5ISZE

Crystal structure of ls01-tcr/m1-hla-a*02 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
IGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAAGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIFGQREQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8(+) T cell epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszE02
3O8XA 4R7NB 1KTDA 5J1TC 3O41A 1XGUB 2RHEA 1S9YB 1G9EA 3F12B 3SCMA 3PP3K 3Q6FA 4HXBL 3KLAA 4IJ3B 3CFJB 4QOKB 32C2B 4O02H 5D1XA 2NY7H 4AG4L 2DI7A 4QNPE 5DWUL 1C1EL 3G6JB 3SCMC 4PUBL 5C0JA 1JYWA 3OR6B 5HYSG 4KROC 1YN6A 1IGFL 4JFOB 5JOFA 1S9XA 2UWEB 3MV7A 1AKJB 1D9KA 1RUQH 4HPYL 5T1LB 3DX8B 3T1FA 5GGQL 4L5FL 1ZHNB 5GRVL 2DDQL 1D9KC 2AERT 4M6NH 2OX5A 4B7LA 1XR8A 3S98A 4DK6A 2VZOA 3GMOA 1FNEB 1AXIB 2BVQB 1W0YT 3GHBH 4UMGA 4XCNB 2FLBT 4CUCA 5EFIA 5KAQF 1VFAA 2X7LB 4L4JA 4MMXC 2P5WA 3WMSA 3U48A 3FB7B 1KGCE 3ROLB 5IMLA 5DUBB 3HZYA 5F7DB 5JXEC 4DGYL 3O45A 1Q9WB 1R5WB 4ZO6A 1NBVL 1YMHB 3C5JA 1II4E 5F8RC 4F9LA 1BIIB 5DHXB 3VRLE 1K4CB 4LCWE 4NQCE 1ZA3B 3G9VA 3HCVA 4GRWF 4OF6A 4F9LC 1BEYH 1A4KA 4R4FL 1JYXA 1SBSL 1EO7A 2DMKA 3D39D 1MPAH 3T0XA 1ZT4A 2IPKB 5I76A 1H15B 5I1IL 1S7UB 3VFOA 2HJFB 1IGCL 4R7DB 1U3JA 2CR3A 3STZA 1NGYB 3T2NL 4Y4KC 2XZAL 2IC2A 3LKOA 5ESAB 2XA8L 3K4AA 4P46D 3KPSE 3RHWF 4DVRL 1LDPL 3RFZC 4WEBL 4HJJL 3BXNB 3VD4A 4JY4A 3MLTB 4XP1L 1F2QA 2EC9U 3WS6A 2OR9L 4PJBB 3WL9B 4KVCL 3TYFA 3EYUH 1IZJA 5C1MB 4XC3L 4AL8L 2YA0A 3WS6C 4QRRE 1P1ZB 3WNLA 4NRYA 3OBAA 1YPZE 2YUVA 4CKVX 1T89C 2AXGA 4MA7H 3E1F1 2VZTA 4U31A 1I7RB 2DQIH 2GYSA 5LQBL 1KUMA 4UDTB 3CXDL 4M6OH 4AQ1B 4LEOB 4X7FC 3B5TA 4ZUUB 4FFZL 3MRLA 4N0UB 1B0RB 5EIIA 4LKCB 1U8KA 3L3GA 4ODSH 3UTQB 2X89D 2LU3A 1B6UA 1GRWA 4MJIA 1WZLA 3JUZA 4AENA 3RTQD 1OARL 4E5XB 3IDYB 2J1KA 5DJ8A 5D1QA 5E99L 3BUYB 1PBYA 4KJQC 1EVUA 4WW2A 4FXGB 4DN4L 2GTWA 1KCUH 3WBDA 4WW2C 4F3FB 5JLZA 4LSSH 3VDAA 3QPXL 4JREC 3QEQE 3VFVA 4JO1H 3T0WA 4NDMA 1T20B 4XNMA 4A6YB 2E27H 3HPJA 3ARXA 5IM7B 4W68A 1KJ2H 4JG0H 2VIRA 4U6VH 2GY5A 5E8DH 5FA3B 2AK4B 2YN3A 4DEPB 1IQWL 1J8HE 4OBRA 1GOFA 4UV7L 3VCLB 4UAOC 4WW2F 3C5SB 1PEZA 4YC2C 1AH1A 1UC6A 1NMAH 2HLAA 1EEYA 2C7UA 1X5AA 5L2KA 4Z95L 2N56A 3QXUA 3T0EA 2EYRB 3QCTH 3H9YA 2ADIA 3HKFA 4K3DL 2GITB 3KNBA 3MLWL 1GXEA 3T0EC 4UI2A 2FZ3A 4DUXA 2ICCA 4NQDD 3LHPL 4IOIB 2HWZH 1BVKB 5FUCC 1UWXK 1NGWA 4N90D 1YQVL 1M7DA 3WNOA 5HVWA 4WI4A 2WUBL 3BQUC 5BRZD 2IADA 1NEUA 3HPLB 3GB7A 3OKMA 2BNQD 4LCIH 2ZG3A 4NP4L 1WEJH 2P24A 2NXYB 4UINL 4GSDL 4S1SH 1S7WB 4WCYH 3REWB 2YZ1A 5JIHA 2BY2A 1MF2L 5KS9A 4HJ0D 2R8SL 4XRCA 1S7SB 4G5ZL 2FEEI 5DSCA 3AREB 2EDEA 1L6XA 2F54D 4ELMB 2OZ4L 1I1AC 3IETA 1LO2L 1ES0A 4DN3L 5INCB 4YBLB 5TDOB 2Z8SA 3N1MC 3VWJA 3FCTB 1DLFL 1FGNH 4YHLL 1V3JA 1I8MB 2YWZA 3SGEH 1D6VL 4LVHB 5BVJA 4FFYH 1X5YA 4Q0XH 1RJZB 1YDPB 1OT2A 1GGBL 3S9DB 4RFNC 1XR9A 1F3JA 3PJSA 2AK1L 2HTKD 4I0PB 4JY5L 1KPUA 5HHPA 3LCYA 5JQHC 3P30L 3U9PH 4LSTH 3F6IA 4JDTL 4MQ7B 5LCVH 5IESL 4M61A 4P23C 3NFNB 3OGCA 2H2SD 4NPYB 5JA9A 5GGRA 1RZGA 4X8XA 4C59B 4NO5A 3LRGA 4R90L 1J1OL 2QADB 3KPQB 3RQ3A 4M1DL 4IMKA 2JIXA 4UZGA 2R69L 1KPRA 4XMPL 1NDMA 3KPOB 4X6CE 1BZ9A 1I1YB 4RAVA 5L6YH 2MCPL 4IMKC 3VXQB 4P5TA 2X4RB 3MOBH 4L8SA 5HYJE 1W0VB 4PJCB 5EU4A 4F9PA 1CLOH 4P5TC 2BX5A 3VFUA 5IVZB 4KTYA 1R3JA 2OYPA 3D0VB 4UB0H 3FO0H 4DZBB 5EOQH 1K4DB 3VXUB 3A6BH 2VLMD 2F58L 4OTXL 3WE6B 3GMRB 5I74C 2AJXL 1SY6A 4WENB 2BVOB 4JN1L 3IYLW 1QLRB 4JPVH 3LVEA 3IF1B 2EYTA 5AYUH 3O6KL 4APQC 1OSZB 4YDJA 3SGKA 4I8DA 1BLNA 1FN4B 4Y1AB 5EN2B 4HUVB 3VFGH 2FGZA 3FRUB 3ULVD 4IOSD 6CGTA 1V05A 3QDHA 4WEMB 5CEXB 1PGRB 4JVWA 4MQSB 2NZ9D 4YHZL 4HFUL 4Y5XC 4G8GA 5DRXA 3O11B 2R0KL 4RSVA 4K7PY 3TNMA 1YNLH 3DMMA 4JFQB 4PJ9C 5HVHB 4YXHL 5DRZB 4NC2B 1FRGL 4OKVA 4M1CC 3OKDB 1CGTA 1RVFH 4AEFA 4CGTA 5GS1C 2WM0A 2R2EB 4P2QA 3S35H 3LS4H 3MLUL 5C0GA 4LCYA 1S7VB 3AAZB 4XI5C 5IB1A 4DKEL 2WZPD 5KZCB 2LAAA 1JWSB 3FB8A 2IBGA 4M9OA 4XCEB 3DXAD 3WFCH 4J8RB 4ZPVB 1CFSB 1P5VA 4NQDE 4PJHB 4PRNB 4C56A 1U8MB 2DTML 2EDFA 4MD0B 2DLHA 5F7HA 3NTCH 2O61B 1EEZA 2X1OA 2FB4L 3TBTB 5BRZE 4TSCL 5HI3C 3LZFH 1IVLA 5BCAA 2BNQE 3F5WA 4K3EH 4L1HA 4Z5RB 1FIGH 1F42A 4WWKB 3GHEH 4L4TA 5IG7B 1T83A 5K93A 4K94H 2ARJB 3TN0D 5FB8B 5TGBA 1ZVHA 1QRND 5KG9B 1G7HA 4DK3A 3MRPA 4G8FA 3U83A 4HLJA 2OTWB 2CJUL 3EJYC 3QWRA 1G0YR 2I9TA 1EEQA 2VXQL 4U1GB 5GISL 3H9SB 2F54E 4RZCA 5A2KH 1IGIL 1U2CA 2W0PA 5CBEA 3D1MC 4RDQG 2CK0H 2V7HA 5HHQA 3QA3A 2R39A 2EO1A 5FGBA 3RNQA 2R2BB 1RZJL 4JZNB 2VDPL 5TF0A 3O4LB 4RX4A 4P48A 4DUVA 2C1PB 5FGBC 5TH2A 3BIAX 4U1KB 3VXPB 1WC7B 2H32A 3QFJB 3T65A 4BUGA 1YY9C 3IAGC 2ZNXA 4H88H 5B8CB 4XPHL 5F1IB 1JZ7A 5ESQB 4OUUA 1NUDA 5I8KH 1CDCA 4FXKA 4X9BA 1WK0A 1T7XA 3BJ91 3O8XD 3NACH 5E94A 3PF2A 1AHWB 4LLYA 1JGDA 3CFBA 5EA0H 5FM8A 3ES6A 3QO1A 5LBSH 4PJ8A 5IQ9A 3SCMD 1FG2B 4AIZA 5J4MA 2X09A 3S36L 4Z7NF 1EHAA 5D1XD 3OMZA 1TVHB 3WDJA 1AO7A 4KROD 2ITDA 2IMMA 4FQJL 5DZOA 4UTBH 4ZQKA 4ZS7L 2H6PA 4UNTA 1YEEH 2AEWA 1MFEH 4XAKD 5CJQL 4EIGB 2YUXA 4H20L 4DZ8A 1G0DA 1YEFL 5M7QA 4P49A 3TH2T 1S9WB 3RAJH 1DQMH 1BFVH 5FO9A 1KTKE 1BREA 4R96A 2VDRL 3SDDA 