2RQ8A

Solution nmr structure of titin i27 domain mutant
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
98
structure length
98
Chain Sequence
MLIEVEKPLPGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLAASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANTKSAANLKVKELLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Titin
publication title Structural basis for unfolding pathway-dependent stability of proteins: Vectorial unfolding vs. global unfolding
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 98
sequence length 98
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rq8A00
2HT2D 3QFDA 4OZ4B 2H8PA 4JRXB 1JMZA 1TVBA 1KYOK 4J3OC 5FYLL 5ICZA 2DDQL 1PYWB 4NKDB 5FO9B 1G9EA 4FQCH 1RJZA 3OKDB 1R5WB 4NRXA 4L3CB 4ZTPH 5E2VH 1BBJA 2BOCB 4JO1L 1A14L 1E0OB 5EZOL 2LU7A 5ICXA 3L3GB 5GRXG 3LKRA 4QRTA 1AKJA 1T21B 1FV1B 2DIJA 1C16B 1OD9A 1CXIA 3VW3L 1ZSDB 3FCTA 1G7PA 4QGTA 1ZTXL 4JO4H 2IGFH 2E9JA 3QXAB 4M1DL 3QH3A 5FUZH 4P2OB 3WN5A 5DQJB 4OD2B 1DQML 4NSKB 4JFFA 1AIFB 4MCZA 2IEPA 3ARFD 1FVDB 5KBNC 2IANE 4GH7B 3NCJH 4ZMAT 5CEYA 4X6DA 3SKNB 5KOMC 1KC5H 3HG1E 1PG7L 2Q8AH 4H25A 1Y6NR 3BQUC 4Z7QF 1MIEL 4PGJA 1FVCA 2X4TB 4Q9BA 5FGBC 2FEDD 4ZQKA 4JQIL 3ROOA 5EBGA 1J0KA 1X5XA 2ARWA 4LP5A 4JFHE 4P9HC 5DUBA 5FB8B 3MLZH 3E6HA 4YXHL 3GMPA 3QPQC 4H1LG 4O4YH 5SWSA 5GJSH 4FNLH 4I18A 2DQUH 3JVGA 3HMWL 3PWVA 4HX1B 5LGHL 1MCBA 5IF0B 3ZO0A 3BP4B 2GAZA 3OZ9L 4EQ2A 2Y6SD 3KXFE 1JPST 3GMQB 2Q6WA 5F3BA 1HHKA 2IAND 3TC9A 1MFAH 4OZGE 1PLGL 3VXOA 4KHXL 3HG1D 4QLRA 1G7QB 1Z0NA 4OZHF 3RWDB 1N8ZB 4DUXA 2NY3B 3WD5H 1U3HA 5E8OB 3EAKA 1LK3H 3BKJL 4M5ZL 1NCWL 4KUCF 5E2TL 4GBXA 3H7BA 4OCMC 4MD0B 4JFHD 1VGEL 3BHBB 3BUYB 3FQRB 4R0LA 4E0RB 1I75A 3O6FA 2YSSA 3X17A 4BQ8A 3VFPA 4X6EB 2Q7YB 3RZCD 5D6DC 4F58H 1KIPA 3LHPL 3ZYOA 4I77H 1T1YB 2P8MB 2CK2A 1OP3K 1INEH 3W9EB 5DD1L 2IAMA 3HE6B 5J12C 5L8KB 2PNDA 4P9ML 4PJXE 3S8WA 1RU9H 5ENWB 3I75B 4P49A 3KXFD 4PJEF 4FQJL 2MWCA 4OJFL 2R2EB 5F72S 3BKYH 1UJ3C 4N1EA 3JWDH 4I0PC 3HC3L 4JO3L 1WAAA 5DDHB 2O5YL 1HHIA 1HI6A 4WU5B 1I8KA 4QT5A 1PSKL 3O9WA 1NGYA 2EKJA 1D9KC 2ZNXA 4Q9QL 1E6OH 1UM5H 4RGNE 4RMVA 5DF0A 1CXHA 3BZ4A 4Z7VB 5DEFA 2DWEA 3SDAC 1NDGA 3S34H 4LCUA 3GJEB 4F2MA 2VQ1B 3J8F7 3QI9A 3T3ME 4JDVB 5C0FA 4OI7A 4UIKL 3S9DB 1NUGA 1A1NA 5E00B 1Z9SA 4OFIA 5JLZA 5F8RC 4K8RC 5TE7H 3AS1A 1TLKA 5IQ7L 5IOPA 1VEMA 2Q86A 3I9GL 5K9QG 3E2HB 2JJUA 3H9SA 3LKOA 3MLYH 4NZRL 4XC3H 1YMMB 5EORH 4P57B 3ZYZA 3HR5A 2BC4B 4BQBA 2DM4A 1P5UA 3T2NL 2BRRH 3MXVH 5MENE 1A6UH 3VGAC 4YHOH 2VDNL 2CKNA 3UTSB 2RB8A 2VMFA 4LARL 1U8LA 2VAAB 2C3VB 4PJAF 4RGND 3VFOB 2X1XR 4H8WC 2PXYA 2Y72A 4YBLC 3SKJH 4EI5B 2HT3C 2FEEI 2E6JA 1JI1A 5JHDE 3WS6A 4YFEA 2WIIB 1JHLH 2AK4A 5I71C 4HUVB 1REIA 1KYOJ 4OIAA 3X11B 3WJJC 2E8YA 4NPYA 1WLHA 4EDWL 1S7VB 2C3GA 2NY1C 5CKGA 3LKPA 4XP6H 2A77H 4YHMH 1ZVYA 2PW1B 5C9JA 1IC7H 5BVPL 3QRGH 1CD1B 2BHUA 4OV5B 1KN4H 2FGWH 5MP6H 5KZCD 3MLTB 1BMGA 3C6LA 3KPNA 2O61A 4QHLA 5MEND 3DWTA 3V6ZA 1CICD 2W65A 4F9LC 5IV2B 5KS9E 4H20H 4NO2B 3PGFH 2VQTA 2AEIT 4OB5H 4U1GC 4YGAB 4KRPC 2OMNA 2P8LA 1FL5A 1K4DB 1KFAL 3SDXA 3B5TA 3CCHA 4Y4HB 5JHDD 1FYHB 1JWSB 3GJFK 3VFMA 3GJFA 2FHCA 1MCPH 5H94B 3ZMRA 3A67H 4G8GA 4PP1D 1CD0A 4MAYA 4UAOB 1HZHL 4PJHE 2VSCA 2XZQL 2A6DB 3W0WB 1U8MB 4ODVH 1EMTL 1IL1B 5GRZA 5IWLC 1SYVB 1UZ8A 5DYOA 2DYPD 5C0CA 2OJEA 1FLTX 4FS0A 1S9YA 4NBXB 2NXYD 3QJFA 4WTZA 3TIEA 2CKBH 3P11L 1A0QH 1FJ1A 1MLCB 2XOTA 3OB0K 2P24A 4K3HA 4XNQB 4ZXBB 1BFOB 1RZJC 4YBQD 5DZOA 4Z8FL 3LN9A 4JN1L 1WF5A 4OLWL 1LP9F 1ZT7B 2W9DL 4MLIA 4GRLC 3GMNB 2ZOKA 4M43H 3IDNA 4WW2F 2DAVA 1IQWH 3ULSA 2C4XA 4QOKE 1MFCL 2X42A 4GW4A 2GSIB 1IGJA 1YN7A 4XX1E 1A6PA 3W9DA 4YFDB 1A7NL 5HDQH 2VISB 3EFDL 2GW5A 1HH9A 5D1ZA 4WWKA 5EBLA 4RX4A 2PTTB 1HEZB 1V3JA 4Y19A 4PJ7F 4Q9RH 3RL1A 1YUHB 1U91A 3LY6A 4JY6B 2CQVA 1UZ6E 1TIUA 3QA3B 3PP4H 1AFVL 2ZJSH 3T09A 5I8CB 3H0TA 3UTQA 3RY6A 5T1MB 3NAAH 2M26A 4LLQA 4RIRB 3TBWA 3VXPB 4QRPE 5JXEC 4OLVH 5EOCL 2K7PA 2D7MA 4J7RA 3V4UL 3DO3A 3H3BC 3O45B 1G7LA 4R90H 4MS8D 1N64L 4OCWL 5I8OL 4RNRB 3D39A 1D6VL 1HKLH 2F15A 2X40A 4QOKD 1NC2A 1LHZA 4MA8L 3B6SB 2HFEA 2UYLB 4QNPE 2BDNL 3U0PA 5E8DH 4EKXA 1WVZA 3DX7A 1D5ZB 5IGXL 5FFLA 3FMGL 1CDUA 4FQIL 3TIDB 3U30B 3PL6C 1MJ7L 3B2VL 5DJ8A 1FH5L 2CR6A 4L4VB 4ZPVA 3K46A 4OFYD 1NGZB 1PG7X 1KIRA 4WFEE 4S2SB 5DJ2A 4HSQA 4P2QB 3HS0A 3TO4D 3DIFB 4XCCH 2WBKA 4QRPD 4Q2ZA 4EUPA 2IBZX 5E7BA 1JZ7A 2ITCB 2NNAA 3LRGA 5HHOE 1KJ2B 2Q76A 4V1DA 1JWMA 1CGYA 1W72B 4IDLA 3MRKB 4MX7A 1AP2B 2IH3B 1U8KB 5GGTH 1QR4A 1TJIH 1DE4A 2OR8A 1I85C 1LO5A 3EGSB 3SBWA 1KLUB 2W60B 1RZKL 3ARBB 4P5MB 4RFOH 2AGJL 3UYRH 5HVHC 2AJZA 2X4SA 4R26L 4PREB 3OWEA 4WENB 4C56B 5L2JB 3T0AA 1BD2A 4P5TB 3OX8B 3RVTD 4LIQL 5DQDL 1BJ8A 4X0KB 1ND0B 3GO1L 4ZS6C 4M61A 1RPQA 4DJMA 3DROB 1WFUA 4DAGH 4NZUL 4UV4L 1PX3A 2E9IA 3QUML 3QUYA 4WO4C 4YAQB 1OWWA 4KQ3L 4YHNA 5IHLB 1UWEH 3PHOB 5FHBH 5C6TL 4WFED 3X14B 3BMWA 1CVRA 4TUJA 1ACYL 5DC0A 3AAZA 5DURB 2EEAA 3EOAB 3MROB 4LLDA 3LQAH 4RAUA 5HHOD 3O3AA 4R2GD 3KPRB 4TTDC 3DX6B 1J12A 5CJ5A 3ARPA 2AQ3A 1A22B 3NCCB 4HXAH 3VXUB 2A1WL 2B2XL 2V2TA 