5ISZE

Crystal structure of ls01-tcr/m1-hla-a*02 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
b'IGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAAGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIFGQREQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8(+) T cell epitope.
pubmed doi rcsb
total genus 57
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszE02
2A0LC 1DN2A 2AXGB 3H0TA 2BVPB 5KVDL 5FOBB 4M1GL 1R24B 2DYPA 1IFHH 4JGUA 3ELAT 5CWSB 3VFPA 5DQDL 5E24E 2DWDA 4LRIA 3V0WH 3HG1A 4YHKL 5EU6A 4MVBD 3KG5A 2D7PA 4N90E 1J86A 1CE6B 1U8OB 1YEDA 3T1WA 1KCSH 4XCNB 3F58L 4NHUB 5H94B 3SQOH 5F7DB 5DK0B 2DBLL 5EOTB 1UB5B 2RQ8A 5I6XB 4ZO9A 4HFWB 5ESVB 5FFLA 5L6YH 1ED3A 3MJ7B 2YRLA 5IHUH 2D31B 4MXQD 5C09B 2HG5A 1J7VR 1JYNA 1CE6A 4LHUD 3BAEH 3H6JA 4KKAD 5GGVH 4ZTPH 5HYSG 2JJSA 1MLCB 3NPSB 3HUJE 4GQ9H 4S1QL 4BUHA 5IEKA 3Q0HA 3LB6D 4YHOH 3ZSSA 3MUHL 4X4MA 1OCWH 3BI9X 5JXEA 2XPGB 5FCSH 4OI8A 3TYGH 2X4UB 1OSPH 4G8GD 2DDQH 5D5MB 5F1IB 1XF5A 4YXKL 3BD4A 1VCAA 1QRNE 3LRSA 4G5ZH 3DURB 1YUHB 5DJYB 2Z4QB 2AJVL 4P5MB 1K4CB 5L2JA 4XP6L 4OCYL 1J8HB 2X42A 3U36B 1W8OA 4JRYE 4P5KA 4OUUA 4J3UA 3GMLA 1BBDH 3C5ZD 4HC1L 2CUMA 4JDTL 4JHZA 4HZLB 3ARPA 5CEZE 5CEZL 4X8XA 1T04A 5DD0H 4MSWA 3DI2B 4YAQB 2P5ED 4ZOEA 3TBSB 3ZKXB 1GZPB 1QSEA 1RIUH 3H3KA 4OTXL 5DGRA 3FO0L 2VXQL 5IB4B 2GSGA 1GC1H 3DWTA 5DEFA 3H42L 2OTPA 1A7OH 3NFSL 4L8SC 1HHGA 4IMLA 2L7JA 3PGDA 3EYQD 4GRWF 4OZHF 4FQXA 2RFXA 4NDMB 2X1QA 1WF5A 3HAEB 1YN7A 1AR1D 2ZUQC 2XICA 3L3JB 5GGSA 3QDGE 3BKYH 2H32H 4I0PA 3H9YA 1YQ2A 4XVUC 5IHBA 2ICEA 3GSRB 2Y7QB 3NGBC 3KYNB 5I8KH 3RZCD 2DS4A 5GRVL 3FAWA 1IJ9A 4FP8H 3DURA 2NY1D 4Z5RA 4RFEA 2XXMB 1KFAL 2HLAA 3OAYK 3SBWC 5L0QB 4IRJD 1U92A 4HS8H 4QRQB 5SX5K 4YZFF 1SM3H 4LVHC 1IBGL 4PGBA 1BBJA 1P7QA 4FQIH 1L0QA 1NBVL 3BZEA 1Y0LB 5C6TH 1E27B 2YEZA 4X4YA 2P7TA 2VXTL 3TBYB 2FRGP 3QIWD 2IPKA 2AI0H 4AY0A 1YNTA 2JIXD 2CLZA 4Z76A 3IKCB 1MHCB 1KG0A 1KIPA 5KAQF 1U92B 3OKOA 3SEPA 4C56A 5HDOA 3MO1B 4NNPL 3ILPA 4Y4HB 5DJAB 3FT3A 3W2DH 5KVFH 2CLRA 3L3JA 2WP3O 1RJLB 4IRSD 5B38A 3PWNB 2ZCLL 1NFDA 4UILH 2NZ9C 4M62L 4OLUH 3UC0L 4NM4L 5EU3B 1NUFA 5J9PB 5C0BB 4DVRH 3BOVA 4L4TB 5JNYA 1JGUL 3S97C 1HQ4B 2BOBB 1KNOA 4ELMB 1Q0YL 3S4SA 2BY3A 1XF3B 3IDIB 4DKAA 2IBZX 3LRHA 1OQOA 1NH6A 4TQEL 3QEUA 3GGWB 4BELD 4YBLB 4CVZB 1T4KA 4HKZB 1UA6H 5GZNC 1JNNL 1LNUB 1BQUA 4WO4C 4RNRA 3MRHB 4Q6IA 5CCKL 1UH4A 3UTTA 3B9AA 2BSTA 5IQ9B 3DUUB 1I9RL 4QKXB 2OR8A 3QZWA 3O4LD 4JFDA 3GMQB 1S7WB 3GSVA 3V0VB 4KZDH 2P48B 1NCAL 1EAPA 1OAUL 3F8UB 1FVCB 2WBJC 2EDNA 5BVPL 1N4XH 5FGSA 4ZXBA 4DK3A 2XG4A 3K81A 3FTGA 1NGWB 2H9GA 3LEYL 2EE2A 3QUKB 1U95A 1GHFH 4NUGH 3AM8C 3MRLA 4C58B 4HWEH 2YPLE 2LAAA 4PJ5B 5JLZA 3DYPA 1RUQL 3DHJA 1FPTL 4KMTH 4RWHA 4OD3L 5DA0B 4S2SA 1FN4A 2FEDC 3BKJH 4OZGA 3WFCH 3RX5A 1A7RH 5C0FA 4NFBA 4PJCE 4GW5A 5D70H 4LEXL 4MNQB 4J3OC 3QI9B 4MS8D 4U05A 2Z35A 5K9QI 2HTLD 3S34L 3CVIH 3BZ4B 3P0VL 2ZG1A 2VNCA 1R0AL 1HXMA 5CGYC 5HD8C 4ELKA 1KPVA 3TV3H 3DVIA 2VIRA 4OM1L 5CGTA 1XCQA 3CH8A 3QDMA 3H9HB 5CIPA 2LFGA 4V2BA 4IMKA 4X5WA 3MO1A 1RV6X 1FE8L 2PYEA 3D25A 4BM7A 1G7QA 4J3XA 2A2QT 1KBGL 3T4AA 3JBG7 4WRLA 2Z91A 4PJBA 5DUPL 4M1GH 5JDSA 1NC4D 4ZUSA 1MWAA 3AB0B 3LY6A 4NRZA 3HUJF 4R0LC 5IQ7H 3QPXH 1MFDH 2Q76A 2I9LB 4X7SH 5KW9H 3IDXL 4RZCB 1XCTB 1Q9KB 4WHYH 5IROC 3Q5YA 5L8JB 2Y1VA 2ADGA 3HE6B 1ZVYA 2CR3A 4LQFH 1J0YA 4DW2H 1DN0B 5MEPA 3RAJL 1ZHBA 3G6DH 4P23A 4F7EB 1V05A 1OSZA 4ZSOA 3MRKB 5FUOL 4XCCL 3MV9E 4HAFA 3KLHD 4HKXB 1MVUB 2Q1EA 3T0XA 4GRWE 4I77H 4OZHE 5JMRA 2QHRH 2WK2A 5KS9B 1BQHG 1JYVA 1FVCA 3VXUA 2XT1B 1BZ9B 4ZTPL 1GYAA 1FH5L 4RX4A 2QSTA 5F88A 3BH8A 2YUZA 4YHOL 4CW1A 4LCUB 4EDXB 1W72B 1HILB 3UO1H 5JDJA 3BKMH 1X4XA 3UP1A 3UJTH 2NY4B 2EYRA 4XVJL 1OSPL 4TNVK 3KYOA 4I8DA 2GTWB 4JM2D 1QLRB 4L8CA 4YDIL 4R4FL 1QSFB 3UJJH 4QY8A 4LNRB 2P5EB 2MJWA 4G5ZL 3TBVB 4PJ5D 3OKKA 1FL5B 1X5GA 3CFCL 1QLFA 2Y07L 1ZHNA 3GSWB 1MCWM 4FTVA 4Y1AE 1OGAB 4Q2ZB 1ZHBB 4HDIA 3ARWA 1EFXD 3SKOB 1ZT4B 2I24N 2R15A 3L1OL 4HS6A 3RU8L 2EEBA 2WAHA 5C0AA 5BXFB 2RCSL 4GKZA 1H3UA 2R29H 3MX0A 1DN0A 4JKMA 5MEPB 1LE5A 1T6VN 3M8OH 4HSQA 2BNRA 1H3TA 1YEGL 1XGRB 4U1SA 3RZCB 4AIZB 2N1KA 4OLWH 3NN8A 3ULVE 4LDEB 3ET9F 3O3BA 4NO2B 2PW2A 3MLTA 3K0WA 3V8CA 2XN9E 2GCYA 2OSLA 2LVEA 1M1SA 1VGKB 2DQIH 4NQDE 1BWMA 4S1RH 1G7LA 3IETB 3KDMA 2LQRA 1JGEB 2JB6B 3O8XA 4HUXA 1MQKL 3D9AH 3JVGC 4CMMA 4MVBC 1CVSC 4LCCC 4PIRF 3QDGB 4UQ2A 5DRNB 1JE6A 4YDVB 3WS3A 3ARDC 3WL9B 5IMLA 5EO0A 3OKDA 2DLEA 3UCRA 1CT8B 4ZAKD 1XAUA 2GSIB 4MD5A 4Z7VE 1WICA 1QLEH 1U36A 1G7HB 3I75A 1U3HB 3P9MA 2C7UB 2VITA 3GIVB 3N06B 2CJUH 4H25A 1CDYA 4N0UB 5IMKA 1UJTA 3QXDA 5C6TL 2IBBA 5F9JA 4HIEB 3PWUA 4LPYA 1F42A 1HE7A 2OS7A 2JCCB 3KLAA 2ITDA 3SKJL 4M61A 5C1MB 3WJJC 2R2HB 4MJ4A 4JFDD 1P4LA 3O8XC 2GFBA 1SBSH 1G6RL 3B9KD 1TJIL 1Q38A 4ONFL 1SMOA 1EA9C 3S37X 1CDHA 3C5SA 3H0TB 5D7KD 1J8HA 4P4KD 4OGXL 5GGVY 4QRRE 4ZXBD 3NABL 3FFCB 4L9LC 4KJQD 1OGAE 5CJ8A 2F58H 5TFSL 2A73B 1NBYB 2H6PA 3LZFH 3W39B 3PHOB 5CILL 1ZS8A 3C09B 5EBGA 3QO1A 3KWWA 1QSFA 4M61B 5JA8B 1QA9B 3NA9L 2VYRE 5L88H 