2RQ8A

Solution nmr structure of titin i27 domain mutant
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
98
structure length
98
Chain Sequence
MLIEVEKPLPGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLAASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANTKSAANLKVKELLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Titin
publication title Structural basis for unfolding pathway-dependent stability of proteins: Vectorial unfolding vs. global unfolding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 7
structure length 98
sequence length 98
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rq8A00
3SPVB 1LDPL 2Y5EA 4LVOC 3UTSB 3MRPB 1ACYL 4JRYB 3ULUH 3WS3A 1IAOB 1ZHNA 4M1GH 4M61A 1FN4A 3VW3L 3SDAD 1KJ2B 4OZFA 1N5AB 3VRLF 4UV4L 4CMHC 1RZKL 1Q9OB 2WINA 4MWFB 7CGTA 4BFEA 4FZ8H 1ZWIA 3VI4F 1LNUA 4TVSa 3BYYA 1IC5L 1UH2A 4XP9H 5BZWA 5BVPH 2BNUA 1U3HA 4NZRL 2X4TB 4DUXA 2EYRA 5E8PA 4XVJL 4AZ8A 3HPLA 3O6FA 3TA3C 4KQ4H 4G8GA 5BCAA 5FO9B 3SCMC 3T1WA 1FZKA 4KUCD 5DQ9A 3RHWF 3INUL 2PR4H 3DUHA 1YMMA 4LCYB 4UQ2B 1TJHH 1FO0H 4NKMA 3L95A 4AJ0A 1T0NA 4NO3B 4UT9H 5DA4A 5CD5D 4OLWL 2OI9B 1G9NL 4BH7A 3F7VA 1JRHH 1UENA 3MUHL 2P49B 5HDQL 4EZMA 3MRNB 4JJ5A 5EU6D 1S78C 1LO3H 4NQDE 1IE5A 5IB5A 4I3RL 4LLVB 3MODH 4PJHB 1NDGA 2GFBA 5IJVB 3MREA 4LIQL 3C6SB 2O26U 2GY5A 3O4OC 2CXKA 5TDNA 1S7VB 3D18A 2ICEB 3S37X 1RQ5A 1AO7B 3QPXH 5D7IE 1HINH 5DMIH 4KVCH 4MNGB 2E27H 5D7JC 1AGEB 5CJBA 4MAYC 3TV3L 4HUMB 3ZYIA 4RAUB 4I2XB 2EXYC 4PTTB 5A2LH 5FYJD 4EUPB 1UJ3B 2WUCH 3V6OC 2Q3ZA 2QR0A 3MRDA 1U8NB 4BQ6A 4Z7NE 5AWNH 1RIUH 3ULSB 3PGCA 3V6ZA 4JRXB 3S5LA 3ZZ1A 1B0RA 1FNGA 4DGIL 1R6VA 1VFBA 2R2CA 5I74B 4GRMB 1TJGL 4L8SB 3O2WH 3MLZL 2PO6B 1YY8B 4JPVL 1QFHA 1X7QB 5C0NC 4CL7A 4CVZA 4L1DA 3SE3C 1TZIB 3P0YL 4WJ5B 5F1OB 3QIWC 4GMSL 4J3WA 3CXHK 2R69L 3IDYB 1MRDH 1J0JA 2YUXA 3L6FB 3LMJL 4R97C 3SDDD 3HC4L 1T2JA 3LEXB 3ARFC 4FFWD 4Y4FD 2X5PA 4GKZB 5T1DL 3RWFA 2BSTA 2KDGA 1G84A 1AKJA 1QP1A 1LP9F 3PP3H 4OLXH 1V7NL 5JO5B 2GJZB 2D0GA 2X70A 3LKRB 1B0GB 1FIEA 3K8KA 2HFEB 1R0AL 4F9LC 3DHMA 5ISZB 2BXYA 5KSAB 4X8JA 3ARUA 2AK1H 5AUMB 3LKNA 3O0RL 4PGDA 3O2DH 5IF0B 4K3DL 2EH8L 1OTUC 2H32B 4LU5H 4H88L 4R0LA 2A74A 2F9BT 2BVYA 3NMEA 3SJVD 1WZKA 5TPWL 4JO1H 3T0EA 3HA0A 5D96C 4PLKC 1V3JA 1QEWB 2ZPKH 2PXYB 3WDHA 4JQVA 1D5IL 3D0VA 4I4WA 1WFOA 4QWWC 3I2CH 4QRUA 1L9MA 4GRLC 4P59H 4E42B 4U1KA 1QFWM 3IXTA 4NHUB 5DRWB 4IRSA 5FYJU 4KDWA 4PUBH 2EIBA 3TBYB 4LVOB 1RZ8A 3MYZA 1IBGL 1CLCA 2AJ3A 3QEUB 3QHFH 1CGVA 1EGJL 1DUZB 3GSOA 3IXAA 1JUFB 4JKKA 1DANU 4K3HA 2AQ2A 2QV2A 2A6DA 4GJTB 1YDPB 3LV3B 4LVHB 4MZ2A 4WTZA 1KJ2H 1LE9A 1K4DA 3D0LA 4DFIA 3QUXD 3G5VA 4X7CC 4MCZA 5DC0A 4ZAKA 3E8UH 4LP4A 4OBRA 5CIPA 2AJUH 3H0TA 5CSGA 1Q0YH 5JUEH 4GSDL 3S36H 2YPVL 3QWRD 3BGMA 1FZOA 3V7AE 3WLWD 5MEND 2ZKHL 4QXTA 1FQ9C 3ARSA 4MCYA 4YBLB 2AJSL 1MCRA 2YRPA 5SX5K 3FFCD 4G8GE 4WHYG 1FG9C 3V0WH 4X5WA 1FNEA 3LRSB 3MV7E 2JELH 1D6VL 2BVPB 4JFFA 2YS4A 2HFFA 1Z2KA 3VWJC 4RFNC 1VEPA 5FHAH 3VFTA 4BFBD 1M1SA 1ZT1B 2A77H 5J9PA 1RV6X 1Z9MA 2OLDA 1UVQA 1YEJH 4Y7MA 4TQEL 3TCLA 3CZJA 4OD1H 4YR6A 3PV6A 1HILB 3RU8L 4X80H 2WZPD 5E8EB 1LO5A 4K9EH 1QFOA 5A1AA 2Q8AL 4IDLA 5SWZB 1JN6B 5IVZA 5M94B 5IKCB 2HJKB 4L5FH 2VE6B 3BFOA 3DVGB 1GZPA 4DGVH 2HMID 4NPYB 4L4VB 2VSDA 3FO1B 5HPMA 4ODXB 4JHAH 1UT9A 3OWEA 1INDL 4K8RH 1MH5B 4B53A 2WK2A 5F7EL 1KCSL 1WBZB 5K9KA 3UPRA 1FLRL 12E8L 3OAUH 3ROOB 5I1EH 4QT5A 1REIA 2J8UA 4YDIH 1RUAH 1KJVB 5C0AA 1DQQB 4R8WH 5F6HJ 4EVNA 4XNQA 2BZDA 4X6DF 4U1SB 5K59F 1BJ8A 3ZT5A 1NLDL 3RVXD 5C08A 1C7SA 4EUPH 4IBLT 4N0FB 3VFPB 2I9TA 2FWOB 1QBBA 2IC2A 1N3NA 1UXWA 4GRWB 3U7WL 3DYMA 4FFYH 4KH2A 4RMVA 1U3HD 3O6FD 4G8GD 5JIIA 4W4OA 1E6OL 1K3ZA 2FH6A 3ET9F 4DZBB 3KPPB 2VZSA 5KVEH 5M7QA 4R97B 4LLYB 4IMKA 3QUZC 4K3EH 1YMMD 4NCC1 1G7MB 4NNYB 4UT6L 3SDXB 4PP2B 4ELME 1NEZG 1A6AB 3SGJC 4AH2A 2GY7B 1I7TB 3BDYL 5CGYC 4JFHE 2GTWB 1YY9D 4YXKL 3MV11 4KHXL 4ONGH 5MEPA 2Z9TA 1MI5B 1CL7L 1CR9H 5IK3B 2P42B 1NBZB 4OZHE 4Q6IB 2DQCL 3FMGL 2P1YA 5KOVC 4PJAB 1T80A 1JHLL 2UVFA 1MREL 2PYFB 5JPMA 4OZIE 4MDIA 1AIFA 2FYYB 3TPUA 1RZ7H 3IT8D 2HKHL 3C08H 5FDYA 4EOWH 4G6MH 3CMOL 2H32H 3VXUA 4M7ZC 5GZND 1CICA 5IV2A 3BKML 1FNSL 5FYLD 3B2VH 3ZLQC 4G6FB 3BW9B 1MRFL 2XRAH 5JW4Q 2B4CL 4HFWB 2G2RA 2FX8L 1JMXA 1E4KC 3T0EE 4GRLB 5DZLA 3SE4A 4TVPH 4ZFOA 4BKLA 5GS1B 2P5WA 4LKCB 1DE4A 3UTSA 1OHQA 3VXOA 4I3SL 1IAOA 1QUNA 4WU7B 2P8MA 2HKFH 5GS2D 1N5AA 2CRZA 4G8EA 2NZ9D 1BFSA 1YZZA 3PWPA 3MLUL 2DBLL 2XZAH 3NOIA 4JFHD 3SE9L 1FPTL 3G5XB 3HMWH 1KPUB 1U8JB 2JCCA 1AKJD 4YUEH 2KH2B 1IM3B 3UC0L 3BD5A 1CG9A 2E9JA 4K94C 1OARL 1JGLH 4TUKL 4UQ2A 1KB5L 1NSNH 4QRTA 4D8PA 3QIBC 1JWMB 2GK0A 3NA4A 4XPBH 5DZOA 2AJYH 2YK1H 4NQEB 1MCWW 4HXBL 5DYOA 2V5SA 4IHOA 4KAQH 3RA7H 4JFFE 1RJLB 4LHUB 5MHSE 4E41B 3HMXL 1AI1L 1GIGH 3VXRB 3QEQB 4FXKA 1I9RH 3RBSA 4YBHA 5CEYA 3JWDL 3QCTH 2NY7H 4DAGH 2EYSA 4OCNC 4NP4H 4PJBA 1PBYA 2CGRL 1JNLH 2HVKA 2NY6C 4P2YA 4Y2DB 4PTTA 3NA9L 4NM8H 5EIQA 5I0ZA 4QOKA 4M7KH 1U8NA 4DKAA 3QPQD 3N1MC 1UQSA 4H1LA 1JI1A 4JE4B 4NQVB 4U1LB 5DQJB 4M1CD 1I85A 2XXCB 4QY8B 3V4VH 2GT9B 3B2UC 