5ISZE

Crystal structure of ls01-tcr/m1-hla-a*02 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
241
structure length
241
Chain Sequence
IGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAAGYSVSREKKESFPLTVTSAQKNPTAFYLCASSIFGQREQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8(+) T cell epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 57
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2016-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iszE02
2ADJB 3AMKA 1I1FB 4R90L 4TNWK 4HIIA 1PZ5B 3WFEH 2O5ZH 4DKEL 1IKNA 1IEBB 1NMBH 3KYMB 1D5ZB 1WAAF 3CFCL 4NJAL 3RDTB 1P7HL 2GJ6B 3TNNA 5IWLC 2WIIA 2ZPKL 4MJIA 3RKPA 5I0ZA 5L6YL 4JGMA 3X17A 2NX5A 2UWEB 3QDAA 4HUWB 3IDNA 1XGUB 2Y23A 2QJDA 2DKUA 1RZFH 5D1XD 2CDEB 2GUOA 3MXVL 3OKKA 5KSUB 1JNHA 4X9HA 1JK8B 4PUBL 3UJTL 4HFUH 1C5DA 1L0YA 2ITDA 3V7AG 3U82B 5EULV 3V2AR 5CLTA 3CPLA 1IGML 2JCCA 3EYVA 4OLEA 3RL1A 1CDBA 5KW9L 2IMMA 5AWNL 1R3JB 3L3HA 1U92A 2CRIA 4TSBL 2V7NA 4X4YA 3BH9A 3DGGB 3BKJH 4MJ5A 1JHKH 4OM1L 4G3YL 4XTRC 1CIDA 1NFIB 2XWBA 1CT8A 4JPKH 5HVHB 3V0WH 1FC2D 3LN4B 2D03H 3SDXF 1QFPA 5I18H 1KEMH 4P5TB 3RZCC 3LSOA 4ELKA 3B9KD 2IJ0C 1WJ3A 1ZV5A 4P57B 5E4EC 3I6LD 3SE8H 3DROB 2AGJL 4JFDD 1N7ML 4PRIA 3CVHB 1MFEL 2OL3H 2YPVL 3IXAB 1ZVYA 4U1JA 1WFUA 2VITA 3C6LB 1IC5H 1FL3A 1LD9A 2W0LA 2EICA 3DRTB 4NHCL 5C7XL 5D7LD 3VFPA 5DVOA 1R5WB 3MRRB 4WO4B 1DLHA 1WICA 3KPTA 5IVOA 2Q8AL 5HYSG 1QLFA 3IETA 4J7RA 1GJIA 5I1JL 5EN2B 4RGNC 5EC1A 4LKXA 3SCMA 3A6CH 4Z7WB 2VQTA 4L3EB 5CAYB 2IPKB 2R0KH 1DN0A 1KIUA 3P3YA 4YK4C 2ATKA 5ICXA 1MCJA 5LBSL 1B0RB 4Z8FH 3JWOL 4LNRA 4XPGH 4YBQC 3S97C 5DMYA 3QO0B 4KFZC 1QG3A 2YN3A 1UEYA 4KTEL 1YEEH 1SEBB 3ME0A 4OZHE 4PP1D 1OARL 4EQ3A 5ID0A 3N1QC 5D6CB 4MQTB 1NAKL 5C9JA 1PYWB 4R2GB 1OSZB 4YHYB 4FTVD 3MA9L 1M4KA 1RULH 4H25A 4J6RH 2YPLA 1NC4B 2AEQL 5FDWA 4K94L 4S0SD 4WI8A 4YIQA 2H2PD 1IM9A 5CJXA 1LMKA 4M62H 3PP3K 5ACLA 4HPYL 5GHWH 3B43A 1R3HA 4OQTA 4P2OA 5F8RC 3PP4H 5EA0L 3MUZ1 3QA3B 1KELL 1F4YL 5GRZA 2Y9RT 3EOAA 1N6VA 1TJGL 4PJHF 5TDNA 5ISZE 3L3IA 2Q3ZA 1RZJH 5I1KH 5EU7E 3RKDD 1I8MB 1AQKH 2IGFH 1UCBL 4WI3A 3OBAA 4MCZA 3F7YB 5I2IB 5GZOD 2QKIB 3U4BL 4ZOBA 4XHJD 3CUPB 3DO3A 4Y4FB 3VFGH 2XG5A 4NKOB 4XPFL 3RZCD 3NTCH 3NCCB 4XXCC 5DD5L 4IMLB 5GSRB 4HUKB 1GSMA 3GO1H 4N8VG 4WUKH 3SDAC 4YWGL 2OXHA 4I77H 4B0MM 2FCBA 4XP1L 1AJ7L 1MJUH 1S5IL 3QJFB 2E9BA 2UYLB 3QDGB 4A6YB 4JDZA 3W0WB 1CYGA 3ESUF 4KPHL 2C7UA 3TBWA 1WLHA 3BEVB 2H26B 1ZHKA 4E41B 5C1MB 3WFHB 1IKFL 5SWSA 4FFVD 3P4NB 4JFYB 3ZKXC 1AXSB 2X4OA 3P73A 3MODL 1QRNA 4QY8B 3B2VL 2NY1B 3EJJX 3D2UB 1P4BL 4N1CA 3GSUB 5GGTL 3ZT7A 1LP9F 4QNPE 3BKYH 4DEPC 5ACMA 1G0DA 3NFSH 3V6OC 5DQJA 3MOBL 1LEKA 1U8KA 4FABL 4P23A 4EI5C 3T8XB 4YBLB 2D9CA 3KHQA 5E8EB 4EI6B 1KCRL 2AJUL 5L2JB 3ET9F 4ODSH 2X4TB 5J11B 1KJ2H 4MMZC 2HG5B 1FJ1A 2XPGA 3FTGA 4M03A 3AB0B 4Q6IB 1FH5H 3MNZB 4G8EA 3UO1H 3HI5L 2X41A 3QWRA 2XFXB 3P9WB 4DN3H 2H32B 5EOCL 3KGRA 3G9VA 3MO1B 3VRLF 4U3XA 2CDFB 2QR0A 4C56E 2G9HB 4Z76A 4GBXC 32C2A 5INCB 4M6OL 1BP3B 3MROA 4GG6E 1Q9LB 5ISZB 2A77H 1KLGB 4LQFL 5T1KD 4PJAF 5FYJH 3ARFA 4NHUA 2WIMA 3OKDB 3OGCA 5FUCE 1BZ7B 2ZUWA 3GIVA 5E2VH 5F1IB 1Y6KR 5EZIH 1IFHH 2EYRA 3B9DA 2VXTL 4CU8A 4UIMA 2F54E 4F2MB 1IGTA 2LAGB 1Q1JH 5DD1L 1MWAL 1S9YB 2ESVE 3VG9C 1XR9A 1RD6A 1LO2L 3LKQA 4P23D 1KG0A 5E5RB 1CL7H 2A9NH 1QNZH 1YUHB 2BP3A 2FB4L 3AAZB 1IAII 3OKMB 4ZFGH 4KXZH 5C8JA 4XH2A 2VOTA 2OBGA 2V9QA 3RY5A 5A3ID 1T89C 1IMHC 1A8JH 1QLEL 3QUXD 2ITDB 3QEUA 1ZMYA 2A1WH 3MV7B 1S7VA 3MO1A 4PFEA 2GK0B 5E99L 1XF3B 3HKFA 1HH6B 3VMOA 3STZB 1QO3B 3DROA 2P44B 4XRCB 4AG4H 1JE6A 2GK2A 3R06B 4NRZA 1OPGH 3KLAB 3BKCL 1DUZA 2AKRB 5IIEB 3Q2CA 2BSRB 2FGWL 2CKBB 5KVGL 3UTZB 2A73B 1QFHA 3IGAA 4JKKA 4YXKL 1U8LA 3OTTA 3OZ9L 5J56B 4J3SA 2IAND 12E8H 1XGQA 4QGYA 4KK8C 1IGJA 5J11C 4M48L 1ZE3C 5SWZE 2FX8L 2BMKB 1GGCH 1DQML 3IS0X 5BO1L 3H2WA 4HS8H 5JUEH 1Z3GL 3ZTNL 3SKJH 2FLBT 3IB4A 2YKLH 1KG0B 3DUSA 4X8XA 3IDIB 3WUWG 1NBZB 3F5WA 1W72B 3QPQC 4RMTA 4AQ1B 4KHTH 4OLXH 2IFGA 5DMIH 5CP7A 4HZLA 3Q48A 4X9GA 2ZOLA 5C0FB 5KTEH 1WZLA 2PCPB 3SE9L 4KUCD 3PDOB 4KK6D 1MCWW 1KCSL 1MFNA 2GJ6A 3I6GB 4HXBH 1C5BH 3QUMB 2YBRA 2DLGA 4GO6B 1HHGB 4NRYB 4HIXL 4CADB 3G5XA 5TPWH 3NZ8A 4X80H 4LCYB 5E1AA 4JGUA 4WEBL 5ADPH 4RGND 3OX8A 1S7XA 3CD4A 1T7XA 3RWDB 4W4OC 2B39A 1TVHA 4G6AD 1AP2A 1NCAH 1V8HA 4KGLA 2HJFA 4P9HH 5L2KA 4F57L 3HLAB 4OGYL 1E28A 1NCDH 4MA7L 5HYJB 2YBRB 1ADQA 2X1PA 1NEZB 1JGDA 4YE4H 2NY2D 2GQHA 3ROOB 3GJEB 4ZNCD 1CQYA 5C0RL 4ZUVB 2FATL 4MZ2A 2HKFH 1HNFA 1V7ML 1ZWIB 5EZJB 3NIGF 1KB9J 3O6LH 1MCWM 4CNIA 5MERB 1U8MA 3DX6A 4XNZB 5D7IE 1U93A 4OIIL 3T0XA 5GJSL 1O7VA 3CJJA 3RTQA 4AH2A 4LSVL 1G7MA 2K3TA 4QRUB 4XWOD 5EZIL 2I9TA 3NABH 5MI0C 3IXTB 2WWMC 3HNVH 3PL6A 3BN9C 3KNBB 3P0GB 3RA7L 4GOSA 4Y4HA 2ESVD 4XNQB 3TBVA 5IHUL 3U0WH 5DO2C 3SDDD 3OJDA 5HHPB 4WFHE 5DJ6A 5E5UB 2F54D 1HSBA 3GJFH 1BD2E 3BJ91 4HWZA 1I3RB 4ELME 2ERJC 1NCCH 4U6VL 3MLUH 5H37H 1SYSA 1IGYA 1Q38A 3GMPA 4Z0XB 4L3EA 2JKXA 4XZUA 2NXYC 1L7TL 4IS6A 5B22A 3NFPA 3O6ML 1XCQB 2F53D 4RGNB 3GSWA 5DRWB 4LHJB 5DUPH 5IMMA 4GXVL 5T1MB 