1E30A

Crystal structure of the met148gln mutant of rusticyanin at 1.5 angstrom resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
LDTTWKEATLPQVKAMLEKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTNFTWHPTAGTYYYVCQIPGHAATGQFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rusticyanin
molecule keywords RUSTICYANIN
publication title Role of the Axial Ligand in Type 1 Cu Centers Studied by Point Mutations of met148 in Rusticyanin
pubmed doi rcsb
source organism Thiobacillus ferrooxidans
total genus 34
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1e30A00
1L9TA 2IDSA 1AQ8A 2HX9A 4A2GA 1JXFA 2YAOA 6PAZA 3T6XA 2P80D 2XXGA 4HIPA 3SQRA 3MX0B 4YSRA 4DPAX 1J9SA 2HXAA 5TK2A 2BO0A 1HAWA 2GSMB 4DP5X 2JKWA 3CDZA 3NJJA 1AZUA 1GW0A 1M56B 4KNUA 3TA4D 4KO7A 4GXFA 1JZIA 1PZCA 2ZOOA 4KNSA 3ASNB 3FU7B 2FQFA 4HCFA 4UAHA 2HX7A 3OMAB 1HFUA 4AKPA 1KCBA 1A65A 3NJNA 2J55A 3FSVA 5I6PA 2WO2B 5B1BB 4YVUA 2BWDA 4GP5B 2FNWA 3AG3B 2XV2A 3PPSA 1BYPA 1AIZA 2FT7A 2I7SA 5I6OA 1J9RA 3AY2A 3N2JA 2BP0A 3FU9A 3MBWB 4F2EA 3S3CB 5D4JA 2R7EB 4QKTA 2QDWA 1QLEB 3FPXA 4HCGA 3AW5A 2AVFA 2PPCA 4GY4A 3DTUB 3AG4B 3EH4B 1MG3C 1NZRA 2GIMA 5B7FA 3AG2B 3NSCA 2YXVA 2PCFA 1A3ZA 2BW4A 5B7EA 1PZAA 3FPYA 3ABKB 4P5SA 2J5WA 4K9JA 2XV0A 4HAKA 3QJTB 5F7AA 1X9UA 2AFNA 1JVOA 2YARA 2WO3B 4KO9A 5EHFA 5IY5B 5LDUA 4YSQA 5TK4A 2AZUA 1L9RA 4W1TA 3S3BB 3T6ZA 4DP1X 1XB8A 4A66A 2EIKB 4FA7B 1GSKA 2OCCB 4DP4X 5B3SB 3NP4A 2MTAA 1PF3A 4NB7A 5I5JA 3FU7A 4A2DA 3HB3B 5ANHA 1NPJA 3ERXA 3IN2A 2PCYA 1BXUA 2IWKA 2N0MA 4G70B 4YSDA 2Y69B 1URIA 4KO6A 1E67A 3QJVB 2AZAA 1L9SA 1MZZA 2CCWA 4CSPA 2HRHA 1ET8A 1WS8A 1NPNA 2BZ7A 1BAWA 3GDCA 4E9RA 1FA4A 4YSOA 3JT2A 4BDVB 4HHGA 3NP3A 4GYBA 2VMJA 3QJSB 1SF5A 