2ZG1A 4Y4FC 1A3LL 5E8NA 2XFXA 4HJJL 2EIBA 4XNUH 5B3NA 3GSOA 1KBGH 1U3YA 1P84K 2VXTH 3MV9A 4Z9KB 1AGDA 1UYWL 1VADA 4HH9B 4MCYA 5DMGD 1LVEA 3TNNA 1QBAA 5EZLA 4HC1A 2OL3A 4S1QH 5DVKA 4YDIH 1M6OA 4ZO8A 5F1NA 3LS4H 1A3RL 1Q0YH 3O4OB 2VDOH 1SY6A 4ZUVA 5D1QA 5SX5K 2PETA 5AUMB 1QUNA 4BJLA 3OAZH 2BVEA 2EDQA 1EZVX 1FBIL 1G7JA 2BY0A 2DI7A 5DK2A 3WXWH 4WTXA 3BMVA 1J1PL 1KT2A 3FRUA 3WFCH 4X7CC 4YHLH 1OM3H 5A43C 2D0HA 2CDFA 4NNYB 2X44D 4LBEB 1U2HA 3CLEH 5HI4D 1QD0A 4YK4B 3QB7C 3JTSA 3GUTB 2R4RH 4WHTA 3G6AA 1WT5A 5CILL 3MCG1 4D94A 2ZG2A 1IAIM 1T6WA 2APFA 3BP7A 4QTHB 1N6VA 5DGRA 1WZ1H 2D9CA 5DLMH 2R15A 1RZ8A 2RFXB 5I1EH 2XTLA 2CXGA 5IK3A 1YNKH 3MBXH 5GGQH 1VKXB 3QDGA 1TZHB 4G6FD 4DKDC 3OG4B 4PV9A 2EICA 2PYED 4JM2D 2ESVB 1IKFL 3MRGA 3QWQB 1Q9OB 3FQTA 3MGAA 1YNLH 3MUY1 5FECA 2HVJB 1CFSB 2AJVL 1AHWB 5C2BL 5HHXL 4M93C 5L8LB 1MUJA 5IW1A 4YBHA 5IVXA 4QRSA 4OF7A 3CDYA 4JFOA 2AXFA 3NIDE 1DTUA 2I25N 1E4XH 4FQXC 5CD3A 2BSTA 1P4BH 2NY4C 1AD0A 4GKNA 1F6AA 1JCKA 1P2CA 3BKML 5T3ZE 5LGJB 5HD8D 3VCLB 3MFFB 4MWFA 3V0VB 3GMOA 4FQ1L 1TTUA 1C8PA 2PTVA 3KPPB 3SGDI 3QULB 4W4OA 3CVHH 5J56B 3EYSH 1MEXL 4J4PA 3U7AA 3FZUD 4XX1G 5BMFL 3S88L 1QSFE 3GSVA 1TQBC 2VJXA 2ZP0T 5JUEL 1RIUL 2N1KA 3DUHA 3G5VA 3TN0A 5IFHH 1CZ8H 3TBSA 3GKWL 4JHWL 4IDJH 4K9EH 1LO4H 3ULVL 5GRUH 2MPAH 5I9QC 4XTRD 5GGRB 1JV5B 1G84A 2O5XL 4DKFH 2YOCA 5EO9B 1HKFA 1WGOA 5F88B 1QSEE 4GKOA 4KKLC 5HI5C 2BNRE 3WLWD 3BO8A 4DVBA 4HJ0C 1FORH 5T3ZD 4XP1L 3G08A 3ME0A 1MJJA 4I3SH 1I1AD 3HA0A 4NWUL 3SCMC 3SJVA 1XGUB 1TDQA 1ZAGA 4OZGF 1A6AA 2NY0C 4IS6B 3DHJA 4DK3A 4GLRI 1QSFD 4OQTH 1BQLH 4PJ7B 5DJ6A 3ZKQD 1CL7I 1YEDB 1NKOA 3IGAB 1A5FL 4I3GA 1HHHA 2VL5A 1Q0XL 1QEWB 3IDGB 3AREC 3D85A 4D9QE 3MRQB 3QFJA 1FN4B 5ACMA 4JQXA 1MH5B 5TDPA 2AJXH 2GKIA 3ARGC 3L3DA 4L8SA 5JQ6L 3MO1A 1FO0B 2J8UA 1H15B 4ZSOB 3TYGH 4ZFOB 1L9MA 3U0WL 1Z9OA 4PUBH 4YXKH 5DMYA 3E1F1 4K8RH 3KPQA 5CBEB 4RGMB 5KSVA 4BK5A 3DMMB 3WFDH 1QSED 5EN2A 2O26U 4K71B 2BNRD 4HS6A 3KPSB 3CMGA 1FG2A 5MEQA 4PJXF 1EAJA 5EU4B 4PJDF 1Q9LA 3ULVF 4NUJA 3MJ7A 4JFQA 1AGEB 4EN3D 1C5DB 5JW3L 1JNNH 1WBZB 2RGSA 4BQCA 5C09A 5CJXA 3TBVB 1UVQB 4CU8A 3MNVB 3BYYA 4H8WH 4D0BB 4D9QD 3WNKA 3OGCA 2WSKA 1QNZH 1JZ5A 5JPNA 5ID1A 1ZA6A 4ZTPL 5E2VL 1P84J 3T3MF 3GZKA 3U7WH 4G8IB 2EDXA 2P5WE 2VLJB 4MA1C 3LV3B 1VACB 4K55A 4NT6B 4DZBA 3RGVB 4XAWH 4GAFB 5GGRY 3SGKC 1CTOA 3H9HA 2CO7B 4LVNC 5D8JH 1G6RA 2VKXA 4HLZH 2IGFL 3LKQB 2FR4A 3PJSA 2X4PB 5FUZL 3CFJB 3OJVC 5I6XB 1A6ZB 1XF2A 1XH3B 3FT2A 5ALCH 3NCJL 1IT9H 1UKQA 1KC5L 3FB6B 2Q8AL 3SPVA 1IM3A 2ATKA 4R7NA 5HTSA 4JFEE 5CFHA 5IB5B 3C2AH 4RMRA 4X5WA 1LEGA 1VSCA 5FIEA 2VE6A 4FQHA 4JZJA 3MLZL 3MNZB 1RI8A 1KNOB 2P5WD 3AXLB 3NACH 3EYOA 4O4YL 5GJSL 4FNLL 3RHWK 3KVQA 2DQUL 4P2YA 2CLVB 4ZFFB 4HGWA 2GFBA 1RJCA 4F37F 1G0XA 3Q3GB 3GSQA 1V8HA 2GJZB 4D8PA 3WLBA 3UBXA 2E7HA 2RJMA 3CFEA 5ISZE 1U8JA 5DEGA 4WHCA 3RWIB 3SGJA 5C0NC 3O4LE 4LSDA 1JTPA 1I7ZB 2UWEA 2VKWA 5E6IC 1RZIA 1QBMH 1TVHA 4FXKA 1RZJH 4BSWB 4ODWA 3FT3A 3T77A 1MFAL 3T1FA 1NBQA 5IHUL 3OJ2C 3OKOA 4K07A 5DMIH 3RTQC 2ZUQB 5KS9F 2C4FT 4CGTA 5EO1A 3WD5L 4NQCE 1JP5A 1X5KA 2V9RA 4JFED 4URTB 1LK3L 4W6XB 4ZAKC 4R4NC 1RZ7H 3MRBB 3JZ7A 1T89C 3WSQH 2Z93B 4PB0H 2YUVA 4LPCA 2PR4H 3QDJA 3MZTA 2MNUA 3UJJH 1GXEA 3MGOA 4HZLB 3QBTB 1CLYH 1OLZA 2RQ8A 3BQUD 4F58L 4I77L 2IC2A 4NN7C 3P30H 4PJHF 1TZIA 3ARFB 3CSBA 5KN5B 3EBAA 5HGAA 3B5HA 2OR9H 4LSPH 1INEL 5ISZD 4LSVH 3O4LD 4LSQH 2FO4B 1A7RH 1UM6H 3VH8B 2HT4C 5ETUA 1BF2A 1Y0LB 3QPQD 2YRLA 4ODHH 3BKYL 2WWKT 5IB1B 2IFFH 1AGCA 3JWDL 5TGBB 1XF3B 5IR1A 1LDSA 5B21A 4NQCD 2FWOA 3IDXH 1I9IH 1I4FB 5J89A 2X1QA 4H0IA 5GIRB 3D18A 4PGZA 4QTIL 1DDHB 1K5NA 1UM5L 4ISVB 1MHEA 5CZXC 5HGHB 2Y5EA 5F9OH 2A74A 5DTFA 2CLRA 3S34L 4AEIH 4AY0A 2Z8WC 4HEPG 4QGYA 3O2DH 4ZOEA 4HV8B 3OV6A 5GSVB 1IZJA 4OQ1A 3VFSA 2IANB 3F7PC 1KLGA 1W0VB 2YUZA 3P9MA 3QUXB 5TE7L 1BWMA 2RAMA 3HG1B 4G42B 3T8XB 4OFVA 3MLYL 4HCRA 5EORL 4ODTH 4N0FA 2QADB 3FQUA 3W5MA 3MXVL 1GOHA 4YHOL 3MRRA 5HYIA 4EI6B 1KXVC 3RIAK 2NY7H 2IPKB 3FO9B 3SQBA 3SKJL 1C5CH 4QNPF 4I0PD 5GGVY 3KYNB 3CDGB 3MLRH 1JHLL 5T1DH 3U4EB 2Z31C 5CAYB 1SHMA 2IQAB 1JIBA 3BESR 3KXFB 5C71A 25C8H 3MREA 3I50H 3BRDA 1CT8B 4YZFF 1D9KD 4OZGB 3MRFB 4S1DC 5JNYA 3WFZA 4XP6L 2A77L 4RSVA 3BGFB 3C9NB 5L88H 1IC7L 3VD7A 1BVLA 4UDUA 3CX5K 2ID5A 3FB5A 1CCZA 1I1YA 1KN4L 2FGWL 1S7WA 5MP6L 4Z6AT 3VA6A 1U42A 4XMPH 2CIKB 4KPHH 1J0IA 4K8RD 1YPZE 3C60C 5HGBB 4H20L 2GTWB 3P9LA 5BOZG 3PGFL 1JPGB 4LAJH 4OB5L 4Y2DC 4G9DB 4Z7UE 4OCRH 2BVQB 4F15C 5CHNA 4L1HA 1XMWA 2V5RA 3VG9C 1CDCA 1HSAB 4HIHA 4U4BA 3GSXA 1MCPL 1N5AA 4XZUA 1PBYA 5K59E 5BQ7A 4JO2L 1C12B 2NX5A 3A67L 1U6AH 4M62H 1M71A 3VXSA 2KH2B 2P8PA 4ODVL 3T1WA 3FHQA 3ZDYE 2HT3D 3SDDB 1ZHLA 5F7WC 3T0BA 3KJ6L 1FG9C 2CKBL 4RGNB 1A0QL 2CUIA 1A3QA 1H3PH 4BKLB 5CEXA 3FKUS 4GAYB 2NY1D 3OXSA 2YKLL 3OKNA 3TLRA 2A73A 2WINB 1A9BA 4M43L 1IQWL 2E6QA 2JK5A 3BPLC 1LQSR 3QQNA 1FIGH 4NDMA 3CSGA 1CBVL 4M03A 3MNWA 2OZ4A 3IJYB 3VFNA 1ORQB 5KZCB 4Q9RL 4HS3B 4KRPD 1YN6A 4RDQG 5J4MA 2DIAA 3IKKA 3CZFB 1SY6H 3QIBC 5MENB 1CICB 3PP4L 4LLMB 4EBQH 1IGCH 1F2QA 7CGTA 1N3NB 3NAAL 5INCA 4OLVL 4UOW1 