3RVXC 2J8UE 3HZKA 3QG7H 1A1NB 5BOZG 1FH5L 2XKUA 1MCWM 5C0AE 5C2BL 4LSVH 4ZAKD 4E9LA 4HS8L 3MA9H 3MYJB 4RIRB 2OK0H 2VLKE 3UTTD 1B6DA 2P7TB 3KPNB 5E2VL 1YQ2A 2C4FU 4XCNA 1KULA 4GRWH 1BD2E 2F54B 1WEJH 4Y16B 2RCSL 4U1GB 3TN0B 3Q0HA 1T1YB 1WGOA 4UINH 4KRLB 3QUZB 1YN6A 2R4SH 3L3DA 4OLZH 4S1SL 4TN9A 2HH0L 5HVWA 2XTLA 4WI3A 4X4MA 3U0WH 1X5LA 3HE7A 1K8IA 4C4KT 1CYGA 2Z8SA 2FO4B 3JTTB 1FFRA 2Z4QB 3HG1A 2EDXA 2GJZA 4JFFD 5JO5A 4NQDB 4MJIE 3LKRA 3NIGE 2ICWB 4YFLI 5DR5H 1UWEH 2HFEA 3LOWA 4FQCH 3U83A 1V7MH 4M43H 2BNRB 5DD5H 5I1CH 1F02I 2MFNA 2AK4A 5TE7H 1ACZA 4XXDA 1I3GL 5HGBA 5D7IB 3IVKA 4TUOA 1Y6MR 2VXUH 3IFPB 3QDGA 3J7HA 1RIVL 1J1PH 1F6LL 1T4KB 4Z7UA 4F3FB 5EIIA 1CLOL 1IZKA 3RUGB 4MA8L 5K93A 4XBEH 3N9GH 4M7JL 4M7ZB 2XICA 5D2LF 3PWJB 1JHTB 2CUHA 4IRJC 2PXYA 3QIUA 4P5KB 4LCUA 1AGDA 1YECH 3RVVD 3RFZC 4U0RC 4WEMB 3VXUE 5C0AD 1QOKA 4XTRD 2H1PL 4NKQB 3KNBB 1H5BA 3HNSL 5C08D 3NBNA 3UZQA 3TBYA 3DO7A 3BJLA 5DJ8A 4N1HB 5HVFB 5LGHH 5IVXA 1IAII 4JCMA 3L5WB 1QRKA 1V3LA 3P77B 3T09A 4U1MB 3MLTB 2CH8A 3AREB 4S10A 1JPSH 1WV7T 3AROA 1I7UB 1JGUL 2AABL 2FSEA 5C0GA 1YNKL 2P5WE 3GGWA 1YDPA 4CMMB 1QD0A 3RZCB 1HQ4B 2EC9T 2I25N 5EZOL 3ROLA 4LARH 4ZOAA 4FP8L 4U49A 3T2NH 5GJTL 1GGTA 3EOYG 4XAKE 4D3CL 1ZLWH 4L8BB 3VWKC 5CJQH 3EFFA 1DUYA 3MNWB 5BZDB 1IGTA 4U7MA 4WVRA 1U8LB 3LB6C 5HHVL 5IW1B 3GRWL 1ZGLB 3EO1A 4LCCC 2V2WB 4D0BB 4MQTB 5E4IA 3CH1B 4P57B 4RISL 5E00A 5FM5M 4OIIL 2V7NB 3QCVL 2Q7YA 5I15L 1JWUB 4O9HH 4NNPL 1VHPA 2YN5A 2R0LL 1IGCL 4G9DB 3R4DA 4IIQC 3VXUD 5GGUB 1CICD 1LE5A 1U8MB 5ESQB 4XCEB 5IOPA 4P4KB 5T3ZH 5DD6B 3T0EC 3LN9A 3L5XL 2VE6A 4F7TA 2M1KA 5DA0B 1XAUA 1ZANH 1RIHH 3D9AH 4F58L 4JQVC 5CP7A 4LLWB 1J5OL 3GBML 1ETZB 3IDMB 5E6IA 3SKJL 2GYSA 4Y4KA 5DWUL 3BQUA 5F7MC 1HHIB 3QXWA 2P5WD 4G3YH 1WBZA 3UTSD 4KMTL 1F97A 4JHBA 4IRSC 3ULVL 3BKCH 5EO1B 1FBIH 3WJJA 3UTPE 3PUCA 2YKLH 3X14B 4PJBE 1ZVHA 3TT3H 1G7PA 2X4NB 4XCYB 3K7UA 2WBKA 3IFNL 3MOBH 2JJWA 3PWPD 4MYWB 4N0FA 5GSRA 3LKQB 1F2QA 2FWOA 4QOKE 1LILA 1A3RH 3S7GA 1QFUL 3CSBA 3OMZA 5T3XL 1W72B 4PY8I 4XVUC 3LAFA 5GIRB 4DZBA 3ISWA 1L4IA 1MWAA 5BW7A 3S3SA 2HP4A 4HBQA 4ETQB 3LKOA 4XPFH 1NCAL 3WFBH 3GIVA 1T1WA 1HEZA 3KLHD 2HRLA 4G7VH 1EV2E 2OS7A 5HPOA 4APQB 2EDKA 1FVDB 1CFSB 5LGJB 1FL3A 3HC3H 5ALBL 2XWTB 2J8HA 5DFWH 1K3IA 4NJAL 3C8DA 1JYVA 4WV1A 3RY4A 1FFQA 4X99A 3AM8A 3UJTL 4RMUA 1MHCB 1MFBH 3LD8B 3UO1L 3K8LA 5FM4A 3O6LH 2Z93B 3HG1E 2R0KL 5JW4M 2MNUA 1ADQH 5FM8A 2VIRA 4FQXA 4QYOA 5I18H 4CJ1A 4TNWK 4JFYA 2Y9RT 5ELIA 4FZEL 4JZNB 2FYYA 4PYGA 1KXTB 1AQDA 1XCQA 3VJ6B 3CXDH 3ARZA 1KN4H 2VQUA 3P9LA 2AK4E 4XBGB 1GGCL 4PLNC 2J8OA 2OTUB 3UTPD 1H0DB 3MRBA 3BW9A 3OHXB 4Z7UE 4QOKD 3NIFE 4HFWA 5JHDE 4U0RB 3CUPA 1IAIH 1KCVH 1XZ0A 3BPOC 1MFDH 1JZ5A 4MAUL 3HTLX 1JPTL 2OM5A 2XZCL 1MVFA 2O5YH 1NDMA 4XMKL 5TFSL 1I7RB 4XTRC 4M4RA 4J3TA 4G8IB 3BISA 1Q0XH 1T04B 3ZSSA 3AUVA 4YNYA 3IGAB 3WFHB 2PO6D 4F7PB 1I9EA 1RUMH 1VKXB 25C8L 4HWUA 4GXUN 4X4YA 3QRFM 4KPHL 2HLAA 2QQLL 3TBWB 2M8XA 4PRNA 4OAWB 4G80A 5BMFH 3OX8A 1U8JA 1A7QL 3P3YA 2HVJA 3HE7D 1WVZA 4KZDL 1WQVT 3E6FB 5IFJA 4UTAH 5D7LB 3C2AH 3HG1D 2DQUH 3VWKB 4G9FB 2MPAL 4F7EA 1NBVH 3ZKXB 4PJCE 1U8IB 4YHNB 1HHHA 1VFOA 4NKOB 3PHQB 4K94H 4OZIB 4N8VB 3OKLB 4Z7WA 4LCCB 1T3FB 2AK4D 3QQ9D 4NQCA 1A5FH 2NXYB 5I17A 5I1JL 1CFTA 3QDGD 4P3DA 1RZKC 3FO0L 2Z91A 3OF6A 3TWCL 5I1KL 5IJKC 4FG6D 8CGTA 1T1ZB 4KY1H 2ID5A 4IIQB 1G9ML 3GM0A 3MRFB 1QBLL 1L7TL 3MRKA 1KXVC 4E41A 1NAKH 1LHZA 5T1LB 2PXYD 1KCLA 3QIUD 2BDNH 2P8PB 1EHLH 4OI9A 2ICWJ 1HKLH 2NTFA 4LLAA 1AGCB 3O9WA 1IL1B 4OI7A 4NZTH 3HLAA 4O02H 1K6QL 5LCVL 4FHBD 2DDQH 5F9OH 1RZIB 3DUUA 2H3NA 1OLZA 2OZ4L 5D7KE 4JFDE 2VXTL 4Y2DA 4XI5D 3OKMA 4DK3A 4YPGA 2CRMA 2E6PA 5HDBE 3CSPA 2ZCHL 5EBLB 2EDNA 2P24A 2BSRB 1T20B 1MFEH 4W4NA 4OCYH 4NQVA 4J1UA 4M00A 1NAMB 1ZHLA 1R5IB 1DBAL 4LLQA 4XP4H 4KTDL 4QY8A 3BEWB 4NRYB 1J0HA 1JK8A 1A1NA 1E28B 2AJXH 1F3RB 4NUJB 4UT7H 3MYJA 1WAAA 5KSVA 3OKKB 1JNNH 2IQ9H 2QTEA 3ALPA 3NFSH 3DROB 2VXQL 3OJDA 4Y16A 2JCCF 5ITFB 2WLYA 3FL7A 3WS6C 4ELKA 3TN0A 1T1YA 1W72H 3C6LA 3QUMB 3VFOA 1JTOA 3DX6B 4HEPG 4V2BA 3PHOB 3MUY1 32C2B 5KJRH 4HIIB 4HGWB 3DXAB 3V4UH 2HT4D 1GYAA 5C1MB 2QQNH 1A14L 1FAIL 5E4EC 3WKMH 1S9XB 3W0WB 4Y19B 4GS7C 4MD5B 1IT9H 4JFPB 2AW2A 1ONQB 1KF9B 3CFKB 4YHOL 3S9DB 2ZG1A 2A6JA 1KEMH 2XT1B 2WNGA 1PFCA 3U36A 3BH9B 3V0VA 1EO8L 4JM2C 3QI9A 4XPTH 4PJHF 3PIQB 4NJ9L 5KN5B 3NTCH 4PV8B 2W0FA 5HHNB 3P11H 4F3FA 1NC2B 4PB9H 1DLFH 1M05B 5A2FA 3SY0A 4HG4K 1P7QB 5H37G 5E6ID 3RNKB 4Y4KD 2PW1A 3BQUD 3QR2A 5GGVY 2H45A 1RZJC 4N9OB 4P5KA 1HCVA 4W6WB 5AAMA 3MLSL 5DFVD 4CDHA 4CN4A 4OD2B 4XPAH 5CSZB 2CIIA 3LY6A 4GAGL 1UA6L 3BPOB 1K4CB 3NCJH 1CGTA 4JQXA 4JO3L 4LSUH 5IESH 1YYLH 4YZFE 2ENSA 1A2YB 3GSNA 1OAQL 3DWTA 5FO8B 2BY0A 4YX2H 2G60L 4ZG1A 1PEZA 1BD2B 5CLTA 5I1AB 3AREA 1P7KB 2FH8A 3WLBB 2BVOB 3H7BA 4EBQL 5TE6H 4OCMC 3U6RA 1NUGA 3FQTA 4JZOB 4CMMA 4KU1A 3EZ8A 4Q2ZB 3ZTJH 3T3ME 1BFVL 3FT3B 4KVNL 3BAEL 3MACL 3RKDC 1C08A 2NYYD 3VFNA 3IKKA 5C0BA 1N0LA 2VZOA 5IQ7L 4DOHB 1X5AA 1NH6A 3U0PA 4X7SL 1TZGL 2HJLA 5IB4B 2IPTH 4POZC 5BZDA 1U8LA 5C0RH 1NCCL 2V6HA 3LKSA 3NIDF 1ZGLA 3QQ4A 