2YXWA 2I85A 3FQYA 2FTAA 3OMNB 2FQDA 1OV8A 2YAQA 1CURA 1NWPA 2PPDA 1AZRA 1GS8A 2H3XC 2OJ1A 3FQ1A 1PMYA 2I7OA 2ZXWB 1DZ0A 3TBBA 1OOWA 2YQBA 2XX1A 5I5MA 1AG0A 1WA2X 1TU2A 4DPBX 1QHQA 1NIAA 2RACA 3FS9A 1JZJA 2VW4A 1OE2A 5D4HA 1SNRA 2DYRB 5A7EA 5I6MA 4DP2X 2EILB 5FC9A 5D4IA 2A3TA 4X4KA 1OCRB 4KOCA 3X1GA 1AR1B 1NWOA 1A8ZA 1AS8A 1AACA 1SDDA 3QPKA 2PPAA 2QPDB 3UABA 4A2FA 1N68A 3UADA 5I6KA 4F2FA 3FQ2A 1PNDA 1NIEA 2XX0A 3EH3B 1KDIA 3NYKA 1BQKA 2BP8B 2DWSA 2FJSA 3D12B 5PCYA 4JKNA 4E9VA 1ZIAA 4E9YA 1BQRA 4F7KA 5AFAA 1KBWA 2UX7A 1RZPA 8PAZA 2IDUA 3NJFA 3SBRA 1KCWA 2HX8A 5I26A 1L9QA 4JHVA 1YLBB 2VM3A 3KW8A 1IUZA 1N70A 2BZCA 2PLTA 1M57B 4WKXA 2HRGA 2IH9A 3PLYA 4BDVA 1ZV2A 3G5WA 2FWLB 1OCZB 4E9SA 1ZDQA 2IDFA 1IBZA 3AZUA 3DKHA 3NJKA 3X1BA 4AKOA 1AZCA 5B1JC 3T6WA 3H4FA 3WKQA 4DP7X 1OE3A 4GP8B 2X87A 5E9NA 1HAUA 5B1JA 1PY0A 4A67A 4DP6X 1GY1A 2UXFA 3NJGA 3QJQB 4E9TA 3ZBMA 1ZDSA 3WNJA 3PAUA 3QJRB 1JZFA 1IBYA 1ZPUA 2UXGA 1PLBA 4TXVB 4UANA 3UAAA 4BWWA 2CUAA 2GHZA 3NJIA 4UF7C 4DP0X 2WSDA 3WI9A 5I5IA 2CBPA 3S3DB 2VW6A 3UGEA 2CAKA 3CG8A 4G71B 4G7RB 3NJMA 4YVNA 4G72B 1OCOB 1MG2C 3EHBB 3FYEB 3CVCA 3SBPA 5B1KA 2BP8A 3L45A 5F7BA 1NICA 3UACA 1W6WA 2PPFA 3H4HA 2EINB 4YSTA 3ZDWA 2H47C 1GS6X 1JZHA 1JXGA 2XVBA 3PXLA 3QJUB 5B7MA 2QT6A 2EIMB 2TSAA 1CC3A 4W9ZA 3T6VA 1BQ5A 1A4CA 4M3HA 2AANA 1KGYE 1SHXA 2E86A 1FFTB 3WKPA 2UX6A 1GR7A 1A4AA 2W8CA 3DIVA 3TASA 1V54B 3NSYA 1AANA 1B3IA 1PCSA 4L0PB 4AZUA 4YSUA 1J9QA 3EH5B 3NJLA 1E65A 4Q8BA 2JXMA 3HEIB 2XV3A 4PAZA 1UATA 1EZLA 2CJ3A 2R7EA 3CDZB 1V55B 1FWXA 2BW5A 2Q5BA 1ZIBA 1VLXA 1ILUA 1AZNA 2MRYA 4BK5C 2BWIA 4CSZA 2XXFA 4MFHA 2VM4A 5I6LA 3IN0A 1SHWA 1ASPA 1ILSA 2OV0A 2ZWNA 4HALA 2HZHA 1J5CA 1GS7A 1BXAA 3CVDA 3NSDA 1TKWA 3X1NA 