2RQ8A

Solution nmr structure of titin i27 domain mutant
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
98
structure length
98
Chain Sequence
MLIEVEKPLPGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLAASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANTKSAANLKVKELLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Titin
publication title Structural basis for unfolding pathway-dependent stability of proteins: Vectorial unfolding vs. global unfolding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 7
structure length 98
sequence length 98
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rq8A00
3L9RA 5I66A 4M6OH 2GITA 2M1KA 1HQ4A 1V8HA 3QBTB 5BMFL 2HFEB 4G7YH 3KPMB 2PR4H 3ZTNL 4M1DH 2OL3A 5AAMA 2WBJB 1RUMH 4E0RB 3A67H 1M05B 3IT8D 1AO7D 5C9KA 4BUHA 1JNNL 4X4ZA 4PJHF 4RAVA 3OJDA 4JM2A 2VAJA 4UT9H 3T3ME 3MRQB 1ZHNA 4NUJB 5T33L 3RZWA 4RFOH 3GSOB 2ERJB 5ALCL 1UM5L 3OXRA 3ZLQC 4N90D 5J1AA 1Q1JL 2FEEL 3MBEA 2K7PA 2HRPH 4WUUD 3GJFK 4G8EA 4OLZH 1C5BH 3VG9C 1RZGB 2X89A 1PBYA 4JVWA 4P5TD 4Z78B 3FQWA 3OPZL 4QXGH 5D96B 2VXTH 4KROC 4D94A 1EZVX 2AP2A 4MX7B 4O58L 5D6CA 4LQFH 2DQEL 3PQYE 2IALA 3P9LB 4HDIB 3KR3L 2Q6WA 3UAJD 4X6CA 4JCLA 3U4BL 4MHHG 1LO0L 4L3AA 1MCWW 1NCBH 5JPNA 4BKLA 2HG5A 4J8RA 2D7NA 1BJ1H 5MHSE 5C0BD 4EDXB 3I6KB 4TUKL 5DFVD 3W0WA 3RX5A 1JWSA 1QSZA 3CC5B 3BVNB 2Q3AA 4CJ0A 1D5MB 4KDTC 5EFIA 3VFMB 3KYMB 4ERSH 1BZQK 1CD9B 3RQ3A 4AM0A 3MZGB 3T77A 3ARBC 15C8H 2APFA 2DJUA 3LSOB 2Z9TA 2VC2H 5TE4H 2GCYB 4ZSOE 4HBCH 4LCWA 2Y06H 1XGPA 1MWAH 2J4WH 1ACYH 1IAOB 4JPVH 3O3AB 3QIUC 5L0QB 2HJFA 2Z91B 1E4JA 2R2EA 3DYMA 4MYWB 1U3JA 3INUH 1VFAB 5CSZB 4MAUH 4YX2H 1UB6A 5CJBA 1HXYA 3GJFA 2P7TB 4O00A 1AGEA 3EYFA 3I6GB 4KY1H 2DQTL 3QNYA 5FKPA 3C8KB 4G9FA 4AENB 4P23B 3VXOA 1KYOJ 5EUKB 5D2NE 1MFBH 4HFWA 1P7KA 4P9HH 2VDLH 1NAKH 5GIRB 4QRSA 3MGTB 3DX8A 3GI9L 1QLRA 3FO0L 1AFVH 4LSUL 5EU3A 3I02B 4HS8H 4MJIA 1T1YA 4LKXB 3WXVH 5GISL 4ESKA 3HI5H 5SWSE 4TTGA 3WE6A 3VXPB 3PP4H 3QDGD 1S9VA 2J8UE 3DPBA 3QQ3B 4NRXA 2XRAH 5D2LA 5IMLA 2R4RL 1WZLA 2EC9U 1RSFA 3OWEA 4NP4H 1QFOA 1F4WL 1SY6L 1ZVYA 1VKXB 3IDMB 3O6ML 2P8PA 1WVZA 3CFCH 3O2VL 4MQXC 3QXDA 2ATPB 1L9NA 2OM5A 4OZFH 3BP7A 4DN3H 4Z7NF 4UAOB 4B53A 1HH6A 1AIFA 1I1YB 1KIPB 3LN4B 3P4NA 1RZKL 2GFBB 4Y1AB 1J11A 1KJMA 4M62L 2MPAL 1J05B 4FQXD 3ARUA 1BMGA 4YDIH 5CP3A 3VCLA 4EOWL 4HC1A 3O0RH 5DD5L 2XQBH 3O2WL 1CD0A 5CEZH 2W0FA 1J87A 5FO9A 5HHVH 2CUIA 3IU3A 2DD8H 1AC0A 2HT3C 4I4WA 3CFJA 5C0FA 4MSWA 1FRGH 1I3GL 4FQHB 1R5WA 1I8MB 4YO0B 2ARJA 4G8GA 4X8JB 2I5YL 1IL1A 1A22B 3T0XA 4IMKC 4NQTA 1IM9B 4R4NC 3CVHH 3NA4A 4ODVL 1KN4L 1MLBB 5KTEH 4PJ9B 2JB6B 1QNZH 1BIIB 3G6DH 4XBGA 3KPTA 3ZYOA 4GW1A 4PYGA 4N0FA 2EEAA 4NN6C 5I8CB 3HAEG 1SHMA 2H6PA 4DKAA 4EUPA 1RJCA 4LRNL 4N0YH 2KH2B 5F7WC 3ARGC 1QTYT 4Y4FD 3MV9A 3QUMH 2P46B 4FMFA 3H3PL 1ZVHA 1WUNT 4WO4C 1J0HA 4FFVD 2JJUA 1N0XL 4ZFOA 2EH8L 2G2RB 4PV9A 1U41A 3W0WE 3LEVH 3K2MC 3UO1L 5BQ7A 2VO5A 3QEQA 1FCCA 1BECA 4QGYA 1Z3GH 3O6FA 3GSXA 3OKNB 3VI3E 5EZOL 1MPAL 4XXDB 4XAKD 4FTVD 4XMKL 1ZANH 4OBSA 4P59L 5DZNA 5CZXD 5C1MB 5GGTA 3U82B 1WITA 4OLUL 4K94L 1BAFH 1MHEB 5FGCB 4Y2DC 2P48B 3U6RA 1JF5A 4PP1C 3VFUB 5DR5L 1IEBB 1NBYB 1W0YT 3BKYH 1IQWH 1NFDB 2A77L 2YZ1A 2WBJD 3L7FA 4MA1B 1U8QB 4XBEH 3V52L 4P5MA 3CPLB 4KI5C 3VXSA 4AH2B 1JNJA 3D5OF 4DAGL 32C2B 4MB3A 4DGYL 5JW4M 2M8XA 3OKLA 4OM0H 4QYOB 4KZDL 3TO2A 1ONQB 4G9FE 4WTWA 5DUBB 5ANMA 3EO0A 5C6TH 4J3UA 3JWOL 4YHPB 4KTDH 4KK6D 5FDYA 4JG0L 3UJJH 1DDHB 1JGUH 4IS6B 4NO3A 2KQNA 4JRXD 1S5HA 1XF1A 1UM4H 4LASL 1PSKH 1JPTH 1A64A 2YA1A 3QRFM 3DUUA 4HW6A 4XZUA 1RU9H 2HKHH 3OGCB 1IMHC 3NA9H 4ODXA 3BYTA 2C3VA 4JPWH 5D2LE 1MCWM 5CCKH 5DHYB 3T65A 2QADB 5IVZB 2MQ0A 5EBGA 1XF3A 3MRIA 3LHPH 4HWEH 2FO4B 1CS6A 1MVUA 3KYOA 1FG9C 1IAII 3HE6A 5IM7A 3L3GA 4OFPA 1MCEA 4D9LL 5I6XC 3VFTA 5I30H 5IGXH 4I18B 1XF4B 4OZGB 4XT1C 1X5GA 3JWDC 2GJ6E 5D1XC 1MFNA 4HD9A 3N85H 3DTXA 1YNKL 2ESVB 1F11B 3WFCH 4JLRA 3TPUB 1UVQB 3SDDB 5KSUA 4MDJA 2YPVL 2ZSWA 2LAAA 3LQAH 5BXFA 4Y19B 1TZGL 4CMHC 5FM5M 5I1HL 1JZ2A 2VLRE 2BNUB 3HPJB 4W6WB 1N4XH 5E2TH 4Y5VB 1IBGL 1UXSA 3MCKB 2BDNL 4NO2A 5E70A 5ICYA 3DGGB 2HLFC 2CO7B 5C0DA 4PGEB 3MLSH 1MQKH 2A6IA 5FGSA 1EJOH 5TDNA 4KPHL 4XCCH 4Y8DC 4OTXH 1GGBH 4G9DA 1P84J 1UM6H 4HJ0D 2NXZC 4EBQL 4KKLC 2NY5L 3FMGH 4X0KB 1AD9A 3WLBB 5T1LA 4P2OD 1MEXH 2JJTA 3LKQB 3V5DA 1HDMA 5ISZE 4RIRB 1KCKA 4JDTH 1Q72L 1T0MA 4RFNB 2DMCA 1ZEAL 3FRPA 2R0LH 1EJ6A 4HWBA 3UTSA 5JIIA 2JCCB 3MV9E 3KLAB 4OUUB 2OP4L 2EE9A 4Z7VA 4GBXB 4YBQD 3WFDH 5DD0L 3U7YL 3QUMA 5IK3A 4NJAL 2IC2A 1QLEH 3GEWB 2ORBL 2V5SA 5DRZA 4YZFF 2JIXB 2QQKL 1LP9A 1MFAH 3O4LD 4ZS6D 1AKJA 3HRPA 5IV2A 4LPWA 3WXWL 2R56L 5HJ3A 1WTLA 4GAYA 3U7AA 2HVKB 4HK0B 3PWUB 4B7LA 4Z7WB 3QPXH 5FIEA 2WUBH 3RUGB 4DOHE 1T83A 4YHNB 4S1RH 3BX7C 1WQVT 3ARFA 3NABL 1KC5H 4MMZC 3BT2L 3V4VH 3GO1H 3ULSB 5HYSB 4ETQA 2B4CC 5F7LB 3OXSA 2EEBA 4TNVK 2IPKA 3C5SB 5DD6B 4D3CH 5FAAA 4R0LC 1GC1H 5FOBB 1XIWD 3TFKC 4JB9H 3RY4A 3K1DA 4NBZB 5C71A 2X4NA 3RVVC 4XGZB 4X9HA 1JWUA 2VTFA 3QI9D 3QUKB 1HK6A 3EJJX 2Y36L 3FFCB 4DVRH 3QZWB 4H88L 4U1JB 4OJFH 5IG7B 