDTL 2MQCA 4WCYH 5DQDH 5I8OL 2G9HA 3QCTL 1AGCB 3NOIA 4MMZC 2NTFB 3MRQB 5EU6E 5IVXA 5C0BB 3QIUA 1MJUH 1FLRH 2YRPA 3RA7L 1MWAL 1T03L 1YMMD 2HTKC 1HIML 1MHCB 1CF8L 4M6MH 4PLJC 1RMFH 4PRAB 2DQHL 2VL5A 5KS9F 1FSKC 3V0VA 4AY0A 2F53E 3B9KD 3VXME 2P46B 1HQ4A 1VFUA 2XXCB 1AIFA 2AK4A 1EAJA 4RMRA 2FZ3B 1U42A 4OCNC 2XA8H 1L4IA 1T6WA 3GHBL 5DUBB 3TYGH 3O4LB 1WFOA 1EJOL 2EXYC 4PJXB 4JLRB 5AYUL 2DWDB 2W0PA 1ZT1A 4HPYH 3O45A 5B38G 1B6UA 1H3TA 3IDGB 5DRXA 4DZBA 1M7DB 4NHCL 1UA6H 3MA9L 4FFWD 5GGVY 1XCQB 4JM4H 1NAMA 5TDPB 3IF1B 4JO2L 1N0LA 5JHDE 4WHTB 1VFMA 3P0VH 1W0WB 1WEJL 4PLNC 3ARDD 5IQ9A 5DD0L 3FAXA 1W72L 3G04A 3LKOA 3SGJA 4PD4K 3H9SD 1BFVL 4IRSB 5FM5M 5HYSG 3OAYH 4GMSL 1KIUA 4YK4C 1JNJA 1P7QB 4W6XB 4GRWE 4KUZH 2XT1B 3FMGL 3OJMB 4G6JH 4Q7DA 5GZNC 1YQVL 3O6FB 1FNEA 4XPBH 3WXWH 2XZCH 5GRUL 1N7ML 2C4XA 1I1AD 3ZKXB 3QNYA 1IKNC 1XH3B 2FJFB 5D1QC 4X9GA 3RWCB 2IAND 3L5JA 1RURL 4NKOB 1Q9LA 1JGLH 3MGTB 3UJIH 1RZFL 1T1XB 2BNRD 2Q8BH 3MNVA 4XXCA 4H1LH 1D5MA 4NQEB 4JFFB 3X17A 1G7LB 1NUGA 5D1XA 4W6YB 2X4TA 2ZNXA 4KJYB 1QEWB 3D39A 3EJYC 4FFVC 4QRRE 1XF4A 1S7WB 2Y36H 4CDHA 1WISA 1DBBH 5D7KD 4OD3L 3AREC 1U8JA 3BP7B 1VESA 2ZOLA 1E0OB 3GK8L 2FJHA 4R90H 1XGTA 3OQ3B 5ELIA 3SDDB 5CS7A 4HG4K 4H0IA 3RWIA 4LSSL 4C83A 4TSAL 2D9QB 1DE4B 2F9BT 4R7NB 3U46A 3KHQA 3EOBB 2WWMC 5DD6A 3T0BA 4FZ8L 4BH8B 1MHEB 3ZKMC 1CD9B 2EDKA 4JPWH 1XF5A 2E6QA 4HCRA 5HPMB 1KCRH 5DMGD 4N8VA 3HE7A 2ERJC 5KVFH 1Z9MA 3P9WB 3RTQD 1G7HA 3PWJB 5DJ0B 4HX1A 5IFAL 4YHYC 4BFIB 3GB7A 4YUEL 2LV4A 4S11A 2FH6A 1TZIA 3IFPA 3IETB 5JDSA 1PKQA 3W11C 2BC4A 4HC1L 5B8CC 5IEKB 2DLGA 2EIBA 2J12B 4MAUL 3QDJA 1XIWC 2X4QB 4WTWA 5DJAB 1FCGA 1HH6B 1X4YA 2NY6B 2VZVA 4RRPA 4HK3N 1ZLWH 5IIEA 2C3VA 1RZGB 2JK5A 3RDTB 2FGWH 2V2XA 1FAKT 4QRPB 4XBEH 3IS1X 4Y5XA 4DEPB 3OX8B 4X5XB 3OG4B 2DIBA 2OI9B 4XCCL 5D5MF 1DL7L 3MQIA 1CN4A 1Z9OA 3TFKC 2GJ6A 4XVSL 3VG0H 1TNMA 1T04B 4LASL 4I4WA 4I0KA 1GYAA 4WUUE 3MLXL 5GJTL 1V3KA 4XB7A 3BJLA 4NQDE 4G7VL 3DECA 