3MV7D 4FQIH 4CVZA 1D9KD 1V7NL 3RY6C 3S7GA 4KK5C 5I6XB 2VLME 1VDGA 4RA0C 4FP8L 3SDDC 1IEBB 3GBMH 5B3NA 3AM8A 4YLQT 3VFNA 2KZ1B 1PKQB 5D2NC 5MEQA 1IC5L 4MA8H 3U7WH 4ONGL 4QT5A 1QSZA 2P5WD 3GBNL 4Y5VB 1BBJB 3C60B 3KJ6L 4KHXL 3THML 4NKIH 3INUH 4WHDA 3ULVE 5HY9A 4ZSOA 5CKAA 1PKOA 3RVTC 5C0BA 2R2HA 3EFDL 4Y19A 4LLUA 4MA3A 3DTXB 4XPAL 1H8OA 1I7UA 3RUGA 3S36X 1F8TL 2AKRB 3DROB 4OIBA 3AY4A 4BELD 5LG1A 5FDWA 1QSVA 2B4CC 4LARL 2DLFH 5J89A 1K8DB 3VA2C 3AY4C 3K1DA 4AJ0A 3PQYB 4GQ9H 1AC0A 4XZUA 3IDXL 2OK0H 4XVSL 5KJRL 3QDME 4S1RL 3TBSB 3B9KB 3CFEB 1VEPA 2HMID 3RWIB 3SE8L 5FV1L 2R2CA 3IDUA 2B4CL 1KN4H 3Q3GA 4K8RC 1M4KA 4L8DA 5C0IA 1TCRA 1BVLB 3RUGF 5IF0A 2AJ3B 2RCSH 4M48H 4WY7L 1WCBB 1S7TA 4KI5C 4OLYH 4IRSC 4G6MH 2JJSC 1FIEA 5FXCH 3S5LG 2B2XH 1YN7B 2GSGA 3OSKA 4K8RL 3EAKA 4Y8DC 3S4SG 3DXAE 4ZOAA 5JW4R 4H5SB 3IGAB 3FRPA 5JZ7C 3DHJA 5IVNA 1H3UA 5HDQL 5ICYA 1H0DA 4DKDC 4KI5F 1SEQH 4ZFZB 3I9GH 1I8KA 5D6CA 5E6IC 4G6AC 2X5PA 4OZIA 1WFOA 2BK8A 2DMCA 3LS5H 4G9FA 4LHUA 1KULA 4M1GL 3FO9A 3IVKA 3T4AA 2E7BA 5GSRA 1QRNE 4YNYA 4KJQD 1LP9A 4PJXA 2EDOA 1LO0H 4MAYA 5F88B 2FYYA 3PHQB 4X8JA 3QXVA 1FHGA 1ZWIB 4J3TA 4WEUD 5J6GB 3VGAC 5I1EH 2J88H 4YDIL 5HI4D 1KCSH 1M7IA 3OWEA 4WHCA 2C1OA 4PRBA 1S8DB 2G5BB 3IKCA 4OCRH 4JPWL 4OZIF 2CSPA 2FX8L 5B39G 2PYFA 1UB5B 5ITFA 1KFAL 5JR1H 4N5EC 1JWUA 4FQXB 5LAXB 3DPBA 1LP9F 4PJXF 1KIQA 1CG9A 3NCMA 4OZHE 1N7ML 3GFUA 4ORGB 5KANI 4XPTL 3ARBB 1ZSDB 3SY0B 1NBYA 3KPRA 4HS8L 4ODXB 5L2KD 5DF0A 2W0LA 3T0ED 3G6DL 3V8CA 4MX7B 3GSXB 2XN9B 3CVHH 3MGAA 4NKOA 3RWJB 4F7CB 1EUTA 1C5DA 1LD9A 5DK2A 5FGSA 1UACH 1CDIA 3HE7C 3MCKB 5T1KB 4JM2A 1M71B 2HVJA 2NY2C 4OB5L 5IHZA 1YJDH 1RZ8A 5DUML 1FVCA 5I19H 2GEEA 1CT8A 1R3IH 3FQRB 4XHJD 2PO6B 1UZ8A 2HVKB 4JM2C 5DHVH 1HZHL 3DRTA 4M7ZB 3RVUC 1LK2B 2IG2L 2ZG1A 3ZT7A 4XAKE 3BH9A 1XT5A 3VMNA 3QJHA 4XNXH 2CKBH 1A1OB 4Z18A 2BCKA 3P0GB 3U82B 3CXHJ 3RWHA 4MD5A 4F15B 1AD0A 4JM2F 3VXSD 3ULVH 2CDFB 4YX2H 2BFVL 5C0FA 2CIIA 1YA5A 5H94A 2Z9TA 1SM3H 2P7TB 5KSVB 1RFDH 5CEYB 4KK8D 5ICZA 2DQUH 2VLKA 3TH3T 4XP5H 4Q6IA 3HUJA 3BKJL 3RWGA 4X7EC 5E4EB 2XRAH 4XBPA 2P5WE 2XPGA 3U4EB 4NZTL 1A7RH 4YGVA 3VWJD 1U8LA 1XF2B 4RFEB 1ADQL 3QQ9C 1T0PB 4ODUB 3BWAA 3RY4A 5I16B 4GUPB 1XH3B 4BK5A 2X10A 6FABL 5D1ZC 2Z4QB 2ADFL 2Y5EA 1RUPH 3TIEB 1ITBB 1Z5LA 2AGJH 4P2OA 3HUJF 5DRWA 3MRJA 2FJHB 2ZUSA 5T3ZD 3ZKXC 4QLRA 4EUPA 3VG9B 1HHGA 4UQ2A 1UJ3B 2FLRT 1TVBB 1I9RH 3VWKA 5DD0L 3DLQR 3MV8B 4YGAB 4IIQC 5TE6L 2JIXD 4HIIA 5ENWB 3VWKC 1DN0B 4N0CC 4GKNB 4OD2A 1OD9A 1RIHH 2O5XH 3BEWA 4P5TD 3FKUS 2FR4B 2Y06H 4RMUA 2EZ0C 2W9DL 4JZOB 1OCWH 2FD6L 3WD5L 2EIDA 1WZ1L 1U3HC 1J0KA 5IEKB 4PPTA 4PJDB 3F7RA 4HF5L 1Z9OA 2DI9A 3DVGA 4RBPK 5IFJA 4RGOH 3KS0J 1CCZA 3RVWC 2A83A 5EZOL 1M05B 5E00B 3PP4L 4QHMA 3NIFF 1RY7B 3U6RB 1MVUA 3ETBF 4K55A 4XVTH 2OQJB 2CUMA 2OL3A 4I48B 3PHSA 5ITBH 3SDXA 4CW1A 4WO4B 1KIPA 2E9IA 2BVPB 1BPVA 2BDNL 1YEHL 4XVUD 5JIKA 1T03L 4G8GD 4G8EA 5JW3L 4RGNC 2GTZB 4JG1H 4ALAL 1FAIH 1U8OA 2FH6A 3SDCB 2NCMA 3WUWB 3DMMD 3QXDA 4M1CD 4OCYH 1P4LB 4NQED 4AG4H 5DWUH 1OB1B 4M4RA 1R5IB 4NN5C 5D7SH 3VXNB 2OL3L 4P4RB 3O3BA 3MV9E 1SHMA 3QXAA 4J3UA 4I3SL 5CD5D 2JJTA 1JGEA 4X5WB 4D0CA 5B22A 3KLHD 5DTFB 2YD8A 2VLRB 3SDXF 4HIJA 3CSYB 1DZBA 4B53A 3JWOC 3MO1A 4F37K 4WNQA 1OPGL 1VGKB 4H1LG 5IB4B 5D7IA 4BFIA 4AK1A 4XI5D 1I3GH 3SOBL 5HHVL 1Z3GH 1P2CB 3C5ZB 1JMXA 4HPYH 5CINL 4XNZB 5L2KE 5GGQH 2DDQH 2LVCA 3T0EE 4H8WH 4X6BB 5SWSB 1HH9A 1A2YA 1AR2A 3QNXA 1U8HA 1UB6B 2VDLL 4JFEB 4KDTC 5MERB 2JB6A 1JZ2A 2XICA 3FO2A 4C56D 3JV6A 5HI3D 1H5BB 4XXCA 1SMOA 5FO7B 5ID1A 2X4OA 4OZFB 2BRRL 3PWPB 3NGBB 5IFAL 1CLYL 1QA9A 4XXCC 1GVIA 2WW8A 3SKJL 1MUJB 1MCFA 5K33A 1YEKL 5AG9A 3MLYL 4MXVF 1I85C 1VGEL 3D18B 4L4TD 1SVCP 1YNKL 1IGTB 1QLFA 2YBRA 4R4FH 3QNZB 5CGYC 1UQSA 3DJ9A 3EJYD 1KYOJ 1A02N 4UT9L 4K2UL 3VXSE 2MTPA 1N4XL 3OX8A 3U7YL 2OSLB 5KS9E 1PY4A 3QWRD 4MNGB 1L7TL 4MSWA 1UEYA 1IGCH 1WICA 3T2NH 4UBDC 4WW1B 2XZAH 3DV4B 4MCZA 1L0QA 3TNNB 4GG8A 4NQSA 4R4ND 4N68A 4CAGA 3L5XH 2OR9H 4PLOB 4KVCH 4RX4D 3LQMA 1A21A 5DQJB 1YY9D 3UJIL 2NXZC 3D85A 1ZLSH 1NUFA 1HDMB 4K23L 1RZFH 2YSSA 1T0MB 5LQBH 4YHOH 2F15A 4YFLF 4OGXH 5KSBE 5ACLA 2LTQB 4FFZH 4UU9B 2IANB 4NM4L 1JGVH 5GGRY 4XBGA 3BI9X 1Q0XH 4PJ8D 4ZUTB 2PXYC 1CS6A 3ARYA 2YEZA 3MJ8A 1AO7D 2EDXA 2APXA 1IC7L 5KVDL 3DHMA 4E41A 1VCAA 4LNRA 5E9DD 4LPXA 1EGJA 1IFHL 5EO9A 1X7QB 1OF2A 2BMKA 5EWIL 5I75C 4DN4H 4KV5F 3L9RA 1XGTB 3GSRA 4JHZA 4F7TB 2UUDK 1NC4B 3NIDF 5F3HB 1A7OL 5C0DA 5HGHA 3CX5J 3SDDD 3GUTB 4MJ6A 3QPXH 1BECA 1FYTA 2FBJH 4GG6A 4Y4FA 2A6IB 5DFTA 3RWFB 1CE1L 2ICEA 3HAEA 4PRIE 3KXFA 5CLWA 3H0TA 3MYZA 4OIIL 1DQJB 3GKWL 5HGDB 1EDQA 2FHBA 2VDKH 3RVTD 3MLZH 3QUYC 4F37F 4PJ5B 4M8VA 4DGIL 5C8JB 5D2LE 4AH2A 2Q86B 1V3LA 2XZCL 5CD3A 1T2QL 5C0BD 3D25A 1IEAA 2X40A 2Q3ZA 3W0WB 4Y19D 4F2MB 4K3DH 2QQQA 1H3VA 1A1MB 1A9EB 2G60L 4GG6F 3X11B 2QSVA 4KWUA 3EYOB 3QZWG 1DANT 3F7VB 2DM7A 2NR6C 5HGBA 3QUMA 4XMKH 1N6QH 2GJZA 2X4PB 2AP2A 4NQEE 3IXAB 5GGUA 4PY7B 2WUBH 4H25A 1FL5A 3CPLA 4PJFE 4Y89A 4P2CG 5BS0B 4LMQE 4K8RD 4GXVL 2BSRA 4HUXB 3S3JA 2CLZB 3QIUB 