1WC7A 2IPTH 4HLZH 3B4NA 1WFNA 1MIMH 1MJ8H 1RIHH 2NY5L 4G6KL 3QG6B 1BD2D 4O5LH 2F74A 3S6CA 3M1BA 1P6FA 3GO1L 3AS3A 5K9OB 2WLYA 4ODXB 1I7UB 5FCSH 1G7LA 5DD5H 5B4MC 4ONGH 3RFZC 1SY6H 1A1OB 4OLVH 5I9QB 2OK0L 1A6AB 3FL7A 4M61B 2OQJA 1KF9B 1KYOK 2GSGB 3DVGA 4PRHD 5CSBA 5DEFB 2A0LC 3U9PH 1WGOA 5J57B 1E4JA 1XCQA 2A6JA 4WNQA 5E2WH 2D9QB 1Q0YL 1YDPB 5F21B 5IROC 4M62L 4PTTA 2DQDH 1XF5A 2IGFL 3PJSB 5DUMH 3QCTH 2XA8L 4LSRL 3IFOB 2A9NL 3TH3T 4BZYA 4CNIB 3RUGE 4GRMA 4UBDD 3O3EA 3WO4B 1OD9A 2W9EH 1CE1L 5GXBB 2AJ3B 1FLRH 1UH4A 3UTSE 1C1EL 4Y5VB 4GW1B 3LIZL 1CDIA 4DVRH 4EOWL 3P0VL 3K4DA 3Q3GA 4YXLL 4AIXA 4WFFD 3V8CA 3STBA 4J4PD 4U6HA 5HYJE 1MFCH 4Q0XH 5ANMA 4JLRA 1X3DA 4JDVA 3UBXB 2OTUA 4HWZB 2IPKA 3S9DB 1TNNA 1ZLWK 3PGDA 4FFZH 4GKSA 4KTDL 3MCLL 3VWJD 4XPFH 4YWGH 5FYLH 5DJCB 5GS0L 4OCRH 4DGVH 3BRDA 4XZUB 4QHLB 2F8OA 4UQ2A 4GBXD 5GGRB 4M61A 3HC3L 3TPUB 4XVTL 1UXSA 2AXGA 1XF2A 2RIKA 4Z0BH 4IIQB 4PJHB 5DC0A 1MFBH 3N85L 4AM0A 4R4NC 5E8PB 5L2JA 2J6EL 4KVCH 1WZ1H 1CGTA 2CXGA 1AXTL 4PJ9A 3NH7L 2IH3A 2X1QA 3D9AL 4PRHA 3TCLB 4PG9B 2GAZB 4IHOB 3PHQB 1CTNA 1JF6A 3E2HB 1KLFA 4NQDA 1W72A 1ZS8B 3TIDA 2NZ9C 4XNUL 1KJVB 4YPJA 4EI5A 1XIWD 3MOBH 4F7MA 2CKBL 5JR1L 1AGDA 4JKPH 4I0PA 4PJIA 5DJYA 5IK3A 3EGSB 1P84K 1U3HB 1KTRL 2EECA 2AK4B 3VWKD 3CCHA 3B9EA 1T3FB 4F7PA 1BQSA 5MENE 2BHYA 3MFFB 3VFTB 2L7JA 3AU1A 4LCYA 5E1AB 3JWOH 4PJBA 1INEH 1TCRB 4XPGL 3WNPA 4JFDA 2NY4B 3UZEA 5F96H 4OM0L 3OF6A 3EO0A 3O3BA 2WBJB 4C56B 3IETB 3DO7B 2BSTA 1MFBL 2Z4QA 3N85H 3ARGC 3WIIH 4EDXA 1P5VA 2EO9A 3SO3C 3WXVH 4PRPD 4RMWA 2JIXA 5GGRY 3JUZA 2C1PB 3GSRB 1I1AB 1DQJB 1S8DA 4KMLB 3TIEA 3P9MA 1U8IB 1GC1C 1AQDB 2GTZB 3KHOA 3Q5OA 1T0NA 5FKAA 4KDWA 3DX7A 1A6ZB 2MSPA 3B2UD 1P1ZA 3PNWB 2DLFL 3M17A 4WRLA 5D9SB 3MLZL 3GB7B 2AK1H 2ZSWB 4N5UA 3L3JB 4BSVB 4AL8H 2WQRA 3MA7A 3R8QA 3RGVD 1KJ2B 1GGTA 3IGAB 5DLMH 3OXSA 4N8VB 3ZYIA 4K7PY 4TSBH 4G3YH 5JHLH 1RY7B 3C5SB 4LDOB 1MCOL 1QZ1A 2EYSB 2MPAL 4R96B 5ANME 4OJFL 1VFBB 4L3AA 1HOCA 2BDNH 5D72H 4LLVB 1H9VA 4HG4K 3BUYB 2NTSP 1KT2A 4Z7VE 5FV1L 1U8PA 3RRQA 4APQD 1H8NA 1CGWA 2UZYB 2H32A 1SEQH 2RGSA 3L1OH 2Z93B 3VFMA 5CEYA 5ACZA 5C0IA 4XAKE 3X13B 1JTTA 4F9PA 4KHXH 1BZ7A 1DR9A 3GIVB 2X4SB 2BVOB 4F80A 3MCLH 4OM0H 3VXOB 4PJGA 2B2XH 5CGYC 4AQOA 3MRGB 4ZPVB 4HDIB 2WBJD 3RWJA 1AR1C 5HY9B 2XXMB 1Q72H 4OLYH 1P7KA 3QCUL 2C1PA 4ORGA 5E9DB 3T1WA 5HHMD 2PR4H 1T0MA 1I4FA 3BE1L 1NH6A 3EFDL 3DXAB 3C9NB 5D1XC 4OLZH 3OSKA 5CLWA 1FE8L 5IW6A 1HEZB 3HRZB 3SQBA 4A2MA 1I8IA 1A7BA 3M1BB 3GSXA 3V4UL 3TZVC 2CRYA 3DSNA 3SE9H 4XP9H 2VWEE 5EBWB 1M7DB 4JPWH 5C6TL 1F4AA 3T65A 1KC5H 3RHWK 3BDBA 1EX0A 3DMMD 2CRMA 3CLEL 1ED3B 3MC0A 4I3SL 3QUYD 1B4RA 4YXLH 4GJTB 1N26A 2AKRA 5IIEA 1JRHL 3VG9B 2E7BA 4XTRD 3ZDXE 3DVNB 2DQIL 1DQLL 4XRCA 1T7ZA 2ADGA 4QHUB 3RWIA 3GUTA 2VTFA 3BP5B 3QJFA 4LGRB 3O2WH 1FLTX 1BM3H 2GCYB 1G9EA 1LK2B 4FQCH 4KGJA 1CIUA 4M5ZH 1JNNL 5I1CL 2P45B 2W0PA 4UQ3B 1MHPL 3MRHA 4P9HC 5SWSE 3FO1A 4P2QB 1OAQH 2CDEA 4LBEB 1RMFH 1I85C 2QHRH 4KUCF 1C5CH 4L1DA 1SJEA 4JRYE 2X42A 4RAVB 4LHQB 3O41A 1Z0MA 5CJQH 4MA7H 1RZFL 4GBXB 2YUWA 2DQTL 4KDVA 3QZWB 3GGWA 4X4ZA 3QDGE 4Y19A 2P5WD 3L7EA 2GEEA 3VFNA 1TCMA 4QTHB 3EO9H 4AG4L 4CU6A 4TQEH 4WCYH 4MQ7B 5HHOA 4IOSD 1U2HA 5FECA 5CEZE 5C0CA 1CFSB 3LKRA 4KXZI 4P23B 4HUXB 1FPTL 5E7BA 4PJAA 15C8L 3V9FA 3TC9A 5I75B 3MRCA 3MLTB 4E42A 3MBXL 3E8UL 4W70A 2B7DT 5ANMB 1FVEA 2J5LB 1IC7H 1J0ZA 5KZCD 1JI1A 3MV9E 3N1PC 2V2XA 1U8HB 3K2UH 4PBVC 4S1SH 3OG6B 4D0DB 2ZP0T 1WBYB 4QTIL 2DM7A 2PXYB 3Q6GL 3GBNL 4K7PL 1HKLL 5DZOA 1G7QA 5IQ7L 4Z7OF 2J8UE 1BEYL 4PB9L 1W2KT 4M1DL 2FZ3A 3X11B 4V2BA 1NDMB 2FX8H 4S1DC 1J11A 5EUOF 1GGCL 2XWJB 5JO5A 1IGIH 3LMJL 1GAFL 1D3CA 1ZVHA 4X7TB 3VH8G 4KJWD 3KWWA 1QACA 1G7LB 5ESQA 3HI6L 5FIEA 3REWB 1T5WB 5JW4R 3O41B 2GSGA 3DVGB 1FIEA 3O3DB 2XKSA 3UO1L 2DQHL 4PJ5A 5FV2A 4ODHL 3TT3H 3TZVB 1QBMH 4OT1H 4QO1A 4JLRB 2M1KA 2NY0C 4M1DH 4Z7WE 4S10A 3IAGC 1ZLSL 3QPQD 2QADD 4BQBA 1R3HB 1QFOA 4NC1E 1CU4H 5ECJE 3HCVB 5I66B 1CFQB 4LRNH 5K9JL 3U4AA 3GJFB 4XP4H 3KPLB 1CT8B 1BBDL 3F7YA 5I2IA 1KCUH 1FZJB 5DMJB 3RGVB 4RMUA 5I1GH 4XB7A 5TJWK 3QI9C 3WNKA 2W9DL 1I3RA 4KUZH 2G60L 1DZBA 5HI3D 2DLTA 4NRZB 5FUCC 4ODTL 4YHKL 2R0WH 3T2PA 2A9ML 3I6GA 3PWNB 1J10A 5FK9A 3ZKMC 4OZGF 5FHBH 4GRWE 4NRYA 3VFUB 3A0OA 3WIHH 1EUTA 4UU9B 5J9PB 1I7UA 1LO4L 2GJ6D 3AS2A 5F7DA 3OJ2C 2KQNA 4AJ0A 1RIVH 4F58H 1FL6B 4BH7A 1MREH 3ARGD 4G80B 1QFWL 1MLCB 3MV11 4JRYD 4F37K 3ARDC 4HMCA 1S9KC 1G9NC 1D9KC 3U7WL 2HN7A 4PLKC 2B2XL 2DQHH 4WENB 3UX9B 3EDEA 1HCVA 5ICZB 5I73B 2NY1C 1TDQA 1OOAA 4WUKL 4M6NH 5JPMB 4DN4H 1FV1B 1ZLVH 5F9WC 5E99H 4OAWB 5EUOE 3V6FB 4CDHA 1AD9A 4FXKA 5F93C 5CWSB 4E9LA 4K3EL 2X4NB 2IBBA 4PV9B 1C5BL 2YWYA 3HI6H 1UVQB 4I0KA 3TEUA 4WDIA 4LSUH 3TN0B 3F8UB 4HXBL 2Z31D 4XXCA 4MHHG 3EJZD 3LQAH 1D5XA 2FB4H 1QFWI 3NCJL 4XC3H 3KPOA 4C56A 4NP4H 2HFEA 4D9LH 5F3BA 4O4YL 5IFAH 2ZNXA 5T3ZE 2BY2A 3NPSC 3TBSA 1CDGA 3V95A 2YC1B 4YUEL 2EEDA 4I3SH 3U2SA 3HHRB 3SDXB 3I9GL 4FXKB 2JTDA 3QRFM 3OKKB 3L95A 1UB6A 5BS0E 3K81A 5HYIA 1U58A 1X5ZA 2P8MB 3H9SE 4NYLB 3VXSA 1HXMA 1MIEH 1T21B 4R9HA 3D0LA 4LCIH 