3WIHL 4OCXH 3C08L 1F3DJ 3PHOA 1DBAH 1UWGH 1ZHLA 3QCUL 4YHYC 5I75B 4HUMB 3QCTH 5ANME 1CDJA 3ROLB 3QQ9D 3SJVE 2AVGA 1IM9D 1SJXA 3PP3H 1IC4H 2XI9A 3IJHA 4PJ9D 5BZDA 3V0WH 3QUXA 4BFGA 3LD8B 1R3IH 3GSNH 1C1EL 1RZJL 4MWFB 4R9HA 4GSDL 1YNLH 4D2NA 1G7JB 4OM1L 1GPOH 1OSPL 3F7QA 2PTVA 5EZJA 3TIDA 4LLWA 4DKFH 1F6AA 1KF9B 5C2BL 4Z95L 2HFFB 1NGXB 3L7EB 3O41B 2WWKT 1HYSD 2EXYD 2V7NA 2VWEC 3VXUB 2FZ3A 1NL0L 3BKMH 2EE6A 3DSFH 3EHBD 1E28A 43CAA 4H25B 5GGRY 1ED3A 3JV6A 1CGSH 4QRPA 3BEWB 2FRGP 4JM2D 1ZLSH 4WHTA 3T4AB 1BQLH 2IPUK 5I1JH 4L8CA 5HYSG 2B1AL 2R8SH 1HWHB 5D7LD 3MV7A 5T1DL 1T0PB 4PRBA 3WDJA 3MBED 5BV7H 3B8YA 5GS2D 1IM3A 1KLUB 2AXGA 1AQKH 2X89D 2FH8A 3CMGA 4LAQH 2X09A 3MACH 4RNRB 4Y4HC 5IW1B 1MCOL 3T0AA 3QZWG 3RZCA 1TXKA 3DO7A 4UNUA 5HHMB 5JW4Q 5CEZE 3ARYA 1U58B 1U8OA 1W72B 4KKCD 2XKUA 4RWYL 3V6FA 2V2TB 1T03H 1DE4A 1MJUL 3RL2B 2J6EA 4Y88A 1Z0NA 4DGIL 5E8DL 5IKCA 3F5WB 3M17B 4NQDB 5SX4H 3HFML 5HD8C 2A38A 2D0FA 1RURH 1T2JA 4LLYA 4OCRL 4QHNB 4NZTL 1OTUC 4NC1E 2VERN 5EDXA 4DQOH 3ETBF 4QNPF 2VZVA 5GZOD 1YZZA 2IG2H 1AGDB 5DQDH 3MYZA 4X4XB 2ITCB 5LCVL 3VG0L 4UTAH 4PJEA 5K9OA 1M6OA 4O4YL 4ODHL 4HUVB 4RGMC 1JRHL 3G6JB 5J1SC 4N0UB 3UTSE 4LCWD 4JFQB 1XH3A 2OTUA 3ESVF 3VDCA 1IGCL 4TSBH 1R0AH 1S7WA 4Z7VE 5K9JH 1GZPB 5KS9B 5I1DA 4JO3H 3FB5B 1J8HA 3MLRL 1JI2A 2AK1H 4GMSL 4ZQKB 4AMKH 4OF6A 2AI0L 3AB0C 1SYSB 2BOCA 2QADD 1DUYA 3VFRA 2NY2D 1LP9E 1OTSC 3FOLA 4OCSL 2HFGL 3T2OA 5C6WH 2OK0H 1T1ZB 3MQIA 1CBVH 3MRGA 4YDJB 5DEFA 3ULVH 5ELIA 1P4LA 4LSPL 4LSTH 25C8L 3QH3A 1ACZA 1UZ6F 3RFZC 1V3KA 3EYSL 1UJ3C 2G9HA 2PW1A 1MJ8H 1NGYA 4YHLL 1EUUA 1R24A 1E27A 3IKCA 4MVBC 4OT1L 1EMTH 5HPMB 4MJID 4TUOA 3RGHA 1EAJA 4FP8H 2R1YA 3PXHA 5BS0D 3AY4C 3MLVH 3V0AC 4ELME 4U3XA 1FPTL 3RU8L 5TQ0H 3SDDD 3LEYH 4YFLI 4OSUL 3FQRB 5T1MB 4OZIA 4O51B 3TO4A 3VFOB 2I60L 2X44D 3EDEA 1R3KA 2YPKB 2ICWJ 4F7CB 1HHHB 1N64H 3S88L 1AJ7L 3KS0H 1NC4A 1NGZA 4NDMB 1N6UA 1AQDA 5C0GB 2A73A 3WFHB 3O6KH 1QOKA 1I3UA 2C3XA 2JE8A 2W38A 4EZMA 4PTUA 1IQDB 1MAMH 2GQHA 2DQGH 3ZE1F 1ZT7A 1PKQE 4MZ2A 1EGJA 1YC8A 3Q6FA 2F5BL 4NZJA 1BM3L 1LDPL 3JBG7 4OQTH 4I3SH 5EG6C 3P2TA 5E6ZA 4TNWF 4F7MA 4NKDA 1IC7L 3GSNA 5HHNB 1KNOA 1AGFA 2YD2A 4BZ2H 1AHWB 2F53B 4ZO9A 1FNGB 5FO7A 4J2XA 2PCPB 1K5NA 4IIQC 1RZKC 3ARVA 3K46A 2YPLB 4PJAE 4GUPB 3D0LA 3BEVB 4HZLA 5CP7B 4FQ2L 2GI7A 1XGUA 1IKNC 1C7TA 1N6QH 2ADGB 4YC2C 5HI4D 1ZV5A 2E9JA 5EZIL 5HGDA 4NCDA 4G8GD 3QFJD 1H0DB 3HZMA 1NCDH 5C0JA 3WN5C 5D9SA 1Q9WB 1RIHH 3FT2B 3U0PA 1JPST 3MLXH 1TJIH 5AUMA 3MV7E 2PYFA 3QULB 1F13A 4GRLA 3FQTB 3W39B 3BUTA 3QXAB 4LSVL 4RISL 5E2VH 1DEEB 1NFDF 2E7CA 5TJWK 2HLAA 2FJHA 4WWKA 4ZPTB 5D1ZB 3VGBA 4JY6A 2VDOL 2B0SH 4MNGB 2VDMH 1SJHB 4J23A 1ZA6B 1Q0XL 5EO9B 4EDWL 5HGHA 3D3VE 5DMGC 1C12B 5FYLD 4X4YB 1OP3H 3X11A 2HT4D 4LDEB 2HFTA 2XPGB 4I8DA 5IB4B 5IIEA 3KLDA 4UNVA 4PD4K 1A6PA 2EH7L 4P5KA 5CZVH 5K33A 4YWGH 2EICA 1VEOA 3VWKD 2E7LC 2FJFB 1BQHB 2MKWA 1S3KH 1I85A 3GMMA 3O9WA 5FKAB 4DWHA 1PD6A 4P2RB 4OAWA 4FABH 3M8OH 4P46A 2OJZL 1AXIB 3QEQD 4HIIB 4JO2H 3LKSA 2CUHA 4G6ML 5HBBA 4GKSA 3SY0B 1D9KD 3VRJB 4WTZA 5GRUH 4R26L 4PPTA 4RRPA 4XP9L 5EOCL 1TIUA 2EZ0C 2FWOA 4S1DC 3C5ZC 3LKPB 4PJEE 4PR5B 1X5AA 5JOPD 3TVMA 5INCB 1EEUA 3O11A 5DS8B 1H8NA 3WJJC 2AXHA 1TVBB 2XZQL 1HHGB 5C0RL 4OZGF 1J8HE 1CFQA 3MNVB 3VXUD 3QNZA 4BZYA 3VXSD 5H35A 4MXVE 4YXHH 1N59B 4K94C 1DN0A 3CFDB 4P4KC 4LSQH 2Z8RA 2XTJB 2NXYC 4HQQH 2GUOB 1U3HA 1MIMH 4JHWL 4IRZL 2Y5TA 4JFFB 2VITA 2JJSC 3G5XB 4M93C 3WFBH 2AQ3A 3U1SL 2AEPH 1DBML 3PGDB 4KRMB 1BQHG 4XP6H 1I9JH 5DMJB 4H1LH 4KK8C 4U05A 3TV3H 3MRHA 1B0RA 4N1HB 4OZIE 5DTFA 2CDEB 3UMTA 1BBDL 3JWOC 5IQ7L 2C1PB 4Y16B 1JFQH 4Q9CA 5EUOB 1KCVL 1KG0B 3WEXA 4UI2A 4OCYH 5DDHA 4E41A 1OP3K 1HZHH 4EIGB 1JF1B 3HE6D 3MUHL 4PJDF 2EYRA 2H2SC 1BZ7A 4ZUVA 5BCAA 1BZ9A 2AK4A 3C5JB 1YYMH 3K4AA 4KV5E 5I1IL 4XBPB 5F9AC 3PIQB 1ZGLA 4OQTA 2BJMH 2WBWB 2G60L 1SYVA 5E95B 1PQZB 12E8H 3I2CL 4LP5A 5ADOL 4KUCD 4ELKA 2BNRB 3VXQA 2WNGA 4OIBA 2VNCA 3BQUB 1G9NL 2XWBB 5GGSA 5JXAH 4ALAH 3OZ9H 4XHQA 1FDLH 1SQ2N 5C07A 5C9JA 3ZKMD 1G7PB 4Z7WF 5C2UB 1ZGLP 5F96H 4GW4B 2LTQB 5F7UA 1VA9A 4FQCH 3EO1B 4P5TC 2ATKA 2A83B 4L3EA 5FHBH 1RK0B 5CBEB 1RHFA 1RZ7L 1EHLH 2RQ8A 4IRJB 4IHOB 3SO3B 1KCSH 1WWCA 2JB5H 4I0PA 4L9LC 1KXTB 4UT6H 5A2KH 2VXQL 2ZNXA 3UAJC 2CQVA 4KUZH 1UCBL 1I7ZA 1OGAE 3VRIB 2WLZA 4L29A 2YZ8A 5DF0A 1BX2A 1JGLL 4MA8H 5HI3D 1DSFL 2DWDA 3F6IA 4ZO6A 3RY5A 3ZDYE 5DFVC 5CKGA 2CLZB 4Z9KB 3GIVB 4PG9A 4JN1H 4OGXH 3TCLB 2ZJSL 5DI8A 4UILL 3S96B 1FH5H 5FCUH 3UTPD 4FQ1H 3GMLA 2X1QA 4M7LL 4M8QB 2YA2A 3E8UL 4KK9D 3TZVB 1ETZB 1K4CA 2J5LC 4DVBB 2YUVA 2VABB 2DTSA 1GIGH 3GHEL 4JFYB 2DBLH 2VLJA 4JM4L 4Q0XL 2O5YL 1EHNA 2VDNL 4NPYB 1FLRH 2VISA 5E8PA 4J1UB 3RI5K 3H9YA 2QJDA 2DWEA 4R3SB 1G7LA 2OYPA 5JDSB 4JFEA 2CRIA 1HQRA 4M6AA 4XCNA 3E3QE 3QXTA 1X5YA 8FABA 3RWIA 3I50L 1KEGL 1JZ5A 1TTUA 4LHUB 3FHQA 5EO0A 1UA6L 4QHLB 3TYFB 2F53D 4F15B 3PGFL 2MCG1 2IH1A 3G08A 2YPLD 1WIPA 3EDKA 3RKDD 3LEXB 3DMMA 3ALWA 4K9EH 4D8PB 1WC7A 3FB8A 2CD0A 4NN7B 2HP4A 2RB8A 2V5MA 4QY8B 5I8OH 3ULVE 3IXTA 2NW3B 4RGNB 1Q38A 3O45A 5FOJA 1M7IB 1U2CA 1A3RL 1FZMB 1T7YA 