2X4NA 1JUFA 3F65A 1K4CA 3ME0A 4UDUA 4HT1H 4M93B 3RQ3A 3MOBH 2JCCA 1DFBL 3BPCA 2CRIA 4KY1H 1NUFA 4Z0XB 2DI9A 1SVCP 4FQ1H 2NY0B 4XMPH 1H5BC 3C08H 4NNYB 1TTFA 2YD3A 3DMMD 5FA3B 3GJEB 3CVIH 4QT5A 4HMDA 5FUOH 5FUCC 4D9LH 1E4KA 3R1GL 4PJBA 1CU4H 5DVOA 1JGVH 4CRPA 1MWAB 5CP7A 4YWGL 5C07E 4PTTA 4TULL 3IJSA 1TJGL 2V17H 4E41D 1FQ9C 3PP4L 5CILH 3UAJC 3OSKA 4PJ9C 4P2OC 4X0KA 3QUZD 3PV6B 3ZT7A 2VLRB 4M1GH 4EI6A 2JB6A 4EZMA 4JQIL 4XPFH 4QHNA 2JLLA 5ESVA 5IW6B 1F3DJ 1MY7A 5ESQA 4XXDB 1HI6A 2R69H 2B39A 3OZ9L 2NLJB 4YEFA 3ZHKA 3V4VL 3VI4F 4GBXA 1S7SA 2AKRA 3QT2A 4EI5A 4B0MM 3IAGC 1A4JA 5HGDA 4NO2A 4X7TB 5GISH 4R8WH 5K9QI 3AB0C 4HIJA 1TETL 5HGAA 4CU6A 3C5JA 3BGMA 3SQOH 3O6ML 2IH3B 3BKCH 5GS1C 1WC7B 2YXMA 4HGWB 1W72B 2M2DA 4GG8B 4KGJA 2JTDA 3HKFA 3TGXA 3ZDYF 4G8IB 3B2VL 4ZG1A 1U2HA 1RAMA 3X11A 3GSRA 3QWRA 2UWEF 4PRIB 3GSXA 4BZ1L 3CMGA 4C58B 4ISVA 5E1AB 4J3XA 5GGRA 1ZMYA 5E2UL 3CFKB 1BQHG 3RIAF 3ARZA 5EIIB 5T1LB 5IEHA 1CLZH 5JXAL 4QHUB 1A1NB 3LN4B 4NSKB 3V7AE 2XFXB 3NAAH 2BMKA 4TYUA 3L9RB 4HZLA 3IAPA 1KENH 5J1AB 1I3GL 5D6CB 1J5OH 1JN6B 4ODTH 3ZE0F 1I8MA 1FO0L 2WANA 1KYOK 2APVA 4FQHA 5D1ZA 5IBTL 1UWGL 5DRZA 4OFVA 1FG2A 3TA3C 4HIEB 5EOCJ 1GGBH 1I3RA 2E27H 4G9FB 3BPNC 3NIDF 1XGPA 1PX4A 4IJ3B 4GS7B 3QUMA 4HF5L 5HJ3A 2L4OA 4LF3B 4KTDH 3QRGH 4ODHL 2OJZH 1DBMH 1AGBA 4UQ2B 1P7KB 3ZTJH 3GNMH 1C08A 2OSLB 9CGTA 4BK5A 4CADB 1EHLL 4MNHB 5JQ6L 5EPMB 1FORL 3RWFB 5M7QA 3UPRB 1FZOB 3ULSA 3DV6B 1N64H 2EDDA 2BVQA 2R39A 5D7LA 1GC1L 3VRJA 4X9IA 1RUPH 3DOSA 4YDVB 5EG6C 3QNXA 4P4KB 1WCBB 1U91A 4WI3A 4LSRH 3MRDB 2ZWLT 3QJFA 4E0RA 1E28B 1RZ7H 2CRMA 5L2KA 4EXKA 2W91A 4G8EA 3KS0H 3QIBB 1IQDB 3F7YB 1DP0A 3WXVL 4NZTH 2YR3A 3BMVA 2I9LA 3HUJA 3H8NA 1NCWH 1X4ZA 2P1YA 3DRTB 4P2RB 4LGPB 3ES6A 5H35B 4JREC 5GZND 1WZMA 2GCYB 2CGRH 4WFFD 1NCCL 2WINA 4XP9L 4BKLA 4UI2A 1DDHB 3HE6C 4U6HB 2ZCLH 4LAQL 2WQ8A 4V2BA 1NJ9B 5K59E 4Y4FB 3ZDXF 3FO2B 3LD8C 3HMXH 8FABB 5J13C 4MHHG 2V2TA 1RZIB 5I1LA 5FECA 3VW3L 