3BWUC 3WNOA 1QFHA 2AQ2A 3CZJA 5JHDB 2FDBP 4MA3B 4N0UE 5D5MA 3C87A 5DSCB 2H32H 1HKLL 3G6JE 1QLRB 3TA3A 3N1PC 4ZNEA 4R97C 4PJGF 1ZT4B 4K2UH 2ADIA 1DUYB 5GS1C 5K93A 1UH2A 1XR8A 1MPAH 3EJJX 1XZ0B 3QIWC 5DD6B 1A9EA 4QCIA 3D3VB 4GRLD 2BNUB 5K9JH 4U7MA 2NPLX 4MHHG 1FE8L 3DYPA 1ETZA 3VXME 1NFIB 4WI5A 5KS9B 2GT9B 1CGUA 5IB2B 5DJCB 2OQJB 3VWJC 3NIDF 5HJ3A 4U05A 2JF1A 4XCCL 3BP6A 3C5SB 3PWJA 2FJHB 1JYNA 1R5VB 5JOFB 2MQCA 3F8UB 1KV3A 4UQ2B 3KYMA 2RHEA 4PJCA 4JM4H 3FL7A 5GGTL 1TJIL 1OTUC 1WICA 1WBXA 3HC4H 1CFNB 4PJHB 4RFOL 4LLAA 5JXED 1DBJH 2GTZA 3RVXC 3UYRL 3GHBL 4D3CH 4PRAA 3BP5B 3T0EA 1A4JA 2X4NB 3FJTA 4Y5XB 1G7IA 3DUSA 4X8JA 5IB4A 4YHPA 5BS0B 3LSOA 2XWBA 1I1FB 5EDXA 4PRNB 3EYQC 2ADGA 4LKXB 5I17B 3H3KA 3NABH 1OAXH 3CFDB 3VXMD 1PJ9A 1K4CB 1Q8MA 1T1XB 2QJDA 3LIZH 4DAGL 1KCRH 3MJ8B 1BX2A 1WUNT 1IGMH 1FFNA 5FHBL 3NZ8B 4AJ0A 5GGSB 5F70A 4XCNA 1GYAA 3LH2H 4YNYA 3VD3A 4QOKB 4F8TA 3QZWA 4HDIB 3LQAL 3MGTB 3FQXB 3PL6D 5FYJH 1XGTA 1KCLA 5F6IC 3BN9C 1CD8A 2P5EA 4MGXA 1L9NA 5L2KA 4HXAL 3TVMB 4U6XB 3CX5J 4QXTA 1MWAA 3R8BB 5KVFH 4FP8H 3BFOA 4NYLA 2XQYG 4POUB 5EC1B 4ONHA 4G80A 3S4SA 2ATPB 1KBGL 1BOGA 5L0QC 5KVDH 2VXTL 3BGMA 3CFIC 2VLMD 5GPRA 3RZWA 4LRIA 1INQB 4LCCB 2IPUK 1SMOA 5E6ZA 5EIIA 1TCRA 4S1QL 4YDIL 2ZNWA 1X5FA 3TO4B 3KWWB 1Q0YL 4R3SA 2VDOL 3BH9A 3IXTA 4F8QA 5C07A 4IOFC 3EZ8A 1UA6H 5F9JB 4BFGA 4PRHB 3T0WA 2E9WA 4XXCA 3WXWL 5D2NA 2C1OB 3WFCL 1GVIA 4PJFE 4YHLL 1OM3L 1EEUA 3VI4F 5HYJE 4ZS6D 2YD7A 3CFKB 4M8QA 4OI8A 2C4FU 4MAUH 4MMZC 4C83A 2R4RL 3HPLA 4UUJA 4KDWA 2KPNA 4WO4D 1ROWA 4CDHA 1JGEB 3LB6C 2V7NA 2DQIH 4HLZG 4NO5B 2QSQA 1JGLH 5DLML 1WZ1L 2PW2B 4PLJC 5H2BA 5I1EL 4HMDA 5TE6H 1RHHA 1YNKL 3MBXL 5GGQL 4CAGA 3W5NA 4RAVB 4EVNA 3WN5C 4TTDD 5INDA 3SE9H 4RBPH 3P40A 1R24A 1DQDH 3C6SB 2VABA 1YNLL 5C0RH 2FIRT 1Z5LA 3E6FA 3U0TA 4Y4FD 3TF7C 3VMPA 1AXSB 4S1SH 5D1XC 1R3JA 2FGZA 5HHOB 4L8CA 4OLYH 4YO0B 4RZCB 1X4YA 3GI8H 2OTPA 4XNMA 1E4XL 4JN2B 5JOPE 5HYJD 3MXWH 4AH2A 5E1HB 1PDKA 3GSNH 1BZ7B 1P4BL 1P4IL 5GGSY 2FZ3B 3V52H 4B50A 4ERSH 3NCYS 5DC9B 4PLNC 4FFVC 2Z0BA 5HDOA 1YEKH 5CGYC 4G8FA 3SKUD 4JRXA 3KS0J 1T0NB 1PYWA 3CVHL 4ODXA 4JFXB 3EYSL 1ADQA 3FAWA 4MJ4A 4U1JA 4NKDA 4FTVE 2BOCA 1CZ8L 5JW5A 4G9FA 3IFPB 4NKMB 4U1NB 4IDJL 4K9EL 1LO4L 1GOGA 4GKZA 1FV1A 5GRUL 4N1CA 4BUHA 4ELKB 3BPNC 2KQMA 2MPAL 1FYTE 4XWOC 5F89A 4DKFL 4OZFA 1T7WA 4KDVA 2ITDA 3MUHL 4PV8B 4QY8A 5I73C 4P2OA 5JOPD 4HKJB 1FC2D 3L5WB 5DQJA 3TPUA 4OD2A 5A2LH 5EWIH 4D2NA 1AIFA 4RDQF 4F7MA 1FORL 3MOBH 5EUOF 1IC4H 4P2CG 4X83A 4G6FB 15C8L 4GG8B 4I3SL 4CUCA 2CJUL 4XNZC 4JM2B 1XF4B 4OF0A 2X4TA 1YY9C 5TQ2H 5KAQG 4LHUA 3V0WH 3ZT5A 1L7TH 4FQXD 4OQTL 3O2VL 1IGFL 5FKAA 4AK1A 4FTVD 4KZDH 2NY4D 1T2XA 2HP4A 5IB3B 5I1DA 1FYTD 5IW6A 1KCVH 4TRPH 3TYGL 4X7DC 1K2DB 1X5HA 2FH6A 5I1LA 4OBSA 4POYA 4YXKL 2CSPA 4K8RL 3BP4A 5F9AC 2V2XB 1QA9A 1Y6KR 5KOVC 1QFUH 5B4MC 3CD4A 1LDPH 2KZWA 3LKSB 2R2BB 4HKXB 2AW2A 2FHBA 3O8XA 1HILB 2G75B 3MJ9A 2DTML 4TUOA 5ERWB 3F12B 3QHZH 1JNNL 4NRYA 5ICYB 5FF6B 2QQLL 43CAB 1JFQH 4K3EH 2ZPKL 3DX8A 4KKLD 5HI5D 5SWZE 1FFOA 5JW4M 4HJ0D 2OK0H 4ZG1A 4H8WL 5EC2A 2BVYA 1XGRB 4LGSB 4LQFH 3HC0A 1QNZL 3EOYG 1R0AH 3BPOB 2EDKA 2Q7YA 3SCMD 1WCBB 5DA4A 4Y0GA 3PWNB 5TDOB 4UU9B 5GSRB 3BDBA 3U7WL 1RMFH 1O7VA 4PTUB 1VB9A 2EEBA 4B41A 2BOBA 3P4OB 3ARED 3T4YA 3QNYB 4XAWL 4HUXB 4JCMA 5D8JL 4IMLB 1QRNA 3RKDC 5CWSB 3T04D 3ARGD 1QSFB 3U9PH 3MV8E 5I1HH 2ERJB 3R8QA 1MHCB 3O3UN 3WS6C 1AGBB 1I8MB 5D7IA 1C7TA 1GGCH 4A6YA 1PAMA 5DI8B 1EBAA 1JRHI 4WU5A 3K8MA 2NZIA 4X4XA 5ALCL 1IT9L 1FL6B 5EBMB 5SWZD 4F7TB 2MSPA 1RJYA 2F54A 4OUUA 5T5NG 4KJYB 4YDVA 1Q9WB 1RUPH 2VQ1A 3MOAH 4JDVA 3VRIB 3CVIH 1GSMA 5F7DB 1QSEB 3T4AA 1BQHG 3U36A 3VGHA 4ZPTA 3NACL 2JTDA 5F1KC 2WBJB 5F6HI 5DJYB 1ITBB 1JNHA 2GJJA 2WP3T 4OV6F 3ALPA 4KKNA 3VE0A 1KB5H 5EU3B 1UWGH 4EN3B 4F80A 3DV4A 4P57A 2LVCA 3MV8D 3BRGC 3HE6C 1J11A 2VR9A 3R0MA 3VI3F 5J6GB 5I1KH 2HFFB 3IDIB 1I8IA 4OF5A 3CJJA 1QBML 2W9LA 1KJMB 1RZJL 3GBNH 2VAAA 1QR1B 5ADOH 2C3VA 1T0MB 4ODSH 3VFOA 1YPZF 5DMIL 3J7HA 4NQSB 2EDHA 4LFHD 4YR6B 5I19H 1NAMA 2EYSB 4MD5B 2OXGA 1OSPL 1RZ7L 4HUVA 3ES6B 3WSQL 4P46B 4L5FH 3RI5F 5J8OA 4PB0L 1ZVSB 3UJJL 5EOTB 5K59F 4WEUD 4UNVA 2AEWA 1FNGB 4KVNH 4OFDA 1YEGH 1CLYL 1U58B 2PW1A 3FQNB 4C57C 3LZFH 1CD1A 4LEXH 1EFXD 5C0GB 5CUSL 5CMAA 1O5DT 3MLTA 2MCPH 4LSVL 3ZDYF 4LSQL 1NAKH 4JFDE 1DP0A 1XGPA 3UZVB 43C9B 1UM6L 1E6JH 1ES0A 3UPRA 3L3JB 3EUUA 1MCLA 3TZVA 4JDZA 1KF9B 4ODHL 3RNQA 1MNUH 1P4LB 3F7YA 2FB4H 4NO2A 5C9KA 2IFFL 1UGNA 4QRQA 3MRPA 1ZOXA 4I48B 3VXNB 3IDXL 4LL9A 5C86A 4XP5H 5FM5M 2P5WB 1JWSA 3QCVH 5C0ND 3TESA 4QWWC 5CS7A 1HINH 4MD4B 5E6ID 1T5XA 2YD4A 4XHQA 1QBBA 2CDEB 4AEIL 3PV7A 5LVEA 3O2DL 1IARB 3RTQD 4YXLH 1U8MA 2VZUA 4N5UA 5CJQH 1IL1A 1SYVA 4V2BA 4ZAKD 1S7UB 2EH7H 4E41E 2ADFL 1GL4B 2QR0B 3UBXI 3P4LA 4JFDD 4J3UA 3C8HA 3O11B 2FATH 4XNQA 3ZE0E 4ZXBA 1BFOA 4PJ8A 2R0ZH 4WW1B 4LAQL 4JFEB 5DR5H 4ODTL 4NNPH 4XP4H 2R2HA 5ITFB 3I3BA 2ICWB 2VZTA 5CZVH 1Q94B 2HRPH 2YWZA 3TH4T 3WNPA 3PDOA 2VXSH 1RZFH 3ESUF 3G6JF 2HT4D 4DGYH 2VISA 3BQUB 4GOSA 5EUKB 3B8YA 5KAQF 2NY7L 4PGDB 1CQYA 5LG1A 4EOWH 4Y4HC 1C5CL 