5ISZE

Crystal structure of ls01-tcr/m1-hla-a*02 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
IGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAAGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIFGQREQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8(+) T cell epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszE02
4ODTH 3V5KB 1C16B 1FL3A 5A16A 5C3TA 2NXYD 4H1LA 3DVNA 4Q9RH 4OTXL 5E4IA 2XA8H 3MR9A 2GK0A 2QSCL 3G04B 4X7DC 5JUEL 1FAIH 1OCWH 4JZJB 1JYXA 4C57C 3ARRA 3TPUB 1KEML 2IH3A 2EDJA 1S5IH 5TFSH 4EBQL 4HGWB 4JKLA 4HHAB 5KSVA 3J8F7 1NCCL 1PKQB 4CNIB 5HYSA 2NY4D 5EOTB 4K7FA 3G9AB 3QIWD 4R4FL 5JORB 3S35L 2ADIB 4JKKA 4MDJB 3MACH 3PL6A 4F7CA 3OJ2C 4IRSD 4NYLA 4RGND 5H35A 1MFDL 3FO2A 1FPTH 1I3VA 4UNUA 3BXNB 3VFGL 4MDIA 4UINL 1R3IL 1XIWD 1D6EA 4I8DA 1D9KC 3BZ4B 2HT3C 4PJXB 5T5FL 4U1NB 5CSZA 1BGXH 3C6LB 5CHNB 3RTQD 1PGRB 4JO4L 3QQ3A 4ZFGL 1BLNB 1S7UA 5EORH 3GIVB 3LKSA 3VFTB 3SE9H 1RK1A 2BVQA 1JPTH 1PAMA 2YKLH 3TA3C 5HVGB 5CJQH 3UTQB 1CFNB 3JWOL 4YDIH 2P24B 4J23A 1PSKL 1YNTA 1H0DA 4RWYL 1A5FH 4X5WA 2D7NA 3OJMB 5TDOA 3F7VA 2Z35A 1ZLSH 5EU5B 5IBUB 5BS0E 3L7FB 2QHRH 3KPMA 4F58L 4MGXA 5E5MB 3T0EC 4XPAL 1KJ2B 3CSYA 3I9GL 4S0TD 1JRHI 1OD9A 4Q74A 4NQDD 4MWFA 1HXMA 3RA7L 4WHDA 3G5XA 5CKGA 4L3EE 1K3IA 2Y07H 1S7RB 3O9WC 3FOMA 4ZUTA 3D39E 3Q6GL 3GMRB 5DA4A 4AIZB 3STLA 2GT9B 3TA3B 3TBVA 3KPRA 2X4OA 4AIOA 3MJ7B 1MCQA 2I5YL 5JXEA 3QUZA 5TDPB 4QHUB 5ESVA 1QNZH 1RUML 4M7LH 3MUY1 4OZHB 1IT9H 3QNZA 4PR5B 1Q9KA 2X1OA 3MA9H 1BEYL 1SEQH 3V0VA 2EEDA 2GQHA 4MA8L 5FYJE 5DA0B 5I15H 2I9TA 1A7PH 3MRDB 3WJLA 4IHOA 4X4YA 3V5DB 1YA5A 2J12B 3TH3T 1XGRB 1LEIA 1JP5A 3QEGL 2PUQT 3PQYB 5E9DB 4O4YL 4Y19A 3FQRB 3TVMD 3VDBA 1S9VA 4R4ND 3VGDA 2XZZA 4XCEB 3V2AR 1AY1H 1Z6JT 3OJDB 3FB5B 4RSVA 4Y88A 3LRSB 4PGEA 1P4BL 4LLAA 1B6UA 1SYSA 1JGVL 2P5EB 1YN7A 5JOFB 3M17B 1QVOA 1TTFA 4OV5B 4IDJH 3L9RB 4WI4A 3BWAB 1ZXQA 4K94H 2R4RL 2CDFB 4TVPH 1Z3GH 2JELL 4RZCA 1KCUL 2P8MA 4H1LH 5DC0A 3C2SA 3MXVH 5IVXE 4JN2A 4JZOB 5F9OL 5KJRL 5MENA 4XBGA 1QBLH 2PYEA 1KTLA 4QYOA 1CG9B 3GM8A 4PRIA 2EC8A 3IJYA 4KK5C 1LDPL 5HSFA 4D9RE 4IMKC 3LEYL 3KPLB 1ZT1B 2DL9A 3HPJA 4X6DB 1KB5B 1SM3L 1KLGB 4QWWD 1G9MC 5D4QA 1F00I 4JRYE 4DQOH 2VDLL 4LVNC 5I76B 5IT2L 1A7OL 1G84A 2BERA 3FFDA 2DQCL 3EOTH 3T8XB 5TE7H 4HEPG 1EAPB 3IDXL 3G6DH 2EDYA 3MLYL 5HGBA 1Q1JL 3U48A 3QDHA 4M1GL 1QSEE 2A73A 4LRIC 2BSTA 5D2LA 5IVXF 4PTTB 2H2SD 2FD6L 3DUSA 1G0DA 5C0JB 4WV1A 4YPGA 5LCVH 2P8LB 4FQHA 3U0PB 4M6NH 1IZKA 1FO0B 1J1PL 1G7QA 5E24E 1F4HA 4QGTA 3JV6A 1FBIL 5CSBA 5IBUG 1IM9A 2IGFL 5F1OB 1DQTA 5DYOB 2J8HA 2PO6A 1X4XA 3B3IB 3GMNA 3FO9A 2D4FA 3GIZH 5CD3B 4TSAH 5BRZA 1EK3A 3BKCL 4WEBL 4HJ0D 3UJTL 3MRBA 4ZO8A 4XVJL 4XAWH 1I7UA 2VO5A 4H20H 1KIRB 5EU6A 3MRFA 3LIZH 3QR2A 3SE4A 3P40A 1FCGA 4MAYB 4O9HL 4ODXB 1QD0A 3V4VH 1INQB 5DMGC 2QQLL 5CEXB 4NKDB 3QXTA 2AK4E 4NO2A 1VACA 2AEPL 4GQ9L 2HVJA 1EEYA 5FA3A 4ZUWA 3L6FB 5BS0D 1M4KA 3SDXE 5AZEL 3HRPA 2D0FA 2EDQA 1BIIB 3DURA 3OXSA 4KU1A 1JHTA 3C2AH 3GSOB 3RNKA 2VR4A 2OTWA 3DMMD 3QFJE 2VXSH 3AM8C 3OQ3B 4DGVL 5KVMC 2DBJA 4LEXH 1UJ3A 4NKMA 4GAJL 4L3ED 5IG7B 4OCXL 3NIDE 4Q0XH 1J0KA 3OF6D 1S8DA 5E00A 5GISL 4HUVB 4I0PD 3D39D 5FECB 4WTWA 3U79A 3RX7A 4IRSA 1U8JA 2H41A 2CGRH 3O11A 3U9PH 4LLWB 2AJUH 5HYQA 4LSTL 4E0RA 4O2CB 3SDXF 3MLRH 2V2WA 1XIWA 4JGJA 4Q2ZB 1OQOA 5DJYA 3RIAK 1DUZB 5FYJD 3IXTA 5J57B 3CFCH 3TV3L 4G9DA 3ROOA 3RTQA 3NIDF 4KKBC 3AU1B 2Z8WC 3X14A 2HMIC 3QCUL 1VADA 3UTTB 1KT2A 3BN3B 5FGBA 3FQUA 5BO1H 5C2UB 4G8EB 4JPVL 3STZB 1CD1B 2H8PB 2MWCA 5HBBA 4XVSL 5I16A 2F54B 3VFMB 3OX8A 2J4WL 2V6HA 3JBG7 3WXVH 3CVHA 4OIBA 3RY5A 4RAVB 2H1PH 3TT3L 4Z7VB 4JREB 4K3EL 3TBWA 2VC2H 4LU5L 4NQDA 1ZGLP 2OR9L 4P57B 1KPRB 2X7LB 1JPST 3QPQD 3KJ4C 4GAGL 4YO0A 5K33A 1GCFA 5T3XL 1TLKA 3QH3B 1VENA 3NZ8B 4YEFA 2P5WE 3Q3GB 1FNFA 4JY4B 4Z7UB 4HIHB 4OLYL 1U8PB 3BDBA 4NRYA 3TYGH 4PBXA 3VXSE 4N0UE 2VXVL 3TJEL 2VWEC 4PP2A 4X6EA 1EXUB 5LGJB 4D9RD 5FK9B 4IOIA 5KOMC 3QNXA 1Q0YL 3UROR 4PRBB 3U82B 4LLUB 2C4FT 3KPOA 1TCRB 2Q86A 4JRYD 1I3GH 3FT2B 4O02L 3BRFA 1FG9C 4CADA 2EZ0D 3AXLB 1U8LA 3BMVA 4XP6L 1U0QA 4YQXH 1HIMH 5H94A 3L3GA 4PJFE 5JXAL 1QSED 4FXKA 3KJ4B 3L3OA 4JCMA 2EDBA 3TVMA 5F44A 4XGZB 2XY1A 5CIPB 4LCWD 1V3KA 1MEXL 4XP9L 5BZDA 2WWMC 1B2WL 1RMFL 4PLJC 1ZE3C 5GJTH 3V6OE 3DBXB 1XCQB 2GCYB 4WU7B 1RZKC 5CWSA 3BPCB 3VXRE 4H88H 1HHKB 3EYQC 4FQLL 4JFYA 1UFUA 5GGSB 5D6DC 3JZ7A 2XWBB 1U2CA 4N0CD 4QRRE 1JPSL 5FDWA 4RGOH 2VDMH 3DYPA 1BAFH 3WHE0 3WFDH 2NW3B 1HI6B 3HC4L 1N8ZB 4YXHL 4J4PD 1TVBB 1GOGA 1ZA3B 4ZUSB 4XVTH 4IMLA 4GBXC 1AGBB 5T1MA 1AE6L 5HD8C 4L8CB 4DUXA 3T77A 5F9AC 1Q72H 2AK4D 1QQDA 1J0ZA 2Y72A 3BP5A 5HYEA 3VW3L 4X9IA 2AQ1A 4S0SD 3GMLB 4PGZA 2CRIA 4LQFH 1G7LA 4OIIL 4F8TA 4Y1AE 5I1DA 1ONQB 3KXFE 3WSQL 5EC1B 3B9KB 1C08A 4MXQC 3QFJD 2R56H 4OAWB 4X6FB 1SY6L 5GGQH 4RQQB 4U7SA 1DL7H 5E4EC 5ITBL 2OJZH 4GXVL 2EE6A 1LDSA 1I3RA 2Q76A 5IGXL 4ZFOB 2WBJD 4PJ5E 5DJ8B 1P1ZA 4YBQD 3RQ3A 1DVFB 3TJHD 4GBXB 3WFEH 1S7SB 2DJSA 4PUBL 4JFQA 3RPKA 1A9EA 5AD0A 5IKCA 3R06B 3KLDA 1GOFA 2CIIA 4MS8D 4UV4H 5I1EH 