1H3PH 5FKAB 4OZFB 3BKYL 2A77L 1SM3H 3NN8B 1IVLA 5IVNA 1JWUA 1KENL 4UU9A 2YN5A 3MGOB 4HJJH 4ZFOL 4KZEH 3MRMB 4PJ9C 1AD9B 3O2VL 5I19L 4AL8L 3D85A 4UINH 2KZ1B 4KRPC 3I02A 1MAMH 4AM0B 1HQRB 3T4YA 5TDOB 3MV01 1GCFA 3ZTJH 1CFTB 1WK0A 3MJ9L 1S7WB 1NLDL 5FM5M 4GUPB 1G7JA 2CH8A 4MNGE 2A6IA 1J1PH 1TQBC 5DR5L 2EIEA 3T3ME 3BPNB 2A0LD 5DS8A 1IAIL 4MAYC 4Y1AD 3E2HC 1D5MB 3F12B 4M02A 5GGUB 5J3HC 1DANT 1AQKL 4FQXD 1CG9A 4QCIA 2I9LA 4XPAH 5D7IB 5BZDB 2CLZB 2EH7H 1HXMB 3HMWH 3LQAC 4R8WL 1WEJL 3MMEB 2F19L 4BQ6A 4NQCE 1S7RA 4OB5L 1KCRH 5C8JB 4FN0A 1MCDA 2YD3A 5F1KC 4RZCA 2Z35A 1UC6A 1JHKL 1JPST 1KLUA 3TCXA 4K23L 5C6TH 1JV5A 1FZOB 1HSAB 3TNNB 1LE9B 2BSTB 3LS5H 1NJ9B 2GT9B 4UILH 1FE8H 2X4TA 2CSPA 3LVEA 3HMWL 2VZ1A 4DQOL 4I3RL 4KK6C 5ITFB 5HYSB 2IEPA 2C26A 2A73A 4RGNE 5IBUG 4Y8AA 1HHKB 4Y7MA 3MGAA 1MQKL 2AXGB 1XF2B 5JMRA 3MXWH 3K7UA 2I25N 5LCVL 3U7YL 4QRPE 2AW2A 1UFUA 3IJSB 4NNYB 1MCSA 2ZJSL 2N56A 5IVXE 4H26A 2MOVA 2Q8AH 5D2LE 3Q0HA 3FOLB 3LQMA 3BP6A 1JF1A 3VXUD 2IG2H 1UM5L 3CH1A 1S7QB 4PJ9D 2ADIA 3RIAK 4Q9QL 2J8OA 2PF6A 5I1IH 2X2YA 5IESL 4U49A 7FABL 5GS0H 4UT7H 4LCWD 1KN2H 5IKCB 1JL8A 2NQCA 4NUGL 3P4MA 4KJYA 5T3ZH 2VZSA 3MFGB 5MEQA 1BWMA 1UB5A 5GJTH 1FFNB 4MQXC 1M6OA 1J86A 1U8OA 5C0BD 4MXQD 4KRMB 3QXVA 1CFQA 5FYJU 1ZVSA 4WWKD 1WTLA 3QQ3B 2UZIL 4J1UB 4IJ3C 4QXTB 2HLFD 1L9MA 3BEWB 4K3HA 1FAIL 4HPYH 1XZ0B 2YD9A 1T03H 5EOQH 1HHKA 2LQRA 5L8LB 1UCTA 3NAAL 4JRXA 3QXTA 1C1EH 5KSAC 2BRQA 2W9LA 4E41D 4LCCA 3CX5K 4CVXB 3AXLB 4XB8A 2G5BB 1CI5A 3DIFB 2CDFA 3MRGA 4Y19B 1I3GH 2A83A 2EDFA 4WV1B 2DQEL 3C09C 2YZ1A 1KCLA 4P2YA 5L8JB 2HVKA 4JFDE 4PJCF 1KIPB 5BXFA 4H1LB 3GJEA 1TZIA 4JVWA 4TOYL 1VEOA 1ZSDA 2NXYD 3GSVA 4NKDB 4LVNB 4OCRL 5F89A 3HI1A 2DQCL 2JCCE 1OSZA 3PDGA 1EEQA 1NCCL 1R3LA 4HX1B 1D5IH 1RZ7H 2AJSL 3W82A 1A6TB 3BWAB 2VDML 1P4IL 2VXUL 4U0RC 5CGTA 1NCWH 3C87A 3EZ8A 5FA4B 3D1MC 4G6ML 3TBVB 5KJRH 3FQRB 2G2RA 5CIPA 4POZD 1MFEH 4HZLB 4MJIE 3BMWA 5SWSD 4LCIL 1F58H 3GRWL 3W81A 2ZG1A 2BFVL 1KPUA 4HS3A 3EYFA 1WT5C 1YEEL 4EIZC 1JTPA 2EC8A 3PABB 3KR3H 5E7FA 1PD6A 3U0PB 2AEWA 3O11B 5CWSA 2HKHL 3BAEL 5IHZB 3TO4C 2C7UB 4LRNL 3EAKA 4EUPA 4P9MH 3JV6B 4XVJH 2A38A 1HHHA 3FN9A 3LDBB 4JPVH 4F3FA 4Z7NE 2KL6A 1ACYH 2BSSA 2F53E 4ERSH 5I1HH 2Y1VA 2I5YL 4ETQA 3HMXA 5MHSE 1T2QH 5DJ8B 5KG9A 4Z78B 2R69L 4XPHH 1L6ZA 4XVUD 1ADQL 1BQHA 2X4QB 1FZMB 2VLMD 4MWFA 1NBVH 3R06A 2Q87A 3BIBX 1AGFA 1B4JL 5MEPB 1FBIL 1DSFH 3MV8A 4QOKB 4BSWB 3WO3B 2X10A 4ZUWA 4QRQB 4RFOH 3WD5L 4JCLA 2JJSA 3TVMB 5H94A 1QSEB 3O45B 1FGNH 4GKZB 1O5DT 4OFKA 3QWRD 4Z5RB 2CUMA 3LZFH 2XZAH 1QFWH 2CLZA 4ZD3L 4ODVL 3OB0K 4TUOA 1BGXH 4L8CB 1KPRA 3WFZA 2GJZB 2VO5A 3MUHL 1OGAE 1Z9MA 2EDJA 4HULB 3MYJA 3P0VH 4PJ8A 1QPXA 4JFQA 4XX1G 2FH8A 4YUEH 2X1WL 4D3CH 1A7RL 4NZDA 4GRLD 1N59B 3Q5YA 2FX9L 4G8IA 3NCFB 5IR1A 4HCRL 3RWGA 2XA8H 4MVBC 3QISA 1T83C 2NZIA 5BRZB 1T20A 2I26N 5BV7L 2YEZB 1I75A 1RV6X 2R9HC 3QDJE 2NCMA 1WZMA 4XC3L 4E41E 1JFQH 5ISZD 4XC1L 1OTTC 2R56H 4JG0H 5EBLB 4L8CA 4OGAC 4POYA 1A9BA 4N1EA 2DLIA 4YXKH 5JW4Q 2XNAB 1FG2B 3CZFB 1ND0B 4TNVK 1YY9C 2Y36L 1FORL 1G9NH 1SY6L 3DV4B 5I1LB 1YECL 4P9HL 3O9WA 1MCEA 1NMBL 3SO3B 2RJMA 4CVZB 3MJ9H 2O5ZL 4I18B 5ERWA 4HJ0D 5J3HD 4WU7A 3S37L 1VPOL 1ZS8A 1UACH 3MNWA 4X4MA 3VXRB 3V52L 2FGWH 2WW8A 1MVFA 4LLYA 4EN3C 1YMME 4U6VH 1C5CL 5GRUL 3TYGL 5EH1A 3KPQB 2X4RA 3I85A 4P4RA 1T04B 5BS0B 4R4FL 5DJYB 2HFFB 4YDJA 1IILE 1I1FA 1MAJA 4YQXL 2CRZA 3WFCH 3CXHJ 1LEGB 1LO5B 3MRNB 4OZHF 5AZ2H 4HWNA 1RFDL 3UPAA 4GLRH 2HAZA 5I74B 4U6XB 3U0WL 3ARDA 5DJ0B 4LIQE 4QF1B 5FYKE 1CLZL 3ZYOA 3UJJL 4QXGL 5EWIH 4KI5D 5KVFH 2A6DB 4JPWL 1JYXA 1NGXA 2VDNL 4Y89A 3RUGB 4Y2OA 3VRJB 1JWSA 1TJHL 2HN7B 4P2RD 4ODTH 4PR5A 3AXLA 2G60H 3OB8A 2MMXA 1EJOL 5DXWA 1DBML 5BO1H 3ZDYF 3IDGA 3F6IA 4H25B 2C1OB 1F13A 5EIVA 4JDZB 1MNUL 3NCMA 4YBLC 5GSVB 4YDKH 5CJOL 1U3JA 4PGBB 5C07B 1HINL 3ZE1F 1ES0A 3KJ4C 4Z7WF 4J3XA 1B9ZA 2YPKA 1T66C 1MSPA 4BH8A 1SBBA 3BO8B 3CMOL 4GKNB 4BSJA 4UTBH 2OR7A 2OJEB 1DBBH 3PWJB 5HDBF 3FRUA 4PJ5D 4YFEA 3S35X 3IDUA 4N68A 3DURB 4Y2DA 5EC2A 4P46D 3HCVA 5I66A 1FDLH 4MNQB 3HG1A 3LB6D 4XCEA 1FGVL 2R56L 2R15A 4MQXD 1A6AA 4GAFB 5F7YC 4RIRA 3UTOA 2QHLA 4HEME 1UWGH 1PG7H 1IAKA 3K2UL 3MJGX 4S1SL 4Y19E 4OKVA 5KVFL 2ARWA 5CBEB 4JDVB 2LU7A 1YC7A 2DKMA 2OMNA 4OZGB 1HKLH 4ZTPL 1WIUA 5JA8B 3UJIL 1UM4H 1HI6A 3JWDH 2IH1A 3BDYL 4JFYA 4NQEE 1A4JA 4ODVH 3LN4A 1NEZA 4KKBC 3LD8B 4E5XB 2B20A 1PLGL 1EVTC 1C08B 4J4PC 4JY5L 2EIDA 2WQ8A 1ZANH 5CP3A 5EPMB 5GRUH 1Q94B 1FYTA 4D9RD 4EIGB 4X6CB 1EEYA 3OKOA 1XFPA 4NM4L 5FKPA 4LU5L 4TUJB 3QEGL 2FWOB 3VFWA 1A7PH 4BKLB 3VFVB 1UM6H 5LVEA 1N4XL 5HD8D 4G42A 2XY2A 1EBPA 4AENA 1ED3A 5EO0A 3UAJD 2FX7H 4CVXA 4X99B 3ZE1E 4FQCL 2R1WA 4OF5A 4U2YA 3KPOB 1RJLB 2YD4A 5F96L 2CLVA 1A5FH 4U05A 3I2CH 4GS7C 2V5MA 4L8BB 5GZOC 4M6AA 4JFOB 3NAAH 3KXFA 3DVFA 5HDLA 4H0IA 4WVRA 2CIIB 2GY5A 3EW3B 1UVQA 2X09A 3TN0A 4D0BB 1PJ9A 4LBEA 2BDNL 4YK4B 1PKQE 1F02I 1CGSH 3CLEH 4HWEL 4P5TA 4P2RB 2IAMA 5AD0A 5C09B 4HCRH 1T66D 2WAHA 3JVGA 2X70B 5DT1L 3D39B 3QULB 1KJ3H 3MLXH 4LEXH 3SJVE 1FNAA 2W1NA 3ARXA 2IPUG 5DEZA 1DQTA 1S78C 1AIFA 1I7TB 