5ISZE

Crystal structure of ls01-tcr/m1-hla-a*02 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
IGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAAGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIFGQREQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8(+) T cell epitope.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszE02
1CFTA 4E41E 5F88B 1G7LA 3MMEB 5FKPB 3MOQA 3DUUB 5F8QC 3WJLA 4MJIB 4NYLA 1I7ZB 5L2KA 3O8XD 1K2DB 3V6ZB 4KFZC 5IG7B 5AD0A 1KUMA 3LDBB 3UTTD 1A14L 1HQRA 4WEBH 4GT7A 2CLZA 3T4YB 1U92A 5SWSD 3KHOA 1NAKL 4IBLT 4WW1A 4J12A 1KTRL 1JNNL 2VDNH 2PNDA 3MFFA 3GMOA 5CEZH 4OV5B 3W5MA 3NCYP 5IFAL 1HEZA 1KB5L 1PKQA 4HC1A 1JHKL 4PRIE 3X13B 3NBNA 2X4PB 1QSVA 3JV6A 2Z0BA 4IRSD 4KAQH 3G5YB 4YDJA 4WHTB 4XBGA 2D9CA 2D7TH 1VKXA 2R15A 3KLAA 1S9VB 2HTLC 4L9DA 3TNMA 2CXKA 3GJEB 1QNZL 3BOVA 4EI6B 3R0MA 3VXRD 4PJXF 1VDGA 1FYTE 4P23C 4F7MB 1UGNA 3LS5H 4Z95H 1UEYA 1F97A 3X3FH 1X5FA 4S2SB 2R1XA 3T77A 2EDLA 4ZYKA 5CINL 2VQ1A 5D9SA 5FO9B 5EC1A 4E42B 3WFCL 3EYQD 5DRNB 5GISL 3GIVB 1FAIH 4DN3H 4LSQL 4NQUA 4QXWA 4Z77A 5IW1A 4JHAL 3ZHLA 2DQJL 4PLKD 4G7VH 3L6FA 3VI4E 4HZAA 4YNYA 1UZ8B 2XPGB 4G42A 3N1MC 1FO0B 4E5XA 4Y16A 1N64H 4NC1E 5DC9B 1VEMA 4WFGD 4NN5B 1RMFL 1X5ZA 4MAYD 4JFQA 4Z7UB 1M7DB 5L9DH 3ULVH 3FFCD 3GSUA 3C6LB 1G6RH 2AEIT 2R0LL 5T1LA 2GJZA 1R0AH 3WNLA 1J88A 2CKBA 2CSPA 4UU9B 2HT3D 1A7RH 3VFRA 3UC0L 4WI9A 3GSNL 1I8IA 2X41A 4UOW0 1LE9B 3LKPB 4ZXBD 2BXZA 2VNCA 1Y18B 5DYOB 4HKXA 2IGFH 3BD5A 3ARRA 2X70B 1LILA 1A7NH 4YIQA 2NY1B 3MJ7B 5C86A 4LNRA 5I1AA 5JA8B 3VFOA 5C0JA 4M6MH 3DMMC 4HH9A 5J57B 3QXAB 4J1UA 1LK3H 4G6AC 5DJDB 1FNSL 5B8CB 3DX7A 3DX9B 5D1QC 1V3LA 4F15B 2FHBA 1YNLH 3ARWA 2VC2H 1BM3H 3OKKB 1GH7A 2AV7B 2VAAA 3HMXH 5F7LB 5KG9A 2PYFB 2YK1H 4WFFD 3RVUD 4HAFA 1KTDB 4ZUTB 5J1SC 4PV8A 2XFXA 2ARJB 4NUGH 1KLUB 1T89A 2NY2B 1FG2B 5C2UB 2O26U 1MPAL 4JVUA 5CJBA 2VXTH 1ZTXH 4AENA 2AXFA 3B9VA 2I24N 1TENA 4RISH 4XP1H 2JJSC 3PHQB 1U58A 4YWGL 3VA6A 1SBBA 1J1OH 1ZXQA 2NZ9C 3FN0H 3GBMH 2Q7YA 5E5UB 1Q9OA 2XWBA 1I85A 1XR9A 3ARGD 1JZ5A 3QWOB 4GRMB 3QEUB 3D85B 1QSFA 5F7EL 1YEKH 3QFJE 1W0WB 4WFHE 3L3DA 3RDTC 2FIKB 1E6OH 1H8NA 5JR1L 3FN3A 4Z7UE 4PB0L 3MBEC 4CVWA 15C8H 1RIVL 5FUCC 3OB8A 4FTVD 3E6FA 4UMGA 1Z9MA 3U7YH 3QXDB 1HHJB 4S1RH 4MCZA 3WD5L 2IANE 2QR0B 2Z8WC 5DEGB 4HIXL 3HR6A 3IFPA 1MCIA 1P53A 3B8SA 3WS6A 3GO1H 2A83B 2X10A 4HJGB 4JKWA 4K23L 4HWBA 4CUCA 1SBSH 1OLLA 2EXYC 4OD3H 3UPCA 1HDMA 3WMSA 5GGVL 3WN5A 3VXMA 3HR5B 1SYVB 2BC4B 1H3GA 3FB6A 3MGAA 3MGOA 4KMTL 2VDKH 4JPKH 1EEYA 3BX7C 3PL6D 2VLLA 4LKXB 4FQXC 3IDNA 4L8CB 3QWRD 4F33B 1BBJB 4PJEB 4F7EA 3GMPB 5CP7A 4NO0D 1CXLA 5DJXA 5K9QG 1A6TA 1RJYB 1G7IB 1EHLH 4PG2A 1I1FB 3RVVC 5GZND 1U8IB 4JDTL 4DN4H 3LQZA 2Q76A 1IC5L 2ADGA 3LEYH 3CJJA 1D5IH 1EEQA 3MFGB 3NACL 1K8IA 2DOCA 1D9KC 4WWKB 3R8QA 3JWDH 5GRZA 4LSTL 4XWOC 3QJFA 2X05A 4PRNB 1N4XH 4N90E 3VI3F 4NHUA 1U8HB 4HK0A 1N59A 1KCVH 1DDHA 4XMPH 1IAOA 3HRZB 5HHNB 3WIFB 1KFAL 4JFED 1ORQA 3GMNA 3DXAA 1U3JA 3N50A 5DJZB 4XGZB 1OPGL 3Q6GH 1XCTA 3TWCL 4U1NA 4F58H 5DFWH 1VGEL 3LH2H 4N9GA 3MXWH 1QYGH 3ZYJA 4D0BA 2IALA 4Y1AD 3ROOB 5GRUL 1BZ9A 3O6FA 2ITDA 1F42A 4P4KC 5HHPA 3NZHL 5JDSB 1S7RB 5C07A 1WWAX 3BD4A 4MXQD 4GW5B 3VRIA 4U33A 3ARZA 3MLPA 2YEZA 1B4JL 1ES0A 5FO7A 5ESAB 1I3RB 3S3PA 5E6ZA 1JPSH 1K4DB 3K80A 1MF2L 3MJ9L 1QFWM 3MA9L 1X7QB 1VFBA 4YDLB 3CPLB 2R8SL 2IQAB 3OXSA 4G3YL 5J3HC 4MJ4A 3HUJB 1K5NB 3D39E 1BX2A 2ZUYA 1EZVX 2R69H 4JG0H 1K8DA 1XGRB 1OP3K 4FNLL 4OTXL 5FM4A 4GBXD 4E41A 4KUZL 5MHSE 3WIHH 1JNHA 2DI9A 1PQZB 3X14B 3EYVA 4FABH 3QNYA 4G43B 3FT3A 1L7TL 2YWYA 1N3NB 2FGZA 4PJ9C 5AYUH 3FQRB 3VXQA 4OD1L 2JELH 3ECBA 3IDGA 3U9UA 1E4WL 5DK0B 5GQBA 4DTGH 5HDQH 1QO3A 2P8LB 5BZDB 4QRTB 4QXUL 1MCRA 5HVGB 4APQC 5E4EC 5ETUB 1ZGLP 2G9HB 5T3ZE 2DQDH 2W0FA 4OIAA 3X3GH 4YX2H 1SEQH 3N1PC 3QEQB 4GAYB 2FR4A 1G7JA 4PRIA 3QG6A 5E5MB 3IFNL 3T1FA 3O8XC 4DZ8B 2Y5EA 3C08H 1CFQB 2XN9B 2I5YH 3GMRA 3M07A 1EBAA 4OQ1A 1NFIB 2ESVB 3O4LA 4HXAH 1OSZA 1S3KH 2GTWB 4M7ZC 2WQRA 5J11C 2HFGH 3P0GB 3RKDC 4MD4B 1YC7A 3C5SB 1U95B 4XVSH 1CK0L 5TQ0H 4LBEA 4MLSA 4I0PA 1CGYA 4WI3A 3KPRB 2OMNA 5FK9B 4M3JA 6FABL 4IRSC 1DVFD 3HZYA 4X80L 1BWMA 1NGQL 5JHLL 4PP2B 4Y88A 2UVFA 5C0RH 1V7MH 5C0DB 5CCKL 3H9SD 2EYTB 1T20A 5IP4A 2PTUA 1KN2H 4LCCA 3VD4A 3BI9X 4XPHL 2ADIA 1OAKH 4JRXD 2C1PB 2AGJL 2C26A 4JY4A 5BV7B 3PQYD 4WO4C 2Q3ZA 4OM0H 2DQTH 3O6LH 4KK5D 3EYQC 4HD9A 2QQKL 1A7OH 2X4TB 4PJGF 1S7QA 4ZFGH 3I9GH 4ZDHB 3C5JB 2ZSWA 4FOMA 3RVXC 5GGQH 1A1OA 2YKLH 4KKAC 3QUKB 4KDTA 4QT5A 2ERJC 1KCSH 3ARBB 4JFZL 1A5FH 4KXZH 4Y2DD 2R4SH 1S7WB 5INDA 2J2ZA 3W11D 1F58L 1D5MA 4F7CB 2E7MA 4HIJA 4MAYC 1OW0C 4FQQB 2X4RB 4QHNA 4UTAH 3QEQE 3X13A 2XIDA 2X4PA 4K2UL 4QRSB 4BZ2L 4MWFB 5JTWA 2EYRB 2OSLB 2HT3C 4LCUA 1N2RA 1X4XA 5HYQA 2H6PA 4ZXBC 3ILPA 5E8NB 5CAYB 1SY6H 2VO5A 4J4PA 3KNBA 2GYSA 1CU4H 1LK2A 3GJEA 5J1AA 2BK8A 3WCYA 3QUMB 2ADJA 3CC5B 4FFWC 2WP3O 5DURB 3D2UA 3QRGL 4CADB 3KPRE 2P4AB 4E42A 3MLWL 4MQXD 1UB5B 2NY6B 3BAEL 3GIVA 4KVCH 1P9MC 1I8KA 3MCKB 4ALAL 4LU5L 3RVUC 1R5IB 1YY9D 4XNZC 1JP5A 3O11A 