5C0CA 3P4NA 2V2WA 4D0BA 1YNLL 3ZYZA 4FQXD 3TBSB 3IDGA 5TF1H 1PVHA 3QQ9C 3O3BB 3PDOA 3CIQA 3W81A 1L0QA 2WBJA 5GGUA 1YEGH 4HFUL 4NQCE 5DTFA 5JA8B 3FHQA 5ESQA 3CFCH 1A8JH 1HQRB 1N6UA 3AC0A 4Y5YB 5F1NB 4HXAH 3MCKA 4G6FD 2X4SB 35C8H 5DEFA 2P5EB 4ACPA 2N7BA 3GMOB 3MBEB 1MLBB 4LLWA 3RWCA 2DQFA 1EERB 1EFXB 2PTUA 4JB9L 5JDJA 1P5VA 1IGML 1H5BC 4YHZL 4FQIH 3C8KB 4JDVB 2J6EH 4HX1A 1TETL 5KSUA 4OZGB 5EU4B 3D25B 2G75B 4XI5C 5DD3H 1QYGH 3QNXA 5F1IA 3KYNA 1C16B 3X14A 5BJTB 3QUKB 2DQJL 2FBJH 3QUYC 5DMKB 4XCYA 4MS8D 3PP4H 3CD4A 4D9RE 3CCHA 2YMXH 1U93B 1CU4H 1L7IH 3EOBB 2RGSA 4Y8AA 2H9GB 2Z31B 2VKWA 3BZEA 1XFPA 1QQDB 1NAMH 1T1XB 1EAPA 2FIKB 5DHXB 3CLFH 3BPNB 5I6XB 4KKAC 3X12A 3AS0A 3TJEH 2LU4A 2AV1A 2NY1C 4PJIB 4HDIA 5CP3A 4N9GA 2QHRL 4OGZA 5B8CB 3IJYA 3L3OA 2Y1VA 1T6VN 1WAAE 3RTQC 3MLPA 1NGWB 1YN7A 3CC5B 2EC8A 4E5XB 4ODHL 4OKVB 5EC1B 3QUMH 3KYAA 4APQA 4BH8B 1QR4A 4NQCD 1MFAH 4NQED 2XWTA 5E4EB 4QHNB 1UH3A 1TQBC 4O2FA 4OF8A 4L8DB 4U1IA 1PLGL 1G7JB 3AXLB 3OF6D 5T3ZD 1P2CA 4HPOH 5JW3H 2Z93A 4R90L 2R0ZL 2Q6WB 5HHPA 5J13C 3W2DL 4BFIB 3OKOB 4KHTH 4E41D 1QSFA 4JM2B 2EDHA 3VXRD 4LK4A 2C7UB 4OGYH 1TCRA 2FEDD 8FABA 5FB8B 2ATPB 1IFHL 5SX5H 1NFIA 5CMAA 5FHBL 2GSGA 4Z95H 3CXHJ 3O9WD 4XAWL 3C2SA 1R3HB 1MCEA 1H3WM 2IMNA 2QSVA 4C56B 1H0DA 1GAFH 43C9B 3P30H 4JKMA 4Y4KC 4Y2DD 3BQUC 4PRIA 2Y5TB 4GBXA 5KZCD 3TGXA 1NEZA 2E7MA 4A6YL 2IGFL 1KSRA 1DQDL 3ARDB 3EIFA 5DFVC 4S1DD 4LGPB 3N0PB 4JFZH 1Q72L 4IMLA 1I7RA 3GSUA 2A6KA 2YXFA 4XNZC 1FFNA 1ORQA 1Q8MA 1T04A 4QTHB 4NZJA 3HRPA 3IJSA 4F7PA 4GRWF 1CD8A 2KBGA 3MROB 2YPLE 1VKXA 5A2KH 3EUUA 4L3AA 4Y16D 1KIRB 2V17L 3V52H 3TN0D 5A2IH 2VDLL 4HWEH 3FT4A 2MCPH 5TDPB 2J88H 1N64L 4JN1L 5J12C 1U9KA 4JN2A 4N90D 5E99H 4OFPA 5DI8A 1DDHB 2UVEA 1TFHA 4UAOC 2IG2L 3SDXF 2B1HH 4KMQA 1OAYH 3QNYA 4XCFL 5D71L 3O8XC 1MJ7H 3FFDA 5L7XH 5CJXC 1RJCA 3MCLL 1U8IA 4WUKL 1WBXB 4ZFGL 3VFUA 4PJ7B 4WV1C 5C0BE 4NKOA 3AM8C 3PHQA 4BQ9A 5LWYH 5A16A 5AYUL 2VC2H 4PB0L 2HT3D 1CDIA 3QI9D 3SKNB 1LDPH 1S7UB 1BQLH 2EDFA 5GXBB 3RIAK 4LCWE 1ACYH 3T77B 4FQXC 3BZ4A 4PJAF 3GK8L 3HR6A 3VW3H 3MGAA 5C0CE 2ZUQB 2ESVE 1S9KC 5TDOB 4DUWA 5JHDB 4DK6A 4AENB 2OR9L 3VD3A 1RZKH 2ENYA 3EOAA 2ZCLL 4XGZB 2KZWA 2P8PA 2V9QA 3GSVB 4QNPE 1IC5H 1Z9LA 4S2SB 5K9JH 4Q9QL 3QO1A 1U8PA 3BD3A 4CDGC 5E7FA 4NZRH 2GJ6E 5E1AA 3BD4A 2APXA 4LDEB 4GW4B 3WBDA 1N4XL 1T5WA 1CFQA 5GGRB 1D5XA 3FQXB 3W39A 3INUH 1DQJA 2CO6B 2OR7A 3FN3A 2CKBL 4WUUA 1CN4A 1F8TL 4U31A 5HI5D 3ARED 4K7FA 1EEQA 3QUYB 1R5IA 5C0JB 3CPLB 4OLWH 1RVFH 4ORZC 4MD0A 1EA9C 3NFNB 4HQQL 1G9NH 1BJ1H 4NRYA 5JPNB 3QG6B 3MFFA 5HDQH 5LGKA 2DI7A 1I1FB 4P48A 1KUMA 4OT1L 5C0BD 4I3RH 3MNZA 3ZKMC 2P44B 4QHMB 4U2YA 1ZT7A 2VZ1A 5GGTL 2NY1B 4LIQH 5JZ7D 3QUMA 1WF5A 4HZLA 4Y2OA 3QWQB 3OR7A 2E7LA 3RTQB 5EOCL 5FA4B 2IPUG 2YZ1A 2DWDB 2VQ1A 4QCIA 2X4QA 4HIIA 4HWBL 3BH8B 4DQOL 2AKRB 1FE8L 3UAJD 2P43B 1DL7L 3KPMB 3QRGL 5C0CD 3PL6B 2X89A 3TV3H 5F8QC 2V2TB 3OR6A 3W0WA 1FL6B 2D4FA 1UYWH 4FQJL 1LO0H 3FQWA 4I5BB 4X8XA 5GISL 2IEPA 3EYSL 5KTEL 1R5VA 2LAAA 2VITB 2X4OB 3CDCA 2WBJD 4PJ5A 5SWSE 3RVWC 5EG6C 3TT1H 4B5EA 3F12B 3QDMA 1OL0A 2A9NL 1U8KA 2ATKB 1H8NA 2DM3A 2XKNB 4DGIH 3L7FA 4NYLB 3SOBL 2QSCL 4MA3A 3VFWB 4ZNEA 4L29A 1TJGH 1ZT4A 3MLRL 4M6OL 3HNVL 5GRVL 5E94A 1TVHB 3MLZH 4JFDB 5CUSL 1XF3B 4JPVH 5IB1A 2ORBL 3K81A 4OQTA 4BSWA 1QSFE 4GMTL 4ZUUA 3KPRB 3IDIB 3EDEA 4GMSH 2R69H 1S5HB 2ZOKB 4OD2A 1AXSB 3HC4H 1WIUA 1CFVL 1EZVX 3VG0L 5CSZA 3M8OH 2IH1B 4KGLA 4X0KA 1NGPL 5DJYB 5FYKL 4HS3B 1A2YA 4XNZB 1V7NH 4PRIE 2ARWA 2IAMB 5LXGL 4PRHB 4J7RA 2R29L 2HRPH 3JWOL 1GOGA 5B3JE 1AGBB 1BZQK 2VDOL 2XWJA 1R24A 1P7KA 1R0AH 3BP4B 5IEKA 2ADIB 3DTXB 5CGTA 3O0RH 2ADGA 4K3DH 2EH8H 5IBLD 4YFLF 4PRAA 3P4MA 4H88H 4XP5L 1NBYA 2NCMA 4I18A 4M8QA 1NANI 3GI9L 3FT3A 1CL7I 3C6LC 3CAFA 3G6JB 1W8NA 4WDIB 5J12B 5F1KC 4ZPVB 2D31A 4UAOB 4APQD 5TPWH 5EUOA 1KTDB 3O8XB 3BVNB 5EZLA 5JIPA 4P99A 2DI8A 5I76B 4TSCH 1ZXQA 4ZS6D 2V9RA 2W91A 5I8CB 2VQTA 3T0XA 3AS3A 2UUDK 4I0CC 2ERJC 4P2RA 3QYCA 4LEXL 1QFPA 5IFAL 3MRLB 3RX5A 1QSFD 3STZA 1JGDA 4YJZL 5D7IF 2HT3C 1IBGH 2DYPA 3M17B 5DJ0B 1FZMA 3S8WA 3F5WA 3H8NA 5B38G 1ITCA 4AIOA 4BZ2L 3RUGF 4PY7A 2NR6D 3BUYA 3NN8A 3O3UN 3EGSB 2CUMA 4PRID 1A6UH 1TXKA 4GBXD 3FTGA 4HC1L 4P4RB 3C8HA 4EN3B 3MBEA 1IAKB 2A0LD 4PJ9A 1EFXA 3BUTA 4JANB 2H2SD 5B22A 1BF2A 3QSKB 4X6FA 1WBYB 1LD9B 3DUSA 4LRNH 5HGGS 3C8KA 4JQXC 2YPVH 1P4LB 4MSWA 1F11B 1BZ9A 1NGQL 2K3TA 5E08L 1C16A 2AJSH 4PLJD 5HYEA 2Y6SD 4Z0XB 5DMKA 2BOCA 1E4WL 2MTPA 2AV7A 4LAJH 2HWZL 1D6VH 1TZHB 1U93A 5JNYB 4WUUE 1YYML 5EBGA 3BZFA 3S4SG 2DD8L 3CX5J 5JXED 3UTOA 4TQEH 1CI5A 4OBSA 4S1RL 5IBUG 1IGIH 5F72S 4XHJC 3QZWB 5B8CA 3ULUL 1XMWA 4H8WC 1S7QB 2D7TL 4M1GL 5JZ7C 4E5XA 5DVLA 3GMQB 4OKVA 4AM0A 3GFUA 5EC1A 3I3DA 4I9WE 1PX3A 3MA7B 3AAZB 3ULVC 4YEEA 2NXYD 5D1ZB 1INDH 2I9LA 5JOEA 5F7EH 5IQ9A 1P84J 1KCSH 3VXTB 1MOEA 4HIJB 4L8DA 1FLRH 12E8H 3IFLL 5F9JA 4TSBH 3U79A 4UIKH 1JTTA 3CFEA 4KQ4L 3SQOL 4HIEB 3T3PF 4I0PA 3U9UB 4M48L 1NLDH 2VN4A 4YXLH 5T1LD 5I1DA 3WN5C 5E6YA 3DETD 1BFTA 2PR4L 1ULVA 3I02A 4PJ5E 2ATPA 3U82B 4R4FL 1L0YA 4R7DB 4M3JA 2AQ3A 3QDME 4UDUA 1K9TA 4C56A 