2GK0A 3HE7A 5D1ZD 1NBVL 3BFOA 1A47A 4JZNA 1E4XL 2HA1A 2YBRA 4OLVL 1J0KA 1FNHA 4HC1L 4WFED 4F8QA 1FE8H 3D39E 2EYSA 3L5JA 5KVDL 4M4PA 4QHUB 4M1DL 2V17L 4XPAL 2BRRH 3EUUA 1RUML 4GG8A 3VI4F 1RZJC 3BGFB 4N0RA 3VWJB 4QRPD 4FQXC 2V2WA 5E5MA 1MRDL 4IOFC 4E41E 4OFVA 5MEPA 2VZOA 3G6JF 5LBSH 2PTTB 4NKIL 3HS0B 2OSLA 3CSPA 3WSQL 5D7KE 2GY7B 4DZ8A 3MYJA 4LHUG 4RFOL 2AK4E 3FT3B 4YIQA 3FB7B 5F7HA 4HS3A 1NFKA 5CLTA 3VXNA 5C0ND 2OXHA 4L4VB 4IOSD 5BVPL 5IMKB 1RJYA 2AEIT 2IAMC 1CGVA 5F8RC 4OLZL 1C5BL 4XNQA 5KG9B 1L7TH 1INQB 4U6TA 1OB1B 3RZCD 1FL3B 4YDVB 2HKFH 2YUWA 4ZODA 2QQNH 2YSSB 3G5ZA 2VDQL 5FYLL 1KEML 1N2RB 3AXLB 1R3LB 3QEHA 5DK2A 4JKKA 3GNML 1DQJB 1MF2H 3FO2B 1NLDL 5E6IC 1QR4A 2NY6B 4LLVB 1H5BA 4L3EE 4I2XA 3GSRA 3NACH 4YPJA 4JO1H 4PY8J 5ESQA 2BSED 4MCZB 4XX1G 4QHMA 4ZFOL 5HDLA 2JELH 3EGSA 2HWZH 3CZFA 2XWTB 4X7EC 3QUYB 4HXBH 4Y4FC 1XF5B 4U6HB 3UEZA 4R4BA 2XZAL 3SKNB 4DTGH 2F74A 5TE6H 3TJHD 1VCAA 5IMOA 3K2UH 4M3KB 5DVOA 3H7LA 5F1IB 1JWMB 5J57B 3E6FB 4FFVC 3DV6B 5GGTL 3TN0A 5DJXA 1GGIL 3O3EA 1L6ZA 3QEGH 4C57C 1F90L 3HI6L 5GS1A 3TYGL 3SE8H 4HBCL 5K59F 2JLLA 3DXAA 4NBYB 4P3CL 1J8HD 3PL6B 5EIVA 3D85D 2AXFA 5FYKH 1L0XA 4KXZH 1M7DA 1QO3A 2AGJH 5I18H 4X5WA 5KVFH 2OMBA 3FOMB 4AK1A 2J3SA 3INUL 4S10A 1FC2D 2VLJE 4KDWA 4XNZB 1A0QL 4DCQB 3F58H 1T5WB 1ZHBB 1HCFX 4KY1L 3Q1SL 4K55A 2HJKA 5E2WL 1BBJB 4HSQA 2DIJA 3ARDA 1IZKA 1S78D 3O4OB 4WJ5B 5IJKA 1GGCH 1NAKL 5KSAC 1OSZB 1MCPL 4XP1H 2VLME 1AFVL 4AG4L 3BHBB 4R90L 3VDBA 3WXVL 1GGUA 1Q9LB 3T2NH 4HWZB 4NZDA 5JHDA 1YPZA 3R8BB 4NFCA 1A4JA 4ODWA 5LAXB 1BOYA 3AREA 1YEEH 2NY4B 4EI5A 1BFOB 1QFPA 2BY3A 2CLRB 3N1QC 3RA7H 4LPTA 3CFCL 5LGJA 3BPOB 2VLKA 4X5XB 3V79C 3T3PF 3BP6A 5KSBA 3H9SA 1CQKA 3UJIH 1YUHB 4KTEL 4MAYD 4HUWB 3NIDF 1ADQL 3DRQB 4Q9QH 1SM3H 1BF8A 4YDIL 5HYEA 3VD7A 4UDUB 3HN3A 4BZ1H 2QL1A 5CEXA 4PGZA 2B2XH 2VR4A 5E1HB 1NGQL 2J88H 1FRGL 3TT1L 4Z7UA 5J6GB 1T7XA 2DQFA 2DIBA 3TM6A 4P2QD 3AU1A 4CGTA 5D5MA 4X4MA 2XNAB 4X7TA 5BRZE 1XF2A 4E42B 1T3FA 2CO6B 1H3WM 2IH3A 1KPRA 4YUEH 3SDCA 4KMLB 3F7YA 5JXED 5KTEL 2C3GA 1TTFA 4WWKD 1CL7L 4XCYB 2NY7H 5KSVA 4NT6B 1E6JL 3RNQB 3GMPA 1MIEL 4CMMA 3FB6A 4XCFH 5D2NB 4JZOB 2QSVA 3IGAA 5DQJB 3BP4B 4XWGH 3U48A 5HHXL 4AZ8A 2F8XC 3V5HA 1CICB 4HWBL 3TA3A 4PREB 4HJ0C 4YE4H 5DJZB 3LOWA 1CT8B 1QBLH 4U1KB 3WS6C 1F4AA 3H9ZA 3GI8H 1HHKB 3SDYL 4P2OC 3BGMA 1YMME 4UINH 3O9WD 1X4YA 1CLOL 2J8UB 2XV6B 3BPLB 1LEKA 5I1GH 3FCTA 3Q6GL 3CXDL 1QLFB 4ONGH 3LEVL 4HIHB 1U8NB 5FK9B 1OWWA 3NFSH 5DXWA 3ECBB 4PYHA 3LKRB 1U8KB 3MRDB 3RWFA 4YBQC 3IXAA 2AV1A 2VDPH 3WIFB 5C8JA 1SVCP 4NQEA 4X83A 4KJWD 4UTBH 5EUOF 3DRTA 5CHNA 3QIBA 1U8MB 2AQ2A 3UDWC 4KJPD 4NQXB 3NZHH 5T5NG 1H3UA 3VFNA 4ZS6C 4LEOA 3TBYA 5HDQL 1C5CH 1BAFL 3RDTA 5I15L 4YXLL 3BH8A 2D0HA 4U1SB 3RBGA 2JTDA 4G7VH 4E9LA 4U4BA 3HZYB 3HG1A 1J88A 1C16A 2GITB 2BSSA 4OLYH 1KXQE 3V8OA 3BWAA 2D31A 1B90A 2QSCL 3WKNA 1ZT1A 2OL3B 5IESL 2V9QA 2GTZA 1EHXA 3P4OB 3TNMA 1WZ1H 2AJXH 2X5PA 5F70A 2DLTA 1N7ML 2WK2A 3GHBH 3LH2H 3IFNH 3TH4T 4GQ9L 4RAVB 4O9HL 1XIWC 2DL2A 2CRMA 1XR8B 4JFDB 1QYGH 3V9FA 4HLZG 4JY4B 3SOBL 5C6TL 4HS6A 3QI9C 4L4VD 4PJ7A 2FD6H 4H0IA 5E8EA 4KTDL 3OXRB 4YHKH 5J3HD 4NYLB 4LFHG 3GB7A 1HHJA 1KTDB 4JFZH 1J1PH 1EAPB 3T0EA 1K6QL 4OIIH 5HPOA 5FM8A 1PSKL 4ZXBA 1P5UA 5HGAA 1G7MB 5JHDE 5J9PA 3VXRD 1YPZE 2FATH 3MXVL 1QQDA 2BZDA 4XTRD 2FIRT 2QLVB 5C0EA 5MERA 3VDAA 2RAMA 3SPVA 2NY6D 2XFXA 4PTTB 4C83A 4O02H 5HYIA 3K7UA 2ILLA 5FM5O 4DUWA 2VLKE 4ODTL 5HGBB 5DRWA 1MJ7L 1T6WA 3K8KA 5DJ0A 2EXYC 2XN9A 5I30L 5IGXL 1HYSC 1X4ZA 1S9YA 4NO0A 3QJFA 3GSVB 4YHZL 1BVLB 3EHBC 4GW5B 5KSBE 4ORGA 3H9SE 3QXVA 4PP2B 2DLIA 1XAUA 5FV1L 4JM2C 4APQA 5D7IF 2ZOLA 4FRWA 4WTXA 5FXCH 2AERT 3MCG1 4U1LA 5DWUL 1MI5B 3LDBB 4CW1A 3IU4H 5FYKU 3GBNL 2ZCKH 5J12C 2VUOA 3ZE0F 1OT2A 3U30C 2R1WA 4AL8L 1MCNA 1XCTA 3MBEC 3KLHC 5C07D 2DS4A 2RBLA 4TSAL 5E94B 2J6EL 4OBRA 4PB9L 5IT2H 4Q6IA 4Z7UE 3KAAA 3EYVA 4OV5B 3PABB 5E4EB 1MFCH 5D5ME 4X4ME 2HT2D 2YA0A 3QB7C 4KKCC 1LE5B 1G9NC 1IEAA 9CGTA 4X98A 3U7WH 3K0WA 5AD0A 4BM7A 2NZ9C 1GGBL 1HXYB 2DI7A 1U93A 1DQLH 3GJFB 3RPKA 2OTPA 1WAAA 3KPRB 3BZEA 1FAIH 4M8VA 4URTB 1A2YB 3CU7A 1FO0B 4JRYA 3KPOB 2R1XA 1C08B 3UC0H 4A2LA 3ZT5A 4LEXH 5ETUA 3H7BA 3OR6A 4S1QL 1CXHA 5M94B 2R0LL 1RUPH 2QR0A 1EX0A 2Q7YA 1G1YA 2DQHL 5BOZG 1JGEA 5GZOC 1CGWA 5D7SL 3GMNA 1KIQA 1S9VB 1QLEL 2OQJA 4U31A 2NY4D 3L3JA 1MFAL 4ZOBA 1RVFH 2FR4B 1RFDH 2KZ1B 2WWKO 3ARBA 1OP5H 2P8PB 3N06B 3VGEA 3QO1B 3QXDB 5CILL 3BP7B 3MNWB 4NQEE 4JFED 4PJCA 1MRCL 3F8UB 4IJ3B 1AIFB 3QG7L 3P4NB 2NY2C 1GL4B 3L95B 1TMCB 1EERB 4OZ4A 2GJ6B 3IFPB 1S8DA 3KYNA 1KC5L 3QIUA 3M1BA 3C6LB 4WHCA 4N0CD 1IGIH 3EO9H 5GGSY 4UUJB 3HG1E 3MFFA 5CUSH 5FYKE 5GRYA 2PO6A 4K3DL 5K9KB 3STLA 3DMMD 4JB9L 3DGCR 5TH2B 4PLJD 4CVXA 3QAZC 4OD1H 1ZWIA 5BO1L 2NNAA 1CFNA 3CFJB 3NGBB 2R4SL 1LEGA 1Q0YL 2GIYA 1VB9A 2VLRB 1LNUA 4G43A 2Z31A 1F4YH 3FQNB 1XGTA 1AE6L 1S7SA 5KAQG 3IAGC 5EU5A 5KVEH 3RNKA 1EGJL 5HVFB 3B9KA 3QDJE 1U42A 3NAAH 5CS7A 1U95B 2C7UA 2R69H 3BDYL 4PJ7E 1OF2B 3ULUD 2IBBA 3FHAA 4UDTB 4OKDA 5C3LD 5HY9B 5CD5D 3T0EE 3MA9L 4R97B 4FZ8H 1HKLH 4NOFA 1A7OH 5DUPL 4LCIH 4MS8D 4XPBL 