3EFFB 5GJSH 5BW7A 3IU3A 3A6OA 4PRHB 4UINH 5DA0B 4YHIA 1P4IH 4KI5D 4Q9QH 4Q97A 4ONFL 4LSPL 3DI2B 1C7SA 3QUML 2V7NB 4GSDH 1JNNH 5BW7C 1GHFL 3PWUA 3TYGH 2IPUG 1BWMA 3CC5A 2VL5A 5SV4A 2WNGA 1KJ2B 4X6DA 2OZ4H 3DUUA 3JTSB 4P9HC 5C0EA 2VB5A 1KCKA 1LO2H 4JZJA 4C56E 1NC2B 4DN3H 3CFCH 3U30C 1QFHA 1DLFH 4ZDHA 3OAUH 4YHLH 5E6ID 4G6AD 1IGML 4JZJC 4FABH 1N5YH 4QY8B 4DCQA 3WV0A 4FQ2L 4P9HL 1GAFL 4LHUD 4G9FD 1MFAH 3S4SB 3U0TB 4JY5H 2W60A 1JI2A 2IH1B 1Y6KR 3P30H 3LAFA 3AMLA 4OGZA 4HK0B 4I3RL 3FQUB 4X6DF 4YBQC 4J3OC 1C7TA 5F9OL 1XIWA 4MAYD 2MMXA 2Q8BH 4CVXB 2KH2B 5M95B 5KTEL 2NW2A 1VPOH 4YUEH 4XNYL 1R3HA 1XZ0B 2AI0L 1VFBA 3MGTA 4LLWA 1BZ7A 1J1OH 1YUHB 1RJCA 3L3OB 4LCCB 1UEMA 1Z2KA 4OLVL 4XMPH 5C0AB 3MXWL 4F33B 4M7LL 3GDBA 5KVEL 2FL5A 2MCPH 5TPWL 4U6YB 4XMLL 2PKDA 2VDOL 4QHUA 4Z7WE 4Z7NE 2WBJA 4J1UA 3IJSA 5F7EH 5IW6B 2C9AA 5KSAA 4X4XB 4LCWB 1U58A 3ARZA 1ZOXA 3E3QC 2KPNA 2VITA 2HT4C 3KPRD 5KSAC 1LK3L 4C4KO 3CFIC 4FOMA 3QQ4B 2V2XB 1FFNA 4JN1H 2NY2D 4O5LL 4MWFA 4LRIC 3GRWA 3O6KH 4C4KT 4JM2D 1I9JL 3L3JB 5MP6L 1JUFA 2ZOKB 3VFWA 1JHTA 1C16A 2IGFL 1AO7E 3KPSB 1OAZH 1W0WA 2VDQL 3FN0L 3DX7B 4QYOA 4LSQL 5E9DE 5IMMB 2QQLL 1SYVA 4NKDB 1LQSR 3ZHDA 2E7HA 4GLRI 3RZCC 4ZUVA 1R5VA 5KOMC 3GRWL 4OSUL 3MRRB 4QRRB 3HZKA 5BQ7B 1YPZB 2ICWI 4HWBA 1FRGH 4GRLC 3OR7A 3QIBC 5CP7A 2FWOA 1OLZA 1CDGA 4GBXA 1UCTA 5D2NE 5KN5B 4N8VB 2J8OA 2VLKD 3FAWA 4GBXC 3VFSB 4HH8A 3W39B 3BP7A 2Z35A 5EOCL 2Z8RA 5FCUL 1MCPL 4BZYA 3CDGA 1HILB 1XGQA 1A6WH 3A6CH 4UIKL 5I2IB 5CSZA 1IZKA 4HWBL 2J8UA 1LMKA 2N7BA 3QQ9D 3QJFB 3RNKA 2AJZA 5C0BE 1Y18B 5IIEA 2NY1D 4DKEH 2X9XA 3UTZA 3ME0A 3QO0B 4JFXA 2VXUH 4EXPX 4CMMB 2BZDA 4YDKL 1U93B 1EXUA 3NMEA 5GHWH 5CP3H 5IB5B 3K3QA 2BSTB 3VXMA 1P4BH 3RWDB 1LWRA 4P2OD 3BZDA 4PBVC 2HFFB 4DUWA 1FQ9C 3IDMA 2FB4H 3QEQB 1VKXA 4HC1A 5C86A 3O4OB 3U9UB 1LNUB 5BVPL 3GM8A 3WNKA 4NRZB 3VWKD 4ZAKB 4NJ9L 3VD5A 2C4FU 3ARUA 4KI5E 2EZ0D 1WFUA 4O58L 4RA3A 1OP3K 5BZWB 1U3HD 3FHAA 5EBLA 1J05B 3WSQH 5KAQG 2VXQH 3FB5A 3MGOA 1E4JA 2OP4H 4YE4L 3NZHL 1NUGA 5H35B 3RL2B 4U2ZA 3QAZB 1VEOA 3DUSB 3MUGA 2YC1A 3LEXB 5GS2D 3RVWD 5L7XH 1KLUB 1T6WA 2R4SL 2D7TL 2D0FA 3B6SB 2GK2A 3GGWA 4BZ1L 4JKLA 1KT2A 3OZ9L 1CFNA 3WEXA 2PTTA 1N59B 4G9FE 5DJYB 4HDIB 1IM9A 4LAJH 5IHUL 4LAQL 3G04B 3CMGA 3MCLH 1DR9A 2W1NA 4L9DA 4KMTH 3K7UA 4I9WE 3MACH 1ZHKB 3U4BL 3MOQA 1S7QB 2B1HH 2DQFB 2Y7QA 8FABA 5DJCA 4U1MB 4L3CA 1T4KB 4RISL 4PRAA 3ZTJG 3C09C 4FQJH 3QH3B 2EH7L 3AU1A 5EB9A 1A1NA 1QEWB 3DGGB 1IGYB 4TOYL 5C6TH 1FZJA 4PTUB 1WLHA 1IILE 4KVNL 2BNUB 1NFIA 3EYSH 3SGDI 1UA6H 3ARRA 3MOAL 1YEFH 1X5IA 5IMOA 4JFPB 4M3KB 2A1WL 3GSQB 4KMLB 1JZ4A 2R1YB 3BSZL 5ETUA 4JCLA 2ENSA 2Q1EA 3JBG7 1KF9B 1V7NH 4FQ1H 3H6JA 2WLYA 4Z9KB 3SHSA 1A3LH 1A4JB 2EDQA 2NY6C 3I02B 2HG5B 1I3RA 3BW9A 4CL7A 4MHHI 2GHWB 4ONGH 4GMSH 1GCFA 3O2DA 3KJ6H 1RQ5A 1OGAA 2MPAL 5DD6A 4DVBA 3MRQA 4P46B 5CFHA 4X6CB 2X1QA 1TTFA 1I9IL 1MJ7L 4K7FB 1EERB 2VZVA 1AY1H 4O51B 1F8TH 5HYJB 4JPKL 4Q9BA 3W2DL 1MHHA 3HLAB 4X5LA 4F7PA 2RJMA 4PB0L 4CNIA 3D6GA 3O2DL 2NTFB 3QXTA 2KUTA 5I8CA 4X98A 3KYNB 5INDB 4EZMA 1KTLA 3IDXH 4XVSH 2DM3A 4PJEE 5KJRH 2C3XA 1RD6A 3ZTNH 2P8MB 3ILQD 2VLKE 3O3AA 1AD9A 5T5NF 1FZOA 1EHLH 2B4CH 5IMKA 3IXTB 4QXGH 5FKAB 3SKOB 5F1NB 1SVZA 3FT4B 3FOLB 4GW5B 4NQXB 3RTQB 4LIQL 1T5XB 2VQUA 3IDJB 5IEHB 3V0WL 5FA4B 2A0LC 4K8RH 2VOTA 5CIPH 2Z31C 3D9AL 3MMEA 2XNAA 3D85D 3ZYZA 4WI7A 4EI6A 4PV9A 1T21A 1DQDH 4IS6A 3NAAL 3BHBB 3OKNB 3MJGX 1U41A 4LVOB 3ORJA 2BVTA 4LCUA 3KVQA 5AZEH 1ZHLA 1BAFL 4OQTA 4QHLB 2JB5L 1QUNA 1A6AA 1TQBC 1A6TA 4PG2A 4U0RC 3V6FB 3I50L 2P8LB 5EDXA 2FIKA 5IQ7L 4KKAD 3ZHKA 3GSNA 3SJVE 4QHNA 4GS7C 4LQ1A 2F19H 2OMNA 1NLBL 1R3LA 1T1YB 1KIUA 3RU8L 1G9MC 1ZKAA 4OQTL 3BIKA 2HFGH 1G7JA 4UDUB 3GIZH 5EOTB 3P73B 1P53A 2I25N 4AT6B 4NQDB 7CGTA 4UV4L 4Y4FD 4HIXL 1A64A 1CFVL 4MS8C 3WFEH 2GJ6A 1KFAH 1G9ML 2PW2B 1FNFA 1NFDA 3KXFD 3EO0A 4R97C 2YD3A 2BNQB 1U8NB 3GMQA 4YDLC 3FB6A 1WWAX 4KAQH 5DZNA 4PRPA 3BGMA 3SDXE 3P40A 4PYHA 1K8IB 4ELKA 3UP1A 1T1ZB 4PIRF 1S7RB 4JANA 1EUUA 2NR6D 3GSUA 1ORSB 2XV6B 2D4DA 2R29H 2XWTA 3V52L 3MRHB 3VMPA 4PB9L 1NFDF 2OI9B 3QR2A 5BMFH 1OGTA 1CD1B 3V5DB 5CJOL 5JDSB 2H1PL 4YR6B 2IG2H 3BPOB 1T1XA 1ZT1A 4LLMA 4KUCD 3WN5B 2O5YL 4E0RB 3VFRB 1DBBL 1MY5A 5MEPB 3ZO0A 3MC0A 5K9KA 1OW0C 1RURH 5D7IE 3BDYL 4G7VL 4OCXH 4U6XA 4NZJA 5IROC 1DBML 4LRNL 3EZ8A 1CLZL 4TUKL 5K9QI 1QSFA 4NKMA 3KWWA 3VRIB 2J4WL 2Z93A 1FL3B 4QRPA 1ZGLB 4JAMB 3S96B 4Z77B 3BKJH 3DSFH 3JWDC 1Q72L 1U0QA 3OAYH 1NEZA 5K9OA 3TWCL 1NJ9A 4IHOA 4BM7A 5E8PB 1LEIB 1GGIH 3MBEC 1ADQH 2EDKA 2CIKB 5JW5B 3H7BB 3JWDL 3CVHB 1F6FB 4X7SH 4HWEH 3QUZA 3RWEB 4OFDA 2WQ8A 4Q58C 2VQ1A 2ADFH 3MSPA 4KC3B 3U1SL 3ARFC 3QUZC 1T7VA 3DBXA 3DETC 2RFXB 1JWMB 1XIWD 2ERJC 1UKTA 3UZEA 4YAQA 1FP5A 3CZFA 4JM4H 2QQKH 4I2XA 3RJDA 3KHOA 2RAMA 3BVNB 5JHDA 1UJTA 5DD0H 5KSUA 1YEIL 4Y5YB 2CKBB 3KYKL 2CLRA 5TE6H 4U1SA 2DB8A 1FVEB 1WWBX 4I5BA 3GNML 1MHEB 4M5ZL 1B2WH 2FEDC 4AEHH 4MQTB 5TFSL 3WXVL 3ULUL 3WD5H 1WZ1H 1QVOB 2JCCB 3G08A 4ZD3L 1DQLL 4HF5H 5JORB 3ULUF 4HKBA 5KSAD 2HT4D 5C9KA 1U8QA 1QFWL 5F7UA 3DURB 2W92A 1K5NB 