3LKQB 5DMKA 4XX1G 2P5EE 4EKXA 3LRSB 3BIKB 1HNGA 3FQNB 3LKNB 3PHQA 1P1ZA 4PJ9C 1UJ3A 2LU3A 2FHFA 4PB0H 2Q7YA 3O0RH 3D3VB 3VXPB 1IZKA 5E2TH 5EU7C 1DTUA 1DBBL 2H26A 3Q48A 3P4NB 4ODUB 5I18H 4IRZL 4QCIB 5GRYA 2PO6D 1FZJB 1GGBL 1NGPH 4FZ8L 5DLMH 1EEUA 3OKEA 3B3IB 3S3SA 4KZDL 3B5HA 4UMGA 4FQ1H 1FZMB 2XZQL 2Z31D 3KLDA 3TIDB 4K55A 3SCMB 4XBEH 3V6FB 2FLRT 3SPVB 2IQAA 1NSNH 2IGFH 3NIFE 4YFLF 4UNUA 5C09A 4MX7B 3MOBL 3U0WL 3D87B 1C5BL 2Q3ZA 1RZJL 1JPFA 4NUGL 2XKNB 1HDMB 3VFNB 1N5YL 3CVHB 3X12A 4JPKH 3ZYOA 4EUPH 1HYRC 4NCDA 4NYLB 2H2PC 3GUTB 1BBJB 4KI5D 1C16B 4PV8B 4KMTL 4JGJA 4OT1H 1V3MA 5F97E 6FABL 2F54D 4G42A 3IFOA 2WWMD 3WFCL 3DVNA 5C6WH 2CKBH 1JPTH 2YD2A 3QA3A 1P1ZB 4LSPH 3RWIA 3U4BL 4C56E 3KXFA 1QRNA 3KHOA 3UPCA 3UBXB 1B6UA 3KVQA 4HKJB 2J3SA 1M71A 2BJMH 4C57C 4HK3J 2IH1A 2R2EA 5MP6H 4JDZA 1MAML 3GHEL 3CDGA 4QXGL 1HXYB 1OTSD 4WEMB 4LAQH 4F15C 4TPRH 1UCBL 4LEOB 2AJUH 1MHEB 3ARDB 4ODHH 4AIOA 1P4BH 4OD2A 1N2RB 2D7NA 4QOKA 1ZK9A 1OP3H 3AS0A 1JF1B 3CZJA 3NACL 3TO4C 4F7CB 4RX4D 4UZGA 3WLWD 5E5UB 5JIIA 3WN5C 1AGCB 2ZZUT 5FYKE 4L3ED 5D71L 3UTZB 4JKKA 4M7ZC 5J6HA 1TNMA 4JRXA 2NY2B 3UDWC 4M03A 1YDPB 2LTQB 4Z7UA 3ZDXF 1H0DB 3BIKA 3CFEB 5E4EC 3IDIA 4KZEH 5DZLA 2O5XL 4KHXH 1M71B 4LQFL 1KCLA 3TNMA 1SYSA 1NL0L 4DN4L 1Q0XH 1RURH 4Y5VC 4GJTB 3BHBA 1OQXA 1YEJL 1N0LA 1FQ9C 2BFVH 4Y4FB 1G9ML 1L7IL 1Z9LA 5F89A 3V4UL 2AEQL 5DZOA 4DGIH 1S7WA 1BMGA 2X10A 2IAMC 3T4YA 1U8JA 4WY7L 3GBML 4PS4H 5DJZB 3ARVA 3S37L 4K2UH 1R3HB 4S1DC 4Z77B 4LSTH 4J3VA 4UV7L 2A83B 1B0RA 4EI6B 3VFWB 4L8BB 4WTZA 1A22B 2V17L 3QG6B 3QWRD 4POZC 5DEGA 4GKSB 4JJ5A 3W81A 4S11A 1LO0H 1XF3A 4EN3A 5HVFB 1U8JB 4NCC2 3HZMA 2Q7NA 3DTXB 1T0MA 5I1JL 1J0ZA 1ZOXA 1MVFA 4KDTC 1RUMH 1JJUA 4ONHB 5C08A 4WDIB 5JXAL 3KPSE 2GY5A 3N50A 1MUJB 2KKQA 1IQDB 4L4TE 3QDMB 4BSJA 3BEWA 5C0BE 2MMXA 4MNGB 1CL7L 3BH9A 2APWA 4YBQC 3NIDF 2RFXB 4NDMA 5D7JB 4ZOBA 4ZAKA 1GAFL 3FQWB 4XC1H 5C2UB 4KKCC 4PJEE 3D2UB 3MROB 4ZOAA 3RWCA 3TBYA 3S36L 4LGRB 2RCSH 3HE6C 4OLXL 4BH8B 4A2LA 5ADPH 1P69B 4BQ8A 4P9HL 4ZUWB 3TA3D 2FEDD 3CXHK 1LDPH 4Y2DC 4MNQA 4LRIC 4ZS7H 1S7UA 1SMAA 4KDTA 4Q74A 1YC7A 3WFEH 4XRCB 2E9IA 4NQUA 5ITFB 5KOMC 3W5NA 1RY7B 5TDOA 1T22A 4JLRB 2FYYB 3MLZL 4YHYC 3QEGH 1KJ2H 1CDJA 2VQ1A 4OAWA 5L7XH 3WXWH 4I5BA 2AEIT 3CMOL 1FC2D 3KPRB 3O2VH 4LHUA 3CXDL 5KN5A 1S7UB 1JNHA 5DEZA 4QTHB 4MD0A 5HI3D 1QLEL 5BW7C 3HB3C 3TM6A 1WFOA 2D4DA 3UBXG 1X9QA 2W0FA 4CVZA 5K9OA 4AT6B 3NCCB 3CDCA 1W72A 3QI9C 5DJDB 3QDJA 3BZFB 1AP2A 1DANU 4QHMB 3T08A 1HH6A 5JZ7D 2VXVL 4K7PY 1YMME 3SKJH 3TVMB 1OP9A 4PJDA 5D7JA 3VXRD 1NFDB 3BIBX 3MROA 1TVBA 4JRXE 3X13B 4XAWL 3QDAA 4KDWA 4WU5A 2OZ4A 4Q97A 4UNTA 3VRIB 5BRZE 5E70A 4HIIB 5HHOD 1HYSD 3P77B 1U0QA 1XGUB 5C0AE 4JREB 1J87A 3OJDA 1TJHL 3JTTB 3LEVL 1HYSC 4HC1H 5FA3A 1DCLA 4U3CA 3NIGF 4YC2C 1KTDB 2NR6C 4M1DL 4FFVD 2CIIB 3WDIA 5C0FB 4I2XB 5C9JB 4ZODA 4CMHB 3ARSA 2FGWL 4WFHD 1Q94A 3GMOB 1DBBH 1VSCA 5I18L 4PRBA 2UYLA 1TDQA 3L5WB 4XTRD 1XGUA 4L3AA 1KGCE 1NGPL 1F3RB 4FZ8H 3ZT5A 1I1AB 2ADFL 3HAEH 4XTRC 5FA3B 3ARFC 1YNKH 2G9HB 4PRPA 1CIDA 2ADJB 1S7VB 4FFZL 4LARH 5JQ6H 1MCPL 1NGWA 1QACA 4KMLB 1F8TL 4OKVA 3SGDI 4ELKB 2R23A 2WMPA 4I0PC 5L2KA 3C5ZB 3S96A 4JDVB 2GAZA 1TVBB 1FV1A 4P4RA 1DP0A 4RFNB 5FA4A 3K46A 1RHHB 4QY8B 1YMMB 1OGTA 1MCNA 2AGJL 2X4QB 4N9OB 4Z9KB 3FHQA 4QWWD 1MY7A 2GT9A 2MCPH 5C0DA 1S3KH 5TE4H 1DLHA 3CLEH 3MJ8A 4YFDB 5E2VH 3S96B 1R3IL 1CD1B 3KAAA 4XNYL 4Y8DC 3IB4A 3QNYB 1QFWM 3MR9A 4O00A 1BD2D 3H7BB 4UT7H 1N7ML 4TSCH 1OARL 3M17A 5E08L 1CFTA 4GG6E 3V6ZB 1RK0A 5JOPE 2FJHB 2AV1B 5KS9A 5KVGL 1H3PL 3BQUD 4X9BA 2R1XB 3ULVH 4PP2B 3LKPA 5IFJA 1IMHC 5EZIH 1AI1L 3TVMC 4F7EA 4NJ9L 5J0BA 5GGQL 2DQFB 3ZO0A 5I1LA 3EOYG 4MB4A 1VFBB 4KTYA 1F4WL 1KN2L 5MEQA 1AR1C 1P84K 3QUXD 2XZAH 1EGJL 4MAYC 4HULB 1D6VH 2X89D 1EMTH 3BSZL 1H5BB 4GKNB 1UYWH 3QXTA 4WWKD 4KZEL 2AK4A 2ZP0T 3THML 4JB9H 3T3PF 3DBXB 3MGOA 1KYOJ 3G9AB 3VE0A 4JGMA 2EDHA 4NO5A 5JPNA 1MQ8A 4OGZA 3JWOL 2J4WH 3ARDD 1OAUH 2FHCA 4YHYB 4FZEH 2HMID 4XCFL 5DD3L 3SDYL 4P3DB 4R4NC 1WTLA 2J5LB 5MI0C 2W9EH 3MRGB 3OQ3B 1HWHB 4PYHA 1D9KA 3KNBA 4MZ3A 1MAJA 4J12A 4LOUC 2AABH 2VLKB 3PHQB 2EECA 3ETBF 3CNKA 3VA2C 4QHUA 1T83C 4A6YA 4K2UL 4HUNB 4DZBA 2BVPA 4Z7QE 4PJEF 1IGTA 1FZKA 5SWZD 3ARBD 1A1MA 2FBOJ 3BESR 4MDJA 4G3YL 1NCBL 5HYIA 4F7MA 3MRFA 1U8OA 4PREA 3MRQA 4K3JL 5DJCA 4L4VB 3NPSC 1UWGL 1BQLH 3MSPA 4G8IB 5KSAA 2MQ0A 1OGAA 4OM0L 3S34H 4PJGA 3RDTD 4IIQB 1PG7W 3T8XA 1GGCH 4RRPA 3P4MB 4X6CA 2AKRB 3ULUC 1W72H 2W92A 1WV7T 5AEAA 3GRWL 3CPLA 2N4IA 1CXFA 2YA0A 3VMNA 1MF2H 1VEPA 2AV7B 4PRIA 3E2HB 3MRMA 3O4LE 4FQLH 4Y19D 5IW1B 3I75B 5J06A 1FE8H 3KPOA 3S36H 2V6HA 3ZKQD 4M43H 1FZKB 4HKBA 4JN1H 3RPIA 1R5VB 4WW1A 2PN5A 1MCSA 5F6IB 1E4KC 1OTUC 4JM4H 1TCMA 5E6IB 4CRPA 3MREA 3FB7A 4NC1C 4MJIE 1WEJH 2EZ0C 1D9KB 4H25B 1JF1A 4D9QE 5CBEA 4Y4FC 5ENWB 5IB3A 1CFQA 2NW2B 1P6AB 1HKLL 2DLFL 3VFTA 4V1DE 5DSCB 3T3ME 3MFFB 1FIGL 1YMHB 3WKMH 4C59B 4D0DA 5L7XL 4XAKE 3WXWL 5HVGB 1MCOL 3UTQB 4N8CH 2CDFA 3CFBB 4JJHA 3RWIB 1AO7B 5KSVB 5HI4C 2LTQC 1DUYA 3GO1H 3BP6B 4PR5B 4RBPH 1NUDA 3TO4D 4PRHE 3OAUL 