5GHWH 1EO7A 4Y0GA 3QPXH 1GZQB 1Q9WA 5ALCL 1Y6MR 3FQWB 1VKXA 4I3RH 2O93L 5E4EB 4P2OB 2GY5A 4OD1L 5GRWA 2YPVL 3SY0A 2ZPKH 3U7AA 4KTYA 3LMJH 5F8RC 4JFDB 3CVHH 2CXGA 3IDIB 3A6BL 3BAEH 4I13B 5EA0L 1FJ1A 4OGXH 4JY6B 5BS0A 1E4XL 4OZGB 3VXME 2OR8A 3MRPA 3K8KA 3S96A 5CSGA 2OQJB 3GSRB 3DMMA 1T1YA 1PJ9A 3JWOC 4U2YA 3HI1B 3DX8B 3K4AA 3LV3B 2ID5A 2VQTA 3LB6C 4L3EA 4J3XA 3OF6A 5CEZE 4ZODA 2P5WD 4I0PA 4WU5A 4JO2H 5E8EA 2FYYB 1G6RA 3SKOA 3VXSD 4TYUA 2OMNA 2W9EL 3W0WE 2V5RA 2YZ8A 2X4RB 3KR3L 3QG7H 3QJFA 1ZEAL 1UCTA 5I1LA 5A1AA 1WLHA 1J18A 3LDBC 1SBSL 3PABB 4AEIH 1F4XL 2AKRA 3V95A 3B5GA 4PIRF 3GI9L 4XXCA 1QSFB 4QXUH 5DMKB 5ESQB 3NPSC 5TQ0L 1GRWA 1HNGA 5DS8A 3IKKA 4ONOA 3WNNA 1RVFL 3TFKC 2LQRA 3S35X 3NFSH 4GKNB 4ODVH 3S4SB 1O0VA 5E8PB 1V3JA 5EU7E 4KDTC 1TTGA 2H3NB 3S3JA 4ACPA 5J56B 2H26A 1F3DJ 4NN5C 1PKQE 3BPLC 4F7PB 4NQEB 2K1MA 3OAUL 1DBBH 1OTSD 3QXDA 3VXRD 1S9WA 5FM8A 1HOCA 4R26H 3PDOA 3GMPA 1AXSA 2E7HA 4QRRD 3VMPA 3WDHA 4JFFB 3MC0A 5FUOL 2AJSL 4FQJL 3TIDA 1NCWL 2EICA 3V6ZB 3MRGB 2M2DA 5KN5B 2BSSB 3CFKB 3NPSB 3L5JA 1KN4L 1XH3A 2ZKHH 4FP8H 3BKYH 5I18L 2VXUL 1FYHB 3GK8H 3CDGA 4JFPB 3RGVD 5IVXA 1A7NH 4J12A 2PXYC 1B4JH 4S1RL 4GW1A 5GGUA 4NN5B 3D18B 3WS6A 1NGZA 4Y1AD 4RMRA 3DJ9A 3KXFD 4JRYA 5DO2D 3ZKMC 1OTUD 4YGVA 3CK0H 3UCRA 4MLIA 1QRKA 4YXKL 5BW7C 2P4AB 3P77A 4O00A 1QSEA 1RJCA 2D0GA 2CSPA 1HKLL 3CVIH 4LCWA 5BXFA 1WF5A 3W11C 5GXBB 4PJ5D 1IGIH 2BK8A 1GGCH 2Q3ZA 5IB4A 2VAAB 4FXGA 1M7IA 4PGCB 4JFEB 1FV1B 1F58L 1CGXA 2PXYB 2NZ9C 3MBXH 1JF6A 4BFIB 3L3JA 1WEJH 2EXYD 1MH5A 1EO5A 4BSWA 1YEIL 4R4BB 1MHPH 4TNWF 3RVUC 5IVZB 4HV8A 3BIAX 4HX1B 2GUOA 3OKNB 8CGTA 3M07A 1C5CL 4OF8A 2HLFD 4Y4KB 1U3HD 2CLVB 4J4PA 1KIPB 3MLTB 4MD5A 3IFPB 3JVGA 3HNSH 4L29A 3VFRB 2CQVA 3OR7B 3QEQA 4OI9A 4MD4B 3RZCA 1MIEH 5CAYB 3QO1A 3T0EE 4UU9B 2AK4A 4XT1C 4U6HA 5D9SB 2GW5A 3PQYE 5JPMA 5E9DE 1B0WA 8FABA 5TE4L 4HUXA 1CGSL 5I8CA 3SDXA 4G8GB 2R69L 3VXMD 3MV7B 4ZOEA 5TH2A 3L5IA 4AENA 1U95B 3QFJA 2OR7A 3MRHB 4MA7L 3QUML 3S4SG 3SPVB 1LVEA 2R0LH 4GXUN 5CEZD 1WZ1L 2VZOA 1F3RB 4FZEH 1G6RH 1AP2B 1P69B 1SMOA 2ADJB 3AREC 4APQA 5EBWB 1EFXD 5FFLA 4P3DB 2BVPA 5CBAB 4E42A 3W0WD 2A9ML 3T4AA 1RZ7L 5FYJH 2VXTL 3QFDB 4LHQB 4F8QA 1G1CA 1ZVSA 3P9WB 1CXFA 1UACL 5KVEL 2H2PC 3U9UA 2WWKO 3GHEL 4WDIA 4O2FA 1OT1A 3O4LB 1UYWL 3PV7A 1DQQA 1M7XA 4X6DE 4XAKE 1L7IH 2B7DT 1FC1A 3OKKB 5DRXB 4HWBL 1KN2L 4I4WA 3H0TA 2OK0L 1CQKA 3F5WB 5IJVB 5J9PA 4OSUH 2D7TL 4HJGA 5C07B 4JHAH 1ED3A 2CH8A 2X70A 3BD3A 5GQBA 3ARGC 4I48B 5DJDB 5JLZB 5CZKA 1QLFB 4XI5C 4P5KB 2NZIA 5F9JB 4X6DF 3O3AA 2ZSWB 5C0BB 4K3JH 3VFVB 3JTTA 1F4WL 5EN2A 1RJZA 3QDJB 4QRUA 5FOBA 2X40A 4ONHA 4YHNA 3P11H 4QY8B 2P5WA 4NNPL 4NHUA 5DMYA 1DBKL 1RZFH 3QA3B 2EXWC 3G08B 5CMAB 3AMLA 1ITBB 5FO8B 1ZHBA 5JPNB 2YSSB 2QLVB 4ZDHB 3LN5A 5E2WL 1XT5A 3EYUL 3SN6N 2R15A 1D3CA 3V0WH 4MA1C 5J8OA 2Y5EA 3CU1A 5CLTA 2F8OA 3BZFB 1Q8MA 3HLAB 1R3JA 2NNAB 5EDXA 3GKWL 4QOKB 3ARGB 1S7TA 1CD0A 2AXFB 1H3PH 1YMMB 4K8RC 4MB5A 1V3LA 5D7SL 4DAGL 4TUKH 3BGMB 4GMSH 4MZ3A 1A7BA 4QF1A 4XCCL 4BH8B 2FZ3A 1S78C 1MVUA 1QO3A 4MA3A 1RHHA 1AQDB 3CH8A 3DARA 1D9KD 2MTPA 3DO7B 2PNDA 1IEBB 3EDEA 3C9NA 1YDPA 3V6OA 1AJ7L 3PJSA 1RHFA 3VXRA 4BQ6A 5CCKL 2NW2B 4NQSA 3IDYB 1S7XA 2WBKA 1RIHL 2CLRA 4M7JH 1J05B 3AY4C 4GMTH 1SJVA 4QRRA 5E6YA 2ZOKA 1Y6NR 4YWGL 2HWZH 5IMOB 3BH9B 3P0YL 2JJUA 4YUEL 1AGEB 4OZFB 4OF3A 4NT6B 3RGVA 1OM3L 3RNQB 1JV5A 4KKCD 1UB6B 3BKJL 3DETC 3T0ED 1IQWH 3V4PL 4M93C 1S7VA 3DGGA 4FMFA 5DC4B 4KK6D 2X05A 3N1GC 3U46A 4LLVB 2GJZA 3HMWH 3I6LE 15C8H 3ZDXE 2E9JA 4Y1AA 3O9WD 4Q6IC 5DD1L 5F3BB 4PJGE 1IFHL 3KXFA 4C4KO 3VMNA 1RZIA 3U7WL 2HN7B 1YQVH 3QRGH 5T3ZE 5IW1B 1ZMYA 1VFOA 4XNZC 3NN8B 4LLQB 4WFGE 3SGEI 3V4UH 4JRXB 5FHAL 1XGQA 4X9GA 4Z7VE 2ZUSA 4OJFH 1DBML 1GC1L 3VFWB 4U6YA 4N8VA 4J3WA 3ZZ1A 1XGYH 3ZDXF 1FYTD 4M93B 5DMIH 3IFNH 3CFDB 4PJGF 1ZTXL 5DD6B 5IBTH 3ZKND 1JGUH 3VCLB 2XKUA 1PZ5B 3SGJC 3UO1L 1W0WB 1I9JL 4PLNC 4KJQC 2R1WA 2BMKA 1DLHA 3MMEA 3I50L 4XNZB 4XAKD 2O26U 1Z2KA 1DQLH 2DLFL 2NY1C 3CSGA 4GG6B 4BQCA 1BWWA 3LH2H 1MPAL 1N5YH 1U36A 3NIFF 4HFUH 5BMFH 5DEZA 1CFSA 1EO8L 1P84J 4BSVB 3S88L 1A6UH 5C9JB 4S1QH 4U6XB 3KS0J 3VXMA 1XGPA 1UQSA 3RY4A 5HHOB 4W6YB 1HZHL 4TSCL 2VWEE 2ENSA 4KK5D 2CRMA 5GGVH 5HHME 4WI8A 2VUYA 3IDUA 1AKJB 3VA2C 2R0ZL 2Q8AH 3L1OH 1EFXA 2BVOB 3FAXA 2NY1B 4DCQB 3VDCA 1GIGH 5JW3L 2K9UA 5F88B 4HG4J 2BVEA 3RWIB 2GFBB 2EH7L 1WV7T 4C83A 3O0RL 2D03H 2WINA 3RX5A 4Y5VC 1CXEA 4MAUL 4PD4J 1OPGH 3NH7L 1HYRC 1JTPA 4JM4H 2DS4A 5D5MB 3ZT7A 4WCYL 1CD8A 1NLBL 2NY7L 3FFCE 3REWB 1FNGB 2Z4QB 4NHCH 5DD3L 2IBZX 4Y4HD 3TC9A 4OZFG 1N59B 3KGRA 3GBNL 1OAYL 1U8NB 1CE1L 5FYKL 1DR9A 3TPUA 3LKRA 4OFDA 5EIIB 1YNLH 2WM0A 3MFGB 3ESVF 1VCAA 3VXQB 4HGWA 4HHAA 5JTWA 2YMXL 3FCTB 1PKQA 3QP3A 4OGZA 1NUGA 2YK1L 1A3LL 5B8CC 2CK0L 1A6WL 1CXKA 1IQDB 1EMTL 5HVWA 5KTEL 1MFAH 1Q38A 5GS1A 4Y5VB 1XGUA 4MDJA 5DQJA 3TYFB 2G60H 5T33L 5F6IC 1DQDH 4NKOB 4TQEL 4RWHA 2IMMA 5DHXB 1KLUA 5E8OB 3OJVC 4CMHC 4ZXBA 2BJML 2R2BB 4LASL 4RAUA 3E6HA 4P2QE 3X17A 1T2QL 2XZAH 1WGOA 4X4ME 5C1MB 1MFNA 3KHQA 1NGXA 4K9EL 4P3CL 5EBLB 