1GC1C 4KV5E 3TV3H 3BKML 3MRKB 3BP5B 3TVMA 3QDMB 3PP4H 5ANMA 3Q0HA 5DDHB 1QKZL 3ZE2E 3TVMC 1QFWM 1WFNA 1IGJB 1MAJA 3X14B 4OAWB 2X1XR 3GJFK 1E0OB 2P5EE 2X4SB 4RMRA 3HC0B 2DQEH 2FJGB 5MI0B 4B41A 5L8KB 5IBLC 4U1LB 3HC4L 3O3EA 5IOPA 2BDNH 1KG0A 1JV5A 5JW3H 4OD1H 3HFML 2A6DA 1MQKH 2Q3AA 4S1QL 1I7TA 1RUML 1TZIA 3ZDXE 4PGBB 1ND0A 3DXAB 2D03H 2MQ3A 4LLAA 1NKRA 1DBKH 4GBXD 4GKZB 3EO1A 3MNWA 4I13B 4I3SH 3TA3A 5CILL 4UNUA 1WBZB 4NNXA 1PX3A 1WQVT 4TVPL 3KXFE 2UY6A 4TULH 1ONQA 2DL9A 4HKXB 4KI1A 2EXWD 4UILL 2XQBL 2FH8A 1RZ7L 2P44B 3SOBH 3AS2A 1MCIA 4HBCL 1ZHBB 1OP5H 2JJUA 5E5UB 4O2EB 1K6QL 1PX4A 2ZUXA 1QRNB 3CFDA 3JWOH 3D69B 3SQOL 4TSBH 3IFPB 4WU5B 2Y5TB 3WIHA 3KYMA 3PXJA 3RZWA 4LVNC 2WINA 4ZODA 3UROR 4IMLA 1OM3L 1CZ8L 2ZCHH 1UM5H 1FNAA 3VXMD 3D3VA 4J3WA 4M7LT 2AXFA 3P77A 1ZLVH 1GOHA 2YUWA 2BRRH 5IT2L 4X6FB 1GH7A 4QHKJ 3T3PE 2VNCA 5DJZA 5TDNB 5C0CE 3PDGA 2P43B 5LXGH 1T04A 4U7SA 1P9MA 2LVEA 3WIHL 1G7IB 2VXTL 4OZHB 2EE6A 5C3LD 1T22A 3BT2L 4NSKA 4HUWB 2Y9RT 4K2UH 5J06A 5FF6A 3VGGA 3EW3B 3T77A 1G6RH 1KB5H 3UZQA 2HFEA 1K2DB 3F7YB 5IJKA 3RGVA 5JOEA 1QHPA 3IKKA 1TVDA 4JN2B 5DR5H 1VFMA 1BGXH 4MXQC 3C9NA 5IJKC 1MCSA 3ALXA 2Q6WA 3SCMB 5FHAH 4BKLA 3H3BC 4KROB 4WWID 1A7QL 4GAGH 5C0JB 4QXUH 5IW1A 2A73A 4P5KA 1Q1JL 3GJFA 5GRJL 5JOFB 1IM9D 4RBPH 2XZZA 4K23H 1BIHA 1S9XB 1HSAA 2J5LC 1URLA 3WYRA 1D9KB 4BFGA 1F11A 5GGTA 3T1FB 2CLVB 4NM4H 4ZFFA 2FO1A 1RJYB 4ZPTA 3CFKB 2ZOLB 1N6UA 1MFDL 1IC7H 2ATKA 4CU7A 3CDYA 2P5WB 1ACYH 2JK5A 4V1DA 5DEFB 1XMWA 3G5VA 3OKLB 5IMLB 3HZYB 1S3KL 2DLGA 3IDIB 4G6KL 5EWIH 3S37L 4TTDD 1WBXA 3C5JB 4U1JB 3E3QE 1W8OA 4P2RD 2XT1B 1HHIA 4QKXB 5I1AA 2VLJA 4XCYB 5IV2A 3HR5A 4LNVA 4CN4A 1BQHB 1RJLB 4HMCA 2AXHA 3MUZ1 4ETQA 3AC0A 3B83A 3G9AB 5CJXC 1CE1H 1MWAA 4QWWC 1TPXC 5MENA 4ONOA 4OIIH 3VW3H 3O6LL 4Y4KB 1KENL 3OKOA 3O6FC 3MA7B 5FO8B 4OCNC 4HK3J 2DKMA 4D0DB 1RULH 4W4OC 1OGAD 4DGIH 1N2RB 3FRPG 1CDUA 1T2QH 2EDHA 4BQ9A 4JY4B 4IDJL 5FYKL 1CI5A 5HHNA 1MWAL 1AQDB 1ZS8A 4NT6A 1CDHA 5K9JL 4LHUG 5ID0A 4NN6C 2Y07L 3MJ9A 4WV1A 3UDWC 4D94A 4A2MA 3CZJA 2AXGB 2CMRL 15C8L 4MXWL 4MAUL 3S37X 3FFDA 2X4UA 2BC4A 4R9HA 1Q9KA 3LV3B 5I1LB 1CD8A 1BWWA 5KBNC 1OY3B 3T0AA 2X44D 5EIIB 2ZNWA 1IRAY 3MJ9L 4ONFH 4LSPH 4MNHA 3F6LA 3QI9C 2J8UE 2A0LD 4PJ7A 3C8KA 3QDAA 1QFPA 2Z31D 3AXLB 5EIVA 2X4QA 2PETA 5DJ8B 4QRTA 2P45B 1RSFA 4F7EB 5E2VL 4WW2B 3L95A 2VO5A 1NDGA 2NY4C 3B9EA 1CE6A 4Z7VA 4P4KC 4JREB 3VE0A 1YEGH 2KKQA 4UUJA 5JLZB 3GMPA 4K3JH 4R0LC 3MV9B 3VFVB 2H8PA 1DUYA 4F7MB 4FQ2H 3LKRB 4PS4H 4LKXA 3RA7L 1GAFH 4PJ7F 2AV7A 2VIRB 2AXJA 4UAOB 1GGTA 3LRSB 4YC2B 3O3DA 3UPRA 2ZP0T 1TLKA 1HHKB 4FNLL 4OLUH 5E6ZA 3ECBB 4BFBD 5KW9H 4Z7VF 5A16B 1EEYB 5KTEH 5L2KB 5EU3B 5T5FL 1MAKA 4L1DA 3T0EB 2NNAA 2ADIB 3ILPA 4X9IA 1MCJA 4EBQL 5C0NC 1NL0L 4XP4L 2YPLA 4MS8D 4OLVH 4ODVL 5DHYA 2C3WA 4CADA 3MXWH 3CMOH 1I7ZA 1JMZA 3BQUB 4LGSB 4ONHA 1FFPB 1MQ8A 1QO3A 2GJ6D 4XMLH 2RGSA 4NNPL 4YPGB 5J3HD 3TP4A 4Z0XA 2CO7B 4RMVA 4OFKA 3H7LA 5B4MD 2ZSVA 4PJAA 1E27A 1CICA 4JJ5A 2P24B 3HMWL 4P3DA 4PRPD 2WMPA 3QYCA 2NQCA 5GRYA 1RZIB 3R0MA 2XG4A 3GMNA 3VXSB 2RBLA 3OHXA 3B2VH 5KS9B 4XWOC 4FMKA 4HPOL 2AQ2A 1N8ZA 1A0QL 1LHZA 1I1AB 1I9JH 4KZEH 5HVFB 1TETL 3L3HA 3NFPB 2IGFH 3IETB 2FHCA 3FN0H 1J12A 3TZVC 1ES0B 3F8UB 1INDL 3X13A 3SEPA 1F00I 1MAML 3BGAA 1RK0B 1UWGL 3EYVA 4EUPG 4QRQB 4LPTA 5BVJB 3JVGA 3Q1SL 4RFNB 4BSWB 4P2RE 5EBGA 3Q5TA 3QULA 1XR9B 2L7JA 1N0XL 1KPUB 5HHPB 4P23B 2ICWA 4HS3B 5BXFB 1QSFD 1VENA 2A74A 3VGEA 4QRPD 5KSBB 1W2KT 2X70B 4NFBA 2VKXA 4FS0A 1DL7L 1IL1B 1IAKA 1RZGB 1MCPH 5EOCH 3BZFB 3FOMA 5EUOA 2EYSA 3O9WA 2K7PA 1WV7T 1IBGH 4UIKH 5MEOB 1OGAE 5EZJA 4PYGA 3T0DA 4JEGB 1MEXL 3P9MA 1QBLL 2VABA 1AR1C 4P5TB 3NA4A 5FUZH 3T0VA 1Y0LA 3ZDZF 5LWYH 5EUKB 2J6EA 3UAJC 3ARFD 3B5GA 3VGHA 3QUZD 4OI9A 3DETD 3ALWA 4ISVA 2YPVL 5E8EB 4LSVL 1QSEE 4R2GD 1ZE3C 1MFBL 1LE9A 4EN3C 5EUOF 5I74B 4HGWA 4LIQE 5CHNA 2MWCA 3ULUD 2YOCA 1JN6A 3OKYA 4APQB 5JHDD 1OQXA 4PRIB 1U8IA 2J6EL 3KYOA 2G2RA 2N7AA 2FEDD 3IU4L 4Z7UF 5DD1H 2ZCKL 3VI3F 3QWOA 2OJZL 4O58H 1PEWA 1KJ3L 3U4AA 1TZHA 3WKML 3FT3A 5D2LB 1DE4B 2AJYH 5IUSA 1CVSC 2EDTA 4Y5XB 3UXFA 3ARSA 2HT3D 2UYLA 1DVFC 4KKBD 2YWYA 3G6AA 3ABZA 5LGHL 4L3AA 4PJ9B 2DWDB 2J2ZA 1ZT7B 4WFGD 1A6VH 3PGCA 2H2PC 4RRPA 4NQEB 2R4SH 3HC3H 5DJ6A 4OKVB 3TVMD 5GS1B 4PJFB 3UTPE 1AI1H 1F13A 5DMIL 1A7NH 2PUQT 5L2JA 3RPIA 5IHUH 4NBYB 5JW4M 4FFWC 3NVQA 2R56L 4N1EA 1QNZL 4BUHA 4LCYB 4Z76B 5BV7C 4TVPD 4WFEE 4RMWA 2IAMA 2IPTH 2Y6SC 1X5LA 1LILA 3LH2H 2VE6A 3PV6B 2IAMC 4ODWA 2EH7H 3EO9L 3NN8A 5AWNH 1CQKA 1HSBA 3TA3D 4KVNH 2HKHH 2ZUTA 4X7DC 3B3IA 4FFVC 1EEZB 2A1WH 4UT7L 4JFZH 5JHLH 3LSOA 3MBXL 3MLRL 4NRXA 3VXTA 2DQHH 4PRPE 1IQDA 2F53E 3PDOA 2OTUA 3EOYG 5TGBB 3OKKA 1U92B 5IJVB 4HBQA 4NYLA 5DK0B 3MRPB 5K59E 4FQHA 4LPYA 3IFOA 5FUOH 1LO3L 5E8OB 2ZCLH 3MRCB 2I60H 1PVHA 1ZVSA 2MPAH 3D3VD 3QG7L 4J3SA 4DTGH 5CBEB 5J0BA 2MFNA 3GO1L 4HX1A 4KXZH 2QTEA 1I9IH 4U7MA 3BH8A 3H3PH 4KK6C 5DYOB 3RL1B 3WDIA 2GCYA 4JPKH 4U1IB 1AJ7L 3I6GB 3VD7A 4JPIA 4Z7WB 5TH2B 2YD9A 3FMGL 1G1YA 2VZSA 2XG5A 4XB8A 5DMKA 3V0AC 3QRGL 3O2DH 5IVXF 