4G43B 3UYPA 2DQTH 2FHFA 4YWGH 5ISZB 5AG9A 4LLYB 5DMKB 3CFBA 3O4LB 1ORSA 3C08L 3MLRL 4S10A 5T1DL 4WY7H 5I66A 3Q6GH 2YPKA 25C8L 4HGMA 2UZYB 4E41D 5I8CA 2SEBA 2IALA 3ZDXF 1OCWL 1UKSA 5CZXD 4X4YA 3HNTH 3U4AA 4M5YH 1MLBB 4RIRA 3GBMH 4J8RB 5L88L 4NQCB 1AI1H 2VXQH 4BFBD 4R9HA 1CDIA 5KSBA 4XMPL 4RNRA 2ENSA 1V5JA 3B6SA 3BW9A 2WW8A 4X6BB 1V7NH 4WNQB 1K8DA 4LVEA 2EDLA 5ITBH 1JGDA 4GS7B 3TIDA 5A40E 2Q1EA 3A6CH 5E2WL 3SOBH 3MYJA 5FYJU 3NFPA 2I26N 4OZHA 1RUKH 4M62L 4PLKC 2VDKH 4S2SA 1WEJH 1HQ4B 2YUXA 2HYMA 5CSGA 3CK0H 1RQ5A 2J88H 5CIPB 1EEYB 1AQKH 3P4MB 4C4KO 3ARDC 2ITCA 3CH8A 1YNTA 1ONQA 3GSWB 3TNMB 1S9VB 2Z31D 4JZNB 3MRKA 4KKAC 1KXQE 1U93B 1UKTA 4NNXB 2QHRH 2IH3A 4P3CL 1BREA 1UJ3B 5EZIH 1H3PL 2XT1B 4S1DD 1Y18B 1UG9A 4MB5A 4I0PB 4LFHG 1NCDL 3OTTA 1ZE3C 1I7TA 5L2JA 4LHQB 2JB5H 4WEMB 5E94B 2YD3A 4WIQA 5FGRA 5J6HA 1HNFA 3OX8A 3C5JA 4PJEA 1D9KB 5H37H 5KANG 4L4TE 1ZA3B 3RPIB 3PGDB 2V5TA 1FIGL 3DROA 2F5BH 3AU1B 3DTXB 5T5NF 3C60D 3X14A 1EX0A 3DLQR 4GO6B 3RJDA 3QUZC 4Y2DD 1WC7B 1J1XH 3QO1A 1XGQB 1SY6L 2AJUH 3MROA 4AIOA 4OSUH 5T1LD 1UM4L 3GHEH 1OP5K 4PJFF 3LN4A 4EBQL 3DVGB 3WS3A 1F8TL 5I16A 3VXUA 5IM7B 1J88A 5C0BB 1BZ9B 1U8OA 5FHAH 4LCWE 4AIXA 1TCMA 1IM9D 1EO7A 2Y7QB 4N8CH 4TSCH 1O7SA 3Q5TA 4MDIB 3VGAB 2PO6D 5ANME 3IRZA 3ARBC 4L4TD 1D5MB 4K2UL 2Y07L 4YBLB 3WO4B 2DWDB 1X5JA 5DVOA 4XCYB 5JHLH 4P5TC 4Q0XH 1MPAL 2A83B 4M7LH 1DR9A 2OXHA 5I71B 1RK1B 5IBUG 5K9JL 5GZNC 1H0DB 4PJAA 4ZYKA 1YPZB 1XIWD 4QKXB 3GUTA 4MJIE 3CXHK 1P53A 3U48A 1B0GB 2V9TA 4JGMA 4Z7UB 5EU6A 1CDYA 1A2YA 4G7YL 4AM0B 2VLRE 3S36H 3QIBD 4YHIA 1TZHA 4ZDHA 4JM4L 4LPVA 1QQDA 3HNSH 4QHUB 3OPZH 3HC4L 4BSVA 1Q9OA 1BWWA 1KXTB 1DBJL 4E5XA 4KRPB 1KPRA 1LK2A 5FV2A 4PRIE 3C5ZB 4XPHH 1QACA 1AHWA 3OL2A 4XMLH 1UXWA 5GS0L 4O9HL 3QXUA 2J12B 2ED9A 3G5XB 3O4OC 4TVPL 5EZJB 4BZYA 1OAXL 3LIZL 1KCRL 1J86A 1U95B 1YDPA 3B5GA 1IGML 2F19L 3NA4A 5DT1H 1DQJB 4MJID 5JMRA 3OR6B 5LGJA 3VCLA 2XTJB 1F6FB 4L8DB 1CGVA 2WWKO 3V0VA 3VFWB 4F9PC 1F11A 2FLRT 4L8SC 1KCUH 5FYJL 3GIVB 4U1SB 3DX9A 4ZFZA 2ENYA 2VLRD 3T65A 4X7EC 4DUVA 2W1NA 3OKMB 4ZFGH 3MBEA 3C8DA 1QYGH 2CPCA 4FP8L 5JZ7C 3VWJD 2JIXA 4GRLB 3MODH 2OM5A 4MQXC 5KVDL 1OHQA 4U6VH 3B3IB 3V0AC 3KLAA 3P0VL 1JV5A 3MZGB 4P4KA 1LP9A 3AROA 1OTUD 4WW2A 1UA6L 5F88A 3RVXD 4N0UB 1F3DH 5F1IB 1CE1H 3VDBA 1PKQB 3G6JB 4N90E 3HZKA 4AQOA 3EYQD 1XGUA 2NY2C 5I8EA 3QNXB 4MAUL 4IS6A 4Y5VC 1QHOA 5HDBE 4PJ7A 4HUWB 3RX7A 5D9SB 1GZQB 3IGAA 3MUJA 1RIHH 2DQIL 5I1JH 1XCQB 1JGLL 1QEWA 4H1LA 2DQFB 2ADJA 5TE6L 3JUYA 4LVHB 3VMOA 3VXMB 5DD3H 1M7IB 3QUKB 1NGXA 5D70H 1FO0A 2W91A 1GHFH 4W6YB 3SE9L 3KGRA 3WUWG 5C0RL 4WU7A 3ELAT 4JHBA 1WBYA 2YD1A 5D7LE 1NFDF 4RA3A 5DWUH 5IMKA 5CBEA 2NTFB 3RWFB 2LABA 2EDRA 3E3QC 1R3IH 2UY7A 1OWRM 4OLYL 4PJ5E 2DLGA 3GI8L 2IMNA 4N90D 3VGDA 1JF1A 3GSRA 4QXGH 3D2UD 3MXWL 5GS3A 3GSNL 1C5DA 5A16A 3V52L 1WBZA 4IOFD 1G6RL 1BBDH 2EEDA 1IAIH 2ICEB 3TBVA 4HXBH 1YEKL 4OKDA 4NQUA 4QHMB 3WCYA 1SBBA 4X6FB 3G04A 1KTLB 1TETH 2NZ9C 2QQKH 1MCWM 3UDWC 2EYTA 4OM1H 2Y5TB 1LO0L 2E9BA 5EULV 1MAJA 5HVHB 4MNGE 3KPLA 2WAHA 1J87A 3V95A 3REVA 2DLIA 4Q7DA 2VLJA 5D7LD 2ZKHH 1D3CA 3LV3A 3BWAA 5SWSE 1F13A 1F42A 4PLJD 3RGVA 3TBTB 1IAKA 3ARXA 3BKCH 3LKQA 3AC0A 4PJ5D 2DM3A 4MJ6B 2N7AA 2X4PA 2P7TA 3IKCA 4K71C 5EWIL 3DURA 4ZOCA 3MOBL 5D1XD 1IC4L 4AQ1B 2O5ZH 2X7LA 4L3EE 2DLFH 2C7UA 4ZUUB 3TCXA 5IJKA 5DHVH 2BVPB 4OLEA 1T3FA 3T3PE 5HYEA 3ZHKA 3GM8A 3LQMA 3M1BA 5TQ2L 4OAWA 1H5BB 5DRWB 5IVZB 3V0WL 2JJSC 1L7TL 2QL1A 4Y4FB 1TXKA 4YEFA 1KPUA 4XP9H 4KZDL 3L1OH 4M7ZB 4CDGC 2E7LC 2YEZB 3CNKA 3DARA 4PJFB 5CGYD 3VRJB 5SWSD 2MKWA 3WL9B 5L6YH 2AJYH 2BNQB 4KJPD 5HYJB 1KCVL 2DOCA 4NQXB 4Y5YB 5C0DA 1II4E 5ESVB 4UIMB 2DTSA 4XVTH 3V8CA 5E9DB 3RWIA 3EOTH 1I7ZA 2W0KA 1T5WB 4KDTC 4UTBH 1QFUL 3KDMA 1OLLA 1LDPL 1D7FA 4L3ED 4GT7A 4RGOH 3NFNB 5I6XC 4XWOD 4ZUSB 3V6OC 1OGAA 2XKSA 1S9XB 3QHZL 4HQQH 3UTPE 1JFQL 4K3EL 4JFPB 4WUUB 4AMKL 2Y36L 4Q6IA 2OK0L 4PG9A 3DJ9A 3MX0A 1SMAA 4AYFA 4TQEH 1R0AL 3EJYC 3I6LE 3MUZ1 4CVUA 1YY9D 4PJ9C 1M05B 2B1HH 3ARFA 3OKLB 5B38B 4AIZB 3GMLA 1EXUB 4OCSH 4NFBA 4P23A 1LEKA 4RISH 3D9AH 5TDNA 1KEGH 3L3IB 1BAFH 3W39B 5A2IH 3MRNB 4JKMA 5EFIA 5IB1A 1FSKC 3I6KB 4U1KB 3U9PL 5I1HL 4JRYE 4FTVB 2Z91A 4P0DA 2NY4B 4JY4B 1GGCL 5DRZB 1DVFC 1I4FA 1X44A 3DGGA 1K3IA 3UTPD 1JPTH 1KG0B 2JB6B 3BT2H 1ZANL 2WV3A 4PP2A 2BERA 4M8VA 2ZUQC 1FYTB 3E0GA 5B4MD 5HGHA 3RFZC 1J0YA 4IJ3B 3L7FB 4U0RC 4D0CA 2VN4A 4G3YH 1TQBB 3ISWA 1I8LA 1XT5A 3TYFA 3X3GH 1OTTC 3S37H 3I6LD 3CVIL 1UB6B 3CFCH 3DYMA 3NH7L 2R4SH 3FONB 1DN0A 1OF2A 1CF8H 5DXWA 4M48H 2IANA 3ZSSA 1W0VA 3CH1A 5I9QB 3HG1A 1CLOH 1A21A 5I75B 2XWJB 3T8XA 4CBPA 1EHXA 1KB5L 4N0YH 4UV7H 5DUMH 3UTOA 1UWGL 4EJ1C 1NJ9B 4GKSA 4JRYD 4I0KA 4JLRB 1MAKA 5I1KL 3GMRA 2ZOLB 4HIIB 2JLLA 2XXCB 3GBNL 5MEOB 1U92B 4ZOBA 3IDJB 1SQ2N 3RZCA 4ODSL 1M7DB 3Q1SH 1ZT1B 3RKDD 2G9HB 2IPKA 1GJIA 2J4WH 5I19L 1BIIB 3D69A 3SDXE 4LPXA 3CDGA 2AABH 5C92A 4NFDA 4HIEA 1EAPB 2IQAA 4IEFB 5HDLA 4L5FL 2BZDA 1MI5A 2EDYA 4OZGA 5HYSG 2WWMC 3ZYIA 4KVNL 2Y25A 1WFNA 1I9JH 1MAMH 1YEGL 5H37G 1ACZA 3K4DA 1MY5A 3MV11 1S9KC 4JPKH 2VH5L 3QUXC 4WGWB 1W8NA 3K2MC 