1JV5A 3CVIL 3L3OB 5DD3H 5HYJB 4PLKD 5EBMA 5ISZB 3EOAA 3GBLA 5ITFB 5ESVA 3WYRA 3BKML 3CSBA 3DSFL 1G0XA 2GK2A 3JWDH 4POZD 3MV9B 4PGBA 2ZUYA 2N4IA 4HGWB 2H26A 4YR6A 1QA9A 3QO0B 3W81A 1IAKB 3CDGB 3KWWB 5DRNA 1MCLA 2XN9E 4S0SD 1NJ9A 4UB0H 1SVZA 1TNNA 2XICA 1PDKA 4PV9B 2R0ZL 3BPCA 3EJYD 1RZIA 5BV7L 3I3BA 3WHXA 2ITDA 4Q9RH 2DF3A 1AQKL 3O6FB 2W0LA 4NSKB 1OP5K 3X3GH 2MWCA 5AWNL 3ZHDA 3RGVB 4IRSD 2ICEA 3BPNB 2A1WH 4PJBA 4Y89A 5CKAA 4TVSa 1F2QA 1TZIA 3T3MF 4FNLH 4R7NB 4OI9A 3TBSB 1A5FL 1J1XL 4L5FL 5DHVH 4CN1A 1DBJL 3OX8B 1IKFL 4NRYA 3H42L 1CTOA 2LABA 1MWAB 4PY7A 3C8HA 3LKNA 1SMOA 3BP5A 3SKJH 5GGVH 2HT4C 2HTLC 1ZA3A 3VXMB 2VAAB 4G3YH 2UUDH 3DROA 4H8WH 2P24B 2R0WH 1UXWA 3OKLB 3VWKC 3TO2B 3V8CA 3ZKQD 1FN4B 2IJ0C 2VB5A 3SJVB 4JRYE 5DQDL 1P4IL 5H94B 2VXSL 2P44B 3D18B 1BFTA 3L5WB 1MLCB 1NC2A 1OCWL 1FVEA 4PS4H 1KGCE 2YKLH 1D9KC 3DXAD 4JQVA 3SQBA 5F88A 3C09C 1KPUB 1MCKA 1MFDH 1N5AB 5KN5A 4W68A 4LMQE 5C0IB 4U6YA 3LB6D 5CZKA 4OLWH 3MROA 1OAZH 5HVHC 1P7QB 4XZUB 4U6VH 1GHFL 5B38B 3D0VA 1YDPA 4WCYH 1P9MA 5DRXB 5IB1A 1MVUB 2NX5A 4PJCE 2B4CH 2E27L 1I7UB 3P3YA 4OZFB 3DURB 1ORQA 1B6DA 4Y2DA 1JHKL 4GO6B 1MJ8L 1JGDB 4LARH 2MCPH 4TULL 5JUEL 1T4KA 2UZIL 4DFHA 2QHRL 4AEIL 1MI5D 2XG4A 1KULA 2A74B 4FQLH 1K8DB 4XP5H 5MENB 2IANE 5I76A 4PG2A 2FHBA 4WY7H 3S34H 4Y5YA 3TNNB 1U92B 5BXFB 1A6ZB 1DQMH 4PBXA 2OI9B 4HKJA 1HN1A 2FECL 1FGNL 1K4DA 3EIFA 2VLKD 3CIQA 3THMH 3E6HB 4OIAA 5ICYB 2D4FA 2NW2A 4OQTL 4I3SL 3L6FA 3ARSA 3KPRD 1FV1A 5TDNB 3CVHB 1U6AL 5E99H 2J8UF 3MRMB 1IEHA 3HE6C 1NCWH 1QHPA 1R5VA 5B38G 4H20H 5L2KA 1VDGA 2EE2A 2UUDK 4BZ2L 1AD9B 4N8VB 2Y7QB 5T1LB 5DJ2A 1DP0A 4JJHA 3V5DB 1HDMB 5FCSH 1ZVSA 3KPSE 2IEPA 4Z77A 3E2HC 3U2SB 3ZTNH 3ZDZE 5CJOL 4GAGL 5HTSA 4OZFG 3WCYA 3S8WA 1S9WA 1N6QL 4H5SA 4Z7VB 3T8XA 3QUMB 4Z5RB 1JNNH 4ENED 4POYA 3SDCD 5T33H 5J4MA 3NIGE 2A6KB 5DRZB 5E0QA 1LP9B 5ALCH 1A4KB 3IS0X 4X7CC 1UM5H 5I16A 2CDFB 4LSSL 4MD4A 5IWLC 4O2FA 1Q1JH 3MV8A 2B0SL 2VDML 1U8IB 5FYJH 4O5LL 1T04B 1YN7B 5TFSL 4S1SL 3OPZH 1S5IL 3C6LD 4PJBE 3ZE2E 5ICXA 3TA3D 5I0ZA 4LLUA 2FGZA 1HILB 5HHOE 5DEGA 5KVMC 4XHJD 4LLDA 4ELMB 1EFXA 3K81A 2GAZB 3WD5H 5HI3C 4PJGB 2JJTC 2FJGB 2IPKB 1I8LA 4M9PA 3U4BH 3T0VA 1I4FA 1LO0H 4DUXA 2CRZA 1RK1B 2X4NB 3MRCA 3PGCA 5DUML 1JWUB 3F12B 2W07A 4TN9A 3NTCH 4UIMB 4PRIE 4JO2L 4TUKH 5H2BB 3PHOB 1ZHLB 2NCMA 3X12B 1P2CA 4MZ3A 3SKMB 4LKCB 3MFGB 4K71C 5D7JA 1PKQB 2GJZA 3QIBD 3RJQB 1DVFB 5DJYB 4YGVA 3CZJA 4HH9A 3IJHB 4HIEB 5BZDB 3QUXB 1YEDA 3RDTD 1JK8A 3B83A 1SBSH 3UPAA 4CJ1A 1N3NA 3NZ8B 4EI6A 4IDJL 5HYJD 4PFEA 5DJ6A 1T83C 3TIDB 4GS7C 4NGHL 3ARFC 1T1XB 3MRPA 3P0VL 4PJAB 4QGTA 5DJAB 2N7AA 1FL6A 5TPWL 2V7NB 3VI3F 2FZ3B 4BH7B 3JVGA 2ZPKL 5JNYB 4ZDHA 43CAB 4JANB 4S11A 2NX5E 1JYVA 5JA8B 1BWWA 1MH5B 6FABL 1I9RL 4L8CB 3RKDC 2XWJA 5BOPA 4NRZB 1OGTA 3ULUL 5H37G 3OTTA 1TZHA 4TSCH 2CDGA 4PRBB 3GI9H 4ZAKB 5JO5A 3FO0H 4KJYA 4LSUH 3STBA 3TLRA 4KI5E 1F3RB 5F1NA 5GISH 3LKOB 4V2BA 3STZA 4MJ5A 2PXYD 5AEAA 1CI5A 4HV8A 3D3VB 3CH1B 3UTTD 5IBLD 3O2DL 1Q8MA 4LCUA 1JGVH 4G8FA 4YQXL 4GKZB 1FZOA 2R4RH 1PX4A 5JA9A 4OCYL 3JV4B 1F42A 2C3HA 5IVOA 1F4WH 5J06A 1SY6H 3H9HB 5KAQF 3N1FC 1FYTB 3O6MH 1EPFA 3O2VH 5CJQL 1H3PL 5I74C 1JYWA 2YK1L 3VXMD 4HHAB 2V2XB 1JN6A 2MQCA 4NO0D 5I9QC 5E8NA 5E9DA 1INEL 2Z92B 4HF5L 1RZKH 5I1KL 1YY8B 2ARJQ 1P6FA 4APQD 1T22A 3RL1A 2NQCA 4F7EA 4M62H 2MPAH 5L2KE 5D2LF 1GZQB 3VFVB 4JE4B 3BGAA 1HYRC 2IFFL 1NUDA 4PJEB 3UTZA 5DD5H 3SDXA 3DLQR 3O2WH 3HLAB 5EULV 4UBDD 4H26B 1P53A 3WFZA 1TVHA 1U3YA 3U4EA 2Z8SA 2RCSL 1ORSB 4LHJB 3DV4B 4N9GA 5F96L 5ACZA 1ZLUH 1I3GH 4Z76A 3HPLB 1VFBA 3RZCC 3T0DA 5GGUA 3OHXA 3HMXL 4PJIA 5GGQL 1CZ8L 2A0LC 4ZFGL 4UIKL 4ZOAA 3LQAC 2FIKB 4I3RL 1OM3L 1ZS8A 3P77B 3FOLB 2JB5L 2NY3D 1Q9KA 4OFYD 3NH7L 5FUZL 1KN4H 5DEFB 2UZYB 3T1FA 4Z7OE 3V2AR 2ADIB 2DQDH 3MV8E 1IT9L 1P4LB 3LRSA 4QCIB 4GXUM 3ARRA 5DLML 1FJ1A 4LDOB 1S9XA 2VZUA 2DQIL 5T1KA 4QRQA 5MI0B 1AP2A 1R24B 4Y0GA 2CIIA 3T0BA 4TUOB 1KGCD 1F3DH 5E1AB 1Z9LA 3G04A 4N5ED 5MEND 4UV7L 2WUCL 3CSYA 1OAXL 3LQZA 1FHGA 1I1AD 2YN3A 3H8NA 4OZIB 1X5ZA 3TO4B 5CMAA 2VIRB 5HHPB 1R3KB 1VERA 3SCMA 1NC4B 1PEWA 3L3KB 4FZEL 1N0XH 2EH8H 4YK4B 2K3TA 1ZMYA 4LL9A 4PJ5D 3UO1H 3QRGH 5JORA 4PTUB 1XEDA 1JTTA 4HIXL 4JEGB 4BH8B 5EZOH 1MPAH 7CGTA 2I9LA 4L8DB 4XMKH 3UBXA 3IDYB 4P59H 2W65B 2IPUG 1I7RB 2V5TA 1FC1A 4OLUH 5FA4A 1S7UA 5CGMA 4K94H 5CWSB 5DMIH 3GSNB 3ZYIA 1S78C 5HXMA 2PO6D 2APXA 2X4RA 5DR5H 4XVTH 4ZYKB 5FM4A 1U91A 4MDIB 3ARPA 4LVOC 3V52H 2AXJA 1BD2A 1XGUB 2Z31D 4KQ3L 4DAGH 1LO5A 3ZT7A 2HRLA 1VGKA 3CK0L 2FBJL 4DGYH 1MUJA 1X9QA 1KB5A 4KZDH 1A8JH 1GC1C 2BVPA 3K8MA 3WJLA 1YYLL 2P5WB 3UYOD 3B2VL 1ZLUK 3BI9X 1S9KC 3CNKA 3JWOH 2PYFB 4GRLB 2CK0L 1B0GA 4ODSH 4R2GC 1A6TA 4OGAD 2EYTA 1I1CA 4CVWA 3T2PA 4JG0H 5IF0A 1FO0L 1OGAB 3OBAA 4JY6B 4HX1A 5ADPH 3DBXA 4Y5XA 2XKSA 3RP1A 4MNHA 4KHTL 4LASH 5BZWA 5KZCB 4L8SB 1B9ZA 4JFOB 5HGHB 5ECJE 5I1EL 1LMKA 3O8XB 3CAFA 3PHSA 1QSVA 4LQ1A 1XCQA 1FFPA 4MAYC 3NMEA 2J8HA 5E56A 2EDOA 3KDMB 1G7HB 1YNTA 3QWQB 4ZD3L 4KDVA 1D5IH 3A0OA 3CH8A 5JIKA 2DAVA 4ZUUB 3MA7A 5F6HJ 1SY6A 3GIZL 3VFPB 5DJ8B 1U8LA 2L4OA 4ZUTA 4MA7H 4F7PB 