4MJ4A 4Y2DC 4YDLC 3I6LD 5FUCC 4HWEL 5KW9L 4JFDE 3WO3B 3L5XL 4B7IA 5T3ZD 3HZVA 4NQCA 1CFVL 4HMCA 1CQYA 4NNYA 4TPRL 4WFGD 4TNWK 2NY2C 5INCB 4EI6B 4JFXB 3S97C 4WNQA 3TNNB 3P0VH 2NY0C 2VOTA 3OXRB 4BA8A 5F96L 4QXTA 3G5ZB 1D9KA 4R9HA 1NC2B 4P9HH 3VXOB 3FQNA 4PRDA 1B0GB 1KC5L 4P9MH 1VHPA 3O2WH 3NCYP 4JHWH 2AEWA 1A1MA 1G7PA 3G6AB 4YR6A 4KKBD 3QIBB 4WI5A 2ESVB 4D2NA 4WFEE 3U2SB 3KLAA 3GMRA 4N9GB 4YDLB 4HC1A 1EEUA 4Y2DB 3CLEH 4KMTL 1MJUH 1PW3A 32C2A 4NUJB 5C09E 4UV7H 3LKNB 1WFOA 5KVDL 4QHUA 2YA0A 1N0XL 1TZIA 1KTRL 3GSUA 1CFBA 3FOLB 5GRVL 3L5WB 5F89B 1GJIA 4BYHA 3EO0B 3MRDA 3QCTH 2NY0B 3V5DA 4C58B 3T0EA 5EC2B 3VG0H 2NQCA 2NPLX 3BX7C 2AJXL 5L0QB 1DN2A 2WANA 4JQIL 1DLFH 5DUBB 5GS0L 3O9WA 4RRPG 1CVSC 1CGVA 2DQHH 3OHXA 2E5EA 3SDCC 1JF1A 5CEZH 4M61A 4NQEE 3HCVA 4KUZH 3VWKD 4UDTB 1SYVB 1RIUL 5F7NC 1MRDL 3DX6B 5HHMD 1PD6A 5ADOH 4NO5A 3HRZA 5AYUH 5JOFA 1JPGB 3I3DA 4DTGL 4M43H 2DDQH 4JFFE 5C9KA 1IAOA 1LE5A 1TMCB 4U1MB 1X7QA 3F12B 3T65A 1IAKB 3PGCA 1FYTA 2V5TA 4WI2A 1SVZA 3O6LH 2AV1B 5D1XC 3V0AC 3BH8A 4QRPB 2OSLA 2I60H 4CVZB 4FQQB 1XGTB 1YUHA 1Z0MA 5I73C 4MQXC 3AS3A 3RDTD 2WWMD 3SOBL 3MCG1 3FFCD 4L8BB 3QEUB 4WI7A 4L4TB 3SDCB 1ZT1A 3ZTNH 3BUYB 4X6DA 3P0GB 3RJQB 3MLSL 1KLGA 4NBZB 3WHE1 4PJ7E 4PJ8D 3DUUB 3EYQD 3VGFA 4Z77A 1WBYB 2ATPA 2F53B 3F7RA 1B88A 5I76A 3T8XA 5CD5D 2JK5A 1PEZA 2EDEA 4MX7A 5E1HB 1DTUA 1KCSL 4TSBH 1K4CA 5E7FA 2X4TB 3EO9L 3MRLA 5DHVB 5GGVY 4R0LC 3NVQA 2XQBH 3TPKA 2OBGA 3DSNA 4U2ZA 2W0KA 2F58L 2XXMB 5GIRA 4K7PL 4X8JB 4XPBH 5HD8D 5DZLA 3BIKB 3MXWL 4XCYB 4PJ7F 5I73B 4XHJC 3S37L 1QRNE 2MMXA 3LKQB 3LKPA 4IMKA 4EJ1C 4HKBA 3HC3L 4K3DL 5EUKA 2PW1A 3B3IA 3FONB 3U0TB 4LSDA 4P2QD 1IEHA 5D7KE 4LHUD 3GMQB 1U93B 1T7ZA 4JAMB 4S10A 4HIEA 1PG7L 2GY7B 2ZUWA 1FZKB 3BI9X 1VEOA 2NX5B 3PGFH 4JRWA 4NZRH 2SEBB 3RZWA 4MQ7B 3VA6A 2AS5M 4LRIA 3PWJA 3GSNA 1U3JA 4UDUA 5SV3A 4R0LB 1WISA 4JFDD 3CFJB 4O51A 4NKDA 1MNUL 4ODHL 3VH8B 1CL7H 3ME0A 2A1WH 4Y4HA 1QOKA 5FO7A 3U30C 3DRQB 5JHDB 2EDFA 1NFDB 4NZTL 3KJ6L 1DN0B 3NCEB 5LBSL 2OXGA 4RIRA 1MFCL 4U1SB 5TE6H 5LQBL 1G7JA 2VKWA 1JK8B 1KJMA 1QUNA 3FO0L 4N1EA 4JFZL 5FA4B 4HC1H 5K9JL 4E41B 4HUVA 4WFED 4FFZH 4ZO9A 1QLRA 2GTWA 1NQBA 4LBEB 5HHVL 2ICWB 1MLBA 4NFBA 4DFIA 5C09D 1RD6A 4LLWA 1X5XA 1CF8H 1J1XH 1KEGL 2ITCA 2VQ1B 3O6ML 3U30B 3UTZB 1DSFH 4GFTB 1AHWC 1T1ZA 5I1KL 1S9YB 3W2DL 2VITA 3AM8A 35C8L 1C12B 1MRFL 2FX9H 3BVNA 4K23L 4V1DB 4Z95L 4JJ5A 3LB6D 1K5NA 4KZDH 4I3SL 4MZ2A 4PJGA 4LSSH 4JPIA 5C0FB 3ZE2E 2EIDA 5C07E 1ND0B 2CDGB 2HH0L 3RL2B 4Z6AT 1LWRA 2MCPL 1JNHB 2UZYB 4NQED 4F7EB 1BFOB 1JRHL 5FCUL 1GZPB 3T2OA 3EFFA 3W39B 1I4FA 4JFFD 3SE3C 5IMLA 4LSRH 5C0BE 3FO1B 3OKOA 3TLRA 3TESA 3FN9A 2FJGB 3QDJE 4PP1C 1MCWW 2HRPH 2IQ9H 5EO1B 3TFKD 1I1AD 3ZE2F 4X99A 4YDVA 2BY1A 5C08E 1K3ZA 3VXPB 5HI4C 1GC1C 2P45B 3QDMD 2CR6A 2VKXA 4WI3A 1KG0A 4PJ9C 1KJ3H 1W72A 4R8WL 2VDRL 1XF2B 1LO4H 2QQKH 4PRBA 5J7CC 3BP7B 3ZL4H 1BOYA 1YMME 3LPWA 3FT2A 3BD5A 3UTPE 2R9HC 5C0RL 3H7BA 4YDKH 1MRCH 2OXHA 5D1QC 3HFML 5EWIH 4KGLA 2OX5A 4ZO7A 1KLFA 2QQNH 1T6VN 4PS4L 1TJIL 3WFBL 5A2LH 1A7QH 5I8EB 3VH8G 1AGCA 4Z0BH 3NTCL 4X4XB 3PDDA 3GMMB 1JWMA 1WWBX 3VWKA 3NAAL 1QRND 3LKOB 1PX3A 2WK2A 3A67H 4HZLB 1G9MH 4GAYB 5GS3A 1DEDA 1QLEH 3ARFD 5T3XE 1JBJA 4NDMB 5ICYA 2IAMB 3CX2A 2ZUTA 4R7DB 2XWBA 2X4PA 3DECA 4JKPH 3K8LA 4NZDA 4OI8A 2DM4A 2C3WA 3ZKMD 2KUTA 2NW3A 3BHBA 1AC0A 4TTDC 1EDQA 3GSNH 4LMQI 5D1QB 3HKFA 4ZUSA 2WSKA 3MV8B 2ARWA 1G7IB 4U1KB 1YEHL 3VGAC 1C7SA 3RDTA 2LFGA 3MV11 1T80A 2MPAL 3FFCA 3MFFA 4L8DA 4LDLB 5D7LB 3OKDB 3WNMA 3NOIA 1X5LA 4XBEH 3RWGB 4PJ8A 2A6KB 2NZ9D 2P8PB 1LO0H 5FUZL 1DBAL 3QO0B 1CIDA 3D85D 2DM2A 5D6DA 4D3CH 4X6FA 3RVUD 1E0OB 3PNWB 4H0IA 3E2HB 3MRMB 4V2CB 4JRXE 1FSKB 3CPLA 1VGKB 2BDNH 1ZANH 1FFPA 4F33A 1D5BA 1A6AB 3ZTJG 1MY5A 2ICEB 2J8UB 2ORBH 4M1DL 5JIPA 5DJ8A 3KWWB 4J8RA 1RJLB 5CZXC 1UVQB 3VGAB 3CXDH 4P23C 2ZWLT 5DSCB 1EBPA 1CI5A 4B53A 3DV4A 3TH4T 4YX2H 3P9MA 4OCSL 2B4CL 3NCJH 3P9LB 4P2QA 1EVUA 4NZJA 5IB3B 4IOFD 2VZUA 4LHUA 5DJXA 5K9OB 2VISB 3DIFA 3SO3B 5GSRA 3L5HA 3EYSL 1QR1A 4WTXA 2VDPL 1J1OL 2FLRT 1KENH 4W4OC 5T3ZH 3RVVC 4H25A 5DRZB 4GG6E 4YDJB 1NUNB 1L9MA 2KZWA 4JFDA 3ARED 4XMLH 1KF9B 1PEWA 2F5BH 3C09C 5C07D 1JNNH 1PYWB 4K9EC 4XC3H 2P47B 4GUPA 4ISVB 4NWUL 4P23B 4JY6A 3ZYOA 5DJ6A 1UM4L 4U6VH 4U0RC 4L8SB 5EO9B 3BISA 3IFOA 4X6CB 3GSRA 1MCHA 1OVZA 1MHHA 4PRPE 4DKAA 1SJHB 4G6MH 1MCOH 2FDBP 1BHGA 2D7MA 3QDJD 5FXCH 5C6TL 1A6ZB 3S3SA 3EW3B 5C08D 5MEOA 3GJEA 5GRZA 3IT8D 4CDHA 4P5MB 4F80A 7FABL 5BJTA 5C09A 5IV2A 4EVNB 1UZ8B 1W72H 2Y5TB 5JA9A 5DJ2B 3L95B 3C09B 4ZUUA 3VXUE 2B1AL 2X1XR 4I0KA 4HUKB 3LD8C 1FNEB 1H5BC 5KSBA 5FHBH 3PABA 1NANH 1YMMD 4UUJA 4XI5D 5LWYL 4PV8B 1CBVL 4LF3B 5JIHA 1EJOH 1N0LA 4OLVH 4GKSB 4ALAL 5ESQA 4AQ1B 4PJIB 3HZYB 5HDBE 2FBJL 1H3WM 4Z5RB 1IGCL 5CJXC 2AGJH 5KG9B 1HWGB 5ECJE 3C8KB 1D6VL 4JY5H 2EXWD 3K1DA 1VFBB 4WW1B 5A2JH 4F7PA 4HF5L 4NQEA 3BQUC 2XN9E 4QRQB 1IC7H 3GHBL 1SHMA 1F4AA 1RZJH 1F6AB 5T3XD 3KYNB 5GS0C 4PJEB 3LD8B 1H5BB 1YEDA 3BJLA 1YEGH 4JFFA 5HDBF 1FNSH 4K8RD 4DGYH 3N85L 1EHLL 3P30L 4M6ML 4DVBA 4Y5XC 3TIEB 