3BYTA 4ZTOH 3BJLA 5F8QC 1B6UA 5SWZB 2CIKA 2MCPL 1NAKL 1GIGH 1E6JL 5EIVA 1JZ6A 5IQ9A 1OAKL 5C0JA 1MNUL 1RULL 1KJ2H 2GTWA 2C3XA 4K7PH 2QADC 3N50A 2FB4L 5EOCJ 3OKEA 1URLA 5CP7A 4HFWB 1W72H 2DQHH 2E5EA 2J5LB 3JV6B 4KGJA 4G9DA 3HE6D 3VFUB 4XP5L 3JWOC 4PJXA 1JGUH 1GGBH 1HINL 1HSAA 4PJDA 1C12A 1YMME 5AD0B 3U4BH 1C08B 4Z78A 4MAYD 3MV8B 4JJHA 4Y19E 4MJ5A 1NUFA 2YN5A 4YXLL 2F9BT 4CW1A 4JGUA 5CJQL 5B8CA 3UTSE 1WISA 2OZ4L 5MERB 4MA1B 2EH7L 4YDJB 4LEOB 3UZQA 5ILTH 1QFWM 3O3BA 2FATL 2HJKB 2R0ZL 2D4DA 3M17B 5DR5L 3MRCB 3RWHA 1KUMA 4NNPL 4W6WB 4XP4L 2WINA 4PIRF 4NKOB 3IYLW 5CZVL 2HRPL 3NOIA 1T04B 4GUPB 2EDDA 1JVKA 2FX9L 3WIHA 2VXSL 4DVRH 1C5BH 1NMCC 1RZFL 1U3JA 2EYRA 1NBZB 4N68A 4DGYL 1YMMD 4MQ7A 4KJWC 1YEIH 3TBYB 4XI5D 1UCBH 4RX4D 4EOWL 4KU1A 1EFXB 2DQTL 4Y19D 1S7QB 4YWGL 5HXMA 3MCKB 3F5WB 4HBQA 2X4QB 4WY7L 3CZFA 3Q6GL 3FT4A 4OTXL 3UTSD 5MENA 4QWWD 2DIBA 3ARYA 3WE6B 5KSAC 4DW2H 3INUH 5EPMA 4GAJH 3D0LB 3HNTL 4M5YL 5DJDA 3U1SH 3GBML 3SDDC 3NVQA 4FFWC 4W81A 1F3RB 3ROLA 2V7HB 1AI1L 3FFDB 4EIGB 4LLVB 5A3IC 2ZUYA 1NC2D 1QLRA 2APWA 4F37K 2GSGA 4NBZB 4X9BA 1EHAA 1ZT4A 2VRAA 1DUYA 3RTQB 2G60H 3AS3A 1V7NL 1B2WH 2YRZA 4XNXL 2X70B 1DANT 3P4NB 1BD2E 2DYPA 2VQUA 4ZAKB 1XZ0A 5IBUB 3ZKSD 2XNAB 3REWA 4JFDB 4HUKB 4HK0A 4NN6B 4LQ1A 3F58H 2DBJA 5KS9A 1RUKL 1CE6A 2VDKL 1WEJL 3M07A 5F1OB 5FA4B 2B0SH 3C5SA 3CK0L 4KTYA 1WZLA 2J88L 4Y4HD 1R5VA 5FA3B 5JIIA 1JYWA 2AXGA 3DI3B 3RY5A 2QHRL 4IRSB 5MHSE 3SGEH 5E08H 4O2CA 1CFNA 4PJHA 2EIEA 2L7JA 3MV9E 3PWUB 2JB5L 4HPOH 1YEHH 1BD2D 5IEHA 3QWOA 1MWAL 4GG6E 4E41B 2VIRB 3UAJC 1I1FA 2YBRA 2CRYA 1K6QL 1F97A 4MNHB 4I4WB 4HKZB 3CFDA 2F5BL 1T1XA 1X4ZA 3BH8B 2HJLA 3EO0B 3UEZA 4U1LB 3KYOB 3MJ8A 5IG7B 3NZ8A 1R3LB 4PJIB 3HI1B 2ED8A 5GGSA 4KMTH 3KYKH 5C0EA 2EXYC 1J1XL 4QOKA 4YBQC 2AJUL 4HDIA 4OSUL 3MGTA 4ETQA 3GHEL 1VFBA 1HHGB 1ZEAH 3CSYB 3HLAB 2EDWA 3VA2C 4LCYA 3AY4A 3JSSA 4U1HB 5MHSD 4PLKD 4GSDH 4DN4H 1ZHBB 3KLSA 4NQVA 4LLUB 4F7EA 4GQ9H 5HDBF 3L3KA 5IBLC 5FHAL 1D5BB 2CO6B 4LOUC 2ATPA 3KHQA 3MV9D 2BY3A 4N8CL 4TSCL 4MJ2A 3ARDD 3QDGE 2V5YA 4LCCA 2WUCH 4NCDA 4OFYA 5DVNA 5H35B 1E4WH 4KKAD 4PD4J 3TO4A 2XN9A 1BVKB 3VXTB 4QRPA 1OY3B 5FK9B 2UUDH 5BRZE 4Y5XC 5JHLL 5DK3A 1NLDH 5F9JA 4Q0XL 1EJ6A 4M7LL 2MJWA 2Z31B 2AQ1A 2C1OA 3FO1B 5IVXE 5C08B 4PRBA 2N7BA 2P43B 4R4BB 4POZC 1FZOB 1ODAA 4X9GA 2CK0H 2B20A 4PR5B 5T5FH 5JTWA 1O0VA 3O41A 4Q58C 5HHNA 3EFFB 4OF6A 4JJ5B 3V5DB 1P9MA 2WMPA 2AVGA 4YE4H 2Q3AA 4NO5A 2AP2A 4FFYL 3QUZD 1KENH 2ORBH 3A6BH 1MFNA 2X4OA 3S36L 1V3LA 3TVMC 1NSNL 1KIQB 2ZSVA 4X9FA 3QDGD 1FIEA 4OIIH 4RAVA 3C60B 1U8NB 4P2QD 1MJ8H 3HNSL 1D6EB 3WUWB 4H5SB 4IIQB 5HHPB 3C6SA 4J3SA 3GSUB 1DCLA 4KK5C 5BRZD 2XA8H 2YD6A 1AXSA 2DQCH 4XPHL 4F15B 3LQZA 4XMLL 5T1LB 2Z35B 1G9MC 3RUGF 1UENA 1NKRA 4J3VA 1TTFA 4YO0A 3LRSA 2IH1A 1JUFB 2ILLA 4U1MB 3ARBD 4FZ8H 1QO3A 4YUEH 5DT1L 3F7RA 2FZ3A 2JJTA 4P5TD 1S7TB 2PO6B 3FOMA 1MRCH 4IBLT 1SJEB 3V4PH 4JKLA 4L4TB 1KCUL 3SJVE 5GZND 4GW5B 1IGTA 3KYAA 5K33A 4I5BB 3UTTB 5AYUL 1HK6A 2I9LA 5K9KB 4P3DA 2RCSL 4PBWD 3D1MC 8FABB 3NTCL 5CCKH 3RVTC 4DKEH 3T3PF 2ZCLH 1QYGL 3HN3A 4NQEA 1T2QL 4U1NA 3MODL 1M7XA 1TJHH 3HUJF 3QFJE 4U6VL 4KMQA 3TH2T 1J1OH 3BPLB 4N5EC 3BAEL 1XIWB 1NCBH 3S35H 3HI6H 3O8XC 4BK4A 4B7IA 4GJTB 2LTQC 2CGRL 3PWLB 1JNLL 1J8HA 2WQ8A 5IFJB 2I27N 4JRWA 1U3ZA 3MSPA 3WDHA 4HKJA 3L5WA 1HQRA 4PLOB 3HZYB 5DS8B 4KK6C 4LCWB 4XH2B 4J6RL 3QIBB 4XB7A 3ZE2F 1CE1L 5ANMB 4LASH 2LAAA 3PQYE 2ESVE 4GG8A 2PYEA 3THMH 3QJHA 1RUQL 1XF4A 3SJVD 1Q9KB 3U82B 1MFEH 1QPPA 3UZEA 3MV7A 5DMGC 1IC5L 5ID0B 1LE9B 1RIHL 1FVEB 2X4RA 3PV6B 4ELMB 3QO0B 5E2UH 5I1JL 1I7RB 1PGRB 5IB3A 3MJ9L 3LS5H 1H3UA 2IBGA 3QFJD 3DNKA 1B0WA 5HSFA 4ONOA 4FA8A 3VWKB 5DD3L 3ZHLA 5GGVH 5D70L 2J6EH 1W0WB 4IRJB 4BZ1H 4WV1A 5GS1B 1GHFL 4MJIB 1MCHA 4Y8DC 1I3VA 1EERB 2FNBA 2Z8RA 2BSED 4LGRB 5JZ7D 5DWUL 1YYLH 4NM8L 1IAOA 4U1IB 4DCQA 4MQXD 2V2XA 12E8H 3VFRB 3JXAA 2VLRB 5KSUB 4PJGA 1R3IL 4KVCH 4M3JA 2ZUTA 3S6CA 3TCLA 1YMHB 3PQYD 2ESVD 4HKXA 4RMTA 2CKBA 3TT3H 2C1PB 3VWJB 2G75A 2VDLH 4QXGL 2Z8SA 1IEBA 2E8ZA 4TPRH 3MYZA 3CLFH 5ERWA 3MOQA 3F12A 4CNIB 2Z92A 3IETB 1B4JL 4PRIB 1BBDL 43CAA 5FUCC 4HXBL 3O3EB 1DUZB 2EE9A 2XG4A 1NBYB 5TF1H 5C70A 1IE5A 1TETL 5IVNA 2QQKL 3L3HA 4NJAH 1WCBA 5DHXB 2NY2D 2M1KA 4OM1L 4UU9A 5CSZB 4PGBB 4PTUA 2DQGH 1PQZA 2ZKHL 3AB0C 2HKHH 2VR5A 1I1AA 5ESQB 3MRHA 3BKCL 3KPOB 4TSBH 3H6JA 4X5XB 1FZMB 1LEIB 3L9RA 3X12A 1MHCA 4NRZA 1KGCE 1I8MA 2UWEE 6FABH 1QLFB 1MQ8A 1KULA 2HVKB 4G6JH 1I3RA 2O5ZL 4ZSOE 1NEZB 3G9AB 4MDJB 4DKAA 1DQQA 1OGTA 5F96L 3ZDZE 3QQ4A 3FFCE 1Q9WA 5DA0B 2YD8A 4LDEB 3AM8A 3JWOH 4HIJB 4PY7A 4EDXB 5CEZH 3BZFB 4XP9L 3ZTNL 3L1OL 2BNRA 5K9OA 5L0QB 1HIMH 2VLKA 1VCAA 1MCJA 3QDJE 4CL7A 3TZVC 5I74C 3F6LA 5DJYA 1BFTA 4F33B 4QXUH 3I02B 5L6YL 5JIHA 2AJYL 2QBWA 1WWAX 3D2UB 5FUOH 5EU3A 2QQQA 4EN3A 5DJZA 2NZ9D 4Z77B 3QFDB 5I15L 3OKYA 4XVTL 3RNKA 4K3DH 1KGCD 2ZWLT 2APBA 3NGBB 2HFGH 3EOTL 5JO5A 2HFFA 3FB8A 1RVFH 5ICZB 4UTBL 1KJMA 3P0YH 4Z7VF 3QCTH 4M1CC 1F58H 4HH8A 1BBJB 3PP3H 4R4FL 1DANU 3MA7A 2OI9B 5GGTA 3FFCD 2WNGA 2BVTA 3LKRB 4HQQL 4QRTB 2EIZA 1AKJB 1ZVHA 1NCNA 3ES6A 4WI6A 