4HJJL 2EECA 1EHAA 1FNSL 4K2UL 5E9DE 2BHYA 2MOVA 3AAZA 4Q7DA 4IIQA 4KKBD 3O3BA 3BE1L 4I1NB 4CKVX 1NBZA 1TQCB 2ED8A 2F54B 4Y2OA 5CD3A 5JOFA 1DVFD 4A2MA 4PRPE 5FA3A 1YNKH 4CADB 1TDQA 3M07A 2NY1B 2YPVH 3CCHA 3SGEH 4NQCA 4WWKC 5BV7C 1A6AA 3O11B 1EUTA 4X6EB 1TZGH 5F9JB 2WM0A 1T0NA 5I1HH 5DVLA 4KMTL 2WP3T 1MHCA 4ZOCA 1FIGL 4ACPA 1UC6A 4PJ8B 3NACL 4PJIE 1IBGH 4XB7A 3Q0HA 1QRKA 1CFQB 2ADJB 2BDNH 2YC1A 5C09A 2ICCA 4HAGA 4Z7QE 2FL5B 4NCC1 2VQ1B 1QFHA 5TE6L 3K2UL 4X9IA 3KLSA 4EBQH 1CLCA 1I85C 1FG2A 3O9WC 1DR9A 2IADA 2NY5H 3HCVA 1NAMA 5FYJE 4P46C 5FGBA 1K2DA 2BX5A 2XQYK 3RAJL 2L0DA 5D70L 3SE8L 1FNEB 1IVLA 1WJ3A 1ZEAH 3R06A 1AI1L 5F1KC 4P2CG 4KJWC 5ABDE 3D39B 3LS5L 3Q5TA 1CXFA 2OP4H 3TVMC 3E3QC 5DD0H 3U7YH 4KJPC 3S37L 4NJAH 5ICZA 2X1OA 1MHHA 5E5UB 2ORBH 4JPKL 1E6OH 4WTZG 2QQKH 4RRPG 4JY5L 1FYTD 3X3FL 3X17A 3ZZ1A 3V5KB 5TGBA 3LPGA 3WXWH 4GAJL 2R56H 3MLUL 3KYKL 4WI8A 3WJJA 3S5LA 1BZ9B 3QPQC 3LS4L 3CUPA 4A6YH 4Z7VF 3QIWA 2H1PL 3ESUF 1AXTL 4LCCB 3BH9A 3PDOA 3NABH 5B8CB 5ID1B 5T3XD 4MD0B 1XR9A 3BT2H 5BJTA 3QG6A 4LBEA 5EC2B 1LP9F 4EJ1C 4CDGC 3T4YB 1XFPA 5JQ6L 1YQVH 2HVJB 4KHXL 5J3HC 1NEZB 1YEEL 2EIEA 4MA3B 4X6FA 2Y36H 3S7GA 2JJSA 4H88H 3S4SB 4NC2B 1FBIL 5D1QD 3WIHH 1GGTA 3C08H 5F7DA 2DQJL 3ILQD 4L3EB 3RWJB 3QCUH 2AJZA 4LLMA 1DN2A 3BW9A 3ZDXE 4ELMF 4P4RA 2R2BA 4JZJA 2OTWA 3HHRB 4PJGF 1F00I 2XA3A 4I0PB 3V6ZA 3JV0A 5J6HB 3BZ4A 1LO3L 1C1EH 1BJMA 3IF1A 1RZJH 4GSDH 1BX2B 5J89A 1OSPH 1J7VR 1M71A 3IB4A 1CXEA 1WBXB 2BSTB 5C2BH 4Z95H 5BVJB 1DLHB 4FQIL 2FCBA 1NL0H 1S7VA 5J11B 3HC0A 1HE7A 3GMLB 4PV8B 1QSEB 1AO7A 1S7RB 1BVKB 2YD4A 1A3LL 4YUEL 1PG7X 3JXAA 3KXFB 2B1AH 3FRUA 1T5XA 4FXLA 5B39B 5EOQL 3MZTA 1KJVA 3LIZL 2VISB 4FG6D 1CGYA 4MQ7B 2C3WA 4CN4A 4LPUA 4PJAF 4XPGL 2HT2C 3RWEB 1G7LB 4V1DE 4WUUA 1MJJB 5FB8B 4ZTPL 4MJ2A 1MCOH 1H8OA 4JDVA 4NKMA 4QT5A 4MLSA 3S4SG 1G7QA 4P5TA 1HOCA 2E5EA 2P1YA 4F37F 5HYFA 4NQCE 5I1CL 2LAGB 1CCZA 3RWIB 3MRFA 5A43C 2G75A 3OG4B 3P30L 4CU6A 3NIFE 2PYEA 1I1FB 3SGJA 3GI8L 2GSGA 2F58L 3SQOH 1MJUH 4E5XA 5EU4B 3G08B 5ERWB 4B41A 1LEIB 4UOW1 4DGIH 5E8DH 3FONB 4TNVF 4LF3B 4PJXB 1UH4A 4NNXB 3HFMH 1X44A 4QO1A 3VH8B 1ZGLM 5C0BA 4OCRH 3FB8B 4B5EA 1E0OB 1UQSB 2P5WD 3IXTB 4NZTH 2WWMD 2MHAA 5D7JD 3CDCA 2O61B 4UTBL 4XMPL 4GKOA 5I2IA 4JDZA 4PJFA 4M3JA 2ICWA 1QUNA 3ZMRA 3VG0H 5LCVH 1CD8A 1QRNE 3BOVA 2GK0B 2D03L 4O4YH 3T08A 4ODHH 4JZNB 4QTHA 4WFHE 4U6XB 2AKRB 5FECA 4PGCA 3R1GL 4H1LB 1IGCH 3DVGA 2DM2A 1QR1B 1OVZA 1NMAH 4IOIA 5F7EL 3O8XD 4J3TA 5B39G 1Y18B 3HR5B 3MLRH 1IGFH 4GMSH 2AI0H 4K7FB 3GBML 4NN5B 1JRHI 4N0CC 2BVEA 1UZ8A 4PJEF 1I8KA 1ZHKB 3GHBL 5E5MB 3SBWA 3IFNL 2XKNB 1WCQA 3VA2C 4LSPH 5DGQA 3GUTB 25C8H 3DMMC 5BRZB 1NUFA 1PYWB 1QYGL 3IJSA 4PLJC 4X9BA 4ZFFA 1U9KA 3EYSH 4M61A 4S2SB 3O3DA 2FD6L 4XCEA 2VN4A 3HB3D 4A6YA 4YHLH 3FQUB 1JI1A 4GKNA 4JFZL 1KJ2B 1J1PL 3MJ9L 4YHML 3RTQB 2F54D 1ZT4A 4JFHD 2EDFA 4OT1H 4RX4A 4Y4KB 3RWCB 1RJYB 3B4NA 4MXVF 5IFHL 4J7RA 1FPTH 1QFWL 3RU8H 5F8QC 5IMMA 1D5ZB 2Q1EA 3VH8G 4CUCA 1WFTA 4OSUH 4NHCH 3ULUC 3HE7C 3PWJA 3MNZB 4JQIL 2I60H 3A6OA 1EEZB 1J0IA 2VMFA 4JAMA 3S88H 4EN3B 3X14A 5IOPB 4WW1B 2OJEA 5TQ2L 3EOTL 1H5BB 3WIHA 2QEJA 1YMMB 4AT6B 1DLFL 2F5BH 4H1LG 1BM3H 4JKMA 5FO8A 1LDPH 2XXMB 4M7ZB 4POZC 2X1WL 4OZIF 3AS0A 4KZEL 4FQQA 4WFFE 4R4BB 4F2MA 1RI8A 1YEIL 4NJ9L 1IC7H 5F7FA 1KLFA 4X6DE 5D72L 4FQXA 4MQSB 2VOTA 5F9OL 2WLYA 2AV7A 3AGVA 1S7XA 1T89A 3IDGB 5F97E 1VSCA 1RMFL 1BJ1J 3MREB 3Q3GB 2BY0A 3PV6A 4FQ2H 3MOBL 4YAQA 4KV5F 5F89A 1JF6A 3VXTB 4QRRA 1IAIL 4BQ9A 1N0LA 1AO7E 2B7DT 3HZKA 5EZIH 4O2EB 4IRSC 4OCNC 2UV3A 1KCLA 4D0BB 4DFIA 2NR6C 1Z9SA 4WW2B 2EEDA 2X9YA 3PUCA 3RPIB 1IGYB 5EOTA 3BN3B 4LSVH 4RISH 4N90E 5IVXA 3TBTB 2VDOH 3CFBB 5T1KD 4WUUE 3ARDB 1Q0XH 2MJWA 4EDWH 3WUWA 5SWQB 3G5YA 2F19L 1OD9A 2VDRL 3MRBB 3VD9A 1LD9A 4L9DA 2EH7H 3TN0C 3MRNB 1MHPL 4XH2A 5F6IC 1OWRM 1F3JB 5GS1C 5E00A 3SGKC 4NUGL 1EK3A 4RMWA 1A1MA 1JTOA 3I9GL 5C0BE 1KFAL 1XZ0B 2PKDA 3VMOA 5TDPA 2OJZH 3WS3A 3ZDYF 3RJDA 5LGJB 4G6MH 3PWPD 4NHUA 1KLGB 4PJFE 4R26H 3PWLA 4XP9H 5EOCH 3GMOB 1UKTA 4JFPA 1YEHL 3C2SA 4PB0L 3H9SB 3DX7A 5T3XL 1I3RB 1IGIL 1G6RB 3N50A 3P9MA 1J9CT 3MUGA 5T5FL 4U0RC 3MO1B 3BUYA 2XZQH 3HMWH 3DUHA 5IJKC 5C0RH 2HFEA 3KPMA 4Z0BL 3DIFA 4AEHL 4OD1L 2WBJA 4E0RA 1BD2D 3U9UB 1QSED 5F9DC 3NCCB 1F6LL 5IQ9B 6CGTA 1OAUL 4R8WL 4F57L 4OCWL 3WBDA 3MRQA 4NUJA 3KXFD 1MREL 4JHWH 3AREC 4IRZH 3GSOA 4EI5C 1KPRB 3V6OA 4L1HA 4U3HA 4K9EC 1JMZA 4JHBA 1SJVA 1WFNA 4G6KH 5A2JH 3U1SH 1DBMH 3K3QA 3RBSA 3MX0A 4WFGD 3PDDA 4YEEA 1CTNA 4G6AD 2X4QB 1QEWB 1RZGA 1BIHA 4IMLB 3DHMA 2FLRT 3UJTL 3IFOB 3QDGE 3V5HB 4MX7A 3ULVF 5CGYD 3BXNB 3QQ4A 4CDHA 3P9LA 3L3DA 4HDIA 4DKDC 4F9LA 5F3BB 1JZ7A 1KCVH 1MNUH 1OAKL 1YY9D 5T3ZD 1WICA 3BGMB 4M48L 1TCRA 2EXWC 3FCTB 4EDXA 3I6KA 2DJ4A 5I1IH 4ZPVB 1T20A 1V05A 2DQUL 3CC5A 2AV1B 3BVNA 5GS2H 4Q2ZA 1D5MA 4ENEC 1D6EB 2G60H 3SDCC 3VFMA 3KYMA 3M45A 3DRTB 3X3GL 2NY0B 5ADOH 1JVKA 3A6BH 2AJ3B 3KVQA 4ODUB 2BERA 3LSOA 2ZUQB 4LEOB 1G9NH 2GCYA 4P3WA 3BH8B 1TENA 2D7TL 2AJUL 3HG1B 2YEZA 1H15B 1IAOA 5F72S 2BSSB 3O3AA 5C09D 1KTLB 3UCRA 1MAJA 3TA3C 2Z91A 3BWAB 2OX5A 1GGYA 4OFDA 1VFAA 