1K9TA 5C07A 3WL9A 2ZCKH 1IZKA 1ONQB 2AK1L 2VQ1A 2Z93A 4L9DA 5BJTB 2IBGA 2AERT 4ZFZB 3U9UB 1YQ2A 3CFJA 2YSSA 3HNSL 2VDMH 4N0YL 4RBPH 4OZFA 2BVOA 3C8KB 5CMAB 4O9HH 2R8SL 1AXTH 2BNRB 2ICWB 1ZGLM 3D85D 3KYAA 5C0DB 3U1SH 3LEVH 2LAAA 4JQXA 1A7QH 3L6FA 3QNXB 1A9BB 1TMCB 4L9LC 4XWOC 4KRLB 1MQKH 4G5ZL 1FH5L 3UC0H 3RWCB 2DOCA 3OAYK 3QEQB 4PBXA 1J8HD 1Y6NR 1UCBH 1QSFE 1RURL 2ADFL 2CR3A 4JPVL 5FUOH 5BVPL 4EZMA 1KGCE 4UILL 4XBGB 4AK1A 2VABB 1B0WA 2NY5C 2JB6B 3MRDB 5LQBL 5CD3B 2Q76A 5GHWL 1J5OL 2DS4A 3AVEA 3GB7A 4EOWH 4MXVE 5LGHL 3DTXA 3FB7A 2NW2B 5D93C 5FM4A 2XWBB 3HPJB 3C5ZC 1JZ7A 4Z5RA 3T2OA 4ZG1A 5HGGS 3ZSTA 5IB4B 5CMAA 3L3OB 4OLZL 1IGMH 4XGZB 3UDWA 3RVTD 2NTFB 3CX5J 4I2XA 1PQZA 2O26U 1GGIH 3L7FB 5GZND 3MODH 3OG4B 2YPLD 3QIWB 1GYAA 1VADB 3VA2C 3NBNA 4YDLB 2OK0H 4RCAA 3KPLA 4FZEH 1NFDA 4I77L 3L9RB 3UROR 2BNRA 4LLAA 2XWTA 4U1GC 1S5IH 1EO8H 1H5BB 3FQUA 2HTLC 4D8PB 5F6HJ 4HFUL 5JNYB 2MCPH 1RZGB 3H9ZA 3G6DL 5F9JB 4K3JH 3ECBB 3QUMA 4OCXH 4D0BA 3OR6B 2AK4A 3UDWC 2OL3L 3HLAA 5L88L 2A2QT 4CN4A 3Q1SH 3TBTB 5HYEA 1FNEA 3VXUA 2VXSH 2MHAA 2Y06H 1NFKA 2JIXD 1CBVL 2AV1B 2NXZD 5H2BA 4LLUB 1VEMA 2VAJA 1OL0A 3RPIB 4R6UA 4HIHA 1VFMA 1MH5B 3HNVL 5I1EH 5I17B 4XNYL 1UM4L 4F9LA 3OGCB 4MWFB 3MR9B 2FBJH 1SMOA 3VFSA 3K46A 4JFEA 2NY2B 4HUVB 5C0EA 1OT2A 1J9CT 1C8PA 1JHLH 2HA1A 3LRSB 5FYKH 5C86A 5FUZL 3S36H 3MV9B 3HN3A 3NZHH 2J1KA 1NDMA 2Z0BA 4O2CB 1V7MH 4JFFE 3RIFF 5F7WC 1GRWA 4OFYD 1EV2E 5CZKA 5EZOH 4XNUH 1MY7A 1YJDL 1KBGH 3RAJH 5SWQB 1KIPA 3WXVL 1FZKA 3V5KA 4RWYL 2NZ9D 5A43C 1LEIA 4N0CD 4NOBA 2HJLA 3ORJA 4JFPA 3F62A 3CUPA 4F57H 4LOUD 4YHPB 2NPLX 5EPMA 4EEEA 4NJAH 1NKRA 2APWA 4KTDH 4FZEL 4Q6IC 2LFGA 3AB0C 4GW5B 2EDWA 3QWOA 3NACH 3T1FB 4QTHA 1NDGA 2DQJH 3MLPA 2BNQE 4J1UA 4QXTA 1KENH 4Y5VA 3PXJA 3G6JF 3QIBB 1CFSA 3LKRB 4QT5B 3RL2B 5GGSA 4X99A 4M8QB 4X5WB 5AD0B 2DBLL 3ARED 4JJHA 3ESVF 3T3PE 4NZUL 1CICD 4HIEA 4H20L 3ZE2E 4GW5A 3X11A 5F71A 5E6ZA 1X5JA 4AY0A 2C3VA 3CDGA 3V5HB 2OL3B 4XMLL 3RJDA 2R39A 2H41A 3WL9B 5CEYB 5HVGB 5GSVA 3NA9L 1MCLA 4N0UE 4CMMB 2DQFB 4ZOAA 1JI2A 4QWWD 3KLDA 3CFKB 5T5FH 4M7KL 3HE6A 5F6HI 1ZHLA 5ERWB 2G5RA 4ENED 3QHZH 1E0OB 3GBML 3LEXA 5IROA 4LSUL 1N64H 4JM2C 1JHTB 1TITA 1P4LB 1RIHL 2OR9H 5I16B 1U8KB 2GAZA 2DRUA 5EUOA 1DBBL 1TVBA 3O81A 2DTMH 3PHSA 1MVUA 3R1GH 5DI8B 3CFEB 3RVXC 5DUBA 4MNGB 3ARBC 3M8OL 4J3OC 1EJOH 2UY7A 3GSXB 3FT3B 4FQ2L 4HHAA 1EHLH 1PEZA 2VH5L 4BM7A 2Y4SA 1HILA 1LK3L 5FA3B 2QR0B 1OAUL 3WUWB 2NY5H 2PTTB 4HUUB 3FAXA 5EFIB 1ZT7B 4UUJB 4OUUA 4AT6A 5ALBL 2GT9A 4YDKL 4HIXH 4LHUA 4H5SA 4APQC 1FO0L 4OTXL 2BJMH 1UQSA 5D1QC 2FIKA 3Q6GH 3UMTA 1CDJA 3QO1A 3U46B 2DICA 3OR7A 4JZOA 3DMMB 4O2CA 3QDMA 3MUGB 5H37G 4NFBA 2VDRL 2QQLL 2OLDA 4NZRH 4R26L 1GOHA 3BGAA 2OL3A 2X5PA 4R2GC 1MUJB 4UNUA 3BN3B 3JV0A 1OP5H 4GXUN 3DRTA 5EZLA 5E2VL 4GMTL 4ONHA 2MJWA 2WWKO 4RBPK 1RUMH 1IJ9A 5FF6A 5C0AB 2H45A 2UVEA 4P5MB 1ZWIA 5EZJA 3TT1H 4XGZA 4M48H 4OZIA 3UTTB 1E4WL 4PJIB 3WJLA 1X5HA 1YEIL 3HG1B 2R2BA 4GMSH 5C0ND 3S37H 4NO3A 4WV1C 3W11C 4OQTH 3FFCA 2ADJA 2AAVA 2FD6H 4XCYA 3T08A 4DVBA 2UWEF 3QHFH 3I6LE 3SE4A 4OZHB 1Z0NA 3BX7C 3HC4H 3WJJC 2UV3A 4F15B 1JYWA 3VWJC 2V5TA 1CDHA 3O8XD 2B4CH 4K71B 3GMPB 4Z0XA 1CXLA 2VLRE 4M9PA 2XQYG 4LVHB 5D2NE 3CZFA 5D96B 3VXMB 4M93B 1OSPL 4KKCC 5SX4I 4PJDA 3FHAA 4N9GA 4R26H 4HUVA 4XP9L 4ZDHA 2P5ED 5I1GL 1RJZB 5F9OL 3AM8C 4P5MA 3VGAB 5DQDH 5EBGA 2H2SC 2YA0A 3EOBB 3FJTA 3UEZA 4QF1A 3AMLA 3VFVA 2DMBA 2Z8VC 3HZVB 3QIUC 2JJWA 4G6MH 1NFDE 4R0LB 1NBQA 3RTQD 4OF7A 3IFPB 1L9NA 1XIWC 2MHAB 2E7CA 3EHBC 4JHAL 3TO4D 4NDMA 4HZAA 3MUJA 3PL6D 4L4VB 4ODHH 3PDOA 1RJLA 3MRRA 2H3NB 4CL7A 5D6CA 3O3EB 1AE6L 2ICES 3AUVA 4D0CA 4DJMA 2F54A 1NGWB 4GXUM 3KPRD 4P4KA 4UDUA 43C9B 2FIKB 2CJUL 5C70A 1U8PB 2Q76B 5E08L 1TZGH 3PABA 3NIGE 3CVIL 1A64A 1W0WB 3GSQB 4Y5YA 4J3VA 5D8JL 1OB1B 4Y2DD 5ID1B 2X4PA 3T04D 4S1DD 5FGSA 1DEEA 3QJHB 4JFHD 3S3JA 4NCC1 3PQYA 3VMPA 3GI9L 4HT1H 5KVDH 5LG1A 4MJ5B 2NTFA 3BKMH 1GIGL 3SDDC 2P5EA 3W11D 2VXTH 3GMMB 2WV3A 2AEIT 2ORBL 1CF8L 3J8F7 3QXDA 1GHFH 4JFFA 2CK0L 3V4VL 1WWAX 5LAXA 2AEQH 3QFJE 2ICWA 4FZ8L 2VXSL 3HE6B 5DYOA 3WMSA 5J89A 2G5BA 2DQCH 4ZD3H 3QPXL 4NNPL 3JTSB 4PB0H 1ZGLP 4FNLH 4G9DA 4GRLC 1PG7W 3H9SB 1MJ7H 3BWUC 3E1F1 5E8NB 2VXQH 1AGFB 4NO5A 4D0CB 5J7CC 3WKNA 1V5JA 1FIGL 3TA3A 2F58L 1J1OH 4H1LA 4PJXB 4KPHH 4WO4D 3OKLA 2FHCA 3WDJA 4I3GA 4PJAB 5I71B 5C0GB 2I07A 1CFBA 1NBVL 3G6DH 3V5DB 3OB0H 4ISVB 1YY8B 4KRPB 1WSST 4F7TB 1NUGA 1IEAA 1QRNE 4MA1B 5D7KD 1N0LA 1Q9KA 3TNMB 1OTSD 4XI5D 5JORB 4FQJH 3KLHC 2VDKH 1YJDH 2XTJC 4GFTB 5TQ2H 4GAGL 2BC4B 1A1OA 4KH2A 1NGYB 2HT4C 3BGMA 1A3QA 1KUMA 4HGMA 1YN7B 4M5YL 1DBKH 3RDTA 5TE4L 4E42B 4HUNB 4D3CL 3CZJA 3LV3B 1JHLL 5FYKL 1GZPB 4I48A 2LE9A 3KPMA 3ARQA 1UQSB 1GGBL 1QFUH 3AAZA 3KPSD 5IM7B 3WSQL 1KC5L 1X5KA 4JPKL 3CH1B 3MNZA 3LPGA 5CJ8A 3OR7B 2H2PC 3BDXA 4UOW1 3EJZC 4IOIA 2P5EE 4NQDD 5D1QA 1UKQA 4PTTB 4HG4J 4OIBA 1TNMA 4MDIB 3MRLA 3S34H 3TN0C 1FGNL 1REIA 4LSPH 4MXWL 5I6XC 5GS2H 1M6OB 2ADFH 1FFOB 4OUUB 4HF5L 3WD5H 4AT6B 3VI4E 4YDJB 5CP3H 2M8XA 3GKWH 5I76B 1BJ8A 2IG2L 3MREA 4NN7B 1NGPH 2XWJA 4OLUH 