1I4FB 4WFED 1WUNT 1CIUA 2VSDA 2IPKB 1N6UA 4JJ5B 4PJ5E 3LIZL 5D96C 5FHAL 4WCYL 2OR7A 3L3HA 3LDBB 1FGNL 2VLLA 2R0WH 3OPZL 1T03H 1DE4A 5K9JL 3L7EA 5FKAB 3MLUL 3O45B 1R3LB 2VZSA 3H9ZA 1DVFD 4NZRL 3V6FA 1T7VA 5E6IA 5EBWA 5ESQB 1UM6H 5I1HL 1TJGH 2ZUYA 3CSYB 4KV5F 1PKOA 2A6KB 1D5XB 2ZOLB 3KHQA 2GTZA 3FO1B 4LU5L 1AXSA 4GKOA 1NMBL 1TJHH 3CFEA 3FB7B 3ESVF 1S9WA 1BVZA 4HPOL 5IF0A 2HWZL 3C6SA 1QPXA 3VFPB 3L1OH 2W65A 4UB0H 2NZIA 3VFOA 4K9EL 4I3SH 4M5YH 3I50L 4UT6H 1FAKT 3MGAA 1YUHA 5DJYA 3MLXL 3EDFA 3D39E 1FSKC 5D1XA 3EZJB 1H8SA 5JW4M 4HEME 4ORGA 5KANG 3HR6A 3OMZA 3I2CL 4MSWB 4FFZH 3O45A 5GGSY 5FK9A 2VQ1B 4KFZC 4JPIA 1EFQA 4IM8A 2R9HD 5TH2A 4PB9H 3JVGA 2R0ZH 1MOEA 5T3ZH 4QRRB 3D9AL 3A6BL 4ZPTB 2I9TA 1DQLL 4OZFG 3Q6FB 3O2DL 1BVKB 1GGIH 4U6TA 5IR1A 5I1AB 4U0RB 5EG6C 4AQOA 3KPQB 4N8VB 1A4KA 3QEHB 1PDKA 3LD8B 3LQZB 4QTIL 1CCZA 2X4SA 4I4WB 3PIQB 1ZEAH 4LCWD 4N0UE 1A6VL 1CZ8H 2EDWA 3MBEB 4KROC 4UV4H 5DR5L 4WU7B 1D5BA 3QHTC 5FYLL 5JIPA 3IDNB 5DMJB 2VDQL 1T0NA 5HGAA 1S9XB 3U0PB 3BZ4A 3DO7A 2H45A 5ADOL 1A64A 4P49A 3KPLA 4NQCD 3HMWL 1A3LH 3QHZH 1KB5L 5F9OH 1U9KA 5IMOB 4L4TA 4DWHA 5FUZH 1BP3B 2NY7L 5BOPA 3E1F1 4MNGA 5M7QA 2LVCA 2W91A 3H9HA 4OGXH 1G6VK 2VTFA 5CIPB 5CFHA 3PWJB 4FFWD 3ALPA 5BVJB 4ZQKA 4NQDB 1CLYL 2BVQB 2YZ8A 5HDLA 3LZFL 3ARGC 2F74A 2AJYH 5HSFA 4WNQA 3QG6A 1AC6A 4V1DD 3SQBA 1ZGLM 4K8RD 3GSXB 1EXUA 3QUZA 2QL1A 1OD9A 3GSUA 3LS5H 3W0WD 1UJ3C 1BJ1H 3WFZA 3VH8B 3C2AH 4JO2L 1U6AH 4E42A 1U3HC 3MLSL 4PJIA 2P1YA 2V7NB 2IADA 2FDBP 4M8QA 1S7XA 1SJXA 3HLAA 4Z77A 5F7EH 4QTHA 3NAAL 4MA7L 4G43B 2EDXA 5IHUL 1CXLA 4CVXA 3FTGB 5TGBB 1TZHA 1UG9A 1UACH 3B9VA 2BNRD 3G5VA 5H8DA 5CEXB 3JWOH 3RDTA 2OI9C 1KJ2B 1VFAA 1X5JA 5C07E 3U4EB 1HKFA 1CF8L 4GLRI 1NFDF 5D5ME 4S1QH 2W9EL 3KLSA 2O61B 1T66C 2EYTA 1RZIB 1T4KB 3O81A 3U0WH 1RHHA 1C5BH 1IAIL 3T3MF 1UWEH 3MRHA 3PABA 4M3JA 4HGWB 1HZHH 1FP5A 3HZVB 3T0AA 1NAMB 3O3DB 3QQ9D 4Y0GA 3QJHA 2W60A 4ELMA 5CP7A 1CD1A 3K8LA 5C7XL 4U1JA 4XBPA 3GBNH 3EDDA 2PNDA 1EERB 2EKJA 1KEMH 1XGYH 4NT6B 3BGFB 1FNEA 4NZDA 5I1IH 2G9HA 5GSRA 3CFJA 4QWWC 1YEKL 5KS9E 4ZNEE 5DJ0A 4RQQB 3IF1B 4JZJB 4PJ9D 4P23B 3ZDXE 4XHQA 4D0CA 3RFZC 4QXTA 2W0PA 2EXYD 5DJ8B 1I3GL 3C5ZA 4UI2A 4ZFFA 4Q9RH 1FNGA 1V5JA 2NY1B 4QXGH 3P73A 4WW2F 2H32A 1QTYT 1MJ7L 3D18A 4HAGA 4M48L 4Q6YA 5FYJU 1PG7X 3HC4L 4NQXB 3VFGH 1INQB 2OTWA 5BXFA 3IRZA 5I1KH 2VXQH 2QSCL 3TO4A 4HG4J 1MRDH 4PJ7E 4XX1E 2A74A 3B8YA 2FR4B 2BNQA 2DQFA 3B9EA 4GRMB 4MA3A 1G7QB 1K8IA 4PJFB 4PRBB 2QQNH 2HYMA 2W9LA 4LHQB 3BIAX 4M1CC 4WFFE 4PP2A 1O0VA 4N8PA 3S5LA 1OY3B 5KVMC 1SJHA 3KJ4B 1F45A 4S0TD 4KKAC 1ULVA 4Y88A 5HYQB 4GMSH 4GKZB 1LD9A 1ZVSA 2W1NA 3HZKA 3BP7A 2GITA 4KHXL 4LLYA 1IM9D 3IDUA 1X7QA 5EB9A 1A1NA 2FECI 5GS1C 4JANB 5GS1B 3UPRA 2EDKA 5HI4D 1FO0B 3MLRH 4IOFC 2ED7A 1A1OB 2AK4E 1NC2A 1FYTA 2V7HB 5E03A 1RMFL 2P5WE 3MR9B 1I3RB 3EGSA 1EHAA 3IDJB 3TN0A 3NCJH 2IAMA 4WHTB 1QOKA 1CGYA 1P7QD 2AI0L 3VXTA 1DVFB 4WY7H 5HXMA 1RULH 5I66A 1UT9A 4K8RH 4XPTH 3WNNA 4LSTL 5C0JB 5D7LB 4MJ6A 4HH8A 4N9GB 3C8KA 2E8ZA 2AJSH 1MEXL 4ZD3L 3PQYB 2XNAA 3O11A 4MJ2A 4KHTH 4PP1C 2FH6A 3VXOA 1MVUA 3GKZA 5HY9B 1JGUH 3RI5F 1QBLH 1JMXA 4W81A 3U7YH 2NY1C 1RD6A 3W9EB 3MRCA 2FX9L 2ITCB 1Q9KA 2W59A 5F6HI 3S88H 5ALCH 1YNLL 4PJFF 3MLWH 1NCTA 3IJHB 4S1DD 3T8XB 4KJWD 4RZCA 4X4XB 2AK1L 1PKQA 4QRTB 1EDQA 4G8IA 5KSAB 5LWYL 2XY1A 5HYJA 2HWZH 2P42B 2UYLB 2DQCL 3O2WL 4RDQG 1C08B 1ZT1A 4XNZB 5DQ9B 5IP4A 4IS6B 4CU7A 2HJLA 2VKWA 2WP3T 1T1YA 5C9KA 4UT6L 3O4LA 4X98B 4KJYA 4XNUL 5BVPH 4WUUE 2Y5TA 3HFMH 1NC2B 5BCAA 1XR8B 4X99A 4Z95H 2XFXA 2I5YL 4D94A 4IRJC 3MLVL 2VISA 1DBKH 4ELME 3HE7D 4FXKB 3VXMB 2B1HL 5EA0H 4L8DA 2VH5L 3HMXL 5F7MC 1IAKB 1FZOB 1MWAH 2OI9B 2VC2L 4TSBL 2YK1H 5H2BA 3X3FH 1JYXA 1FPTH 4MLIA 3SDDA 4NO2A 2B0SH 4I48B 3B3IA 1EK3A 4G9FA 5ISZA 1QNZL 4HQQH 4V1DA 12E8H 4JHBA 5BW7A 3ROLB 3TESA 1TQCC 1AXIB 4UT9H 4IRSC 3TJHD 4PRAB 3VDBA 4XBGA 4JAMB 3BPCB 3IFNL 1XF1A 2BRRH 5T1LD 2CDFB 4YXHL 3OR6A 3CPLB 5GS0C 1H3VA 3IXTB 3V6ZA 1R24A 2L4OA 3ARGB 4H8WH 4YWGH 5FGCE 1DANT 2LU4A 5J3HD 5I1CH 3HMWH 3QHZL 1KB5H 1MCQA 4LCWE 5D7KE 4XPHL 1JGVH 1I7ZA 5GGRB 4YDJA 2F9BT 4WHCA 4X9IA 5DC9B 4YXLL 3PGDB 3VU2A 1KLUB 5DURD 5HHMB 1FJ1A 3IXAA 2DQGH 2ATPA 2GFBB 4XWGH 1QBBA 1HHKA 4HUKB 5D5MF 3RY6C 2AXFA 2WIIB 3QPXL 4JFOB 4ODTL 1P5UA 2XIDA 4DZBB 1BVLA 3RUGB 2FB4H 3VFOB 3MBEC 2C4FT 4LEOA 5D7IB 1YDPA 5EOQH 1RI8A 3FO1A 3PJSA 3VXRB 4XVSL 2FGWH 2P5WA 5IFHL 4WWID 2ATPB 5HGHB 5BJTA 3LD8C 1II4E 3SDDB 4NN7C 4P23C 2VR4A 3QUYA 4H88H 2OLDA 4CMMB 2NX5B 3NGBB 2KDGA 5IF0B 2ADFH 3R4DA 1YJDL 4YDVA 4JRYB 2ZUQB 3CX5K 3P4OB 43C9B 4DCQB 1JFQL 5IWLC 4Y4HD 5JQ6L 1J8HE 1MCPH 5TE6H 2YD1A 3S36X 1YNTB 3MRQB 5E00A 1X44A 4P2QB 3MRDA 4LRNH 1KG0B 3OR6B 4HH9B 2R9HC 2X4TB 1IAIH 4PRHA 4RA0C 4EIGB 5GJTL 2FGZA 3UJIL 2XV6B 4LLMA 2C3VB 4M3KB 3C60B 2IALB 4DGVL 5C7XH 4HJ0C 1ACYL 3ZKND 1YEEL 3REWA 4WI6A 1S3KL 3CVHA 1CG9A 4NWUL 4U6HA 4ALAL 4CN1A 4NNYA 2PTTB 1FG9C 5IW3A 5CD3B 1IM9A 4KVNL 1Y18B 3MREB 2XZZA 4EBQH 3WUWB 2HT2C 4WUKL 3WIHA 3V5DB 3MJ7A 4ZUVA 4MDIB 5IBUG 1N8ZB 2JK5B 1JZ7A 3VXRA 1CFQB 5AZ2H 1RJYA 