1CE6B 4JO1L 4UT6L 4G42A 2PYFA 3CC5B 2V17H 4LGPB 4G6KL 1I1AA 3NFPA 3MRKB 5KS9A 4RA3A 5T1KB 4AL8L 1E6JH 4DKFH 1R24B 1DUYA 3C60B 3HR6A 3QQNA 2Z93B 4EOWH 3QDMA 4U1LA 4MSWA 5ERWB 1D5ZA 1YEEL 3WD5L 5J13C 1RZKH 4HKJB 1YYLH 2WLZA 5I8KL 5AZ2L 3BDYH 4JQVC 1UENA 1LO3L 3WL9B 3MNWB 5HY9A 1P9MA 4AYFA 5DI8B 3BQUB 1L6ZA 1WT5C 4PJ7A 2W60B 3P4LA 1A6PA 1ZWIA 5D72L 2BOCA 3SKNB 3FB7B 2D4DA 3UZQA 2CUIA 5GGRB 5IOPB 1R5IB 2XOTA 3O41B 1ZHLA 3DVGA 5HI5C 2VH5H 5JQ6H 4Y5XB 1C7TA 2B2XL 1HINH 3NFNA 2B0SH 3BN9C 3CIQA 4ZFZB 43CAB 3BWUC 3GSXA 1VPOH 5IWLC 1LILA 1OQXA 1JNJA 1GPOH 2YD5A 3DETD 3MNVB 3BZDA 1QRNA 4ODWB 1TJGL 4ZTPH 3U0WL 3ARFA 3VRIB 1AD9B 4IM8A 1BVLB 4JG1L 2KDGA 5FUCE 5BCAA 2P43B 5F7UA 2H6PB 4M48L 5L2KB 4KRLB 4GRLD 4WI6A 3TT1H 5K59E 3L7EB 1ZT7A 5JUEH 2QQQA 5BW7A 3MLTA 1F3JB 4WWKC 3EYOB 3H3KA 4ELMF 1FFRA 2PTTB 1CLZL 2ZCLL 3JWDL 3VFRA 1T7WA 3Q48A 4PGJA 5HGDA 4Y16B 2AJVL 3PGDA 3I6GA 3WN5A 1NCBL 1TPXC 1QSVA 3KPQB 2BXZA 5BVJA 2Z9TA 3P2TA 4WW2C 1A6TB 3BSZL 3KPTA 4BQ9A 3T0AA 5HJ3B 4R4FH 3O8XB 2IPTL 5K59F 3QT2A 3B83A 1ORSB 3D85A 1U95A 5DRNB 4PRPD 2G2RA 4KJQD 1TETL 4KI5C 4JR9L 4UINH 4O58L 4TRPL 1K2DB 1S5HB 2FATL 4ZOCA 2FO4B 3N0PB 2OTUA 4WWKB 1DE4B 5T5FH 3RWDB 2NY1D 4LFHG 4NFCA 4UBDC 1BQHA 1JGLL 5E6IC 3UPRB 3TBTB 5CZVL 4ZFGH 3VXUD 1U8QA 1TPXB 3LZFL 3QFDA 4ORGA 4QRPE 1KTKE 4WW2B 3UTSD 2A6DB 4NCC1 1KXTB 1LO5A 4FZ8L 1PSKH 3MUHL 4YJZL 5E8NA 4RWYH 2AAVA 2NXZC 4BZ2L 3OZ9L 4X5XB 4MB3A 4LAQH 3G5VA 4NSKB 1T5XB 2Z31C 3OKKA 4Y5YC 4F58H 2UUDK 2F53E 5DJAA 5B38A 4X80L 3S37X 3AREA 1BPVA 5E08H 5C07A 3WKMH 4HFWB 3RA7H 4XBPA 5E2TH 4XMKL 2NY6D 4WJ5B 4HKZB 3CZFA 5HGAB 4MNGE 1OGTB 2XN9D 5E6IB 5C0AB 3QUKA 5JLZA 3Q6GH 3BIBX 4I18C 3KYMB 4Q97A 1PG7X 1NBZA 1U58B 4HW6A 2NTFA 5EPMB 3NIGE 5A3IC 3VFVA 1F8TL 2OM5A 4N0YL 1BJ1H 3SKJL 5CGMA 3BRDA 2NXZB 4DZ8A 5IEHB 5ISZB 4XC1H 4JVPA 4W4NA 1FVCB 3MRJA 5TGBA 3CD4A 3EYVA 1NLDL 2A77L 4MA8H 5C0GA 2ZSVA 1IL1A 5C08A 2QJDA 4Y5YB 1QKZH 1J0YA 1MUJA 2YSSA 3FRPA 4R2GC 4KTEL 4L4VB 2NX5E 4UI2A 1WWWX 1WC7B 2APFA 3HLAA 1EGJL 3ARDC 2J88L 2EYRA 5HHNA 3NIGF 1MLCB 3WFZA 2EYSB 5I9QB 3G6JE 2DI9A 1P4BH 4NKIL 4NPYB 3GM0A 5D96B 3F8UB 4IRZL 4XTRC 4BH8A 4U3XA 1LEGB 2DD8L 2Q6WA 1MCSA 3MLUH 1NC4B 3OKEB 1RZGA 4IRJC 1NGQL 4HCRL 4N90E 5I19L 1ACYH 4LCYB 1BD2E 1RU9L 5C2BH 6FABL 4R2GB 1IILE 1UKSA 2DQIL 3WE6B 3IAGC 4E41E 1UH3A 3G6JF 5JHLL 4ZQKB 2CO7B 3O81A 4FQ2L 3ARDB 4QHMB 3E8UL 5KJRH 1XCTA 4Y2DD 2PR4H 1HSAA 5IM7A 3SCMD 1E6OH 4WHYG 4OLUL 1SEBA 3B6SB 2EEBA 3LEYH 4XMPL 1G9EA 3SDYL 2JB6A 2C5DC 4FHBD 5TDNB 1SM3H 3H7LA 2NY2D 2LVEA 5F3HB 4NZUL 3FN0L 4J6RL 5DDHB 2VDLH 2I27N 2NY0D 1P4IL 2NYYC 3KPSB 4IRJB 4FQCL 1NFIB 5K9KA 1FFOB 5CP7B 3RWHA 5C0EA 2JIXD 1Q1JH 4V1DE 4M1GH 1I7ZB 2FD6H 1WFUA 4HS3B 5F9WB 4ZPVB 2X4SA 5I1JL 5F3BA 3DX9B 4AK1A 2V7NA 2RJMA 3UYRH 1BBJB 4YHKL 5EU3B 3CCHA 1J1PH 1EEZB 1PY4A 3B9AA 5D1ZC 1IGTA 3MRNA 4GRMA 3D25B 5AUMA 4HUUB 5C8JB 3MUZ1 4XPHL 4HK3N 1YN6B 4U1IA 4EN3B 4HDIB 1T89C 3OKLA 4KZEL 1Z5LB 5IR1B 5E95B 4XPGL 4G9FA 2V2XA 3WJJC 5FB8B 4NN7C 2DTML 5I66A 1IBGL 4WEBH 3T2NL 1MWAL 3RU8L 3UJTH 2X1PA 3O3EA 2WQRA 3MBEC 4G8IB 5DD6A 3T0VA 1BF8A 4QRPD 5HYJA 1UWXK 1FL6A 4O9HH 3ZYZA 1C1EL 2W65B 3L3KB 4EZMA 4GW5A 2CMRH 4Q6IA 1WIPA 2QQLH 3C5JB 5BV7L 4GRLA 2YRPA 1RJYA 2R23B 4OFPA 5D1ZB 3VI4E 1BZ7B 2UUDH 2AEPH 4BZYA 2X4NA 4GQ9H 2X6MA 2R0KH 3X12B 3OGCA 1GL4B 1LNUB 1UCBL 2FHCA 3GSQA 5AZEH 4G3YL 4HLZH 3LQZB 4MNHA 3WEXA 5I8OL 2B4CC 2FR4A 1QEWA 2QADC 2YHGA 1ES0B 4DGVH 4XH2B 4U49A 1HHGB 4MVBC 4WY7H 3I75A 4OCXH 3AGVA 3IETB 1T20B 1BP3B 1SY6A 3ZMRA 4BSVA 1UGNA 3TWCH 4WEMB 5GISH 3MNZB 2IPKB 5D1XD 3IU3B 1HK6A 2FSEA 1A2YB 3H42L 5INDA 3VI4F 1P7HL 5TF1H 1A0QL 4PRPA 2DQUH 1YMHB 2BC4B 4MQXD 4LSTH 2JKXA 2UWEE 5IHBA 4G43B 3IKCA 5DUPL 3DX7B 3DXAB 5D2NA 3KYOB 3GJFA 5DFVC 1NBVL 3GJFK 5FKPB 2BVOA 3LN9A 1X3DA 5ETUA 2EKSB 3T09A 3QIUB 4X7SH 1GXEA 2ZCHL 4LL9A 2CRZA 5L6YL 3DROB 2QADB 4NQVB 4OUUB 4DKDC 1CFQB 3RWIA 5MI0C 3VXUA 3OPZL 1MSPA 2COQA 4JHBA 3F62A 5DT1L 3MV8E 5EH1A 1Q9LA 1YEJH 3UTSA 1DFBH 4JPVH 2EDKA 4L3CB 4KJPC 5MHSE 2XZCL 1LD9A 1U8KA 4XVSH 2XFXA 3ECBB 2UWEF 3HI6L 1AH1A 4JDVA 4ZSOE 4PTUB 3WIFB 4NO0B 4XHJD 4FS0A 1A7RL 1E4WH 2EDWA 1HE7A 1FVDB 5EUOF 2YD2A 4K3EH 4URTB 4ZOAA 1A1NB 4PGDB 2XRAH 1S3KL 3UZVB 1OT2A 2E8YA 4V2BA 3WUWA 1BIHA 2HVKB 5ITFA 2DLGA 3MROA 4JM2C 5JOPE 4M5YL 2NY5L 4KTDH 4X5LA 1BD2D 5T3XH 2XN9A 5SV4A 1RY7B 1RSFA 2L7JA 2Z0BA 4E41D 1M71A 4K8RH 1WWAX 1FORL 2W59A 5LVEA 1INEL 4LLMB 1QA9B 3MZGB 2DKUA 1DCLA 1XMWA 1BF2A 2O5ZH 1CU4L 4R7NA 3FB6A 3UDWA 1B4RA 1I8MB 1E27A 2FJHA 4RNRB 5DK0A 2D7PA 3U1SH 1NEZB 3WFCL 3ZE0E 5D71L 4O02H 4NN6C 2EE2A 1A4KA 5C0ND 2RQ8A 4V1DD 3HS0A 3D3VE 4D0CB 4IIQA 2HG5A 5B8CA 3RWCB 4RMWA 4RFNC 5ALBL 1MEXH 1P7KB 4M5ZL 1HYSC 3CMOL 2BX5A 5EU4B 1RMFH 3NACL 3RWEB 1KJVB 4BSJA 2VLJE 2BY0A 4JCLA 4MNQD 2F5AL 1RULH 2M1KA 4EI6A 1PQZA 3ZE0F 4FQLH 4HGKC 3L3HB 4N8CH 3TNNA 4PRAA 4S2SA 3HG1B 1HDMA 4X6CE 5DTFB 3G5ZA 4XCFL 4Q9CA 3VXOA 1AD0B 4ELMA 4UTAL 1DDHB 1B0GA 3PWUA 1EIBA 3LEVL 5L9DL 4QNPF 4NN6B 3MJ8A 3HC4H 2Y36L 1OB1A 4TULL 1RUQL 2MCG1 3K1KC 4XB8A 4Z7WA 3HE7C 4XNUL 