3OMZA 2XPGA 3TN0D 5F44A 1FO0A 1ZHLA 3BPNC 2X4QB 3UZQA 1J0IA 4UT6L 3UXFA 3QFJA 2E5EA 3OR7B 5JHDD 4N0YH 1IAKA 2VLRB 2VL4A 3UX9B 3PE9A 1M7DA 1BMGA 4MDJB 3GBNL 3QEHA 5IESL 1CQYA 2P5EB 4MA7H 4UU9A 1OAZH 4HCRA 1QBLH 2K7QA 3I3BA 1LE9A 4HXBL 2IANA 1I3GH 4JFOA 3LDBC 2XI9A 4C56B 1QFWI 2ZJSL 3BKJL 1I1AD 3CX5K 4F80A 5F7YC 4HMDA 5DWUH 4YHKH 3ZE2E 1WCBB 4LEXH 3NH7L 1F6FB 3O45B 3DX9A 1R3KB 4V1DD 3ZLQC 5E8OB 4HS3B 3FQTA 3IXTB 3FB5B 4OLVL 1QRNA 1QPXA 1CL7I 3U4EB 1GGIL 5EIQA 5IBLC 3OGCA 3H6JA 1J18A 2OL3L 5B4MC 3U7WH 3EOAB 1KLUA 4B0MM 1T1XB 4LLVB 4OJFL 4YFLF 4KZEH 3T0BA 4EI5D 2C5DC 1S5IL 1K4CB 3I2CL 4WI8A 2YRLA 4OLXH 4Y4HC 3EO1A 3P9MB 3FOMA 4WHDA 4GKZA 1U91B 1LNUA 3PL6C 4ZPVB 1MQKL 4FQ1L 4ZUVB 1JK8B 2BHUA 2C7UB 4C4KO 5DUPL 2D0GA 5DJ2B 5D1XB 1V7NH 2P8PB 3ZMRA 4U1JA 4GRMA 3PP4L 3VDCA 5IWLC 2CR6A 2DL9A 3HZVB 3QEUA 3D85A 1ZHNA 3IU3A 4XNYL 3MYJB 3VFWA 2X89A 1A6PA 4QTHB 3FO1B 3T0WA 2ID5A 4TNVF 1E4XL 2VLRE 4K3DL 1FFOB 2XQYK 3RWDB 2NPLX 1AKJB 1KULA 2AV1A 4OFPA 4Y4KB 3PWUB 5FHAH 4I0CC 3C6LC 3PWLA 1EIBA 1S8DA 4WEUD 3ROLB 1K9TA 2AQ1A 1TCMA 2QR0A 4WV1C 4L4VE 1ZLSL 2OZ4A 4C56E 4PREA 3ULSB 3UBXI 3IVKA 4G8FB 2H2PC 4JFDD 1J11A 4M3KB 3HG1B 1RZ7L 1YJDH 3HR5A 1PGRB 3MRGB 2IFGA 1TQBB 1BD2D 5F7KC 1RZJH 3K74B 1ZKAA 4KMLB 4ZPTA 3ZL4H 5C6TH 3D39A 5B8CC 3E3QC 2IPUK 4KVNH 2EDBA 4OB5H 4F15C 4BKLB 4B53A 5I75B 4KTDH 5J6GA 3IYLW 4NQCD 1L0XA 5C0BB 2RBLA 5D8JL 3ZTJH 4FS0A 1RJYA 4NN6C 4WNQB 1QVOB 3N1QC 4Q0XL 3ALPA 1U6AL 2JCCA 3MO1A 1B4RA 2X9XA 3BZEB 4NIKB 4RAUA 4P2QB 4LDLB 3G5ZA 2OQJB 2Z92A 3BGAA 1BJ8A 3NFSH 3S9DB 1OAXH 3CFDA 2WSKA 4GBXC 1ODAA 3SO5A 4JQXC 5GRJH 4K07A 3S7GA 1EEUA 3IRZA 4I0KA 5IJVA 3O2DH 3B2VL 4KJPD 25C8L 3RIAF 4Y4FB 2YD8A 1DBAL 3HC0B 4P3DB 3L3JB 2A77H 2GJJA 1OOAA 3FQXB 2EIBA 1T22A 4ODXA 1F8TL 3WO3B 4XH2B 3KYAA 5C1MB 2MHAB 1FDLH 4XVTH 5DRXB 2F74B 1MIMH 1B0RA 1FJ1B 3EOBB 1LO4H 2WUBH 4X4YB 5K93A 5F7UA 3QI9B 4WI2A 5E1HB 3LEVH 2D7QA 1VACA 4CVXA 4N8CL 5CLTA 2DWDA 1I3RA 3RI5F 4KHTH 5L6YH 1SQ2N 3IDJA 3NN8B 3QCUL 5I18H 3CPLA 4MD0A 1ADQL 1CE6A 1JNJA 2GTZB 4Z76B 5L8LB 4NQEB 3T0ED 3RIFK 4QF1B 3PGDB 4YHZH 1XGTA 1X4ZA 1K6QH 5C0BE 4AIZA 2Q6WB 3ZE0E 3H42L 3SDDB 4QKXB 1AY1H 1BEYL 3X14A 1P7KA 1UXSB 2RQ8A 1R3IL 1ZOXA 5D72H 3VXTB 1DEEA 4NDMA 3M45A 5DK0A 4JDVA 1LMKA 2C1OB 4P2QE 3VFTA 5ADOH 5JUEH 1MFAL 5J4MA 1EFXB 1AR1D 4MZ3A 5FCSH 4M1DH 4ODVH 5GJSL 5ETUA 2NXYD 3F58H 1ORSB 5KVFH 4UOW1 1NGPL 3TT1L 2BVQB 3CXHJ 3HE6B 3MROA 1BZ7B 1I1RA 3VFGH 2GSIA 5E56A 4ZO8A 1JF5A 4I5BB 1HOCA 5JOEA 3D25A 4QRRD 1QLFA 1YQVL 1RQ5A 4JY5H 2HWZH 3KXFE 1QQDB 4LMQI 2EDQA 2PYED 3GK8L 4RWHA 4C59B 4XWGH 4Y2DC 5E95B 1NCBH 3CSBA 3W11C 3C5SA 4J3VA 3V0VA 2EXWD 3AM8A 3DX8A 4GKSA 5IK3A 4RGMC 3IXAA 2D7NA 3NIFF 1BFVH 5F6IC 1NCWL 1FL5A 1IM3B 3I50L 3IS0X 4QRQA 2J8UF 4NKDA 1F00I 3DARA 1G7HB 3QNZA 2X9WA 3Q1SL 5D7IB 2EKJA 4OD2A 4OLUL 3TPUB 1PFCA 1WFUA 5ICYA 4JKPL 3NCFB 5L2KD 3KGRA 4FQ2L 1YDPA 4NQEE 3C60A 1NUNB 2YD6A 2ZCHH 1GRWA 4OCWL 5J1TC 5IJKC 3PIQB 4OF0A 5I73B 1ZVSB 2GCYA 3VWJA 4GXVH 2I9LB 4PJIB 2CUIA 4XPTL 3VJ6B 1JV5A 2IAMB 1DQQA 1T83A 4MQXC 4R9HA 2P5WA 3UBXA 3GRWH 3WFEL 2A6IB 2WW8A 4CW1A 4K3JH 1UXWB 1QG3A 3C5JA 5BRZA 1HSAB 3IDXL 4HWEH 3QNXB 1YY9C 4JG1L 4NC0B 3TN0C 3QUKA 2XT1B 2IC2A 1F6AB 1F3DJ 3VD3A 1TVDA 1XF1A 2KDGA 3D0VB 3QEGH 1W8OA 3NFNA 3DSFH 4JZOA 4AY0A 4S10A 1JE6A 2Y06H 4DGYL 1G84A 2X4RA 2ICEA 3DYOA 4PYHA 3UPRA 5C0CB 5HVFB 5EOCH 1RUKL 2ZSVA 1U8LB 3B2UD 5ICXB 5DR5H 4OUUA 3EIFA 2QBWA 1BFTA 3BQUB 4G8IB 4YGAB 1IQWH 3ULUH 2XZQH 1RJZA 1MIEL 5E8NA 2DQFB 2NY3B 2Y6SD 3K2UH 4A6YA 1JPST 5F1SA 4UINL 1I1AC 1DQMH 2J3SA 3LMJH 3CC5A 4ZTPH 4C83A 5K33A 4NJ9H 4Y16D 1R3LB 2GQHA 3RX5A 3AB0C 2UWEB 4Y0GA 4JY6B 3GI8H 1T1ZA 4F7TB 4RAHA 4ETQB 1UVQA 1JF1B 3U0WL 4W6WB 5KSAB 1A0QH 4MSWA 4LAJH 3MCKA 4KI5E 5IFJB 5ESQB 2PUQT 3QIBA 1R5IA 3P3YA 4BSWA 5L7XL 5T1LD 4JE4B 1IKFH 3OKMB 4JO1H 3G6DL 3L3KB 1MRCL 2X4QA 1H3TA 3B9KB 4OI7A 1FBIL 1AC6A 2ICWI 2Y36L 4BZYA 1VGKB 1A3QA 1CDBA 4JPWH 4YE4H 2VLRA 3QULA 1VPOH 3S37X 3MRQB 3LN4B 1CD8A 1P5UA 2X1WL 3AMLA 3BRFA 1NC2A 1A6VL 3NCJH 3Q2CA 5LBSL 3BPCA 4KY1H 3BPLC 4L4VA 1GJIA 4HIHB 4XP5H 3CFBB 4C56A 4S1QL 1QEWB 2NY0D 3I02A 4ZD3L 4NO2A 4P5TB 5ADPL 4JHBA 3QHTC 4HHAB 1FV1B 2E6JA 1P1ZA 4FQLH 1U8NB 3TYFB 3MV8B 4OI8A 2IPTH 1U8QA 5CSZA 1XF5B 2MCPH 1R3KA 35C8L 1ETZB 5IGXH 2A6KA 5DD5H 3IXTA 3FB5A 3IS1X 4XHJC 5FYJH 1C5BH 3U4EA 2FO1A 1ZS8B 1YYLH 3DGCR 4UTBL 2NNAA 1TDQA 5FGBA 1XMWA 1T1XA 1PSKH 1UWGL 1N5YL 5IKCA 1K4CA 3QUYB 4LOUD 5LGHH 2HLFD 2UZIL 1TJGL 1EH9A 3ZDYF 1MCLA 5IHZA 2UUDH 1QSFD 5BCAA 1ZT1A 3D1MC 3NA4A 2FZ3A 2P46B 4UZGA 4PJHF 1YECL 5GSVA 5DO2C 2YSSA 3C8HA 4BQCA 1JK8A 1CD1B 1U93B 3GBLA 3P11L 3FQUB 4L9LB 5D1XA 2P8PA 5D71L 2YD7A 3RUGA 5E5RB 5MP6L 2ITCA 1KELH 2XTJB 1RUQL 4NKMB 5C09A 2YS4A 3ALWA 5IBUB 1CZ8H 4LGPB 3MRCA 4IRJB 3BWUC 4MXVF 4QTHA 4FRWA 2L7JA 3RWDA 2IBBA 3QO1A 4DZBA 3AU1B 1JNLL 3FRPA 1IM9D 4Y4KA 4JB9L 5ILTL 4RMWA 3VXMD 4M61A 1EA9C 2W38A 3F5WA 5GZOD 5J6HB 1AFVH 3ROLA 2WIIB 3E2HB 4LVOC 4ZODA 4Z7WF 3G6JF 5DQDH 5D5MF 4LRNH 1JNNH 5IR1A 4KRPD 4KJPC 2QHRL 2WBJB 2AQ2A 3V7MA 3L7FB 1Z9OA 1FZKA 