5ISZE

Crystal structure of ls01-tcr/m1-hla-a*02 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
IGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAAGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIFGQREQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8(+) T cell epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 57
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszE02
3WCYA 2KBGA 5K9KB 2COQA 1HI6B 1OAZH 3ARGB 1N8ZB 3PGFH 1J8HA 2DLFH 2IPTL 5JOFA 2VITB 1T4KA 2YC1A 4N0FB 2F58L 2Z35A 1VACB 1NMCB 3QEUB 4XGZB 3SKMB 1XF5B 5C0EB 1CZ8H 2Y6SD 5LCVH 2YD4A 3FO9A 4HHAB 2MPAL 1AGEB 3NIGF 4EIZC 1MHPL 3A0OA 1S7XA 4OZFH 1Y6KR 1DVFB 2J4WL 3DVNA 4PTUB 4NRZA 4OFYA 2J2ZA 2ZSWA 1Q9WB 3RY6A 1CR9L 1DFBH 3LEVH 4OQTH 3SKOA 1BVKA 1IGJB 1U8OB 5DHVH 5LAXA 1ES0B 2Y9RT 5E5MB 4XP9L 1SQ2N 1T5XB 4AIZA 3PWNB 1YYMH 2CGRL 4M5YH 3P0YL 3SCMC 3UYPA 5IFAL 3U1SL 3MV7B 2GTZA 3VXQA 3WDIA 1DQJB 4Q97A 3MUZ1 4ZOCA 1KJ3H 2AQ2A 3WLBB 3UDWC 4FQXB 4BQBA 5GGVH 1EO7A 3K8LA 3SDYH 1IT9H 1JRHL 3FRUA 5TPWL 1N64H 4ZUUB 2X4OA 3V4VH 1XGYH 4YDLB 3ULUD 2EDRA 3O6ML 3MRPB 5ADOH 4RGMC 4Y16D 1J05A 3BIKB 2LVEA 5AG9A 4UDTB 1M71A 1IQDB 4RAHA 4PJ9D 4Y19D 4JRYA 4QRRB 4IBLT 2ATPB 2XQYG 3QDHA 4JN2B 1C12B 3JZ7A 1MRCL 5J1AB 3HA0A 5E8PA 3UTZB 4JZJB 5BMFH 1U8NB 5LGJA 4XAWH 1IGCL 3LKQA 3P73B 5E56A 5ESVB 4XTRD 1U8PB 1TJIL 3GIVA 4XNXH 4CVXA 2XRAL 1J8KA 2BK8A 4JVWA 5D7SH 4OF6A 3UJTH 4LVNC 4OB5H 4KY1L 3NCYS 3ZE0F 3FN0H 1X5FA 3U4BL 3V0VA 5FUOL 5DGQA 5DLML 5A3ID 4LEXH 4OM0L 1MF2H 5TQ2H 3KPRA 3VXNB 4U0RC 2XKNB 4MXWH 4YR6A 4OFVA 3NZ8B 3HB3C 3CVHB 1SYSA 4HGWA 1HZHH 4PUBL 4ETQB 1T66C 1RVFH 2BOCA 2FDBP 4DOHB 2BOCB 3VD7A 5K33A 4ETQA 1F58H 1SJHB 1VCAA 1WAAE 4HGWB 4QRRE 1SYSB 5E95B 3CVHA 4C56A 4JREC 1H3GA 4YR6B 2WNGA 2KH2B 4MXQC 3BGMA 3KPRB 4Y4FD 2HH0L 4NQCE 3QUML 4Z0BL 3PWPD 4E42B 2APBA 3EFFB 3TIDB 3OAYH 4FQ1H 3NFSL 1LGVA 2AXFA 4Q6IB 4BKLB 5JW4M 7CGTA 2W9DL 3ULVH 4CVXB 4JY5L 3GIVB 4W70A 5E99L 3P73A 1AKJD 2DKSA 3ARDD 4X8JB 4PLOB 5LGJB 4R0LC 4I9WE 1U8NA 5GGSY 2YD8A 1IEBB 4F8QA 4JO2L 3UTZA 5E8PB 2QTEA 3CC5B 4JN2A 3U9PH 3PE9A 1OTUD 4BQCA 4KZEL 1WUNT 4JRYB 5SX5K 4HCRA 3WHE1 4KK8C 1IQDA 1M71B 4UDTA 3SN6N 2IALB 3MRPA 2NTFB 4P5TD 3LDBC 5EULV 2Q86A 2YWZA 4QKXB 4TSBH 5I8KH 1UWXK 4XZUB 1AR2A 4FQXA 4IMKA 2HLAB 5BV7C 3U7WL 1JNLH 4W68A 2CO6B 5EOCH 4L5FH 5C07A 1VADB 4RGNE 1LO3H 3U79A 2DRUA 4PJAA 2EYSB 1CFSB 3Q5YA 4P0DA 3UTTA 1GVIA 5INDB 4ETYA 1KT2A 4EI5A 5E5MA 2NX5E 1ES0A 4WEUD 5LAXB 2HT2C 2IJ0C 4X9IA 1BVKB 5EB9A 3SKOB 3W81A 3WXVL 4R4ND 1EAPB 1V3JA 3QDME 4XVUC 2BMKB 1Q9WA 3G6JE 2ZSWB 3HAEB 4ZMAT 1ZGLP 3LS4H 5I1HH 1JYNA 1DVFA 1MI5D 1G6RB 3MRBA 3UO1H 1S7XB 3LB6C 4HHAA 1EEQA 4LHUG 3FO9B 1QFWI 5EOCJ 3T1FB 1XF5A 5C0EA 1AE6H 3TVMD 3V52H 1A7QL 4N0FA 2VITA 3PHSA 3THML 5FYJL 5JOFB 3RL2B 1EJ6A 3KGRA 1HI6A 1CZ8L 5K9KA 5FOJA 1MIEH 2XZQH 4J3SA 5F89A 4YX2L 1HHIA 4AT6B 1DR9A 3MCG1 5J12B 2PF6A 1OAZL 1RUPH 1C1EL 3AM8C 1FAIL 4M1CC 3O6FC 2YUVA 4QNPF 1AQDB 1QNZH 1ZEAH 2KZWA 4HSQA 4HXAL 3UPAA 2FIKA 3MREB 2D03L 3RVTC 12E8L 3E0GA 2YHGA 4X6DE 3M07A 4G8GE 4OCSH 4E41B 3OQ3B 3S34H 1NUDA 1LWRA 2UZIL 5HPMA 3KXFB 3FFCB 3VE0B 1T2QL 4EXPX 4IEFB 5TFSH 5ISZE 3MNVA 1JGVL 5GHWL 3SE8H 2WM0A 1TZGL 3BESR 4BZ2H 5DMJB 1IKNA 3RY4A 1I7ZA 2YN3A 1I8MA 1MFBH 1FN4A 1KC5H 3FN3A 4ONGH 2AGJL 5EZIH 3FO0H 4M5ZH 3IDMA 2R0WH 1OTTC 4R26L 3SHSA 1RHHB 1Z9SA 3MA7B 2OTWA 4X4ZA 3T65B 2DBJA 2Y7QB 4OCXH 3LVEA 5HHMD 4EZMA 1WZMA 5FO7A 1J0IA 3WFZA 3WFCH 1MELA 1TJGL 4RFEB 4WV1C 2HJFA 3PWPA 4QGTA 1IM3A 1KIRB 4JPWL 3RKDD 4UOW1 5T5NF 2R4RH 3P11L 5MHSD 4TSAL 3ULVF 4P57A 3RPIB 3QPQD 2VH5L 5BO1H 4PJXB 5I18H 4X6FA 2JLLA 4ZXBD 1J0KA 5IMLA 5JW3H 4HS8H 4R2GB 1AKJA 3ARDA 1CT8B 1R3JA 3QO1B 3WYRA 2FL5A 3RWDB 3QI9D 4HJ0D 4J8RA 1CFQA 1NJ9A 2XZCL 3HPJB 1CG9A 1H8NA 3FT3A 2MSPA 5H8DA 5C0AE 5MEPA 3D6GA 3EYSL 4X98B 1FNEA 4I8DA 4ZFGL 4CL7A 3CLFH 3O4OB 3FT2B 5JLZB 2OCFD 1Z9OA 4NRYA 1CN4A 1NGYB 2ICWB 1QOKA 3C6LB 5IFJB 3MLUH 2FYYB 3O3DB 4H1LG 1I8IA 3O3UN 3IFNH 2AJUH 4CDHA 1G7MB 3K7UA 4M3JA 4X6CA 4NQSA 2R1XA 5E9DA 3ZTJG 1F45A 3O2WL 3ULUL 3DROA 4M9OA 1FV1A 2NX5D 2NCMA 3KXFD 1F6FB 1MCSA 4DN3L 2RFXA 2BY1A 1KJVB 5FCUL 2PO6A 5DRNA 2YSSB 3O11A 1JNNH 4PJAF 4PTTA 5JQHC 2YD1A 1ZV5A 2OR9L 1BWMA 1I9IH 1FNGA 1IGML 1BEYH 1HDMA 2VLRD 4W4OC 3OKNA 1IC5L 1UCBL 3BP5A 2ZKHH 2XV6B 1KPRB 1OAKL 2GJ6E 5ECJE 4M7ZC 4F80A 3PWUB 4HBCH 2V7HB 4JFFE 1ADQH 2D7OA 3O9WC 5JIKA 1RMFL 3L9RB 1Q0XL 2R4SL 5FYKH 3O8XC 3GGWA 5LGHH 1BX2B 2Y5TB 4GRWH 3K4AA 3KPNB 4D9LL 3QA3A 4GBXC 4WFHD 2F53A 2XPGA 3U0WL 1IM9D 4CW1A 3TCLB 1F4AA 1MEXH 4NWUH 1P4LB 3BZEA 1OT1A 3EO1B 3KLAB 4IHOA 2J5LB 3BKMH 3NIDF 1A7RH 4G6KH 3U30C 1BBDL 1ZAGA 3KYAA 5FV1L 5IW1A 1F6AB 5DJ6A 1QSEE 4MDJA 1QBMH 2A9ML 2EDNA 5J3HD 1FH5L 1A9EB 4YHNB 1D5XA 2HVKB 5IT2H 4RFOH 1AXTL 4OQTA 2ORBH 3HC3L 4YHMH 5EH1A 4XX1G 4LNRA 3ZTNH 3W11C 3SGDI 1MCNA 2BSSA 2I26N 5LBSL 5GPRA 2Z92B 3LS5H 3RHWK 4JQXA 4FFVC 5IVXE 4U6YB 1HYSD 4XNZC 2RIKA 3V8CA 4GG6E 2CKBA 1E4XH 4UT9L 4G9FB 1QVOB 4KKLD 1ZLSL 1BIIA 1TVDA 4N8VG 2YD2A 4WENB 3VFOB 5KOMC 3K0WA 4XMKL 4XH2B 2FX8L 2DIJA 5C0IA 