3PWLB 1S7WA 1CGWA 3DV6B 5ITBH 5ICZB 4JFEB 5FDWB 4ZNEE 3FOMB 4XZUB 1E6OH 4UILL 1LEGA 3HC0B 2IF7A 4XXCA 5INDB 4ZS7L 3AY4C 3QJHA 4WUUD 2DF3A 2P47B 1J8HA 5E9DB 5CJOL 2F53B 1KLUA 1UWGL 2YOCA 3BGFC 5DJAB 3MODL 4QXUH 3LSOB 1RMFL 1WCQA 1DP0A 3DYOA 3BDYH 1C7TA 1AD9A 2E7HA 3MRGA 3DGGB 4YXKH 4KHXH 1NGXB 3JVGA 1NANH 1A9EA 4QRQB 1CL7H 4TULL 2YA0A 4KVCL 1X5HA 5B39G 3FRUA 4W68A 4I9WD 2DQCH 4JLRA 2ITCB 4XWGH 3FMGH 5IHLB 5DEGA 2BMKB 4CKVX 1JHLH 1MREH 2EE9A 4S0SD 5IBLC 3NABL 5HYQB 2HKHH 3HR5A 2M2DA 3C60A 1DDHA 3CMOH 3EO0B 3DXAD 3R8BB 4LNRB 4L9LC 2X89D 2LU3A 2GUOB 3P4LA 4FTVA 3BKMH 1I4FB 1FNSH 3MRCB 4Y19D 3W0WD 1AH1A 5GGSB 1WBXA 3P2TA 2B4CH 1DVFC 4PJ7A 4PJ5D 2FX8H 4NM4L 3D39A 4WNQA 4O5LL 4PGJA 2EIDA 3LQAL 2ERJB 4R3SB 4M6AA 4ZYKA 3A0OA 1EGJA 3QDMD 1PYWB 3R06B 4F15C 2FJGA 1S7UA 1MCJA 4JO2L 1MRDL 3T77A 1QLEL 1SBSL 3G6AB 1CXEA 4I3SH 1BJMA 4MXVE 5F21B 1NC2D 5DGQA 3RGVB 4P2RE 4YIQA 2IQAA 4HJ0D 5C7XL 2NLJA 3SDCA 1BGXL 3BMVA 2BXZA 2QEJA 1OAUH 3MLUH 2NR6C 2R2HB 4RAVA 3VD4A 1A6WL 1JYXA 3BE1L 1OWWA 2J1KA 2Z0BA 4YHKL 1OT1A 1RHHA 2VDKL 4Y4HC 4GQPH 4J4PA 5J0BA 4U6YB 3FQUA 3LHPL 3O2DL 2H2SC 4CAGA 4LU5L 2F8XC 2M26A 3UC0H 5EO0B 1HHJA 2YPLB 3BRFA 1EX0A 2R2BA 4JGUA 1OARH 1GC1L 2OQJA 4R9HA 4NT6B 4TUKH 3OSKA 5GSVB 5GRVK 2Y23A 5GJSL 4WFED 4JY4A 3CPLA 4PLJC 2JJTA 1OF2A 2Y6SC 4XNXL 4FXGA 3LQMA 3ZKQD 3B9EA 1G9MC 1GGYA 4AIXA 4EI5B 4LSPL 4Q0XL 2R0WL 2VAAB 5BS0E 2EE6A 2AXGB 1BX2A 4HXBH 4NO0A 1VCAA 3EDFA 5MERB 1MIML 1MY5A 1WWBX 4XVSL 1CF8L 3LN4A 4HMCA 4PJXE 2FL5A 5KAQG 3HMXH 3LS5L 1KTKE 2JB6B 1CXLA 1JF1B 5FA4A 1LK2A 2DWDA 4WU5A 3BXNA 3FQNA 5TGBA 3VFMA 2V5TA 2H6PB 2NW2B 1A21A 3V0AC 4PJ8A 1M71A 2BRRL 5E8NB 5EPMB 4I77L 3VRIA 4WHCA 4Z76A 4LCWB 3K4ZA 4P2RD 3ABZA 2BSED 4QRPB 3D3VA 2YA1A 3STLA 3PXJA 1VERA 4CN1A 1MCNA 1ZA6A 1ZLVK 2V2TA 4JG0L 4WRLA 2D9QB 2EEBA 1KJ2L 2H2PD 2DYPD 4JFOB 2VITA 1IM9A 2X4OA 4ZUSB 1AGFB 1XGRB 3DRQB 3WIFB 3F12A 4ERSL 3TH4T 3WFCL 2AJUL 1MCOH 3L3HA 4QLRA 5A3ID 3MV8A 5JUEL 3ALXA 2NY5L 2UWEA 3WN5B 2GJ6B 2MMXA 4FNLL 3N1FC 3MBED 1FH5H 3DETC 1WSST 2BRQA 5DJDA 4H0GA 3RNQB 4PJEB 5C2BH 4PJ9D 5JR1H 4HS8H 1EFXD 3OV6A 3KPRA 2YPKB 5E2VH 2DIBA 2E9WA 5IUSA 3NPZB 4YDLC 4NC0B 3C09C 4WHTA 1FJ1B 5DK2A 3PGDA 2YD9A 1YEJL 4PR5A 4S1SH 1IGJA 2HH0H 1UJTA 5BOPA 3BGFB 4WFFE 3BN9D 1SVCP 5IMLA 1XR8B 5I73C 2QJDA 2IAMA 1OSZB 4GUPA 3B6SB 1J8HE 1E4JA 3OGCA 5F7DB 1KELH 2WWMD 4HSQA 3KLDA 5AD0A 3DTXA 3VXNB 1I3GH 2XNAB 3TVMB 1RIVH 3G6JA 4U05A 5BVJA 4Z8FL 1CLOH 1PQZA 4LGSB 3WNPA 5E95B 1R3JA 3WL9A 4M7JH 4ODVL 1OAXH 4L9LB 4AIZA 4MJ4A 3UTZA 5CWSA 5SWSB 1U8QB 4CVWA 1A6TB 3Q5OA 5ETUA 1NMBL 4XWOC 3ME0A 1HXMB 3X3FL 4WW1B 4NC1E 1U8OB 3G5ZB 1WK0A 4OM0L 2H1PH 1BVLA 5ECJE 4I0PD 3T4AB 3HNSH 1Q94B 1DQTA 4WFHD 5FF6B 1EAJA 4HUUA 4PGBA 4B41A 3AFLA 4K3EL 4NWTH 3CFBB 3D39E 4KJQC 3EYFA 5GRXG 3JUYA 1JGUH 2AABH 4C56D 1IEBA 4PRPE 1Q9LB 1YNKH 4U6HB 5HD8D 5KSBE 3AGVA 3DRTA 4GG6E 4WFFD 5MEOA 2G5BB 1T0MA 3EGSA 3S96B 4LKXB 4UQ3B 3L3KA 5D4QA 3JBG7 4RZCB 4ONGL 5AZ2H 4EN3A 1U8HA 4JCLA 1J8HD 5C07B 5HGAA 2B1AL 3ARDD 5GJTH 3RJDA 4Y4HB 4HD9A 1RUKL 2BVEA 1LD9A 1KB5A 1DBBL 2YD3A 4D3CH 4U1NB 4BSVA 1VADB 2VR4A 4RMSA 2W1NA 4MD4B 4KK6D 1OP3K 4EOWL 1F00I 3FO9B 3GRWH 3U30B 3I75B 2OTWA 1NCUA 1A4JB 1WTGT 3EJJX 5DJZA 1TZHA 5EWIH 4RISH 3ZDYF 4WO4C 4G6AD 1RAMA 3FKUS 4Q9RL 4OIIH 3QCVH 1DN0A 5I15H 3DV4B 5BV7L 3KPLB 4NNPH 4EQ3A 3OPZH 3C60D 2R0LH 5H94A 5F88B 1IGCH 5F89B 3H3KA 3NIGF 5IM7A 2FDBP 4FTVD 3BKJL 4M3KB 1NGYA 3NVQA 4X9IA 5EUOF 1S7QA 4GH7B 4BQBA 2FECL 5GRWA 4F58H 1FG2A 3D39D 1J5OH 3GBMH 4RFEA 2Q86A 3AAZA 1I1AA 5DWUH 3P9MB 5I1GL 1S8DA 3X3GL 5FV1L 2XZAL 2UY7A 4XNUH 5ESAA 5C9KA 1A7NL 4LPWA 4KMTH 4Z7VA 3ULVH 4LEOA 3D3VE 3MOQA 5D1XB 3HS0B 4HIEA 1UM4L 3SDCD 3IFNH 2UZXB 4LBEA 4JG1L 5DURB 1QFUH 2VLRE 3B8YA 1XEDA 4PGEB 2YC1A 4R7DA 5T3XH 3JV4A 3QXVA 3BEVB 3MV8E 4J4PD 4PJ9C 5DK3A 4RGNB 5EUKA 1YPZE 4YHIB 4YDLB 4TNVK 4X6BA 3JSSA 2NY3D 4TUJB 4F33B 2Y7QB 2A83B 3H42L 3OKEA 3RA7L 3H2WA 4OZGF 5JLZA 2EDWA 3PGFL 3OJ2C 5I73B 4XP6L 1I1YA 1TTUA 3BN9C 1I9RL 4HUWB 4YDJB 4NO0D 4OCWH 1CDBA 3UO1H 1HI6B 5HYSB 3RL2A 2NY7L 2W9DL 2VLJA 2R0KH 1HHKB 2ITCA 1BOGB 2BMKA 3RL1A 4FZEH 1GRWA 1T66D 3FT2A 4PJIF 3C87A 5ENWB 5HYQA 4BA8A 3BN3B 5J11C 3ETBF 4PJ8D 1MCDA 3EO0A 5ID0A 2PYEB 1GGCH 3SKMA 3D3VD 2VL5B 2GUOA 2BJMH 2ADJB 3V4VL 3VXMA 2LABA 3S5LG 1CVRA 2X7LA 3DMMA 4IM8A 1S7XA 4YE4L 1A6VH 5T1KB 4M6MH 1JPTH 4MAUH 4XMKH 3MV8D 4X98B 4MNQA 4UINL 4PJGA 3TC9A 4I0PC 4Y5VB 5D9SA 4JM2F 4UNVA 2WWKO 4OLZL 3HI5L 1TNNA 4WTWA 4P23B 3LEVL 3MXVL 3KPRD 25C8H 1C8PA 4KPHH 3UP1A 4JREC 2QQLH 3EJYC 4U33A 4FQCL 3WXWH 4HT1L 3BWUC 4XXCC 2VL4A 5DD5L 1T7VA 1A7QH 5E56A 5C0EA 3D87B 1K5NA 4JHWL 5HYJB 4ZOBA 2IAMD 3RVUD 5EO0A 5D2NA 1ZSDA 2EE3A 2MPAH 1J1PL 1KJ3H 5CILH 1K2DA 1YEFL 4XBEL 3JVGC 4KKCD 1DFBL 1MJ8L 4MNHB 4YBQD 4DW2L 3B9KA 1P4BL 4BK4A 4WWKC 1KXQE 2VZTA 1RJZA 5ESVA 2OJEB 4WO4B 1ORSB 2AXGA 1XH3B 2LTQB 5ICXB 3FO0H 3TWCH 4G6AC 4FQHB 4C83B 1TVBA 3G9VA 1G9MH 3U4BL 3WO3B 1QBLH 3C60C 2IH3A 4HS6B 4KRNA 3RX7A 3U0TB 4NC1C 4MJ5B 3A6CL 3VGEA 5CSBA 4MLSA 1D5ZA 3W82A 4NKDB 5EPMA 1KJMB 3G5YA 5TH2B 1UZ6E 4JM4L 4NQSB 4PJ7F 1K6QH 