5JO5B 4JY4B 4ZSOA 1G1CA 1V3MA 2VITB 3C6LA 4LIQL 2OMBA 3X3FH 2E8ZA 2F53B 2NLJB 1Q0XH 1EFXD 3ARDB 5JOFB 4ZAKD 3CMGA 4LSSL 4OCYL 2APBA 2F5BL 3SCMC 4XVJL 5F89B 5TE7L 4DCQA 1JV5B 2AJZA 4OZFG 5FDYA 3MRJA 3WFEL 2XQBL 3BP5A 5E70A 1P2CA 1XCTA 3VXRE 4XWGH 4JY6B 3RWEB 4P2CG 3A67H 4N1HB 1IGFL 1NFIA 1T80A 3MRFA 3QXDB 4I1NB 3LKNB 1K5NB 4K07A 1KJ3L 1X5LA 3MLXL 3LIZH 1Z9OA 1ZLWH 5JOFA 4WJ5B 1CBVH 1XGYH 3CFDA 5EN2A 2YEZA 1YMMD 1U95A 4NUGH 1I8IB 1OF2B 2L4OA 5I1EL 1LEKB 1JGVL 3VG0H 5IUSA 5J0BA 3L3GB 2VUYA 5HHOB 4LPYA 2AEPL 4NZTH 1X5AA 2ZG2A 5CHNB 5LQBH 3OV6A 4XP6H 4HXAL 2Y6SC 5EU3A 5JOPD 2DLEA 1HZHH 3QQ9D 3RWIB 3DX7B 3X3FL 4Z0BL 1FQ9C 4OF8A 1A14H 1FVCB 1T6WA 1WISA 3L3KA 4UQ3A 3O4OB 4Q58C 3FT4A 3CU1A 4YGAB 4RGOL 4BELD 2AVGA 2YC1A 1G7PB 4PTUB 3HAEA 1BIIB 3PF2A 1A7QL 6FABL 4PY8I 2HFTA 1H5BA 2HFFA 1BFVL 1RJCA 2A74B 2J12B 2CQVA 5JW5A 3SBWA 1II4E 1YMHB 4XBPA 1I8KA 3PQYB 1M7DA 2C3GA 3JV5A 1OLZA 2VZTA 4YEFA 1KCVH 1KN4H 3L3JA 5KS9F 3S96B 1L6XA 3MV8B 3QAZB 4QOKA 1MY5A 1YMMA 4JM2A 3VJ6B 4FZ8H 5CEZL 2AV1A 1NGXB 3RUGA 4A6YL 2IBZX 5FGBA 5GS1B 2H3NA 2F19H 4PIRF 4OKDA 5CP7B 3QUZB 3F7VB 5I75C 2K1MA 5I1LA 5EU3B 3QB7C 2W9DH 4OBRA 3QIUD 1N59A 3HZYB 5CIPH 5LGHH 4RISH 3RVWC 1K8IA 4P23C 1X7QA 2F9BT 2XYCA 3SGJC 1JN6A 1U8NB 4WHYG 2E3VA 4JDTH 4O4YH 1WBXA 1S78D 3LRHA 5BV7B 3KXFE 3ZKXB 2XY1A 5ALCL 4JG1L 3EOTL 1X5YA 2FLRT 4G6JL 2HJLB 4JFPB 2FEEL 4OF6A 3E6HA 4NSKA 3K4ZA 5TDOA 4M9OA 3TM6A 4P48A 4UAOB 1MREL 3QH3A 3BIKA 2FX7L 1JK8A 4RAUA 3ZKMD 4Q9CA 3MV7D 3HNTL 4DGVL 2DI8A 2G2RB 2R29H 5CIPB 4BFBD 3ALPA 4M6NL 2OX5A 4U1MB 3RVVD 1MF2H 4EQ2A 3P4NA 4KZEL 1L7IL 4X4XB 5DQDL 4N5EC 3LMJH 3LOWA 3CFDB 3MRIA 4N0RA 4D9QD 1G7JB 4GUPA 4EKXA 4WUUE 2O5XH 2MQ3A 1Z5LB 3CFCH 4YJZL 5E2UH 1BVLB 2K9UA 1NCUA 3BDYH 4HLZG 3DI2B 4QXUH 3G04A 5FYLE 4PRAB 2P8LA 1MIEL 1QR1B 4P4KB 4UDUB 2IADA 1QKZL 3WDIA 2J7LA 3PUCA 4U2ZA 4L9LB 2FECI 4JFXB 3KS0H 4NQDB 1JJUA 1JBJA 3GI9H 2YMXH 2M26A 4HT1L 1MQ8A 3TJHC 4OZIB 1C08A 2JE8A 1K85A 1XR9B 4KROD 4XAKD 4IOFC 2VWEC 4GRLA 3FT4B 4UT6H 4XP4L 3FQWA 3QUZD 2PN5A 4FQQA 3BT2L 2HRPL 2H9GA 3ETBF 1VPOH 5CS7A 5I16A 1ZKAA 4HMDA 3UPCA 2J88H 2PW2A 5ESQB 2AV7B 2W60A 5FHAH 1AE6H 1CXIA 1ERNA 1NL0H 5HDQH 4A2LA 1DL7L 4NGHH 5EORH 5F7EL 1J0KA 3OPZL 1HQ4A 4OZIF 4FQXB 2P4AB 1NJ9A 1IAKB 3GMOB 5IEKB 4Z77B 5DK2A 4J2XA 1A7PL 3H6JA 4PREA 3PWPB 3H42L 4JZJA 4J3UA 3EYOB 4WY7L 1VFUA 4GMSL 3ULUD 4ODWA 5EIQA 1P53A 5J1SC 4JAMB 4ZXBC 3MRPB 2BNQB 3GSNL 1M05B 4LAQH 5D2LF 4PB0L 3SDCB 1CGVA 2NY7H 4MX7B 1V3JA 3HFML 5B3JF 5DFWH 4PGCA 2VLRD 5FEBA 3QUKB 1WIPA 4LL9A 2JJVA 1A7NL 4CW1B 3W9EB 3WLWC 4QRPB 3K8KA 4FXGA 3BESR 5F6IC 4X98A 2G75B 3EYOA 3EYQC 3QDMD 1OSPH 4PJ7F 3L3GA 4X7TA 1M71B 1RFDH 5DEFA 5D2LB 3PHOA 3QDJA 1K4DB 4EUPH 3GMQB 2WWMD 2Q6WA 5MENB 4LP5A 5FF6B 4UDTA 4DTGH 1OT1A 3P2TA 3I3EA 4TRPL 5J6GB 1UKTA 3P4MB 5SWZA 1EXUA 3W0WD 3QIBD 2QLVB 4LEOA 5M95B 3QDHA 5CJQL 1QBML 3DARA 2DD8H 5HI4C 5E95B 4EBQL 3WN5A 5DMGC 3U36A 2EIBA 3VDBA 4JY6A 4IRSC 2RCSL 4HS6A 5L7XL 4NKQB 4MJ2A 1Y6MR 6CGTA 4Q9BA 3TP4A 4RZCB 2R69H 4GG6F 4HK3N 5DK0B 1DVFB 1RK0A 2P8PB 4BKLA 2YRLA 3NFNA 2DI9A 2OTPA 4X7EC 3QNYB 4GQ9H 4DGYH 3RWDA 1R0AH 4Y16D 3KAAA 1FYTB 2A1WL 4KI5F 3SO5A 1OLLA 5I17A 1QLEH 1CR9L 1B3JA 4M43H 3GMMA 1H3TA 3KPMB 4OLWL 4UT9L 2DD8L 4PJ7A 3W2DL 3U2SB 3NZ8B 1CTOA 3K4AA 3MQIA 4O02H 2AJXL 5HYSA 1RUAL 1JFQL 4MD4A 3RY6A 1MPAL 1F58L 3LN5A 3QQ4A 2KH2B 1K4DA 1KB5H 1FNSL 1NC4D 2P1YA 2A6IB 3IJHB 3QNZA 1BQHG 5IVXA 1F4WH 1UH3A 2H6PB 2PW2B 3QWOB 2E6JA 4XNYH 4P3CH 1P4IH 3HUJA 3P11L 3MRMA 3ROOA 1IKFH 1VFAA 1BAFH 4K9EC 4PLKD 3W5NA 4Q97A 1T5XA 1CDCA 5DRXB 2WBWB 4IIQC 4L4VA 4QRRA 4QWWC 4X7SH 5E1HB 3MJ9A 2ARJB 2XZQL 3DHJA 3OAZK 4ODWB 3I50H 4OIAA 3EYVB 4HSQA 4AMKL 1DSFL 5HPMA 3NIFE 1DVFC 1OP5K 1X5FA 3KPPA 1EBAA 3SDXA 4ZAKB 2APXA 1NGQH 4IRSB 5KSAD 4Y16A 3B8YA 1R24A 3MRBA 4MB4A 4JZNA 3MRIB 1T4KA 2P8MA 3VXSB 5BZDA 1BPVA 1CD1A 4P9ML 2EYSA 4G7YH 1FNHA 4WW2C 4LMQE 4P3DB 2WSKA 2WWKT 4EN3B 4CN6A 4NC1C 1DP0A 2VMFA 1MWAA 5CGMA 5BMFH 1NQBA 5JXEC 1PY4A 2VIRA 3MLZH 5HYFA 5D2NB 5ID1A 3KXFD 1A7OL 2XKUA 1DFBH 2VZUA 1D5XB 1IAOA 4JFQB 3GUTB 3GK8L 3ZMRA 2PXYD 2DWEB 3ARBB 3H9SD 4LGPB 5IR1B 1S7TB 5CZVH 4R96A 4Q9QH 1CGXA 4JFFD 1N5AB 4MNQE 2D7TH 4PRDA 3B6SA 2DQJL 5CUSL 3VWKC 4MJID 1QLRA 5H35A 2PKDA 5JW4M 35C8H 3GFUA 4LLYB 3X3GH 1BOGA 5DHYB 1CG9B 1FHGA 1GGUA 5LXGH 1S5HA 4OSUH 5FUOL 3M8OH 5BVPH 5SV4A 1OTSC 4XI5C 5FB8A 5GRXG 5IW6B 3EOTH 3G5ZA 4RFOL 2XTJD 5AEAA 3UBXA 5EG6C 1IL1A 3U30C 1LP9B 4PRDB 4N5ED 1AH1A 4P3DA 5EOTB 2IFFH 4IRJC 3FB6A 3H3PH 4FMKA 5IB5B 4LLWA 3DLQR 1JYVA 1UWEL 4WHTB 3EBAA 1KIQB 4WTZG 3T77A 3IFLL 4G6JH 3QI9A 2AXJA 5T5FL 5B39G 2BSSB 5MI0B 2IQ9L 3RX5A 1JVKA 1N2RA 5DRZA 1GGIL 2FBJL 2W59A 1CZ8L 2C4XA 4MHHI 5CD5D 1FVCA 2PXYA 2PETA 5D2NA 5T1DH 5GGVL 5IJVA 4PJ8C 4MLSA 2B5IB 4Y5XC 5ETUA 3BKJL 1K2DA 4ZXBA 3RGVC 1MHHB 1P4BH 3VDCA 32C2B 5INCA 3U48A 3RWCA 3BN9D 1U3YA 4JB9L 2DLFH 1OARH 3GGWB 5GGTA 5DSCA 4U3HA 3MTRA 2OSLB 2XN9D 5A2JH 1VKXA 5A16B 3WYRA 4X5LA 1WCQA 4Z8FL 3P30L 3U7AA 4LCWE 3DURA 4Y2DB 5EC2B 4LCCC 3SCMD 3JXAA 4XPTL 4XPBL 3MRLB 3B5HA 1KOAA 2J4WL 4LSSH 3V6ZB 