5CSZA 3OKKA 2EDWA 2XY1A 1WV7T 3LQMA 1AGBB 2BHZA 4XHJC 1ITBB 4H8WL 2P7TA 3I6GA 2VXQH 4RQQB 1Z6JT 3BAEL 3C8KA 4JKLA 5IVXE 4P23A 4Q97A 5JW5B 5EUKA 1I9EA 2ED9A 1NEUA 3QDJB 1K8IB 1DSFH 3R0NA 3RHWK 5GIRA 4PJ7B 3MGTA 3MLYH 1U8PB 3OB0H 5E8EB 2X4SB 4LVHB 3I02A 3WNLA 1D5BB 3SDAB 2ZJSH 1MFDL 4UILH 1B3JA 3VXPA 3QIBC 5HGAB 3C60B 3MOAL 4M7LH 5J9PB 3E8UH 3QHZL 3QQ3A 1QQDB 3RDTC 3BO8B 4K07A 5C0AB 5MERB 4D9QE 5C0EB 3GHEH 1TQBC 2ZCHL 4JM4H 4Q0XH 1MAKA 2O5YH 4WCYL 1NDMB 1VKXA 3O4LA 2VDNH 4QLRA 1IARB 3NN8A 2ATPA 4P57B 3MBXL 5DRWB 1U3ZA 2XA8L 2P5EB 1KIPA 3HI1B 3LN4A 4YHOL 2XN9B 3F62A 3GM0A 4XAKE 2GFBA 4LARL 3W2DL 1KT2A 5DHXB 3I50H 1KEGH 5EIIB 3QUZD 5GJSL 5EN2A 1J05A 1UA6H 3R8QA 5IBTL 1WZMA 1JPGB 3OR7B 3Q48A 1NUGA 2MKLC 5EBLB 1REIA 2UWEE 1XCTB 5TE7L 3T0EC 3EOBB 4JPIB 5J8OA 2KKQA 4FQHA 4ZXBC 3QI9A 2X41A 1WWWX 3EYVB 4UT7L 4GRMB 3P0YL 2V5RA 5EA0L 5C08D 4GOSA 2PXYC 2WV3A 4NQVA 1I8MA 2DM3A 4FQPA 4YO0A 4FXKB 4AEEA 2ENSA 4X8JA 1RD6A 2CMRL 3VW3H 5LWYL 3V6OE 3VG9B 2KDGA 1IM9A 1MLBA 2H3NB 1H8SA 4Q6YA 5KANI 1A3RH 3HRZB 1UB5B 4WFFD 1NBVH 4PJ9A 2JB6A 4KROB 4R7DA 1E4XH 5E8OB 5GQBA 4OLVH 3BZEB 3P40A 5CP3H 1AD0B 4HC1H 4JRXE 4JRYB 2IBGA 5I8CA 4RGOH 3S36L 5ETUB 5KVDH 1XGRA 4W70A 4APQC 2V17H 4XPAH 2YWYA 4NKOA 2QR0B 4UQ2B 1E4XI 2LU7A 3OB0K 2EDHA 3MRJB 4MJ6B 1B88A 1JGEB 4U1IB 1TFHA 4HUXB 1MRDH 2DKMA 2WINB 1KIQB 4LRIA 3GJEB 4ZTOL 1CXLA 2O5ZL 2QSQA 4MXWL 4NKIH 3ZSTA 4UBDC 4ZUWB 2PETA 3WSQH 1QZ1A 4ZFZA 2G2RA 4Q6IC 1M4KA 3V0VB 1SEQL 5D7LA 3ARBB 3IFLL 2VKXA 5BVPH 2Q76B 5EWIL 1QSFB 4C56D 3OKNA 4XXDA 5FYJL 1WGOA 5DA4A 3RI5F 2BMKA 1XGYL 3KHQA 2NY3C 5DD1L 4EUPH 1S8DB 2VDQH 5FYLH 1KEMH 3QIUB 2JKXA 2FX7L 1I7TB 1MHEA 2PYED 1NCTA 2OS7A 1X3DA 2CXKA 3SKOB 3VFUA 3GNMH 3WD5L 1IEBA 1NBYA 1NLDH 2IANB 2HMIC 4WI7A 3NCMA 1I9IL 2VH5L 1U8QA 1QBML 2DN7A 2VQTA 3CPLA 2X4OB 1CFNB 1CFSB 3MPCA 32C2A 3NTCL 4RZCB 2NPLX 2FX8L 1LNUB 1I1AC 3MLTA 4G43B 4HPOL 1BEYH 1ONQA 2XZAH 5DUBA 1F5WA 2C7UB 4YHPA 2CR6A 3WLWD 5GGTH 2BVYA 1SBSL 1GGIH 3BD4A 4IS6A 1F90H 3HI6H 3TYGH 3HUJE 4N8CL 5IW6A 4DGVL 3QDAA 4P3CH 4ZNEA 3PWNA 4WU5B 2AJSL 3C9NA 3B9DA 3OGCA 1FL5B 3KPSB 1MSPA 5DSCA 5DHYA 3ARQA 4GXVL 5D93C 5IVZA 1OAYL 1W8NA 3BSZL 1A0QH 1KB5L 1R3JA 3O4LE 1NCCL 2PO6C 4C55A 1FZKA 5MEQA 5DRNB 3Q1SH 4QRTB 4NFDA 5E2WH 4I18A 1XF4A 1L0QA 1S7QB 4TSCL 2Z31C 4RX4D 2N7BA 1MCPH 3U79A 1B4JL 4AG4H 4R90H 5B3JE 3B9KC 3ZTJH 2NY0D 4WW2F 5BS0A 2ESVA 3SE3A 3TPUA 1UVQA 2W59A 3SDDA 1WCBB 1W72H 4IM8A 2YN5A 1JGVL 1FSKC 3BRGC 1UZ6E 2BNQB 5HHOB 1TJGL 3HPJA 1ZKAA 1G9EA 4LOUD 1KUMA 3HAEB 4L8BA 5T3ZL 1I1RA 3MCKA 4GQPH 1F4HA 4FFZL 3DGGA 4PGEA 1IGJB 2APTA 4KVNL 4ZUSA 3H0TB 3DROB 1YPZF 4NN6B 4PRIB 1NMBL 1UXWB 3MJ6A 2CKBB 4KTEH 3QA3A 1ADQH 4X0KA 1IC5L 1JPFA 3WLBA 3ARGB 2J2ZA 3LKQA 4M5YL 4LP4A 1Q94B 4Q9BA 1PFCA 3SDAD 3DETD 3IDNB 1E4WL 2BC4A 4XPFL 4KKBC 4AQOA 1NC2B 3BZDA 3WNKA 5KW9L 1D6VL 4WO4B 1NGQH 2JCCA 4NO5B 2X4TA 5F88B 3KLAA 2Y9RT 4QRRD 4PGDB 4OUUA 4O2CB 4GBXA 3TT1H 1T2QL 5KSBF 3MROB 5JHLH 5C0AD 2XXCB 1O7VA 5ESAB 4EXPX 2JIXA 3QFJA 3QWRD 3FN0H 3NCJL 2ZOKB 4RBPH 1DTUA 5D7LE 2E6QA 5J13C 1FVCA 1KN2L 2DQDL 4FXGA 1OHQA 2BVQA 1CL7H 2HVKA 1NAML 4DEPC 1E6JH 1QFWM 1P69B 2LV4A 4Z7WA 1MIEH 4Y2DB 1KJ2L 4G8IB 3RUGA 4YHNA 2CGRL 5C0CD 5HHXH 3ZT6A 5D5MF 1T4KB 1JE6A 4HWBH 3ULSA 4UMGA 5HYSA 3L3IB 1ODAA 3O81A 4FOMA 5IUSA 3EYOA 4X6CE 4M4RA 3C5SA 5DD6A 4LVNC 4KVCL 5FOBA 2AABH 3SDYH 4R6UA 1CLZL 3CJJA 3G9VA 2DQCL 3VWKA 4F3FB 4D9QD 1CLOH 4XGZA 3AUVA 1B2WL 3EJZC 4JQVC 4QXTB 3Q6GH 1PW3A 3FFCA 4PD4J 3CXDH 3QZWA 1RZ8B 5IG7A 1ES0B 4QF1B 1K4DB 2P45B 3QRGL 1OQXA 1Y6MR 3ROLA 1D9KA 4LPXA 4CN6A 2ADFH 1B4RA 1P9MC 3WHE1 4U0QB 3KS0J 2EIZB 5HDQH 5DMIL 4MWFA 3BRDA 5I15H 5GS3A 3DHJA 4YXLH 1G7JA 4LCWE 5DZLA 4K3GA 4ZNEE 2DM4A 1IAIM 5J0BA 4XVTL 2RR3A 2HFFA 3ET9F 1NGXA 3L7EA 3RWDB 3ZKXC 3ARTA 1G9MH 1NSNH 3VXUA 2HAZA 5I71C 1J0ZA 2QSCH 5I6XB 5IESH 3DVFA 4H25A 5ACMA 1N7MH 3BEWA 4PG2C 3T8XB 3ZYJA 2P8LB 3ILPA 4Y5YC 5EIQA 1HH9B 3T4AA 4GQ9H 4O9HH 2WP3O 2Q86B 1T7WA 1A7QL 5D1XB 3SOBH 1R3HB 3P4MB 4ODSL 1P4BL 1QSFD 3KJ4C 3NPSC 2WAHA 5D1QC 1KLUA 4MJIE 3VFWB 3ILQC 5ADPL 3PJSA 5BS0E 1K6QH 4CMHB 5IW1A 4RNRA 1CF8L 2WBKA 5E5RB 5DMKB 1W72A 3OAUL 3MXVH 2DI8A 2EDLA 3RL2A 4PJ7F 1D5IL 3KNBB 5DHVB 3VJ6B 5DJCB 2HN7B 1WWAX 3F5WA 3M17A 4NQDA 2NXZB 1EO5A 4ODTH 4MA7L 1MJ7H 3RVWC 5DQ9B 3CDYA 4LIQL 1OP9A 4QHNA 2V5YA 4OFKA 4TOYL 4YHZH 3VFSB 4ZG1A 1V7NH 4X7DC 1YMHA 1CWVA 4I3GA 2DBJA 1AGDA 1ADQA 4XRCB 4X4XA 2ITCA 5DWUH 4BSWA 3GBNH 1MCRA 4HUVA 1G6RL 2R23A 2SEBB 1JK8B 4N0UA 4AL8H 4FG6C 1HNGA 4JFQA 2JCCE 4TSAH 4EI6B 2J6EH 4PB9H 1GZPA 1T80A 5KS9A 1LVEA 3FB5A 3QWOA 3VE0B 2AJYH 1LO4L 4ZQKA 5IWLA 1SYSA 3MRPB 4G8GE 3MRRA 3QFJE 1HEZB 4WV1C 1FL6B 3N0PB 1MQ8A 1Y0LB 1RUQL 2OMNA 1T1ZA 2GJJA 1X5JA 4XC1L 4YDJA 1OW0A 1PG7L 1I8LC 4P23D 3GSUB 3KPPB 5IBUB 3NFNB 4U2YA 4Z7WE 1A6UH 3HKFA 1OGTB 3RUGE 3PNWB 5HPMA 4H8WC 4R0LB 3I6LD 5I19L 4S1QH 5FYLE 4PJDB 2WWMC 3OMZA 3ES6B 5D7JC 3R0MA 3I85A 3FQRA 3I84A 2GTWA 1Q9OB 2DQHH 5T1MA 1X7QA 4HKBB 4O51A 5D7SH 4QKXB 2YPKA 4HV8B 4NWTL 4F7CA 2BNQD 4YHYB 1HHHA 5B4MD 3GK8H 1E6OL 4NDMA 1KOAA 3FFCE 3B3IA 3WFHA 4WHDA 1KENH 3QEQE 1IQDA 