2QSCL 1B0GA 1K4CB 5L2KA 4HFUL 5F6HI 1JZ6A 4X99A 2D4DA 5DJ2A 1CLOH 2R8SH 1AXSB 1C7TA 1KB9K 3VDBA 1MWAA 1P4IL 1RJLB 5BRZD 2H1PH 2I9TB 1UWGL 4KDTA 4MSWA 5C0AA 4M7LH 3EGSA 4JR9L 4ZS7H 5MP6H 5EA0H 1CLZL 4TSAH 1K3IA 1MHCA 3JWNC 4WU5B 7FABH 1JE6A 4ZTPH 4JPWH 4LEOA 3T0EA 4J2XA 4PYHA 4HGMA 1P9MA 2OMBA 3GMNB 4XP1L 4HIHA 5ANMB 1A21A 2YWYA 1ONQB 4PJEA 1KTKE 2IMMA 2VKXA 3K4DA 1FCCA 1UXSA 2EH7L 2CMRL 4IS6B 3QI9A 1YQVL 3FFDB 3QDMD 4O2FB 5HHME 1RZJH 4M6AA 4TPRL 1KLUA 5BXFB 3BYYA 2NY3D 1WBYA 2FB4H 3FJTA 3V79C 1UVQA 2IH3A 1N4XH 1QFHA 2APVA 4XNUH 3C6LD 4EEEA 4I2XE 4GG6B 3EO9H 3AUVA 5IESL 3EFDH 1MWAL 2JJWA 4QHUA 4J23A 4XT1C 1I1YB 5E2WH 2WBJC 4P2OB 3M17B 1RU9H 5F7WC 5DJCA 4XBGA 4JZOB 1U3HA 1BD2B 1GSMA 3VFUA 2M8XA 1R3HA 3L3DA 4LHUD 3UZQA 1SMOA 2VDRH 3BKCH 4NM8H 5F7EL 3QUYD 3L3GA 3HNTH 5EUKB 3O3BB 2ZCHH 4OZHE 1JPFB 5T3XL 1VEPA 2NW2B 1TITA 4NUJB 4PRPB 4R97C 4JEGB 4PRBB 4PJ5B 3JXAA 3DHJA 3VH8B 1T03L 3GSRA 3C5ZA 1MVUA 2VLRA 5E2UL 4X4XB 3QIWA 1FZOA 2G5RA 4LRNL 4JDTH 5KOVC 3DBXA 4YX2H 3MBEB 1A7OH 3HI5L 1J86A 1AFVL 3G5XA 1G7PB 1CDBA 1EAJA 1FORH 3VXSE 1KG0A 5JTWA 5E7FA 1U8KA 4GAFB 4M6NL 2DLEA 3OJDA 4M1GH 5GRUL 3TBVA 2HKFH 3C87A 3MGTB 4GW4A 2M26A 3DVGB 2HFTA 4WO4A 4OF8A 1AE6L 4PJIF 4I18B 4V2BA 3OR7A 2VRAA 4GLRI 1LDPH 4UB0L 3GIZH 4LCIH 4GRLC 3TH2T 1UFUA 1ZT7B 1WWCA 4PRHA 4ZO7A 1DBBL 4G9DA 5DVOA 3WHXB 5EPMB 5HGDB 1QD0A 1T2XA 3PGCB 4QHMB 3VXUB 2W91A 4IRJA 3SKNA 4HMCA 3GMRB 1KCVH 2EYTA 4Y2DC 1E4KA 5CD5C 3PP4H 4KHXL 2BSRB 3MR9A 4FP8L 2F54A 4JFOB 4YXHH 4NT6A 3BP7B 1P7KB 1BWWA 3WL9A 4R3SA 4DKFL 5HDBF 2VLJE 2BOBB 4P4RB 4WJ5A 4S1RH 1P6FA 4I48A 2DL2A 2GJJA 4XVTH 4N8VB 1T80A 3CX2A 4KK6C 5CIPB 2OL3B 5D6DA 3BE1L 4R0LA 3SO3B 1MFAL 5TE4H 4LOUD 1PKQB 3PJSB 4HPYH 5HDQH 1CWVA 1U93B 4JKMA 3JV4B 2ADJA 4DWHA 3DUUA 3ALWA 3KPSA 2MWCA 3RUGF 2IGFH 1ULVA 3VRJA 2EDJA 4PREB 5SV3A 1D9KC 2VIRA 3IVKB 1WK0A 2YUWA 3CCHA 4FQJH 5DQ9B 5FDWB 3RWIA 3U9PL 3OTTA 5I6XB 2Z31D 2DYPB 5GGUB 1Z2KA 4FZEH 4HCRH 2AP2A 1HEZB 1QQDB 5J11C 1T1WA 1K2DB 3BH8B 1LO0H 4GMTH 4OLUH 4F7TB 1NGQH 4FABL 3IU3B 2JIXB 5DJ0A 1KPUB 2I60L 5C1MB 4IRSC 3ULVL 5IBTH 5D1XB 1NBZB 2Y06H 1ZMYA 1RUQL 4OIIH 4UIMB 5CILL 2QQLL 4LMQI 2MHAA 2IAMA 3WD5H 2GCYB 2W59A 5I1EH 2NY0B 3N1QC 1QEWB 5FGSA 1NKOA 2LU4A 4Z0BH 2DMCA 4XC3L 1NEZA 3RNKB 1H3PH 3OMZA 3IJSB 4JG1H 4YHYC 4YDVB 3LKRB 1QHOA 3D1MC 4FFZL 4L8BA 1QBAA 3GBNL 1KPVB 2A6JA 4TOYL 5GS0C 2HJKA 4X80L 3T0AA 4P23A 1DLFL 4YHIB 5HI5D 3GSUA 1G7IA 4OZGA 5SX4H 2CSPA 2DJSA 4ZFOL 3CFCL 3Q6FA 3S5LA 3QXVA 4EDXB 4U1NA 4YZFF 1NFKA 4AQOA 5CJ5A 1IZJA 1CTNA 2VMFA 4P5MB 5KW9L 5MEND 3KYKL 1MF2L 1MLCB 1QBBA 4JY4A 5A16A 4UBDD 4LEXL 2D0FA 2VLLA 1DEEB 1P5UA 3L3JB 4X5WB 1EHLL 4OD2A 2QEJA 2R9HC 1D3CA 1WQVT 3D69A 2DQDH 3V4UH 2AQ3A 2I9LB 4MCZA 4ZUVA 4N0UA 3UZVB 4OZHF 3B5GA 5TF0A 4DZBB 4U0RB 5DJYB 4QXWA 1X5YA 2ITDA 2GJZA 4OF3A 5HHPA 1WICA 1OCWL 4KPHL 2J6EL 1P7QD 1V7NL 1OAYH 3IYLW 1I7UA 4M8VA 5GS1C 4YWGH 3EDFA 2BVQA 4LLWA 3WE6A 3P0GB 5C0DB 2B4CL 4U7MA 2NZ9D 4K3JH 3NIFE 4YBLC 5FEBA 1BJ8A 1UB6A 3WO3B 1DLFH 4JZJC 1QRND 3BXNA 5JXAH 1TCRB 3PNWB 4YXKL 1GZPA 1DDHA 2I5YH 3FB6A 3SCMB 1Q94B 3CU1A 1JK8B 1S5IH 4RGOH 4JFFD 1G7HA 5JORA 4FN0A 4G7VH 1H3PL 1PGRB 4ODWB 2EDYA 4PRHD 2I25N 4UMGA 3CAFA 4KHTL 4HV8B 1WIOA 1U8IB 1LO5A 2ARJA 4LSRL 5CILH 4I4WB 1T0NB 4I3RL 2R0LH 1OARL 2HJLB 3QWOB 4WCYH 3TZVD 3IB4A 2FD6H 4OT1H 4XB7A 2FJHA 4J6RH 1GGUA 1RURL 1TMCB 1MOEA 1CICB 2VAAA 4JPKL 5T33L 2OS7A 4OLWL 2Q76B 1HHHA 1MAKA 3MQIA 4KMTL 1UB5A 3C9NB 4NQED 4RMTA 3O6FD 3MUY1 5E2TH 4Z95L 5IMMB 2DQGH 3TBTB 2OJZH 2Y5EA 4HIXH 1N2RA 2P5EB 5CBAA 2NY5C 2BVOA 5C8JA 4MJIE 3D0VB 4JB9H 3ARGC 1G7LA 1YNKH 1DSFH 1HN1A 1UM5H 2VABA 4PJCA 3NGBB 4GSDL 3JWOC 4E5XA 4XCYA 3DXAA 3RTQA 4QF1A 3D25A 4MQ7A 2J88L 2UVFA 2XA8L 3DOSA 1SM3L 5C92A 5HI3D 5DJXB 1J12A 2X89D 3L5XL 2MCPL 1TETH 1AIFB 4FXKA 4E41D 1NUFA 1DQQB 1O5DT 4FRWA 3T4AB 1VSCA 3AAZA 2YPLA 4MD5B 4YXHL 3DI2B 1YNTB 4FP8H 5SWZA 1A6AA 2NY1B 3PP4L 4JFDE 5HVGB 1HSAB 4J3WA 4ZTOL 1J0JA 2MFNA 2DQHL 2FHBA 3BEVB 5DD0L 4F2MA 4UT6H 3RBSA 2F5AH 4YDIL 3MRMB 2V5MA 3U9UB 3IKCB 1E27B 5BS0A 4JFED 4Q0XH 4H0IA 5DURB 2F5BH 4P46B 1EFXD 1S9WA 3IGAB 1BVZA 1MUJA 2AJ3A 1GGIH 5E5UB 3HUJE 4JDZB 4YNYA 3P2TA 5F9AC 1LEKB 5EFIB 4H1LA 1AR1C 4P2YA 3L6FB 2E7LC 3VGHA 1AC0A 2MCG1 4X5XA 5H2BA 3EO0B 3FMGH 2NR6D 3VI3E 1HH9B 3QFDB 3MRGA 1D5MA 4PGJA 3TYFA 1F3RB 4QT5B 3D85B 3I6GB 4EN3C 3QDJB 4HG4K 4HPOL 4PP1C 3AS2A 4G8EB 4JFPB 1AP2B 3PXHA 3QULA 4R8WL 1X5JA 3X14A 2ENYA 2CJUL 2NXYB 2ZSVB 4Y5YC 3LPGA 1Q8MA 1F4WH 1CICD 3WIFA 4NIKB 2C1OB 4BUGA 5FUCC 1P7HL 3SDAC 2ESVA 5TE7H 1FVCB 1JTOA 3K1KC 2E6PA 3LN5B 3P4MA 5FGCB 2R56H 3QWRA 2NMSA 4HJJL 4KKBC 4PJ7A 4OD1L 4PRIA 8FABB 4R4BB 1FAKT 4G6FD 3D39A 5ACZA 4G80B 3DRTB 5EUOA 4L8CA 4R6UA 4MWFB 5HDBE 2VXUH 4P5TB 1KLFA 1I4FB 2VAJA 3JUYA 4M61A 1QRNB 4TSCH 4YHPA 5DUBA 3RY6C 4Z8FL 1EDQA 4HWEH 3G08B 4Y1AA 3AB0C 2HFFA 4N9GB 4GLRH 5J6GA 5D2LB 2X9XA 4Y5VC 4PJGE 1U2HA 3U46B 5JHLL 2XIDA 3PP3K 4EQ2A 1EMTL 3HC0B 3O8XD 3L1OH 4HULB 3SDDA 4NZRH 1Q1JL 3MLRH 3D3VB 1KNOA 3LHPL 3VFMA 3N1FC 5EC2B 2HVJA 5AD0A 1EZVX 2CJUH 2KKQA 4PB9H 2YOCA 