1OF0A 4HCIA 4RH4A 2DY2A 5I28A 2VSKB 1NIBA 3PAZA 4N4YB 2BP0B 1NIDA 3X1FA 3UAEA 3OM3B 1SFHA 4N8UA 2YAEA 2DYSB 4A2HA 7PAZA 5PAZA 3ASOB 4EF3A 1SF3A 1AZBA 3IBOA 1BEXA 1AS6A 1NTDA 1V10A 1GY2A 2GI0A 2VSMB 4KO5A 4DPCX 4YL4A 3SBQA 1ETJA 2IDQA 1JERA 2CALA 1NIFA 4ZK8A 1JZEA 2PP7A 1E5YA 1AOZA 3GYRA 4AX3A 3NT0A 1W6LA 1JOIA 3T71A 4QLWA 4YSEA 4E9WA 1DYZA 4BWTA 2YAFA 4G7QB 3RYMA 4DP8X 4AKQA 1NINA 3OQRA 2XWZA 3N55A 1XMEB 5I6NA 3FYIB 6PCYA 3FT0A 2VW7A 2VN3A 1AS7A 2XUWA 4FAAB 4E9QA 4NAJA 4BXVA 3H56A 1QNIA 1L9PA 2IH8A 1KYAA 3TU6A 1XB6A 1W8EA 1WAEA 1A4BA 3OMIB 2DV6A 4AI7A 1AG6A 1PLCA 1PLAA 3TBCA 3S8FB 1MZYA 3OD3A 2IWFA 4GP4B 5AKRA 2TSBA 1ASQA 4KNTA 1GYCA 2XLLA 1NDTA 4HHWA 1ADWA 2FQEA 4WTQA 2GB2A 3U25A 1OE1A 1X9RA 2NRDA 3ABMB 4KOBA 3V9EA 3FU8A 3BQVA 3GXUB 2IWEA 2Y1AA 3ABGA 3FSZA 3FSWA 1CYXA 4A2EA 3QQXA 1EHKB 4M4RB 2QPEB 1MDAA 3CVBA 7PCYA 3FSAA 1CYWA 3WG7B 3EF4A 1SDDB 1JZGA 2UXVA 2YAHA 1IC0A 2UXTA 3X1EA 3T9WA 3CZUB 1I53A 2J56A 1RZQA 1SJMA 1ASOA 4YSSA 1PAZA 1WA1X 2GC4C 1R1CA 4NERA 3ABLB 1WA0X 4BWUA 1E30A 2XYBA 1PZBA 1WS7A 1KV7A 4YSCA 2LLNA 5AZUA 1ET5A 1OCCB 3KW7A 1BYOA 2IDTA 2QDVA 1F56A 1BXVA 2B08A 1KDJA 3BVDB 2HLEB 9PCYA 2FT6A 2H5UA 2XU9A 3PCYA 1TEGA 2X88A 4G7SB 1ID2A 3C75A 4BXSV 3X2QB 2B3IA 2YAPA 1JXDA 1M9WA 2J57A 2PPEA 2PP9A 2FT8A 1J9TA 2Q9OA 1J5DA 3ZX1A 4PCYA 3V9CA 2IAAC 3IE9A 2DWTA 4JHUA 2BHFA 2FQGA 1AAJA 1L9OA 4YSAA 5B1AB 1ET7A 1RKRA 2GBAA 2PP8A 3WNIA 1RCYA 3JTBA 1IKOP 4ENZA 1TEFA 2ZONA 2YAMA 3NJHA 2W88A 3PAVA 1KBVA 1CUOA 4Q89A 3AG1B 2EIJB 1XB3A 4DP9X 2GC7C 1T5KA 4P5RA 3IEAA 3S8GB 1PNCA 1JVLA 4YSPA 1SFDA 1E5ZA 3WIAA 4E9XA 3NSFA 4HZ1A 2JFCA 4A68A 2P80A 3ZIYA
chains in the Genus database with same CATH superfamily