5IB5B 1C8PA 5CILH 1R5IB 5GPRA 1MRCH 2X2YA 4Y1AD 4F37K 3JVGC 1JN6B 4A6YL 1CD1B 3QG7H 2E7HA 5E8NB 5DK3A 5E9DB 5JOPE 4FN0A 3RL1B 5HHNA 1AHWA 2F53A 2J7LA 5JW4N 5MEOB 4OD3L 4KGJA 4PRPB 2PCPA 1YQVL 5SWZB 4I48A 2YPLA 4K7PL 4K3DH 1V3MA 2VYRE 5I17A 3BEVA 5CP7A 3VXUE 1TVHB 4PJCF 3VXSE 3G6AB 3IJYB 5BO1H 5IBUG 4JVUA 2ZWLT 5TDOB 3T0WA 5E2JA 1EXUB 2R4SH 4XNUL 3IDJA 1Q0YH 5SX5H 3MODL 4P48A 1UACL 1HHIB 1HKFA 2MFNA 4MCYB 3U9PH 4PJIB 1AE6H 1IFHL 3QJHA 1JZ6A 1EGJH 1J1OL 1Q9WA 3OL2A 2DDQL 3BDYH 4Y4HB 3W39A 3QULA 3FQTA 3QXAA 2PN5A 4QOKB 1DEEA 4ISVB 1VPOL 4ZPTA 5D1ZA 3TWCL 2E9IA 5IHUL 1SJHA 3MA9H 1ZA6A 1FJ1B 1NKRA 5DUPH 3C6SB 4XPBH 3CVIH 4XNMB 4QRQB 1QVOA 2GT9B 1C12A 4X80H 1OOAA 4ONHA 4X4YA 2XYCA 3TGXA 2XPGA 5IB4A 2D7PA 4TUJA 2FYYB 2B5IC 3CSYB 1DFBL 3MOQA 4MB4A 3UYRL 1YN6B 2FJFA 5EO1B 3EFFB 2W9EH 5HI5D 2QKIA 2R0ZH 4HIIA 1FNLA 3SY0A 4RGMB 1F58L 4JFXB 3VRJA 2VLLB 3ZDZF 3CMOL 2BRQA 1LGVA 3B2UC 4PRHB 3LKPA 2DMBA 4PR5A 2KL6A 2DM7A 2DLEA 5AWNH 3UBXB 5INCA 3FO9B 2ZUTA 3UYPA 5DS8A 1WBYA 1XMWA 1GXEA 3AB0B 1TVBA 1HHGA 1BLNA 3NIGF 1A5FH 2R2HB 5LXGL 1W2KT 1J1XH 4L5FH 2Q7NA 3SQOL 5KS9E 3B5GA 1DBJH 2X4RB 3MNVA 1IKFH 3H42H 1KCRL 4WDIB 5A2FA 1NGWA 2OR9H 1A9EB 1N59A 3CFDA 1J18A 1WZKA 1UJ3B 2YXFA 4MXQD 2WZPD 4U1GC 2GUOA 4PJBF 3ZE2F 2MSPA 3GKZA 2LE9A 3W9DB 1IC1A 4ORZC 3SCMC 2BSRB 2DJSA 2ZZUT 4JFFA 3O6LL 1PZUB 5SX4I 3G5XA 4MGXA 1P4IH 1J12A 2VXSH 2FHFA 3D2UB 2BY1A 3PGDA 3WFEL 4J6RL 1IGML 1OCWH 3PP3K 1TPXC 4HCRH 2FO1A 1EA9C 3DBXB 3ZHKA 2DL9A 2VDKL 5E7BA 1NMAL 4WU7B 3UTPE 2CDEA 5BZWB 5ILTH 3D85A 1HSAB 1JIBA 1IGFL 2C1PA 5AZEL 4Y16A 4J3SA 2HLFD 1UYWL 3OJ2C 3UPCA 1GHFH 3DJ9A 5EUOA 1QBBA 2C9AA 2VL5B 5IHBA 1YNTB 3QQNA 2NXZD 3UBXG 3MA7B 3DX6B 3FAWA 1GOFA 2KPNA 5JDJA 4PRAB 2E27H 2VZ3A 5HYQB 1MOEA 4KRPC 3L5XL 4XBPA 1JHKH 2UVFA 2YD7A 3PIQA 4DZBB 3LPFA 1TETL 2QHLA 3AAZB 4TULH 5JUEH 3TF7C 4IIQB 2BP3A 3O3BB 1WFOA 2UZIH 3WJLC 1QKZL 2X70B 1PQZA 2QHRH 4AEIH 2ESVD 4UQ3A 5CD3B 4RAUA 3K4ZA 3TH3T 2F53E 4V1DB 4NHCL 2BNRA 1A9BA 1NDGA 4QXUL 4YC2B 2YPLE 3BQUA 4Y19D 4HMCA 4NM4L 3CCHB 4NQCB 2XWBA 5EBWB 2ED7A 4JJ5B 3IDIA 3WN5B 4Y5XC 4G6AC 4GW4A 1P6AB 1RHHB 5DC4B 1FGNH 3GGWB 4WUKL 3SE9L 2A83A 4NWUL 1RK0A 5CBEA 4HKXB 4KI5F 1H3VA 4KH2A 4IRJA 4IHOA 3FT4A 4F7TA 2AQ1A 5CEYA 2FECI 1U6AH 2FH6A 3VRIA 4DK6A 4I9WD 4MAYA 1FG2B 1J86A 2H32H 1GJIA 5LKNA 4WFEE 1DBBL 1UG9A 5LVEA 2UVEA 1K2DB 3F7RA 1QRNB 4Z18A 4ONFL 3TCLA 5GZNC 5D71L 3S96A 1A14L 5CJOH 4GBXD 4GAGH 4LU5L 4M8QA 4QRPE 3TZVA 1ETZA 2ZUWA 4OB5H 4P2QA 2VABA 5ICZB 1CR9H 2JIXD 1RJLB 4M6NL 4DN4L 1WTGT 4JFYA 1PG7W 4WI4A 3WIIL 2BVOA 1FGVH 3C5ZB 5JXEA 1AR2A 2HJLB 4LSSH 5I73C 3KPQB 4J1UA 1KPVB 4GRWB 4NN5C 4BFBD 4HXAL 3ARWA 5JDSA 5JTWA 3FTGB 3TCXA 1XGQB 5F3HB 4O5LH 3H3KA 5TFSH 4LGPB 1SJEB 4S1SH 4D9RD 1S5IH 3BN9D 4X7SL 4QHLA 3TYFA 1YEFL 4NC0B 3GSQA 5BJTB 1HSBB 4LLQB 4P4KB 5SWZD 5FGBC 3BKCL 4KKAD 4U1NA 5IJVA 2NXYB 4J3WA 4Z7OF 1T6VN 3MCLL 5IHLB 3FFCD 2IWGA 3W5NA 4D8PA 5DUMH 1NCUA 3SE4A 4M93B 2IQ9L 4QY8A 1N8ZB 3H6JA 5HGGS 2NW3A 5C3TA 4LLMB 5EORL 4Y4HD 1M7IA 2A9ML 2E3VA 1FZMA 4BQCA 3OJMB 3V6ZB 2Y07L 3T09A 1CG9A 3CLEL 3EFDL 4I77L 2DMKA 2I9TB 2DYPB 3HMWL 4IDJH 5IHZB 4HCRA 3NCBB 4X6DB 3QIWC 1Z9OA 4G42A 4IDLA 1M71B 4QHUA 1KXVC 2N56A 4NGHH 3OKDB 5GSRB 3P0VH 4GMTL 5TPWH 3QUZC 1CVRA 3S5LG 3VWJA 3WDIA 1S7VB 2ZPKH 4HJGB 5L9DL 2UYLA 3FQXA 4EVNB 2PTTA 5D6DC 3HS0A 5GHWL 3MRKB 6FABH 3FT3A 1I9RH 4CNIB 3I75B 2FGWH 3FRUB 3ULUH 5J56B 4G6KL 4L4VA 4AIZB 3B6SA 4HZAA 5HSFA 4LAJH 4PRHD 5KG9A 1Z5LA 1A7NL 1INQA 1OB1A 2Z93A 2X4UA 1PVHA 2B1HL 4JZJC 2BNRE 5HHMD 5ACLA 1BPVA 4YNYA 2YSSA 3QYCA 4P5TB 1N2RA 3VXRA 5IEKB 2H8PA 1R3LA 3O2DH 2VSCA 4YQXH 2XQYG 1DQJA 3JTSB 2Q8AL 1AGCA 1MNUL 2FSEB 3FO2A 2OXGA 3KPLB 4LLVA 4NQDD 4L9LB 4R96B 2EDRA 1HXMB 3W9EB 5CJQH 1FFRA 1H3PH 2GSIB 4D0DB 4GLRH 5EPMB 2YK1H 1U8JB 3BESR 3S9DB 5EU6B 2XWTA 3QUYA 3BMVA 1INEH 4MVBD 1XF5A 4HF5H 3QT2A 4U6HA 3U36B 5I1KH 2DLHA 1MRFL 2A6DB 1W8OA 1YEJL 2W60A 3WO4C 1CIUA 3LAFA 5E24E 3UP1A 5F1IA 1JWMA 5KVGL 3E6FA 5I2IB 3DV6A 3A6BL 2H32A 2IFFH 5F9WB 2P49B 2J5LB 4QTHB 1BGXL 2RCSH 1JHLL 1G7IA 4UOW0 4PRDA 4P2QE 3FOMA 3HMXH 5GGQH 1CZ8H 4ZFGH 4UIKH 1TJHL 1E4KA 3UPRA 3QDMB 4I3RH 3SGJC 1OM3H 3HTLX 2JJVA 4DCQA 1I8KB 3NH7H 5FUZH 1YEGL 1IT9H 5DLMH 3IJSB 2W92A 4WJ5A 2DQIH 4HMDA 3O3DB 3MLYL 4F58L 4EIZC 4OQ1A 4PJIF 3BHBA 3IYLW 1F97A 1Q9LA 4H0GA 4Z7QF 3DUSB 1LQSR 4HWZA 4EQ2A 4UV7H 3UZEA 2WUCH 2NY5C 1I8IA 1OAXH 4L4TB 5C92A 3WLWC 3AVEA 5LAXA 1UWEL 3QDGB 1R6VA 1DUZB 5EC1B 1BFOA 1CE6A 5D7IB 2PW2B 2X7LB 4FZEH 2CLRA 5CFHA 3SGDH 3ROOB 4KKNA 4LNRB 4HT1L 1AXSB 3BZFB 3QR2A 1MFEL 3ZL4L 4HIXH 3RWHB 2VE6B 4BSVB 3QFDB 1BHGA 3IVKA 4X5XA 3JTTB 5FO8B 1YJDH 3SBWC 3P73B 3GMQB 1RJZB 3SGDI 3ZSSA 1YUHA 4HUWA 4F2MB 3DRQA 5FF6B 4MNQB 4UDUA 4FQXB 4NFBA 4YDLC 2AV7B 1S7XB 4PRNB 2KBGA 3MR9B 3PHQB 1L7IL 4YAQB 5IFAL 5J6GA 4KQ3H 3RIFK 3ZYZA 2WIMA 1OLLA 2VKWA 3CK0H 2FBJH 2P47B 2YRLA 4E42A 3VW3L 4NQSB 2IAMB 5ENWA 1YYLH 2CJUL 4W6XB 3C5ZD 3B2VH 3F65A 3WL9B 1GYAA 1HIML 4L4VE 2CK0H 1RZFL 2Y4SA 3C2AL 4XCYA 5I8EB 4NT6A 5IVXB 3RNQA 1FO0H 3V4PL 3Q5YA 2FB4H 2FX9L 4JGMA 1ZLWH 4JZOA 2NLJB 5DQJA 3L5IA 3BP4A 