3LD8C 1U91A 4M7LL 4L3EA 5C2BL 5IM7A 3VA2C 1JGEA 2X70B 3KDMB 1D9KB 3TJEH 5F9OH 4BFGA 1YJDL 2B0SH 5J6HB 1HKLL 3QUXD 4LCWD 5FYKE 2X7LB 1QFPA 3D3VD 3DGGB 3BPLB 4JKPL 1M6OA 2J8UA 4KROC 4S11A 4HUUA 4LKCB 3VFSA 4QTHA 4DGYH 3AREB 1A1NA 4GAYB 2FSEB 3CDYA 1B0RA 4KQ3L 3VCLA 4OJFH 3RGVB 4YHKH 5BW7A 4PJFF 2A73B 5CIPH 2HT4C 3DUSB 3L95A 5CD3B 5TE6H 5HYQA 5IR1A 1DBKL 2IBGA 2Z91A 1L0QA 1JMXA 5DK2B 4BELD 1AQKH 4U6HA 4EDWL 4KKLC 1T20A 2F19H 5SWQA 1T83A 1S7SA 4RQQB 2UVEA 3CVIH 5GRJL 3CK0H 5KSUB 4PJCE 3MYJB 1JF5A 3VXTB 3IRPX 5EIQA 1T2JA 4IRZH 4U1HA 3TYGH 1PY4A 2JB6A 4ZYKB 1YPZA 3LN4B 1DTUA 4AH2A 2FLRT 3ZE0E 2XA8H 5IROC 1ZWIA 3GJFK 3PWLA 4RIRB 4JHZA 1MEXL 2WBKA 5EORH 1A7NL 1H3VA 2XTLA 3DECA 2NY6B 2P8PA 4QRRD 3TO2B 4N90D 4DGYL 2R0KH 4K94C 5CMAA 2V2WA 3QEQD 4UQ3A 3MCKB 4X7SH 2VQUA 1J0ZA 4GH7B 1OGAA 1FRGL 4K7PY 1LHZA 2GK0B 1H0DB 5IMOB 1ZT4A 5C2BH 2X4NB 5GZOC 2FR4B 1F3JA 2E5EA 4JPKH 1LE5B 4V1DB 5HHOE 5DYOA 4Y88A 5BJTB 2PUQT 3ZDXE 4ODUB 1JPSH 2H32H 2JTDA 3X3GH 4WHTB 4NKDB 2EXYD 1MFEH 1R3IL 4I3RH 5F7FA 1Q1JH 1WZKA 3E2HC 4MB5A 4I2XB 3TBYB 5E0QA 4UDUB 1J10A 1N6VA 4LCCB 3JTSA 1OP9A 3LN9A 2DQFB 1QR4A 1PG7H 1FNSH 3LKNB 2GYSA 5I16B 4IRJC 2LAAA 3DTXA 4QOKB 2BC4B 3WN5B 2OYPA 5GXBB 5EC1A 3O2WH 5E8NA 3L3KA 1EVTC 4ZAKC 5FUZH 1NCNA 3BAEH 3JV6B 1E6JL 1FGNH 5DFWH 1EEYB 2OP4L 3TV3H 1UKTA 3RAJL 3BWUC 1KIPA 3B4NA 2V17H 5C6TH 5IQ9B 1MNUH 2O26U 4ZOAA 5FB8A 3F58H 4JFQA 3W9EB 3A6BL 4I0CC 2YRLA 1WAAA 3MYZA 2H6PA 2H32A 1BQLH 3OKEA 3VFWB 2D0HA 3BUTA 3FQRB 5CWSB 4HWBA 4ODSL 5E1AA 5FYKU 5K9QG 4KPHH 5ICZB 2HTLC 1OCWH 1WGOA 1KENH 1CIUA 3ZYZA 4M48L 1GIGL 4KRLB 4LAQH 1Z0NA 5HGGS 4MDIA 43C9A 4NP4H 5HYJB 4NQCD 5EOQH 4R4FL 4XPHH 4U0QB 2ZUXA 5DQDH 4K8RL 5IHBA 2R4RL 2ATKA 3VXSA 1WISA 3FHQA 5HYIA 1WC7B 5JDSB 3B43A 1JWUB 4PRNA 4IRSA 5CJOL 1JF1A 1ZXQA 5I66B 5D2LE 4QRTB 4HC1A 3HNSL 4PJHA 2W9EL 4UQ2A 2H8PA 4PGDA 1X5GA 3VXPB 4H88H 3S98A 1GGIL 2IH1A 4MZ3A 4UUJA 1JWSA 4HXBH 4JFFB 3BW9A 3G9AB 3DLQR 3WBDA 4MJ6A 3ZHDA 2QL1A 3LOWA 5KN5A 4L8SB 2BHUA 1ZT1B 4G3YL 2WINB 5IVOA 3LH2L 4ELMA 4OBRA 2R1WB 1RK1B 3I9GL 3MV8D 4DQOL 1X5ZA 1Q72L 3H7BB 3VFNA 3ZYIA 4HT1H 1T2QH 5AG8A 4HH9B 3MRFB 2F74A 1AD0A 4MNHB 4PV8A 1NFDE 3L7FB 2V5TA 4QCIA 5EU5A 5DT1L 4JRXD 3HE7B 5IBTL 5I1LB 3I02B 3VWJD 3UJIL 4QOKE 4P2RD 1D9KD 3RUGE 2X09A 1PX3A 4KAQL 3LPWA 5I8OH 3NTCH 1XCQA 4NCC2 5L9DH 4Z7WB 3S35X 1DANU 4U31A 4ZPVB 3VG9B 1LO2H 4OLEA 5IV2B 3P9MB 3QEHA 3F7QA 1FL5B 4ZFOA 4LPYA 3PHQB 2EE3A 3ILPA 3RIFK 5D96C 1YYLL 5HGHB 4FQJL 5SX5H 5BRZE 3TEUA 4XBEH 1AGFA 1YEGL 1YEGH 4WHDA 3QHFL 4HJGA 5E08L 1MCRA 4N68A 3O9WB 2BY2A 5EU3B 5D93B 2DQGL 1A7QH 4GKSB 3QCVH 1E4WL 2F54E 4FXLA 5TE4L 1MJJA 2PXYA 3T1WA 3MRLB 4ZNEA 5DHYA 4NPYA 4L4TE 4LLUA 4TTDD 2VXQH 3K81A 1TNNA 4S1DC 5EU6B 4P49A 3IJHB 4BH7B 3ISWA 1K8IA 3DVFA 3S88L 1KIUA 3KPRE 5FYLD 1B3JA 1ZHNA 2A2QT 3VGEA 2DWDB 4Q2ZB 1H5BB 5IWLC 1DBJL 1MLBA 4WIQA 3QNZA 2E9IA 1KOAA 3GMPA 4NQVA 4LIQE 1KULA 1QLEL 4OV5B 1KCVL 1BFVH 4LCYA 2E9JA 3UBXA 3BPLC 3C6SB 2OZ4A 3T77B 4UNTA 2EE9A 4C59B 1QZ1A 3STBA 2AK4B 1X5HA 5FKPB 4YXKH 2JCCF 3ZMRA 4LSVH 3ZKNC 1U58B 3ZE1F 5DZNA 2W07A 3V6FA 5FDYA 3KYMA 4PFEA 5I8CA 2FGZA 4LCCC 3RX8A 3WNKA 1I9JH 3K74B 2EC9T 1YA5A 4MA8L 1F13A 3HE6D 1BF2A 1UA6L 5KZCD 4L3CA 3MOQA 2X6MA 2HG5A 3WUZA 3VFPB 2Q7YA 2NY6C 2XY1A 2O61B 1NAMH 1XCTA 3REVB 5J56B 3H2WA 4F3FB 1ETZA 3UTTE 5T1DL 4GKNA 5IHZA 3PV6A 5GSRA 3QUKB 2Z31A 4E41E 4LGSB 1P84J 3HZYB 4KH2A 2HYMA 3QG6B 4F8TA 5FYJE 3SO5A 4MNGE 4M48H 1IFHL 3DWTA 3IETA 3VXMD 5BOZG 4F15B 1V5JA 5I8EB 3ZT6A 4BQ9A 3QIUA 1Y6NR 2GJ6D 4FQ2L 1ED3B 3VFTB 3MRDA 2VLRE 4X6CE 4MA7H 1BQHB 4F9PC 3U36B 4YPGB 4KK9C 2APFA 2PO6C 5CZKA 3OF6A 1NGPL 2FECI 4PY7A 3HI6L 5E8EB 3CFCH 4GRMB 4OTXH 4MAYA 4MJID 4LHQB 1CE1H 3T4YB 5IK3A 1HWHB 1U95B 4U1KA 1QR1A 3ZE1E 2N4IA 4PS4L 5F3HA 3AU1A 4WHYG 4RWYL 3BAEL 3RQ3A 4PD4K 3KYNA 5TDNB 3F62A 4JHWL 4HUXA 3ARBA 4EVNB 4FMKA 3BRGC 1KCSL 4P23D 3GJEA 1RZKH 5B21A 4UV4H 5DJAB 3TVMA 1BFVL 3G04B 3GMLA 4PUBH 1P4BL 1HZHL 3AREC 2CKBH 1BZ9B 1N5AA 3FB5B 4NCC1 4QHNA 4HC1H 1FP5A 2BNQD 3WD5L 5CP7A 2EC8A 2P48B 2GKIA 1TNMA 4OM0H 1UKQA 3WIIL 1T89C 3H9SB 5LKNA 2F53E 5I73C 4LCUA 5JPMA 3VRLE 2XFXA 4RBPH 5FO9A 2OTUB 3UTSE 4GW1A 4XNXL 4EN3A 4RAUA 1FRGH 3BWAB 2PCPA 3DX7A 4WUUD 1LE9A 4PY8J 5D5MB 4MZ2A 4C57C 1EGJH 4FNLL 1TZHA 5ETUA 4Z76B 3BPOB 1PY9A 1GC1L 2H2SD 1QSZA 5IHUH 1II4E 1BLNA 3CNKA 4G6JH 4UT7H 1ZHLB 5C2UB 1QG3A 2XWBA 4PJGB 2QSCH 4AEHL 1CXEA 1YNLH 1WWWX 3AB0B 3CGTA 1YYLH 4WI4A 2EDFA 1A7NH 5IBLD 4UOJA 1AO7D 4JO3L 5EZLA 3FZUD 1UZ6F 1HCFX 4BSVA 3CX5K 3R0NA 1N64L 5T3ZE 5JHDD 3L3IA 5DD6B 1HILB 3MOAL 4S1RL 1I1AB 5F6IB 1JUFA 1LEIA 4HBQA 1V7ML 4NNXA 5DMKA 5DA0B 2GHWB 5DS8B 5JNYB 4WNQA 3MOBL 4BFIA 4JAMB 2IQAA 2VWEC 3IS0X 1A14L 4R7NB 1YEJH 4ZPTA 3S8WA 1FJ1A 1FO0B 1ORSB 4L4VE 4F57L 1TVBA 5GGRB 1K5NB 3IDXL 2F19L 2D31A 3I84A 2MJWA 1KEMH 1QBML 1YUHA 5EO9B 3D0LB 4ONHA 2FEDC 1FPTL 4K9EC 2DQTL 4OQTL 2ZNWA 1X4YA 4NN5B 5SWSD 2XWJB 2WUCH 1OLZA 4KJQC 5T5NG 4EBQL 4KVCL 4EKXA 1F90H 4ZUTA 4UOW0 2C7UA 1RK0B 1BBJB 1AHWB 2EIZB 3UTOA 1FORL 3AXLB 1YY9D 2FGWL 1NANH 5FYKL 4U1IA 4MX7A 2O5YH 