1G7PB 4U2YA 5IMLB 5HYSB 3QDJD 1ZVSA 1MREH 2J3SA 4UBDC 3ILQC 1FNGA 4JHAH 1L0YA 3WN5B 1MCCA 3LKNA 2EDFA 1U58A 4OCLC 3FQNA 4P59H 3V6OE 4MCZB 4Y4KA 1NANH 3PUCA 2WBJC 5D1XB 4ZUWB 5CEYB 1HOCB 3SKMB 1IGYA 4OCSL 1VFOA 2M8XA 3LOWA 4H25B 3D9AL 1KEGL 2BFVH 1FVCB 2VC2H 4X6CE 1EUTA 4ZQKB 4JREB 3ROOB 4O2FA 4MNGB 3VXNA 5DUBB 2C26A 3BX7C 5DD0H 1LD9A 3E6HB 3KJ4B 3GMPB 4LLWA 1JPTL 1MVFA 3BT2L 5SWSB 5HPMB 4I18B 3DRQA 1QVOA 2YZ1A 1UH4A 4N0RA 2V2WB 4IHOA 2AEQH 3X3GL 1GOFA 3S37L 3WIHH 3LMJH 4P46C 2GAZB 2H6PB 4CVZA 3CFCL 3IAPA 2R4SL 4LRNH 4GAGH 4S1RH 4HPYH 2Q6WB 1S7UA 4XHJC 1HHKB 3IS0X 3OAZK 4OGXH 4YPJA 5DK0A 2CMRH 4L3EB 3VXOB 2QR0A 1CLOL 4M4RA 3O11A 4HS8H 3S36X 4PRPA 4X4ME 5FOBB 3BD3A 5DUML 4JFEA 3PHQA 5EBWA 3EJYD 4P48A 3WJLC 1ZHKB 2OTUB 3H7BB 4GBXB 4PJ9D 4R0LB 5F7EL 4KI1A 3JTTA 3RU8H 3O6FB 2ZZUT 3VD5A 4AT6A 5FDWA 4P2RE 2XACC 4XNZB 3VFPB 4HFUH 5M7QA 2QKIA 1KIPB 3Q1SL 3LEXA 4JPIA 4APQC 4G43A 4JG1H 3WEXA 5E56A 7FABH 5F7FA 5ISZA 2IAMB 4LLYA 5DMKA 2AABL 3O4LA 5EUOA 4DZ8B 1BJ1H 4KROC 2GQHA 3NCFB 3MRMB 3BIAX 1DVFD 1KOAA 1FFQA 3VXSE 3VD4A 2EZ0C 1ZWIB 2WUBH 5MI0B 1I9JL 1MAML 4ZO7A 3X13A 1DBAH 1HHIB 4NQCA 3K8KA 1I8KB 4QT5B 1OTTD 4JPKL 4Z95H 1UWXH 1NGYB 2R8SH 4NFCA 4ZTOL 2G5BA 3DSFH 5FAAA 4WCYL 1IQDA 5JW4N 1GIGL 5DEFB 2DWEB 4P5KB 1NDGB 4TUKH 1V7MH 3V9FA 4UTAH 4M6AA 1VEOA 4F2MB 2FBJH 4O5LH 3QI9B 4P2RD 4FQ2H 4YGVA 1KJ2L 5C0FB 4K7PL 3HMXH 3CVHA 4NHCH 1W72L 2DQHL 5E2JA 4YHZH 5JLZB 1KSRA 3U2SB 4H0HB 4TTGA 5F7YC 5TFSH 2BMKA 3V5KA 5IOPB 3WFHA 1GGBL 4GG6F 8CGTA 1BHGA 3S98A 4K94L 3K81A 3U4BL 3VXSD 1IAMA 5D6DA 1HQ4A 4DN3H 4JRYB 1Z6JT 1D5XB 3V5HA 3V8OA 1EJOH 1TVDA 5J1SC 4NCC2 1EEYA 5DGQA 4BM7A 4GXVH 2HMIC 4G7VH 1MF2L 1U8LB 5CEZE 3KPTA 4JZNA 1NCUA 4BZ2H 5ILTL 2PXYB 1UJ3A 4R96A 1KCSH 2WWMD 1T83C 3WO3B 2DJ4A 1UJTA 3L3OA 5E94A 2CDGA 4OQTA 3BEVA 3QUXD 1KEMH 1B0RA 1CS6A 4O2EA 2YPVH 3LKPB 4DVRL 2H9GB 1C5BL 3SDAA 3DTXA 2AKRB 5C9JB 5JDSB 3RWJA 1YEIL 4GS7C 1F45A 3L95A 2QADD 2D31A 4HWEH 1G9MH 3KPNB 3U7YH 4QHLB 4JAMB 3EKCA 4FHBD 2W65B 3U46A 4RMQA 3QYCA 5CEZD 1OW0C 1OT2A 3INUL 3I6GB 4GAJL 4GRWE 5HYQA 2XQYK 3U1SL 1JNJA 2P8LB 1FL5B 1JHKL 3SDXB 3RDTC 1NLBH 5I1CH 1P69B 3GJFB 4U6YA 2Y7QA 4Y1AE 3Q2CA 4MDIA 3CU1A 1CN4A 4G8GB 1CFQA 4ACPA 3BZDA 2DLTA 1AXTL 4MAYB 4K7FA 1W0YT 4GMSH 4NWTH 1SYSA 1VERA 1B2WL 3MJ6A 3T0EE 5SX4H 1X7QB 2A83A 2ZUSA 1NANI 4YFLI 3QJFB 3FRPG 3TIEB 4B5EA 3QG6A 3S3PA 1CI5A 1H0DA 2OMBA 4G5ZH 1YPZA 1QSZA 3F58L 2XKNA 3MBEC 1G9NL 4XVJH 4KJWD 5ACZB 2B0SL 3IDNB 1HHJA 3ULSB 3TPKA 1YEEH 3V4VL 3RI5K 4X7SH 1IGJB 3HPJA 5IUSA 5SWQB 1YN7B 4XPAL 4L29A 1AGFA 3W9DB 4Y1AD 4F9LA 4P4KC 4XGZB 5D1ZB 4WWKB 2BRQA 5EBLB 5KSAD 2MOVA 5E08L 4Y19B 2WLYA 5DHVB 3JV4B 4X99B 3RL1B 3SDDD 4RWHA 3HZVA 1U91B 4FFWD 4XPFH 2V5SA 4HPOL 3B9KC 4HHAA 3BIKA 3UTQB 3G5XA 5T3XH 5M95B 3Q5YA 3WO4C 5A3ID 4KMLB 4LLQB 3TBWB 2XZAH 5IT2H 3VGBA 2B5IB 3ESVF 4NO3A 2JJWA 1OP9A 1P7KA 4IOIB 4B0MM 1AXIB 4UB0L 3OR6A 5IWLA 4KMTL 3FN9A 1I7UA 3KYKL 4RAHA 5FGSA 1ERNA 3D39B 4NQDE 1G7HA 3VFWA 1LO2L 1NC2B 2LAGB 1ZEAL 2HFEB 4YLQT 3U0PB 2DD8H 3QAZC 5TJWK 4YHYC 1HH6A 3D3VE 4GSDL 5TE4H 4DN4L 5D71H 4GRLA 4M02A 1DEEB 3WHE0 4ONGH 3B3IA 3LAFA 5E8EB 3VH8G 4ZPVB 5E99L 2WUCL 1KIRB 5DJ2B 1E4WL 3LDBC 3NIGE 2FD6H 5BW7C 2V6HA 4N9GA 1LNUA 3C5ZC 4CN4A 5D2LE 2COQA 4OCXH 3WIFA 1NLDL 5I1AA 3UJTH 1FO0L 2BSSA 1QKZH 2Q76B 32C2B 1CFVH 4V1DB 1JWMB 4ZFOL 4LDOB 4NQDD 4L3AA 2RBLA 3G6JA 5HGDB 2BP3A 5IBTH 3UAJD 2EKSA 1DE4B 4ZS7H 4U7SA 1ZLVH 1LO5B 3QNXA 1CGSH 3WXVH 2CK0L 5JXEA 5T5FL 2X4SB 5IJVB 3O3DB 2XIDA 2XTJC 2LU4A 1GZQA 5BS0E 4YE4L 3D3VD 1BD2B 3S37X 2F58H 1TQCC 2HWZL 3RL2A 1KENL 2EXYD 1HCFX 2DQFA 2ORBL 3A6BL 1ZMYA 4M61B 2FL5A 4BH8A 4M9OA 4U49A 4OIIL 3QUYB 2HG5B 4YHNB 1MJ8L 1TZGL 4G9FE 3C8KA 2R0LL 5KVMC 4TUJB 3VFGH 2CIIA 2XA8L 4LLDB 2DQCL 3O2DA 5IBLD 1J9CT 4LOUD 5LWYL 3PL6A 3RWFA 2VDMH 4FRWA 5E0QA 5T3ZH 5M94B 1N5YH 3B9VA 2V2TB 3VD9A 2XWTB 4ZO9A 3QEHA 5FYKH 4FZ8L 2R69H 2XFXB 5E8NB 2A0LC 1FDLH 3G5YB 4YUEL 3GSOB 2VUYA 2XRAH 1CLZH 4JQVC 2BY1A 3MV9B 5B3JE 1AGDB 5IMOA 1VADB 5BS0D 1ZKAA 3ARDB 4MCYB 3PGCB 4NCC1 1MRCL 3TNNB 4GG6B 4QHMA 5EZLB 1FNFA 2OL3B 1KB9K 1M6OB 4XBPB 2I24N 4KHTH 4UILH 5GRYA 5D96B 4P99A 1WWCA 1VFMA 4POZD 4PRHE 1I85A 1XGYH 3ZDZF 2EH8L 3P3YA 5CCKL 4DKEL 1P1ZB 2ZCLL 5BCAA 5FDYA 1G7JB 1H3GA 3I3EA 3ZKXC 1S7SA 3NCBB 2DKMA 3TT1H 1KT2B 3FRUB 4LVHC 1J05A 4U7KA 3TBTA 3CU7A 3H7LA 4U31A 3S35L 1NCBL 3EIFA 5FO8B 3HI6L 4MB4A 3JTSB 3TVMD 5GRJH 3G6AB 3ARZA 4WO4A 3T2OA 4MJ6A 4NO0D 2EECA 1AR1C 4K7PX 3BP7B 2X1WL 3QUZB 2R1WA 3IAQA 4KK5D 5IK3B 3PE9A 2X9YA 3QDGB 1XEDA 4LASL 3THML 1VPOH 4ODUB 5JA9A 3C09B 3JWNC 4DOHE 4L4JA 4JEGB 2IWGA 4KUZH 1MFEL 5DRWA 5IVZA 4KTDH 5DJ0A 5FECB 4PRHD 5BRZB 1BQHA 3TJEL 1OVZA 3STZB 4E9LA 1T20A 5E2UL 1BLNA 1MUJB 5IW1B 1A1OB 4P23C 2EC8A 3QIUC 5IVXB 3LS5L 4I13B 4QRSB 4PJFA 1P7QD 2AXFB 3ARQA 2CXKA 3WL9A 5J3HC 5GGVL 2BX5A 5CD3B 2BSTB 4NC1E 3O81A 1LO3L 4BZ1L 1AD0B 4GKNB 4XBEH 2D4FA 2UY6A 5ESVA 5HHQB 3LN5A 3HRPA 4MWFB 1YYLL 3GMOB 1WIPA 1T5WA 12E8L 1J0JA 1TPXB 1QRNE 1NGWB 5IMMA 4KVCL 3HZMA 4N5ED 3GSVB 2NW2B 3NFNA 3TT3L 3TN0B 5T3XE 3O8XD 4X6CF 1TFHA 3TBSB 4ZUSA 2VDLL 