2OX5A 2OZ4H 3F8UB 2VXTH 4JGJA 5I1IH 1HE7A 2IMMA 2YBRA 4X7DC 5F1SA 4R4BB 3T2NL 1FFPB 1NBQA 5CEZL 3DRQA 1KN2H 3GJFB 3PWUA 4LLDB 4LSTL 2X9YA 4Z7VE 1DBAH 2V5YA 5CJQL 4H25B 4KTDH 3SDCC 5IW6A 3GEWB 3VDAA 4EN3D 1F42A 3QWOA 4G6JL 1II4E 1QRNB 1QSVA 1YC8A 3BPCA 1HNFA 1YQVL 4JFQA 1HDMB 2D0HA 3MMEB 5F7KC 1Z6JT 3KXFB 1E4XL 2IALA 4O9HL 4ZOEA 3KPQB 2X4RB 4GKSB 2XA8L 1JZ4A 5BS0B 3CVHA 4ODTL 2ED7A 1INQB 4ZPTB 1G7IB 1A14H 1FAIH 3OBAA 4PJXB 2AGJL 4HKJB 1RIHL 5FOJA 5C3LD 4YHOH 5FGBC 5H35A 3RDTA 4RRPA 3ARBA 1EO8H 1D9KB 4KV5E 4NJ9H 1QLFB 3ZE1E 3REVA 3HUJE 3NCMA 1GJIA 1GZQA 2D3VA 5J11B 1EXUB 3T2OA 2KQMA 1T66C 1J7VR 2VLJE 5I75C 5IHZA 4MVBC 1I1AD 4A6YB 4FQQA 3T0BA 1A6TA 4OSUH 4GLRI 1CLYL 1JMZA 3HZYA 1I9IL 5DHVB 1HXMA 5I9QC 1YEDA 3QAZC 3MLSH 4H20L 4EKXA 4QHLA 3TO4B 5C8JB 1JWSA 3GUTA 3O4LB 1D5BA 1UA6H 1UFUA 5D1QC 3T4AA 1P1ZB 4HWZA 3T0AA 1Q94A 3VXME 4G8FB 5FF6A 4ZUTB 1KBGL 3K1KC 4RMRA 3BIAX 4POUB 2MJWA 5FGCE 1KPRA 2G60H 2NXZB 2UWEF 1NLBL 3DIFA 3MLVL 2E7CA 4KK5C 4V1DA 2FO1A 1JBJA 3TESA 3I3BA 4EBQH 4MNQE 2ZSWB 2JK5A 3QHZL 4LKXA 4MJ2A 4DVBB 3RBGA 3QJFA 4JREB 4K55A 2VZVA 1KIQB 3JUZA 4PD4K 1BFVH 2DQTH 5C07A 4KVNH 3BAEH 3MACH 4HIXL 3HZVB 4L3EB 4L4TB 2RFXB 3HRZB 3DX8A 3MTRA 1ADQL 3X11A 5IQ7H 3RVTC 3ZDXF 2C1PB 3QEHB 4X7SH 3WHXA 3LIZL 2X41A 2V2XA 4RMTA 5IIEB 4MXQC 4OV6F 5ERWA 3KPSA 2BOBB 1NCCH 2IANE 3WJLA 3PV7A 3O3EB 3S3PA 1UZ8B 2VLJD 1CGUA 1YNLH 4Y1AE 5D2NE 4WWKB 1IVLA 3U4EB 2I5YL 4QHKJ 3WNNA 5B38A 43CAA 4FABL 3LRGA 1JF6A 1G7HB 1MFDL 3G6JF 3JTSA 2HTLD 4HFUH 4EIZC 5C0FA 2EKSB 4J23A 3HPJB 4KQ3L 4D0DB 4GAYB 5INCB 4ZNCD 1BZ7B 4Z78A 3IKCA 3VXMD 5CJ5A 1QTYT 2PKDA 4QHUB 2P48B 5EULV 4JGMA 1QSEA 3VXSA 3PWVA 4JFXB 4Y5XA 4HKZB 4JO4L 2CKBB 4JB9H 1XIWB 2GKIA 1R3IH 4LPCA 4MNQD 1IGMH 4YHZH 1HH9B 1SQ2N 5D72L 1TETH 4PRPB 4UDTB 3HZMA 5KSBB 2HT2D 1DTUA 5I71C 2EZ0D 2OSLB 2XZZA 1U58A 2PCPB 3HS0A 1JYNA 4L1HA 3E2HC 2DQJH 3QH3B 1ZVYA 1F4YL 4U6XB 2XKSA 4ODUB 3S4SA 3QXAA 2CLZA 3ARWA 4IRZL 4ALAL 3TNNA 3ZE0E 4KC3B 1PZ5A 1C5DB 4WHDA 3U9PL 5B4MD 1F2XK 2UUDH 4Z18A 4TNWF 4K94L 4HLZH 4WCYL 2ZSVB 1A5FL 5E24E 1EEYB 1VSCA 5FOBB 4OZ4A 1A7BA 2CLVA 3GB7B 2E6QA 1OTSD 1G6RL 4HUXB 2QHRH 3P73B 4KY1L 2EYTA 4ODHH 1S7SB 2R39A 3FZUD 3Q1SH 2PF6A 1ERNA 3GMMB 3B9KD 3EYOA 2BNQE 3VXPB 2UYLA 5EZJA 1JPGB 2QADB 4HUWA 3ZT7A 2V7HA 1PLGH 3GZKA 3TFKD 5HYSA 3T4YB 4YK4C 3TPKA 4OLVH 4XBPB 4NFCA 2EC9U 4R90H 2R0ZH 5F9OL 3W2DH 2XTJB 2PN5A 1BOGA 4QXGL 1N8ZB 4GLRH 3GO1H 4KJYB 1PKQA 1FGNL 4EUPG 1IFHH 1T5XA 5FHBH 3FRPG 5I75B 4XAWH 4NOFA 1JP5A 4HGMA 4XP4L 2ADJA 3FB8A 1I1AC 3CSYB 2C3HA 2AJXL 3G04B 3KGRA 4UI2A 3MJ6A 4PJFB 4A6YH 2IGFH 1J0YA 1JNNL 2MCG1 2X4UB 5T1KA 3NFSL 1U3JA 5DHVH 5D1QB 5T3XD 3DVIA 2NTSP 5GRYA 1WC7A 3Q2CA 4Y5VA 2VDPL 1DLHB 3GMNB 2RHEA 2NNAA 1KCUL 5B39A 5GGVL 1YPZB 1HKFA 1MUJB 2EIZB 3NZ8A 2HN7B 4MXWL 1T89C 4J8RA 3DLQR 4JDZA 1VGKB 5HDLA 1J0IA 3N50A 2VUOA 2VDLH 2FRGP 3FCTB 3QQ3A 4V1DE 3RWJA 3MRQB 4OF0A 4JN1H 4L3CA 3IDJA 3TBVA 2ZOLA 3WMSA 3M1BB 5SWQA 5CD3A 3QNZA 2IG2H 2WM0A 5I1LA 2BCKB 3PQYB 3TIEA 1GOFA 4XCFH 3MJ8B 3MZTA 4X4XA 5IB3A 4UB0L 3MCLH 4WUKH 2GW5A 4ZFGH 3RWIA 4ODSL 5AG8A 4MNHA 2X44D 5L9DH 1UACL 3RDTD 4JY6A 4FA8A 2FLBT 1LO2L 3ARBD 2P8LB 3B5GA 3TVMD 4R2GD 5EBMA 3VRLE 3OJVC 2AAVA 3FB5A 3KPSE 1B4JL 3U2SB 3ZHKA 3IB4A 15C8L 1MVUB 1DEEA 4JAMA 5HGHA 4P2QA 1FYTE 2XQYK 3RY6A 4WW2B 3U0TA 3VI4E 1CDYA 2OR9H 2IADA 1OGTA 4KKNA 3B3IB 4M62L 1M7DB 1I8KB 3G6DL 3KDMB 5DC9B 1J12A 4K23L 2ZCLH 4Q9QH 2E8YA 3BWAB 3MJ7B 3DMMC 3CFDA 5TE6L 2EKJA 1INEL 5GQBA 3OXRA 1VACA 3EYVB 1JNHA 1Y18B 3HE6A 1TPXC 1QSEE 5DJXA 4J3SA 3VXSE 1FFPA 2E3VA 1CFNA 2CKBH 3DX7A 3IJHB 1F8TH 3GJFA 4Z6AT 4V1DD 3FO2B 4AT6A 5ADOL 3E2HB 4PJDE 1G7LA 2Q7NA 2AERT 4ZTPL 4H25A 1M6OB 3IETA 4HQQH 5IT2L 5D7SL 1FNLA 3ESVF 1B0WA 5C07D 5ID1A 1FV1A 3KJ4C 5HHOA 5I8EA 5C0RL 5LAXB 5JORB 4P5TC 2QLVB 2D03L 3OKDA 4OT1H 2ZUTA 4LLMB 1OGAE 3SO3C 3BP6B 5DVKA 5KANI 1OM3L 1IARB 2GIYA 2ZUWA 5GGTH 1FL5B 2XN9B 4YAQB 3JWNC 2WIIA 4MA1C 3L5JA 2EDQA 4X6DA 3AS2A 5EOCH 5IMOB 5D2NC 3ARVA 1OTSC 5H2BB 3KPSD 4HWBH 3JV6B 2DOCA 4DQOH 1FE8H 3QRGH 1DL7H 4M02A 1ZEAL 3GSXB 1U95A 1VB9A 1G7IA 2C5DC 3T8XA 2E9IA 3TZVA 2ILLA 4NRZB 3B9KC 4AG4L 4NNXA 4FQJH 4K7PY 5GISH 5GRJL 1R5WA 5KTEH 1CE6B 4YK4B 1HHGA 4WI7A 5BXFA 1RULL 2A9NH 5DEZA 3KPTA 1QLFA 3W9EA 3SOBH 2QSCH 4NFDA 4OFKA 5L2KB 2H8PB 4BQ8A 5E5UB 1QYGL 4Y4FA 4M6OH 1H9VA 1QSED 3HNVH 3VXSD 5CUSH 5FUCE 4PGCA 5EO9B 3ES6A 2ORBH 2OBGA 3PWNA 3MRRA 4GMTH 3NH7L 5DHVA 5EOTB 5I2IA 4CNIB 3ULVF 4K71B 1LP9E 1CGYA 1CFVH 4YHYC 4YH6A 1IEAA 5HI3C 3VG0H 4E0RA 3MLYL 3CLFL 4JQIL 1SJHB 1P1ZA 2QKIB 4MDJB 1NGPH 4F9PC 5FYKH 2YD6A 4XNMB 4ZUTA 5FM5O 4H5SB 5LXGH 4O00A 2R29H 3DECA 3IAPA 4ZUVB 1QVOA 2NY0D 2KUTA 2CDGB 2DLFL 2VDOH 4HH9A 4MQ7B 3C5ZC 1WCBA 1XF2B 2OXGA 4PJEF 3SN6N 2W0KA 4OGAD 3S88L 4RGND 1T7XA 3BYTA 1MFAL 5DMYA 5JDSB 3MO1B 3GM8A 3FB7A 3H9SE 1FVEA 3GI9H 5IMMA 1KNOA 4QRRA 3EJZD 4F37F 3FHAA 4HPOL 4L4TA 3LKPB 5JW3L 1KG0A 3D48R 2XFXB 4KHTL 3C5JA 5FEBA 3RWDB 3X13A 4U1HA 4C4KO 5IIEA 1N2RB 4FRWA 5EBWB 4IOSD 1MHEB 4QF1A 1UZ8A 4LEXH 2R1XB 1GAFL 3WUWB 3CU7A 3K1DA 2O61A 3BOVA 3LQZB 3U4EA 1F6AB 2PTVA 4X4ZA 4OV5B 