4PJIE 1HHHB 2NW2A 2DQUH 1R3LB 1HILB 5FA3A 2DJSA 3L7EB 2EO1A 1WF5A 3V0AC 4H5SB 1IKNC 1RUPH 4K3DL 2MQ0A 1OM3H 2VE6A 4KK9D 1O0VA 3CDYA 3LHPL 3MJ7A 2F15A 1YY9D 1DBAH 5DVMA 3S5LG 1FO0A 4OF3A 4PJFF 4F7MB 3V4PH 5KS9A 1CDYA 2FEDC 4HGKC 1ZHLB 3QNZB 4JO4L 5T3XL 4NBXB 3BISA 3QYCA 3PWNA 5E8DH 1BJ1H 2CO7B 1RJYB 3L5XL 4MB3A 4YHOL 4OCSH 1OAYH 3QFDA 1A3RH 2XQBH 3C6SB 4G8EB 4LDEB 1B6DA 2EXWD 2X7LB 3QQ3A 4PP1C 1NSNH 1AXIB 4H8WC 4OGZA 1S7VB 1WTGT 5DUBB 3QFJA 3K1KC 3RWHB 2HKFL 4HIEB 1DLFH 4ZFOB 4Z7UF 4P4RB 4XVSL 5BS0A 3HPLB 5EU4B 2JELH 3V5HA 4X98B 3MLRL 4OLVL 4Z95L 1FDLL 4D0DA 2JK5A 4LHUB 2Z92B 1MAKA 2P8LB 2Q86A 3FB8A 3NVQA 4PTUA 4WUUD 3G5XB 2JB5L 2WMPA 4G43A 2VAAA 3BSZL 4ZTOL 4OSUL 4PYGA 1KB5A 1A4JB 2F8VA 2VL4A 5F97E 3U1SL 3VFNB 4RRPG 1PLGH 3QBTB 5GRYA 2R4SL 4ZNEE 1WZKA 3QUMH 3C2SA 1J05A 4MA3B 4PJEE 5EO9B 1PSKH 3VRLE 4AIOA 2F58H 2X9XA 5JPNA 3RU8H 4WW2B 4WFGD 4YHIA 2AJYL 5T3XE 2XKNB 1J1OL 5D7SL 3SEPA 1U3ZA 4Q2ZA 3GM0A 2VKXA 5IMLB 4PS4H 5SWQA 2P7TA 2NY4D 3PJSA 1TFHA 3VD3A 3C9NA 5LWYH 1LEIB 3NCEB 2JLLA 1MPAH 5BRZA 3V5DA 3VXQA 1KCUL 1YZZA 3QCTL 4JFZL 2DBJA 1CZ8H 1B2WL 4GAGH 1OGTB 3BKML 4P46C 1JGDB 1GIGH 5LGJA 2DWDA 4PREB 3VE0A 4Y0GA 3PGFL 1EGJL 4L3EE 1U8QB 3JV4B 4KY1H 3T0BA 1TJIH 2BNQA 1KPVA 3HRZA 4M1CC 5T1LB 2ZG3A 2NNAA 4PUBH 2EDQA 3QRGL 5IB1A 3UJTH 3OAZH 4JZJB 5HHNB 4CVZA 2VRAA 1WAAE 4G6KH 5JORA 5IVZB 3U4EA 3MLSL 2X05A 5F70A 2EC9U 3SPVA 1KACB 1INQA 4X80L 1G7MB 3BP4B 4QRUA 5C08D 4R4BA 1MCCA 2DL9A 3VI4F 1F6AB 1D5MA 3F12A 3KDMA 5DC9B 3K1DA 4KK5C 3WEXA 3WNNA 1VGKA 3DETC 3OJDB 2HVJA 1VA9A 1TPXC 5KVEL 4FXGB 4EI5B 4OI8A 2BVQB 1J1XH 4N90D 4IRZH 4DEPB 4JVUA 3WLBA 4KAQH 1JTOA 3GSNB 5IF0A 2GJJA 5BQ7A 1BX2B 5INDA 3DSFL 5HGHA 3HFMH 4XCYB 4N8CH 3RGHA 3SQOL 4QRSB 5I8OL 4YNYA 4PRAA 5IMOA 3D0LB 4FOMA 3REVB 2AQ2A 1JF1B 1UJ3A 1FO0H 3WBDA 4I18A 5A16A 1F90L 4U6YA 1YPZF 5L2KB 4WY7H 5K9JH 2APVA 2AK4E 2AXFB 1I1RA 4OD2B 5BQ7B 3HPJA 1MCPH 1XF4B 2PYEB 3HZMA 3X14A 4ZUVA 1CE6B 2Y36H 1U8IA 3ARYA 3GHEH 2ZWLT 2BMKA 1RZKL 1UJ3B 1NCBL 5I8EA 1JIBA 5TFSL 5AYUH 1K8DB 1UJTA 4RFNC 5DD6B 3D0VB 1ZOXA 1OPGL 1I7TA 1J87A 4DZ8A 1I1CA 3PV6A 2Y72A 4ONOA 3QDMB 4NCC2 3IU3A 3BZEA 3CSYA 2LTQB 1G6RB 2WBKA 5K9QG 1R5IA 2N7BA 5FYKD 1A6ZA 2Y25A 3CSBA 1H3XA 1Z6JT 4C57C 4HIJA 3BOVA 3BPCA 5D1ZA 3BH9B 1A2YA 3JTSA 3MNVB 1ZT1A 3F5WB 3I6KB 1IL1B 2VYRE 1U3HC 1WV7T 1JRHH 4LSVH 4NN5B 1VFBA 2RFXB 1SMAA 2HH0L 4JFOA 5D7IF 3BW9B 4CRPA 1JZ4A 2Z91B 4KK5D 4WI5A 4ZSOE 4ACPA 3SDDB 3CLFL 3GMLA 2R0ZH 3C5JA 1FNSH 1YNLL 4QRSA 5DC4B 3CXHK 4MDIA 1QQDA 3QEQA 3QUXA 3V0VA 1D5ZA 2BZDA 5HPMB 3LKSB 5JDJA 4U1JB 4NKMA 4OLYL 2GYSA 1UT9A 1NCDL 1EEZA 2ATPB 3ZE0E 1ZLSH 5I1AA 5C0CE 1FP5A 5ALBH 1YPZE 3WHXA 1CFTA 4YPGA 5L2KD 2OJZH 5C09A 4NO0A 5JTWA 3U9UA 4Z6AT 4G80A 4JN2A 4KHXL 3O4LA 1Q9OB 1R3IL 5IQ7H 3IFOA 3O3AB 2DTML 1AKJA 4YX2L 1X6NA 5DMKA 3HI5H 5KBNC 3HZYA 4UNTA 5EZOL 4PJ7B 1LO3L 3VD7A 1X44A 3SJVD 4L4TB 3KPRA 3QRGH 5DJDB 2JF1A 4PJEF 4R0LA 1YEDA 2XRAL 2IAMB 2YD2A 1U91B 1TETL 2KZWA 5AG8A 3CC5A 4TUKH 1KXVC 1N0XL 1QQDB 4QXGH 2UUDH 5EWIL 3THML 1MCOH 3KS0J 1UB5B 3CCHB 1DEDA 3NA9H 1NDGB 3SY0A 3HS0A 4HS6B 4XT1C 3ARVA 5E03A 3HC0A 2MQCA 3CDGB 4HQQH 1RVFL 2CGRH 2P8PA 5KVEH 3ZDZE 5FO8B 4LCWB 1QBLH 4A6YH 4Z7UE 5C08B 4K8RC 3WIFB 4YPGB 1XMWA 3U83A 1FSKC 1DQDH 1I85A 1UH2A 3PXHA 5J6HB 4TSAL 4WHCA 3VXME 1P6AB 3MCKA 3G5VA 4KTEH 5EFIA 4Z7QF 5C09D 1QHPA 3JUYA 4D9RE 3OKDA 1OAQL 2W38A 3NACL 2DQEH 4LKCA 4KC3B 1U9KA 1MFAL 1WUNT 3BEVA 4YXHH 4JRXB 4NPYA 5SX5K 1W0VB 3CAFA 1CGUA 3QG6A 5B3NA 1YEDB 3B9AA 4ZTOH 1FFOA 5DHVA 5IG7A 2IPUK 2B1HH 5DDHB 3ZHLA 2X1OA 5FKPB 4ODUB 1E4KA 2OS7A 5T5NF 1H8SA 4U0QB 4MVBD 1CK0L 1DBJH 5JQ6H 5D72L 4ZUUB 1RUKL 3UPRB 1LILA 3BPLC 3N50A 3D2UA 3QUXB 2V17L 3SKNA 1WBYA 1U6AL 5I74C 1VGEH 1NAKH 1IT9L 1CL7I 5IB4A 1HQ4B 1I9RL 1U8HA 3C60C 4PJBE 3HMXL 4JE4B 5DJZA 3MUGA 5HI3C 1IC1A 3T8XA 4XNZC 5GRWA 3U0TB 3IXAA 4P2OB 4PJ7E 4ZUUA 3QO1B 2GUOB 2R4SH 3KPSA 3FOMB 1NBZA 1YY8A 3GMRB 3SDAA 2BC4A 4LCCB 2J6EH 1A1MB 4KVCL 2DWEA 4H88H 3E6HB 5IMKA 3EOAB 3REWA 3BSZH 1LE9A 4UNVA 4OBSA 4QEGA 3S3PA 2V5RA 4YO0A 1G7IB 1JMZA 2PCPA 4JHWL 2VE6B 1MJJA 2OZ4H 1MWAB 4G7VH 4CW1A 2YD8A 3ZO0A 5GRJL 3T0DA 1IAIM 1TZHB 4WU5B 5GRVK 4XPHL 5HBBA 4NQSA 4RAVA 1HWHB 1QHOA 5HGHB 2V9TA 1ZGLA 2ADGB 2X4RB 4QHUA 1T1ZB 3STLB 1QOKA 4PRPE 4JG1H 4ENEC 5J1TC 2NNAB 3OJVC 1NGZA 4CGTA 1XH3A 3MRHB 2NXZB 1MAML 1A2YB 1QEWB 1K8DA 4G6FB 3BP6B 5IV2B 4J8RB 4JPIA 5MEPA 3HMXH 4GH7B 5D71H 3SCMB 5LGJB 1CFVH 5IW3A 5JW4N 3WFDL 1R5IB 4OI7A 2FR4A 3HG1E 3V4PL 3TH2T 4JFEB 3HZMB 5LGKA 5D6DC 4UT7L 1S7XB 1SEBA 2VISA 2CKBH 4U1HB 1JWMB 2BXZA 4FQQB 4XWGL 5E2WL 3MFFA 3SE3C 1UADC 4NQDE 4WI9A 3BYTA 3NPZB 2XN9A 4PJDE 3C09B 5LBSH 3LKPB 3SN6N 3CSYB 3C60A 4GBXA 4ORGB 3WFBH 1XF3A 4U1LA 5D7LA 5HHXL 1MELA 4GRWB 5A1AA 1P84J 1RUKH 1X4ZA 3O6FC 1NFDF 1I7ZA 3Q1SL 4QYOB 1DQJA 5CINL 5GS1A 2RQ8A 5JLZB 3HRPA 4ONFH 1PKQA 1X4YA 3O4LB 1K3IA 4K8RH 3SDYH 1JGEA 4I4WB 4Y8DC 4UINL 2FIRT 1JZ8A 4NM4H 5EBLA 3WNMA 4IJ3B 4M1GH 3UTZA 3G04B 3O6MH 4PLJD 3WHXB 2BHZA 4AIZA 3TO4B 2YPVH 2W65A 4DQOH 1T1ZA 1H3PL 4DKEH 4K3GA 1NC2D 4X4XA 3QEHB 5EU6B 4EI5D 