1KB5H 3MV8E 1JWMB 2IADA 5D7JA 1KJ2L 3GSRA 5HSFA 1AXSB 3QAZC 2CGRL 5J9PB 3VCLA 1BQUA 3D18B 32C2A 4DWHA 5HGBB 3MV01 3EBAA 4X9IA 1S9YB 5C0BA 2R2HB 1QNZH 1T7ZA 1MCOH 3FO0L 4ZUSB 1C5DA 3RHWK 5I71B 5ACMA 5FYKD 1YMHB 43CAA 4XRCB 3REVB 3F6LA 3BZEA 1FNEB 2OR9H 3VRLF 5DSCA 3T0EC 4J6RH 4P2QA 5GISH 4K9EC 4WENB 3BP4B 3DXAD 2OQJA 3PWPB 3RVTD 3NTCH 3MBXL 3TNNA 5F1NA 2W0LA 5A2IH 5TF1H 4ODTH 2DQJH 1JWSA 3MA7A 1PYWA 3O6FD 3SBWA 1FGNH 2PXYA 2XTJE 1FG9C 4M7JL 5C07D 2JB6A 4Y4FA 1CN4A 1I3UA 4PG9B 5DMGD 2CJUL 4U1KB 3T8XB 3FQXA 1YC8A 5JOFB 2VSDA 3KXFA 2EC8A 5FYLD 1A9BA 1GAFL 2GEEA 3OQ3B 5D6DC 1S7XB 1AR1C 2Y5TA 3F12B 5TH2A 2F5AH 2F74A 4JANB 4PJFE 2NXYC 3GSNH 1BHGA 1FRGL 5INCB 3CFEB 1K85A 1BZQK 2HJKA 3V52H 5I1JH 3W39B 1I8LC 4E41D 4G6ML 5IMMB 3AREB 3MLUL 1IGJB 2V2XA 2ICWA 3ULVE 4XBPA 3RWJB 1FNSH 3C09B 2GTZA 1G0XA 4XP6H 2GI7A 2B1HL 4M1GL 2XG5A 1QP1A 2RJMA 2YD3A 1Q9WB 1J0HA 4YK4B 4JM2B 1XEDA 4IRZH 4NO3B 1UCBL 2BVOB 3VW3L 4JREC 1LP9B 2IH1A 3UJJL 4HUUA 5EOQL 2GY5A 1MPAH 1UXSA 5I16A 4N0CD 2R29L 2ZG3A 3WUZA 1O7VA 3O9WA 2EDWA 3SOBH 2FEDD 5FHBH 4UQ2A 5DHYA 3PWPE 4YWGH 1J1XL 4GRLB 3O4LD 1MCWW 1EJ6A 5I1IL 2FBJL 4NP4L 2BOCB 4GW4A 3TM6A 1MJ7L 3NIDF 3HE6A 5SV3A 5C6WH 5E6IA 4WUUA 2IBZX 5E9DA 4I5BA 3PWVA 2P47B 4I0PD 5F7EH 3DROB 4WU7B 3TJHD 5C92A 3S37L 4WHCA 1KCUH 1QQDA 2DM2A 1Q94A 1RIVH 4O5LH 4XZUA 2ZUUA 2YC1B 5IVXB 5J0BA 3T65A 1T0NA 4NQSB 4PLJD 4R2GB 1TPXB 4RFOH 3TYGH 2YBRB 3U9PL 4HIXH 4OBRA 1PG7X 2V2TB 1C5CH 1IM3A 2ATKB 3B2UC 5T1KB 3LKQB 3LKSA 4K23H 1LHZA 4MD5B 4L3CA 4CGTA 1B9ZA 3MUJA 3DURA 3TPUA 1IAIL 3L3IA 2Y6SC 5EH1A 4RIRB 5ID0A 1WSST 2B4CL 3HC4L 4MS8D 2P24B 2CK2A 3QIWB 3MLZL 5C0AB 1W72L 2JJTA 3F7VA 1HXYA 2GK0A 5SX5H 2D3VA 3HI1B 4X9HA 3KPSB 3HTLX 3U4BL 1WF5A 1F6LL 4WY7L 2IPUG 4ZO6A 4MX7A 4P2OA 1HHIB 4R8WL 2VISB 1S78C 4QTIL 4LSPH 4JDTH 1RUML 3IT8D 5IB1B 2DQEL 5IMKB 2KQNA 3RGHA 5DGRA 5EORL 5ABDE 4YDKL 4J4PD 4HK3J 1EHAA 2J6EA 1CGXA 3HRPA 4OCRL 5EBGA 3MXVL 1IBGL 1GSMA 3D2UD 5ICXA 1JGDA 1TNNA 3SJVB 2FH8A 2WAHA 3TFKD 1I8MA 3LVEA 5HVWA 3BJ91 4P99A 5HPOA 1OPGH 1MOEA 1JI1A 1N5AB 2DQFA 2NY4D 5B3JF 2O5XH 2ORBL 2A1WH 4X6BB 2NY0C 1MHEB 5IVXE 5GRUH 1OD9A 4CVZB 5D93B 1AXTL 1JZ3A 1FSKC 3SDXE 3K8KA 5D7LE 1A4JB 3B3IA 3NZHH 1T89C 1CFBA 2FD6L 4ELMB 2HYMA 4K9EL 1FL6A 1RUPL 2E7BA 3QFJD 1B4JH 5K9OB 4X7SH 4NQVA 3ARDB 3L7EB 3WNPA 4QRUB 2ATPA 5KSAA 2R23B 3C2AL 5SX4H 3MA9H 3DVNA 5ESQA 5I19L 5KVGL 2IPKA 1CD0A 3SE8H 2FLBT 4G3YH 3TBSA 4M1CD 3L3KA 5C0NC 3HKFA 3PDOB 4GO6B 3IRPX 5I1EL 5FM5M 1GL4B 1U8JB 2IAND 5C0AE 1AE6L 5D7KE 1SJEB 4LOUC 3KPSE 1I85C 1UM6L 4HJJL 3KJ4C 4FNLH 4OTXH 4MAUL 4U2YA 2NY1D 3G5VB 1W0YT 2ZUQC 1MHHA 4PR5B 4ZO7A 1AR2A 3BT2L 4POZC 4OD1H 5L0QB 1MWAL 1YUHB 5A16B 3TH4T 1E4WH 1OHQA 1XF4B 4YHIB 4FP8L 4QXUH 1QRND 2NW2A 3NPSC 3CUPB 4JQVA 1FV1A 3UTQB 1BVZA 1INDL 1OL0A 1U8NA 3WS6C 3HS0A 1OF2A 3TP4A 2BJMH 1PX4A 4H20L 3ZDZE 4BQ6A 4QHKJ 1XF5A 3SJVE 3IFNH 3WN5C 4ZFZB 3PWJA 3O41B 5GGUB 1M05A 4NWUL 5GZOC 1MLBB 2J1KA 2VXVH 2GAZA 3MRFB 2OJZL 4YPGB 3GDBA 1GYAA 4B50A 1PBYA 3BQUC 2VLKE 3IJHA 4NZRL 2E6QA 1PEWA 4N5ED 1KYOJ 1S7VA 3ZKMD 3KYKH 4N90D 1RZ8B 1CK0H 1GCFA 2FSEA 2BFVL 4U1MB 3BP7B 2F19L 3MJ6A 3AXLA 1C1EL 4Y19A 2FATL 4LCWB 4PG2C 3QHFH 1CQKA 4OAWB 2VE6A 3PHSA 2X89D 5IMLB 2CLVA 1OM3L 5A43C 4X80H 3MLVL 5JHLH 1G7QA 3DV6B 4HG4K 5IB5A 4DKEH 1QBML 4CMHB 2PTTA 1U93A 3S4SA 1KC5L 1X5AA 3QJHB 2HJFA 1KIQA 4OIIL 4PTTB 4HC1L 5EPMA 1A7PL 4D0DA 1Z2KA 4FA8A 4GUPA 3CLEL 4OZHB 5IV2A 1D7FA 3S35X 3U2SA 4DOHB 4U3CA 2QKIA 4HBCL 5EDXA 1A6AB 2Z35A 4PRHA 5HI4D 2DTML 4RGOL 3AU1A 1JN6A 8FABA 4NM8L 4RFEA 3KLSA 5IB3A 1YMMB 2IFFH 1UEMA 4PJFA 3BVNB 4X98B 3RWHB 3O6FC 1IKNA 3RRQA 3D39D 4HF5L 4AEIH 1HWHB 4JFZH 4HH8A 1WJ3A 3ME0A 2IMNA 4HIEB 3HMWL 3VFNA 4JJ5B 5DMGC 1BF2A 4U3XA 1ULVA 1JWMA 1FORL 1MEXL 3RJDA 1G6RA 4GAFB 2E7LA 4K2UH 2VZUA 3KPOA 3DHJA 4NM4L 4BZ2H 3G08B 2I9TA 5ISZE 5KOMC 1T2XA 3QHZH 2ZCKL 5HGBA 3PDGA 2R2HA 2RFXA 2EH8H 1F11A 3ARXA 1HSBB 2YPKB 1P4LA 4ZUUA 5MENB 4ZUSA 4J8RB 1GGBH 2RIKA 1FVEB 1KPVB 4JRWA 4XRCA 3REVA 3QRGH 1PG7L 2G5BA 2CKBL 1FFRA 2PCPB 3MV7E 2EZ0D 4XMKL 4U3HA 2AEQL 4LCWE 5EA0L 3THMH 3B9EA 4EVNA 3MLWH 2A6DA 3KPPB 1JYNA 1AO7B 4HUXB 2NZIA 3HMXA 4KH2A 4ALAH 3RP1A 5K9JH 4HZLA 2VLJB 1CDYA 4YUEL 1XGPA 4NOBA 4PJAB 1ZGLM 1TZHB 4FFYL 4UT6H 4HUVA 5F7NC 3G5XB 5M94B 2X7LA 4FMKA 1HIMH 5JW5A 4U1KA 1FLRH 2FEDC 3LIZH 1CIUA 2FECI 4FG6D 3HE7C 4IRJC 4Y8AA 2BVPA 1FYHB 4OCXH 4PP1D 5DK2B 2EDRA 4PGEB 1YMME 3FO9B 5GSRB 2HRPL 1ZT7B 4HXBH 1IGCL 3FB8B 3CFEA 1J05A 3HNVL 3E2HC 2M26A 2YN5A 5JNYA 3BKJH 2HMIC 4IJ3B 3VRJB 4OZGB 4NGHL 1T3FA 4I0PC 3DVIA 1PJ9A 5IMMA 5JW4M 3QQ3B 5FUOL 3FHQA 4F57L 3SKNA 5D2LB 2ZOKB 1F4YL 1FZJB 4XXCC 5FOJA 4WTZG 3VFUB 3DLQR 4NO5B 5SV4A 3CX2A 4XCNB 1GGIH 3SGEI 1BWWA 4K71B 3S4SG 2OL3H 4JZNB 3T2NL 2R1YA 1HI6A 2WWMD 3ZKQD 2O61A 3RBSA 1SEBA 1S5IH 3LKOB 3RTQB 5IBUG 1YYMH 1UH4A 3I2CH 3VI4F 2VIRA 3DNKA 1AD9B 5CHNB 1YPZB 2G60H 2YPLB 4AQ1B 2XQBL 1BOGA 3WEXB 1AO7E 4DKAA 1KNOB 5HJ3B 5FO8B 4C54A 1CGTA 3CAFA 4OZFH 4KDTC 5BZWA 5HY9B 3CH8A 1QLRA 2VLJE 1JPTH 5KTEL 3DGGA 5GGRB 3I3DA 1JRHH 4PJAE 1ONQA 4NKQB 