1Y0LB 1DQMH 5HPOA 3HUJB 2NLJB 1OF2A 4U49A 1G6VK 1NGWA 4TQEL 4E0RA 3VJ6A 3HCVB 4JFYB 2NXZB 1S78C 3C2AL 1OAKH 1M7IB 2OJEA 4GBXB 1SBBA 2ZKHL 3J8F7 2X9WA 3OHXA 1KF9B 4OIAA 5C0BE 3MLRL 2EECA 4OCMC 2HFGH 3VXMA 1JNNL 3C60A 4LDLB 3ZHKA 1U8JB 5CZVL 5T3ZH 32C2A 1MNUL 2GJ6A 2NQCA 3VGBA 5HHNB 2R2EB 5JR1H 4MVBD 3WFBH 3TWCL 5KTEH 4XRCB 5DMGD 4U1LA 1JI1A 1CGYA 3IAGC 1MCOL 2XQBH 5DMYA 4G8FB 4XNUL 5IQ7L 3UXFA 2AXGA 2LAGB 1YDPB 4OGXH 2VL5B 1J1OH 1S3KH 1IE5A 1A9BB 3S7GA 1N0XH 5IB5A 1DUYB 4OD1H 3OXRA 2NY4C 5JR1L 1YN7A 4L3AA 2G2RA 1QO3B 1J11A 3QIBA 3NCBB 5F8QC 4QRSB 5TE7L 2A74A 1CL7L 1LEGB 5J7CC 3O0RL 3C08H 1BM3H 5CUSL 8CGTA 5GRVL 1LP9E 5E24E 3HZMA 4K71C 4ZSOE 4NKOA 2F53D 5DHVB 1CDUA 3QHZL 3OGCA 5F1NB 1A22B 1RJZB 1CBVH 1FNFA 3DX8B 3RWHB 2OK0H 4P9HH 3NFNA 3MXWL 5DO2C 5JW3L 4Y19A 4ODXB 3T2QA 2PTUA 3ARQA 1I3GH 2GITA 3VA6A 1DQML 3O4OC 2R8SL 4OIBA 1G7QA 4J3UA 4X7SL 5E8DH 1CFNB 4PJ9C 1DJSA 4EJ1C 2O5XL 1NKRA 1I8LA 1G84A 1D6EA 4LU5L 5T1MA 5EZJB 1Z5LB 4D3CH 2R69H 4Y2DA 3EBAA 3QPXL 2IFGA 3RNQA 3RVVD 5EORL 4CVWA 1LK3L 4P2QE 2WUCL 1KCRL 3L3OA 5D1QA 3W2DL 5F3BA 3BDYL 1BFTA 4IOFD 4ZSOA 4NO0A 4L4JA 1G0XA 1WT5C 4HH8A 2Q6WA 4YEFA 4MJ2A 4P4KD 3CDGA 2CK2A 2FHFA 2PR4H 1FFOB 3BYTA 1TZGH 3GUTA 5IB4A 4WV1B 4J4PA 2UY6A 3CFJB 4HS3A 5D7IB 5HGBA 1L7IL 2LFGA 4ZTOH 3A67L 3QQ9D 5ADPL 4N8CL 1MCWM 1MI5B 2Y25A 4OGAC 5C0CE 3S34L 3U83A 4HKZB 3W0WE 2D4FA 3WFHB 4P99A 1INDL 4Z77A 5E00B 3CFKB 4CADB 5AAWA 4JFZH 5EBWA 5BRZA 3BOVA 3OKOB 4GKOA 2BNRA 3VGDA 2H3NA 1QNZL 1TCMA 3QISA 5EU4A 5TGBA 4M43H 5IEKB 2XTJD 2VC2H 4PJEE 4KQ3H 2YEZA 1T6WA 4QWWC 2IG2L 4JY6B 4IMLA 4QHLB 1ZK9A 4WW2B 3KNBA 4GUPA 1NMBL 2CIKA 4HZLA 4RA3A 4X9HA 4TUJA 5MERA 1GC1H 4ODTL 4LOUC 4NQDD 2P42B 4UTBH 1HKLH 3EZ8A 1K4DA 2HTKC 3EYFA 4OGZA 1R5IB 2AV1A 5I2IA 1NL0H 2KQMA 5FIEA 4M4PA 4RISH 3CFBB 1INQB 3CH1B 4MNGB 3GJFA 4HIIB 4MXVF 4XXCA 1JGUH 2OR8A 4KMLB 3JWDC 5IEHA 5IVXA 4QXTA 5CZXC 4TVPH 4OT1L 4EQ3A 1FBIH 3O3AA 3RGVD 4Q9CA 1OTUC 1U92A 3B3IA 4FS0A 2W38A 3O0RH 1BOGB 4WFFE 3SDCA 4JFDA 1KJMB 4BJLA 4QXGL 3WKMH 1SJXA 2R0ZH 1L6XA 3MJ6A 1JFQL 2BVTA 2BCKB 4D0CA 4ELKA 4UV4L 1EXUB 1RZKL 3ULUH 3C60D 2ARJQ 3LKPB 3RX5A 1HHKB 5IW6A 1TPXB 4DN4H 4HWUA 3Q1SL 4BYHA 2XQBL 1G9MC 4P2QB 3MLVH 1BFSA 1C8PA 4K7FB 3MLUL 3MRIA 4OTXL 2ESVE 1SBSL 1NLDL 2HN7A 4YWGL 4CVZB 2YPVH 4HUKB 4OCWH 4Y89A 2VLKD 4PRAA 2CRIA 4HWZB 1FC2D 1B88A 1BVLB 2XWTA 5E4EB 3SO3C 4B50A 1KYOK 1VFBB 3NFPB 4HUVA 3CZFB 1SMAA 5L8KB 2DI9A 3WFDL 3B83A 1TQBC 5T1DH 1XIWC 3I75A 1FFNB 4Y4FA 2ZCLL 1PQZB 4XPGL 1W72B 2X9YA 4OGYL 4L9LA 1J0HA 3ARFD 3MXVH 3KPLA 1ZGLB 2X4QA 5JW5A 5E4EC 3T2PA 3NFSH 5DEFA 1LP9A 5CJQL 5F7UA 4TN9A 5CJXC 1PDKA 3X11A 3MLWL 1JGLL 3Q2CA 1JPTL 4PJHE 2J12B 3SGEI 5A2LH 2NXYD 2BY3A 2IBZX 3TJHD 4OCNC 2QR0B 4M5ZL 4EOWH 1IZKA 4NO2B 4LSVL 3SJVB 5A2KH 3ARFB 1MHEB 3GBNH 1MCPL 1T1ZA 2P24B 3CVHH 5B39G 1M7XA 3IFOA 5KSVB 2F15A 3MJ9H 3SE8L 4JG1L 1RVFL 2W65A 5DR5L 3VD5A 1HXYB 3C5SA 1GJIA 2CR3A 1IEAB 4JKLA 4P4KA 3TPUA 5A1AA 5C0NC 3KPSD 5HHXH 4JM2B 2RCSH 4PR5A 2BY0A 4J4PD 3KG5A 4D8PB 5HVHB 1PZ5B 4ENED 5FF6B 4WW1B 4NNYB 2IANE 1WBXB 2A0LC 4U1JB 4W4OA 3ZL4H 1KTLA 3B9KB 2FBJL 3MCLH 4GMTL 1E28A 3RTQC 5DC9B 25C8L 4J3XA 3D18A 4S1DD 1UM5L 2YBRA 5I71C 1OGTB 5GS2D 4WRLA 1DSFL 1UZ6E 2AXHA 5GGSB 4TNVK 5IGXL 1J1XL 3J7HA 4WEMB 2Z93A 2VE6A 4YAQA 2JJUA 1AGBB 2IGFL 4WFEE 3GMOA 5FM5M 1EGJL 4EI6B 3QIUC 1J5OH 1I7RA 5BVJA 4YEEA 3FO1A 4Z7UA 1CXLA 4OLWH 5CGTA 3FQTA 4KK5D 1FNLA 1U0QA 4S2SB 2FBJH 3FKUS 3G6AB 1RIHH 4HUMB 1GOFA 3U0TB 5EN2B 3SGKC 2ADIA 4BA8A 2B2XH 4IIQC 1IT9L 5KAQF 4ZUWB 5IJVB 3MGAA 3D2UB 2DQEH 4GOSA 3ZKND 2FZ3B 3ZYJA 5D7LB 4NM4L 5HY9B 3QXDA 3W39B 2FECL 1B4RA 1ORQB 3P0YH 1PKOA 4H5SA 1HYRC 1ZGLM 1OGAE 5MEOA 1RFDH 4I3SL 2MQCA 1GC1C 1X4XA 2VN7A 2WWMC 2FH6A 4AENB 1W0WB 3RU8H 2QQKL 2NNAA 3FQXA 3MO1B 4BSWB 3CVHL 1NANI 5D70H 5H94B 3I6KB 4PLNC 4RWYH 3HMWL 1CE6B 5JXAL 3KVQA 3PL6B 4P5KA 5I1JH 4LPCA 4ZUSB 2JB5H 3IXTA 4LP5A 3L3HA 1JPTH 1Y6MR 5ENWB 2RR3A 4LRIC 3V5HA 4KRPC 3HNSH 1C08A 1I1CA 5FA3B 4RGNC 2E7BA 1MHPH 1VGEL 2EDDA 2UYLB 4I77L 2YKLH 4ESKA 2ZPKH 3VXOB 2DF3A 4X6DB 4BH8B 2CUIA 4Y5VA 1IFHH 4TVPD 4XCEB 4N1HB 5HYSB 4NFDA 2NR6C 5DQDL 4I0PD 3OXSB 4Y16B 2FLBT 1FZKB 2IADA 3VMNA 1NGZA 3CUPB 1YJDC 2R15A 1C5BH 3ROOB 4A6YA 3B9AA 1NAML 1NCCL 1DVFC 2G60L 3QJHA 1JTTA 3NGBC 2FATH 4X0KA 1G9NL 1UKSA 3H6JA 5H37G 2NW3B 2IFFL 4LVOB 1UEYA 2YPVL 4UINH 4MA8H 1UJTA 5L2JB 4JJHA 4G7YH 1P7QB 5D7IE 5C09A 3B9DA 2DLHA 3FONA 1I7TB 2GIYA 2OP4H 2X1XR 5E6ID 3MLVL 5I15L 3BQUC 3IJYA 3BVNB 1G9NC 4ZXBA 3SGDH 3VWKB 4KI5C 3VWJB 4KRPB 3HE7D 1YN6A 4O2CB 2BZDA 3L7EA 3V7AE 4WDIB 5FO8B 3AM8A 1OVZA 4D0DB 3O6FA 3G6JB 3R8BB 4YGVB 1RJYB 4GG8B 1JHLL 1JFQH 5ERWB 3P9LB 4FFYL 1MI5E 1KFAL 3U6RB 2R0ZL 2Y6SC 4N0YH 1P2CB 4MXWL 3Q6GL 1R3LB 3EHBD 1X7QB 5IFHH 4LBEA 4LAJH 1XR9B 3DURB 3E6FA 1NC2B 1L7TL 5D9SB 3T0DA 4CNIB 2CIIB 5FGRA 3PHOB 1AI1L 4J3TA 4WI7A 4FQPA 4Y4KB 2EIBA 4D2NA 5HI4D 1ZANH 5CHNA 5FYLE 5KVFH 4Y8AA 3G5ZA 4YE4L 1F2XK 2CDEB 1JN6B 4D0BA 3OKKA 1DLHB 5IBLC 2FO1A 1ZS8B 3IDGB 3UYRH 1N6QH 15C8L 4OFYD 3AFLA 5E08H 3QHFH 4DCQA 1MCWW 1T04A 3MRJA 