1Q94A 3P30H 3P4OA 3LKSA 1F4YH 3WHE0 4MNHB 1UZ8A 1YC8A 1AC0A 2VISB 4TVPL 1IARB 1MFCL 4Q0XL 4PY7B 5E2TH 2GJZA 4RMVA 4XNXH 1D9KA 1CLYH 1P7QD 1M1SA 4JB9H 1RULL 3EFFB 1JF5A 4XMKL 3LPFA 5HGDA 4OB5H 2D4FA 2DM2A 4LSRH 3NCJH 5LJYH 4HX1A 2P43B 2PYEE 5IESH 2FATH 2EE9A 3SGJA 4FFYH 4UI2A 3UTPE 4MQSB 3O8XB 4NUJB 3R4DA 3QFJD 1LHZA 4NM8H 3VXOA 4IOFD 4KKCD 1MRFH 4LASL 5BS0D 3WFHA 2HVJB 3C60B 2E7LC 5EUKA 1U0QA 4CVWA 2X70A 4HIIB 3HNSH 4N0YH 5HHQA 1CQKA 3Q6FA 5C6WH 3C2AL 1AGCB 3CFBB 5J1AB 2HLAA 3BPLB 3GSUA 5CJOH 4MA8L 3HE6D 3TV3H 1ZTXH 5FK9B 3A6OA 2JK5B 1YEFH 3KLAA 4YHIB 3KXFB 1J0HA 5DQJB 1R3IH 3SGEH 1EAPA 1XGUA 1HHJA 2FECL 5LKNA 5T1KA 2X9YA 1T1WB 1A4KB 2P7TB 1BREA 5ESAA 5DT1H 3DMMA 1D9KD 5F9AC 1A7OH 4YHPA 5DF0A 5DUML 1P7QA 1BAFL 2R23B 3G08A 5J6GA 3T0EA 4OLXL 3EO1A 4WW2A 3TO2B 1HXYA 5TDNB 4RDQG 4TTGA 3FRPA 4OAWA 3RUGF 2FYYA 4I0PB 3GBNH 1JPFB 1P4LA 5CZVL 2QQKH 1EEYB 3CNKA 3OKOB 4L4TD 4O58L 5BRZD 3DYPA 4ONGL 3SJVB 2BOBA 2CIKB 4LHUD 3UYRL 5ICXB 3HC4L 3BQUB 1TQBB 4QLRA 4K55A 2HLFC 1FN4B 1XR8A 3O3DA 3RI5K 4XPAL 3CFKA 3PP3H 3VH8B 3MSPA 1RUAH 4PJHE 5L0QB 2J8UF 1OP3H 1Z9SA 4LPTA 4YO0B 2IH3B 3TCLA 3QZWA 2DJ4A 4NUJA 1KTLA 1MCFA 2PO6D 1KTDB 1A5FL 4LK4A 5E8OA 5I1DB 3MLUL 2R4RH 4TVPD 5DEGB 4GQ9L 4Y5VC 3SDAB 1IM9B 5D1ZC 4WTXA 1TVBB 5JW3H 5C08A 5M94B 5F7UA 4G42B 2GITB 5ESAB 1BEYH 4PB9H 1UM6L 5IVZA 3ZL4H 1YEHH 5F6IB 1QLFB 1EZVX 3NCYS 1NCBH 4K71C 1HH9A 3ELAT 1MNUH 1E28B 4JQXC 5DJAA 3ZT5A 1BECA 2VC2L 1SM3L 1XF1A 2FJFA 2VQ1B 4NT6B 4DTGL 1CXHA 1BJ1J 1SHMA 3Q3GB 2YMXL 3L9RA 4YHKH 3L3IB 1HSBB 1T20B 1RVFH 4JKLA 2FL5B 4P3CL 5EO1B 2P24A 3MYZA 1P9MA 4R7DB 3I9GH 4TULH 4PJAE 3RPIA 3RVUC 2DIJA 3J7HA 5DK2B 2KUTA 4Q74A 4CN1A 1MH5A 3RQ3A 1GGYA 1CU4L 1MI5D 5IFHH 3DX9B 2O93L 4NP4L 3KPNA 4K9EH 1QVOA 1OWRM 4U31A 1V3LA 1BOGB 3TPUA 5C0EB 5HHMB 4P99A 4CJ1A 3DXAE 3BE1H 1CR9H 3MRPA 2CJUH 3O0RL 4BYHA 4XVUC 5ITFA 1QTYT 4EBQH 1EEUA 4I48B 4U1SB 5GGUA 3MBEC 4ZO7A 3WNOA 4LLVA 3ZL4L 1KGCD 5DVKA 4OFIA 2IANE 4GG6A 2E6QA 3MOAL 2IANA 4IEFB 2I9LB 1A21A 4QRPD 1FRGH 1LO0L 5JXAL 3C5SA 3WIHA 4AZ8A 5KTEL 5CEZD 1T7WA 2LTQC 2DB8A 4QRRB 4P4KC 4J3WA 3FB5A 1FAKT 1UZ8B 1NAMH 2AJ3A 3TESA 4BZ1L 2EZ0C 3I6KA 4RFNB 3TNMA 5KAQF 2PO6C 5H8DA 5IBTL 5I8OH 5K9QI 4U1IB 4Z7VB 4KZDL 5D1ZD 1T3FA 3SKJL 2AABH 1YYLH 1UWXK 3IKCB 4EXPX 2NY0B 1C7SA 1HDMA 4OFPA 3DTXB 2E7HA 4UIKH 2YK1L 4YZFF 4NDMB 4KAQL 5D1ZB 4NIKB 5IWLA 3OHXA 5J13C 1QKZH 1AI1L 4D9QE 4XMLH 5I8EB 2JB6A 1FPTH 4NO5B 1IGCL 4JRYA 2R9HD 1NCWL 4TSCL 1RZGA 3MZTA 2W91A 4B7IA 1AO7A 2HTKC 4NQCB 4WCYL 3TWCH 1NAMB 3GNML 3WS3A 4M6OH 3EO0B 3DHMA 4LQFH 1F2QA 2JB5H 4TN9A 4PRIE 3TYFB 3TVMA 2N7AA 4MAUH 4PRPB 3FO0L 4QRTA 5HYJD 1UACL 3N0PB 1D9KB 3QNXA 1PSKL 5EBWA 2V5YA 1AFVH 4MS8C 5GS1C 2ZUTA 4C56D 3HTLX 4UQ2B 1F3DH 5HXMA 3TZVD 2NYYC 2FO1A 3TA3D 1K3ZA 4QHMA 4WO4A 2CKNA 4IRJD 1SYVA 2XZZA 3ARUA 4ZQKA 3A6BL 3QIBC 2I5YH 2G9HA 2A83B 1EA9C 2E7LA 4X6DE 1SJHA 4PRNA 3S35H 4F33B 3VFOB 2GK0A 3RY4A 4K7PH 3NGBB 4ZUTA 5HGAA 3BIAX 3BPOC 1OAZH 4IRSD 4JG0L 4TUJA 4X9FA 4ZSOB 4IHOA 1BGXL 4S2SB 3BEWA 4HUWA 3WXWL 3ZHKA 4HUMB 4TVSa 3ZYZA 3MA9H 2V7HA 5GJTL 4G8IB 4K94H 5CD5C 5T3ZL 1H8OA 3LZFL 1XEDA 1MWAH 3RNQA 3B3IB 3ULVH 3HAEB 5IBLD 1FYTE 4XP5H 4J3TA 1OAYL 4MD5B 4FMFA 3E3QE 3G5VB 5T3ZD 3MRFB 1ZT4B 3JTTB 4YDVB 3HE7C 4JZNB 3VI3E 1U41A 3WS3B 1YYMH 1OCWH 4LLDA 5ADOL 3CU7A 5I8KH 1ORSB 5I30L 5LCVH 3U7YH 3C08L 4DKAA 3CFJB 5I1JH 3S8WA 1G9MH 4UTAH 2AQ3A 1XGTA 4Z76B 4FQXA 4WHDA 1RUPL 4OCNC 3NMEA 4DKFH 1BQHB 5KOMC 2NX5B 3IAPA 4FG6D 4MJ4A 5E8OB 1VENA 4KKNA 2GY7B 4I3RH 5D1XA 1DLFL 3MACL 1ZLVK 4OV5A 3PHQA 1JPGB 4PJFB 5EBMA 1I3GL 1HDMB 2BFVH 3PWVB 2BVYA 4F3FB 3LB6C 4NT6A 4HH9B 2C3HA 4KY1L 1AQDA 2GTZA 2H8PB 4U3CA 2YHGA 4ISVA 1FZJA 2E6PA 4ODBD 2Q6WB 3PIQB 3MGTB 1YEJL 4NCDA 1XAUA 4YHOH 1FZOA 1KTLB 5JIHA 5JHLL 1X5XA 1FAIH 2VLKA 3HR6A 4I0PD 5EU4A 4B5EA 2HVKB 2IQ9H 3ZE2F 3IDXL 1BFOB 4OD1H 4N8PA 3VWKA 4C55A 3FQNA 3GMRA 1MVUB 5F1IA 4KDTA 4PYHA 5T1DL 4PS4L 1F6LL 5T1MA 1KN2L 3MXVH 2FJGB 5F7FA 2G75A 3TVMC 1XCTB 1QD0A 1MCKA 3QR2A 2SEBA 1SVZA 4FFZL 1PZUB 1CGYA 4X6CE 4X6EB 3FQNB 5IJKC 4IOIB 1WT5A 3QEHA 1UWEH 1A6WL 1T1WA 2QQNH 5EU6A 4JCMA 3BO8A 3BZFA 2QADB 1EGJA 4NSKB 4X6FB 3HC3H 3FFDA 4WTZA 1VCAA 1JZ6A 2HMIC 4ALAL 4ZFFB 1S7SB 3L1OL 4HUXA 2OTWB 2Y07H 5C07E 4AH2B 5EU7C 1WBXB 5JZ7C 3SHSA 5IB2A 4WI6A 3MRQB 2VSCA 1F2XK 3PE9A 5JDSB 1OQXA 4WWKA 4MNGA 1I1YB 3G6JE 2E9IA 2XTJB 1GOGA 3F7VA 3IDXH 2YA1A 4KJQD 3QCVL 1ZVSB 4DVRL 3VGHA 3R8BB 1XT5A 3ECBA 5C2BL 5FDWB 3SBWC 1J7VR 4G8GE 3NABL 4GKSB 4P2OD 3CVHA 1RHFA 3O6FD 3TBSB 2NY1D 2XRAH 4PBWD 1P9MC 1WEJH 4BFIA 2WBJC 2DQDL 1NFDB 2NY3C 4JFFB 3DBXA 4U0RB 1CFVL 1AY1L 4F37F 3ULVC 1DEEB 1F3JB 2W0FB 4LSTL 1HIML 4HBCL 5HHPA 4K94C 1I9IH 2ICEB 4JR9L 3QDGA 4A6YA 4G5ZH 4RGMB 2EH8L 4M1CD 1PAMA 4GRLB 4J8RA 4JPIB 3SGDI 1E6JH 1KPRB 1F6FB 5DS8B 2HJKA 5I8KL 1ZSDB 4BFGA 3VD9A 5I30H 1ZA6B 4FQIL 2IQAA 5LXGL 5LAXB 2W65B 43CAB 4OCLC 1MIML 3B5TA 4F58L 4UZGA 5GRJH 1QO3A 3ARBD 3QUYC 4QCIB 3AS0A 5AAWA 2FYYB 1DLHB 2X4SA 1EHNA 3FQWB 5SWZB 4WEBH 3MRKA 3TA3B 1B0GA 4OM1H 2HWZL 4IMKA 1JWUB 5FYKU 1F11B 1JPTL 4IDJH 3ARSA 5GJSH 3HZVA 