5J13B 4FFVC 4DEPC 4XNYH 1QA9B 3MRMB 3L1OH 3EYSH 1E4XH 4MJ6A 2VZVA 4LPXA 2HT2D 4JZJB 4RGNB 2APTA 1Y0LB 4I4WB 2KUTA 1DUZA 5FAAA 1P2CA 4NQSA 5JXEA 4J4PC 1CXKA 3SDXA 5D7LA 3P73B 1TTFA 3C60D 4HPOH 1ZLSH 4EN3B 2SEBB 1OQOA 2D7OA 1FFPB 3VWKA 5F1IB 4KC3B 4OZGE 3LKQA 1L7IL 3VWJD 3UO1L 2AS5M 4OZIA 2VDRH 1E27B 5KSUB 1RZ7H 4XXDA 1ZSDA 3OJDA 1S5HB 2QQNL 3O3DB 2P5WD 1TMCB 2NY4C 3IDUA 2YN3A 3QDJA 5D2LE 5DMIL 1DQJB 3VMOA 3AREC 4KUCD 4Y5YB 1IEAB 1NBZB 5FYKL 5BRZD 4YR6B 2QLVB 5C0AA 4HGKC 1A4KA 1GGTA 5D7SL 4LIQL 4JM2C 4XAKE 2UYLB 3SKJL 5LQBL 4H0HB 1KENH 4U1IA 2JB5L 3UTPE 1NGXB 3OF6A 5EO0B 2VISA 2ZNWA 4TSBL 4TNVK 1OAUH 1H8SA 4Q0XH 1YEEL 3LQAC 1U6AH 3TA3C 4U31A 2DQCL 5GRWA 3BGMB 4L4TB 2YPLE 4ZFOA 1NCCL 5ID1B 5EZLA 2I07B 4JFHE 2R2CA 3TCLB 4AEHL 4RAVA 5FYLL 4Z7UF 4ODHL 5TFSL 3OAUL 3N0PB 5DFVD 2HKHL 2O93L 1I7TB 3WIHA 1FN4A 2AJXL 4DK3A 4EIZC 1D6EB 2IG2H 4GKOA 2BP3A 5KN5A 3B2VH 4XMLH 25C8H 3S35L 3LCYA 4U7KA 5FOBB 4UQ3B 1GZPA 4PRAA 3DX6A 2G75A 3LRGA 1F8TH 2PW2B 4OM1L 1MFDL 2NY6D 4RGNE 2VLKA 5CFHA 1MFBL 5IVNA 3JXAA 3QIBD 2OCFD 2CDGA 3CVHB 4WU5A 3P9LB 2CQVA 4RMTA 1M71A 1P84J 1D5XB 4QHMA 5DJ8A 4GAJL 4XHQA 5IEHB 3DOSA 4R2GC 1T2QH 5FECB 4YHOL 1Q8MA 2IF7A 5EBLB 1JHTA 5K9OA 2HVJB 4HKBA 4DGIL 2GUOB 2R23A 2AJYL 3BHBB 1OP9A 3QCUH 4I77L 5HI5D 1RHHB 4AMKL 1ADQH 3FRUA 5DD1L 4GRWF 4MCYA 5DHXB 5FGCB 3DO7B 2OR7A 1NC2D 2AJSH 4H26B 3ZHKA 3QCTL 4K94C 3MLSL 5F93C 1R24A 4L4VD 5EO1A 5HHQA 3WFZA 4C56D 1C7TA 2FGWH 4PTUA 3AAZB 4JVPA 3X12B 1YEGL 2V5SA 3MRRB 4UIMA 1OT2A 3H42H 2A6JB 1BEYH 3O3BA 3LV3A 2XWTA 4JN2B 4PJCE 1R3IH 3TH2T 2X40A 2NTFA 4XPGL 1FLTX 1U42A 3MCLH 1KCLA 4L4TE 1NSNL 2X2YA 4K8RD 4FZEH 5BQ7B 2GHWB 3I6KA 3OJMB 3N06B 4JN1L 1DSFH 3S88L 1U3HB 4P5KB 2WBKA 3C2SA 3UTQA 3UJIL 1NGPH 3TT1H 1EZVY 2PR4H 2W9EH 3BH8B 5KJRL 1UA6L 1PDKA 1UWEH 3BUYB 5ISZA 1EO7A 2VL5B 4BQ9A 4WW2A 4G6JH 5E8EA 4NQXA 1CTNA 2DQGL 2DF3A 4I48B 3FQWA 4OGYH 4D9RD 2DLHA 3CFJB 4X6FA 4L3AA 1SMOA 4M6OL 3RA7L 4Q58C 2R0WL 1RZ8A 4LLQA 1I9RL 2XY1A 3Q0HA 5C9KA 3MRDA 4O02L 1CBVL 1VFAA 3VD5A 3CZJA 3MV7A 5C09D 5EIIA 1NLDL 2EYSB 2Z93A 3I50H 5L2JB 1WAAE 2HFEB 2H26B 2XG4A 1OVZA 3VXPB 5HGGS 1YEFL 4LLMA 2C3VB 3DPBA 4OLUH 3HZKB 4M6NL 1SY6A 4Y4KD 5FGCE 4FQ2H 3HAEA 1DL7L 1WT5C 2RB8A 4PTTA 4Y5VA 5JPMA 4QHLB 3MLYH 2JCCF 3GUTB 1MCHA 3N1GC 2HFFA 5FDYA 1UQSB 2DQIH 2EZ0C 4NZTH 4F9PA 4XPTH 1G7PB 2ICWJ 4OCSL 1X5KA 5D96C 1A6AA 4H1LH 3RL2A 3FT4A 5B3NA 3D9AL 5D7JD 2XXCB 1NEZB 2VWEC 3BVNA 3IDXH 3L5IA 3RWHA 1UJ3B 4H8WC 4JG1H 1J8HE 5L0QC 3K1DA 5BMFL 4YFLI 3PABA 5KZCD 3BP5A 3NCYS 3NFPB 1IRAY 1XCQB 3SDYL 5EU6A 4PP1C 2Q8BL 3S96A 3T2QA 5BS0A 1RULH 5T33L 5T1DL 5EO9A 4Q6IB 1ZLUH 2KKQA 3B83A 4JJHA 1Q9LA 4I3SL 3CXDH 5K59F 5F1KC 4UUJB 4P2QD 1ZHKB 1EBPA 1WV7T 3BXNB 1KXQE 1MRDH 4LFHG 2GJ6D 2IQ9H 3HA0A 2AAVA 2B1AL 2F5BH 3O2WL 3FO2A 4G9FA 5GRVK 3LQAL 4J8RA 1X4YA 3TV3L 3QDMB 2PXYD 2XXMB 5KBNC 1HH9A 5IEKB 3KYMA 5HHMB 5E2UH 1N8ZA 4BFGA 4HUXA 3SY0B 1WIPA 3U0WH 3V79C 1JWUA 3KXFD 3ULUE 1F4WL 4WI4A 3HI5L 1GC1L 1T1WA 1DFBL 4U1HB 3BE1L 4JR9L 3MRLA 5L7XH 3MODH 2FWOA 4D94A 5CMAA 3OKDA 3G6DH 4PJAA 1MRCH 5KOVC 2WWMC 3BESR 4P59L 1UKQA 1RVFL 1AGDA 1X5JA 4OUOA 2Y36H 1ACZA 1W0VB 4QXTB 3ZT7A 3EDEA 1TNMA 3KPQB 1C12A 4CKVX 4PGEA 2E27H 4TQEH 3F8UB 5EZIL 1CVRA 1A6VH 5CILL 4N8VB 2YUZA 4ONGL 3RNQA 3GMLB 3MNWA 5C7XL 4JVWA 2VDQL 3BP6B 4ZD3H 3SKMB 4KGJA 4OZGA 2GFBB 5ADPH 2I27N 1OGAA 3NCEB 3MJ8B 1CICA 3UAJD 4Q9QL 1YEIL 4O00A 5LVEA 4MNQB 2HT2C 2BSSA 3NZ8A 1BQHB 1UB6A 4C58B 35C8H 3STLB 5IB2B 3Q6FB 5CZXD 1FZJA 5DJ6B 3O9WD 5EU3A 4GAGL 2W65A 4I18C 4K3HA 5I66B 4XCNA 2NY7L 4GMSL 2YUVA 4XNQB 4MDIB 3T4AB 2G2RB 4UTBH 3T1WA 1FVDA 3WJJA 2KQMA 1UWGH 4KJWD 3VWJC 1N5YH 4HGWB 3IKCB 4X4XB 3ZTNL 3HE6D 1QLEL 3QXVA 2UZIH 3LKNB 5E6ID 4WUUD 1KB5B 5E9DD 1T83C 3WL9B 3STBA 2Z31B 2OZ4L 4WDIB 5CLWA 5FYJE 1MELA 4POUB 2VXQH 2EDHA 3GSXB 3QA3A 3SCMB 4YZFE 5HJ3A 3SE3A 2XZCL 1T0MB 2YA1A 4CNIA 3QUZB 2EH7H 3RGVB 4DVBB 1CE1H 4M4PA 1A21A 3TZVA 4KUCF 4YAQA 5F7DA 3OJVC 1U8KA 5EBWA 4NBXB 2PW1A 4YPJA 4UDTA 4LSSL 3MRMA 3PNWA 3ARFB 5KW9H 2R2BB 4N0FB 1JNLH 1KIRA 3GSOB 3DVFA 4JB9H 5ILTH 2BY0A 4LCIL 1Y0LA 4KI5D 3ZE2F 1G7MB 1BFOB 2LVCA 3P73A 5DFVC 5BVJB 1DBML 4XPBH 3VXSA 5F1IA 1SMAA 2QHRH 4NWTL 1TITA 4ZNEE 5KSUA 5DHVA 1L9NA 5FM5O 5JW3L 3WUWB 2C3HA 2FHFA 2QADD 5DJYA 5I0DA 4FQJH 1KJ2H 4P2OD 5MERB 3RWGA 4RRPA 1PZ5A 1S9XA 1ZA6B 5E1AA 1DQJA 1CFSA 4WFED 4KTYA 1IJ9A 4RZCB 3QIBC 3T3PE 4XC3L 1BGXL 3GSNB 1CLZL 1RY7B 5JIKA 4Z0XB 1DLFL 3CLFH 5IW3A 1NMAH 2AK4A 3PHOB 2E8ZA 5A3ID 1CFNB 4D8PB 2OI9C 5I1LB 4DAGL 3TH3T 4PJCA 3L3OB 2WK2A 3INUH 4NQDB 4YEEA 5HI5C 3RTQC 4U0RB 4L4TA 1FVCB 4UV7L 4N68A 1HHHB 5GGSA 1J12A 5EUOE 1H0DA 2AABL 1I7RB 2BNRB 3KPLB 5IVOA 4HX1A 1I7TA 3VA2C 1IAIM 5LGKA 1CIDA 4NCC2 2JIXB 1YN7B 4M7JH 4U6HA 1MQ8A 3I84A 4QGYA 3WE6A 4UQ3A 1JUFB 2CJUH 3FQNB 4HEME 3D69A 4LRIA 5LKNA 5KSAD 3GB7B 4R90L 5HTSA 5IHUH 1R3JB 4R4FL 2XV6B 1YQ2A 2MQ3A 5ALBH 2VXSL 5KSBA 1FRGH 3VFVB 1DJSA 1Z3GL 5FGBC 1OP5K 3TF7C 1D5XA 1IGTA 4LHUA 4IIQB 5CJ5A 4WIQA 1FL3B 3WO4C 4IS6B 1TFHA 4CAGA 3KJ6L 3OAYK 2CDEB 3V6FA 2AJUH 1BVKA 1AHWB 1E4KC 1A6WL 