4DWHA 5CEXB 3CFJB 4R2GC 1GXEA 3VXQB 2CK0L 1MPAL 4WEBL 4BZ2H 4X7TA 4CBPA 1YMHB 5I16A 2AXHA 4OUUA 5TQ2L 1CT8A 1BQHB 4QHUA 3KPOA 5MENA 3O11A 3NGBC 4HC1H 2AS5M 4EIGB 2JB5L 1AHWC 4P2QE 1RURL 3I84A 5C2UB 5ANMB 2X1XR 4UNUA 3PG2A 2I07A 3FFCA 4O58H 5T1KD 1XGUB 1U91A 5DRZA 1U92B 2HJFA 3A6BL 1Y6NR 3V52L 5CHNB 3IU3B 1T6WA 3OG4B 3FB6A 3LPGA 1D6EA 5IMKA 2WAHA 2QQQA 1CE1H 2OSLA 4PRBA 2D7PA 5E08H 1XF5A 4P23D 1FSKB 4XH2B 2OMBA 4Q74A 3QH3A 5DUBA 4U6XA 4YWGL 1TVDA 3WO4C 2HWZH 3L3GA 3QXDA 6FABL 4NO5A 1WFUA 2BVQB 5EU6E 1QBMH 1YYMH 5DDHB 3AB0C 4MHHI 5GGTA 1C5DA 4R96A 2DD8H 4FQPA 2NW3B 4P5TB 4MJ6B 3R0NA 5F6HI 1NCWL 3MV01 1QFWL 4S1RH 4IEFB 4N0CC 5A43C 5HYJD 4KI5C 1EEYA 1KC5L 3GJEA 3SO3B 2R2EB 1S9YA 3FOLA 4YFDB 5B3JF 1BQLL 1SJVA 2IANB 1NC4A 3DX9A 3QHTC 3L3IB 1V3MA 4MA1B 5ACLA 4X83A 2D7TH 4Y1AB 3V6FA 4QGYA 3DSNA 3ZHDA 5HY9B 4K07A 1AD0B 3GMMA 5D5ME 4I48A 3GMRB 3WJLC 2R23B 1AJ7L 3D2UA 1HSAA 4N5ED 5FYJE 4LHUG 4X6DE 4YHLL 5K59E 4JR9L 6CGTA 3IFLH 4U1JB 5K9JL 1WT5C 2CDFB 3VRJA 1Z5LB 1RK0B 3HCVB 2R56L 4P2QD 4ZFZB 5MI0B 1JZ3A 3SQOH 2X10A 4XPGL 4M48H 4ZO8A 3F7YA 1J18A 1B6UA 3N1QC 4ONOA 2YSSA 5F3HA 4HK0B 1OP3H 4R4FH 2CRIA 3ECBB 5C70A 4KROC 2C1OB 2NY2D 5F3BA 3DI2B 5E03A 4ZFOL 2VLLA 3MRIA 1RVFL 4ZD3L 2AI0H 3GKWL 2PTTB 3HI1B 3MRMA 4Y5XC 1DCLA 1JV5B 3HE6D 1RK1B 3G04A 2FHCA 1X5ZA 4U7KA 4UILH 4YO0A 1HZHH 4Z5RA 3T1FB 4ZS7H 3QDJB 2AXFA 3VFRB 5I19L 5CJOH 2X4UA 1UWGH 1IKFL 2ZG3A 2R1WA 3C5SA 2YUZA 1RMFH 4LLUB 2IJ0C 5GS0D 1DLHA 3MUGB 1MQKL 3ARTA 3ILQD 3KYMB 4P2OC 3WIHL 3V79C 5HHOD 4RNRA 1JIBA 5D2LA 4TULH 1CDJA 1P5UA 4IDJL 2CIKB 5J6HB 5JW4N 4U3HA 4PP1D 3QT2A 1OSPH 1UYWL 1LO0L 2O5XL 3NABH 2BNQB 4UBDD 2GSIA 5DO2D 2GAZA 2NY4B 3SJVE 1C5CH 5JIHA 1AR1D 4LMQE 3TT1L 5IEHB 2BCKA 3GSRB 2X2YA 4KKLC 3OKNA 3TZVD 5EU5B 2PUQT 1FZJB 4QRRE 4HKBA 5IFHL 1H3PL 4ZXBA 3KWWB 1MCCA 3E3QE 4NM4H 2RAMA 2KPNA 3W9DB 2W60B 1NFDB 1NGZB 3MRJA 4O5LH 3LQAH 2FCBA 4N0YL 5HI4D 4KRPD 3TIDA 3VCLA 5EB9A 4F7CA 2AXJA 4JO2H 4F7MA 1QLEH 1SBSH 3UJJL 1OTTD 1CXIA 3U2SA 2Z8RA 1V05A 4LASL 3M8OL 5ICYB 1ES0B 4CJ0A 1RZJL 1EMTL 4WW2A 5C7XH 1Q9KB 1BGXH 3QFJB 5HHQB 4ZFFB 3CX2A 4M5YH 3PXHA 1U36A 3GMLB 2HRPL 4AEHL 5FK9B 3NGBB 4OGXL 1A6WH 3BE1H 1G1YA 5EU3A 2DLGA 3EDDA 1I8LA 3MV9A 4YHKH 2VDKH 2F19L 3LN5A 4HIHB 4ZSOB 3LHPH 2W0LA 3EYVA 5MENE 2Z92A 3O3AA 4YGVA 4Z7QF 1GC1H 3BZDA 1SY6A 1DN2A 3FFCE 2NX5B 3BP7B 5DJ6A 4FN0A 1UKQA 2YUVA 3FO2A 4IOIA 2DWEB 5GJSH 4R4NC 4P46B 5BV7B 2DB8A 3IFOA 4XNXH 2K7QA 4TSCL 4LSPH 5IG7B 4NN6C 4Q0XH 2R0WH 3AB0B 3E6HB 1I7ZA 4FQLL 4QRRD 2BHZA 1A9BB 1MHHA 1LMKA 1FNFA 4L4TD 1MIMH 3RPIB 4XVSH 1CF8H 2IPKB 1OQXA 2G9HB 1FL5A 2EDTA 2XN9A 1AP2A 4YAQA 4G43B 3LS5H 3WDJA 3F7PC 5H2BA 3JV6A 2BRRH 2FJHA 2J12B 1OAKH 1BBJA 4I77H 4PG9B 4CMHB 3PDDA 1S5IH 5CBEB 3SDAC 4GKOA 2MQCA 2WANA 1F4AA 3OAZK 2ITDB 4JG0H 1S9WA 1TIUA 1BEYL 3ZDZF 4NRZA 5HHMB 1A6UL 1FYTB 2FECI 1ZLSH 4N5EC 4N8PA 1CE6A 2CRYA 1MAJA 2A6IB 3UTTA 1VFAA 4ERSH 7FABL 1P9MA 3TA3B 3WFCH 2B5IC 2HFGL 5C0IA 3SCMB 1FO0A 4LRNL 3K4DA 4FQ1L 1QHPA 2NY5H 3G08A 4O51B 4N0UA 2K7PA 2EDJA 1W0VB 4FNLH 5L8JB 2DICA 4JZJC 1WITA 4BZ1L 1M7XA 1HH6B 5I66B 5IROC 1T03L 1ZV5A 4D0CB 2VXVL 2E5EA 2YHGA 5CD5C 1YMME 1KPVB 4O2EB 2AJZB 4HGKC 4PJDB 3ILPB 3HE6C 3GSQA 1RJYA 1LEKA 4P5MA 4HHAB 4WGVB 1IGIL 3X17A 1KIUA 3BPLC 3V8OA 1BIIA 1KT2B 3O4OB 4ISVB 4LSQL 1A1MB 4XMPH 1OGAB 5GS0C 4JPKL 1K85A 4J3UA 1RZGA 3REWA 5D7JB 3ARGA 4YDVB 5KAQF 1KLGB 4MAYB 5JDSA 1G7QA 4EDXA 5I8OL 1NC4D 3UTQB 3IF1A 1A4KB 4BSJA 4PP1C 4TSBL 5D2LE 4LVEA 2XY2A 4UIKL 3PF2A 4YDKH 4Z8FH 4HV8B 3VG9C 4OB5L 5C09A 5FYLE 5GZOD 4ODVH 1AR1C 2JIXA 4YXLL 3VI3F 3ZE2F 4JPIA 3D2UD 5DSCA 4V2CB 1NMBH 1EEZA 3O3DA 5BRZA 3X3FH 4PJXF 1KIPA 2H41A 2IBBA 2ARJA 1GGBH 4LF3B 4GW5B 4URTB 2R1XA 4OM0H 4BUGA 5ITBL 2XTJD 4QKXB 3QIWB 3V5KA 2DS4A 3K74B 5HI4C 3ARFB 3FN0H 3VH8B 2X40A 3OXSB 3SDDC 4Q9BA 1F3DH 4NHCL 3VXQA 1NMCC 5SV3A 4FFWC 4X6CB 5L2JB 4Y4FC 4QXUL 1I3VA 1YMHA 1IGFL 1JGEB 5ILTH 3HB3D 3O2DA 2FZ3A 4PG2A 1J05B 2B1AH 5DRNA 1M7IA 5DUMH 1U92A 1RUKH 3ZTJG 3L3JB 1DBBH 2GI7A 5J56B 3K3QA 4XWGL 4MX7A 1UKSA 2WP3O 1HOCB 3MV9E 1FVCA 5FCSH 3MR9B 1S7RA 3D69A 3H9SB 1T22B 4AMKH 1EPFA 5B21A 1MWAL 4JKPL 5D96B 3H6JA 2Q8BL 5E8OB 1R3LA 4G42A 5T1MB 2XY1A 4YEFA 4NN6B 4Q9RH 4R7NA 2BK8A 4F2MB 5BV7H 2NW3A 4LFHG 5KVGL 2R9HD 3PQYD 5CZXD 1S3KL 2X4PA 3SPVA 4N8VG 3E3QC 3BKJH 3MRPA 1SM3L 4JRYA 1CXHA 3NAAL 1TDQA 3B8SA 2HG5B 5F7HA 1X5IA 2LE9A 4ZXBD 1KJ2A 4ZDHB 1NQBA 3QFDB 1XGTB 1MCLA 1AD0A 5C0DB 1Q9OA 1RPQA 3SDAB 1CK0L 3GMRA 5I1GH 2R23A 3T08A 1TQCC 1OAUL 4MWFA 3X3GH 1BPVA 3GMPB 3KYKL 1A7NH 2KQNA 1VGEL 4U1JA 1ZKAA 5FXCH 1QPPA 2X4TA 3O81A 4RDQF 4ZFZA 3QUXC 3V7MA 5FO9A 1UM4H 2B5IB 3UDWA 4JG1H 4NDMB 5FIEA 3B9DA 4O2CB 4L9DA 4LCYA 4MQXD 4HK0A 1CDUA 3UTTE 4JZJB 3WLWC 3MV9D 2C1OA 5K9OB 2VISB 3K46A 3EZJB 4HKXB 4NO3A 3MUJA 5KS9B 5FYKU 3QO0B 4N0UE 1OPGL 1F3DJ 3VWJB 1EIBA 4FMFA 4RFNB 3GSWB 2VO5A 3M45A 3T1FA 3MRNA 4LGRB 4UU9B 3H42H 1GPOL 4LLVA 1BIHA 3BIKB 4PJHA 4ONHB 5T5FL 3CX5K 3H3BC 5IJVA 3BPLB 3C6SA 3PGFH 4XP6H 1C12B 3H9HB 3QISA 1E4XI 1S7VA 3D85B 3KYMA 2ICEA 3VGAC 1AO7A 3ULUD 2L7UA 4MNGA 1AGEA 5DT1L 4S0TD 2W9DH 2HMIC 2HYMA 