4HMEA 4I5BB 4X7CC 5DJ2A 1A02N 2V7HB 2VLJA 3LKOB 4XBEL 2P42B 4LNVA 4DWHA 3P11H 3B83A 3QG7H 4Y4KA 4ZDHB 4HAGA 2QQQA 1VACA 4WO4C 4XXDA 3RY6C 4WW2F 1RK1A 3LSOB 4ELKB 1CE6A 5E4IA 5C9JB 3O11A 3EOBA 2FBOJ 3LEYL 2F5AH 1KCKA 2YK1H 1IAIH 1UKSA 4APQA 4QHKJ 4G8GA 3S7GA 1S3KL 4KQ4H 5T5NG 4AIZB 1I1AC 5F88B 5KAQG 5C0JA 1XIWB 2UVFA 2Y7QA 1D6VH 1FSKB 4L1HA 3C8KA 4KZDH 2IANB 4Y5YB 3WJJA 2FEDD 3QIUB 3P9LA 1UEMA 4R90H 4TNWF 1MJ8L 5TFSH 1T0NB 5CBAA 3TJEH 5FB8B 1NLBL 2R2EB 3MJ8A 1H3GA 4Z7VF 4BSWA 2XZQH 4S1RH 4TUOB 2EXWC 5F3BB 4JY4A 1NCAL 4KU1A 4G8GB 4XH2B 1CFNA 5DGQA 2K7QA 4ZS7H 3PV6B 2JJTA 4PJ5E 1F4XL 3FT3A 4HHAB 3DVIA 5L7XH 5IB3B 4DAGH 5EU6E 2VQUA 4B7LA 3WIHL 4P2QD 3OKEA 3VWJB 4F15C 3MRJB 5C2UB 1OW0C 1EO5A 1BVZA 4L8BA 1DQDL 2B8OT 3N1GC 5IBLC 3QUYA 4Y4KD 3IF1A 2A9MH 3DBXB 2D7MA 4EJ1C 1FCGA 3IDYB 4MD4B 1MCIA 2R23A 3G08B 2VZ3A 2I60H 1CF8H 1CWVA 2PYFB 3WXWH 3ILQD 1NAML 3U9PL 2BVPA 4KKAC 4RWHA 4TULL 4OD3L 2JCCB 3RL1B 1DE4B 3ZKSD 5IVXB 1FJ1B 2XPGB 3FTGB 4OQ1A 4Q9RH 5K59E 4UV7H 2E27L 1NKOA 3A6BH 3BGFB 3PWUB 3B9KC 3ZTJG 1YN6A 4HKJB 3OGOE 3DI3B 2EDYA 1WITA 5FYJE 2GTWB 3TYGH 2FD6L 4U1IA 4Z7VA 2X4UB 4PLNC 1UYWL 5E8PA 3QEGH 4WW1A 4MJIB 3S4SA 1ZHBA 1PY9A 1MUJA 1LGVA 1KTDA 5MEND 1MI5E 3IRPX 2OTWA 3GHEL 4OZGA 5IHBA 4PG9A 1KFAL 4GW4B 2EDLA 4Q9RL 5F9OH 4YFLI 2FJFB 3T0AA 2BVUA 3DRQB 4UIMB 2CLRA 5TDPB 1S3KH 4KQ4L 3GEWB 5D1QB 3KYKH 3T2QA 3CX2A 5ENWB 3T2NH 1QPPA 2YD7A 4GSDH 1P69B 1AXSA 3P73B 4O58H 1QBBA 3AREC 3CXDH 4R7DA 2FJGA 4HKZB 3RHWF 1GVIA 5J6HA 1UJ3C 5ISZA 1EUUA 2OQJB 4OI9A 4I0CC 5BV7H 4C58B 1GZQA 2RR3A 4H20H 3SY0B 3UTSB 4XBEH 2BOCB 3S96A 4CMHB 1LDPL 3H0TB 1RQ5A 2YSSB 4RQQA 4LKCB 5DK0A 2VC2H 3ZDXF 3CC5B 3ZDZF 1IFHL 4K8RD 1HH9B 1QSFA 5HPOA 2R29L 1BJMA 3RBGA 1Q72L 4ZFOA 4GW1A 1RZKH 4AEHH 5IM7A 3O2DH 4HKZA 1UYWH 1ZT1B 1G7PA 5K9KA 4W6WB 1T2QL 2CUIA 3P77A 1Q9WA 1B6UA 1T0PB 3OXRB 5MENA 2F53A 2NLJA 4LPVA 2R4RL 5TGBA 2EZ0D 2VR5A 5JHDA 2Z31A 1B4JH 4OZ4B 4JDTL 4BQ9A 1KBGL 3CFIC 3GKZA 4YIQB 4XVSH 2I9TB 5CCKH 2WNGA 1Q9LA 1A1NB 4WHYH 3KLHD 2XQYK 1RIUH 5J9PA 4L8SA 3OAUL 4M5ZL 1KLUB 2MKWA 2L7UA 3O2WL 2XWTB 3ROLA 1RHHA 2BHUA 5DMIL 5E24E 1PYWA 3VXSD 1KELH 4EVNB 5FGRA 5MHSD 2P5WB 3FRPG 1QSFB 2XICA 4X5XA 5J1AA 4HK3J 1RAMA 1U42A 2D7OA 1FYTD 3LKNA 3SQOH 2GSIA 1WVZA 3DYMA 3H0TA 3EO9L 3KYNA 4NN6B 4R4FH 5IGXH 1KXQE 5FYLD 4K7FA 2NXZC 3INUL 2NY6C 3F7RA 1ZLUK 1MCBA 2N1KA 5C0IB 3BFOA 5ACZB 1MHHA 5L88H 4LFHG 2EXYD 3OX8B 4PJDF 3V52H 4YGVB 4MS8D 2DI7A 1JNJA 15C8H 4ELMB 5C09E 4YHMH 4RAUB 3KVQA 3H9SA 3C2AH 1ZTXL 3VXSE 1JZ2A 4BK5A 4YHZL 4PRID 3D3VE 5GISH 5D5MA 1HOCB 1A9EB 4HDIA 3RWJB 5F1OB 1XGPA 2V6HA 5CINH 3X12B 1AD0B 5HYJA 2Z8SA 4YDIH 3LRSA 1OY3B 1WWWX 2I07B 4QHMB 3D25B 3OPZH 1XGRA 3T77B 1NEZG 5CEXA 4NOFA 3S3SA 3BH8A 1R3KB 1N6UA 3NCBB 4QRRE 4L29B 3SGKA 2IAMD 4ZOCA 4JR9H 3U6RB 3HE7B 4ONFL 2QADC 4RISL 4XC1H 2BSRA 3TJHD 1S7RB 2HJFB 3BQUA 3IS1X 4JO2L 4U6YB 1AY1H 1MCHA 4ZQKB 4HK0A 1TJIL 3L5IA 5CJ5A 4QHKI 2ZCLH 2VLRB 1RI8A 3DGGA 2QBWA 3MRBB 1OP3K 2FX9H 3H9YA 1GC1H 3RPKA 4NQVA 2FR4B 3LRGA 3IKKA 3ZHDA 1KN4L 4ZFZA 5CBAB 4LDLB 1A3LL 1IEHA 1AC6A 2ZOLB 3HE7D 1UM5H 5HSFA 3QG7L 2KPNA 4BSVA 1CXKA 1OQOA 3IDGB 5FYJL 2BVEA 2ZSVB 1RPQA 2MNUA 4O2FB 3G6AA 4OCYH 1BZQK 3BPOB 1MHCB 4HK0B 5EB9A 3H3BC 3BZEB 3ABZA 4M1GL 2PR4L 5IB3A 1N3NB 5L9DH 4ESKA 1S9YA 4ZXBD 3CFBA 4UB0L 1PEWA 3PL6C 1FVDA 1ITCA 3OF6D 3VWJA 1H3VA 3QAZC 4JN1L 4PRIB 1LVEA 4CKVX 3MLWL 4NO3B 3MLYH 1NEUA 2DQGL 3GIZL 4KQ3H 5GGQH 3PWPE 3ZSSA 5C0AE 5TQ0L 5E5MA 4O2FA 1F42A 2QQNL 4JM2F 5AG9A 4MXQC 1CD8A 3I75A 5D93B 4GT7A 2V9RA 4ODSL 1SJEB 2ICWJ 5CILL 1A6UH 5FGCE 3L95B 3BQUD 1KPVB 5CSGA 1HH6A 1FFQA 4GG8B 1DTUA 5CD3A 2EEAA 1UG9A 2ATKB 3SDCD 3UYOD 1MEXL 1Y18A 5JPMA 2AI0H 1WFOA 1QA9B 5C07D 1A47A 3MPCA 1J18A 4R4ND 5DVNA 2CXKA 1XIWA 5D71L 3RGVA 5J13B 1MLCA 5HVWA 4FTVA 3IFPA 4HKXA 1OAKL 5C2BH 4O51A 4LVOC 5GS0C 4G8FA 5C0AD 4OF0A 5TH2A 2IAMC 1V05A 1IM9D 3U36B 1NGZB 4F7PB 1VGEL 4L8DA 2PO6B 3AFLA 3D9AH 3G6JA 1ZGLB 3IDJA 4OCWL 4Y16C 4WJ5A 4JO2H 2XN9E 5GGQL 2OCFD 2E9JA 2GW5A 5TGBB 2MCG1 3H3PL 4ZMAT 3C60D 4NO0B 3UTQA 3MRKB 4P2QE 1UA6L 3TH4T 5JPNB 4AMKH 3C08H 3QXWA 3MBEB 4BQ8A 4UTAL 4XCNB 4IS6B 4MD0A 5CZXC 3IKCA 4LSPL 3ARRA 5JQHC 2LU3A 1G7HB 2O61B 3SE3A 1WBZB 4XPBH 1G7QB 4G6AC 4WFEE 4TTDC 4K2UH 3SE8L 2HT4D 3V6ZA 3SDCA 4LCWA 3DNKA 4M7LT 1JWMA 3KYOB 2FZ3B 4PJHA 2ZCHL 4NKDA 4PGDA 5BOPA 5AUMA 4PY8J 3WKML 5FCUH 2VXQL 5I18L 1DE4A 4GAJL 4IBLT 3K8LA 5TE6H 2X9WA 2PW1B 1IT9H 5IGXL 1U6AH 1X9QA 3KPNB 1KJ2A 5BW7A 1DFBL 3MLTA 3GJFA 4LPUA 5C0AA 4Z7OE 3O6KH 3VGFA 2AJXH 2OI9C 1JUFA 3JWOC 4EI6A 3GRWA 4OZ4A 5FGCB 3K80A 5F1SA 1WFTA 3U4EB 4LEOB 5DJXA 1RZ8B 1EDQA 1KPUB 1A6WH 1QSVA 3VFRB 5HDBE 4CMHC 4M7ZC 2DIBA 5D70L 1MHEB 4RSVA 4YDIL 1X5GA 1AFVL 1QUNA 4U1KB 4GW4A 1FN4A 1HINH 5GGRA 4HAFA 5DUPL 2H1PL 1HE7A 4M7ZB 4MAUL 3AREB 4EVNA 1CICB 4NKIH 5DJCA 1IC5L 1Q8MA 2WBJA 2YZ8A 4JAMA 5HHOD 5HY9A 1LP9A 1KXTB 4PV8A 1IGYB 2VL5A 1KCSH 2D3VA 3BI9X 1BF8A 3K3QA 5AAMA 1DVFA 1RK0B 3DVNA 3OWEA 4NPYB 4Q2ZB 3PWUA 5CGYD 4JFED 4P3WA 5A3IC 1L0XA 1Q0YH 2LVCA 3PDDA 1GZPA 4MSWB 5HGBB 2OP4H 3RWFB 5AUMB 1R5WA 1EIBA