4G6MH 5KVDL 4XBEL 3IDYC 3LZFL 3HNTH 3IU4L 4P2RB 3DO7A 2V17H 1IL1B 1UG9A 1A7BA 2YD4A 4OGXL 4KMQA 4XP9L 2ZZUT 5SX5K 3RFZC 4H26A 1CL7L 1J7VR 3RWEA 1EEZA 4PJ8B 1Q9KB 1RZKC 4PB9L 3QQ4A 2EDEA 5BV7H 3HNSL 3U36B 3A6CH 3MRRA 4JQIL 4KU1A 4NRYA 3ZTJG 2A6JA 5T1MB 5EOQH 1MFNA 4OCYH 4BUHA 2QV2A 2R29H 4XI5D 1XR8B 2YZ1A 3PWNA 3RUGF 3JV5A 3GSVA 5CZKA 5BQ7A 4W6YB 1J8HA 5SWQA 1B0GB 3HPJB 1FCCA 1VADB 3GMQB 2YMXH 1U3HA 5E94B 2DIJA 5I1IH 1IT9L 2FBJH 4NP4H 5A2FA 1MJ7H 3L5XL 1MREL 5TDPB 3BRDA 1IC4H 1MI5B 2DKUA 1V8HA 5BW7A 5CEZD 3GRWA 3RU8L 3TVMD 2EO1A 3TBYA 4KK9D 2PO6A 1JPFA 3LS4L 5D7JC 4Y19D 2VL5A 1IGYB 4I48A 2CUHA 4E9LA 3KYOA 2B2XL 4RRPG 4UDUB 3ILQC 43C9A 4UV4H 2F9BT 4AL8H 4M8VA 4X6CE 1NC4A 4NPYB 2C3GA 2V7HB 2HTKD 4L8DA 4P3CL 2Q86B 4OI9A 3QZWA 4QNPE 3JV0A 5C8JA 4PJXB 1JHLH 3U9PH 2HLAB 1PY4A 2XTJD 4CL7A 2EYSA 4R3SB 2HFEA 3VXPA 5FF6B 1A2YA 1C7SA 1JL8A 2C3VA 5I8EA 4PRHD 4LVHC 1QOKA 3ZE0F 4HKJA 1J10A 1IAIH 4P23B 4HMCA 1MHCA 1LEKB 5C08A 4BH7B 1NGYB 3MLZH 3ORJA 5AG8A 2XNAB 2F58L 4ORGA 4J3SA 3U4BH 1KJVB 2PXYC 4JGMA 4WY7H 4RA3A 1T2JA 1D6VL 1DN0B 4MVBD 4DKDC 7FABL 5E6YA 3U46B 4R8WH 5ACZA 4A6YL 3KYNA 2DYPB 4IEFB 1EJOL 2PN5A 5DLMH 3MV9B 5TE4L 1MVUA 2BMKB 4LPVA 1JPGB 1S7TB 5TQ2H 1P7QB 5DI8A 2Q8AH 2Z91B 1H3PL 4YDKH 4YFEA 4F2MA 1QFPA 4Y5XA 1MI5E 1QRKA 4OCRH 3EFFB 4PJ7E 5JMRA 1HHKB 1D5ZB 1VENA 3KR3H 3L5WB 3MXVH 1IBGH 3TJEL 4X0KB 1QPPA 5H35A 4XPFL 4Q6IA 5TPWH 5CIPB 3BN9D 3O3EA 4PGCA 4MQSB 5EUKB 4PV9B 1TJHL 4NCC1 3NIGE 3K46A 4X6DB 3DETD 4H25B 2J5LC 1ZLVH 3DMMB 1AXTH 3SGDH 2LAGB 2CRIA 5KS9E 5D1QB 3OJ2C 4YQXH 9CGTA 4K9EH 4QWWD 4HK3N 5IEKA 1RUPH 4ZOBA 3BKMH 4M43H 4AM0A 2Z9TA 2KH2B 5GS1A 3RY6A 5CZXC 2JJWA 1B2WH 5D70H 5JQHC 4QRPB 3C2AH 3QQNA 2X4SB 2FJGA 3R06A 3P77B 4G9DA 5LGJA 1BLNA 1K3ZA 3RZCD 4PFEA 4AH2B 1LO5B 3S5LB 2X42A 3TO4B 3AS3A 4TUJB 4TRPL 5JZ7D 1J5OL 4K8RL 1CWVA 3NABL 3SDCA 3QXTA 2R2EB 4ZAKB 1W0VA 4HJJH 5JXAH 5I1GL 1RK1B 3UTZB 4MAUH 3IKKA 2H32H 2OJEB 3C5ZA 3R1GL 1I9IL 1KV3A 3EO0A 4LQFL 3RIFF 5IMOA 1DLHA 3BT2H 1NBYB 3MV9E 3TPKA 3N9GH 5I8OL 1RJCA 5HYSB 1T5WB 5L8KB 4N0RA 1QKZH 5DZLA 3RDTB 3QIUA 1VFMA 4FP8H 4ODUA 2EICA 5I1DA 2VITA 4HT1L 1OT1A 4JGUA 4ZNEA 1XF2B 3MBEB 3MLXH 3M17B 3QZWG 4ZSOB 1INDH 3D3VE 4XVJL 1CR9H 1WFTA 1XH3B 3X11B 1ZEAL 1LO2H 4DUVA 5F96H 5IB4B 1RZKL 4M7LL 3AY4A 1JGUH 4NWUH 1KJ3L 3PG2A 3F7YB 4GH7B 1ZHBB 4AQOA 1KIPA 4MNHA 1PLGL 3T4AA 1LO0L 2EE3A 1J86A 4X6DE 1AIFB 2FJFA 3CCHA 3UTSB 1MCWM 1I7UA 4KI5F 4X4XA 3I6GB 1OB1B 5FCUL 2BFVH 5E4IA 3V0WH 4R6UA 2F19H 3WL9A 4LSUL 1C1EH 1N6QL 3QXWA 3A6BH 1KBGL 4G5ZL 5T5NG 2X4NB 2XKNB 4FQXB 3EAKA 4U4BA 1NL0H 1TZGH 4MQ7B 4QRPE 5EUOA 3GSXA 2HAZA 1QBMH 1NEZG 1MCQA 1BQLL 5IQ9B 2XTLA 1ITBB 5A3IC 8CGTA 4F7PA 4YXLH 5JXED 3K4DA 4P5MB 1GXEA 5D7LD 4LARH 1A7PH 4RQQB 5BVPH 5MEPB 4RA0C 3CLEH 2DI8A 2R39A 2P7TB 3VWKD 5I2IB 4HBCH 3LY6A 3OKEA 1D9KB 2R2BA 4N0FA 4XP4L 2DRUA 2DTMH 4RGOH 4NM8H 3SDAC 5CGTA 1V3JA 5CJOL 1E28B 2AKRA 1XZ0B 3QDJD 2GSGA 1MCFA 5BVJA 5CEXA 5F9JB 2OP4L 4OGZA 4TOYL 1ZV5A 1WFNA 4L8BA 1KCRL 3I75A 4ZUWA 3HPLA 4GOSA 4HUMB 2ED8A 1HKFA 1NFDA 3WHXA 1B0WA 4ZSOE 5FUCE 4PUBL 3QPXL 3K81A 3BGFB 2VLME 3OF6D 2NY5C 1L6XA 1Q0XL 2X4UB 5BO1L 3W0WA 3IJSA 4YHML 1PD6A 4R7NB 4NM4H 3QG7L 1H9VA 3GSNA 4P48A 4IOFC 1RAMA 1DQLL 2ZCKH 1TQCC 2J4WL 5C0IA 1DBJL 1QFUL 3KLDA 1HYSC 4OLWL 3ZO0A 2Y7QB 4E0RA 5I1LA 1OGTA 2JE8A 4FZ8L 2PF6A 3VFMB 2CIIB 3H3PH 5BJTA 1PG7H 2CKBH 4LL9A 3QDGE 4J23A 5IROA 4MGXA 4BH8B 3HZMA 5ANMA 5EA0H 5JOPD 4OKVB 4WJ5B 3QUXA 3TEUA 1WBZB 1EPFA 3VDBA 3TIEB 1XF3B 2APFA 2DDQL 1KJMB 2CMRH 4N8VG 2VLKD 4NHCH 1UC6A 3HFML 2OL3B 2NLJB 4IDJL 1R5VB 5DEFB 4PJ9B 3CMOL 1CDIA 3QUZC 4N8PA 3RGVC 3CZFA 4FFYH 1Z9SA 4AK1A 1A3RL 4XI5C 1GGYA 2HN7B 5HHXL 4QYOA 3VMPA 4QY8B 3H7BA 1EV2E 5ICZA 4V2BA 4Z7VB 4APQB 1BQHG 1JTOA 2NX5A 4X6CA 4MLIA 3BO8B 3EYOA 4U6XB 4Z78B 2EDOA 5I17B 1KLFA 1IGML 1IGCH 3F62A 5E24E 2BCKA 5JQ6L 3O8XB 3GGWA 4G7YH 3WKMH 4O51A 3UTTB 2ILLA 4YGVA 3TVMC 4IS6A 4NGHH 1CT8B 5SWSB 2CDEA 2X5PA 2C4XA 4M7ZB 5J11B 1S7SB 4KPHL 4F57H 1ZWIB 1FIGL 2D0FA 4HG4J 1IL1A 1NH6A 3PDDA 1YEDB 1JFQL 4YHLL 2HTKC 1P4IH 5E2VL 2FYYB 5T5FL 4X7TB 2WM0A 3U36A 4IRSB 3MGTB 2VUOA 5D1ZA 5B38B 3T2NH 4YXKL 1U8MA 4W4OA 2E9JA 1TJIH 1MHPH 5IT2H 2FJHB 3VXRB 4PJGB 1ZGLB 2CK0L 3D48R 2AXGA 3HPJA 1LQSR 4U0RC 5ISZD 1VADA 3H9YA 1R5WA 1ZANL 3GMQA 4WO4B 5F89A 4P0DA 2OX5A 1TZIA 3H9HA 4O4YL 3SGJA 1IKNC 5GJTL 3LKRB 3A0OA 1UM5L 2E9WA 2QHLA 5KTEH 1FE8L 4PJ7A 4MVBC 2VR4A 3EUUA 4PJFF 3LEXA 4DVRL 1IGFL 4TUOA 2FX9H 3MV7D 2QL1A 2ZNXA 4NNPH 4RSVA 3WUWG 2E7LC 4GG8A 3PV6A 5GXBB 2VR5A 4Z7VE 4ZS6C 4TUKH 4Q2ZB 4PRPA 3U6RB 4M8QB 1KF9B 3OAZK 4MAYB 5EFIB 3U0PB 3FAWA 5F1OB 3WDJA 3PGCB 5M7QA 3FFCB 5KS9A 1MJ8L 3G6AA 4R97C 2ZUSA 3UTTE 2B8OT 2WINA 3K3QA 1L7IH 3DBXB 5DD3L 3EGSB 4ZXBB 3NMEA 1G9ML 5SWSE 4QGTA 2IBZY 5J7CC 3BN9C 4EDWH 3EO9H 3MLTB 1AHWC 5ITBH 1RZFH 2J6EL 3DETC 4YDIH 5E08H 3SQBA 1LEKA 4P2CG 4GSDL 3VFSA 2VZOA 4JPIB 1BQSA 1HILA 3GHEL 1X44A 4URTB 4HGMA 3B5TA 1MAMH 1IC7L 4QWWC 3WS3A 3SKJH 1FZOB 1DUYA 3MUGB 3ARVA 3ZKND 1X5LA 3P0VH 1AGFB 1F90H 5FKAA 1AGCB 4XNZB 4TSBH 5HGAA 3EHBC 