1AGDB 1AE6H 2GSIB 5I75C 3T4YB 5J4MA 4RFNB 1B9ZA 3SCMA 5DR5H 1T0MB 5FKAB 2BNQA 3AS1A 3GRWL 3GBMH 5F9DC 3VW3H 1HN1A 3TCXA 2AJZB 1VEPA 5KAQG 1VGEL 1UM5L 1Y0LA 2DYPB 4OIIH 4X6CF 5I1CH 3M45A 5F89A 3MCLL 3QNYA 2APBA 4MJIB 3WSQH 5GRYA 3EDDA 2VLKD 4NOBA 1SY6H 2JIXA 4X98A 5IHLB 3QG6A 4LCIH 2J5LC 4PRHB 1XF1A 5A43C 4KJWD 2FBOJ 5GSVB 4XNYL 1WAAE 5IGXH 5MEQB 3QDGE 4PP1D 1IGMH 4ODTL 1UWEL 3JWDC 4Y4FD 3F65A 3HE7B 4Q9RL 1JTTA 3I6KB 2XPGB 4D9LH 5I75B 1DP0A 1X5IA 5HI4D 4CKVX 1RV6X 3GJFH 4PUBH 3IDGB 1NCDH 3DX6A 1OCWL 3FT3A 4PJ9D 4X8XA 4RFEB 1H15B 1JUFB 4PREA 5IHZB 1S5IL 3MO1B 5TFSL 4M8QB 5ALCH 3CJJA 1WAAF 4OCRH 2R9HD 3MGOB 3GSVA 4WVRA 4BK4A 4QRPA 5LAXB 3MV8D 2J5LB 2YPVH 4M7KH 1NMAL 4FQQA 5AEAA 4N0RA 4YK4C 2CKBA 4Y2OA 5MHSD 3O4OB 5CINH 1BOGB 2C1OA 4FOMA 1R5WA 1FPTL 2X44D 4M3JA 2R2EB 3J7HA 3QEHB 3BUYA 5EA0H 3HC0B 3RUGB 1HXYB 3RRQA 4M7LT 1NEZG 2AK1L 3PP4L 1E4XH 4U6TA 1WBYA 3U4BH 3FT4B 3WLWD 2LU7A 2XIDA 3IB4A 1K6QH 1KOAA 4MCYA 1DANT 2GJ6B 2VTFA 5JOPD 3QQ4B 5HHPA 1QBAA 1F6LL 5EORL 4MNGA 4JDZB 1O7SA 1B0RA 4WI9A 3QUMA 3VFNB 4TTDD 5EZJA 3SE9L 1TITA 1JPTL 5D1XA 3ULSA 5CJQL 2LABA 2XTJB 5IEKB 5L88L 1A1OA 3C6SA 2W9EH 3QZWA 3BIKA 2PW2B 3O2VH 4I2XA 4JG0L 4G7YL 1ZEAH 4JGMA 5I17A 1ZLSL 4EDXB 2IQAB 3GSWB 1RUAH 3LHPL 3QUYC 1CDJA 3GNMH 5I2IA 5H37G 5I1IL 2FJFA 2BVUA 5L2KE 4G80B 5ICXA 3GI9H 4PJHE 3VWJC 4LLDA 1SJEB 1FZKA 1FZJA 4P99A 2Y07L 4PLKD 1UB5B 3D3VD 4P4RB 2F19H 1EV2E 4B50A 1V7NH 4ODSL 4JPWL 1D5MA 3REVA 4R0LA 3RY6A 1HQ4B 3EO1A 2O61A 3G6JA 4QT5A 3VH8A 1T1WA 4FFVD 1KYOJ 3TO2B 4XRCB 2VLJD 1U91B 3LN4A 3OAUH 1MJ8L 2GITB 4M7LL 5CZXD 3NABL 4P23D 3L3DB 3MA9L 4XCNA 5I15L 1A7PL 4PJHF 5SWZB 25C8H 1G7HB 3QUYB 3WIIH 3WFHA 4Z0XA 3VFOB 3C5SB 4FQJH 3GO1H 5HTSA 1BD2A 1T22B 5LKNA 3LSOB 3AROA 4QHNB 1KN4H 3VRJB 4E41A 3KDMB 1OAUH 4CRPA 5I18H 4BM7A 1RIVH 2ICWI 4CN6A 2ICWJ 1AY1L 4NRXA 2IJ0C 1FC2D 4LBEA 2DTSA 3EUUA 5BOPA 3JXAA 9CGTA 5F1KC 4MJ6B 1N2RB 1HEZA 4LNRA 3BFOA 1FG2A 1ZSDB 5JO5A 4HIIA 1RUPH 1GHFH 2E6JA 3UTZA 2AXJA 5E5UB 5SX4H 3MLVL 2ZNWA 4DN3L 2YEZB 4CJ0A 5DEGA 3JTSB 4PG9A 3SO5A 3QJHB 1JPFA 4YXKH 4K94L 3QHFH 3KPNA 4V1DA 4OGYL 1IAII 1EUTA 4TVPL 1Z3GL 4KI5E 1U8IB 4R90H 1IGFL 4HIJB 5D6CA 1YNKL 2FWOB 3QDGD 1IEAA 2Z91A 3JUYA 3MYJB 5JW5B 2W92A 4MNQA 2UZIL 4AH2B 1E4JA 1JNHA 2A83B 4WW2F 2HKFH 5C0AE 2OL3A 1BFOA 1NGPL 2VL5A 2VIRA 3U4EA 1Q0XH 1J12A 3HPLA 1BVKA 3EDFA 1YEIH 4LSPH 1W0VA 5JZ7C 1UG9A 1S7WB 2YPKB 1P2CA 5IFHL 3EOTL 5TE7L 3P4MB 1GGIH 1AHWA 3G6DL 1GOHA 3WLBA 4PGBA 1U8OB 3SGKC 2AP2A 5IP4A 1J86A 5ISZE 2PCPB 3D0LA 5D93C 2CKBH 2EECA 4TOYL 5T1KD 4M6NL 1I7RA 1JN6B 5F7DB 3R8BB 5KSAD 4FQXC 3N9GH 5IF0A 4DUVA 1FNHA 1QHPA 1CGSH 2DMCA 1I7TA 3IJHA 1WFNA 1HH6B 2RBLA 4KV5E 3GIZL 3SJVE 4QLRA 5GS0D 2VLKA 2ARJB 4MA7H 5BV7C 3QUMH 3SE3A 5CGYD 1LP9B 3HUJB 4GS7B 4XAWL 1WZ1H 3D0VB 4IJ3C 4M1CD 4HPOL 5B39A 2MQ0A 1DQJA 5D93B 3A6CH 2HJFB 4Y4FA 3ES6A 1YPZE 4LKCA 2X2YA 1RI8A 3MYZA 3HN3A 5T1DL 3QSKB 2FCBA 2BHUA 4X7FC 1HSBA 2VXTH 1TCMA 2UWEA 4HZLA 4KDVA 4KV5F 1MWAB 5IMKB 3PWPE 3ULUC 3IVKB 1UACH 4PJ9A 2R1YB 5KVEH 2FB4H 4O2EB 5L2KD 2HFEA 5EUOA 4ZAKB 3SE8H 2XKSA 1LHZA 1UYWH 1J8KA 4LEXL 5ID0B 4Q0XL 5BV7B 5JMOC 4CVWA 5IB5B 3VXNB 1YPZF 4KDWA 5HI5D 1G7IA 5SWQB 3AAZB 4TNVF 4IJ3B 2FECL 2HJLA 4OCMC 3BZEA 1MFBL 5EZLA 3KPSE 2D7TH 3WXWH 3U9PL 3BN9D 1NGYB 3W5NA 1F4YH 2N56A 5KSUA 1UH4A 2AJUL 4BH7B 5CBEB 2C3XA 4ZSOA 3MLRL 3PHOB 1BECA 2CLZA 1QBMH 2OCFD 5IFJB 1JZ3A 3LOWA 4ZYKA 4R3SA 3V6FA 2UZXB 3HZMB 4LLYA 5C0CD 1VGKA 4X7CC 1TVHA 1A6AA 5CP3A 4Z78A 1XF4A 5BO1L 2ZJSH 1T2XA 2AV7A 3MV01 1U8MB 4WWKD 2LU4A 3GMOA 3LEXA 3HE6A 4JZNB 2FL5B 4OFYA 4IS6B 5E2WH 4NJ9L 4PJDB 2NY5C 4KY1H 3ILPB 2V9QA 4RCAA 4D8PB 2H1PL 5ACZA 3MV9E 3OV6A 1MIML 5EULV 1P53A 2W0FB 4XNXH 2VC2L 1JCKA 5DJZB 5M7QA 5IB3A 4KKNA 5D7SH 4HZAA 4RMVA 5CGTA 4DOHB 43C9B 3ZKXC 3D3VA 3ZTJH 4X0KA 4XCCH 2YBRB 3T3PE 3O3UN 5C6WH 3AB0C 3HNVH 1AFVH 1T0NA 4KJYB 2QSVA 3SQBA 2P49B 2KQNA 2EIEA 2OL3H 2VLJA 5GS2D 4YAQB 3W9EB 5IW6B 4UBDD 3RKDC 5CCKH 3O3BB 5C0AD 4ISVA 4P23A 3QI9D 1A9BB 4ERSL 1DEEB 4F7MB 5DJ0B 1RIHH 4ZMAT 4PRNA 3K4ZA 2IANB 4YWGH 4XWOC 2KH2B 1H3GA 4YQXL 1HIML 5E94B 3P0YH 3T3PF 5FM4A 3TO4C 4KROC 3TBSA 1YECL 3PWVB 2NXZD 5CEYB 2J2ZA 4YUEH 3ZKXB 1D5XB 5J1AB 2R0WL 4U0QB 1R3KB 4OLWL 3UBXB 2Z31D 4WTZG 3BKJH 3AB0B 1T5WA 4PY7B 2AI0H 3L95A 5ENWB 4H88L 4E5XA 3QISA 1FNEA 4LPYA 3BE1H 4PV8A 3SJVD 3U7WH 2VDML 3QWRD 4GT7A 3RWJA 3ARPA 5KAQF 1BAFL 1P7QB 3WFDL 5HGHA 1MI5D 3FL7A 4CU7A 1LE9A 1OWRM 5B3JE 1T3FA 4KROB 4YHML 1SJXA 5D7JC 1WAAA 2VL4A 2XA3A 4XVTL 2C3GA 3QDGA 2FEDD 2R4SL 1HHIB 3AUVA 1Q72L 4WO4C 1FAKT 4JB9L 2V9TA 4P49A 5FEBA 4R2GD 4QRQA 1ZTXH 1FVEB 4LQFL 3VFUB 3PWPD 4U1HB 2ATKA 4HXBH 5DVLA 1FCCA 3RX8A 3W9DB 2MJWA 3O6FC 3S5LB 1I9JH 2R56L 4Q9QL 2PKDA 1RZ8B 3D5OF 2B8OT 1CT8B 1DL7L 3I50H 3TIEA 5D7IE 1TZGL 3CC5A 1OWWA 5IMMB 1NH6A 3E0GA 1FFNB 4XTRD 2WP3T 5T1KA 4RISH 5CJXA 4CMMB 4CJ1A 1R24A 2C4XA 2QKIB 5GRVK 1ZA6B 3KPSD 3WFEL 2FRGP 5KSAA 2ZZUT 4P2RB 3UJIH 5DI8A 1EO8H 4LARL 3TEUA 3X13B 3D9AL 3IDMA 4OKVA 5H2BB 3S88H 5MEPA 4UV4L 3FB7A 1MHCB 3QPXL 1WZLA 5D7IF 3FQXB 4OD2B 5GGRA 