4WFGD 2XN9D 4RAUA 4I2XA 1QO3B 3IAGC 1X3DA 2YWYA 1X5GA 2DJUA 1LEIB 4EUPA 1UJ3A 5D5MB 3WNKA 3FRPA 3KVQA 1P84K 5IEHA 3VG9B 3ULSA 3RWHB 1MCOL 4JRXA 4U3XA 1XGQB 4XPHL 1D5MB 4S1QL 1FZJA 2VZUA 4G7YH 4GRMA 4L8SA 4N68A 2PO6A 1YY8A 5JR1L 1X7QA 4KK8D 3IDXH 3WSQL 2CDEB 4GXVH 1GHFH 2GTZB 2Y36L 5C08E 2Q3AA 1QACA 4YE4H 1J10A 1DEDA 1TZIA 1U3HC 4WJ5A 4AL8L 3O6FC 4CU8A 3WDIA 5BRZE 3L6FA 3LEXA 2LU7A 2XPGB 3UMTA 3HI5H 4GKZA 3SDDB 4W70A 3DSFL 1Y0LB 3LEVH 1A6ZB 3Q6FB 1Q9KA 3MXVH 3QFJA 1F4XL 4HPYL 4PD4J 2B7DT 3T65B 3MBXL 1B0GA 1EH9A 1KGCE 2FR4B 1YY9C 4WENB 3UBXB 4RMQA 1KELL 1MCFA 1UB5B 4HAFA 4HT1H 5ISZA 5L8KB 1HNGA 5KSAA 4PJFF 1D3CA 4JHWH 1FYHB 5AUMA 4HIHA 4ZSOA 3VA2C 5IF0A 2H32A 3VE0B 5IVOA 4MMXC 2V5RA 1MCIA 3S34L 4XNYH 4NQXB 1ZAGA 4I3GA 4LHJB 2GITB 4IOFD 4BYHA 2DWEA 2ICWI 1YEFH 4P46A 9CGTA 5D93C 1OAXL 1YPZF 3ARGD 5DC4B 4X9FA 1DFBH 1MJ8H 3UBXI 4DW2H 3BMWA 3C9NB 1LK3H 1P4BH 1QEWA 2IBZX 5GZNC 5CLWA 3FQRB 1NKRA 2K9UA 3U46B 4E42A 3UYRL 4NHUA 5DRWA 5C09D 2JKXA 2VLMD 3U4BH 4Z0BL 5IWLA 2JIXD 3WE6B 4NZUL 2HAZA 1ZHBB 3MGOB 1MLCB 3DVNB 4G43A 4JHZA 1FIGL 3A6CH 4NWTL 1R3KB 3QEUA 3EKCA 1IQDB 5BRZD 4J3XA 1DUZA 1MAML 3LPFA 1JUFA 1CXFA 4PG9A 3H3PH 2I60L 4ZXBC 4JM4H 3P4OB 3VD7A 3UTSE 3DOSA 1TQCB 4JRYE 3LV3A 2NZ9C 4X9GA 4P49A 3L7EB 4Z7OF 5AZ2L 2DKUA 1DQLL 1KGCD 5CEZH 2RIKA 3Q3GB 3RWGB 3QUXB 3PWPE 4CADB 3N85L 1VFMA 3SCMA 5DRXB 4OTXL 2L4OA 5J06A 2YXMA 3KLSA 4LSTH 1G0DA 4WW2F 2FBOJ 4O51A 4B50A 5HGDB 1FRGL 2YD2A 1W0VA 5DD0L 2UV3A 2C3VB 5IB2B 5F93C 2JCCE 1XR9B 4G6JH 5CGMA 1ZA3B 1G6RB 3QIBB 4U0QB 2WUBL 3LRSA 1YQVH 5FGRA 4D0CA 3GSNL 1I8LC 2BVPA 5EWIL 1FORL 4KUZL 1S7TB 3JV5A 4LSSL 2AJZA 3MGTB 4ENED 1ZT1A 1E4XH 2WLZA 4R0LC 2R1YB 4LQFH 3OPZL 3V5DB 1HILA 2XA8H 4ZUWB 5E8EA 4ODTH 1SMOA 1BVKB 5SWZA 1ROWA 1JN6A 5IKCA 1MSPA 4P3CL 2HJKA 1C5BH 1J86A 3VGAB 3DVGA 2AGJH 4NPYA 4L4VA 4LPUA 4PJHE 3FO1A 3ARYA 4ODXA 4H8WL 3DNKA 3ULUF 1MH5A 4XB7A 4XNUL 2VR5A 2NY6B 3UTQA 4JRYD 1A4KA 4NO2B 1TJIL 3ROOA 1FDLL 1KEGL 1AO7E 4UOW1 5I8KL 3V6OA 4MNGE 1KJVA 1UCBL 4HULB 1DQQA 3B43A 3WS3B 4U1SA 1ZHNB 4M61B 3WIIL 3OTTA 3ORJA 2P45B 5TF0A 3QPQC 4I2XE 3VFPA 4OZFB 1UH4A 1CLYH 1RY7B 1I9IH 4M1CC 5FYJH 4TTGA 4H20H 1ZWIB 3T0WA 4LF3A 4U4BA 3PHSA 5DD1L 5BZWB 5GHWH 2ADFL 4ZAKC 2BNUB 2VN7A 3SE3A 1U3HB 4POYA 3AS1A 5E8PB 3DYPA 2CO7B 5JMOC 3HPLB 3KPPA 1P9MC 3O6FB 1KBGH 4G8GB 4LLYA 1JF5A 1EVUA 1QKZL 1FZKB 1G7MA 2MQ0A 3MV7B 4NNYA 3SDXA 3WD5L 4PP2A 1NLBH 1A6AA 3MLVH 4EQ2A 4X6CA 3DI3B 1YMMB 2WV3A 1I7TA 2DIAA 5AAWA 1FHGA 3L95B 4KJWD 4NKMB 5F7UA 2EO9A 3QHZH 2GTWA 1T0NB 4U6VL 4EJ1C 4A2MA 4BH7B 3F7VB 1MI5A 4OCWL 4X4ME 4F9LA 3SO5A 3QA3B 5IK3A 3ZKND 1NBZA 2CQVA 4HIXH 4JJ5B 4Q6IA 1U0QA 2EDOA 3L3JA 5IB5B 1U42A 4PJAA 3BT2L 3NIDE 2C3WA 1XGYL 1NDGB 1YEIL 2PYFA 1DBKL 2GFBB 3MREB 4K8RD 3LIZH 1NFKA 3MR9A 1AO7D 1U6AL 5TDNB 3VGGA 2BJML 4M93C 4CU6A 3QDGE 1F5WA 4IRJB 5EORH 2I5YH 3UYPA 3M07A 4FABH 4GRLA 3RVVC 4B0MM 1A6VL 3G9AB 3EFDL 4M6ML 2QR0B 3MRDB 4JRXD 2VDRL 5GS1A 4KQ3H 4LKCA 4HJJL 4TVPE 3PABB 1W0WB 3PGCB 5D8JL 3MUZ1 4TTDD 4WU7A 5J89A 1FNGB 1CVSC 2WW8A 5HVGB 4X5LA 3MLXL 4JO4H 4ELMB 4JY5L 5IVXE 4TSAL 4CVZB 3G5XA 4W4OC 5D72H 1KPUA 3WXWL 1CD9B 4OFIA 5L8LB 4IMKC 5LBSL 1DBJL 1AE6L 5JQHC 3QFJD 1IM3A 1F4YH 5JW4R 2BSTB 5LVEA 3EDKA 4IRZH 4ALAH 1KJ3L 4OZHB 3HAEB 5CILL 5HVHC 2GEEA 2X70B 5ISZD 3U9PH 1JWMA 5KSAD 2ZG2A 4L8CB 4KDTA 5KS9A 5ACZB 4WCYH 4NQEA 4X8JB 4HBCL 3LKNB 3VWJA 1J8KA 5K33A 1G6RH 1XT5A 1W2KT 4UU9A 3F65A 1CGSL 1X5XA 2A74B 1YC7A 4P46D 4ONHA 1RJLA 4LHUA 4N5UA 3GIZL 2X1QA 3H9HA 1B2WL 1CICC 3VXRA 3QEQA 3T0EB 2VRAA 3D85A 4NGHL 4KJPD 4TVPD 5DVOA 4TOYL 3V9FA 4ONFL 3D0VB 4I4WB 4NRXB 1NMAL 3OAYH 5SWZE 4QRUB 1RI8A 4LVNC 4U1KB 5I1IL 3IXTB 3SE4C 4QXGH 2B8OT 4IRSB 1UEMA 1MCKA 4DKDC 4L4VE 1RZ8B 1ZGLM 5HHXL 3UZVB 1KN2L 1FGNH 3CFIC 2AJ3B 1IC4H 3GSOB 4U1LA 1L9NA 1ZHKB 5DQJA 3EBAA 1XGQA 2GT9A 5E2WL 3V6OE 5EA0L 2A6DB 2D4DA 1RU9L 4QGTA 4PLOB 4RIRA 4OZFH 1LE9B 4DCQB 1K4DB 2P7TA 3LEYL 3D0LB 3KPNA 5A2JH 3G5VB 4ZAKB 1X5JA 3SCMD 2F54A 2NPLX 4C57C 4OLUL 4GRWE 5CIPB 5DJ2B 5J3HD 5FECB 3QUZA 2VDPH 3CMGA 3UDWC 1OQOA 1KCUH 3BGMB 5GGVH 3SGJA 5J1SC 4QXTB 4MXWH 3Q6FA 4MCYB 3QEGL 2CPCA 3O6KL 3KLHC 2FO4A 3JTTA 2Z4QA 3CVIH 2VKXA 4N8CH 1WUNT 4NQDA 3HFMH 4X5WB 1FNEB 2ICWA 3SDXE 4KJWC 1A7PL 4JFFB 4EXPX 1ADQA 2GK2A 2FR4A 2HFFB 1S78D 2WQ8A 4JEGB 1H15B 2BNRA 4K9EC 5J9PB 1UXSB 1UVQB 3ZKNC 3TCLB 5D7IA 3VGBA 4YR6B 5SWZD 2Y06L 2ZUSA 3IFPA 1MI5E 1LO5B 3IDUA 4UB0H 2MOVA 5F7YC 1T4KA 3IDNB 3TLRA 1IGYB 4BFGA 2IFFL 5IVZB 3RUGA 5L88L 4L4VD 4K8RC 4ODSH 1GZPB 4MAYD 1UACH 3PWJA 4OSUL 1JHTA 2GCYB 5HPMB 1LO2H 1DBML 2W65B 4N0RA 2W9EL 4HF5L 1X9QA 5E5RB 1KB9J 1B4JH 1MCBA 2AEQL 5K9KB 3UPRB 1UC6A 1E4KA 15C8H 1UJ3C 3KNBA 2J8UB 3QULB 5C0AB 4HUVB 4EVNB 5FYLH 1L6ZA 2WP3T 1MLCA 2VDQH 2VLKB 4M62H 3G6DH 5C08B 2MKLC 4K23H 2V9TA 1I85C 3L5WA 4OFYA 5JHLL 3P77A 4U1MA 3MLTA 5I74C 4CW1B 3ARRA 2MQ3A 4L8SC 1N3NB 1I7UA 1UXWB 5C0ND 2PO6C 5DLML 5DZNA 1NFDF 5EDXA 1INEH 1UGNA 3RZCA 1HQ4A 1JVKA 1MNUH 2DQTL 3RP1A 3RY5A 1GH7A 3Q3GA 4MJIB 4OQTL 1EDQA 4GO6B 4CADA 5ADOH 1OOAA 4L8BA 2XOTA 5I0DA 3HE7C 1MFCL 4ZTPH 5HGDA 1I1CA 5IT2H 3MNWA 