2EKSB 5EU6D 1KPRB 2BNQD 4LSRH 5FB8B 4J2XA 3MV9A 4XNUL 3VXRE 3M1BB 5BS0D 4JKMA 3BKCL 1HNGA 3RZCC 1P7QA 1ZE3C 4D9LL 5DT1L 5IBTH 1MFCL 3MNVA 3RL1B 2H9GB 2E9BA 4TSCH 1T03H 1E6JH 4KHXL 5FYLH 4ODHH 3RHWF 4O2EB 2NY5L 5TFSH 2GITB 1J0JA 4HFUL 3D3VA 3C9NA 3CH1B 4G9FD 1JZ2A 4UIKL 1MLCB 2D2OA 5F3HA 1QBAA 1MJUL 3SE4A 5E2TL 3S35H 4YHNA 3VG9B 2QSQA 1XGYH 5KVMC 3ARGB 3U0TB 4OM1H 4WFGE 1Q72L 1MFBH 2WWKO 4X6DA 5I8KL 4H0GA 4MJ2A 1QD0A 3VXUA 3DMMA 4PRBB 3TBVA 4GW1A 3QH3B 2C4FU 3VE0B 3TBTB 4JRYE 3UJTL 2D03H 1IILE 3FFCE 3B5GA 4FTVB 1H3UA 2DWEB 1FZMB 4WCYL 3FOLA 1G1YA 1XGQB 1C16B 1UKSA 1AQDA 3MOBL 1OQXA 4GQPH 3KPMB 1IQDA 4R0LA 4I77H 4X4ZA 4AMKH 4TULL 1OAYH 3MUHL 1KXVC 5DD1H 1EGJH 1OD7A 1I1YA 1JI2A 4GXUM 3V6OA 3EJZC 3QCTH 1RI8A 4NJAL 5TDOA 4O2CB 2JJSA 4TUJA 4Y4HB 5IOPA 1U2HA 3FCTA 1RK1A 1YEGH 1BPVA 3UTZA 4GKNB 3BW9B 1OGAD 3PL6B 2F54E 5AZ2H 1EUTA 2E6PA 4WFFE 1DN2A 1CICD 3Q5OA 1NGWB 3R4DA 1LEIB 2UY6A 1CXEA 4XPGH 4NO0B 1NBYA 3V0AC 5CEZL 3VXOB 1NSNH 4UBDC 4IOIB 2AI0H 5KSVB 3DECA 3RDTA 3AS1A 4U2ZA 5IVZB 3S88H 4ISVB 3SE9L 4S1SH 2AJ3B 5CBAB 4X6EB 3MBEA 4OZ4B 4YHPB 4KAQL 3M17A 4NKIH 4XAKD 3UJIH 3VWKC 5CZVH 1T04A 3KPNA 2X4OB 1NMBH 1ZLUK 1XH3A 4H1LB 3UTPD 3WDIA 4MJIE 1UA6H 4OQTA 4IHOA 3SDXF 4MA3B 4WV1B 2HG5B 4HUWA 5DC0A 2NR6D 5EBMA 4Z95L 5LG1A 3ARSA 2GK2A 4OIBA 5DDHA 4JFEB 2OYPA 1CYGA 4NN7B 4OZIF 4JFYB 4JFHD 1EAPB 4M6OH 5H2BB 4OKDA 3RA7H 2R0WH 1OB1A 2EDFA 1I9RH 1FAIL 1A9EA 4FTVE 1CBVH 4Y1AB 3MRKA 3TZVD 2H41A 3QDGA 3TO2A 1NLDH 4G7VL 3QP3A 5DRWB 2XKNA 4FQXA 3V4VL 1U8OA 2EDDA 3RWIA 1CF8H 2VZ1A 3CFKB 1N64L 3CDFA 5HGHB 1MJJB 1HH6A 4JAMB 1CXHA 2XRAH 4L3EA 4NN6B 5E8PB 5IQ9A 4KK6D 4LLUB 4QCIB 1N0LA 4UB0L 5HHVH 1DL7H 2CRMA 1G6RL 2EE6A 1IMHC 1KT2B 2H8PA 4KROD 3EYFB 3MRBA 3VXSD 5I2IA 2DLTA 3TO4C 4NKOB 3REWA 1A7RL 4OCSH 5MEQA 4ZAKC 3VGAC 5DVNA 3C8KB 2IGFL 4LLYA 1OWWA 2VZ3A 3D9AH 4PD4J 1SYSB 4GBXB 1A7NL 4MYWB 3ZDZF 2DM3A 2A74A 3TESA 4M6ML 5DUBA 5F9JA 4NSKA 2FRGP 4DCQB 3V5DB 1RHFA 5DTFB 2YRZA 4O2FB 2FX8L 2AK4D 1H15B 1NJ9A 2XKSA 3CSPA 4RBPH 3AGVA 2VR9A 3HMXL 4YJZL 2YK1L 2P49B 2WV3A 2Q8BH 4Z7QE 4P4KA 2X4UA 1OCWL 3DI3B 1IEBB 2YWZA 4KKCD 5CEYB 2DKSA 3W9EA 4I3SH 1ZTXL 4EZMA 1JGLH 2FEEI 3FT2A 4BSVA 4RISL 4XP1L 2EEBA 1H3VA 4BQBA 2YPVL 3O2WH 3IFOB 4X5WB 5IW6B 1RK0A 1WBXA 3LQAH 4LSVL 4EEEA 1NBQA 4P46A 1RFDH 3C6SB 3HLAB 1RD6A 2DKMA 2CIKB 1KEGH 4U0QB 3E3QE 4NNYB 4OFVA 3FN0L 4WJ5A 4S1DC 3GBML 2BNUB 1NAMA 3TIEA 1GIGH 5ALCL 4D0CA 1KJMA 5EZJB 1F4WH 1ED3B 1AGEB 1WBYB 1YEKL 1DFBH 3BE1H 3QO0B 5LXGH 1DVFB 2F53A 3BH9A 1E6OL 3U7AA 3Q5TA 4RDQF 5HYSG 1R5VA 5DD0H 5JPNB 4LEOB 5FA3B 2ZPKH 3TIDB 1KPUB 5D6CA 3H9SB 4JCMA 1MFEL 5EN2B 3S34H 1KCKA 4LHUD 3PF2A 2HN7A 3NCBB 4S1RL 2ZOLB 4ZNCD 1NDGB 2J88H 2FO4B 4HV8B 2ZUTA 3ARTA 3PQYB 3P4NA 1AGBB 4WW2C 4H88L 5CILH 1F4XL 4I2XB 4ODSL 5DD6A 4GRWH 4OZFA 2X09A 4ONGH 5CP3H 1BBDH 4OD3L 1NCAL 3DWTA 1B88A 4QHUA 4FXGB 2DL2A 1OAQH 5A2JH 1UJTA 1I4FB 1NMCC 3WFHA 1NEUA 4WW2F 5H94B 3KAAA 2VDKL 4PY7B 4GQ9H 1YEIH 3LHPH 2J8UB 4Y2DB 4K94H 1NDMA 3BGFC 3F7QA 4RGMB 1YEDA 2W0PA 5DJAA 3ARPA 5GHWL 4X8XA 5AAMA 5F6IB 2BSRB 1S9KC 4P4RA 2Z4QB 4PJ5B 2NY7H 1J8HD 3RY5A 5EIVA 4CDGC 2AXJA 3DRTB 1FGVL 5DVKA 5B38A 1TLKA 4LLDB 3LEYL 3B9DA 3DHMA 1CGUA 1WC7A 2H3NA 4K3EH 2VMFA 3GKZA 3GMMA 3H0TB 4IMLB 1KJ2B 2A73A 1N4XL 2PO6D 3SKOB 4Y2OA 4XMPL 2NW3A 3MRPB 4WO4A 5DF0A 1A6ZA 4G8GB 3D0LB 3LKRA 4Q7DA 3QR2A 2IH3B 4PJEE 1NC4D 3EFDL 3DO3A 3MXWL 3H9SE 3L9RB 4LSSH 4P57B 3TN0B 4YXHL 3PP3H 4HPYL 5EOTA 3NPZB 2UVEA 5IM7B 3G9VA 1RZIB 4U1LB 2XA8L 1H3WM 3UZVB 5JHDB 4LCIH 3IDMA 3ULUD 3GHBH 1IARB 4I2XE 5DQJB 1OW0A 3GI9L 4JRYA 5DMKB 2NCMA 1JPSL 4DUXA 5C08D 1DBMH 4PS4H 2R9HD 3E6HA 3BZ4A 4L1DA 5F3BB 4NWTH 4ZFOL 3RNKB 4ZXBA 2E7HA 3RQ3A 4ZFFB 1I1AB 1WTGT 2J8UE 3D6GA 3MLTA 4WTXA 3OKOB 1AD0A 4CMMA 3Q3GB 4NRZA 3WIHL 2AJZB 3IFLH 1FYTA 3AB0B 4XC3H 3MTRA 4D9QD 4PJ5E 1D5BB 4L5FH 3BEVB 4YLQT 1DLFH 4GJTB 4TVPD 2D4DA 3CDCA 1FZOA 1P9MA 3P4OA 2F54A 4JKKA 3LSOB 1AGCA 1GZQA 1RU9H 4FMFA 4H8WH 3PXJA 5FB8A 3M1BA 1SHMA 4NCDA 1HXMA 4PJAF 5IIEA 4X99B 4EI5B 4ZS7L 5FUZL 3HUJE 3BWAA 4YX2L 1SEQL 1NLBH 2VN4A 2YA2A 3GSQB 2AABH 1ZA3B 1M7IB 1NKRA 3P40A 4G8GE 1RURH 4R4BB 4PGJA 4KTEH 3C08L 4Z7OF 4FQHA 4OZFG 4UAOC 1OWRM 4NT6B 2GITA 3BYYA 3K4AA 5F88A 3MMEA 2AK1H 5FKPA 3DUUA 3IJYB 4MJIA 4F9LC 1I7ZA 1K2DA 1S3KL 1CICC 2EECA 3V6ZA 5IG7A 2NXZD 2FECL 3BPLB 1XGUB 2HFGL 2CR3A 3IF1B 1UACL 4PLKC 4L29B 4Z8FH 3PJSB 12E8L 4QXGL 4XVSL 3T4YA 5TQ0L 5DJ0B 4OZGF 5FYJD 4R90H 5JHDE 2VB5A 4R4FH 4PRBA 1QFWH 3T0VA 4OV5A 1CGSL 4OLYL 2DWEA 3V95A 4OCLC 5C0RL 1V7ML 2GT9B 5B38G 5B39B 1XGQA 1X6LA 2V7NB 4C57C 3SDCD 2XN9E 3G5YA 1T1YB 1X5GA 4N1EA 4WHTA 5DZOA 4WHYG 2ESVE 2NR6C 4U6VH 5KVDH 1OAKL 2WP3T 1S9VA 1JGVH 3C5ZD 3LZFH 4JFDB 4PJHB 3OHXB 2HVKB 4EI6A 1UT9A 2DQTL 1O7SA 4OSUL 4F7MA 5TJWK 1BD2B 3CMGA 1P6AB 4Y4HA 1OP3H 3HNSH 3O6MH 1T7YA 4S2SA 1A1NB 2ENSA 1I9JL 3QIUD 3TZVC 2V2WB 4JQIH 5F6HI 5FO9A 1ROWA 3QPQD 3OPZH 5DRNA 2MPAH 5HHOD 4HDIB 2OK0L 3VGGA 1KCSL 3EDFA 4NQCB 3K1KC 2R4SL 2N7BA 2D31B 2FCBA 1UZ8A 4IOIA 4KK6C 1KN4L 4JFPB 1H5BC 4UTAL 3W5NA 3CDYA 4ISVA 4Z7WB 3G6JB 