4KHTH 5E6IB 4RGOL 2ZUUA 3FFDB 1CICA 2RIKA 3VXRE 5I1EH 1T21B 4WNQB 3NFPB 4PREA 4G6JH 5DJZA 4PGJA 4P4KD 4U1KA 3O2DA 3ZDXF 3LZFL 1DQQA 4I0CC 1HHKA 1RULH 2NXYD 4ZD3H 4Y4FB 1FFNB 4JGUA 1EO7A 1T89C 3GIZH 4XH2B 4P2RD 4L3CB 2QBWA 1QLFA 43C9B 4K3EL 4HJJH 1DANT 1FNSH 4HIHA 4K2UH 1U8NA 5FK9A 3ECBA 3LKRA 1OPGL 1U8KA 3MRDA 3PWVB 3WS3B 1BWMA 4OF3A 3WIFA 3BE1H 3HA0A 2I26N 3JUYA 1URLA 2Q8BH 1JUFB 4NQXA 1W0WB 3H2WA 4FTVB 4JFPB 4XB8A 5L88L 4TPRH 2QTEA 4TVPD 4IRSA 2WIIB 2DYPD 5DYOB 4YPGB 5C07E 3MUGB 5L7XL 2IGFL 4KMTH 3VGAC 5JR1H 4KWUA 2R29L 1FIGH 3NOIA 4JR9L 3HNVL 2H2SD 2CK2A 1CDYA 3VGDA 4MB5A 3QXWA 3DIFB 2UWEB 3HMXA 1W0VB 3P4OA 2XTJD 1KIRB 3EDDA 4B0MM 4X6BB 5KSAB 2E9BA 1BEYL 2R15A 3WUWG 3MXWL 3PE9A 4M5ZL 1WLHA 4JFFD 1VACA 3LY6A 2ZG2A 1XR8A 4JFDA 4NZRL 4JY4A 3TJEL 1FORL 3NIFF 4AIOA 1ZK9A 2DB8A 1WEJL 1K9TA 3RX7A 3CFKB 4NYLA 5B22A 3RAJH 1KTDA 1EAPA 2EKSB 3IETB 5D70H 3SGKA 4P49A 5IR1B 1AI1H 3GSWB 3JSSA 1WFUA 5L8KB 1G7MA 4JRXB 3LS5H 1YEKL 4Y16D 5CZXC 1A21A 5GRXG 2VXVL 5FDWA 3S37H 1ZLWK 3BDBA 2QQQA 3CX5K 3QQ4B 4MD5A 4YDKL 3L3HB 4RSVA 4JPKH 4PTTA 4RMRA 3L3DB 4NNYB 1TNMA 4JY5H 1HI6B 3X3FH 3R4DA 1JNHB 2HYMA 1EEYB 5AYUL 2D2OA 5HGBA 3I3EA 4XVUD 3MJ7A 4GAJH 5EU6D 1TCRB 3MLUH 3KYKH 3QCVL 4KXZI 2WBJC 2C4FT 1AR1D 4I5BB 2OZ4L 4JFEE 4RMVA 1PY9A 3QXUA 3GSVA 3LS4H 4W4OA 1BVLA 4GW5A 2E6JA 1T20B 2H1PH 4KAQL 4PP2A 4WENB 1AXTH 1T1WB 4XNYL 2Z35B 5DA0B 4Q2ZB 1X5XA 2ERJC 3V6OC 1MI5A 2BNRD 2DLGA 5C7XL 1W72L 1JPSL 3BQUD 4P3DB 1OARL 5JQ6H 2MTPA 3K8LA 2ZUXA 5CBAA 4KHXH 4KK6C 5EZLB 4GRWF 2F8OA 4OKVB 5A16B 5E94A 5LGHL 4PIRF 2BCKB 3PQYB 2CLVB 2IQAA 2ZKHL 4OV5A 3J7HA 3REVA 4U1MB 1D5XA 4M7JL 2YEZB 2CR3A 1FBIH 3PABA 5D96C 1ZSDB 5DC0A 2DQJH 3QDMD 1WBZB 1A1NB 1O5DT 1LE5A 4IRJD 1X6LA 4F9LC 3OKKB 4OUOA 3A6CL 3ULUE 1A1OB 1RQ5A 3D69A 1FVDB 3KPRA 3BIKA 5IVNA 1LO3H 4RFEB 1A2YA 1BOGA 1FO0A 3KPOA 1C08A 2UY7A 1L4IA 1A6VL 1LK2B 4G80B 2Z4QB 4P2OB 4YEFA 4RAHA 4R4FL 5ID0B 1DQDH 2X6MA 1VADB 3VFGH 4FQIH 4L4TD 3HUJB 4ZSOB 3TZVD 4X99B 2JF1A 1KCUL 1VGEH 5JHLL 3GMRB 5DT1L 3VGGA 2R39A 5M7QA 1A3LH 3IS1X 1PZ5B 3BIAX 3FN0L 1C5DA 5GGRB 3CLFL 2FR4A 4XMLH 1T7VA 1LE9B 4X6DF 5EOQH 3P0GB 3O4LB 2I07A 3LIZH 5L0QC 1F4XL 3H3BC 1A7BA 3NN8B 1O0VA 3DVNA 3QO1A 3B8SA 3MNWA 1CDHA 4XPGH 3TESA 5B21A 1U8HB 4OGZA 3FO1B 4ZTPH 3L95A 3E0GA 4LHUD 2GJ6A 3IFPA 1CDCA 5FUCC 3BKJL 4U1HB 3C6LA 5I1CH 4WIQA 1PLGL 4P23C 1KT2B 4MNQD 1LO2L 1CFTA 4UUJA 5EN2B 3P30H 4IOFD 3S37X 5SWSB 2F58H 5BW7C 2AABL 3KPNA 2NTFB 4I2XE 5K9KA 1TCMA 5TH2A 4D0CB 1XIWB 1QHOA 1Z2KA 1HNFA 2VLRA 5F1SA 3QI9B 4HIJB 4HUUB 3U46B 3FQNA 5EB9A 2VXUL 4LMQI 4NQVB 4RGND 4F33B 2IAMD 1VEPA 4JFDE 4KU1A 1A7RL 2FNBA 5B4MC 1U95A 1P1ZA 2ADFL 4XMPH 1OF2A 1OLZA 2OCFD 4UDTA 3NBNA 5HY9A 4ZS7L 2D03H 4QTIL 4R7DB 4UAOC 2BOBB 2DICA 4FFYH 3DXAE 5E6ID 3R1GH 3OG6B 3L3OA 5H8DA 5HYJA 3L9RB 5I66B 2VZ1A 5F7EH 3K80A 5ISZA 1HQ4B 5ITFA 5GRJL 1XGRB 1G9ML 1NSNL 2F5AL 3VWJD 3GBMH 4PJFF 4NKOB 4HGWA 3QO0A 1IAKA 3CDGA 5I8KL 4GG6A 3N1PC 3KWWA 4LNVA 3OJDB 4JM2B 4RDQG 1ZHNB 1CFVH 4HG4K 3UZVB 4ZFZB 3LRHA 5KJRL 3LRGA 4LLAA 5J12B 4X7FC 5D7LB 4TTDD 4YHMH 5J1AB 3MJ9H 2H41A 3U30B 2W1NA 3MBEB 4XAWL 4NSKA 3CD4A 5IFHH 1MI5E 4WEUD 4G8EB 3QQ9C 1QFWH 2RGSA 2BMKB 3RGVA 3FQWB 5IFJA 2ID5A 2PXYA 3BJLA 4PJ9C 5SV4A 4JQIH 4WI3A 3UTTA 4M1GL 5D6CB 4R7NA 3DX9A 5H37H 3TBSA 2NYYD 3VGFA 1EH9A 2IALB 3OX8A 5TQ2H 3AMLA 4K8RD 4CVZA 2Q6WB 1QFWI 4X6CB 3EOTH 5KOMC 1MWAA 4K23H 1EBPA 2X40A 5JPNB 4BKLB 2HG5B 4J8RB 3VXMA 3QUYD 2VAAA 5KSAD 1DLFH 3MUJA 3T2QA 2P24A 3W0WB 4LRIC 3MLTB 7FABL 3KPRE 1JWSB 1V7NL 4KZEH 1J0YA 1UADC 1FN4A 5HI5C 3SJVA 5JLZA 1YEIH 4NJ9H 2O5XL 1RUKL 5EFIB 5H94A 5D72H 3D18A 3L5WA 1SBBA 2YMXL 4TVPL 3T77B 4AM0B 1MLCA 5F9OH 3HNSL 3GKWH 1RMFH 2CIKA 3PL6D 1KPUA 3KJ6L 2IMMA 5A3ID 5A1AA 3MOBH 1N5AA 1KJ3L 4LCWB 1KTRL 5C0IA 5IW6B 1XGPB 2AJYL 1IAIH 3PWNB 4JQXC 1P7QA 2ENYA 3C9NB 1QPPA 2DLFL 2HJFB 5B38A 4NNPL 2R2EB 2WSKA 5DSCB 5JMOC 3HC4L 1UB6B 2NY2B 4ZOEA 4HK3N 5DRXA 1R3JB 4OFYA 4UOJA 1AGEB 3EYFB 4DKEH 1FZKB 4MA1C 3QNYB 5FKPB 5MEQB 4G9FB 5KBNC 1I7UA 2OR8A 4OZFA 3VXOB 3DURA 1A6UL 3HR6A 3K1KC 1JGDA 1V7ML 4HFWB 1P7KB 4MXQC 4QRSB 2F19H 3DX8B 1QLRB 2VDRH 3PDGA 5EU3B 3QAZB 4MJIB 1T1YB 1KB9K 2A74A 5BS0B 3VD5A 1K8DA 5MENA 3WE6B 3OKOA 4OLXL 5E6YA 2BVUA 1I1AA 2K7QA 1DQTA 1MHPH 3TNNA 5IVXF 1NBQA 1U92A 1A6ZA 3GK8L 3PQYD 4M00A 3GFUA 4LPCA 4NUGH 5CINL 4NRXB 5D2LB 5IMLB 1BREA 2G5RA 3I9GH 3CXHK 1KFAH 5HDBF 3WV0A 5GXBB 4L8BB 1KENL 4QHKJ 3E1F1 4PJ5A 3E6HA 3QDHA 1GAFL 5MHSD 1A6WL 1HH6B 2QADC 4ZUSB 3CVHA 1YEHH 3U4AA 3MRMA 4PB0H 4XPTL 2AEWA 5T3XH 1KJMB 3QA3B 5L6YL 5T5FH 4I18C 4N8VA 1JPFB 2Y7QA 3VCLB 5HYJE 2W0FB 3S35L 4Z0BH 3U2SA 2BC4B 5FO9B 3U0WL 4AEHH 3GRWL 1A02N 4WHYH 3IU3B 1OD7A 4I4WB 2X4TB 5C0FB 1WISA 4MSWB 3SE3C 4C4KT 3SDDC 3HC3L 2C26A 1R5WB 2AEQL 2B39A 1CE1L 3P11H 4Z5RA 3U9PL 4GG6E 1OAUH 4R8WH 2G5BA 2V9TA 4F57H 4OCWH 2ARJB 5JW3L 1RUAL 1MREH 2A6KA 4G8GB 3QFJB 1QG3A 1IL1B 5IROA 1A4KA 1FNFA 3MUY1 4Y5VC 5DJDA 2CDFA 2W9DL 3PV7A 1FVCB 3RY6C 2LU3A 4KQ4L 2UWEF 4FXGB 2BVQB 4LGRB 4QWWD 1TITA 3MJ9A 1RIUL 1U8IA 4XBGB 1T04A 1YN7A 3EDFA 4GW1B 1CICD 4X80L 4N0FB 5KANG 3UJTH 3K4DA