4FQCL 3RBGA 1MCDA 1UJ3B 3WFBH 1FZJA 1IGCL 3UTZA 2DJSA 3GMMB 4OLWL 1G9NC 3AUVA 2Y36L 3PIQA 4I4WA 5EUOF 4D9LL 5D96B 1YPZE 3O3UN 5HHOA 3GK8L 1F4HA 1C5CH 2F53B 1KCSL 4HT1H 1T04B 1BD2B 1KIRB 3BJLA 2XZAL 4BZ1H 1EGJH 1D6VL 2DBLH 1KTKE 4G43A 4OGAD 5D93C 1B0GB 1T22B 4JLRA 1YYML 2Q8AH 3FKUS 3QNXB 4M8QB 1QVOB 4PJGE 2RAMA 3OX8B 1MHEA 3ARDA 3ZE0F 1FNFA 3TH3T 3TBTB 3MXWH 4X6EB 5HYSB 3DNKA 4NZUL 4LLWA 3CC5B 1E4XH 3KPTA 4K7FB 2VLLB 3DMMA 2NY6C 3QIUC 3HZYB 5ESAA 2G5BA 1HEZA 3DRTA 3B83A 3QZWB 4JFQA 5F96H 1D9KC 1EAPB 2FYYA 1S9VA 3IGAB 5ANMB 1QFPA 4DUVA 4MQXC 1WGOA 2AQ2A 1BFVL 2VOTA 5L2KD 5F7UA 1D5ZA 4ONFH 4WWKB 3ULUL 1AGDB 2DDQL 4K3DL 1A6WH 2HLFC 5KTEL 2EC8A 3O6LL 2XPGA 4UUJB 4G3YH 3SKMB 2E7LC 5C08B 1S9XA 3DVFA 2RB8A 3E2HC 4YHLH 3K8MA 2FATH 5KSAD 3WIHH 1TZGH 3KPLB 4LBEA 4P4KA 4D0CB 2ZKHL 3OXRA 4OKDA 5C0ND 5HVHB 3EFFA 4ELMF 1HHHB 1UWGH 5I75B 1WSST 4O2FB 4KRPC 4PGZA 1YC8A 1X3DA 3B9KB 5SWQA 3OB0K 1UM5L 4XI5C 1LO3H 3DX6A 5HYEA 1EO8L 3SN6N 5TQ2H 4LLVB 1FN4B 3AROA 3K2MC 1G9NH 1MF2L 1T0MB 4PP1D 2PTVA 4NN6B 2I9TB 3QJHB 5D7LD 1GGBH 4LSRH 3MBXL 3O9WD 2EC9T 1A9BB 5IR1B 4FQ1L 5D2NE 1E27A 2H8PB 4M43L 4NKIH 3WO4B 1NMAH 4C4KT 3MV7D 3DMMB 3N1PC 4LSQH 4WUUA 4P4KC 3B2VH 1GZQA 2Z9TA 1SYSB 2I5YH 5DRXB 1Z0MA 4LCYA 5F1NA 1LDSA 5IT2H 4P3CH 4XP1L 4KY1L 1L9MA 4JM2B 3UBXI 3X13A 2M8XA 3RDTB 1FFNA 2CRMA 4GAGL 3LDBC 2HVJA 5JUEL 1NGZA 4PV9B 3GMQA 2NTFB 1C1EL 4KQ4H 2Z31B 4OF0A 3VXNB 2CK0L 3WKML 4ZOCA 4QHNB 4OT1L 3TN0B 1KCRH 1U8MA 2P5EA 5IB1A 5L8KB 5SX4I 4PJIB 4UQ3B 3RA7H 2F54A 3U4BH 5HDBF 1I3RA 1U41A 3EGSB 3HI5L 3MRPB 4F2MB 3IVKA 5EOCL 1NEZB 1Z3GH 3FB6A 3VGFA 2P5WD 4MA1C 3MODH 4LSVL 3BH9B 4JFFD 1ADQL 5KAQG 4WCYH 3U9UA 3W2DL 3V6OC 1T66D 1UCBH 3FL7A 4KPHL 5SWZA 4GBXD 5J8OA 4K3HA 4E5XA 5E9DB 1IL1B 2FIRT 2CMRL 3WJLC 3ZTJG 4OUUB 5E6IC 3UPRB 1JPGB 5FF6A 4OFYA 5D2LF 2IH3A 3P0GB 1TJGL 4ZTOH 4WHYG 1CDGA 3EYVB 5D71H 4DQOH 1P2CA 3QO0A 4M7LL 1KJMA 4DKFL 5LGKA 5MHSD 1MRFH 4X7EC 3JWDC 5C70A 3OJDB 1FNLA 1N5AB 5ID1A 1K8IB 4PJFA 3BGAA 5FF6B 3MRNB 3JV6B 2ARJA 5FAAA 1I9EA 2CO7B 1OHQA 2FCBA 3LPGA 3N0PB 4QRPA 4OD1L 2Z8SA 2J7LA 5HYJE 1FNEB 4RFNC 4PJDE 1ZA3B 2EDOA 1J10A 3ZDYE 4PLKC 4X6CE 3QIBC 2J8UE 3HPJA 1L7IH 5DJ0B 3RNKB 4Q2ZA 2DTMH 4LSUL 2BHYA 1ZV5A 4ERSL 2IQ9H 1SJEA 2DOCA 3C60D 3FN3A 1LEIA 5CEYB 2VLJD 2I07A 3S37H 3NIGE 5KVEH 2UVFA 3PABB 5BRZA 3VJ6B 5T3ZL 3HE7C 1RUQH 4XC3H 2NW3A 3B6SB 4EI5A 1J9CT 5E95B 2W60B 1V3KA 1I1AC 4U7KA 4MXWH 4CNIA 1ETZA 2BERA 1SBBA 1A7NH 4GRLC 5J56B 4KK6C 1I8MA 2HFGH 1HNFA 3BUYB 3T77B 4XMKH 3HI6H 4MCYB 5I19L 1ZEAL 2R8SL 4NNXB 5B3JF 4ETQB 3E6HB 3CD4A 1RVFH 4ZDHA 2IANE 5GJSL 3RL2B 4L4VA 2C3XA 4PJ7F 1I85C 2CDGA 4OZHA 3ZZ1A 3CVHH 3PG2A 4JRYD 4HF5H 4NKMA 3ZL4H 2XTJE 4HLZH 4JREC 5SWSE 2BVUA 3QXWA 5A16A 1WZ1L 3NZHL 3SOBH 3BWAA 1FORH 4ZNCD 4XBGB 1WISA 4KKBD 3L5XH 3MJ9L 1J05A 1UXSB 1JGLL 4MAYB 5IBTL 4AMKL 1NGYB 2FO1A 3B6SA 4EI5B 3TBWA 3ALWA 3RKDD 3WFBL 1X6LA 3WFHA 1FBIL 1VGEH 1BM3L 1G7IB 5D6DA 4QHUB 4R97C 4AL8H 4Y5YC 4F33A 4LIQL 1QD0A 1LNUA 4Y5YB 2UWEB 4JVUA 3DUHA 3UTTB 3QULB 5JDSB 5DRZB 1CDBA 3RIAK 4DOHE 2XTLA 3D85B 5KSBF 3MGOB 4CNIB 1WCQA 2EIDA 5KG9B 3SDAA 4X6BB 4HS3A 3SDXE 4DW2L 5HPMB 5DUBA 1BIHA 3CDFA 2NY5C 3MYZA 1LHZA 1ZA6B 3C6LC 2YA1A 3MRNA 3O2VL 3MC0A 2YMXH 3V4VL 4C4KO 1MREH 3WFDH 3FOMA 1YZZA 4EQ3A 2ICCA 2RIKA 4DJMA 3MNVA 1PEZA 3MOAL 4DOHB 3KXFB 1HQRA 4X6BA 1UENA 2NZ9D 3ZYJA 5F96L 4X4XA 2BVTA 3RKPA 1JTOA 2DWDB 1DBMH 5J1TC 1S9YB 1F3DJ 2HLFD 3IJHA 4HH9A 4PJBE 3DPBA 3UDWA 2CGRL 4CU8A 4CJ0A 1PX3A 1V7NH 1M7DB 4Z7UF 4U6YB 4HS6B 2XKNA 2WQRA 5C0EA 4M7LT 5I1LB 4ISVB 4NFCA 1X4ZA 3GBNL 3GNML 3U6RB 1U8HA 5SWSB 4LCWA 1KJVA 2AKRA 1MHHA 3CFCH 2Y07H 3MCKB 5IHZA 1Z9OA 3GJEA 3CUPB 2VABA 2DKUA 2KQMA 2JB5H 2WBKA 5GGUA 2FX8L 3I6KA 1WIPA 5IV2B 1MPAL 1LO3L 2PUQT 1BQHA 3PP3K 2V5YA 4JKPL 2Z8RA 5JXEC 5GS0D 32C2A 4ODVL 4WW1B 1EO7A 5BS0D 2X4OB 4NHCL 5I8CA 4RAHA 3R1GH 4G9DA 1D5XA 1VHPA 3MMEA 5LGJA 1ORQA 5BV7L 5IUSA 3S7GA 5EZOH 1KIQB 1OWWA 3RTQA 4XMLL 4RAUA 1RIVL 1OF2B 4O4YH 1KB9K 2F8XC 2V5SA 2OQJA 4P5KB 4X6CB 4OLYH 1SQ2N 4LVNB 5IESL 5EPMB 1MJ8H 3CX2A 4L3CA 3LEXB 1L4IA 4YFEA 3QI9D 4QHLA 1YEFH 2ZOLA 2J88L 2IALA 5SV4A 2VZOA 2YS4A 5TE7H 5FYJL 4P59H 4MA1B 3ZSTA 4LDLB 3U6RA 3UROR 5J11C 5D1ZB 2E3VA 4R2GC 2NY6D 3D2UD 1YYLL 2YEZB 4X4YB 2XY2A 4G7YL 5B3NA 1U3JA 2VWEC 4UT7L 2DMCA 1OARH 1C16A 4PV8A 4UNVA 5C0CD 2AQ3A 4CKVX 1I7UA 1NCNA 5K9QG 2NXYD 4PG2A 2BX5A 1A7PL 5K59F 5HBBA 1ADQH 1JNLL 2C1PA 5H35B 1XGTB 2ICEB 5FCUH 3MFFA 5INDA 4U1KA 3IKKA 1GOFA 4G6JH 5H94A 3ULVL 1KB9J 5JHDA 5JW5B 2COQA 3HS0A 1VESA 3MJ9A 2Q20A 5TFSH 3SBWA 3X12B 2RR3A 4LGPB 2ZCHH 3VWKC 3RNQB 5SV3A 1MCFA 5T1KA 1ZLUH 5IK3B 1UM4L 3SPVA 4L8BA 1NCDL 2YD5A 3H9SE 3TPUA 3PGCA 3E3QC 3ZKSD 2X9YA 4FFYL 3U2SB 1Z2KA 4Y1AD 3TYFB 4X6EA 1CU4H 1VPOL 4PG2C 4JFEA 2H2PD 4OLVH 3D3VA 1CGUA 3VXPA 2VLJB 4EZMA 2VL5A 4JG1L 2HT4D 3PXJA 1G84A 2OL3B 2A9NH 4DKEH 1NUNB 5GPRA 4L4VD 4EJ1C 4W4NA 1AHWA 1P6FA 1U2CA 3O9WC 2D7TH 5CEXA 1CTNA 3B9DA 1RZ7L 3OX8A 1NLDH 3MLVH 1DBKL 3LN5B 2IQ9L 3CDYA 1F13A 3L95B 4LCIL 1L9NA 1QSFD 3QUKA 1LK2A 1G0DA 1IEAA 1OAYH 3RWCB 3ARYA 3WO3B 