3EDDA 3T65B 2D31B 1HXMA 3ARGA 3DV6A 5ALCH 2WP3O 1KBGH 4JR9L 3E6HA 5C3TA 3U2SB 1QSFE 4OUUB 3ARGC 4HAGA 4MXQD 5ICXA 4BFEA 5E94B 3RGVD 2WP3T 3ES6B 5DVOA 2AV1A 2Q20A 5CEZD 2IBBA 3QUKB 4OGAC 1WVZA 4UOW1 4XNQB 4AIZB 5IQ9B 1I1RA 1OP3H 1D6EA 4URTB 1RIUH 1XGUA 1S9YA 1AO7B 2ITDB 2WK2A 4LIQH 1TIUA 4KJWC 5E9DB 4ZQKB 2PR4L 4QOKA 1PQZB 32C2A 3HAEG 2H6PB 3G6JA 2DQDL 4OFYA 4DZ8B 2C26A 4WFHD 3O81A 1AQKL 2CRMA 3LRHA 3MRNA 5HYQA 4JKWA 4R96B 3SDDB 1JGLL 5HHXH 4CVZB 3BJLA 4KRLB 4YH6A 1U8PB 3LKSB 2UWEA 1J1XL 1MRFL 5D2NB 2JB5H 1NANI 2APWA 1AKJA 4KH2A 5HGAA 3I50H 5T1LA 3DX8A 1ZHNA 5IQ7H 4KTDH 12E8H 5DUPL 1P7QD 4JDVB 5DK3A 3IFNL 3UBXA 3G6JF 3REVA 1FNEA 5HDLA 2BVQA 4XCNA 2IH3A 2ZUVA 1HKLH 1OD7A 5HY9B 4HEPG 4KZDL 3VG0L 3RU8H 2R2HB 5J7CC 3CK0H 3FB7A 2AJUL 4OQTH 1D5MB 5EBWA 1QP1A 4LLQB 2UWEF 1R24A 1Q9WA 1R5WA 2VLJD 4DFHA 1YMHA 5H37G 4WFGE 3BKCL 3QCUL 4UV4H 1CFVH 1BIIA 1K4CA 4JO4L 1OLLA 1QYGH 3LB6C 1G9MH 4KQ4H 3G5XB 3WLBB 3LQAC 3O6FD 1H3WM 5MEND 4OV6F 1KCVH 5ANME 1ETZA 5DQDH 3RI5K 1X5GA 4NQVA 5JMRA 1MIEH 3TO4C 2IPKA 1H15A 1TCRB 2EDDA 4R7DA 5DURD 4IRSB 3MODL 1D5IL 1NGYA 5ESAA 1JNJA 1J9CT 3V52H 2XFXB 4MLIA 3OAZK 3MLTA 5DLMH 3LEYH 5ALBL 5IGXL 2GSGB 4PJBA 3WL9A 3ZHLA 5IB3A 1P1ZA 1RUKH 2H1PH 4G7YL 5E2TH 5EO0A 4PGCB 5E6IB 2O5YH 1X5HA 1H0DB 1BD2D 1R6VA 2DKUA 1I7RA 1DBBH 2HLFD 5E2JA 3MRMB 1G0XA 1ULVA 4UDTA 4KHTH 1E4XH 4LEOA 3B5HA 4ZUUA 4G7VH 4G9FB 3F58H 4Z7OE 1ERNA 1A47A 4LRNH 3FO9B 1B0RA 4NJAH 5GGVH 4S11A 4D9LL 4PJBF 4TUKH 4YNYB 4S2SB 2J4WH 3VGAB 5HPOA 2NY4D 4P4KD 2BNRA 4E5XA 1BX2B 2G9HA 4OCSH 4WRLA 4JHAL 3BUYA 3TWCH 3D3VE 3S34H 1CR9H 1OAXH 5T3XH 1INQB 1QPPA 4ZTOL 4O4YL 1BJ1H 5ITFB 1CL7I 2PYEB 5DGRA 3RVVD 1G9NH 1JTPA 1T20A 2UVFA 3NZ8B 3VXRA 3U1SH 5IM7A 5FA3A 1ZEAH 5F9AC 1QFOA 2QSCL 2OR8A 3NA9L 2D4FA 3VH8A 4KJPC 3QHFL 3NCJL 4KMQA 4TNWK 3MRIB 4MJ4A 1NBZB 1NBYB 2VDML 3KPMA 3GK8H 3C5SA 3HE7B 3TT1L 2NY2B 3I3EA 3ESUF 4XCFL 3JTTB 5DK2B 2YPLD 2EYRA 1UYWL 5IHZB 2FX9H 2GITA 3SDYL 1FVCB 2VWEC 3UJTL 1FORL 2EIZB 3QEHA 5HTSA 1K3ZA 4AY0A 5TFSH 3DRTB 1V7ML 4YDVA 4OZGA 1OAKL 1BVKA 2W38A 5CCKH 4AMKL 4C83B 2EH8L 4I77H 1CICD 1HIML 3QJHB 5TQ0L 4G6JH 1QFWH 4DAGH 1NLDL 3UX9B 1PYWB 1CYGA 3RWHB 5L88L 3LOWA 1RIVL 2Z92B 1AD0B 5EO1A 3QEUA 4Z0BL 4PJEB 1DP0A 3HA0A 1AP2A 4JHWL 2LFGA 1QKZH 1S7WA 3REWA 4OZ4B 5ICZB 1AGBA 1T1WB 4NIKB 1GC1H 3MRGA 4OZGF 1IMHC 3RI5F 4H1LA 5LKNA 4K9EC 4OCWL 4M62H 1S7SA 3MCG1 4XBPB 1FBIL 5EG6C 5I73C 4YGVB 1NMBH 2WANA 1R0AL 1JZ6A 3CLFL 3Q48A 1MY7A 4AQOA 2E3VA 1GGCH 5D1ZB 3FCTA 4XCCL 2XWJA 3BWAB 1I8MA 5IR1A 1I8IB 2VLJE 1ODAA 4BK4A 2W9EH 4L4VA 4NN7C 3ZKXB 4DW2L 1RJZA 1Z5LB 5FYKE 3P0VL 4JQIL 5CILH 1J0IA 3BE1L 2ADJB 5DRWB 4I0PA 1CF8H 1IAIL 5MENE 3C2AH 5D9SB 4X5XB 3UJJH 4ELMF 1HHGB 4IIQB 1CDBA 3K8LA 3EOBB 3QXWA 4MQ7A 4U49A 2OS7A 2XTLA 4V2CB 4NPYA 1RZ7H 3VWKB 1MJUH 3TT3L 4HBCH 1AR1D 3BMWA 4M43L 1J7VR 1K6QH 3MFGB 4J4PA 3SJVB 3KPQA 1IAIM 3V6ZB 1U3HB 1MFCL 5C92A 4HKZB 5I1GH 4FXLA 1S5IH 2X4RA 1OM3H 2CR6A 5JQ6L 1W0VA 4PJCA 3T2QA 5IVZA 5HPMB 1MJJA 3EUUA 3D0VA 5IFJB 1ORQB 3W9DB 4OF8A 5AAWA 1F45A 4GAYB 3UTTA 2XIDA 1BD2E 4MDJB 3VXUA 1WISA 2L4OA 3JV0A 4J3VA 3ZL4L 5DJ2B 4MZ3A 5E7FA 3WE6A 3GMRA 1QLEL 4K7PL 3SGEI 1P5UA 2VXTH 3FONA 2BVOA 4TPRL 1QLRA 1W72L 2FGWH 1J8KA 1KJVB 3IF1A 5AD0A 1FN4A 5EN2A 3SDXB 4PJCF 1KIPB 4RGNB 4TNWF 3FRUA 3WHXB 1BOGB 2F9BT 1B4JH 2JELH 4CDGC 5C09E 3NPZB 1H3XA 5HD8C 4NN5B 1UWEH 3LN9A 3O11A 4KUZL 3QCVH 1FFOB 5FYLL 1F90H 5CWSB 4JB9L 4N8PA 1XF5B 4JFQA 3QXAB 3MNZB 5DRZA 2NYYC 5D7JC 4D0CB 1Q1JH 5GRJH 3OKDA 1PW3A 4TQEL 2D7PA 5D7IB 5GS0H 3HI6H 1YYLH 1DDHA 4IEFB 5T5NG 4OM1L 4K7PX 2IAMD 1EH9A 1KLGA 3PHOB 4JO2H 4GMTL 3V5HB 4KDVA 1TFHA 1JPSL 3K8KA 4QEGA 2YPLE 1A2YB 2VR4A 4OM0H 4X99B 4HSQA 2JB6B 1JNLL 1JWSA 3PWVA 4FFVD 5BO1H 3FO2B 5LGKA 4XCEA 3C6LA 5ID1B 4J8RA 4ZPVA 5D6DC 1CFSA 4X7CC 4PJHA 4DGVL 4PRNA 1AXTH 2DM2A 2DLTA 3S37H 5IFHH 1U8MA 4D3CL 3C6LC 4LSUH 4PJAE 5TJWK 5TQ2H 4G8IB 3TBTA 3PXHA 3O2WH 4QCIB 1A5FH 1QLFB 3HE6C 4Z5RA 2KDGA 4WWKA 1E28A 5IG7A 5CJ5A 1FPTL 3QQ3B 3T09A 1BZQK 2Z8VC 4WI9A 3OX8B 5FB8A 4WUKH 5KG9A 4XBEH 3O6LH 1KENH 4JO3L 5CZVL 4PJHF 2H2SC 2OTWA 4LEXL 3VD3A 3GMLB 3ZE1E 1GZPB 3EJZD 5E8NA 1RAMA 3ARWA 4NQSB 1JGUH 3H9SA 5FYKH 4HLZG 3L5HA 1NSNH 4HCRH 1BHGA 2NXZB 2WLZA 5K9JH 3FFCD 1NUNB 1GSMA 2R2BA 2VSCA 3QSKB 4HH9B 4JZNA 3SKUD 1JFQH 1RU9L 3O4LA 4QRSB 5GGSB 3D5OF 2C1PA 3ARGD 2CMRH 15C8H 3ZDZE 1T6VN 3EIFA 4U1KA 1TJHL 4HEME 3EOTL 3VXPA 5I0DA 1WC7A 2DQTL 3QFJA 2AW2A 4Q9RL 4HQQH 3V4VL 2DQCH 1P7KB 5F1IA 5F1OB 1H9VA 2PXYB 5ESQA 4LGPB 4NBXB 3ARDA 5JPMB 5KVFH 3FAXA 2YEZB 5F96L 2P5EB 3ARDC 1FG2A 1IKNC 4QOKD 5I75B 4ZYKB 1TVHA 1CTOA 5B38G 4OV5B 3VI3E 4OFYD 4QTIL 5DVKA 4H26B 2DIAA 4QXTA 4KRMB 5KANG 1CU4H 1S9WA 2B5IC 2ADGA 3DVFA 3IAPA 3EKCA 4ZFGL 1ZANL 4AYFA 1MCHA 4NOBA 3DOSA 2XXMB 3KXFB 5T1LD 3H0TB 3QUYB 3ZYJA 5A2IH 1IEBA 5E08L 2V17L 1RV6X 2YK1L 5D72L 1F4WL 5DD5L 2YD4A 1INEL 5I8OL 4AH2B 2ZG2A 1Z9LA 1P6FA 3EGSB 4Y5VA 3C60A 2BRQA 3C08L 4BQCA 1NL0H 4JFFD 4RCAA 4TSAH 2HKFH 2VDNL 3LB6D 3SKMB 3DTXA 1UM6L 2AKRA 3QUMB 3V6OC 2GJZB 3DROA 3QDGB 1UKSA 4XP9H 5EOCJ 