3O6FB 5IOPA 1KNOB 4TSCH 5CP3H 2M8XA 1OF2A 3I02B 2BSRA 3CUPB 5HHQA 4I3RL 4CVUA 3CZJA 2R0ZH 2ILLA 2ZPKL 5DLML 2GSGB 4ZPTA 3LMJL 4JFOB 4OLZH 4ZFZA 3ARQA 2Z92A 2YC1B 4JM2F 5TQ2H 2NYYD 3FJTA 3ARZA 1CDGA 3VG9C 3BP6B 4MAUH 3MV9D 5JQHC 2LE9A 1R3HB 1M05B 3DRTB 3DTXA 4M7ZB 5L2KA 1KTDB 4PJHA 2WUCL 1HH9B 3DSFH 4O5LL 4HBCH 4LPVA 2EIZB 3UBXG 2FNBA 1UA6L 4JO2L 2QR0A 1BJ1J 4GO6B 1P6AB 5GRUL 3SKMB 1ZGLB 3RVXC 5IIEB 3IXAB 2YMXH 5IWLA 4X7EC 2X1QA 2YK1H 3M8OH 3H9HA 3QG7L 4PRHE 4GKZA 4KK8C 1A6WH 2JJTC 5J6GB 3VG9B 3MBED 3QWOB 5KTEH 1NGWB 1TQBC 3GUTB 1NBYB 4WUKL 4MD0B 5T33H 4JZJC 4U3HA 1MFEH 4YIQA 3CFEA 4QXUL 3F58L 5C0CA 4UIMA 5I1AB 2XKNA 4KRNA 1K8DA 4LASH 4PYGA 4WWKA 3TNMB 5DHYA 5JDSB 3JWNC 3RWDA 1T2QH 4TTGA 3EGSA 4MHHG 1GGYA 2QADD 3UPRA 4HKXB 1V7ML 4F7TB 2C1PA 1UH2A 4YC2B 5SWSE 1I75A 4WW2A 5E7BA 4HWEH 5KW9H 3S5LG 3D6GA 3HB3C 1NJ9A 3ARBD 5C0DB 4FFWD 1CDUA 1BZ9A 2P7TA 3L5XH 1TQBB 5DJCA 4HK0A 4EI5A 5KOVC 4M6AA 4TPRH 3ARYA 3C6LC 1M7DA 1FN4B 4GLRI 2ZKHL 4NSKA 3BKYL 4QTHA 4ZFFB 5BZWB 3GK8L 5BVPL 4DN4L 2DL2A 5DFVD 5F96H 4WENB 5F1NB 3GFUA 4KMQA 1S7QA 4LGSB 2GJ6E 4N68A 1KC5H 2MHAA 5DQDL 3ALPA 4NKQB 1B4JL 4ZUVB 4D9QD 4K94C 3WNKA 1T7VA 1OGTA 5C0AA 2Q7YA 3QI9A 4KAQL 4H5SA 1UXSA 5TJWK 2A9NH 4HPYL 4GOSA 4GAFB 4XPTL 1OHQA 5KVDH 2C7UA 4UIKH 1ZS8B 1J87A 2EDDA 5JW4N 3UYPA 2BY2A 2L0DA 3E6FA 2O5YH 2VE6A 3INUL 1DQMH 1WTLA 3F7YA 1FVCA 3VGBA 3EOBB 1KCVL 2JB5L 5DEFB 1IGIL 2Z31A 4Y5YA 3VE0A 3RIFF 4P5TD 5MERA 1NFKA 3N1FC 4KHTH 1R5VB 2I9LA 1TJHH 3DV6B 4YFLI 5DRWB 4JM2D 5T1LA 1WEJL 3OL2A 2AJXH 2ITDB 1ZLVK 4XZUB 4JQIH 5GS0H 4XNMA 3MRQA 1VFUA 1FL3B 2OI9C 3P3YA 5A16B 2EDHA 3DPBA 4I18A 3SJVA 2YD4A 2HFFA 3DVNB 4H1LB 5GZND 3QWRA 3MR9B 2GK0B 3KYAA 2R39A 1MI5A 1RK0A 1MRDH 2N4IA 1RPQA 1V5JA 2IH3B 1MIEL 4KXZI 4BELD 1I85A 1YPZA 2HFGL 1ZT4B 4TNVK 1VFAA 2W9DH 1L0XA 4P48A 3QRFM 1D5IH 2DMBA 4K7FB 4ZQKA 3PWPA 2XICA 4X7TA 1J88A 1N3NA 5C71A 3PL6B 2WW8A 3MRRA 4F7CB 4NYLB 2OI9B 5H35B 2GKIA 3FO2B 5D8JH 4UTBL 1K4DA 2PTUA 2R0LL 4MDIB 1CDCA 2XNAB 2DQTL 1TFHA 3B2UC 4LPWA 1D6EB 2YXMA 2GIYA 4IDLA 5CSZB 4QXGL 2W9LA 1S7UB 4PRHD 5FF6A 2OZ4L 3VD7A 3EO9H 4ZPVA 3LKSB 2Y7QA 1RK1B 2BVQB 2WMPA 4MYWB 1E28A 2FEEL 5ILTH 1BBJA 2F58H 1MQKH 2FO1A 4DZBA 3QUZC 2W0LA 3BGFC 1YNTB 3PXHA 4A2MA 5HVFB 2IH1A 3MA7A 4X5WB 4ZTOL 1YN6A 2DOCA 5DFTA 1XF5A 4XXDA 3C08L 1YEKH 2ADFH 2EDNA 3F7VB 2Z35B 4K3DH 5TDOB 1BQUA 1GGBL 4M62H 3DNKA 4UILH 3CSYB 5IUSA 4OSUL 4MWFB 5FB8A 4JHAL 4NP4H 2H32A 1HXMB 1NMBL 3G5XB 1JJUA 3FQTA 2XACC 2DRUA 3MV9A 3FOMB 5SWSD 2IPUG 2BNRB 3RKPA 2EKJA 1FZOA 3O2DL 3ARSA 3STLB 3TBVB 3G5YA 2HRLA 2X4OB 4K3JL 1K9TA 3QUZB 3BGFB 5ESVB 2FGWL 1PLGH 4PJAE 3QNZB 1Q9KB 3P11L 3V0VB 1JHKL 3O3DA 4LGRB 1RZFL 1L9NA 3PP3K 5GS2H 4IHOB 4LOUC 2HTKC 4X4YB 1MFCH 4OLXL 1OL0A 4KRMB 2GJ6D 3B2VL 2RFXB 4MAYC 3WJJA 3HUJE 4LSQL 1LEIB 3FO0H 4JFZH 3IETA 1T20A 2DWEA 3IS1X 1S9VB 2YZ1A 3MBEA 4NM4H 4H1LG 1QTYT 5ANMA 1WCBA 4WUUE 4C56E 5HHVH 4LK4A 4PGEB 4PJAF 3KPPB 4TUKL 4GMSL 2Q7NA 4JO3L 1KEGH 1P4LA 1JGEA 1SYSB 1WK0A 1YN7B 3KYOA 5FKPA 5L2JA 1QVOB 4OBSA 5E1AA 1MQ8A 2C3VA 5FM5M 2GEEA 4JEGB 5I1KH 2VR9A 4NCC2 2KKQA 5HYSG 1OOAA 35C8H 1MRFH 1G9NL 4K23H 4Z95H 1HHJA 5JNYA 4G6AC 4RZCB 5E2UH 2P8MB 2IFFH 1B6DA 1AQKH 4I3SH 5A2FA 1NCNA 4JN2B 3ARBA 4YGAB 5MENB 4GMTL 4XBGB 3R0NA 2PYEB 4GSDL 4KK9C 4PRIB 4QYOB 2HWZL 3IJYB 2WIMA 2DN7A 2MCPH 4G6FD 4F2MA 3DVFA 1JRHH 5C7XH 5E99L 2KPNA 1CD9B 4F57H 5AWNL 5F72S 3SDDD 3ULUE 3JV4A 3QUYD 3TBYA 3FFDB 1WBXA 1IQWL 3Q0HA 5F8QC 3O6KH 5HGBB 1JE6A 3FRUA 3O45A 3DI2B 2JE8A 3QHZH 3QIWA 4XNQA 2A73B 5D2LB 2BSTB 4NBXB 3VWJD 3DUSB 3HMWL 3VGGA 15C8L 1X5GA 4WV1B 4YPGB 2V2TB 4FQHB 3S7GA 3U36A 4OD3H 4HJJH 1QP1A 3X3GH 1X5HA 1YQVL 2W91A 1G7QB 3QRGL 4LLMA 1QA9A 3VMOA 4HLJA 3WDIA 5DZOA 2ED9A 3L3IA 3JV6B 4JREC 4ELKA 1URLA 5F1IA 2R8SL 1WBZB 4P46C 5D7IA 5L8LB 3ULUF 4R8WH 1IM9B 5CJOH 2VDRH 2PO6B 4OJFL 4RNRA 3GMNB 3FO9B 2RGSA 1T21A 2QTEA 1VFMA 5BRZB 3TN0D 2ED8A 4NC1E 4P5TA 3X3FH 3IRZA 5C0RH 3MRBB 3HFMH 5CJ8A 2D3VA 4JM2A 5DMIL 4BKLA 2AJ3A 1I7UB 5IBTL 1JGUL 2LTQC 3MRFB 3RWCA 4PS4H 2ZG3A 2BNUA 2WIIA 2NXYB 3NTCH 5E8DL 3IGAA 2HJKA 1OARL 4NO2B 3F6IA 1XIWC 2VDNH 5FA3B 2HVJB 1EEYB 4ZUWB 4P46B 1DQLL 3RTQC 3KYKH 2H32H 3OXSB 3DURB 2G75A 2IANE 3LH2L 2OTWB 1N5YL 4GRWH 3ARVA 2AABL 1UJ3B 4NKMB 2D2OA 4W81A 1AI1H 1S8DB 5E00B 2NY4B 5KBNC 1A6UL 3HMXL 4S1QL 1WICA 1AGDA 2LTQB 4AEFA 2D0HA 2R1XA 1YEHH 3BW9B 4IRSB 1U8JB 3O11B 1ADQL 1VEMA 3JUZA 3K3QA 3VFPB 3K80A 5HYQB 4E0RB 2OJEA 4QEGA 4Q6YA 3MCKA 3EZJB 5GGVL 3DHJA 3PP3H 1XIWB 2E6PA 1OW0C 2E8ZA 4FN0A 2BOBA 3HAEA 5FUZH 3OR6A 3L1OL 1BQLH 3IXTB 3CFBA 4G9DB 1LEKA 5ADPL 3ROOB 3RTQB 1GIGL 3IDNA 3ARUA 4FQPA 3X14B 1KT2B 3MODH 3FQUB 2VDQL 1OPGL 1RURL 5F7MC 4M1DH 4JM4L 4WUUD 1CN4A 4C56D 1BFVL 4ETQA 5I16B 3V52H 1KB9J 3OX8B 3BP4B 2P46B 4PB9H 4FQXD 3B9KC 4U05A 4YHLH 4JE4B 2JF1A 4PJFF 3Q1SL 4HXAL 4OCSH 4RFEA 3TBWB 3VFSB 4NQDB 4EUPA 5L7XH 2DQJL 4LEOA 4YO0B 4PJBE 3EYSH 4R4NC 1DVFC 3OKMA 5LAXA 3U7YL 5SWSA 1MFAL 3TZVD 4NRYB 2D31A 1DQDL 1BOGA 4NM8L 1Y18A 2ZP0T 1Z9SA 4XVUC 4P2RE 4PP2B 4X6EB 1NAML 3LVEA 1WIOA 2MSPA 1KGCE 1ZVHA 