3F12A 3D1MC 3TIEB 4G9FD 5ISZD 4XRCA 2F54E 1QR4A 3B43A 5HHOB 1IZJA 2DQTL 3QUMB 4Z0BL 1ZHLA 4FQJH 3V5DA 3GSXA 1HQ4A 3MCLH 4QGYA 5HHXH 1NC2D 5FEBA 5JORB 2PO6A 1RUKL 3SE8L 4TVPE 1EFXA 4X0KA 1IGJA 1T7ZA 3GMMA 4HCRL 4MZ2A 3QIUB 2BVYA 2IAMD 3DX6B 5DD1H 3E8UH 1QKZH 5JW3H 1AD0A 2BRRL 3QEQE 4GRWH 1MAMH 5FUCC 1I1AD 2A6KA 2R4RH 1X5FA 5BVJA 5C08E 5CJQL 5CJOH 5ACLA 1S5HB 2VMFA 5LGHL 1FORL 4HWUA 1WIUA 2GK0B 4QHKI 1HHJA 3MACH 2P7TB 4XCNA 4BQ6A 2KZWA 4X0KB 1UXWA 1R3HA 2A77L 4OFIA 1CFVH 3HKFA 5F71A 1P2CB 4PGBB 4EI6A 5C0CB 5D8JL 4GAJH 3RVUD 1NDMA 3TO4B 1EUUA 4PJBB 5DK2A 1D5BB 3W0WE 2KL6A 2G5BB 3SGEH 1IEBA 3OTTA 5J1SC 5LQBL 4MA8H 5I8OH 4LVEA 2DQDL 3KXFD 3GSRA 2NY0B 1LK2B 3BRGC 5EU5A 3DVGB 4JG0L 4WGVB 4HXAH 2DQJH 5IFHH 5IVZB 5B4MC 3EOTL 2Z8VC 3KPQA 4N5ED 4N8VA 5MHSE 4RQQA 4E5XB 2NY0C 3ZE1E 4S1SH 2O5YL 5CMAA 5DFVC 4H26A 3Q6FA 1JPGA 1DUZA 2AEQH 3LKOB 1CD8A 3GO1L 4L4JA 4LCCB 1KSRA 4KI5C 5ITFA 1CI5A 2FL5B 3MA9H 5I0ZA 5IQ9A 2FX7L 1ZTXL 4ZUUA 1YPZB 4W6WB 3H7BA 1N0XL 5IBUB 1QR1B 4GS7C 1K6QL 3C60C 1D6EB 4ZUWA 1U58B 3MNZA 3U46A 5BZDA 3OL2A 4XBPB 4JO3H 1K5NA 4LCUA 2HFEB 3L7FB 3GMLB 1FO0A 1PQZB 4PBXA 1G1YA 3SDDD 1FG2B 2Q3AA 4HHAB 4HGWA 1S7TB 1IQWL 4M7JL 1FL6B 4EUPA 2CD0A 2X6MA 1PZ5A 1UM6L 3QYCA 1W2KT 2G60L 1IEBB 2R39A 4KTDH 5CZXC 3NBNA 1LEGA 3NZ8B 4GG6A 1CK0H 4FNLH 5CMAB 5CZXD 1OAXL 3P0YH 1U8NB 2BOCA 1FDLL 1VFMA 4NKDB 4HJGB 1GAFH 4EXKA 4NN7B 2E6QA 4ONGL 5IVZA 3GSOA 2ARJB 4HPOH 4TVPL 3NOIA 3BYTA 1SYVB 1NQBA 4PJGF 2Q8BH 4ZSOB 5LKNA 3V0AC 4O51B 3UTPE 4M5YL 1MH5A 3WD5H 1JV5A 4Y89A 1FFQA 4HIIA 4GG6F 4K3GA 4MQTB 1S7RB 4GT7A 5BQ7A 1U8LB 3O3EB 3R1GL 1CXKA 2NYYC 4O58L 5LCVH 3H42H 4NQXA 5IEHA 1TTUA 2ZCKH 3FFCD 5KS9F 4OLEA 5DO2D 5C0CA 2DMBA 5D1XD 2QADC 3IF1A 2XFXB 4QNPE 4LLDA 3PV6B 3RIAF 4PB9L 2R0KL 5DQJB 2WBJA 1GPOL 3T2NH 3GSWA 4NQCB 3SGDH 1Q72H 4FFVC 4KVCH 3S35X 3QRGH 1A5FL 3SDAB 3RBSA 1SVZA 3C87A 3Q3GA 4F7PA 2BDNL 5FUCE 4B7LA 5DQ9A 3NIFF 1PY4A 1MI5A 4P9MH 5ILTL 4PJDB 4HV8B 1HXMB 3V6BR 4L8CB 4HMCA 2CLZB 2EO9A 1U8IB 2FO4B 4LSSL 4R96A 3SO5A 1GCFA 2HRPH 5IOPA 2HH0L 4AZ8A 5HI5C 4JN2A 3L3DB 1IBGH 3MLPA 2JJUA 5JIHA 1WIOA 3VWJB 2UWEA 1TQCB 1OM3H 4U1NB 5FYKL 3QULA 1U2HA 4GW4B 3T0BA 1TZIB 3RVTC 3ULUH 4GUPA 1DSFH 1A7PH 5E9DA 3B2UD 3MV9D 1JNLH 5AYUH 3WV0A 4HUUB 2ITCA 2VZUA 1QSZA 1ZHNB 3N1MC 5KVFL 1Z9SA 3ARUA 4YBQD 4TNVF 2FD6H 2FATL 3TZVD 3HI1B 2EDRA 2XWTA 4IRJB 2NY5L 4XP5L 4ZO8A 3VW3H 4X80H 1RQ5A 2EDBA 3TFKC 3NCFB 4BSWA 3P9MB 4XHJC 2YUXA 3C8KB 4YJZL 4XZUA 2YBRA 3QUMH 1T1XA 5D1ZC 1TVHB 2I9LA 1Q1JL 1EEYB 4NQSB 5J4MA 5I66B 4MCYA 2X4OA 2ESVE 4EDXA 1EO8H 3BXNB 3EDKA 5FA4B 2NXZD 5D7LA 5GIRA 2YR3A 2I07B 4R96B 3TT1H 2VSCA 5F88B 1JWUB 2YPKB 4HWBH 1CU4L 1IM3B 3BUYA 1G7MB 4N0CD 5E5MA 2QKIA 5FKPB 3CJJA 4YHPA 1DJSA 3NCEB 3MUGB 1UACL 4LVNC 1NGXB 3KR3L 4NO0D 5HYQA 1GIGH 4JO4H 4KK5C 1AKJB 8FABB 5ACZA 4LARL 5SWZE 1IAIM 2DD8H 1X7QB 4ODWA 4BUGA 3QWRA 4LNVA 5EO0B 4MJID 4JHAH 5HGBA 3X17A 4XP1H 2R2BB 3FJTA 3RL1B 5EU7E 3Q5OA 2Y6SC 1CXIA 3DGCR 4EN3D 1FZMA 2CRZA 2R56L 4R26H 5JUEH 1WFNA 2DM4A 2WBJB 2NLJA 5EUOA 2XWJB 1DBAL 2FEEI 3CFDA 5FDYA 3OG6B 2CK0H 4YX2H 5HHOE 2YN3A 3DX7B 4JHWH 1G7IA 2MCPL 3ES6B 3GFUA 4WTWA 4WTXA 1JUFA 2W38A 3DMMD 5GS0H 4WO4B 3RA7L 1AE6L 1DEDA 1DFBL 2G75B 3FONA 1LE5B 4NYLA 5DRWB 4J4PD 2FLBT 5DC4B 4RAUB 4JZOB 4H0IA 3H3PH 4U0QB 2J8HA 2VLRA 4OQTL 1I3GH 2A73A 3MRJA 2YXFA 1XEDA 5KANI 3T0EC 4B53A 4HBCL 3BE1H 4OFYD 5ACZB 5KVDH 2CXKA 1JWUA 2YPKA 4KKNA 3FRPA 4P2RA 4R0LB 4U49A 1BQHB 1JGDA 4X6CF 3SKNB 2VAAA 3BW9B 2JJTC 2P47B 1KBGH 1LP9F 1AXTH 4RISH 4YHMH 4HIEA 4JFHE 4OQTA 3CZFB 3OKLA 3KYMB 4DQOL 3TO2B 2ESVB 4CVUA 1GOGA 2P5WB 4JPVL 4U1LA 5I1GH 1KIUA 5ANME 4EVNA 1TVHA 1VB9A 4YHIB 5L6YL 1VENA 2VDPH 4MA8L 5I8OL 4KC3B 1JYWA 1AXSB 1H15A 3AS1A 1R3LA 4QRPD 5GGTL 2P49B 1BZ9A 5I9QC 2EDJA 4PBWD 1K4CA 3RJDA 5L2JB 3ARBC 4PRPB 1JMZA 3CDGB 5GQBA 3KGRA 3X14A 1B88A 3ZTJH 1HSBA 2P8MB 3CSYA 3RAJH 4NNYB 3FONB 1KCKA 4PGCA 2QR0B 4XCCH 5JOPD 3CU7A 4LPXA 2KUTA 5IHZB 4KV5E 5AG9A 4PREB 4QOKE 4BFBD 3WIIL 4BH7B 2NPLX 2AABL 1ROWA 5F7WC 2FX7H 2H2SD 2N56A 4P5TB 4G42B 1RUPH 2F53E 4PY8J 3GJFK 4EI5C 3RWGB 5DJ2A 5E2WH 1QBML 1FVEA 2NY0D 2NLJB 4KHTL 1A3RL 4Z7NF 5GHWL 3JTSB 5FDWB 4QRQA 5E8EB 1CGWA 2P8PA 4NQDA 1CN4A 4K3EH 2B2XH 4MX7A 1AD0B 4A6YL 2IBGA 4PJAB 2FX9H 4JRYA 3IU4L 4XH2B 2WBJD 1QFHA 5TF0A 3RIFK 1M7IA 5F7HA 1UWXH 2ENSA 2X1PA 3EFFB 4NRXB 1S5HA 2AVGA 1IQDA 3ZL4L 1AJ7H 1CG9B 3PQYD 1D5ZB 1K3IA 3WE6B 5MEOA 3LPFA 1EEQA 1J1XL 5EZLB 2FH8A 1IEHA 5DHVH 5F7DA 5EORL 3X11A 2Q8BL 3RVWC 3QUMA 3OBAA 1YEDB 1A6AA 1T80A 1AIFA 1MELA 4N1CA 3TBSA 4X9HA 4A2MA 4W6XB 2VWEE 3UZQA 1IFHL 2B1AL 3MYJA 5C07B 4PJXB 1WEJL 3V5HA 1MY5A 2B1HH 3VWKD 3ZLQC 4JY5H 5CUSH 4P2QE 4LVOC 3MV9A 5FECB 1AGFA 3W9DB 4U31A 1RPQA 2OL3H 5FHBL 4NRYB 4FXLA 3WXVH 3HC0A 4LLWB 1OGAD 2BSTB 4KRPD 3WMSA 1KIRA 3C2SA 3HZYA 5ESAB 1FRGL 2XKUA 5I1DB 1SEQH 5ILTH 4O9HH 1HINH 1B2WL 3V4VH 2IBZY 4Z7VA 5C07A 5C2BL 1U3ZA 5HHMD 3PUCA 3BUTA 5I74C 3QEUB 1MJJB 2OP4L 2UY7A 3EFDH 2VR9A 3GSUB 2HT4C 1D6EA 2WIMA 3UYRL 3CU1A 4BH8A 3CIQA 3BYYA 3PWPB 4GAFB 2CJUL 3S4SG 3RUGE 1LEKB 4QT5B 