4GG6A 5I6XB 1GOHA 3SJVE 4J2XA 4U1LA 5SWSA 4LCWE 5IFHH 2D31A 1JTOA 1MIMH 3BKYH 3BT2H 4MA7H 4FFVD 1GOGA 5C0AB 2XTJE 4L3ED 1OSPH 3VXRE 1RHHA 4RA0C 4MD4B 3ARED 2YPLA 4Y2DD 4WI2A 3ARGA 1WWBX 2DKSA 3NCBB 4F7EB 4R7DB 1WUNT 4HIXL 3L95A 1MVUA 1HCVA 5H8DA 1AP2B 1QBML 3CUPA 1MI5A 3T3MF 3UO1L 3B8SA 5J1TC 4LOUC 3RRQA 1OF2B 3L3HA 1KJ3L 1X7QB 1CR9H 2X4OB 4JPKH 4MCZB 5CZXC 5EUOA 3SE9H 5LAXA 1NBVL 3BKMH 2F5BH 1ZT7A 5E00B 2X40A 1YMMB 4K3JH 1G7MA 1D5BA 4ONHB 4KVNH 1BOGB 5FO8B 1JL8A 3QIUC 3EO1A 1RUKL 1SJXA 4CU7A 2NY3C 2GIYA 3VGDA 4DZ8A 1HINL 3B9KB 1RK0B 1INDL 4PJ7E 1UZ8B 5SX5K 4KK8D 1F2QA 4I2XA 5HHOE 1BJ8A 1XGRA 4GQ9L 4M7JH 4PS4H 4N8VG 3SE3A 1QRNE 1NDMB 2B5IC 4U1SB 4KU1A 4IHOB 3HLAA 1N6VA 1QFWI 4XC3L 5EFIB 2C1PB 1NCAL 5TQ0H 3O9WA 4XPTH 5EZIL 1KT2B 4H0HB 1FP5A 3FQTB 4KAQL 2VC2H 4LMQI 5F9AC 5K9KB 4FQLL 3CCHB 3M17A 2ZP0T 3IJYA 4PUBH 1W2KT 3TFKD 2IBGA 4HS8H 4PGEA 1UFUA 3ARDB 2JJTA 3HRZB 4GW4B 4HWEH 3UZVB 1O7SA 4NQDD 4F9LA 1LEKA 3H9SB 3ZKNC 5LGJB 2BNQE 3DX8A 4Q6IA 3PWPE 1FC1A 5D7JA 4GSDH 1NGZA 3SGJC 5LWYL 4EJ1C 3RFZC 3ULUF 5I30H 3MREB 5FHAL 1FYTD 1VACA 1I1AB 3BP5B 1BZ9A 1RIVL 4MZ3A 2IANB 4TUOA 1AC0A 2EIEA 3DTXB 2XKNA 4G5ZL 3HTLX 1F6AA 5BRZD 2BNRB 1DBJL 2R29H 1FO0B 3FRPA 5HVGB 3V4UL 1VPOL 4KUCF 1GGIL 5E9DE 3L3OA 4XXCC 2EE2A 1HN1A 1R24A 1TVBB 1YECL 5DEFB 5D1XC 4PJ9D 4GLRI 1IC4L 2XY2A 5HYQA 4O2FA 2CUIA 3S7GA 4OV5A 2OL3A 2PCPB 2WWKO 3C09B 1SJEA 3IU3B 2GK2A 3GMOB 3WHE1 1MJJB 2BVOA 2WBJA 4K23H 5I17B 4LARH 3FOMA 1JWMA 5CGYD 1JZ6A 3H0TB 3RNQA 4NBYB 1JCKA 3NFSH 4FQIH 3LCYA 2W0FB 2BRRL 3RVXC 3RTQB 4O4YL 2HFFB 5ANME 4OLXL 1A7NL 3HE7C 3AXLB 1JHTA 3ARUA 5GGUA 1MCBA 3RJDA 1LO0L 4H88L 3PIQA 1IC7L 4KQ4L 5DRWB 1V7NH 5FYJU 3H3PH 2AEQH 1AI1H 2WV3A 3RGVD 4LBEA 3PNWA 2G2RB 4Y2OA 3HAEG 3DSNA 5BMFH 4PB0H 3ARFD 1PG7W 3DLQR 1YEFL 1YEIH 5FYLD 4F7TB 4PJ5A 3HC3L 4Z7UA 4ZSOA 1U3HD 4ODVH 4WTXA 1PBYA 1I1YA 2C26A 2CKBA 2VLKE 3C9NB 2N7AA 5EU6A 3FB8B 4MNQA 4Y1AE 5MENA 3UTTA 4WNQB 3DVIA 2YPKB 4Y5XC 2FBJH