1A6TA 5D7IE 4TPRL 2DBLH 3CLFL 1E27A 4CRPA 1S9XA 5FKPA 3S4SG 1PZUB 4Z18A 2HH0H 2DN7A 4KK6D 5CSBA 4JFPA 3WDJA 5J0BA 1R5IB 1ZTXH 4XAKE 1ZHNB 4GXUN 3MLSH 2F54E 3FTGB 1XCTB 1H5BC 2VOTA 1JK8A 3BUTA 1J0ZA 2W0LA 2G2RA 1KJVA 4NJAL 3RIAF 4M7ZC 2GIYA 1DQMH 1HWHB 3BO8B 4DVBB 1DBMH 2DMCA 5FUCE 4AIZA 1MJJB 2DQGL 4P4RA 1ZGLB 2P44B 3WFEH 1PG7H 2HKHL 5DJAB 3W82A 3SJVB 4Y5YC 1A6AB 1I3UA 4TSBL 1AD9B 1QRND 2EE3A 5D93C 4FQXA 2GI7A 5DJ6B 5J1AA 2JCCE 4FTVA 5T3XD 1WCQA 3VFTB 2B4CL 9CGTA 2VL5B 6FABL 2OTWB 3QFJB 1KG0A 2JB6A 3ZKNC 3IVKB 5TDPB 1IFHH 1CDGA 2PUQT 3L3DB 4L8SB 4XAKD 2H32A 3L7FA 2F54D 4X98A 2X9WA 3DO7A 4K7PY 5JW4Q 4Q6YA 5E5MB 3F7VA 4BQ9A 1WIOA 5KSVB 3JWOL 3L5HA 1VA9A 5EN2B 5CEZL 3FONA 4I3RH 4JZOA 5MEQB 1FG2B 4KY1H 3QDMA 1Q9LB 3PQYB 4QXUL 3MJ7B 4P9HH 4JFQB 1FL3A 2XWJA 1GZPA 3GGWA 2R1XB 2EIDA 2V17H 1TNNA 3ZL4H 4BYHA 4RQQA 1HXYB 4JLRA 2NR6C 4K3DL 2HFGL 4C59B 1IEAB 4HIIA 1RVFL 3NIFE 4Z7NE 3ULVC 5MEOA 3OGCB 1Y6MR 5JPNB 3IDJA 5HY9A 5LBSH 4YPGA 3SCMA 5ID1B 2NY2B 1OPGH 3QCTL 2W9EH 3K1KC 4X80H 2G9HA 1PW3A 2GK2A 4Y5VB 1H3XA 4F7PB 5FYKE 3TEUA 1U8HA 2D03H 1M1SA 5E4IA 1KB9J 1MHHA 3MRJA 3WMSA 4DZBB 3AREA 4OM0H 4IJ3C 3H9HB 4OJFH 1B4RA 3U6RB 4JKPH 1A7OH 3ARGA 2FR4B 1WK0A 1MREL 3PJSB 3GRWH 4OZFG 3HC3H 5F1SA 4P59L 1FFPB 1JZ2A 1XF2B 1P6AB 4BH7B 3FT2B 4LCIH 1XF1A 4KKCC 4DTGH 2YPLE 4Q9QH 5I75C 3SPVB 1IRAY 3IJHA 3ALXA 5CIPH 2ATKB 3TZVD 2BFVL 4OZIE 2VC2L 1MFBH 2FJGA 2VZ1A 4X5WB 1LEGB 1NFDA 3CPLA 3U79A 5DD0L 4H0GA 3NCEB 5FYKD 3EYOB 1CR9H 2X89D 2J8OA 2I07B 2NXZC 4HGWB 4NZRH 4PY8J 5AD0A 1E4KC 3GSQB 1BGXL 1EEZA 1NDMA 4UQ3A 3MV8A 3UBXB 3WLBB 3FOLA 4M1CD 5TF0A 1A02N 1G6VK 2EO1A 1TNMA 3WIHL 3LMJL 1KTDA 2UWEB 5D7JC 3QHFH 4GAGL 1TVHB 3O2WH 2A6IB 3QWRD 4FXKB 4HPYL 4HUUB 5MERA 4LARH 3VXQB 3FT3B 4OGXL 3T77B 1B88A 3T1FB 4Z7QE 2GK0B 2CMRL 2XKUA 2YPLD 4CJ0A 4LEOA 4F57H 1WZKA 3S5LG 4HS8L 4D0DA 5KTEL 4PJ8D 5EO1B 4XC1H 3CDFA 3FFCB 4UBDD 2VDPH 3ILQD 4GRWF 4O02H 3IJSA 4KTEH 4HMEA 2NLJB 4NKOA 5KSBE 5I0DA 5LAXA 3RU8L 2WBJD 3QDJB 4C4KT 4GRMB 3S7GA 2ZCKH 4OD3H 4HFUL 3PABB 4N9OB 1GC1L 1NBZA 2AJ3A 2J5LC 1EK3A 3TBYA 1FZKA 2ARJB 3T08A 1TZIB 4JG1L 5HGAB 1EFXA 7FABL 4RBPK 1JMXA 3F5WA 5ACLA 1MVUA 3LVEA 3MFGB 5ETUB 3OXRB 1KELH 3P77B 1BOYA 4FQCL 2L7UA 1AGCB 3M8OH 5IR1B 3IDUA 2WUBL 4J1UA 1DBAL 2X1PA 4KXZH 1RK0B 2V7HA 4P46D 3GSNA 2R8SL 4LLVA 5E6IA 5FM4A 1MHEB 4JO4L 4RRPA 3DSFL 4XHJD 3SHSA 4BUGA 1UACH 2A74B 3HFMH 4TUKL 4UTAL 2CLRB 4E42A 2FBJL 4H26B 4O5LL 3S35X 1HZHH 4JKKA 4FQ2L 3RTQA 4NHCL 2ZUUA 4HKBA 5DEZA 3OMZA 3P4NA 4YHZL 2BVOA 4ZAKA 5IFAH 5CGTA 2LE9A 1Z9LA 2MQ3A 1T1ZA 3TFKC 4OGYH 1NBVH 5DRXA 3FB7A 1T89A 2AI0H 5TFSL 1U8IA 1YJDC 2FECL 4JFDA 4Z76B 1U2CA 4LMQE 4X6CB 1DN2A 2AXHA 4DN3L 4N0FB 2QSTA 2OSLB 1S3KH 4PJ9B 4APQD 1MFCH 4G7VL 2BSRA 1AR2A 5GJTH 3MRRB 4KROD 3OKKA 4BZ2L 1AQDA 3EFDH 2BCKB 1FPTH 1FSKB 4OF8A 1KCSL 3X3FH 2EZ0D 2GUOA 5B39A 3ORJA 4PYGA 3K2UH 3WIIH 1DVFB 3DXAA 3IU3A 3MREB 1JHTA 2VR4A 1KEML 3BI9X 5JNYB 3MR9B 1A6VH 3O6LH 4I4WA 4U0RB 5CP3H 5EOCH 3DETC 4XBGB 3BH8A 3EO0A 1BVLB 4UDUB 5TQ0H 3FB5B 3NIGF 1I1YB 5IG7A 4KV5E 4HWUA 2XV6B 3JWDC 1CXKA 3Q6FA 4HWEL 5D2LF 4Y88A 1G9ML 3ARSA 1RURH 5I2IB 4HJGB 3U7YL 4NN6C 4J3XA 2BHYA 4PJAE 4Z5RA 2IJ0C 1T4KA 3HLAA 3SDCC 2R39A 1E4XI 4P2RB 1LE5A 3P9LB 2XQBH 3QR2A 1QFWH 4F3FB 1P5VA 3G5ZA 4B7LA 3CMOH 4W70A 1X3DA 5EU6E 4PG2C 4FQIH 5AWNH 1JF5A 3P73B 5E24E 4RFEA 2QSCH 1NLBL 5I1CL 5CHNB 1A6WH 1RU9L 4XMKH 1MIMH 3HI5H 4HIHB 4RMSA 4XPGH 4IRSC 1HDMA 5BQ7B 2HMID 2NX5B 1K8IA 5D4QA 5H35A 4Y16C 3VXSB 3D5OF 4GMSL 5J9PA 4MHHI 4NWTL 4QXWA 1BVKA 1D5IH 2P8PB 3VDCA 5FK9A 2DI9A 1ZHLB 1ZLWH 3U83A 1CIUA 4PGEA 1E6OL 2Z31A 3HAEH 4X4ZA 4S0TD 3ZKMC 3Q0HA 4G5ZL 5CEXB 3RVUC 1MCEA 1ZGLM 1FZOA 3NN8A 2AGJH 4XVJL 3OKNB 2A73B 3SE3C 3EFFA 4WWID 5CD5D 2E27H 1A9BB 2ZCHH 4MZ2A 3ARTA 1YEEL 2D9QB 5EU6D 4X7SL 2Q8BH 1UZ6F 3RWCB 2Z4QA 3GO1H 5AG8A 2A6JA 5F6HJ 1KIQA 4NQTA 4XC3L 3MNWB 3QUMH 3C60A 3VMNA 4IOSD 3VFNB 1S9WA 4QF1A 1ACYH 3GMMA 3IDYB 5E03A 1UXSB 1MCNA 1HXMB 3D0VB 1YN6B 2BRRL 3DVNA 4Y2DA 1A6UL 3GSUA 5LKNA 4XPFL 1I9EA 5C0IA 1YY8B 3RDTD 2XG5A 2Z35A 5E5RB 3PNWA 1JYVA 1ED3B 5T3XL 5JW4R 3O0RH 5DHYB 5C0BE 5INCB 2JELH 4WJ5A 4GW1B 5BZWB 1LP9E 2XZAL 4I2XA 3BVNB 3W11C 5IT2L 1K85A 4N8VG 1KB5A 1N2RB 1IM9A 5I18H 1S7TA 4L9LC 1H8SA 1SJEA 3IF1B 3OJDA 4YHML 1A3RH 4XVUC 3UPAA 2ADIB 2DD8L 3QRGL 3MRLB 8FABA 3MBED 1BECA 5TE4L 35C8H 2JIXD 1A9EB 2H2PC 5D71L 5IKCA 2C3WA 4ONGL 2NYYC 1VENA 2X5PA 4M3KB 1NMCB 4AENA 4IIQC 5C0BD 3B2UC 5HJ3B 4GRWB 2FD6L 4P4KD 3BP6B 5CILH 4NGHH 4OCXL 5IW3A 1CFTB 2HN7A 3P0GB 4EXKA 3UJTL 4XH2A 1QKZL 3IXAB 4Y1AB 4NC2B 3QIBA 3KYMB 1QSVA 1B6DA 3B9KD 4PRDB 1JL8A 4OCNC 5IBTL 5KSAB 4ZS7L 5FEBA 3DYOA 1CGSL 3WXVL 4MNQA 2GTZB 3IS1X 4W4NA 3EHBC 3T0EB 2PO6C 1FC1A 5F44A 1A4JB 5E4EC 2WLZA 1FVEA 4LSUH 1G7IB 3DUSB 4X8JB 5IROC 2F58L 1ULVA 1JN6A 1SM3H 2ADGB 5D6CA 3BPCA 3NMEA 1A4KA 3QEQE 2UVEA 2YXFA 2HRLA 5GRVL 1BX2B 4ZOAA 1W0WA 3BZEA 5GS1A 4MJIA 3BKMH 2XTJE 2VUOA 3VFGL 4XCNB 4AL8H 4NN5B 3QIWA 3LCYA 1XIWC 5T1KD 1ZS8B 2Y4SA 3F6IA 4OT1H 3VFRA 1XGTB 2VDML 4KI5C 2ZSWA 1MEXH 1Q1JH 3ET9F 5HDQL 4JM2F 2VDQH 5T3ZL 3VFVA 1WTGT 1RIUH 4QXTB 