1AR2A 4RGNE 5EN2A 3DOSA 3RNQA 4P2RE 3LIZH 2QTEA 2HTKC 5F7NC 5FV1L 2MNUA 5BRZD 2HRLA 1I7RA 4HWZB 5BMFH 1JHKL 4KKBC 3DX8B 5INDB 4HZLA 3O41B 4RFOL 2R0WL 4GXUM 1KPUB 3BEVA 1J0HA 3HPLB 2PTTA 3U7AA 3IKCA 4LOUD 3OHXB 1I1RA 4H20H 3EO0B 3SDXB 1U3YA 1WWWX 5FB8A 4LIQE 4PTTA 4ZAKB 4IDJL 1M7XA 2DQGL 3IDNA 4MDIA 1YMMD 4L8SB 4TSAL 3IT8D 3LMJH 4X80L 1KT2B 3GB7B 3MRRB 3QWQB 5L88L 1A7BA 5DJAA 1PBYA 2P45B 2X1WL 3WEXA 4Y16C 1KJMB 1ZVHA 4RFEB 3VFWA 3TN0C 5EOQL 3UTOA 2CIIA 4X83A 5T1DL 4H0HB 5E2TL 3TJEL 4U4BA 4X7FC 1BWWA 4G8GB 3LN4B 5C0CE 1IC1A 1JBJA 5ACMA 2A6IA 4IJ3C 1N4XL 4HFUL 4FG6D 1ZGLB 1LP9E 4JM2C 5BV7H 2Y7QA 3KR3H 3F7VB 2QEJA 3Q5TA 3BPOC 3NFSH 4X7TB 4XHJD 2VLRD 1J12A 3LKRA 5DFVD 1IAOA 1LO5B 4Z5RB 4ZFGL 4X5XA 2YC1A 4Y5VA 4O4YL 2R0ZL 1NSNL 4JHAL 3GZKA 5LAXA 3VXME 3BEVB 3ZE2F 5E1AB 5GRWA 4AYFA 3QEQB 3CFKB 4JQVC 1R5IB 3PXHA 1MJ8L 2BCKA 2O93L 5AG8A 2NX5D 5I8KL 3STZA 4JPKL 1S5IH 1F2QA 4OGYL 4ZUUB 1KPUA 2HTLC 4APQC 1CE1L 4QXWA 4LEXH 4YGAB 4JVWA 1P5VA 3DRQA 5GSVB 4Z7NE 1PYWB 1EIBA 1P4IH 2DF3A 2UZIH 2HFEA 3L7FA 4F80A 4KRPB 1N3NB 1JPTL 1LO4H 3Q2CA 5FYLH 1MFNA 2WINB 1IC4L 5TGBA 1RK1A 2YD3A 1F90H 3NH7L 5DJXA 3QSKB 2BJML 4Y8AA 2BC4B 4N0FA 2KH2B 1Y6NR 3CX5J 5T3XL 4JQVA 4X5XB 3HPJB 4F57H 4NNPH 1IC7H 1KLGA 4J6RL 4LAQL 1TZHB 3EYFB 3L5WA 4L1HA 3SGJA 2VZ3A 4HBCH 3LKSA 3MBED 2XKSA 3WBDA 4APQA 4GW4A 4F9PA 1OPGL 4LCYB 4WVRA 3EOAB 2W9DL 4NQEA 1NDMB 5IFAH 2VLJE 1J5OH 1CGSL 2AJYL 1CICB 1MFDL 2D2OA 5DK2B 5F6IC 5D7LE 2J6EA 4JN2B 3HB3D 5F8QC 2MKLC 4CDGC 2CDEB 4C55A 2QLVB 1CWVA 2NY6B 2XA8H 4Y5XA 5LBSH 4OCWL 3H7LA 3TCLA 5FYKD 1EZVY 4Y2DA 2EXYC 3S6CA 5HJ3A 5I74B 4FFYH 1L6ZA 4NQDD 1E28A 5FUOH 2VDPL 2QV2A 4MS8C 2O5XH 5J89A 2AK4B 5A2KH 3RVTD 4V1DB 2L0DA 4NQCA 2EIZB 3AM8A 3U7WL 4L4TD 2EE3A 2F53D 3ULSA 4K94H 1JTPA 3TH2T 2D7TL 1SVCP 3FAXA 2PYEE 3T65B 1GSMA 3GMNB 3V4UH 3BDXA 3S8WA 3MV11 4LPCA 5E8PA 1GHFL 5HPMA 1A6PA 3GBMH 4PS4L 4JQIH 1R3JB 5EU4B 1N5AA 1I3VA 1WZMA 2BY1A 4XAKD 3ZKMC 3W0WA 3QI9A 3RZCA 3RGVA 5LVEA 2R1XA 1M6OA 5E2WL 2DWEB 4JPWL 3O4LB 4ZPVB 2V17H 3UTSD 3EYVA 4YK4C 3WIFB 3L3GA 1LE9B 4RWYH 5MEND 4K3EL 4JCLA 4HWBA 1EHLL 5L8LB 5T3XD 3FN0L 3ARFD 3IU4H 1C7TA 1U8NA 2BOCB 1QZ1A 4HW6A 3I9GL 4PJ8B 2KZ1B 3I84A 3R0NA 5E56A 4XCYA 3OKKB 3ZYZA 4Q9RL 5IJVB 2B4CC 5FIEA 3LB6C 4UIMB 5C07D 4IDLA 3ARZA 5CJQH 5CJOL 4BK4A 5KSBE 2VN4A 25C8H 2C7UA 2VITB 1PLGL 1FCCA 4MYWB 4LP5A 5I1KL 2UY6A 2QSCH 2Y25A 5EU4A 1DBJH 4P2QD 5IMKB 2G5RA 3IFLH 2ZUVA 3KPNB 2C26A 1HCVA 2X9WA 4LSQL 3VXTB 4P9HH 3V5KB 3RNKA 1Q8MA 5IJVA 1KXVC 1PG7L 5IQ7L 2FSEA 3QIUD 4HKXA 1JP5A 3SKNA 4U6VL 3RWHB 3ZHKA 1HOCB 2VDML 1U8HB 3ZTNH 5EO9B 5GISH 4FTVE 4Y1AA 3QEGL 1KJ2L 1G7LB 2AP2A 4YR6A 1B4JL 5JOFA 3IDYC 3BN9D 1KULA 1ZGLP 4CADA 4X6FB 3ZYIA 5DK0A 5EOTA 1DDHB 4NUJB 1F4AA 2DJUA 2OTUA 4NZJA 2Q87A 4HUXB 4QEGA 5IM7B 2WW8A 3P30H 4Z7OE 2VXSH 3F6IA 1N0XH 4K8RL 4XPTL 5ID0B 3KJ6L 4WU5B 3MV01 3QQNA 5DJ6B 3CH1B 4F3FB 1P7KA 2ORBH 1FYHB 3O6KL 1FNSH 1FL5A 4UAOB 1EHNA 2DQHL 2NW2A 3UJTL 4K8RC 2F58L 3MUGA 2FBJL 3U4AA 3VA6A 1BJ1J 2YD4A 5KZCD 3AAZB 4QO1A 1ZWIA 5L2KE 4H20L 3UJJL 4PJAF 3VFMA 3ECBB 5ALCL 3AY4C 4UOW0 2ZJSH 2ZUSA 2FZ3B 3O0RL 1EEYA 2NX5A 5EO9A 4C83A 3LH2H 1AGCA 2XRAH 3O6FD 5JR1H 2A1WH 2VDNH 4EDWH 2UZXB 1AC0A 1ERNA 4TVPH 5EO1A 4HGMA 2UWEE 2AS5M 1VKXA 3MJGX 4YDJB 5DLML 3KYMA 2AJZA 4RDQF 4M4PA 4HUWA 2VE6A 2QQKH 2CO6B 2Q86A 3JWNC 4JDVA 1U8PB 2QSVA 3IJYA 1J1OH 4K9EC 4NGHL 5FV2A 1N8ZA 3LKNA 5IVXF 1KUMA 1NBYA 3DYMA 5EBWB 5AD0A 1BEYH 2EKSA 1ZANL 7CGTA 3MYJB 2B20A 1ZVSB 4PRAA 2GJ6A 3GSNH 3UZVB 3RVXC 2XTJB 4S1RL 3VI3F 5I1DA 5EUOE 1AGFB 3W9DA 1INDL 2ZNWA 4ISVA 3BP4A 1S9YA 4YLQT 4APQD 2VLJA 4XNZC 1EZVX 1U8PA 5BV7B 1DQMH 2B0SL 4PJXA 2H2SC 5EBLA 6FABH 4Z18A 2FEEL 4EI5D 1IKNA 3PWUB 4P23D 3CLFL 3WNKA 5K59E 2X4PB 4M7KH 1J1PL 5HYJD 2BSSA 3AS2A 1HIML 1I1YB 3GI9L 4NO3B 2EDQA 1EGJA 1F4YH 2UZIL 5D1XC 1UZ8A 2DTSA 1HH9B 1ED3B 3D85D 3GGWA 1H8OA 4L9LA 5B39A 2HG5B 5EC1B 3MV8B 3OHXA 4ODHL 4OZIE 3EUUA 1T21A 1UH2A 4XP4L 1CGVA 2WLYA 3HR5B 3HPLA 3INUH 3E6FA 3OZ9H 1WK0A 5CBEB 1H3PH 4ODXB 5D7IE 3QCVH 5TPWH 3U0PA 1FLRH 2FD6L 3B8SA 5HI5D 4ZFOL 4XWGL 1DVFC 2W9DH 4AL8L 3AC0A 5CILH 2EE9A 1OTSC 2V5RA 5GGQH 1ZE3C 3LQAH 1KLFA 2C3VA 4NWTL 3VWJC 1JRHL 3QUML 5FOBA 2FB4L 1ZHLB 4OF8A 3F58H 3MRLB 5KZCB 4PRHB 2P44B 2YSSB 1C8PA 5JLZB 3U48A 4CAGA 2VN7A 1XGPB 5BZWA 3FCTB 4QHLB 1S9VB 3RQ3A 5IB2A 3L9RA 1XIWB 5JOEA 3W11D 2RHEA 5IKCA 3C6LA 3CXHJ 3WFDL 2ADIA 3W11C 2E27L 3UTTD 3V6OA 4FG6C 4XBEL 1KTLA 1FVDA 4JQXC 2W65B 1I8LA 2VL5B 3DX9A 4ZFZB 5MENB 3ZKMD 1FNHA 2CLVB 1RZJH 1RJZA 4FQQB 4DEPC 2VXUL 2X40A 1CVRA 3VGDA 3VXSD 1A8JH 3H2WA 2CGRH 1EEZB 5DFWH 2YOCA 4WJ5A 5MEOB 4DK6A 3QH3A 2JK5A 1XGQA 4JHWL 3R06A 4N1EA 1EUTA 3DGGB 1CDUA 5ESQA 3STZB 3K4ZA 3PL6C 4URTB 4OCYH 2BXYA 4U1KB 4TYUA 5EDXA 1AKJD 3NCYS 4U3HA 4JO1H 3KPSB 1BQLL 5E7FA 1R5WA 3BGFC 3UPAA 1N2RA 2YC1B 4Y5VB 3TGXA 4XNQA 3U79A 4EBQL 1I8LC 3ILPB 4Y4HA 4WDIA 1KOAA 1X6NA 3MV7E 3T0EA 1CBVH 5EC2B 2HT2D 2ZNXA 1Y0LA 3KPPA 1MHPL 1QFUH 4WI9A 4K94C 3VXMD 4MQ7A 1AQDB 5D2NB 1AIFB 4NHCH 1J8HD 25C8L 3HE7A 2DL2A 4X7TA 4AG4H 3EO1B 3VDAA 1H3WM 