4CBPA 1JVKA 1CDGA 4KDWA 1EO8H 4KROC 4OZ4A 3L5XH 3MZGB 4U6YB 1MREH 3E0GA 2X4OA 4Z7UA 5I76B 1QBBA 3C6LA 4Q6YA 1SY6L 5GIRB 3WBDA 4LVOB 3RU8H 1CU4L 5DS8B 4X5XB 4KKLD 3BIKB 2A0LD 2UZXB 1ZLVK 4YEFA 3LKPA 3R0NA 1Y18A 5DYOA 5I1KH 4FXKB 3V4UH 3VG9C 4AJ0A 2B2XH 2LU3A 3ARGC 3IAQA 2X70A 2Y07H 1NCUA 1EAPA 3MJ7A 2BZDA 5H2BA 3QFDB 4MNGB 4P3CH 3P0YH 4YO0B 2Z8RA 4LASL 2Y9RT 1WCQA 3WIIL 3QXAA 2QQLL 3QAZB 4GLRI 1A3LH 2EIZB 3LRSB 4W68A 5DJDA 4BFIB 1QFOA 5B8CA 3KWWB 2VQTA 4I3GA 4KKCC 5FA4B 5LAXB 3OKKA 2AV7A 4EQ2A 5EU5B 2PYFA 5F21B 1KTDA 4MA8H 3OB0H 5FYJU 4ZUTA 1BIIB 4LVNC 2ARJA 4O9HL 4OF3A 1FG2A 4PJCF 3CSYB 1JZ8A 1T5XB 1EXUB 4CU6A 1B6UA 1HNFA 2N7AA 4M93B 1CG9B 1LO3H 2F58H 4MA7L 3T0EB 1OAZL 2OS7A 4C4KT 2X1XR 1QBLL 3WLWD 4OLEA 3PHQA 1D6VH 3K0WA 1I3GL 2Q3AA 7FABH 3RWFB 1MCEA 2BRRH 2R0KL 4NQCE 4XCFH 4A6YH 4HBQA 3ABZA 4LNVA 5DWUL 3DV4B 4YHKL 5TE4H 3W0WD 5DQ9B 2BOBB 1BAFL 3QWOA 3M8OL 4JKLA 2RCSH 4Z7WE 1ZVHA 4KV5E 4YBLB 2ZWLT 3G6JE 1CDUA 1W0WA 5GZNC 4O2FA 3K4ZA 2FIKA 1TVBB 4G6KH 4PGDB 4X5LA 5AUMB 4LF3B 2FH6A 2H32B 1J8KA 3ZSTA 1IFHH 2NXYB 3MNZB 4XPFH 2P5EE 3QXDA 5KSBF 4LKCB 1HHJA 1FIEA 4F3FB 4KZEL 5I0ZA 3G9AB 1MWAB 3QUXD 5DEGA 1TJHH 3OBAA 4QRRB 5D2NC 1KACB 1F3JB 3T08A 2A83A 4HJGA 4PRDB 4NN7C 1P7HL 3CGTA 2PYEB 4QOKD 3HLAA 2CIKA 1SYVA 1DP0A 5K9KB 2BC4A 3T3ME 3QCVH 3ZT6A 4AIXA 4NNYA 5E2WH 1V7NL 4ZG1A 4NFBA 4JREB 4LKXA 1AP2B 3LRHA 1ED3A 4MXQC 1AGEA 1WBYA 2VZTA 4L8CA 4IM8A 3GNML 3QO0A 4F33A 2NX5D 1BBJA 3QT2A 4PJEA 3GMPA 2UY7A 1CFTB 1G7LB 3EJJX 1OSPL 1G7IA 4KQ4L 1I1FA 1GGUA 4NYLB 5L2KB 1BF8A 3HB3D 1U8IA 1CCZA 4LK4A 5BW7C 3T0EE 5C0FB 5AD0B 3GIZL 3KLHD 4OCMC 5EULV 1HQRB 2ZOLA 5KANG 1NDGA 2FO4A 4HQQL 4H1LG 2CLZB 4HV8A 1U92B 1DANU 3R1GH 4LQFH 4WW1B 4ZQKB 1AGBA 4XB8A 5EU7C 4WWKA 3RY4A 3MFFB 2O5YL 5TE6H 4I2XA 4PRNA 4BFBD 1MSPA 1U8HA 5I8OH 5LWYL 1HEZB 3S36H 2IMMA 1PKQB 3HRZA 1N26A 5HHNA 4U1GB 4KWUA 3WIFA 4HT1H 4KK8D 5H94A 5D1ZD 5DJZA 4XBGB 4KVNL 4XGZA 4XVJH 5GS0D 4OB5L 3KLAB 5C2BH 1VCAA 3W9DB 4KTDL 1U3YA 3FHAA 3ROOA 2J7LA 1RZKH 4M7LH 5KAQG 4HKZB 3MRHB 5JDSA 1S7RA 3TLRA 4PJ5A 4GW5A 5A2KH 4QRRE 1LO0H 2R9HC 4EIGB 1B3JA 5CWSB 3T77B 4ZYKB 4LLDA 1S9WB 5D9SB 5ESAA 3ULUF 3HG1E 1K4DA 5IHLB 1J0YA 5FCUH 2PYEE 5CSGA 1X7QA 4IMLA 2IQAA 1GPOH 4LSUH 5IW1B 1OAXL 2IJ0C 3L6FB 5CJXA 1BFSA 5IJKA 3RBGA 2N1KA 4YNYB 4G42B 1XT5A 5T3XH 3HUJA 1K5NA 5GRJL 3MRPA 3FKUS 4G8GA 2DIBA 3EDKA 1XGRA 1BQLH 1L6ZA 1WIUA 5T5NF 1DBBH 4PRPD 2A77L 1X5XA 4JFQB 1PQZA 1DVFC 4Y5XC 3LN9A 3CK0L 4G43A 3L9RA 5T1LB 1N3NA 3BZFB 3FQRA 2GJZB 1FDLL 2CKBB 3AMKA 2WANA 4X4ME 3U1SL 2VKXA 4KJYB 1LO4L 5IM7A 1RZIA 4U1LA 2P8LA 5BZDA 4HKXB 4QRTA 5JHDA 3LEVL 5F8RC 2P43B 4YIQB 3CVHH 4LNRB 3H3BC 2G9HA 4RMUA 4KHTL 3VFOB 5C0JB 2OP4H 3GZKA 4TOYH 5I18L 3QEQA 4GAYA 1PKQE 4HH9B 1YNKH 4KK5C 2BDNH 2G5RA 5E5MA 1WZKA 4DZ8A 1CFQA 2XN9A 1XIWD 2NXZC 3RNKA 3DIFB 4MMZC 3S8WA 3QPXH 1NFIA 2ESVA 2AXHA 2NY0B 5GS1C 5KG9B 3RY6C 2VAAB 4JDZB 1FSKB 4W70A 1Q0XH 2GTWA 4PV8B 2XFXB 5GGTA 5BO1H 4ELKB 2XA3A 4MD4A 1U95A 3Q5YA 1M4KA 2GW5A 4AENB 3QQ9D 1P7QD 3LD8C 5D72L 3KPRA 2W9LA 2R0ZH 1DBJH 4L1HA 5FK9A 3KDMB 4OLWH 2JF1A 3SDCC 4JO4H 4OFIA 4B5EA 4YZFF 4EUPH 3D3VD 4PP2A 5I6XC 5C0DA 3HHRB 4ODVL 3OXRB 3F58L 5KVFL 2EYTA 3UYRH 1BJ1J 4S0TD 1Q9OB 2XWBB 1XR9B 3GSQA 3KJ4B 2C1PA 4R4BA 1H8OA 4PJBB 3WKNA 1QSFB 5GGRY 2ZUQB 3L3DB 3QIUC 1CGVA 3MLRL 3VXUD 4MXWH 3DMMD 2H1PL 3CMOH 3IJYA 3GKWL 1I75A 2X4TA 3W2DL 3OZ9L 3E6FB 4ZTOH 3WV0A 4XWGL 3QRFM 1LD9B 4HIIB 1A3RH 4ZDHA 4AT6B 4L29A 4HS6B 3PJSA 2VDOL 4MCZB 5HHXH 3TT3H 3NPSB 1BFVL 3ARBA 1WITA 3IFPB 1S7WA 5B3JE 5E00B 5MI0B 2B0SH 1IGMH 1IM9B 4F7CA 1HDMB 1CXFA 2KZ1B 3WN5B 4FQQA 3VXMB 1EAJA 1R3HB 4M62L 5B39A 2V7NA 3T3PF 1RIUL 3FB6B 4QRSA 4U7MA 3MGOB 2ZCHL 4MWFA 2EYRA 2OSLA 3GFUA 4KKLC 4HLZH 4DQOH 1EEYB 4KRPB 4KPHH 2WNGA 4GXVL 1A6UL 3IDNB 2F15A 2YRPA 2NZ9D 3OHXA 1OARH 5CP7B 2CDFB 1VEPA 5DJXB 4LPWA 3JVGC 3E8UL 3QUMA 5E2VH 5I15H 1HK6A 1R6VA 3O2VL 4OF8A 2M2DA 2V5RA 5T5FH 3VGHA 4CADA 3GSWB 3LQZB 2HKFL 5EUOF 1T7VA 2Q76B 1UB5A 3MBED 4X8JB 3V5KB 4HUKB 4LAQH 3FL7A 2B5IC 3IETB 1K8IB 2VLMD 3AS0A 5D7IE 4CVUA 2ARJQ 3ZE1F 2ARWA 3GJFH 3QEGL 1V05A 1PKOA 2BY3A 2CK0H 4NHUB 2F8XC 4HK0B 2FB4H 3ESUF 1N59B 1DDHB 1UADC 4EI5C 3B6SB 3JUYA 4PJBE 3OR7A 4KQ3H 1ORQB 4PJIE 1UM5H 3GMNB 3WLWC 4NBZB 3ULUL 1FE8H 1XCTB 4U1NB 4MDJA 4XNXH 3K2UL 4N9GB 4DVRH 4D0BB 3O4OC 1T0PB 2P5EA 3MRIB 1BZ9B 3O6FB 2ITDB 3QDGD 4BQ8A 3ZKXB 2QEJA 3LMJL 4ZTPL 5HHPB 4NJ9L 5C07B 3VRIB 1NFDF 4M5YL 4TPRH 2R4RL 3GI8L 1M7XA 3QFDA 5HDBE 3SN6N 3LB6D 4L3ED 2VQUA 5FO7B 1WCBA 1A0QL 1MJ8H 5EZOL 1VFBB 3O45A 5C0CE 2YD1A 3KWWA 4WUKH 4HS3A 5E8OA 4TN9A 1V5JA 5DD3H 1IKFL 2QQQA 3OXSB 4TVPL 1BX2B 3WXWH 1CLOL 2BSED 1EHXA 3QUXC 2YXFA 1K8DB 4XWOD 2J6EH 2ZKHH 3EOAA 4JPWL 4E41B 4LLVA 1ND0B 5L88L 1VPOL 1JNHB 1T5XA 4H0IA 4MA1B 3QNYB 3T2OA 3JTSB 2UWEE 1WK0A 3NCJL 3ECBB 1JYXA 2DQHH 3IDGB 4I3RL 3T0DA 5C3TA 3U9UB 3P9MA 3DYMA 5BOZG 2WZPD 1U91A 2APVA 4DFHA 4ZPVA 2HA1A 4XPAL 4ZUVA 1T7WA 4L8SC 2C7UA 3OSKA 2FNBA 4XNUH 5DJ2A 4P4KD 3N85L 1Y6NR 3BKCH 2F8VA 2BOBA 2HT4D 2W0FB 2IPTL 3CFCH 2FR4B 4ORZC 3HZVA 2B4CC 