2E3VA 1S7RB 1DZBA 5FOBA 1MRDL 1RZGA 2FHCA 3GKWL 5F21B 4KTDH 5HDQL 3RVXC 4HPYL 5DGRA 2CDFB 3D9AH 1H8SA 1CFTA 5ADOL 3QXWA 4PB0H 4BK5A 1VENA 4GKZB 4NYLA 2HP4A 1J1PH 2JF1A 3NMEA 1S9XA 5LBSH 5IB2B 4Y16C 2Q8BH 4PJDB 2Q8AL 4LDEB 5CP3H 4PJCF 1QRKA 3GBMH 4PJDF 3VFRA 5TDPA 4KHXH 5ADPH 4YXLL 5ID1B 5TH2B 4PGEA 5AZEL 3I9GH 4QY8B 3WS3A 3FB8A 4NGHH 3DMMA 3GSNB 3QIBC 4R2GC 1LNUB 5FK9B 2LU7A 4OF0A 1U6AH 4LLVA 4JM2C 4IOIB 1NFDF 5GS2H 4ZFZB 2HKHH 1NCBL 4GQ9H 4HXBL 4LSQH 1JBJA 3C6LC 5ICYA 3QDGB 4MGXA 4NC2B 3GSXB 3QZWA 1YMMA 3GI9L 4H88L 4YHKL 4OJFL 3TIEA 3MRCA 4OM1H 3KPSE 5A3IC 1YMME 4APQD 4LU5H 1UJ3B 1W2KT 4NFBA 4C83A 1LVEA 3VW3L 5J9PB 4P2RB 3C5ZD 5DUPL 1IAOB 1TLKA 1X9QA 1ZLUH 1FE8H 4TULH 3WO4C 3LZFL 1B0WA 1YY8A 4O02L 2Q7NA 3RZCD 4RSVA 1ADQL 5T1LD 3P4NB 3L5IA 5GGTL 1FVDB 5EBLA 5AWNH 5DSCA 3MODH 2ZUVA 1X5XA 4G43A 1AO7A 1U8HB 1XGPB 3UPRA 3S4SG 5B3JF 5CUSH 5D5ME 4F7MB 3ZTJH 1BM3L 5GZOD 1I9IL 3NCJH 4JGMA 3WN5C 4CUCA 3ORJA 4Y1AD 1CGXA 5F88A 2QQQA 1FG2B 1U8MA 4Y5XC 1HOCA 2EH8L 1EFQA 3BZFB 4PJIA 4Y4HB 4H1LH 4O2EA 1A6WL 5HSFA 4XWOC 4R7DB 1I9RH 3G6DH 4NC0B 1N0XL 2EE6A 5DWUH 4XWGH 4LF3A 1S3KL 1ND0B 3CFDA 3N9GH 4X6EA 1B6UA 5I71B 3V4PL 4NDMB 1AJ7H 4JQVA 4HS6B 3PUCA 4WGWB 5ICXB 4M1DL 4XP4L 5D7JB 3MUGA 4HKXA 5DD3H 4PRPD 1R24A 1FZMB 2WUBL 4OFIA 4ZAKD 1DUZA 3VDAA 3WFBL 3HLAB 4M6ML 1RZIA 3QUYB 5IOPB 5D6CA 4FZ8H 2EH7H 4ZDHA 3QXTA 2BXZA 4KKNA 3FTGB 3S36H 2EEDA 2X1WL 1GGTA 1HXMB 2XN9A 1MFEL 5J1TC 1CFBA 5DTFA 3T2NH 1AGDA 2CRZA 4UZGA 4PLJC 3P4OA 3RVUD 3N06B 1DQTA 2XXCB 2EDBA 1T0MA 1JGDB 3MLTA 5EA0L 3KYOB 2DOCA 1I3UA 2EICA 1QLRB 4KXZH 1VKXB 3FQWB 2R2CA 5GIRB 5JZ7C 3VD9A 4NC1C 2NY3B 3TO4B 4Q9RH 1G9ML 3SY0B 3B2UC 3TA3B 4I18C 1GHFH 5I0DA 5T1LB 1FL3A 3ULSA 2PYEB 2CPCA 1BGXH 3OSKA 3SPVB 4WFFD 1UQSA 3VMPA 4CU8A 5DEGA 1WIPA 1YPZE 4MJIB 1A1MB 3TT1H 3WFEL 4B7IA 3MV7E 2Y36L 1YMHA 4HIJB 3H7LA 2ICWI 2X4UB 3KWWA 2WBJB 4P2OC 2MNUA 3FO0L 5DD3L 4J1UB 2CLVB 4Y4HC 4ONGL 1KC5L 3UTQB 1D6VL 1IC4H 2QKIB 1SJEA 4YDIH 3UDWA 2F5AL 4CMMA 3C8KA 5ESQA 4XWGL 1OTSC 3WUWG 1ZVHA 1ZA6A 3PXJA 1I9RL 4P9ML 3CK0L 1JGVH 5KVGL 5TFSL 4HKBB 3O2DL 5GGRY 3LRSB 4UTAH 1PVHA 4FQQA 4WU7A 2ERJB 5IWLA 3NCJL 4K7PH 12E8H 4U7SA 2D03H 2VDLH 2D0GA 5GS0D 2YUZA 3FQNA 3GB7B 1UJ3C 5EO0A 1BP3B 1IL1B 3PGDA 5SWSE 3CH8A 1XGQA 1MQKH 4NBZB 1UWXH 3LKSB 3QO0A 3QQ4B 1IQWL 3LDBB 4O02H 1R5VB 3KPPB 3T8XA 1TVHB 1YNKL 1R3KA 4KUCF 1W0YT 3ECBA 1XGUA 5C6WH 3EUUA 5MEQA 5LGHL 5EOTA 1OAXH 4UU9B 4APQA 2FX9H 2OSLA 4H8WC 4S1QH 5C0GB 2OI9B 3TJEL 3KPQB 1U3HC 4O00A 3TNMA 3V0WL 1W72H 3V5KB 3LV3A 5HBBA 4YC2C 2NYYC 4YQXL 1ZVYA 2AI0L 2WQRA 1NBYB 4WWID 4CMHB 2HKHL 4HGKC 4UAOB 1IM9B 2Z9TA 5DDHB 2BNRE 2ITCB 3OKDB 4WCYL 4KJWD 1KIQB 5FM4A 1MFDH 1A2YB 2YXFA 4Z7VA 5J57B 2BNUA 2E6JA 3IRZA 4JJ5A 3PIQB 4MS8C 2MMXA 2YPKB 4GAGL 5ISZA 1XF4B 1NC4B 5E2VH 4Z5RB 3FCTB 2OXHA 5JMRA 1CD1A 1IMHC 1P4BH 4Z8FH 4XNMB 1NCAL 3CXHK 4RZCB 2VLKB 2NZ9C 3V0AC 5KSBA 1PLGH 1YEHH 2X4SB 5B8CB 3W5MA 5CEZH 5E94A 1J7VR 4L4VB 5C86A 3PQYA 3P40A 5B39A 5FKAB 4MAYC 3HRZB 5C9KA 5CKGA 1Z0MA 1MH5B 5F9JB 4A2LA 1FYTD 4LASL 1TENA 4U6VL 3SGJC 5I76A 1S7UB 2CR6A 2FJGB 4FG6C 2IAMD 4RX4D 5C08A 1TZIA 4M7LT 2VOTA 3GK8L 1RIVL 3QHTC 1AH1A 1TJHH 4JRXB 4Y5XB 4H25B 3O4LB 15C8H 2YS4A 3DUHA 3F6LA 4EXKA 5H35A 3IF1B 3TA3D 1NFDB 2CLZA 2X4PA 2XN9D 2ZOLB 3GBLA 1GCFA 2CLRB 2AQ1A 2JKXA 4V2CB 2CDGA 1ZHKA 4M03A 4K8RD 4DVRL 4NZTH 1QA9A 1CLCA 4MD0A 5C0BD 5DJDB 3HC4H 5BZDB 4DKEL 4EUPA 2PW2B 2W0LA 1S8DA 4ISVB 4HK0B 4JHAH 5GJSL 1EV2E 3HR6A 3DNKA 4MA3B 4HWNA 5J4MA 1NDGB 1JHLH 5M94B 1XAUA 4LLDB 4YO0A 2GTWB 3EJJX 2EE2A 2HH0H 4PJBB 5ALBH 2AS5M 2X40A 4PV9B 4HUWA 3GMQA 1Q9KB 1D5IL 5HHVH 1JL8A 1BQHG 4NRXA 3I2CL 4HKJB 1QLFA 4O4YH 4XC3H 4LARL 3S96A 3VXRB 1WBZB 4XCNA 3QXAA 1KTDA 1U3YA 1XEDA 5I1EL 4G6AC 3KJ4B 3GSOB 3H9SD 5CEYA 4EI5C 2BVUA 3ET9F 2FCBA 1W8NA 4ODVL 5C6PB 4K9EL 2MCPH 2AKRB 1XR8A 3L5XH 2QHRL 5LXGL 3O4LE 3EJZD 2I60H 4I1NB 5IB1B 3F12A 1S7TB 4U3XA 5C0RH 3BRDA 3KPTA 1F2QA 4KK5C 5BZWB 1JHTB 3QUZB 1S7QA 2XZAH 3DSFL 1I1AC 4N5UA 3JTTB 2LQRA 1EFXB 4ORGB 3DV6B 3LKOA 2BVPB 4Q9BA 2VDPH 2W60A 3QUXB 1AR1D 3CFEB 4MCYB 3U4EA 3QBTB 4G5ZL 3RL1A 1HHGB 5I1CL 4JO1H 3HG1B 3O6KL 5INCB 4U1GB 3V52L 2OBGA 5JHDE 1PFCA 4FQHB 1BFOB 4HFWA 4OAWB 2VLJA 3QFJD 1BAFH 2FWOA 2V5RA 5HD8C 5DRWB 2ESVD 1ZLVK 1M05A 4FXGB 2ILLA 5IVNA 1UXWA 3MMEA 3WEXB 5D70L 1IKNC 3QRGH 5B38A 4HIEA 2QQKH 3EIFA 1OSZA 2NY2D 4NO3A 3GSWB 4NKMB 4NQXB 1LK2B 1ROWA 4N8PA 2D2OA 3BO8A 5I73B 1SYVA 1T83C 3AS3A 4XP9H 4PJ7E 3F7VA 3LH2H 2DQEL 4HK3J 2WLZA 1EIBA 3BO8B 2YPLE 4RCAA 1MCFA 4NKMA 3GSWA 4NQXA 4NO3B 4UB0H 1KSRA 5DVLA 4HIEB 5B38B 2P5ED 1NH6A 4K3JL 5AYQA 3SJVD 1H15B 2B4CH 3EDEA 1UXWB 4FXGA 2JJTA 5CBEB 2FWOB 5IJKC 3NCMA 4OAWA 4HFWB 2QADD 1JV5A 4DZ8B 5LCVL 4FQHA 1I3VA 3R1GL 2C4FT 1OB1A 3CSYB 3KPMB 1GGYA 5INCA 4W81A 5I19H 1B4JH 3BP4A 3LEYH 3V6BR 1HHGA 3RL1B 1F11B 4GW5B 4JM4L 4RMRA 4MCYA 3U4EB 3CFEA 4JO2H 4NN5C 2W60B 3QUXA 4R4FH 2VDOL 4XPHL 2HFEA 3IDJA 3BFOA 3DV6A 4LGRB 4ORGA 1EFXA 4LAQL 5F9WB 4P3DA 3RDTB 1QFWH 5EIVA 1WVZA 1CL7I 1CDCA 2YA0A 3DO7B 3HZVB 5D4QA 3PABA 5IHLB 2ZCHL 2W9DH 4C54A 