2HFFA 3NACH 1NCCH 4QRSB 1IGML 3LS4H 4GS7B 3GK8H 3EYUL 4S0SD 3PL6A 3K3QA 4AIXA 1NCWH 1RIVH 4CVWA 4P2CG 4M6ML 3ARTA 1DEEB 1UC6A 5F89B 4LLVA 3MRIA 4BZ1L 2GK0A 1INQA 2OTWB 4LKXB 3T4AB 2OYPA 3BHBB 4QRRA 4JZJA 1NC4A 2K1MA 1YECH 3HRPA 4WFHE 1IL1A 3KPSA 1IKFL 3FZUC 4HIXL 3MPCA 5I73C 3CXDH 3ZTNL 1N26A 3SDXA 35C8L 1DQQA 4N0CC 3B5GA 1BIIB 1KENH 1CR9L 5ICZB 2YA2A 1TMCB 2V2XB 5CHNA 2P4AB 3TNNB 3RIFF 2OJEA 3DUSB 4TULH 3DARA 5GSRB 5HVWA 4DVBA 4J7RA 4G6AC 5D1QB 2VZTA 5E4IA 2EDFA 2JELH 3QCTH 2YN5A 3L3OB 1KTLB 1U8QB 5JMOC 2Z92A 5ALBL 5IG7B 4F58L 5EFIA 1MCCA 2ZSWB 2D4FA 3IGAA 5DO2C 2B4CH 1SEBB 2EDTA 4MD0B 4PFEA 2OMNA 1QBMH 2IF7A 4XAWH 3VFSA 2Z4QA 4P5MA 3AFLA 2AV1A 4NM4H 1KC5H 1LO0L 4H26B 2BC4A 4QRUA 1GVIA 2GJ6D 3RGVB 3LEVH 1Q9OB 5CINH 1VEMA 5I1HH 4RMWA 3HNVH 2LE9A 5F7KC 3FRUA 4ZYKB 3QISA 3BISA 3G5VB 2NXYB 4PJFE 4YIQB 4LU5H 5F3HA 3SKUD 4OB5L 4EXPX 3VH8A 3WHXB 5H37H 3OGOE 4ZG1A 3TC9A 1G9NL 5TDPA 1E4XI 5JR1L 1B3JA 2A1WL 2VDNL 4XC1L 5LG1A 2O26U 3I3BA 2OJZH 3U9PH 3QUZC 3T77A 4OFKA 5CKAA 5EORH 5CHNB 1M6OB 4B0MM 1I8IB 2RGSA 4FXGA 4RNRB 3FOMB 2NXYC 4PY7A 3BO8B 4I3SL 5D1QA 2QQKL 3QCUL 1KCUH 4KH2A 3S4SB 1UFUA 5DQJA 3HNTH 1RZ7H 1XR8A 1BHGA 1OAKH 4QXUL 2VISB 4QHKJ 2HJLB 1K9TA 4HV8A 3GSNL 1OAYL 3MRIB 3O9WB 3NA4A 4G80B 1RHFA 2FECL 4L8DB 3WXVL 4KQ3H 2R2CA 1OAQL 3Q1SH 4JFXB 2GCYB 2OSLB 4NC0B 3V95A 3FT4A 1MCRA 1RFDH 1PKQB 4QRTA 4CN6A 5CSBA 3QNZA 1PEWA 4FQJL 1T0NB 2XI9A 4U1JB 1HINL 5C2BH 1CICA 3S98A 1PVHA 4NQSA 2VDKL 5D1QC 5JHLL 4LLUB 1JZ6A 1KCVL 4NKDA 3Q6GH 4S2SB 3EAKA 4HCRH 4TVPD 5DXWA 2VDRH 1JL8A 4OSUL 1OT1A 1NGYA 5E08H 1CGXA 3L6FA 3QQ3A 2C4FU 3GBLA 4QNPF 4UIKH 1KPRB 5BS0B 1FAIL 1RIHL 3VWKB 5KVGH 5I30H 2R4RL 5I73B 1A7QL 4NKOB 4R8WL 4TN9A 4OM1H 5ADOH 4GLRH 2WANA 4AEHH 1A3QA 2DQEL 4OIIL 4NJ9H 4PLNC 2PW1A 1MSPA 3OZ9L 3VRJB 3L5IA 3VXSE 2NX5E 4QF1A 2R2HA 4PGEB 2D7OA 5KJRL 3RL2A 1ODAA 1HSAB 3IAQA 1S7XB 4X7DC 3IDJA 4CU6A 4TUJA 4WI2A 5IW6A 1XIWD 3BXNA 2VDLL 2R0LH 3BW9A 2WWMC 4XGZB 4G6ML 5CD5C 2ARJQ 3RZWA 4NWTH 4I0CC 5I8EA 4GBXB 1ZHKA 2APTA 3TVMD 1KLUA 5E8PB 1LD9B 2XQBL 3O6FC 2XWTB 4YPJA 4HWNA 5E8DL 5HHME 2GKIA 2GT9B 5C0DB 4WFFD 3MNWB 3VD4A 5IJKA 4XCFH 4JZOA 3RWFB 4OFPA 3MCKA 1NUGA 3N9GL 4I77L 1A6UL 5ITBL 1YNKL 3QA3B 2KQNA 1WWAX 2GYSA 4XP9L 2ZSVA 3CH1A 1DUYB 2EE6A 2AXHA 4XNMB 4PLOB 1WT5A 3HG1E 4LPVA 5HDQH 3RVXD 3FB5B 2OXGA 4PJIF 2X7LB 4FQXC 5E00B 4ZUTA 3IU3A 2ICWI 3D69A 3K7UA 2APXA 1L7TH 3CFDB 3KNBB 5LJYH 1RVFL 3F7QA 3BP5B 5IB3B 1YEIL 4UINL 3NMEA 4Y1AB 2FSEB 2MPAH 3EJJX 4HF5L 1LO4L 4FXKA 3P4OA 4GG8B 3P0YL 5HGBB 3TBVA 1CFNB 4HGKC 3VD7A 1RU9H 3UYPA 4BKLB 4TSCL 4LASH 3L5XL 5E8EA 3HAEG 3JUZA 5F72S 1IC7L 3SGJC 1A9EA 4J6RH 3RWHA 2AQ1A 4NM8L 4U1IA 3QAZC 4YUEL 1QFUL 2IFGA 3SDCA 5F3BA 1G7MA 1GZPA 2YD8A 4HBQA 1MFEL 1DL7L 1CGSH 2GHWB 5HHNB 4XXCA 2ARWA 1QSEE 1IM3A 4N0YH 4YHKH 5HHQB 3UZEA 1RZJC 3D39D 4UTBL 3FFCA 3VMOA 2PO6C 5T1MB 2JTDA 4OCSL 1A5FH 1XMWA 4JFDE 4N1HB 1MHHB 4YE4L 3I02B 3MRKA 3MV9B 5FECA 4ZS6C 2UUDH 1IKFH 4P9ML 3QNXA 2R69H 1AFVH 2HA1A 3D48R 3OWEA 5F1IA 1H5BC 1IGTB 5SWSA 1H15B 3U7WH 1S78D 3W39A 4D9RD 2WWKT 1CR9H 2JJVA 5D1XB 2HRPL 1NAKH 1DLFL 4EVNB 3LHPL 3PQYE 4U1IB 4Q6IC 1GGUA 1EO5A 5DJCB 4GQ9L 1CXEA 4Y4KB 4EIZC 5FYKH 4YGVA 5JO5A 3MRFB 4JM2F 5F1SA 4R97B 3RGVD 1B90A 1VKXB 3SY0B 5F1OB 1JZ2A 1AO7E 1FGNH 3TYGL 4R0LA 5I15L 5KSVA 4ODXA 3F7YA 2HKHL 2AJSL 1MEXH 4ZD3H 4P3WA 1ZWIB 4OZIA 5FO7B 1IM9B 4R90H 3ULVD 1T21B 4U1MB 1KC5L 2VR5A 3VW3L 3HE6D 4MJIB 5DTFB 1NMBH 5DJ2B 3NA9H 4PUBL 5FKAA 5INCB 1QFWH 5CINL 2GEEA 3BT2H 1OB1A 5E99L 3JV5A 3SKMA 1I7UB 2GUOA 1MI5E 4CUCA 4KK6D 1JWSB 4HWZA 3F7YB 3G6JB 2Y9RT 3K2UH 1A4KB 4JKLA 3GRWH 2BY2A 4EUPG 1XGRA 2VL4A 3BP4B 3C60A 3DETD 3V8OA 4TTDC 3MBEA 1W0VB 3BP6A 4PR5A 4N0RA 4NO3A 1A7OL 2B8OT 3FT2A 3T04D 2XZQH 1QSVA 5JHDE 3QCUH 4R7NB 5AD0B 5DWUH 4Z7QF 3ORJA 2X4PA 4U1GC 1D5MB 4JKWA 4X8JB 4OV5B 3QUYC 4IMKC 3ARFB 1KIQA 1G7PA 2VUYA 3TA3A 4M8VA 4QXUH 3ILQC 2FWOB 4NJAH 3AXLA 2WNGA 1IGJB 3IJSB 4H5SB 4HX1A 4UDUB 1UADC 3QH3B 4QTIH 2YK1L 5EPMA 1QSEB 1OAQH 3Q1SL 3S3JA 2IPUK 5J7CC 1FL6A 4RGOH 3QJFA 3VGGA 2BRQA 2YPLD 2PKDA 3HZVA 2VKXA 5C92A 5IB4A 4JEGB 5CP7B 2VLKE 2CKBL 2NTFA 1DFBH 2IAND 4RMQA 4UQ3A 5T1KB 4WW2A 3AXLB 5LXGH 4G7YH 1BIIA 4GAYB 4LVHB 4KKCD 3BMVA 2IPUG 5EZLA 1D9KD 3SE4A 1E6JH 1TENA 2FL5A 2UWEF 5DMIL 3WUWA 5I30L 3STBA 1FFNB 2BOBA 1YPZA 4M9OA 4UU9A 1M7IB 5D1ZD 4Z6AT 3F5WB 4LCCA 3FFCE 4XPHH 1XGPA 2V5TA 4G8FA 3CUPA 3DVNB 4PGDB 3D5OF 1DEEA 3AY4A 3LS5L 2ADJA 4YXLH 2C3WA 5D2LE 3BPLC 4TQEH 3P40A 4WW2C 1JWMA 2R0LL 1J88A 1UZ6F 2PF6A 3G6AA 4HXBH 3OR7B 4HCRA 3VI3E 3I6LE 2YSSA 1JNNH 1L6XA 3ME0A 1ORSB 4ZFFB 2X4RB 3GB7A 1QG3A 2E7HA 3D2UA 1MCKA 3BZEB 1VPOH 4OLVL 5GGTH 1Z5LB 5E1HB 3VFVB 1J0IA 4XVSH 4Y19A 3WNMA 1A6ZB 3I50H 1OVZA 2WV3A 2Z8WC 4L3EB 5GS2H 1YEJH 4GG6B 2ESVD 3O6MH 4RMSA 1NLDL 1HHJB 5ITBH 5JORA 4UBDC 3AGVA 3HZMB 3O3AB 4Y2DB 4YK4B 4E0RA 3BQUB 4LBEB 2LU7A 4P4KB 3OKYA 3DMMC 3DV4B 3QIUA 1MFAH 1E28B 2NNAB 1M4KA 4KGJA 3A6BH 3IYLW 3SDCD 3JV0A 1EEZA 3G6AB 2F5BH 3N85H 4CW1B 2C9AA 2EYTB 3BKJL 3OGCA 4NN6C 1XGYL 1I9IL 2RJMA 1WBXB 1A0QH 1S7SB 1J1PH 4G6KL 