3QG6B 2MCPL 3MYJA 3HE7B 4KHXH 3GMRB 3FO1A 2MWCA 3KLHC 4HFUH 5AUMA 5FYJL 4LF3A 3RZWA 1C5BL 1AH1A 4OF5A 1FFOA 2H32A 2WQ8A 2O5ZL 3O4LB 1AKJA 4X6CF 3X17A 1YYLL 1OSZB 4P46D 5B39G 1HE7A 1MJUH 3PWUA 5E2TH 4QNPF 3IDIB 1PSKL 4F3FA 1A14H 3B8YA 1N0XL 2XOTA 4LBEB 5C07E 5LGHL 1NAKH 4I0PB 3ULSA 5GRVL 1F3JA 5I8KH 4G8FA 2LTQC 4PRDA 5FYLE 2VXUL 2F53D 3HG1A 5D1ZC 2AEPL 2PYEA 3HZYB 5IFAH 5JW4N 5GS0C 1Z9LA 3MRGA 3RWCB 5KVEL 4WCYH 1KTKE 1JHKH 5I74C 5BXFB 5AWNL 1KELL 4LCCB 2E7CA 2ADIB 4BKLA 3L5JA 5D4QA 1UWXH 4K55A 4JY4B 4TULH 1JYVA 4M7KL 1U36A 1A1MB 3KPTA 4YHYC 3SGJC 4JHWL 4WNQA 1QVOA 4NJAH 6CGTA 1GHFL 1S7QB 5C0FA 2P8MB 4X4MA 1AFVL 2ZSWB 4M93C 5CINH 1A1OB 3WFCH 4KRNA 2MKLC 5DQDL 4QT5B 4ZQKA 3HI6L 1GOFA 4LRNL 4LSQH 4N9OB 3RKDD 5INDB 4JHAH 1WWWX 4LDOB 4PJ7F 3P30L 4FN0A 5E03A 4LPTA 1JF6A 5J8OA 4DEPB 1D5MB 4HIJB 4YDVB 4QHNB 4RBPK 3SE9H 1WZMA 2EDKA 5JIPA 3SPVB 2C9AA 3HC0A 2YXMA 4P3DA 3Q48A 2ICES 3L3JA 1RMFH 4YBLC 4LCUB 3NIGF 1N2RB 1CFVL 5HYQB 3O4LE 4XH2A 2H6PB 3W9DA 3ILPB 2MHAA 5CD3B 2R0LH 3KNBB 1CGWA 5DRXA 1LK2B 2HFTA 4HKZA 5J1AB 1MCOL 5KS9F 3UC0H 1FJ1A 3EOBA 3MRHA 2ADJB 2OMBA 4X4YA 3D2UB 3QI9A 4RWYL 4WO4D 4TNWF 5CWSA 2OR9L 1S9WA 2YA0A 1XIWC 4J6RL 2NY4B 1U41A 3NN8A 3NTCL 1I8KB 5TF1L 4ODTL 3WSQL 4Z76A 3RVXD 2KBGA 5FGSA 4KKAD 4NQEA 3O11B 2WMPA 5I9QC 3V4VH 1ZHLB 1FGNL 1PEZA 3MRJB 4QF1A 5HI3D 2K7PA 2EXWC 3PGDA 1MVFA 5TE7L 3QQ9C 3QFJB 2FL5B 1IAKB 2VAJA 2Q6WA 3FFDB 4UB0H 3SDDA 1P69B 4JRYD 3TA3B 2MQCA 3QEHB 3BZFA 1QSZA 5C70A 2F5AL 3WJLC 3VXTA 4PRID 2CO6B 4KJYA 2FIRT 1OTSD 3SE4C 2IANB 2C1OA 4S0SD 4J3OC 4JFOB 1EFXA 4PGZA 2D7MA 2V6HA 1ORSA 3V52L 5I1JL 2BVQA 4FFWD 1BZ7A 2XACC 1FYTD 5FYKU 5JORB 4WRLA 4XP6L 2EDYA 3DIFA 2FX8H 3FQTB 4P3WA 5JLZB 4U1GC 5JR1H 1QRNB 4KRMB 4X6DF 2F54D 2I25N 4PB0H 4IRZL 4JDZA 2CH8A 4NFDA 3OGCB 1W8NA 1OCWH 1V3MA 5A1AA 4ELKA 3DTXB 4R0LC 4GRWB 3WD5H 3WFDL 3V9FA 2VH5L 3V6OC 3WYRA 3SOBL 5FHBL 2YPVH 3KDMA 3EO1B 4LSVH 1G7HA 3FOMB 5GGVH 4GKZB 5D7IA 1LNUB 4U05A 4UOJA 5ERWB 2BERA 4MJID 2ZCLL 3OXRA 4NBYB 5TF0A 3BSZL 4KMTH 4U1JB 3MSPA 4IMKA 3PIQA 3VGBA 5ALCH 4M48L 2DM7A 1ZVSA 1FP5A 4LLAA 4PJBA 4G80B 1ZHNB 4Y16C 2Y72A 3IU3B 2I9LA 2PKDA 4PJIA 3VFWB 2X6MA 1AXIB 1LP9E 1ACYL 3VJ6A 2IAMA 3PP3K 1KCUL 2A6IA 2D0HA 4O5LL 4XC1L 2AV1B 2Y1VA 1MFEH 1LD9A 1UXWA 4HIIA 4AT6A 1HSAA 4HS6A 3PWLB 3ARYA 3QNXA 1S8DB 1IC5H 1BVLB 4RFOL 3TYGL 5IBLD 1F6AA 3QXUA 3NACH 4PREB 3IVKB 1C5CL 5B4MD 4H88H 3VH8B 1KB9K 5GS0L 3MQIA 5SWZB 5E00A 1F4XH 4LSTH 3D0VA 4ODSH 1IE5A 1FFQA 1IM9A 4M7LT 1NCAH 1EDQA 2RAMA 5C0CA 1R3HA 1U8LA 4Y4HD 1KFAH 4ZPTB 3BQUA 4G8IA 3D39B 2DQUL 1QRNE 3TWCH 1KYOK 1VGEH 5C6PB 5J6GB 2Z8SA 1VA9A 2CDFA 5GHWH 1A47A 3LB6C 4GRWE 1R3LA 4LSPL 3SKUD 2UWEA 3MV11 2JCCB 1FGVH 3MO1B 4JY6A 4ONOA 4F7TA 3GSWA 4WFHD 4ETQA 3V5KA 4X8JA 1Q1JL 4RFNC 4X9FA 4RAUB 2CLRB 1JF1A 3G5ZB 1MF2H 3IETA 2Z92B 3MJ9H 1LVEA 5IFJA 2R8SH 3C6LD 2XZAL 1SM3L 3CFDB 4Z18A 3OKMA 3B6SA 3BZDA 4GG6B 3B9KA 5D96B 5IJVB 2H2PD 2OTPA 2HLFC 4Z7NE 1F4HA 1VGKA 3ET9F 1JTTA 4NFCA 4KUZH 3MRQA 1T22B 3EFDH 4ODXB 3LN4A 4KRLB 2O5XL 2A1WL 1L7TH 5J12C 3MRIA 3T2PA 1UZ6E 4YXHH 1KLGB 5CIPH 3S6CA 1B0RB 4HPYH 1DQDL 4HIHA 3CFBA 2HT4C 5JA9A 2XA8H 1QEWA 3DRQB 1UH2A 4BK4A 5FV1L 2E3VA 1VACB 4CVXB 4P5TA 2DWDB 2FBOJ 5SWZE 2DB8A 4HHAA 4MHHG 3GI9H 4JM4L 1EUUA 4X7SL 1GOGA 2NY2D 5DJCB 3TYFA 5MI0C 3MV8A 3IDJB 4N0UB 2DLGA 1X9QA 4MB3A 4MD0B 1CE6B 1ETZA 4P46C 3SE8L 1FC2D 4NZDA 4YFDB 3W82A 2N56A 1UM4L 4F8QA 3SHSA 1ZS8A 1XGTB 5E99L 3AROA 3H2WA 3ZDXE 1OLZA 2W9DL 4AIZB 4KRPC 1ND0A 5IQ7L 3BDBA 1Q38A 4V2CB 1P7KB 2RGSA 3QUYA 2D9QB 1F45A 1XFPA 4ELME 3JTSA 1PAMA 3MUY1 2JCCE 1DEEB 2W60B 3D85D 4NDMB 3BPOC 6FABH 5F6HJ 1X5IA 4JDVB 4KGLA 5GGVY 1A22B 5FFLA 4WTZA 3VFTB 2VYRE 1P4BL 1NGQH 1ZLWH 1CD1A 5CCKH 3BJLA 3FQUA 4L9LA 4ZS7H 1EGJA 5FUZH 3MROB 1U0QA 2OBGA 4Z0BL 2GSIB 2BJML 4NKMA 1IC1A 5ECJE 4XPHH 4GG6E 2AGJH 1HOCB 5I30L 2BVYA 3K8MA 3D25B 3HE7A 4IRJA 1QLFB 3HN3A 4Z7VF 2VXVL 4Q97A 3CU7A 3LPWA 4DUWA 3VD9A 2VWEE 5GRYA 2QQKH 1GGCL 3RVTC 4UNTA 4P9HC 2NMSA 3IDIA 3CD4A 3KYKL 5J6HA 1UACH 1NUGA 2WIIA 12E8H 3V0VB 4QXGH 3DX8B 4GKSB 5IK3B 3IXAB 5CJQL 5GPRA 3ZKXC 4JFFB 1HHGB 4WWID 2VDLL 1FL5B 5K59E 2FHCA 3QHFL 2WBJA 1F58H 1CGSH 3L7FA 4QRQB 3U79A 4NKDB 5MHSD 4OLYH 3QNZB 4DKEL 4BYHA 1AQKL 4N0UE 3RWCA 4OD2B 4XXCA 5ICYB 1AXSA 4I18B 3OB0K 5BXFA 1YDPB 5J9PA 3C60B 2WLZA 1DCLA 3EJYD 1D3CA 3D18A 3FTGB 2GCYB 2OTWB 3VWJB 1S9YA 1G9EA 1A1MA 5F9OL 4WWKD 2H45A 2WLYA 5DVMA 1JV5B 4OSUH 3SGEH 1DQQB 2P5WB 4OQTL 3UBXB 5T3ZD 1YMHA 2IFFL 3IB4A 4CW1B 2P8MA 2OR8A 1I9JH 4MA1C 3KS0J 3QB7C 1FNEA 4JFXB 5BRZB 2B20A 1RSFA 1II4E 2OK0H 3BP4A 3BAEH 3I85A 3PWPA 4AEIL 4Q9CA 5HI3C 1F13A 2IWGA 3DUSB 4LU5H 3NFNB 4P9ML 4JZOB 3VG0L 1KN4H 2C3WA 4YDVA 2VTFA 4QHKI 4M4RA 2ICEB 3UPRB 5DA0B 4PJ5D 1FFNB 5HYJB 4N0CC 2ZSVB 3SPVA 4OUUB 4OZHE 4DOHE 4PG9A 3T8XA 4AEEA 5I1HL 5JOFA 4FHBD 5JIHA 1QR4A 1OTSC 4JO2L 3QHZL 1RJZB 3GBNH 4DFIA 1S7XA 3TGXA 5CD3A 5IESH 4A6YB 3F12A 3HAEH 2EH8L 4JANA 3I6LE 4C83B 5INCA 1GGBL 1B6DA 4JFFE 2ZJSH 2ICCA 3DYPA 1QUNA 4G8GD 1T1ZB 3THML 3W39A 1UVQB 4LASH 3TJHC 2GIYA 3AREA 4MSWB 1IGJA<