3TBWA 3BZDA 1S7TA 2BJML 4NSKA 5IB1A 3CSPA 3TCXA 2XG5A 4HG4J 1RU9L 4YFEA 3EYUL 4G8IA 5FA4B 5C07E 5DURD 2LU3A 4ONFL 5AYUH 4KK8D 3OJ2C 1M7DA 2XN9E 5F6HJ 3N1GC 2MOVA 2DI7A 5CEYB 3V8OA 3GSOA 4OFDA 1NAMA 1S7WA 1MCPH 1E6JH 4XCNB 3BH9B 5CS7A 4O51B 5FUZL 1QLFB 2P7TA 5CEXA 2FB4L 5D1QC 4NRXB 5TDOB 4OF7A 1LDSA 3ROLB 1JGLH 3MLWH 1PG7L 4PV9A 1G6RH 4CKVX 3PDDA 4DKEH 1A7BA 2A83A 3VH8G 4PJBA 4LSSH 2GTWA 4XP1H 5E5RB 3U2SB 5L7XL 1NDGA 3ALXA 3MLSH 5FUOH 1MFCH 2EDOA 3FQUB 1Y18B 4KKAD 4HK0A 4ISVA 1S8DB 4XMPH 3OAUH 2GAZA 4FABH 2VUYA 4Z7NE 5DJDA 3P77B 5KJRH 1QA9B 5J06A 5DJZA 3ARXA 3NH7L 4I0PA 4R96A 4WO4D 1TJIH 2H2PD 4PGCB 3QH3B 3UP1A 4YDJA 4Q58C 1S9YA 4PJAE 1NC4D 2CLRA 2AW2A 2ZG1A 3T3MF 3V6ZB 3ZLQC 1XMWA 2ZOLA 1TJHL 2X4PB 4KWUA 2CLZB 2H26A 1S9KC 5FM5O 4P3WA 4OLVH 5HXMA 1LD9B 3O8XA 4G6FB 3MBED 4HF5L 5JOPD 4NKQB 4OZFB 4PRDB 4YFDB 4H25A 5L6YH 4Y5XA 2CUMA 1NLDH 2ZUUA 3OB0K 1FNHA 1TZIB 3DVIA 3LEXB 5C08B 5B38G 1MRFH 5E6IA 2F54D 3UBXG 4F7PB 2IEPA 4MNQD 5F9JA 1MH5A 2P44B 1WSST 4JQXC 4XNQB 5F7NC 5SWSA 5FKAA 1J9CT 5KAQG 5B39B 3ZTNL 5JO5B 2YXMA 4KJYB 2LE9A 1UZ8A 4L4VA 5JW4Q 3HC3H 4JCLA 5KVDL 1RI8A 4M62H 4OLYL 4QXGH 5C0BB 3R0MA 4GAGH 4RZCA 3SDAA 1CD1B 3EOTH 4Z5RA 3SE4C 1XF4A 2YPKA 1EUTA 5ISZB 5DFVC 4Q6YA 2BNUB 4Z7VB 1OAUL 4FQXD 2ADFL 2DQJL 3OKDA 3U0WH 1W72L 2EO1A 4NQDE 1EEZA 5SX4I 1C5DB 1IGIH 4WFGE 4WUKH 1EO5A 5F7HA 2AEQL 3SDCC 3T04D 3T0EC 3V5KA 3TNMB 1FDLH 5F7MC 2OSLB 3EOYG 2HTLD 2FX7H 5ACMA 3VXSD 5EOTB 5MEQB 4QRPE 3B8SA 3OAZK 5E2UH 2VDNL 1FIGH 1XGUB 3OL2A 1MQKL 3QAZC 4OI9A 4RAVA 1R3KB 4XP6H 1TVHA 3Q0HA 5C9JB 2PXYC 1R5VA 2AV7B 1KEGH 3QQ4A 3QO0B 1XGQB 1QYGL 3ZDXF 3PGDB 1IL1A 3HMXA 3L1OL 5EO0B 5TJWK 2HWZH 2RHEA 3CLEL 1KB9J 4MJ5A 2FNBA 5GRWA 5DD5H 5FCUH 1VFAA 1QKZL 2DWEA 2ZUTA 3A67H 4HWEL 5IF0A 1OGAD 1ZSDB 4G9FD 5I1AA 3FT4A 5KZCB 2VZUA 4FQQB 5JA8B 1RHFA 4RGMB 1PYWA 3ABZA 5SV4A 3RHWF 1VFMA 4HKBA 3DMMD 3RWJB 3MJ7B 1TFHA 4BUHA 1ZA6B 1XFPA 2JCCB 3C8KB 4CMMB 1LO4L 3DETC 4TPRH 1K85A 1RZJL 1SJEB 2SEBA 4HMDA 5L6YL 2ZCKL 3BDXA 3UTQA 5IG7A 2R69L 2WBJA 3KWWB 2FBOJ 1L0YA 2AJZA 3B2UD 4FQCL 4LK4A 2O5XH 3TZVB 4D9QE 4JKWA 4JO4H 4K3EH 1A1MA 2F8OA 5FGBA 1FFPB 3STZA 4OCRH 4ONOA 3SPVA 1XF2A 3RZCA 2RGSA 5T1LA 4KFZC 3MRHA 2DM4A 2B39A 4YBHA 3TO4A 4Y4HD 5IVZA 1S7VB 3FQWA 1MVFA 3C08L 4FQCH 3MLTB 1JGDA 1T0MB 4G42B 1FL6B 2A6IA 5KG9B 3P4OB 2CO7B 1MCLA 3K1DA 2VZSA 1NMCC 2XN9B 4JFXB 4A6YL 2RQ8A 5GZNC 3TZVC 4MQXC 4BZ1L 4OGXL 4PG2A 4NN6B 3ZKXB 1MFBL 5DA4A 5C70A 5D6CB 2W0FA 5DVKA 1RZIB 3VWKD 3HLAA 1DUZB 3DX9B 3RFZC 3N9GL 1FZMA 1OP3K 1R24B 3RZWA 5ITBL 5ESAA 4XBPB 1T5WA 3NCYP 5KTEL 5D7JA 4PJHF 5ICXA 3CD4A 4NDMA 1TQCC 1RZFL 5CEZE 4RFOL 2P5WB 3BHBB 3NCEB 5E1HB 4NWTH 3CFDB 1J88A 1ND0A 2V9TA 2EH8H 1WCQA 2AK4E 5D6DC 3SGJA 5HJ3B 2DQIL 1EGJA 3VRIB 5JUEH 1HHJB 4NQEA 2OQJB 3DYOA 3QPQC 4K3HA 3MLPA 4O2EB 1KN4H 1MJ7L 3VD4A 1ZEAL 1HOCB 1U8MB 1QSED 1FG2A 3RP1A 1T3FA 4IMKC 2QQNL 3MGOB 4TQEH 4F7MA 5FYJD 1FCGA 4ENEC 5KANI 1NGXA 4L8DB 2FEEL 4JFEE 4DUWA 1U8HA 1AO7B 3I3BA 2FRGP 3BN9C 2CK0L 3DXAD 4HEME 3S37L 5DSCB 5IIEB 3RTQD 3P4NA 4H20L 5ILTH 3QAZB 4WI2A 1FFRA 4WI8A 1P1ZA 4WUKL 4DVBB 2R4SH 1IGIL 3N1PC 4KVNH 5E2TL 3SDXB 1R0AH 1IAOA 1FNAA 5DEZA 4P2RA 4POYA 4N0CD 2NY0D 1YECL 3GI9H 1IAKA 1KXVC 4GAJL 3RWCA 1JZ8A 2P43B 1RURH 5EIIB 1JHKH 4J6RL 1EBAA 2VXSL 5I1DA 3TIEB 2PKDA 1YMMB 3GSXA 3QZWB 1XGTA 3OF6D 4KTEL 3QDGA 4LKXA 1IBGL 2ICEA 1OY3B 2R2BA 4PJ8C 1KXTB 4ZFZA 3X13A 4JFEA 4LLVB 5KVDH 3WXWH 5FK9A 1W8OA 4QRQA 5B3NA 3GSNA 3DMMB 2IAMC 2VQTA 3OJVC 2R1YA 3E2HB 3UTPD 3EJYC 3WS3B 4QY8A 5DK0B 3ARBD 2NY4B 2NY7H 4PGEB 5TH2A 3CDFA 1V7MH 3G5VB 2QSVA 1FHGA 4ODBD 1G1CA 5TDPB 3MOAH 3IFNL 3EW3B 3K8MA 4MMZC 5I75B 4P2CG 4PJGF 4AM0B 35C8H 3HMXH 3N0PB 4OUUB 2BDNH 1T22A 4Y19E 5DVMA 4L3EE 1OAYL 4OLVL 1E4XI 2VXTL 4G5ZH 4AG4L 3PWJB 3WMSA 5C0JB 3MV9B 4J3OC 2EDQA 1CDJA 2UZYB 2CDFA 3ILQD 2WBJD 3BEWB 4QO1A 2GT9B 4NZDA 1CLYL 1RZGB 1S7RA 4XMLH 5FOBB 1KLGA 4F33A 4Z7WE 1T04B 2YD6A 1ZA3A 4RNRA 2OX5A 4H0HB 3QUYC 1ZS8A 5F96L 1ZLVH 2FO4B 4ORZC 1JN6A 4D0BB 2CDEA 3SKJH 5JIPA 5JPNA 1MQ8A 3NIDE 1NDMB 4ZG1A 3TO4D 3HR5A 2CIIA 4CNIA 3L5HA 1G6RL 5IKCB 3MLYH 1UENA 1NC2A 2ICCA 3WNNA 4LARH 4RRPG 4NHUB 4LBEB 2DBLL 1X7QA 5KSBF 2N56A 2VB5A 1P2CA 1MHHB 3U6RA 2VYRE 4YGVA 2V9QA 3G6JA 5ALBL 4BZ2L 3ME0A 4JGUA 4XP5L 4FFZH 5FO8A 4WDIA 2XTJE 1JRHI 1J8HE 4O2CA 1YN6B 5FYLL 3VWKA 3CSBA 4ZXBB 3VGFA 4AEIL 1IAIH 3BX7C 1HSBA 4WI3A 3QDAA 1FLRL 4MA7L 4ZNEE 1I7TA 2QQLH 3FONB 5HYJE 2VJXA 4NZTL 4HQQL 3S97C 4Z9KB 5L2JA 1RUML 4LCWA 5F96H 3E6HB 4OFKA 3BUYB 2NY1C 4RMUA 2NW3A 4AL8L 1CGVA 3QNXA 3P30L 4P5TC 4FHBD 3ARSA 1GAFH 2V2TA 4X0KB 2XRAH 4H8WH 4HDIB 1FVEB 4YPJA 1H3XA 3OZ9L 3UROR 1B6DA 1PX4A 3UZEA 3R1GH 4H26B 1RZKC 2VDKH 1FZKA 3UYOD 4Y16A 3OXSA 3TP4A 4Y8DC 3THMH 5HYSA 1KB5B 5K9OA 2JELL 4PJ9A 4GXUN 4KK6D 3WIHL 5I30H 4BH8A 1I9JL 3HFMH 4QXUL 1MCQA 2UYLA 3M1BA 1OAQL 5FA3A 1C08B 4X7CC 4F58H 1JPGA 4XPTH 5I1JL 2VISB 4PP2B 5TPWH 4X4YB 1I8KA 2RB8A 2GSIA 2LVCA 2Z31C 3QUMB 5DJ8B 4ZUSA 4P5KB 1OD7A 3PL6A 1NCDL 3KXFE 5T1KA 5CSBA 2HT3D 2DQCH 4ODHL 3TT3L 2AK1H 3GRWH 3HG1E 3I6KA 5H94A 3TT3H 3RWFA 