1P7HL 1YMHA 1N5YL 2GCYA 4PBXA 5FYKL 1G7MA 2C1PA 2DMKA 4NYLB 5IIEB 3VWJA 3GKWH 2R69L 4JHWH 4G80B 3HCVA 3S4SB 4XRCB 2XRAL 4CNIA 2JCCF 3C5ZD 1CLZL 2AEPH 3BGMB 3IETA 2ZJSL 4LF3B 1DUZA 5BJTA 1S5HA 5EIIB 1TCRB 2DQJH 4OGAC 4KHTL 3MMEB 4UILL 3QEQD 3KG5A 3BH9B 3IXTB 1MCQA 1T1WA 1IILE 1N7MH 3IFOB 5KG9A 4R90L 5CSZA 3PIQA 1I1RA 2XTJD 1PKQE 1UCTA 4HMCA 4NQDB 3VWKC 3H9YA 3HE7C 3B8SA 4NP4H 1U8QA 4IRJC 4NWUH 4M8QB 4UUJB 5GRJL 1VGKA 3MQIA 5E8DL 2HLAB 1G1YA 1BFSA 4HBCH 3A0OA 1KLFA 1J7VR 1BQSA 2HVKA 1RHHB 1IBGH 4LNVA 3ILPA 2JE8A 1MCSA 4EVNB 5JQ6H 2MCG1 4I8DA 1VPOL 4G6AC 3N1FC 3QEUA 1DJSA 4RFNB 1YQVH 5EH1A 1OGAE 4KUZL 4Y4KC 2N56A 5EO0A 1ZGLP 5D2LB 3U0TB 2P4AB 4HIJA 5L7XH 1JBJA 2A0LD 3EO1B 1X9QA 3LQAC 4LIQE 3CUPB 4XXDB 3D2UA 4AH2B 4NKIH 4XBEL 5ESAA 4Z77A 3L7EA 4M7KH 1PD6A 1X4XA 4IMKC 1J18A 4G8FB 1JPSH 1LWRA 3NA9H 1GGYA 4ODXB 3ECBA 3QEGH 1EHNA 5JDJA 2DS4A 1JYXA 4U1JB 4ZO6A 1UWEL 2A6KB 2H1PH 3ZTJH 3FN3A 4OZIF 3GNMH 5JW5B 4G9FB 1HYRC 1DLHA 3BEWA 4ALAH 4HUMB 2MQ0A 2DBLL 1OGAD 1PX4A 1AR1D 1N6QH 5HBBA 1U8PA 5D7LA 4GKZB 5EG6C 2PYFA 2HH0L 5IMLA 2VXVH 2K7QA 3MLSL 5HYSA 5F89B 4OZFB 4PJ5A 5F7HA 2ITDB 4QY8B 4NO0B 1UT9A 3QDHA 4XNUL 3TPUB 2LV4A 5TH2B 2A2QT 4AG4H 4F7MB 1IVLA 2XI9A 1DBML 2D7NA 4ZUWA 4JHZA 5D1XA 1HOCA 4H88H 3SKMA 3HNVH 3UPCA 3WFEL 1GRWA 4MQSB 4ETYA 4P23D 3TH3T 2UZIH 3LS4L 1NGQH 3QIUD 5EU7C 1EGJA 4JFZH 2VZSA 5KVGH 3WHXA 4CMMA 4LHUB 5J3HD 2I60H 1VFUA 1GH7A 2CRMA 5FM5O 3S96A 5FKAB 3NGBC 4QRRE 4MNGA 3STLA 5I1DB 3TGXA 3ZE1E 2XICA 5CBAB 3RUGA 1P7QB 5KSBF 1FGVH 2BNQE 1IFHL 3CLEL 1QPXA 4LGPB 4PY8I 3RVWC 5HPMA 2V2WA 1QOKA 5IW6B 1F3JA 2OI9C 3AGVA 4MXWH 1ZV5A 4AEEA 3BXNA 3RWEA 5E9DE 5I1LB 3EJZC 4QRUA 4TYUA 1NGPH 2H6PA 1YJDH 1QA9B 4R7DA 4I3RL 4DGVH 1MI5E 4KY1L 5IHUH 3S5LB 4L3EA 2FH8A 3O8XB 4P9HL 5EU5A 4DOHB 3UTZA 2LTQB 3GM0A 5FOBA 2DM7A 4NZTH 4TUOB 1V3MA 2V17L 4OLUH 4NRYB 1AE6H 3ZL4L 3HUJA 3DV6A 5DJXB 3QQ3B 1ZHKA 1YEFH 2OTUA 4QRRD 4WUUE 3DX8B 1FFOB 4UNUA 4K9EC 5EC2B 2X05A 3H9ZA 3CC5A 4Z0XA 1PG7W 1C7SA 2A9MH 2BNQD 3HC0B 1U9KA 4JREC 5F21B 2M2DA 5LBSL 1OPGL 2W9EL 4X80L 4OZ4A 2GEEA 3KJ4C 1CK0H 5E9DD 3QNZB 1NMBH 3ULUC 1SEBB 4I18C 4DZ8A 2D03L 2F53E 3JVGC 4TOYH 4KJPC 2Y9RT 2BOBB 1S78C 2J7LA 2R1YB 3VXRE 3T4YB 3MRMA 4OM0L 4PJDE 4FABH 3ULVE 5CJOH 5FO9A 3ZKND 1QRNB 1MI5D 4JKPL 1A7OL 3OKDA 1R5WA 4L3CA 4S0SD 5IFHL 3PWPE 3GRWL 1ZWIA 1FFRA 3CXDH 4RMWA 3L3GA 5D7IB 1ZLUH 3MLXH 4A6YB 1T21A 1MCWW 3SKOB 1C16A 4X4XB 4LCIL 4QTIH 4WUKH 1ZSDA 4WUUD 4DTGL 3OF6D 2OJZH 3T2QA 1RJYB 1U3HC 2F54B 3QXAA 4P5KA 2AV7B 4OUUB 2Y06H 3VG0H 4YDVB 1MFBL 4KKBC 4MMXC 4HK3J 2VZ3A 4GBXC 4NSKA 4R0LC 1FVDA 3T4AB 2NW3B 3O6FC 3U2SA 3U36B 4ZPTB 3SKNA 1JF6A 4JKWA 1CR9L 2F53D 2NR6D 1JNHB 3VXRD 3V7AE 3VE0B 1BF8A 1HWGB 5L8JB 3ULVD 1E28B 1BQLL 3Q5OA 1EFQA 3DV4B 2YK1H 2IAMC 3GDBA 3PWPD 4JRYA 2JCCB 1D5XA 2LU3A 5FB8A 5CLTA 4KV5F 1QP1A 1I8IB 3QHFL 1KCKA 3O2WL 2AJXL 2F5AH 3AB0B 4HX1A 5MI0C 4WTWA 4LSSH 4F57L 3K1DA 5C0AE 3HAEG 4PUBL 5IF0A 1NAMB 4XC1L 1ITCA 3O9WC 2VDPL 3GIZH 4O02L 3WFDL 3RA7H 3JBG7 2ZUWA 4WI8A 3GMQA 4KTEL 4OCYH 5A2KH 2RR3A 1BIHA 4TULH 4KKCD 3QI9C 1G7QA 2ZCKL 1IGIH 3RWDA 1N8ZA 4OD3L 3OSKA 2R0WH 2H9GA 2E7BA 3NCYP 3WNNA 5E8OA 2AKRA 5JDSA 1CLCA 1INDH 5J13C 1L0QA 4TNWK 4MD0A 3BHBA 3BUYA 3FQRA 5CMAB 1IEHA 4E0RA 4JAMA 1XGPB 2AAVA 1ES0B 3UPRB 2C5DC 3TZVB 5I74B 4JDZB 4X6EA 3N85H 1KELL 5CINH 2OR7A 4L8BB 3RNQB 5C3LD 2DF3A 2NXZD 3F7YB 2NCMA 1T1YA 3M8OL 3I6GA 2P8MA 5GZOC 5C0AD 4QRQB 3MRPB 3W9EA 3HE6A 2VLLB 1T7VA 5ENWA 3I75A 5D7SH 1CU4H 4U0QB 5D7JD 2PXYC 2R2EA 1T5XB 4JO2H 4NZJA 1UACL 4XVSH 4C54A 3HFML 4I1NB 5DDHA 4HW6A 2AV1B 2W07A 1TENA 1X7QA 5IFAL 3BSZH 3L5JA 4OGYL 3KJ6H 1NBVL 2AI0L 2YPLB 4XNYH 5DVLA 4Z7VA 3GJEA 4PJ8B 2WZPD 3C2AL 4OZIB 1RJLB 2YKLH 2YA0A 3V7MA 5E00A 4Y8AA 3C6LC 5AZ2H 2R2HB 5ACZA 1S3KL 4M6OH 4AZ8A 1KJ3H 4JPWH 3SGDH 4NOBA 5GJTL 3PDOB 5SWQA 2DJSA 4WRLA 2H26B 4HG4K 5F7NC 1CBVH 2V5MA 1YMMA 4UT7H 4QYOB 5CJ8A 4XGZA 5F7LB 1FPTL 2BC4A 5KANI 3VDAA 5DHVA 3JV4A 4X99A 3X3FL 3ABZA 3CFBB 1ORSB 3K2UL 3WIIL 5I66B 2YPKB 3UTSA 1R3KB 5I76B 2FX8H 4MAYC 2SEBB 2IALB 3EOBB 1A6VL 4P3WA 4X4YB 2XN9E 3O6LL 4N8VB 3UYOD 4EI5A 1HYSC 5TQ0L 2WIIA 4IOIA 1EH9A 4Z7UF 1X5LA 3X11A 4DGIH 2X6MA 5KSBB 1RURL 2PR4L 4FXGB 1S7VA 3TFKD 4FMFA 4KK9C 2B1AH 3BW9B 1OQXA 2YN3A 4GLRH 2OYPA 4LSRH 2XQBL 1WJ3A 1QFWL 1CL7H 3P30L 1WV7T 1TJGH 3CMOL 4OV5A 5IEKB 1K8DB 4LSPL 1JGDB 2OR9L 3CSPA 5FOJA 5AWNL 5B38G 1DEEA 2QSCL 4AEHH 1A6WL 4XMKL 3MYJB 1MIML 1A7RL 2G5RA 2YMXH 4YZFE 3HI5L 1FE8H 4Z0BH 2GHWB 5FGCE 1JGVH 3NFPB 4XPGL 5E8EA 2PCPB 5IV2A 5D1ZC 4WWKC 4XI5C 4FOMA 4OZHB 2MMXA 4UDTB 5DMJB 1FCCA 2XN9D 1K4DA 1D5IL 1I9IL 4APQB 4Y4HA 1YNTB 1ONQB 3RY6C 1F5WA 5H94A 32C2A 5C8JB 4KROB 5DRNB 5F9OL 4I0CC 2DRUA 2B5IC 1AC0A 5HGDA 1SJHB 2A6DA 3W0WA 4N1HB 3DETD 5A2JH 3O3DA 3GHBH 3QQ9C 5IJVA 1I7TB 4U6TA 2E27L 2ZCHL 3RPKA 5J6HB 1G0DA 3SO5A 3C5JB 4JB9H 2Q8BL 4PJEB 2YC1B 1MLCA 1JE6A 3MPCA 4ZNCD 1F3DJ 4ODBD 3BJ91 1KTKE 1CGTA 2YA2A 4X7TB 3V7AG 2HG5A 1ZT7A 3SDCD 4PJIE 1BP3B 3GMNA 4NQEE 4KJQC 3VGEA 3QT2A 3ZT6A 1BZQK 2GSIA 3QO1B 3RAJH 5I0ZA 3LN4B 4IRSD 3WS3B 3O0RL 5I16B 1J8HE 2JELL 3OAYH 2PTTA