4ZNEE 3A67L 1YY8A 3CPLB 3TO4D 1MI5D 2X41A 1ZLWK 1JJUA 3PQYA 2BSRB 4Y4HA 5C0CB 1WIUA 3C8HA 4XH2B 3NFSL 3HMWH 3B9KA 3TBSA 4N0RA 1NEZG 4D0BB 2ARJQ 2R23B 4Y4HC 4EVNB 4JY6B 1JHKL 5AG8A 1HOCB 2Q76A 2FECI 1BVLA 3TN0C 1J88A 3U0WL 4FZ8L 5I1JL 4ZFOA 1UCBL 1A0QH 3CC5B 2P46B 4KKCD 3BP4A 1WCBA 3ZDYF 4WI2A 2F5BH 4YBHA 3U30B 1NCWL 1E4KA 5C0EB 2C3HA 4TRPL 3GM0A 3I2CL 3EJJX 1E4KC 1FVDB 1UWGH 4H5SA 4R8WH 3IGAA 5D96B 5I17B 3WJJA 3SE9L 1QBML 4ZFOL 4K07A 2AEQL 2MHAA 2EDLA 3WJJC 4ZFZA 4ERSH 1JRHI 5LJYH 1FE8H 1N0XH 1EBPA 4PD4J 2EIBA 1VACA 3VD9A 3BN9C 2BNRD 3O8XC 4TNVF 3H9HB 5F88A 1F4XL 5HI5C 1BZ7B 2F74B 3PHQA 4KU1A 2ZUYA 1FDLL 1L7IL 5DZLA 4DQOH 5J6GA 3RPKA 1TXKA 3N1QC 1QBLH 1BBDH 4RIRB 5D1XC 3BPNC 4B50A 4LSRL 3SPVB 1S8DA 4PP2B 1F02I 1B0WA 1C5CH 2YPKB 3MUJA 2B20A 3FFCE 4R26H 1UB5A 4J1UB 3IJSB 4KJPD 1NMCC 3VXRD 1QG3A 2YPVH 5D70L 2BY3A 5EC1A 1UXWB 4LSVH 5KSAB 1MFBH 4ZOCA 5I1KL 4FQXA 3X3FL 1U58B 4NGHL 3LIZH 5C7XL 2LAGB 3FTGB 5EZLA 2VITB 4OLWL 4ORGA 1ZSDA 1HEZA 3SY0A 3UO1L 3UYOD 4MWFB 3BEVB 3KS0H 2W59A 4G9DB 1KNOB 2R1WB 3IU4H 4ZUSA 4MX7A 2XN9A 3RWJA 2I07A 2OJZH 2GSIA 4WU7A 5JOPD 2FJFB 1FNGB 4HGMA 1GPOL 3WKMH 3MCKA 3MROB 5T1KA 1M71A 1FSKC 1FLTX 3RZCB 5CUSH 4QOKE 3FQRA 3F65A 1HXYB 2HVKA 3H3KA 3DVNB 4BZ2H 4RGMC 1F3DH 2FIRT 4ZUVB 5I18L 1N64L 1LK2A 1CK0H 4GRLB 5JO5B 1FGVH 3QIBB 1WT5A 4U1HB 4RWYL 2L7UA 1QZ1A 5C08E 3VI4E 4M4PA 3UTSA 1MLBB 5I0ZA 1A1OA 5CP7B 1WT5C 3GI9L 4GBXB 1MHCB 1F58L 3ZSTA 3TGXA 2HH0L 1GJIA 2CDFA 1LO5B 1PSKH 1WAAA 4LBEB 5FKPB 2P7TA 3CSGA 3CDGB 5CEYA 2HJKB 3N9GL 2R56H 2HRPL 3MV11 2HMIC 1RZKC 1NAMA 1CL7H 2QHRL 5LGJA 2J8UB 4L3ED 4R6UA 2AJSH 2GI7A 3RNKB 4PR5A 4CVWA 1QOKA 1VB9A 2WQRA 3U4EA 4X4ME 1OAYH 2AVGA 4JFXB 2VR5A 4RFEA 2DF3A 2QKIA 1VADB 4JFFE 3HNSL 1XGRA 1RZKL 5T1DH 1J0YA 5JUEL 3BWUC 3O6MH 4L4VD 5BV7H 2ENYA 3NCFB 3VFTB 4GUPA 4JFHE 4U1NB 2EC9T 1WAAF 1XH3A 1NAML 1EAJA 1J1PL 1A6PA 2Z4QA 5E2UH 1VKXB 1MI5E 4PTTA 2FJHA 4UT7H 5IK3B 2FATL 3BKYL 4J2XA 4P57B 3NOIA 2VN4A 1UJ3A 4J4PD 1B6DA 1TVBA 2QADD 5AUMA 3MV8A 4ZXBA 2WBWB 5EBLB 1CVRA 5ENWA 1DN0A 4GKNA 2I9LB 4ZXBC 4GAFB 1REIA 1JBJA 5D1QC 2FR4A 1DCLA 4LFHD 2J12B 4JZOA 4ODTL 3HZMB 5HI4C 1NCCL 5IEKA 3AB0C 3GO1H 3MREA 3MUGB 1BJ8A 3UTTD 3HMXA 3LKNA 3KPNB 2R0LH 4X80L 5FHBL 1AJ7H 3VXUD 1A6UL 5D5ME 3RWCB 4LQFL 1NGPL 3FMGH 3N0PB 5EU5A 3MJ6A 5GJTL 2W0KA 1CFNB 2DJ4A 1BQUA 5FYLD 1M05A 3GKZA 4FQLH 3U6RA 4JR9H 4YHPA 4M5YH 4FTVA 1OWWA 2VZUA 2EICA 2OQJA 4KKNA 4I48A 3HMXL 3VMOA 2BNRE 4N5UA 5HD8D 4I4WB 4WO4A 4UT6L 3C09B 5DJCB 4L3CB 4WI3A 1QPXA 4Z8FL 4HIHB 4M8QA 2GTZA 2NYYD 2NY3C 4OGYL 1X44A 5ECJE 3DX6A 5D7JD 3AS1A 3WUWA 1A1NB 1AGEB 2PR4H 4XHJC 1P4LA 2BJML 4D9QD 1NFIB 1KN2L 4P4RA 4BJLA 3VXRE 4X5WA 2P47B 4P2RB 3VGDA 4ZO9A 5DTFA 2VLRA 3CSYA 4RNRB 1VERA 2PW1B 2NY6B 1VGKA 5IB4A 1MRFH 3V0VB 5F93C 1P2CA 3C5ZA 4GXUN 4J6RH 1G7PB 4WDIB 2VWEE 3IFNH 4KK8C 5SX5H 5KZCD 1TJIL 5SWSA 1NCDL 1EAPA 1OGAB 1MCOL 1UB6A 3C6LD 5DD6B 1YNTB 1DBAL 3KG5A 4H0GA 4KZDH 5DJAA 4L29A 3VG0H 4OZGE 1H5BA 3DARA 3E8UL 5FO7A 3LN4B 3VWJC 2PTUA 3HE6D 3HN3A 4OZFA 3PWPA 1C8PA 1KEGL 4LLDA 4PJGB 3BKCH 3QCUH 4F7PB 4CNIB 4WWKD 2ESVB 1QSEB 2YKLL 3D18A 4KTEL 2VN7A 3D39E 1IGTA 2VLLA 4FMFA 3LEVH 4EJ1C 4S1DC 2GT9B 4OCMC 2WWMD 3QNZA 5FOBA 3WJLA 4HG4J 2ZUQC 1YMMB 3WIIL 3WJLC 1VEMA 3CJJA 3B9DA 3FQXB 4MNGA 3P0YL 4DKAA 5GXBB 1BJ1J 2VERN 2HTLD 3K81A 3LQAH 1Q0YL 3H9SD 3I75B 4WW1A 3DV4A 4L3EE 5T3ZL 3TNNA 2Z31B 3DRQA 2Q8AH 2W65A 3L3IB 5E5MA 3V5KB 1T3FA 1DJSA 5ALBH 5IGXH 4O02L 2NY7L 2XKUA 4L8SC 1DFBL 1LE5B 3O4LD 4F9PC 4R4BB 4XC1H 5HGGS 4PV9B 1FH5L 1T21B 2ID5A 4L4VE 5IWLA 2UZIL 3KAAA 3TBYB 4PREB 3QFJD 1XGYH 1TQBB 2E9WA 4U0RB 1NGXA 1ZHLB 3QG6B 4B0MM 1A6AB 1GYAA 3NCYS 1A6TB 1RUQL 3ARDD 3RP1A 3HB3C 4UOJA 4GS7B 2AJVL 3SGKC 5HDBE 3RGHA 1JF1B 5D71H 5DS8B 2ZKHL 4KPHH 4QHNB 4ZUTA 1CN4A 3IS1X 3GHBL 3P4MA 1SY6L 3K80A 1PLGH 1JL8A 1JPST 1G7JB 4XVUC 1H3PH 2ZPKH 3UCRA 2H3NB 4BH8A 3DMMC 5F3HA 5ADPH 4ZTOH 4R97B 4HWUA 3UTTE 2OJEA 3VXUE 4YDLB 2OCFD 5CD5C 1LO4L 2MOVA 4MA1C 3K8MA 4P5MB 2YZ8A 4YO0B 4NUGH 3KLHC 1SJHB 4JKMA 5FYLE 3NA9H 4QTHB 5DO2C 3NCJH 5HGDA 2F53B 2UZXB 3B8SA 3T2OA 3S88H 4PJ5A 3C60D 5B3JF 3V4UH 1HHHB 1V3MA 2O5ZL 3GSUB 4OQ1A 1PZ5B 1UYWH 2XWBB 4UNVA 5MHSD 4F2MA 4BYHA 1A1MA 1A9EA 4QHKI 5ADOH 4RAHA 1FORH 5DFVD 3UJTH 1WZKA 4KGJA 3EYUL 4N90E 4FG6C 43CAA 3F7VA 1OAKH 43C9B 2BOBA 3IXAA 5BOPA 3WHE1 4D9QE 4PY7A 1T1XB 3PQYD 4I0KA 4MA7L 4Y4HD 5TQ0H 1DUZB 4EEEA 5F3BB 2DQIL 3B9KD 5BS0A 1V8HA 2YXFA 4M6OL 4HUXA 3A0OA 3B4NA 2CLZA 3QIUA 2CDGB 1I1CA 4PBWD 3QEGL 1T83C 1E6JH 4PRHA 4LF3B 4Z0BH 4HAFA 2DQGH 2DQJH 3ARVA 4ODSL 1QSFB 1BVZA 1RZJC 2V7NA 1G7LA 2IWGA 3KWWB 3P4OB 1JHLH 4JHWH 4L8BB 2Z93B 4Q7DA 3LKQB 4LLVB 5F7LB 1QBAA 2HN7B 3PWNB 3NPSC 3KDMB 5I8EA 1KJ2A 3MBEB 5K9OB 1FBIH 4Z7QF 1NJ9B 1TMCB 4IHOB 3JTSA 4X7TB 2E8YA 2VISB 3CLFH 4R4NC 4EI5A 3JV4A 2AQ1A 1JK8B 1XCTB 3MRBB 4K9EH 4XCCH 1ITCA 4LSSL 3MZTA 4EI5C 3ARFB 3QUZB 4JO1L 1C5BH 2EC8A 5TE7L 2E27L 4DW2H 3BN9D 2ERJB 1MCNA 1KJ2L 4JG0L 4RFOH 4X9FA 3D0LB 1IAIH 4WUUB 3TIDA 5HI5D 4YAQB 4HK0A 3FQUA 4JE4B 3JZ7A 3TPUB 2VXSL 1E6OH 2Z8WC 3H8NA 4ODBD 