2UWEE 4BSWA 2MQ3A 5HGAB 1A7PL 5J0BA 3KPRD 4AENA 1DBJH 1BJMA 3QRGL 4C56E 5MEOB 5DMGC 4KI5F 1ORQA 2IAND 3BKJH 2B2XL 1CYGA 2IPKB 4XPTL 3W39A 3QXDB 2WANA 3MRKB 3TBSA 5D7LA 3ZDYE 2FZ3A 4YHLH 2UUDK 1A4KA 1KGCE 4JM2D 1F3DJ 2ADIB 3ULUF 5I30L 4S1QL 2VZ3A 4JANB 4LLMB 2ZZUT 3G6AA 1J5OL 1E4JA 3VG9C 3REWB 3VD3A 1I1FA 2V2XB 3NA9L 2DTML 1HQ4A 4AEEA 2WSKA 4Z7UB 4XBEL 5HI5C 2GI7A 3FO1B 1AFVH 4DFHA 5BVJB 2D3VA 3GMOB 3TN0A 2XNAA 5FUCE 4FTVE 2VE6B 2Z93B 2PYFB 1T03H 1LO2L 5GGSA 4UBDC 1ZTXH 3BGFB 5BV7L 2YBRB 3D18B 1Z3GH 5FECA 5I17A 3ZT5A 4HQQH 3OKMA 3PWVA 5D7LE 2XKSA 2OLDA 3MFFB 4U1JA 1WBXA 1QUNA 3IDNB 5HHQA 3BQUB 3ESVF 5FF6A 1YEIH 1PZ5A 4F7EA 3O2DH 5CSZA 3K3QA 5TF1L 5CINL 3IDIB 4D8PA 3U7YH 3D3VE 3UTSA 2VDQH 4LPXA 4PR5B 4M00A 4LVOC 3AVEA 3TPUB 4P4KB 1IEAA 1N4XL 3BZ4B 4WW2C 4LIQL 2E27L 1HXYA 3C5SB 2W65B 1H8OA 4BZ1H 5DD1H 5A2JH 5KSVA 3IFOB 1ODAA 5DI8B 4A6YH 3OPZH 1T1ZB 1MHEA 3RKDC 2C4FU 1YQVH 4Z78A 4D94A 3SJVA 4B53A 3EYQD 2H2PC 4URTB 3SE3C 3E1F1 4K55A 3VU2A 2K7QA 3H0TA 4JG0L 1A4JA 1B2WH 2G5BB 3GSNH 3RWEA 2E8YA 4PLKC 1ZVSA 4OBSA 5E8OB 3HZKA 1LQSR 1LP9B 5DEFB 4Q9RL 3QI9C 4HJ0C 3LB6D 5JW5B 1X5AA 1LP9F 1GGBL 1RV6X 4KDWA 4MD4A 4RGNB 3O2DA 3KPLB 4IRSD 1ZGLA 4NHCL 4RDQG 5EBMA 4U6XA 4L9LB 3WFDH 1GIGH 1W72A 1PQZA 3B6SA 1U8LA 5T3ZD 4YUEL 2W1NA 2XY2A 4X7TB 4ALAH 4PJFB 3P0VH 4XX1E 3DV4A 3O81A 2V6HA 4YBLB 4AG4H 1HH6B 1QSFB 5J11B 1CXHA 4GMSH 1BQLL 4LVEA 1HK6A 4HUVB 3NFPA 1VFBA 5GSVA 3LSOA 3L5JA 1SBSH 2BSTB 3HMXL 4PJBE 35C8L 3O6MH 3H3KA 4HWZA 1LO4H 3T0BA 3OX8B 1R5WB 1FGVH 2HN7B 1FGNL 3LQZB 3S37X 4WUUE 5AUMB 2VR9A 1BD2E 3VGAB 2C3VA 4K7FA 3F7YA 5ALCH 3G6DL 3WSQH 4NN6C 4ZAKB 1MREL 2BX5A 5F9DC 1HHKA 1YEDA 4ZO9A 4PJXF 5J13C 1FH5H 2V9RA 5ACLA 4KTEH 3EOAA 3RWGA 2BCKA 4FFWD 4D0CB 2X1OA 3RX7A 5JA9A 4OKVB 1I85A 2B1HH 1C5CL 5HHMB 1CXKA 1KJMA 3LEVL 4JFDB 3VG0H 4WWKA 1KCKA 2AI0H 1BOGA 2DKUA 5AWNL 4QYOB 2AEWA 2VZ1A 2R2HB 1U92B 3B3IB 4RISL 4G8GB 3DX6B 3AMKA 2FX7L 4QXTB 5ABDE 4XC1H 3DX6A 4G8GA 3B9KC 3QDGE 5GRYA 5DUPH 4MNGA 4ODTH 1INQA 3CH1A 3CFBA 4H20H 2R2HA 4QYOA 2K9UA 4WWKB 2OZ4L 1E4KC 1IQWH 2ED9A 4XPBL 1EEUA 4OKVA 4HZLB 3EOAB 3RWGB 4P2QD 3ARYA 4GUPB 3KNBB 1RUAL 5C09E 1JI2A 3U4AA 4LSQL 1YEDB 2VZOA 2YEZB 4Y2OA 3VXME 4PY8I 1D7FA 4PJDE 2D9QB 4HEPG 4ZAKA 5J89A 2WK2A 4NGHL 5IEKA 4M9PA 4IRZL 3TYGL 1PAMA 5EZOH 3F7YB 2H3NB 4POUB 2BNRB 5AZEH 2C3VB 5BRZB 5EBWB 1IC7H 5AUMA 4R97B 3LQZA 1MJUH 2ZG3A 1R5WA 5A43C 4HKZA 1CS6A 3OX8A 2Q8BL 3KR3H 4G6MH 3C8HA 2BSTA 4XNYH 3LSOB 4HAFA 4L1DA 3VI4F 3B2VL 2AJUL 5GSVB 4UV7H 5HGBB 5D7IA 4HS3B 4BFEA 2P1YA 1FFOA 5D72L 3JWDH 1HH6A 1KCRH 1QSFA 3DV4B 4PJFA 4X7TA 1CD0A 2QHLA 1UG9A 3ARGD 3LQMA 1KB5L 4LFHG 3JV5A 4NO0B 3QPXH 1U8LB 3B6SB 5F3BB 2ID5A 3L3OB 5D1QB 4U6XB 3VXUE 5EBMB 1RSFA 4J4PC 1DEDA 5HHOD 3VRLF 3ZKMC 4MD4B 4Y2DB 3E3QC 1OWRM 1YEKH 5GGQL 1D6EB 3HZKB 5E8OA 1ZVSB 2A38A 4LP4A 5HI3C 2DDQH 5LG1A 2JCCE 2C3XA 3RWEB 1AY1H 4QLRA 5F8RC 1GGBH 1G7QB 3I6LE 1I9EA 1BOYA 2G5BA 4P9HL 1A4JB 3H0TB 1AI1H 2P4AB 3WHE0 4Z78B 1EJOL 2VLME 4WTWA 5HVWA 4NZRL 3FAXA 5DI8A 1EMTH 3NFNB 3RWHA 1RQ5A 3DX8A 3Q6GH 1G9EA 1UM4H 4WEBL 5DHVA 4Z7UF 4NKOB 3NIFF 3BZ4A 3MBXH 4TSCL 2A74B 1H3WM 4QRSA 3UTSB 1WWBX 1QO3A 1A0QH 1IARB 2AGJH 4M1DH 1FLTX 3IDIA 2E27H 3MV8E 4MHHI 2K1MA 4PJ5E 5CSZB 2XA3A 4F7EB 3OXRB 1DUYA 1MCOH 3BQUA 5IB5B 3IDNA 5HHQB 3Q48A 1DBML 1UACH 4OCYH 1A9BA 3LCYA 5DWUL 3MFFA 2X1QA 1YDPA 3S3JA 1QRNE 4BQ6A 3CMOH 3PWVB 3OKMB 4HJJH 4LPUA 3WLWD 4G8FA 1QPPA 4QOKD 5I17B 4XNZB 5FECB 3CLEH 1A3LL 4U1LB 3QCUL 2HWZL 1NEZG 4UNVA 3S35L 4Z18A 2PYFA 4EN3D 2J8UE 2R2EA 4JRYE 1EVUA 5HHNA 1CDYA 3EZJB 2XNAB 2AJVL 3TN0B 2XQYK 4HXAH 1U8JA 2AJSL 2G60H 4PJEF 4WY7H 3V6OA 5I1KH 3ZSTA 5FHAH 3VXMB 5JOEA 4XTRC 4R8WH 2VDOH 4RRPA 1C1EH 4DEPB 1HQ4B 1G1YA 1I1FB 2V2XA 3SQBA 3CDCA 3REWA 1M7IA 4LLMA 4JANA 1FDLL 5CSGA 3HCVA 4JFYA 3VJ6B 5T5FL 2HRPL 3HUJF 3BIAX 1NGWB 3BIBX 4TNWF 1A4KB 1BQUA 3FMGL 2CRYA 1OF2B 2NLJA 3TBSB 3MRKA 4MX7B 4U1IB 2IPKA 2YK1L 3AXLA 4KVCH 3MA9L 6FABL 1RIUL 2ADFH 2EIZA 4UIKL 1AHWA 1MY7A 2C7UB 1T66D 1UH2A 1ZLWH 2F5BL 5C7XL 4P3CL 1L6ZA 5HGAA 1WV7T 3HMWH 3VXRD 3QZWG 3RWFB 2UY7A 5T1KB 1E0OB 5L0QC 5DJ8A 3QUMA 4YXLH 4ONHB 3D0LA 2GSIB 1I8KB 4X4YA 2A9NL 1CDIA 3GBML 1YUHB 2VISA 4PP2A 5L2KE 1JPGB 4NN7C 2D31B 3MSPA 3M1BB 1K5NA 5GGRA 1TVBB 5FV2A 5EUOF 3OJMB 4ZPTB 4R7NA 4DTGH 1LO3L 5GRXG 5KVEH 5F1KC 1SM3H 4L5FL 3C8DA 1U2CA 4JAMA 1VERA 4ZOEA 4PJ9B 5K9OB 1KB5A 5DS8A 3VI4E 3QUXC 5JXED 1LEIB 1JUFB 4RFNC 4CU7A 3GNMH 4H26A 1PEWA 2YA2A 2AVGA 3KS0J 4BSVB 4KTDL 2VDMH 4CU6A 1FVEA 1M1SA 2P49B 4HDIA 4AEFA 2HLFC 5EWIL 1MPAH 4G6JL 2V2TB 5IHUL 2VDPL 2EDXA 3QNXB 3UYRL 2OJZL 4LMQE 3BUYA 3E6HA 2XZAL 3DSFH 4LCWB 5JW4R 4PJGA 3FFCD 1BLNB 1GAFL 4FQIH 3LIZH 4PJFE 2A77H 1LE9B 3MC0A 3DX7B 2PCPB 1HSBB 2I27N 5LXGH 1RZ7H 4GW1B 4HD9A 2P45B 4QHKJ 5FO9B 5JPMB 5JW4N 4B5EA 3H9SA 4XHQA 4FFYH 3IU4L 1MSPA 5FYLH 1MHHA 4XVSH 2BXYA 1KCSH 4XP5H 5CP7B 4GRLD 4XVUD 4JHWH 4NHUA 4QHNB 3FB5A 1N5AB 1NMAL 1BZ9A 5DO2D 3HAEG 3SBWA 5IKCA 1F58L 3GMLB 3G04A 3TVMB 5DJAA 3PG2A 2VUOA 5I15H 1QHPA 1T89A 3HR5B 4EOWL 2DM3A 4EVNA 4EUPG 2OXGA 1NDMA 3DPBA 