3QEHA 4IOIB 4NWUH 2Z8RA 3QNXB 2HTLC 1QG3A 2V7HA 3KPOB 2Q86B 3ULUD 4PJBF 4P2OC 1U2HA 4CADB 5HYIA 1OAZH 1G1YA 1U8LB 1IC1A 2GJ6A 1I1FA 5H94B 3BYTA 4Q58C 3ZT6A 4I0CC 3AMKA 3L3OB 3RIFK 3TVMB 4TUOA 5C6TH 3MRIA 3PV6A 2DB8A 2A74A 5BZDB 2R29H 5IEKA 5T5NG 3DYOA 7FABH 2F8XC 3UXFA 1UKTA 3ALWA 3W5MA 5CWSB 2B1AH 2YD3A 4KQ3H 3P0VL 4JFYB 4D0BB 3EBAA 5B4MC 1G0XA 3IDJA 5LWYH 5FDWB 4HQQH 4FQIH 4P9HL 1MAML 3MJ9L 4P9ML 4G7VH 4ALAH 1SJEA 4KPHH 2H2SC 4K3HA 4OZIE 3MLXL 2FBJH 4HUWA 1FNAA 1WVZA 1IGCH 4LIQH 4GW4A 1J0IA 3DO3A 5F21B 5T1MB 3CLEL 1MJUL 3T77B 3TF7C 1YEFH 4UV7L 1BMGA 3BP5B 3P73A 1R0AL 4RX4D 4ODBD 3KVQA 5KVGH 3CLFH 1G7LB 5FGCB 5I1DB 2XXCB 1FZMA 2ICCA 3SDDA 3IFLL 5H37H 2VDOH 5FIEA 4MQSB 2IAND 3IAPA 3RVTC 2A6JA 4PV9A 4OZIF 3VG0L 3KLSA 3N85H 2BHZA 3HTLX 1EHLH 3P30H 1LGVA 3BEVA 4M6MH 4OB5L 3D39A 3VWJA 4JO1H 4UT6H 3LSOA 4QHNA 2Q76B 1ORQA 3KDMA 4G6KH 1H8OA 3MRCB 2XG5A 1P1ZB 4M9PA 1TDQA 2YS4A 1IGJA 2RHEA 4RFOL 3IJSA 1Z0NA 3WD5H 1N64H 1IM3A 5DURB 4KUZL 5AZ2H 4QRSA 4OZ4A 4KHXH 3HAEH 4JFQB 2O5XH 5IBLC 1WTGT 1LO3H 1W2KT 5HI3C 1A9EB 5AD0B 5ADOL 5IKCB 3FTGB 3RKDD 2CIIB 4N0FB 1XR8A 2EDOA 4DGIH 3TN0A 1DBJH 3QJHA 1Q9WB 5EZIH 1HHHB 3BRGC 4XWOD 3QULB 3O6LL 3TO4D 3RWFA 4KROD 1NKOA 1U3ZA 4LHJB 2I60L 3M1BA 1AGFA 2R2HB 1BM3H 4MCZA 5DQ9A 3B5TA 5DXWA 1INDL 4OLEA 3ZTNL 1TJGH 4NQXA 2IC2A 4HCRA 2DBLL 1FJ1B 3C8DA 3F7QA 2G5BB 3U0WH 2J8OA 4EUPH 5BS0B 2I07A 4PB0L 3MRPB 3S96B 4XXCC 2I25N 1T1YB 4AT6B 2NY3D 3CDYA 3ISWA 4FG6C 4ONGL 3R1GL 3V5HA 4L3EB 2EYTA 4TSBL 2APTA 4PJXE 4M6OL 5CUSH 1F13A 1QZ1A 2JCCB 5EFIA 1CLZH 2XQBL 2ZCLH 3JWDH 5HDQH 4WU5B 2B1HH 5E8EB 5C0IA 5D7JD 1JN6A 2AJVH 2XY2A 3SKOB 3ZDYE 5F7YC 5FCSH 2MKLC 4P2RD 1NCBH 3CH1A 4WO4D 1BREA 1KGCD 3QJFB 1Z9MA 2YUWA 4PJAA 5I1LB 1PBYA 4H26B 1CXHA 1JZ8A 1JFQH 3A0OA 1T66C 4Y4KC 1XEDA 4JPKL 2AKRB 3QPQC 3EJZD 3IU4L 3Q5TA 4OKDA 4PJXF 3CX5J 3MLZL 3O6FD 5DS8B 1JZ5A 5C86A 4J7RA 4CGTA 4CVXA 4JR9H 3U83A 3MUGA 3D0VA 3SGKA 1N6UA 2FATH 1IAIM 4WUUA 4KUCF 3MGTB 4C56A 4LVHC 4NC2B 2H26B 3JV0A 1CL7L 5DWUH 4X6BA 5CFHA 4YHOH 3WS6C 3FZUC 2A1WL 4FQXA 3QXDB 1S9WB 5C3LD 4MJ5B 1MWAA 5JR1L 4OT1H 1RUKL 3IVKA 5BQ7A 4CW1A 1CTOA 1XZ0A 2BRRH 3PDOB 3GMPB 2EZ0C 3WHXA 3WIHL 12E8H 5ICZA 4OZHE 1F11A 5TE6L 3TIDB 2XWTA 1N4XH 3OZ9H 1HQRA 4NQTA 2JLLA 4HC1L 1EZVY 4QHLB 1XH3B 3U6RA 3CDGB 4FFZL 3TZVA 4X80H 3UYOD 2C4FU 5DK2A 1DZBA 1XR9A 2VB5A 4LVHB 1CF8L 4XMKH 1ZVYA 4GW1B 5GGUB 2W0PA 3S3PA 1J1XL 5KZCB 3OAYK 3PHOA 2B5IC 1G9NC 4HWZA 4UQ3A 4ZS7H 1NGZB 2F74A 4OZHF 4UZGA 4JRYB 2WNGA 2IBGA 5J6HA 4YGVB 3N1PC 3I2CH 4RDQG 1JWSA 2P5EE 4W70A 2VLLA 3P77B 2FX9L 2PF6A 4N0YH 4HEME 1QSEB 3JVGC 2WBJA 1MOEA 1AIFB 4YNYA 4KZDL 4OCYL 4LCWB 3RZCC 5BXFB 2A77H 1JF5A 4LSSL 5EOCJ 3P4NA 1MCJA 1OAKH 2FL5A 3SBWC 4P3WA 4WHTA 4FXGB 1CGWA 1M7IB 1SQ2N 1U92B 1HCFX 3RVXD 3EFDL 3K7UA 3L3JB 1MH5B 3ROLA 4KK8D 4BSWB 1J9CT 2B5IB 2BNRE 3VJ6A 3KHOA 5DJZA 4R96A 2GUOB 1N5AA 2PN5A 3GI8L 4P2YA 2B39A 1AXIB 1NDMA 2HRPL 3VRLE 4APQC 2IQ9L 4JVWA 4RBPK 2AXHA 1SVCP 5EZOH 3QEQB 2V5MA 3RZCB 1NGQH 4XWGH 1A4JB 3H9YA 1XF3A 3QO1B 2WZPD 2RCSH 2AK4B 4HCRH 3PIQA 5I19H 4U33A 2Q3AA 3HI5L 3HZKA 3CXHJ 5LGHH 3T1FA 4Z7QE 1RU9H 2AXGA 2DQIH 8FABB 1KJ3L 4TVSa 3KAAA 1CTNA 4HUXB 4FQ2H 5I8CB 3E8UH 1ZHNA 1I8LA 1G6VK 5IROC 5TH2B 5I30H 2IANA 4FFYH 1XFPA 4AENB 3QFJB 5IK3A 1EHNA 4YDKL 4OLUH 3QCVL 3VRLF 1JWUA 1NSNL 2CPCA 4XMPH 1T1XA 5IJKC 5HPMA 4GG8A 1Q94A 4AM0A 3C6LD 2QQNL 1D5XA 3UBXI 4BZ1H 3VXSA 4QRTA 2ZG2A 4J6RH 4N0UA 1A7QL 4APQB 4M03A 4GXUM 1UXWA 4Z0BL 3OB0K 4Z7QF 2PTVA 2BVPB 2Y1VA 3EOYG 3IDYC 4E42B 2G9HA 2DWDB 4PFEA 4KUCD 3T4AB 1W8NA 3T1WA 3HR5B 3PHQA 4QTIL 5F7LB 5MENE 1I8IA 1BX2B 3U9UB 4JKPL 1IAIL 4PRIE 4WDIB 4PJFA 4O2FB 1QACA 4XPHH 2FX8L 3RL1A 1CXIA 2CDEA 1DQQB 4UQ2B 3LPFA 3GSNL 2GAZA 3TO4A 5IB1A 5LJYH 1X5AA 1QYGL 1I9RL 2HT3D 4I4WB 3H0TB 1IC5L 1QFWI 4HJGB 4U1JB 5FYLE 1CZ8H 2DTMH 4MHHI 3T2NH 1MWAH 2VLRB 1ED3B 3GKZA 3CSBA 1MJJA 4FXLA 4HMDA 1FVEA 2EC9T 4XBEL 3TA3D 4TUJA 4JN1H 5EG6C 3G9VA 1MAKA 1C1EH 4NO3A 2DQEH 2DMKA 3K2MC 1EERB 1F6FB 1W0YT 2H9GA 3O3AB 4PJBA 3JTTB 1ETZA 4LNVA 5EN2B 3NA9H 1RJZB 4QRUB 5FOBB 2LVCA 3AVEA 4ONHB 4YHNB 1UCBH 1FFNA 4KQ4L 4NHUB 3VDAA 2ORBL 4G3YH 3SGDI 5I8OH 5D7JA 4F3FA 4L5FH 1FL5A 3V8OA 2KBGA 1H9VA 3OAYH 1ZHBB 3PQYD 3UTTE 5E9DD 4D0DA 3LN5B 4P2RA 2NR6C 4WO4A 3GGWA 3ULUH 4ZD3H 4YX2L 1BVZA 2DIJA 1G0YR 2F54E 1C5DA 4I5BA 1TXKA 5DMJB 3H42H 5IQ9A 1GAFL 3VI3E 1T83C 3NGBC 4K2UL 3O6FA 2P5ED 1A0QH 1UWGL 1YY8A 4AJ0A 3ZYIA 5HPOA 5F6HJ 4QF1B 4HK3J 4PJ5A 5MP6H 1MY7A 4KKLC 2FZ3B 4ESKA 2XT1B 1MVUB 1QO3B 4Z18A 3B2UD 4MA3B 1RHHB 2F9BT 2F5BL 5L6YH 3C9NB 1YDPB 1JNNL 3PJSB 3EDJA 4Z7UE 4YE4L 3OPZH 5FO9A 5DT1H 3H3PL 1QFOA 2EO9A 5GRXG 1S7XB 2BNRD 3VI3F 4U6VL 1R3HA 2CLRB 3BO8A 1IGYA 2ADGA 4Z7VF 4QRRB 2ZOKB 2XZCH 4NQUA 1U3HA 4RBPH 3HI6H 1ERNA 3EHBC 1OP3K 3K2UH 3NGBB 1AXTL 4OZIA 2WWKT 1A7RH 1NAMB 2J6EL 3Q6FA 3RGVB 3ULVL 2YD8A 1JV5B 1S3KH 4FNLH 3VXTA 4Z7UF 2ZCKL 3SKMA 4F37F 5I74B 4HIXH 4P9HC 1W72L 4L9DA 2J1KA 4M5YH 3DGGB 3VD4A 4LCUA 1P84K 3CSPA 3U46B 1T03H 1H3VA 3PWNA 4Y1AB 1KPUA 5FHBL 3KXFB 1IC4L 1RZIB 2CIKA 2MQCA 1EJOL 