4U6TA 5D7SH 1MI5D 5IW1A 3R1GL 1G6RA 2XXMB 4OF5A 1Z9SA 5MEPB 2D03H 4GQ9L 3HAEH 1OTUD 2XG4A 3CH1A 4P57A 1OM3H 2DL9A 1S7TA 4ZO6A 2I24N 1JZ8A 4YHML 2FLRT 2V7NA 1JWUA 2BP3A 1D7FA 4G9DA 2A1WH 5JPMB 4MDIB 1AIFB 4Z7WE 1QFWI 3TPUB 4FG6C 3NCYP 1U8MA 2DTSA 4NQEE 3AU1B 4XCEA 1ZEAH 1LDSA 5FUZL 3VXUB 4PLKD 5F9WC 3FONB 4P4KA 5DD6A 2AJVH 1CICB 5IV2B 3GDBA 5T3ZE 3QZWG 4AG4H 5DMGD 4CUCA 2PXYC 5GRJH 1BM3L 3QIUC 1FNAA 1ETZA 3GNML 3IDMA 4QWWD 4F57L 4GRLD 1N5YL 4E41E 4ODBD 4RX4A 1HHIA 1RULH 1FC1A 1R3IL 3VXRE 5EOQL 4KI5F 5IWLC 5DQDL 3IYLW 4LOUD 4ZFOB 4BKLB 2P5WB 5EO1A 1DE4B 1E6JL 3UJIH 3VXOB 2PNDA 5I30L 4PS4H 4BM7A 3HI6H 1NCTA 3LS4L 2P8MB 2X4NA 2FX7L 5CEZD 1N7MH 1NEUA 3LKQA 4G8EB 3AVEA 3NH7H 4RA3A 2EDDA 3PWPB 4LVHC 1E27B 5J8OA 1W72A 4JVUA 3MLYH 3RAJL 2CR6A 4JQIH 4M1DH 5GIRA 4NC2B 2JCCB 2JE8A 1FC2D 4OFDA 4ETQA 3MV7A 3CU1A 5E2TL 1CG9B 5J3HC 2DLFH 3Q1SL 5CBAB 2F54E 5CIPH 4YBLC 1FVDA 1CFSA 1J1OL 1HIML 3OAZH 4QRTB 5F7LB 1IJ9A 2ZUXA 4D8PB 5LGJA 3S88H 2J7LA 3TYFB 2HT4C 1AFVL 4R26L 3VWJD 2AQ1A 2GK0B 1KYOJ 4GS7B 4YQXL 4N90E 1MHCA 4OLYL 5CKAA 2DQEL 3QA3A 4PJDF 4OLVL 5DYOB 1MY7A 2XG5A 4IHOB 2CJUH 4LHUD 2C9AA 5JOPE 4UUJB 3GO1L 3QEQD 3D85D 4JZNA 1YEHH 4NO2A 2BNRE 2X1WL 4BZYA 3VJ6A 4FXKB 1X4YA 2QQKL 4XBGA 2OTUA 2XYCA 2EXWD 5CEYB 3UCRA 2VTFA 4IRJA 5E6IC 2EYSB 2DIJA 1RZFL 4KXZI 4PJBB 5ABDE 3OHXA 1QHOA 2HVKB 2EIEA 1YJDC 2BVUA 3RUGE 5CZVL 4QOKB 1MFNA 2CK0H 3WJJC 3O6ML 1MPAH 5JQ6L 4WEBH 4UTBL 1KTLB 4G8IA 1UQSB 4H1LB 1IEHA 1XF4B 3PABA 1W0WA 3KG5A 5TQ2H 3A67L 1BQSA 1XF1A 3IGAA 3WFHA 1GGIL 2JB5H 3EOTL 3HZKB 1RURH 1IMHC 4X7EC 1SJXA 3VDBA 3RIFK 2F54D 1KENL 3OJMB 3A6BH 4ELMA 3BDXA 5F8RC 1ZTXL 3TBWA 4XCNB 3QUZD 4OAWA 5BW7C 2D7MA 5JXEA 1YN6B 3L3DB 5CAYB 3E6FA 4AEIH 5CGYD 2NYYC 5D7LA 4X6CF 3TBTB 4YWGH 4NQDD 3VWKA 3HE7B 1I8IB 4G9FA 1K8IB 5EN2B 3JZ7A 6FABH 2FGWL 4XX1G 3WCYA 4OZHA 3HAEA 3HG1B 5JOPD 5J57B 2F5BL 3ZHLA 4YHNA 4NN7C 2BNRD 4L8CA 4OZIA 5ACZA 4N8VA 3OKLA 5L9DL 2C3GA 4LCCA 1NCWH 1T3FA 1QFWH 2Q20A 1KC5H 2VMFA 4Q6IC 3BHBB 2AK4B 4G6KH 4XXDB 5HGBB 3IVKB 4TUOB 3OZ9L 1T1ZA 4UMGA 3QDGB 2J4WL 4IIQA 3MRFA 3IU4L 2KL6A 4Z7UB 5EIIB 5F9WB 2F58L 5T1LA 1AJ7H 4UNTA 1O7VA 4YHLH 4JR9H 3T3PE 4D9LL 3QIUB 2J6EA 1AGCA 2WMPA 4LCUB 4NQTA 5IGXH 1IL1A 2APVA 1AGDB 5DMGC 2R56H 1GCFA 4NRXA 4DVRL 1RZIA 4GG8B 4XPGH 1CQYA 1P53A 1H5BB 1VA9A 2ED9A 5GS1C 1SYSB 3NZHH 4WY7L 2VB5A 5EBLA 4OFYD 2N7AA 3DO7B 4MB5A 5DJ8B 2BSRA 2VDML 4ZTOH 5IVXB 4LOUC 1T20A 1T7ZA 4MB3A 4F80A 1VEOA 1ZHKA 4K7PL 1NAMA 3KJ6L 4ZD3H 3GKWH 3BEWA 2FSEB 5C0GB 3RZCD 4XRCB 4MS8C 1E28A 3GGWB 4MMZC 5F9DC 3T0VA 4NUJA 5I19H 3L9RB 4ZO9A 3ROLB 3OKKA 4DCQA 1IKFH 1MJUL 3DROA 3WFEH 4NFBA 1PG7H 5ITFA 4PJCB 2YEZB 5DJ2A 5FECA 1MQKH 1HYRC 3DX6A 1DUYB 3EFFB 3VU2A 3PHOA 4K3JL 3WIHH 32C2A 1MEXH 2DLEA 4HGWA 5E2UL 3QIBD 4KUCF 3DXAA 2NQCA 4OCRH 4XC1H 1J0KA 1IGTB 4IDJH 1Q38A 1O0VA 2N56A 4KDTC 3EO1B 5KS9F 3VMNA 1S9XA 4Y19A 1OAZH 4MD5A 2APFA 1TQBB 4U2ZA 4JFPA 2O5XH 1ONQA 3CFKA 1F90L 3KHOA 5E00B 4OF3A 1H15A 2Q7YB 1UXSA 5HJ3B 4Y0GA 5J13B 3BH9A 5KVDL 4X5XB 5FV2A 2F8OA 3PIQA 3E1F1 5KN5A 2CXGA 4P4KD 4PV8A 5FFLA 1LE5B 4RRPG 5HHNA 2YRLA 5IOPB 3IDNA 5F7NC 1IGYA 4KXZH 1NC2A 1M05A 5IFHH 1H3PH 2FEDC 4F7TB 1P7QA 1DJSA 3Q5YA 3RNKA 4LRIA 5CP7B 4RX4D 4N0YH 4RAHA 2GCYA 3O9WC 2NY6D 5E6IB 2EXWC 4Y4KB 2W65A 3BDBA 1UM6L 3BQUB 3UJJH 1B88A 4JPWL 4Y2DC 4AY0A 4LASH 3THMH 5D5MF 2QHLA 1K4CA 5J4MA 3VMOA 1MELA 1RZJH 1EMTH 3QULA 4HUVA 3D5OF 4S1DC 1EEUA 2VLKA 3S3JA 3B2UD 4DKEL 1G7PB 5FO8A 4HAGA 2VJXA 5GSRB 1MIEL 3V95A 4AEHH 4OGXH 1BD2A 4KGJA 4U7SA 5I1AA 4CW1A 2DQHL 1FGVL 1AXTL 4H1LH 3SEPA 2OL3L 5F96L 3WLBA 2BVOA 2F19H 1YEEL 4JZOA 4I8DA 1BFOB 1IC1A 4Q2ZA 1SEBB 1N0XL 4Y16C 4U1GC 3MV7D 3TN0C 1MWAB 3N06B 4MJIA 5LJYH 1LWRA 3LKOB 3GIVB 1T1WB 1HEZB 5D70L 3TH2T 1DQML 4GAFB 2ZCKH 5IB4A 3B83A 1FL3B 4CVXB 4FQLH 4WV1B 4NN7B 4X99B 5D7LE 1KACB 2X1OA 4G9FE 4WI4A 1U3ZA 3TBSA 4YFEA 1CWVA 1UM5L 3BX7C 1JI2A 3O3BA 3MX0A 4RFOH 2D0FA 4YGAB 2VIRB 4FQXB 4QYOB 3QI9C 5IJKA 4JFYB 3TYGL 3AU1A 1HQRA 2JJUA 1AQDB 4EDWL 4Y5YA 1XCQB 5F1NA 3P9LB 4IRJD 3FONA 2X4SA 2UZIL 2P5EA 1BEYH 1JGVL 1B3JA 1IC7L 4Z7NF 1UB6B 3GMOA 2QSTA 5F7FA 4HH8A 4J2XA 3MRBB 4KZEH 3I9GH 1MLBA 4HUKB 4O58L 1WTLA 3CUPB 4OKDA 7FABH 1XZ0B 2HFGH 1PAMA 4JDVA 4FQ1H 1PY4A 2YD8A 1NDMB 3EO9L 1TCMA 3S35L 3DARA 4OZGA 5EU4A 3D25A 2G75A 4I0KA 1CE1L 5BJTA 3QUKA 3UROR 4YNYB 4BZ1H 1OB1B 2FJFB 5HI5C 3AREC 1T03H 2VXVH 4S11A 1TNMA 3EOBA 2XZQL 5HBBA 2H9GA 2Z31A 1QBML 4X4YB 1IKNA 1E27A 2HLAB 1QQDA 1T1XA 3RZCC 2FIKA 2YD1A 5AYQA 4PRNB 4G80B 2VXSL 3OX8B 4N1EA 3WIHA 5D7LD 5DF0A 1CD1B 2XI9A 3WS6A 3EYQD 4PJIA 2HVJB 4G9FD 3VWKD 2W38A 5IFJB 1NGWA 4LFHD 4LSQH 3CC5A 2B2XH 2VAJA 3LB6D 4JPKH 4MA7L 4F7EB 5CBAA 3A6OA 4JDTL 4BH8A 1HHHB 5L0QC 3WXVL 3TYFA 2EDRA 3UAJC 4QHNA 1IILE 4Z7WB 4NQCB 4ZOCA 5I8OH 1K8DB 1G7JA 3AXLA 4OJFL 5I17B 1CFTB 3DXAE 3BKYL 4P3DB 2Q6WA 2Z91B 4M6NL 5HYSG 4OB5H 3TJHD 3BSZL 2WBJC 4BFIA 3OKOA 1YNTB 2FIRT 3W0WE 4Y19E 4JM2A 4WI9A 4UUJA 1P4IL 3T0ED 3P40A 2C7UA 3MRKB 5FB8A 4P4KC 4MQSB 4YHPB 1ZLUK 1SJEB 4JKWA 5GRUL 4HW6A 1R3HA 4OQ1A 3R8QA 1AQKL 1GSMA 43C9A 2NTFB 2AI0L 3O9WB 3HLAB 4B7IA 2Y5TA