1N7MH 2UUDH 3TLRA 3EYUH 3KYNB 5TDNA 4WTZA 5JPNB 1ADQA 2WMPA 2FO4A 3TVMC 1QR1B 1U95A 4U1KB 5IK3B 4MAYB 1WJ3A 5TQ2L 4GRMA 4RNRB 1ZA3B 2IQ9L 4MXQD 5DVNA 4F33B 4IDJL 1KLGB 5CLTA 4YPGA 3U36A 4GS7C 2GT9A 3BEWA 3MRDB 4HUNB 4AZ8A 4ZD3H 5D1ZC 3MV9A 5C0JA 4IOFC 4KKAC 3PWJA 4M1CD 3LEYL 4LPVA 3IETB 3NZHL 4U2YA 3QG6A 3HZYA 1EHLH 4ELME 1T22B 4OZIE 4OUUA 3QUKA 3PV6B 3OKYA 4GKNB 5GSRB 5IHZB 1MRCH 4AM0A 4HLZG 4F3FA 4NO0D 4RFNB 4XI5C 1UA6H 3BI9X 2O61A 2Q7YB 3VFPA 3G5VA 1UGNA 2V5SA 5DK0A 4TYUA 1XGYL 2R1YB 2P47B 1HIMH 3SE4A 1GGCL 4QRQB 2EZ0C 1MCEA 3KYMB 4C4KT 4JFEB 2APTA 3X13B 1KJ3L 3V6FB 3RU8L 2R2BB 2ICEB 4XHJC 4LKXB 1N5YL 1U58A 2B5IB 3AY4C 3U1SH 1OTTD 3U48A 1XGTB 2ZUYA 5FKPA 2AK4A 5I1DB 5A40E 5EIIA 3EDDA 3RWCB 3C6SA 1IAKB 1RUQH 4OIIL 1V8HA 4OV5A 3UCRA 3GMPB 4NQVB 3S88H 3SDXA 2V5YA 4YHOH 3ZZ1A 4P3CH 3BPOC 1RIHL 4DVBA 1P1ZB 5D1XC 2HMIC 4OLUL 4YQXH 3QSKB 4HCRL 4FZEL 5HYFA 4KUZH 4ERSH 4NJ9H 2EEAA 5IIEA 3NCFB 5EU6A 2WBWB 3IFLL 4JO1L 5I1CH 1OAXL 1NGXB 4L8DA 3H42L 1N0LA 3MRLA 2ICWJ 3I85A 3MGOA 1MJJB 2ARWA 5IGXH 1NMBH 2CK0H 1T3FB 1CGUA 4GKSA 3W82A 1A8JH 5EU3A 1Z6JT 2IG2H 2ZUQC 4HJGB 3TM6A 4GXVL 3JBG7 1H9VA 3QXUA 1AGFB 2OQJA 1NQBA 1HHJA 4NQEB 2E7HA 4X9FA 5HJ3A 3VRIA 5ID1A 1MJ8L 1CDHA 1MJ7H 3ILPB 3PHQA 3BHBA 1A3RL 2P5WA 3MLXL 2AABL 4JFZL 4ZFOB 1FL5A 5IV2A 4R90H 3S5LG 1T5WB 4XBPA 5ESAB 4O5LH 1XCQB 1OQOA 1OW0C 4NUGL 4NWTL 5B8CC 3DX9A 5HHXL 1OHQA 2ZJSH 3MUHL 4YGAB 3B5TA 4Z7WF 3VI3F 4AJ0A 2W0FB 4DAGL 2X44D 4PV8B 3MJ9L 3RVTD 1CK0H 4K94H 2F74B 4JFXA 3H7BA 4Z7OF 4P2OD 4XCCL 4OF5A 1RK1A 3BDYH 1FL6A 2A6IB 4G42A 3WDHA 5KG9A 2CQVA 3V9FA 4ELMB 3E8UH 4WWKC 1WWAX 1VEOA 4MJ6B 1S7VA 3O9WD 3ARFC 1CFVH 5IVZB 4JFFA 1JWSB 4D3CL 4YC2B 3JVGC 4WFHE 1T7ZA 3MRHB 2IH1B 5GRVK 3RZCB 2NY5L 1XF2B 3VXPA 3C09B 3STZB 4TTDC 1FFPA 1A7OL 3D87B 4PJHB 2DQUL 3K80A 2X05A 1JF1B 5I66A 4IRSB 3MLZL 5GGVY 3ZE2F 5F44A 3OAZH 2DDQL 3TZVA 5TQ0L 2AJZB 1JPST 2ATKB 3VXSB 2E6QA 5IG7B 5I6XC 2AXJA 3MV9D 3WS6A 1UWEH 2SEBB 1VDGA 4L4TD 1HNFA 4LVNB 3KS0H 2JCCA 1PZUB 1EO8L 1FQ9C 1F8TL 3MJ7A 3RWJA 5ICZA 5E1AB 2YZ8A 1MCJA 1PYWB 3VFWA 5L88H 2FH8A 3OKEB 3VDCA 3TV3L 3AMLA 3FT4B 5I1AB 2H2SC 2NYYD 1ZSDA 3W11D 1KBGH 5IF0B 2JJSC 3Q1SH 2Z8VC 5FB8B 1T0PB 3WV0A 2DWEB 1QSVA 1VFAB 2EDLA 1KIPB 4MJ5B 1HYSC 5BV7B 1MY5A 3T0VA 4KJWC 1TQBB 1EEYA 1VA9A 3WJJA 3WDJA 2NY6D 3FZUC 2AV7A 5E8NB 5GS0H 1CXFA 1MFNA 5C9JA 1QFUL 4RA0C 1SHMA 3WN5A 4X8XA 2BC4A 4RAVB 2NPLX 1MFDL 2QSQA 1R3IH 3I3DA 2DLGA 5C0AD 5I16A 4GRWF 4ZO8A 5DUML 1J0YA 3UMTA 1MIML 3UAJD 4UDUA 4Q9QH 2B1AL 4XP6L 1OSPL 5J1SC 1CLZH 4YJZL 1FIGL 5HYJD 3D5OF 1F4YL 5FHBH 4NKDA 1CU4L 4WHTA 3V0WH 1NL0L 3RVWD 5BJTA 4JQVC 1C5DA 5D2LF 2Q1EA 2PN5A 1EEZB 4YBQC 2VXVL 5IVXF 4PYGA 2GK0A 3SOBL 5EU6D 4BZYA 2D9CA 4FMFA 3MCKA 4OD3L 4UQ3B 4IDLA 3BRFA 4PBWD 4O9HL 4LL9A 5MI0C 1OAUH 1NCUA 3SDAB 3TO2A 5KSAC 1NCBH 4GQ9L 1DCLA 2NY2B 4JRYD 5C0BA 1MAMH 2UV3A 5CFHA 2P8PB 3IAPA 3PF2A 3LS5L 4TUKH 2DAVA 4RIRA 3PWLB 1UZ8B 4DGIL 4KJYA 5JO5A 5DMIL 3W5NA 5E6ZA 2DIAA 2EIEA 4XNQA 5SWSB 4UTAL 3LN4A 1YPZB 3S9DB 1GRWA 4F7PA 1AXTH 5IT2L 1HINH 1L7IH 5E6IB 1WTGT 5D2NE 3MOBH 4XPFL 3LEXA 3IDYC 3MYJA 3UJJL 1EPFA 5KSUA 1WLHA 1TTGA 3BGFC 4WFGD 1D6VH 1J1PL 4PRDA 4OZFA 3BD5A 1T20B 5SWQB 1LD9A 2N1KA 3O8XB 3DYPA 5DK2A 1IAII 4YHZL 4LSDA 2H26B 1WIUA 4S1SH 4KGJA 3V6ZA 5JIHA 1S9YB 3SOBH 3DUSA 3L95B 3GKWH 4YDJB 3QH3A 4PGCA 1BF8A 2P5EE 4R96B 4KZDH 4I0PB 5DJZB 1L9NA 1E6OH 3VCLB 1B0RB 3P77A 1V3MA 4GAYA 1G9MH 2GAZB 4NZUH 2AJXH 4HUUB 4LKCA 3ARWA 2J8UB 3VFSB 1I3GL 1Y18A 4HAGA 3FQUA 4WTZG 5FHBL 3DGGA 4HBCL 4YDLC 3U2SA 1CDGA 3INUH 5IW3A 3GM8A 2CUHA 5J6HA 2A83B 5DUMH 1JGEB 2X70A 3T2NL 1BEYL 4L3ED 3ROLA 4GQPH 3TFKD 2OR9H 3GSNL 5TDOA 4LQ1A 2YN5A 4L9LC 5AD0B 5CEXB 2P7TB 2VLJD 5EC2A 4FZ8L 4O51A 3BH9A 2KL6A 1KNOB 3D3VA 1S7WB 1NAMB 3OPZL 3HC0A 3IS1X 1M7DB 1YZZA 4P59L 3U46A 5FA4A 4G8IB 5D2LA 5J6GB 3V4PH 3MV01 3GHBH 1NBQA 3G08A 4PRPE 1G0DA 5DUBB 1KBGL 4YHPB 1I4FA 4P5TA 4NSKB 5DK3A 5B4MD 4MWFA 3TBWB 1JIBA 4AY0A 5EUOB 3PABB 3HZVA 1CVRA 3OG6B 4ACPA 3DO7A 2EDWA 4UINL 3MV9E 2IFFH 4P3DB 3RDTA 4N1CA 8FABA 3IDJB 2HFEB 4YK4B 4PJ7B 4GW5A 1F11A 2E7MA 3MUJA 2LABA 3LN5A 3P4MB 5A2FA 3BP4B 3QQ9C 1KYOJ 1N6UA 1F5WA 3PWPE 1QFWL 2XI9A 4XVJH 5CJBA 3UTTD 1IKFH 4OI8A 3KPMA 3CSYA 1OB1B 1GH7A 4DZ8A 1JV5B 2Q3ZA 1NAKL 1FE8L 4TULL 5I19L 3FHAA 5CBEA 5I1IL 3QDGD 2W0KA 3ALPA 3NIGE 1H15A 2ZPKL 2ED8A 4I77H 4S0TD 3I6GA 3FN9A 4QT5A 3TYFB 3QDJE 2X2YA 4OSUL 3QFDA 1HH9A 3T0WA 4DOHE 1KTRL 3EO0A 5H2BB 4C58B 3F7VB 3QIBD 4CN4A 4DEPC 4W6XB 1LEKA 4D9RD 2NY4D 1SYVB 2XT1B 4JDZA 3SGKA 1LK2A 3IGAA 1S9WB 1CK0L 1U42A 2NZIA 4P46A 4UT6L 2Z8RA 1OSZB 1A7PH 4U3HA 3SDXE 3QP3A 4RBPK 3MX0A 4DAGH 1JZ7A 1E27A 3IKCA 5BS0B 1NLBL 3U9UA 4OLXH 3WEXA 3MMEB 1M05B 5DRWA 2Q8AH 3RGVC 3U7AA 2VLJB 2HLFD 1HSAA 2KDGA 1BFOA 3ZDZF 3CZJA 1A6AB 5SWZB 1YNTA 2R9HD 3P4LA 4Y2DD 3AAZB 2J88H 3K8KA 3HG1A 3T4AA 2VXQL 4FXKB 1AIFA 1INEL 3GI8H 5D1QD 4PBXA 2BVPA 3HFML 3LKOB 1PKQE 4GXVH 1X3DA 5ELIA 4OLZL 2AEPH 3BPNB 4NC1E 5LGKA 3QCVL 3JTTA 3O6KH 3DARA 3FAWA 3D25B 4MQ7B 4QF1B 4AEHH 2JJVA 1S7QB 3QUZA 2NXZD 1JHTA 5BZWA 4QNPE 1HE7A