4G6JL 2HLFC 1S9XA 4ODUA 2A6IA 5EO0A 2YRLA 2Q8BH 1XGQB 1M6OA 3OB0H 4LCCA 1R3LA 3W0WA 4J1UB 4U6YB 5D71H 4N8VB 4JY5L 4LOUD 2HTKD 2WUBH 3BEWA 1RQ5A 4LMQE 4MAYD 3V5KA 1IC7L 1C16A 4PD4K 3EOAB 3FAWA 1RZJL 2JJTA 4UT7L 2EDLA 3SQOL 5MEND 3G04A 5LGKA 4PRID 3BT2L 2R1WB 4JZJA 2BMKB 1DLHB 2F5AH 2D7QA 3MMEB 4KGJA 1CGTA 1FN4A 1LQSR 2V17L 5CILH 3LY6A 1FP5A 5DF0A 4XCFH 2X1WL 4CNIA 4XP4L 5FYLD 5L9DH 5EOTA 3BDYL 5GGTA 5JORA 5EBMB 1JHLH 2ADIA 2Y36H 5CS7A 2X4UB 1RUQH 1YZZA 4G6AD 4K3GA 4XNUH 5DMGD 3VXMB 1XGPB 1LO2H 2IWGA 1UQSB 4LPCA 2AEIT 5C6PB 3BXNA 2YD1A 2E9WA 2UYLB 4KK9D 1BFSA 1VGEH 3BZ4A 3NCFB 4PJXA 1MCPL 4RMSA 4U1NA 2VH5L 3C6LA 3QYCA 5CHNA 3MCLH 3RPIB 3EOBA 1HINL 5L8JB 1P5VA 5ID1B 2P48B 3QIBC 1VPOL 4OM0L 4Z7OE 1BLNA 3UTTD 3GIVA 3A6OA 3VFTA 5DRWA 1H3XA 4PBWD 4C83B 5GS1C 2WINB 3D48R 3RVWC 3UTOA 4DVRH 5AG9A 3QXVA 3UTQA 1CFNA 3THMH 3D1MC 3LPGA 2P24A 3SGEH 1UWEH 2F54D 4UMGA 3NA4A 4UNTA 4E9LA 4YHZH 1RFDL 3MLWL 5IB2B 4NWTH 3TT1L 5EU5A 3L7FA 2MKWA 4C4KT 4ZXBC 4OZGE 2AEQL 5E5MA 1KJ2A 2XZQL 5FGCE 1N6QL 4Z7OF 4P46D 1OAQL 3LKRB 1OSZB 3OWEA 5L0QC 4HAGA 3STBA 1S7RA 1GGUA 1ZT4A 2HMID 2EDRA 4BK5A 4UB0H 5DD5L 4AIZA 2GT9A 5D70H 3TA3A 5GS1B 3MJ7A 4S1DC 1NMAH 1XGUB 5DQJB 5TDPA 1OP3H 4FABL 4OZHA 4OZGF 4PR5A 1I8KB 1F42A 2EE3A 1CS6A 1KLUB 1JI1A 2XNAA 4ZXBB 1HCVA 2AK1H 3PP4H 3S36H 4N8VG 3E6HB 4RAUB 1QSFE 3X11B 1XGRA 3PQYA 5E9DA 1NGXB 4LPTA 3FQRA 4LKXB 1A6VH 3KS0H 4XCEA 3KLHC 3UMTA 1NCAH 3OJDA 3FB5A 3LRSA 3VGHA 2CJUL 5L88H 3HZVB 4NQCB 2P5EA 4NNYB 2ARJQ 4JG0H 4LAQL 4G7YH 3M17A 4XPFL 4WNQB 3LHPH 4KKCC 4OV5A 4YLQT 3L9RA 3BWAA 5I1IH 2IF7A 4QXTB 4AG4H 1D9KB 4RDQF 4MJ2A 2CDFA 2YWYA 5E08L 4P4KC 4KK6C 3WKML 3FQNB 4PRDB 1IAMA 2EC9U 4OI7A 4ONFH 5E2TL 4Z8FL 1EVTC 5C70A 1A1MB 1G7PB 4YR6B 2YXFA 4JZOA 4RAHA 2JCCE 1CLYL 4ODSH 1CG9A 4JPWH 3KLAB 2BNRA 1JNLL 4PLJD 2FECI 32C2B 1YYMH 3KPLA 1KB5A 1QHOA 2ZUQC 1TZIB 1MJ8H 3FHAA 3GSUB 4LSUL 3NABH 4XC1L 4QXWA 3MOQA 2P1YA 5LXGL 3B9KD 1EAPA 4EIZC 1A14L 5GJSH 5GGTH 1QKZL 2MOVA 3T0EB 4PTTA 2RFXA 1XAUA 2JCCF 5C0JA 4YBLC 4P4KB 3ZKNC 5IVNA 2P8LA 3U0PA 2Y25A 1DVFD 1I9IL 1FO0A 4GBXD 3O9WB 5DUML 1FRGH 1MCCA 4S11A 4JFEE 5FM5O 2XYCA 3OHXB 3KPPA 3ZHKA 1JF1B 4MXWH 3DYMA 4M61B 4QGYA 3HCVB 5DYOA 4XVUD 2ZUQB 4P59H 3WKNA 5CD3A 4NO5B 3HRZB 1G7MB 2HTLD 3MLUL 1CLOH 3MLVH 4MXQD 4DN3H 1FIGH 1IAOB 1LE5B 1X7QB 1KIRA 3T65B 5GRJL 4DW2L 3PGCB 1ACYL 4P2OD 4NC0B 3FN3A 4MQTB 5C2BL 1FYTB 4S1SH 4MAYA 4FTVB 4OGYH 4ODXA 1CDBA 1INQA 1IKFH 1T6WA 3BH8B 4YBLB 1AR2A 2A0LC 1IGFH 5A2IH 5CEXA 3ARWA 2OSLB 1YNKH 4RMTA 3LS4H 2PR4L 2FIKB 1YUHB 3HNTH 1OP9A 1E6OL 4BUHA 2HAZA 2UZIH 1KJ2H 3L6FA 5FYKU 3RJDA 3VD5A 2QV2A 4G8GE 1NGPH 3MV7E 1BIIA 4ORZC 3GSOA 3S9DB 5E2VL 4Z77B 2ATPB 1F02I 5IFHH 5IG7A 5B4MD 2JK5B 4MX7B 4EDWH 1K4CB 5FECA 3MRLB 4J3OC 4LCWE 4TOYH 2V2TA 3T0XA 3UYRL 2KL6A 5GIRB 4O2CA 4YEEA 4AMKH 4Y4HC 5DURD 4Q2ZA 2VDKH 1WBZA 1DUZA 4JFHE 3LKPB 4HKBB 1NBQA 4HS8L 5EUKB 2PW1B 3O4LE 4OM1L 1QSFD 3AU1A 5E03A 4IOSD 2IBBA 3UTTA 1EPFA 4LVNB 4NGHL 3F6LA 2IG2H 2RB8A 4HIEB 3RVTD 2BFVL 4G8EA 3STZA 1CD1A 2H8PA 1P5UA 2QEJA 3PWJB 4HPOH 4NBYB 4N5UA 3ILQC 3QEQE 3GSNB 4UDUB 2F54A 3VFMA 2CMRL 4O51B 4RAVA 5JMRA 4Z7VA 5F1SA 5T1DH 4Y4HB 2HKHH 5FO7B 1EA9C 4M4PA 1X6NA 5IQ7H 2R0KL 3BD4A 5IBLD 4P46A 2HT4C 5HI3D 4HULB 1A3RH 4P57A 1KPRA 2X7LA 1CDYA 2EO1A 4RIRB 4Y8DC 1AR1C 3QH3A 1G7JB 1MVFA 3NZ8A 4WY7L 1KJMB 3Q3GA 1EBAA 4JY4A 4Z7UA 4HIHA 5IHUL 4F37K 1U8PA 3TWCL 4F9LC 1KB5H 4HS6B 5LGJA 1EXUA 1QLRB 1MFBH 2GTWB 3BW9A 3WS3B 4WGVB 5FK9A 4U4BA 1CK0H 1MLBB 4JGUA 5TF1L 3RHWF 4B7LA 2IAMC 3VFPA 4QOKE 2DQUL 2DJ4A 4OGAC 4LLUA 1F90L 1EJ6A 2Y06H 3K74B 1TCRA 4KVNH 2ITCB 5IESL 1FH5H 1MJ7L 3AXLA 1KUMA 4X7SL 3NCCB 4BFGA 1T1ZB 1OY3B 5F7EH 5M94B 3PUCA 3RGHA 3LS5H 1U42A 2VITB 4XGZA 1FO0H 2PETA 4I77H 5CIPA 3BVNB 3UC0L 6CGTA 4FG6D 4JJ5B 1K5NB 1YEJL 1DFBL 4PJGB 4JFED 3DBXA 1XCQA 2GCYA 4WU7A 2EH8L 3ULVC 4JPIB 4JDTH 3BPCA 2ZOLB 2PXYD 4N1HB 1HHKA 3MOAH 2VLRE 1FGNH 4OV6F 3BP4A 1UADC 4NJ9H 5GGSA 3MOBH 1E4WL 1LK3L 3PHSA 3E2HC 1MIMH 3UP1A 3VFSA 1OW0A 5D7KD 1FSKC 3EFFB 2XRAL 4PJCB 1EHXA 3UJJL 1HI6A 1I4FB 1T66D 1N8ZA 5IMLB 4Y4KD 3OKOB 3JSSA 1TVBA 1ZA3A 1KPVB 4KTDL 5J0BA 1AGBA 4L8CA 3W11D 3TGXA 4K8RL 4X99B 4YDVB 4Y8AA 3VWKC 3GMLA 2YOCA 1KG0B 1ONQA 5KZCD 4G8GD 2BHYA 2O5ZL 2WQ8A 5IFAL 1W72B 3MV7D 2CUMA 3FZUD 5EC1A 1Q9OB 3SO3C 4ERSH 3B9KA 4G8FB 1MCLA 4OAWA 5FYLH 1RZJC 3U1SL 4RQQA 1UT9A 2C3HA 5B3NA 3H7BB 1JZ4A 3C5ZC 2EDXA 1YECH 4ZFOA 1RAMA 1MREL 1DVFA 4GBXA 2R0WH 4OLWH 1MCIA 1S7SA 1ULVA 1AGCB 3RDTC 1JWMB 3R06A 1RULL 4L8SC 3VWKB 4PJ8C 4JFHD 7CGTA 5HHMB 4N8CL 4Y89A 4X4MA 5ICYB 4D0BA 1GZQA 5CD5C 3O4LD 2X4PB 3N06B 4AEEA 3FQWA 4XX1G 3GZKA 4P2OA 3U4AA 2WAHA 3BHBB 2EE9A 4YHMH 3C5ZB 3MJ6A 1CICC 3V8CA 5I1HH 2EDTA 3QEQD 2R4SH 3RZCD 1OAXH 5DR5L 3IDIA 3RDTB 2VYRE 3GBML 4JB9H 2L7UA 3FFCB 3MFFB 4L8DB 4EXPX 4OZGA 3NZHH 4PJ8B 5I1CL 2OQJA 4U7MA 2IMNA 2H2PD 2QHLA 5HHOE 2E27L 3HI1A 4KMLB 5C0BD 3DX8A 3QBTB 3LV3A 1L7TH 4Q9QH 4GG6F 2JTDA 3BKMH 4JKMA 4BUGA 3CPLB 4LCIL 4YXLH 1TZGH 1FFPB 4F33B 2B20A 1D5BB 2FYYA 4AEHL 1BZQK 3MRCA 1IGML 4APQD 1JZ6A 2X4RA 1CICB