5E5RB 2NW3B 4CVXA 4OLEA 2ED9A 3DNKA 3UYRH 3V2AR 3PL6A 3L6FB 3QCTL 5JW4Q 4NWTH 1XZ0A 1I4FA 2GW5A 1MCBA 4PJ8C 4QNPF 2E6PA 4RRPG 4WHYG 2KBGA 3PL6C 3L3OA 4LCCA 1G7MB 1MFCH 5C0AA 2J8HA 3B8YA 4OI8A 2A9ML 4PLJC 2HWZL 1UG9A 3G08B 4U6YA 3EOAB 5JQ6H 3O4LE 3MLXL 3OV6A 4FQXD 2I5YL 4LPVA 4YZFE 3IDGB 1OVZA 3TEUA 1C12B 4X4XA 3EYQC 4LCWA 1CBVH 4RMTA 5HYSB 3TVMB 3ZL4H 4M7JH 4G3YH 4K7PH 2YN5A 3QQ4A 3AM8C 4S1SL 2V2XA 3BFOA 2XN9D 4TPRH 1W72H 2QHLA 1NCBH 3BD5A 3GSVA 4NO3B 3L3JA 4YHKL 3O3EB 5IOPB 4JDZA 4X0KA 2XY2A 3KPSA 3Q6GL 5F71A 1JRHH 4LSDA 3DX7A 3WFBH 4XXDB 5HHOA 3VRLF 5IMMA 2A6DB 4NKDA 4U6TA 2KZWA 4R3SB 1CFQB 1FGNL 1HNGA 4N0FB 2R0ZH 4M02A 5C2UB 3UTSD 5JXAH 5B21A 4MDIA 4Q0XL 4QRRA 1J86A 3VFPA 3B9AA 3EO1B 3EDEA 1YPZA 1QR4A 1TZGH 3M1BA 3HNVL 1RHHB 1LEKB 1MELA 4PV8B 1ONQB 3B43A 4MNQA 4LSTL 4X6EB 3I6KB 4N8VA 5LCVL 5DJ0B 4XPFL 3W39A 2IMNA 3VRJB 4YIQA 1JZ8A 1ZLUH 5SV3A 2AABL 1Y6NR 2A6JA 3CFDB 5I2IA 3CGTA 4GMTH 5IW3A 4LVNB 1S5HB 3UEZA 1X4XA 1B0GB 3V6OE 3KYMB 4JFDA 5L6YL 1YPZF 1JNLH 2WINB 3QO0A 4EKXA 3D3VB 3J8F7 4I18A 1UM4H 5FEBA 1CLOL 4F8TA 5ACZA 3ZDYE 3BZ4A 5IB5A 2NY0C 1RHFA 3BAEL 3QUXA 2BSTA 4NNYB 4D3CH 4I18C 4OCLC 3FO0L 3O2VH 3KLDA 4XNUL 5DJZB 5E7BA 5F9DC 1IM3A 2HFFA 3QUXC 3QEQA 3A6BL 4JRWA 5JIIA 4MJID 4CRPA 2P8PB 1T7YA 3U9UA 4FZEL 3SKNB 3NCEB 4NRZA 1JF6A 4UIMB 5FF6B 1BM3H 2E9JA 3MV8D 4JPVL 2EECA 4ZXBD 2W0FB 5AYUL 1VA9A 5D1QD 4YEFA 2HFEB 4MJ2A 1KLFA 2OM5A 4MAYC 4JO3H 4WVRA 5CZVH 5BZWA 3KGRA 4LEXH 2NY5H 4YHML 4F57H 4OD3L 3C9NB 3BGFC 5F6HJ 2Q6WB 5AAMA 1GIGH 2EDJA 3KPLA 5D93C 3RL2A 5H35A 4W81A 3G5YA 1T7WA 3DUSA 3FO1B 4HFWA 3LEXA 1YNLL 5ISZA 3MRDB 4OJFH 5IW1B 3L1OL 2A73B 1KLUA 5GIRA 1RU9H 4LMQI 3IFLH 4P9MH 2FRGP 5HHMB 2J5LB 1XEDA 3UBXG 1CFTA 5F1SA 1RVFL 4JQXA 1TJHH 5EORH 1N59A 2EDBA 4FTVD 3HR6A 2DQTH 4HDIA 3V4VH 3G04A 5DJDA 3LS4L 4WO4D 2MQCA 2NY3D 1ZHKA 1CD9B 3SO5A 1S7QA 2DQFA 4ZPTB 1JZ3A 5CBAB 3MUY1 5FYKU 3MRFB 1P7QB 4U1MA 2LABA 2ATKB 4J12A 3BUTA 2B1AH 4GRMB 3WFCL 4N0YH 4Q2ZB 3QH3A 2EEDA 1QEWA 4Z6AT 2CRIA 4QTIH 1IGYA 3EYFA 3TC9A 3L7FB 2BNUA 4K94C 5C9JA 3NTCL 2VLRD 1HHIB 1IEHA 4JFPA 3MV7E 2FX7L 3LZFL 3GSQA 2R1YA 1FIGL 1TPXB 2YMXL 1MRCL 4ETQB 2IFFL 1CXHA 4GRWE 1X5KA 3C5ZD 2D7QA 3O6FB 4K94L 3TBVB 1TCMA 3PABB 4GQPH 3QHTC 4PJIB 1XF4B 2DD8L 4G80B 3OKOB 2V17H 5ERWB 4Q6IC 2HG5A 5F8QC 4EQ3A 2YK1H 5SWSD 1U8JA 1F4WH 35C8L 2FO4B 2XKNB 1L9MA 1KCLA 3ZZ1A 5E95B 5DURB 2CPCA 5DJXB 1JIBA 3C08H 4NN6B 1FO0H 3BMVA 3PWPD 1EO8H 2NY1C 1MJ8L 3GMMA 4K7FA 2VDNH 2PCPB 4M3JA 1L9NA 4O51A 4HS6B 1CWVA 2JJVA 1MHPL 5HYJA 4S1DD 2DL2A 3HLAA 3UTSE 2Q87A 3A67H 2NTFA 2X4UB 4P2OC 2BC4B 4HZLB 3KYNA 5INDA 2QL1A 1U42A 1BD2B 4NO2A 4H88L 4NCC2 1GZQB 1T2XA 1WAAE 4RAUB 3QI9B 1HHJA 5EBMA 5I8KL 2P8MA 4PGDA 3K2MC 3NACL 2ZWLT 1OTTD 4X6CF 4MNHB 5EA0L 5HJ3B 4NKQB 25C8H 3IXTA 5FKAA 3VXOB 5F1NA 5LBSL 5I1JH 1AFVL 3FT4A 2VAJA 3FOLA 3QIWA 3BYYA 2NY4B 3CDCA 4GW5A 2MKWA 3GSWB 4P4KB 2BERA 1T5XA 1NCWH 3IDJA 3WNMA 3QIWC 4UTBL 4KY1H 5T1MB 4HKJB 4NUJA 5C09B 1YEEL 3VH8G 4R0LB 2E6QA 2KQMA 3Q5YA 4M6ML 2HRLA 5CMAA 5JPNA 5E1AB 1A14L 3H2WA 2DIBA 4CMHC 1SBBA 2H8PB 1QBMH 3OKNA 3RAJL 1DQML 3HB3D 2AEQH 2QR0B 4U3CA 4FQIL 4LKXB 4ZUWA 3BZEA 3N50A 4NWUH 3EDJA 2WWKO 5TDPB 4MJIE 5FFLA 4QHLA 3AMKA 5F6IC 3ZE0F 3UPRB 1FNSH 3FQWB 3V6FA 1FL6B 1R3KB 2P8LA 4NM8H 4MA8L 1F3DJ 3U7WL 2WWKT 4HV8B 3HRZA 1F4XH 4GW1B 1S7XB 4HK3N 4HXBH 1T1YA 2YPLB 4JKPL 1PZUB 1HKFA 5DHYB 1C1EH 4PUBH 1IT9L 4UDUA 5EOTA 3ZYOA 1CFBA 2J3SA 3WO4C 4AT6A 4NQDA 4L8CB 4KGLA 1IGFH 1EJ6A 2JJTC 5DO2D 2DLFL 2PW2A 4Q9CA 4P2QD 5D70H 2ZSVB 4PJAB 4GQ9L 1E27B 2OK0L 5C7XH 2BNQA 1YEDA 3OTTA 4OLWH 1U8NA 4FTVE 4L5FH 5JTWA 3GMNB 4PJ5D 3TO2B 1KN4L 3LD8C 3OHXB 5F7YC 1FCCA 1HYSC 5EC2B 2VXVL 3DGCR 5FYJL 3W11D 1N8ZB 1K8IA 4M48L 1WCQA 3JXAA 1T1ZA 4FG6D 4PFEA 1S7RA 3TZVB 4GFTB 3V6BR 1ORSA 1GPOH 3NABL 3L3HB 4G6ML 3MRHA 2B2XL 4DGYH 1NBVH 1T5WA 3V7MA 4GRWH 4IRJA 3V5DA 1MNUL 3T04D 1N64H 4YR6A 3QQNA 4IRJC 5BS0D 1OL0A 3ISWA 4RWYH 3WN5A 1SBSH 3VFRA 2VLRE 2ED8A 4YHNB 3QIUD 3I9GL 3BOVA 4PRHD 4U33A 5DGQA 4YHYC 5I9QC 1F58H 2APBA 3LS5L 5I1IH 4ENEC 3N1FC 3D48R 3FOMB 4LFHG 3VRIA 2ZUWA 2XA8H 3ILQC 1LO0L 1FL3A 3N9GH 4DVRH 4N1HB 1LDPH 2HRPH 4WEBH 1ZGLA 4HJJH 4JAMA 3ZTJH 3S96A 4XP1H 5I1EL 3TH4T 2J88L 5I71C 1KCSL 2WUCL 4EI5D 1Y6MR 4XC3H 5IKCB 4AL8H 1GGYA 1DLHB 1Y0LB 5E8PA 2ZSWA 4OCRL 2R1XB 1LEIA 1CIDA 1XAUA 2NLJB 4NHUB 1RZKH 2CIKA 4EN3B 3TESA 5JW5A 3E2HC 5I1DB 5JR1L 3CVHA 4X4YA 1LE9B 1J1PH 3RWEA 2CDEA 2QJDA 3CXDH 5T3ZE 1IC4L 2X4NA 5CHNB 5DHVA 1BJMA 4KQ3L 5ILTL 1U8IB 4MNGE 3I3BA 3KYOB 3PL6D 3U46B 3BVNA 3WHE0 1OARH 4PLJD 2CKBA 1TZHB 3FT3B 1DVFB 5E99H 2V5SA 5C0AD 4KKAC 1MREL 1FVEA 5I19L 4OBSA 1KGCD 5CS7A 3PP3H 4Z78B 4W70A 1QQDB 3EYQD 3OJDB 2JCCA 1NCCH 1KOAA 1U6AL 1I3VA 5JORA 4LCWD 4XNXL 3DURA 1EGJL 4XB7A 3OXRB 1K5NA 4Y4FC 5J12C 4CJ1A 3PNWA 1IQWH 4N9GB 3MRKA 4UV7H 3BP5A 2GUOB 4KK9C 3QDMA 5L2JB 5GRVK 3RPIB 1SQ2N 1SM3L 4JFYB 5DDHA 5BV7B 1RFDL 3ULVF 3F62A 2DQUL 2IEPA 4XP5L 4Z95H 2HJLB 1K9TA 1IGJA 1S78D 4GW4B 3X14A 4OAWA 2JCCF 3K4DA 3MLWH 4G8GE 2FJGA 4O2FB 2YD5A 2XRAL 2IAMB 4U1LA 1CGVA 5HHOD 