1RUKH 4GO6B 4I3GA 4DGVH 2W0FB 3D3VD 5K9OB 4Z7WF 1RZGB 5D2LB 2XXCB 3FRUB 2HVJB 5EUKA 3V7AE 4KMQA 5JXAH 3E8UL 3B9KC 1YEIH 1LGVA 4UV4L 3FMGH 5DR5H 1QSED 2CIKA 1A6TB 1HXYA 3V6OE 4LHUB 1KLGB 1TETL 5HVHC 4U7SA 3KS0J 1HCFX 1ZSDB 2O61A 5FO9B 2XWBA 1WCBB 5F7YC 2QQLH 4AM0B 3P2TA 1F00I 4I18C 4ENEC 4MXQC 1J1XH 3PQYA 4EUPB 5D5MA 3MGTB 3RTQD 3D39B 3FO2B 4HJJH 2V7NA 1BD2A 5FGBA 1F6LL 1EXUB 1FGVH 5EUKB 4BQBA 1QSFE 4GXUN 1CFVL 2WINA 2WWKO 4NM8H 3L3DA 4YUEH 4WWKC 2Z92B 4I2XE 1WWCA 1DVFA 1Q9LB 5C0IB 5J6HB 5DVOA 2AEPH 3ARRA 5DT1H 9CGTA 1MFEH 3BQUA 4P3DA 4AEIH 1IT9L 3ABZA 2DLTA 1NCUA 5I16A 5AWNH 1S7SA 5SX5H 3TNNA 2DWEA 1JRHH 4G80A 5LQBH 1C5CL 5BRZB 2DKSA 4UTBH 3C2AL 1TCRB 4JO2H 3DV4A 4A6YB 1UVQA 4Q0XH 1NDGB 1S8DB 2Z93B 5C09E 1U8KB 3KDMB 5C71A 1BX2B 2EEDA 3G6DL 4Y4KD 2QSQA 3FRPG 3QUXA 4DZ8B 1S7RA 1PGRB 3TT3L 3RY5A 3U1SL 1LEIB 3DJ9A 3DVGA 4R7DA 1OW0C 2FJFB 3HZKB 3EFDL 5D93B 3S5LB 4WWKA 2EDYA 4B5EA 1E4XL 1BFOB 1EJ6A 3LV3A 4LLDB 2EIZA 4OCXH 4NFDA 4XB7A 4H1LH 5EIQA 3DBXA 1ZTXH 3WN5B 3ZE0E 3DLQR 3JV6A 4F9LC 1EH9A 1XF2A 3LSOB 4K71B 3ULUF 5IM7A 3EHBD 1C08A 2JJTA 4AQ1B 3NPZB 3VXQA 2Z91B 3UO1L 3EHBC 3FQUA 1HQRB 3EOAA 4RFOH 2M26A 3IFPB 4XPAH 3N1GC 2EEAA 4XZUB 2KBGA 5JIKA 1JZ3A 3EOBB 1FNGB 3MGTA 2DN7A 4K3DH 1QBLL 3QBTB 3U7YL 1JNHB 3EYFA 4HIJB 4NUJA 4R4FH 2H3NB 1MIMH 3JV4B 3MNWA 3QXAB 2HT3D 3FB8B 3GHBL 1ZA6A 2GJ6E 5GS2D 5IIEB 15C8L 1OW0A 4IDJH 1KEML 4NQEB 3BPOB 3IDGA 4MB3A 1G6RA 5EU6D 3DSFL 1E4WL 3LKSB 4JO1L 4HC1A 1A2YB 1FDLH 4PUBH 3U0TA 3D85A 3GSVB 3D0LB 3JZ7A 1NMCB 2V9QA 3I3EA 2B39A 3LQMA 4NN5C 2AXFB 2ZOKB 1UZ6E 2E6PA 1AQKL 1QLRA 3RVVC 1FFPB 4MHHI 5C0JA 2W0LA 1ZLVK 4MNQE 1ETZB 1OLLA 4PJCB 1GGYA 3EJYC 1OGTB 4BZ2H 2GAZB 2V7HA 3RY4A 4JR9L 4H1LG 4HFUH 3VFGL 5IOPB 1CTOA 1OAZL 4LSRL 4O58H 4W70A 5FM5M 4M93B 3MMEB 3BD3A 4YDLB 2FO4A 1BECA 2EYSB 1U42A 2VRAA 5E7BA 5EA0L 3BP7B 3QDME 3PP3H 1BLNB 4ZFGH 2YPLB 5IMLB 3MRJB 3AMKA 3QFJE 4DN3L 2GW5A 1GPOH 3T2NL 5I1EH 2R1YA 3KPSD 5IBLD 2AJ3A 2ILLA 5GRUH 5DC0A 1S7VA 5DI8A 4BFEA 2I60L 1Q94B 5DRWA 4HIXH 2CKBA 4O2CA 3S35H 1QNZH 4JFDB 4OGYH 4L4VE 4LPUA 3BRDA 2PW2B 3MLTB 4KQ4L 1UH3A 3BVNA 4MD4A 4U6XB 3MLRL 1ITBB 4U1SB 2HH0H 5CZKA 5TE4L 1TITA 5CLTA 1CFSA 3IFNH 4KI5F 1PSKL 4XNYH 4M5ZL 4Z7WE 2ICWA 3MV7B 2PYFA 4H8WL 5EOCH 4YWGL 1K8DB 3GIZL 2Y6SD 8FABA 1RULL 1T1YB 3I6GB 1AD9B 3ISWA 2JB6A 3O8XB 3QWOA 4ZS6D 2VQTA 3E6FB 4MMZC 5E5MB 4YQXL 1SJVA 1FVEB 5F70A 3ULUD 5ECJE 4F33B 3ULVC 1ZT7B 1AKJA 3B4NA 1JK8B 4X99B 4R3SA 1X5XA 5IGXL 4HXBL 4OCMC 5A2LH 2FJGA 4P99A 1I1FA 2YBRB 3TH4T 1ONQB 3QR2A 2OMBA 2EDDA 5I1AA 4Y2DD 3HG1B 2YHGA 1ZS8B 3C5SB 4MJ5A 4LDOB 4WI8A 3H8NA 1QRKA 3OB0H 4JO4L 4NQVB 1JFQH 2B5IB 3U36A 1I8KB 1YN6B 4K94L 4YNYB 2GJ6B 5E9DD 4UBDD 3CSPA 3SO3C 1JPST 3DI3B 5CGYD 3IXTA 2F53A 2IGFL 4K7FA 2R1WA 4PJ8D 4Z78A 1IGYB 2WSKA 2ZPKL 3EYSH 4ODSH 5HDBE 3CK0H 4KDVA 2R56H 3SE3C 43CAB 2EKSB 3ZDYF 5BZWB 3X11B 1ORQB 5KVEL 5HI3C 4KQ3L 3RWEB 2JJSC 1CD0A 4IRSA 1CXHA 5J12C 3UX9B 3PWVB 1YEEH 4QLRA 1DLHB 1JGDB 3NCYP 2VE6B 1P9MC 3QQ9C 4KXZH 4XVTL 4U1NA 3V4PH 4JFEE 4XP6H 3AAZA 4G8EA 2APBA 1T5XB 1WJ3A 3T3PE 2V2TB 5E5RB 1G0YR 1OB1B 5CEZD 2YKLH 1D5IH 4YH6A 3IS1X 2VDRL 2K7QA 1ZT7A 3H3PL 4JDTH 4PRDB 2E7CA 3NCMA 2X70B 1DR9A 2VLKA 1JI1A 3STLB 4LK4A 3ARFA 2OZ4L 3ARBB 1W72L 1RIHH 3HRZA 1GGTA 3SE3A 4LMQE 2NQCA 1RZ8A 4EOWH 4TPRL 4D8PB 1FYTE 1QPPA 3BE1L 3NZHH 2DLHA 1IGCH 2NY4C 4L5FH 3MV8A 4WIQA 3QHFH 3FT2B 2DQEH 4OIIH 3PNWA 2X4UA 1DBJL 1QRNB 1ZGLA 4HUMB 3K8KA 3CSGA 4PGDA 4X4ME 4JN1L 1TPXC 5B22A 2CUIA 4JFZL 4P2QA 2PCPB 4TTDD 4PJDF 1BM3H 1PG7H 3QIWB 3T4YB 2X4TA 3FFDB 4KK5D 4X7CC 4L8SA 3PNWB 3MRDB 4D3CL 2VDMH 3EDEA 1MFBL 5C0AB 3SQOL 3CFIC 2VO5A 4MQ7B 5EZJA 5CSZB 2JE8A 4BSVB 1FLTX 4YHIA 3VRLF 3WLBB 4RAVA 4BA8A 1C12A 1FIEA 2AJXL 4Z0XA 4JRXB 5CAYB 3RI5K 4FMKA 3NIDE 1YN7B 2F19L 2JCCE 1H8NA 3DECA 4FQQA 1AGEB 3P30L 4JFEB 3TZVC 3NFPA 3D6GA 4RGNC 1AP2B 1XGQB 1VFAB 3TCXA 3O6LH 43CAA 2ORBL 3ZMRA 2F5AL 4Z7VB 5DS8A 3J8F7 2CLVA 4M62H 4OLUL 4F7TA 5F9WB 2FBJH 3V52L 1R5IA 3MLUH 2ZKHH 1PY9A 3WNLA 5HYSA 3L95A 1RUAH 4YXKH 4KUZL 3FQXA 4X9GA 4L3EE 4P5TD 15C8H 1ZSDA 1W0VA 2ED8A 4E9LA 3QIBD 1XR9B 1T20A 2AJVH 1RJLA 2MPAL 2IG2H 2XN9B 3DSFH 1D7FA 1UGNA 1MLBA 1ND0B 2XRAL 3FFDA 1HK6A 4X8JA 1RZGA 5D2LA 2A9ML 3EYQC 4LASL 4N5UA 1I9RH 4CBPA 3L3KB 2ID5A 4J4PC 5A2FA 1AGBA 4UB0L 2YPVL 3FCTA 5C9JA 2WLZA 5C6PB 4HKZA 1P7QB 4KK9D 3ULSB 1HWGB 1TTGA 3KPRD 2BSRB 3B2VL 3KPPB 2F74B 1LDPL 3MRRA 4PJEB 3FOLA 3VXUD 3RPKA 5DHYB 2HFTA 5MERB 1BEYL 5DD5L 3WFEL 2OX5A 1KNOB 4GAGH 5TF1L 4HWEL 1Z6JT 3MLYL 4OFDA 1AHWC 5FHBH 2BNQD 3O41A 5I1EL 3DTXA 2X44D 3TVMA 2CLRB 3TLRA 5JPMB 5IVOA 4OD3H 3DGGA 2D9QB 4PYGA 5GZOC 3QUXB 1F11B 1C5DB 4LLQB 3DX8A 4O9HL 1I75A 1A7RL 4OZFH 1QP1A 4PJ5A 3TIDA 5D70L 1LVEA 3HI5H 1BOGA 4Z7WB 1HIMH 2JLLA 4NPYB 1CZ8L 1A6VH 4FTVD 3CVIL 4Q9BA 4FQIL 4WI3A 3LQZA 1RZIA 5FO9A 2J1KA 2E6JA 4M5ZH 1BF2A 4I5BB 5T5NG 4XCYB 1A4JB 3LCYA 5BMFL 4GRWB 4OZHB 1JHKH 1SYVA 1BVKA 2X1OA 4UIMA 4XCEB 1KJ2A 2PXYB 3JXAA 4PV9A 1X5ZA 4U1HB 3INUL 2DIJA 3PF2A 3BKCH 4TOYH 1VADB 1Q9OA 4FABL 2HKHH 2DQUH 5I76B 3PWPD 1QBAA 3BWAB