2DYPA 4GKSA 1A7RL 1Z9SA 4TYUA 4JGJA 2VE6B 3LHPH 5ELIA 3C6SA 3QDJA 1YQVH 2YA1A 4QRRD 4PGZA 4PGBA 3DXAA 1KC5L 1HSBB 3CCHB 5DEGB 1KN2H 2LQRA 2OTPA 4NP4H 3D2UB 4JKKA 1V3KA 3BDXA 2AGJL 3TJHC 4MNQD 1P6AB 1WSST 4P2QE 1WBZA 3AFLA 3ZLQC 1A9BB 4DKFL 2ZJSL 3LSOB 1GOGA 2DLEA 1BOYA 3QISA 3G5ZB 1MF2H 2OTUB 1FZKA 1XCQA 4IRZL 4BSVA 2R8SH 1ZHBA 4G5ZH 1U91B 4GH7B 4AEIL 4CU8A 4O2EA 3W5NA 4JFDD 3D69A 2J7LA 1U95B 4XPGL 1ZVSB 3IFPA 2Y06L 1LEGB 1NCDH 2NY0D 5FM5M 1DBAH 3U7AA 2EDRA 4AEEA 4KJYB 3QUXD 1D6VH 3BH8B 2DTSA 2B39A 1IJ9A 2V9TA 3S5LB 4X6FA 4U3XA 2IQ9L 5FECB 3QEQD 1GGBH 4L4TE 3FFCB 4BH7B 3LDBC 3CLEL 1KTRL 4X9GA 1N3NB 2AK1H 5BS0E 1LVEA 3U0PB 2FEEL 5TDNA 4HT1L 4OLZL 3CUPA 4JDTH 3ARGB 1ZVYA 5IESH 1G7IA 4OZHA 3PGDB 4RQQB 4HUWA 5CZXC 1OOAA 5A2JH 1XIWC 4R90H 3WIIH 4Y16A 5ITBL 3M07A 1K2DA 4M1DH 3F7YA 2AV1B 2R69H 4Y16C 3PDDA 5EPMB 1Q0YH 1D6EB 4JN2A 4JG1L 5AYQA 2I27N 1FAIL 5T3ZH 4WJ5B 1PG7L 3DIFB 5ISZD 3IDNA 2G5RA 4OCYL 4HIEA 1DFBH 4OZHF 5D7SL 1FH5H 2WBJC 3CSPA 3F7QA 4NQCB 1EPFA 2UZIH 1A3RL 2F58H 4OTXH 5C08B 3MRNB 5HYQB 2AJXH 2VAAB 5B39B 3QNYA 1JNHB 4H8WC 2Y4SA 1I3GL 1LGVA 1Z3GL 5HGAB 5BZDB 2CLVA 1KEML 3MJ7B 1U3YA 2AJVH 5FOJA 3UBXB 3WNNA 1RJYA 2ZKHH 4H8WL 3REVB 3CFKA 2ZOLA 1UKQA 2IH3B 4YHZH 5C0AE 1SY6H 4HFUH 4JRXA 4AM0A 3DX9A 5JXEA 2L0DA 2R0KH 3BO8B 5DEFA 2R15A 4JGUA 5EBWB 3OKLA 5IVOA 3U36A 1MCRA 4PG9B 1UWXH 2A38A 1R24B 2FSEB 3IDIA 4JFFB 4YXHH 5F7FA 3KLSA 1PG7X 4U1JA 3VFMB 5J57B 5JA8B 1TJGL 3ROOB 1A3QA 5DT1L 2O26U 4XCYA 3Q2CA 2OXHA 1BQHA 1KPVB 1RJLA 4HHAA 3TO4B 1LO4H 1MCDA 1MI5B 2F8XC 3SGJA 1ETZB 2K7QA 4NQVB 5SWQA 3ZKSD 3MLUH 3GIVB 2GKIA 3SGJC 2EXWC 4Y4KA 4ZSOE 4YFLI 3MA7A 5FO8A 4D0DA 4Y19E 1N2RA 4RWHA 2BVUA 3RUGE 2WAHA 2O5ZH 3L7EB 1HI6B 4F8QA 5HHOE 3S3SA 2XQYK 3L5XL 3LKPA 5HYJD 1AQDA 2DTMH 3STLA 1EEUA 2Q7YA 4EDWL 5IB3B 1T89A 4OFIA 1OAUL 1MLCB 4TSCH 5EO0B 1ZLSL 1N6VA 5DMGC 1RZFL 5D5MB 3UMTA 1K85A 4MNQE 3LV3A 4YHOL 5I1LA 4OGXL 2A6KB 1J8HB 2V2TB 1FV1B 3QEGH 1RK1A 1CDYA 4PGEB 1JGVL 3W5MA 2CJUH 1Q0XL 5GPRA 4HC1L 2VC2L 3SDAB 3QIWD 4U6HB 3OB8A 2BNRB 5GISH 3AXLA 4JFDE 2G9HB 2C4FT 1IGIH 2DKSA 4F7EA 1KB9K 2APVA 1RZJH 2VDPH 3UPCA 5DQ9A 1ED3A 1D5XA 1RPQA 2XY1A 4OZIE 1AXSA 2FBJL 3MV9A 5TE7H 4NO0A 4F7MA 3LKRA 3VXRB 5J1AA 1S9VB 4XPHH 1MCKA 1LP9E 4PJXE 3VH8B 1V5JA 3LRSA 4WFFD 1UH3A 3KPMB 3FN3A 2VDKL 1HHKA 2VXSH 3MLZL 2GAZB 3ECBA 3T3MF 5A16A 2EXYC 3L5WA 3S36H 5EU3A 2H32H 4XWGL 1WWCA 5F89A 4ZS7H 3FQTB 4MD4A 3QEHB 4LASL 4OFVA 4O9HL 1U36A 5CJQH 4XGZB 2A9MH 3O3UN 2H26B 3BQUA 4YDVB 4OZGB 5ISZE 4H20H 1FFPA 5FYJD 5J11C 4XMKL 3RDTA 1N6QL 1HQRB 3S6CA 2BOCB 1A6ZB 4NZRL 2VTFA 1XGPB 4YPGA 4PRDB 1EHXA 3MLXH 3RDTC 2I5YH 4TTDC 2VDRH 5DI8B 5C2BL 1UVQB 3KPRE 1QRKA 4FP8H 1HYSD 3IB4A 2D7NA 5CGMA 2OZ4A 3QB7C 3D39B 5GJSL 3MR9B 2D0HA 1EMTL 3MUHL 4P99A 1QBBA 3QEUB 1RZIA 5EO1B 1P4IL 5F9WC 2E9BA 1IC5H 4YK4C 4Q9QL 1AP2B 3C8DA 1JNNL 4C54A 3VXSA 3BPLC 1M6OB 2V6HA 3TYGL 5GSVB 1AGBB 3GBNH 3MRGB 4KHXH 3WS3A 3THMH 4H1LB 5I73B 1I1AA 2AEPL 1XF3B 4JLRB 1JPFB 1WBYA 3MQIA 3EFDH 1Q94B 4YHKH 3NFPA 4L3EB 4XPAH 1N0LA 4IRJD 4OF7A 3Q6GH 4UQ3A 1IAOA 3VDBA 4XVJL 3CFCL 3CIQA 1FJ1B 1OWRM 1RK0A 1CD0A 1F6AA 3OAUL 4HWZB 4QRQA 2XWJB 4NN7B 4WHTB 5L9DL 4FABL 4LARH 5IR1B 4L9LA 2BSSB 1N5YL 4ENED 3P11L 4L4VB 4BSWA 3GSOB 5E24E 5KS9F 4S1RH 4L9LC 1CTNA 1MFAL 3DO7A 3HNVH 2CQVA 1Z6JT 4P23A 3SE8H 4HS3A 5BXFA 2DIJA 3HUJE 5SWZA 3WXWL 4KRPC 5KSBA 3TBWB 2Q8BL 2G75B 3HS0A 4XPFH 5TE4L 2X70A 5BJTB 1C08B 1IL1A 5D8JL 1F4AA 1VPOL 3BZFA 4WY7H 4YUEL 5HBBA 4LPUA 2AABH 5MEOA 1JPTL 1G7QB 3T4YA 2M2DA 3MFFB 4LVEA 4CU6A 3PWJB 5EH1A 4P3WA 2C3VA 1JE6A 3NBNA 1W72B 5EUKA 2LE9A 4ETYA 4Y2DA 5HDQH 1MJJB 5KSBF 3BAEH 5F7EL 5E8EA 3KPTA 3PIQB 1EX0A 4XNUH 4Y2DC 3UTTB 2IQAB 4M1GH 1E4WL 4FZEH 4PG2C 4APQA 4PRIA 3FONB 4E41D 3W81A 3PWLA 5FCSH 3WUWG 5AD0B 3NIFE 3H42L 1UADC 3ZSSA 2V5YA 3TCXA 4YDIH 3ZE0E 1EJOL 5D2LA 1DE4A 2KL6A 2B0SL 4Y5XA 1OAZL 1RUAL 4YHMH 3BP6B 2ITCB 4OD3H 4JPWH 3SN6N 4CVUA 1FYTD 2FX8H 3RRQA 4PJ9A 3GSNL 2CKNA 1L6ZA 2DWDA 1KIRA 3OKEB 5F44A 3TJEL 5D7JB 1ZT7A 3N1GC 4G43A 5BRZB 5B38A 3L1OH 4KK9D 2I26N 2I24N 4NQEA 1N7MH 5IB2B 5JDJA 2EKJA 5J3HC 5GS1A 4XPTH 4PJFA 3DYPA 5DRNB 2GFBA 3QDMD 3TCLA 5B4MC 5D2LF 1CXKA 4HS8H 3G6DH 1DDHB 4IM8A 4WFFE 5CP3A 3ZT6A 3RY5A 3M17A 3OL2A 1A6WL 1KLGB 3A6CL 3EHBC 2DYPD 3I85A 4OZFG 4YFDB 4OB5H 4Z76A 2A9NL 5DC4B 2ARWA 4HXAL 5DUMH 2X2YA 4YEEA 2F54B 3QDJD 2SEBB 1N5AB 1HZHH 4QF1B 2IBZY 3PV6A 3W9EB 3X12B 3PWVB 5L8JB 2VXUL 3KHQA 4H0HB 4PJFF 3C6LB 2RR3A 3TJHD 5GHWL 5FYJE 3BPCA 4MJ5B 1P4BL 5EIQA 3HE6B 2NX5A 2W07A 2Z91B 2W9LA 1H8SA 3QZWB 4HUUB 2YXMA 1D5ZB 2FX7H 3WFZA 2XI9A 1I1FB 2BFVH 3R06A 3S34L 2YMXH 4MXVE 1MRCH 2IFFH 1E28B 4M6AA 2EKSB 5CJ8A 4YPJA 2LU4A 4Y7MA 1ZA6B 1U92A 5IJVA 5DK0A 2DD8H 4GO6B 1SEBB 1BP3B 4NZTH 3WSQL 35C8H 5E8OA 3MRCA 5AZ2L 5E8NB 1PJ9A 4DOHE 2OP4L 2R4RL 4ZTPL 4FA8A 1WGOA 4M93C 1MJ8H 5DYOA 3RL1A 6FABH 5L7XL 3P4NB 4OT1L 1MHPH 4U1IA 3I6GA 4Z7WA 3BESR 5JMOC 5CZXD 5EZIL 4JRYA 2X9YA 4R2GC 3CU1A 3V8OA 3KPPB 2D31A 3MYJA 1Q9OB 4Y16D 5J9PB 3B2UC 3ULUC 3GJEA 4XAWL 3U2SA 2H9GA 3MCLL 4D8PA 4KMTL 3MACL 2ATPA