4KU1A 2OL3H 2M26A 1JCVA 1GJWA 4X5WA 1YO4A 1QRNE 3WD5L 4R26L 2OS7A 1KTLA 1QEWA 1T0PB 3CH1B 3RVWC 4OJDH 1OZTG 1HAWA 5FUOH 4OZGB 3L3IA 4PI0A 4QGTA 3VFTA 4KKBD 1M56B 3RPKA 3D09A 4KNUA 5F6IB 1AH1A 1OPOA 3ZW3A 1A6PA 1JZIA 3T3MB 4IRJC 2VSDA 1KLUA 2X2YA 4H44C 3WKYA 4XI5D 1FZMA 1ETZA 5LN8A 3R06A 3STLB 4YHKH 1A65A 1X7QA 4KMTH 4XNQA 1TQBC 1F5WA 4MXQD 3VD4A 2QGDA 3W9EB 4Z7QE 3S0PA 4XBPB 1WITA 1LO3H 1AQKL 2WKLA 2GAZA 3MLRH 3UOAB 3WLWC 4BHUI 3O2WL 3CTTA 1FAKT 2XV2A 2A9BA 4A2MA 1LGVA 3P0VH 3CVHH 4YHYC 4FQ2L 4BINA 5BVPH 3SSGA 2YGPA 2VOTA 2ZNXA 3Q2WA 4D0BB 2G0KA 4AVIA 5C6TL 5BCAA 3AWEA 5C3LD 4A7VA 3KS0H 3DX8B 3F12B 1UWEL 3HRPA 4L8SA 4WJ5B 1T2QH 3LIZL 3V4UH 2FGZA 1MXDA 3FO2B 2JI1A 3HBQA 3RB5A 2DWYA 1E4XL 1DQJB 3ABZA 4NYLA 3EXLA 3RILA 3KS0J 2DAVA 1KXTA 3A23A 1DBMH 3OX8B 3QORB 4QI3A 3D3VA 3PE9A 2MCPL 5KVDE 5DHDA 1WCBB 3DRTA 2D7OA 3INUH 5D6CB 4K5MA 2X0UA 1YQVL 3NEOA 4LLQA 4LSSL 1J9CT 5LDUA 1R3KA 3FQTB 2AZUA 4MNHA 3GMLB 2APFA 3BW9B 2EIKB 2ZCLL 3GEWB 4IOFC 2LE9A 2OCCB 4PV8A 4U6VH 1XF2A 3EGXA 3LMJL 5E8PB 2O6DA 3B4NA 4JDZA 3ESMA 3HB3B 5MP6H 2V7NB 2J21A 3MV7B 5HVHB 3CHQA 1WP6A 4N0CC 3VCLB 1ZGLP 4JRYE 4M43H 1E67A 1HEZA 3P11L 4RBPH 1L9SA 3SCMA 3U1SH 4U7SA 2E7CA 2ZXQA 1PLGL 3OKDB 4QGYA 2Q7YB 1C12B 1QUPA 4OV5B 2WXIA 2CRIA 1QZ1A 2YQGA 5CLTA 5FWRA 3KBFA 1KB9J 4OKVA 5T3ZE 2LVCA 4ODSL 4ANVA 1F2QA 1MJJB 4B9KC 3H3KA 4IK6A 1NANH 5E0QA 1D2PA 5D7IF 4N28A 3GLEA 3MN8A 1MJ8H 1YECL 2IANB 3L9BA 5I1CL 3IDYC 1O7SA 2F7IA 4JFEB 1NFDE 3T6QC 4AENB 5B4MD 3A3YB 1NIAA 4JO3L 4ZSOB 4R0LB 3K6NA 2AKRB 4MD0B 1IEAB 3ZGHA 4OW6A 3WEBA 2NUPA 1PX8A 5I6MA 1RFDL 4JN1L 3JYBA 5IFJB 1BPLB 4Y4KC 1PYWA 2AC0A 3A6OA 1OCRB 4GQ9H 4OLZH 3UBXI 3CN0A 5FM8A 3QJHA 3AS2A 3EDFA 1N5AA 5I0XA 5IVZA 1QUNB 1U8NA 3RWGA 4XNBA 2FZ3B 2YXFA 1N68A 4DZ8B 1G9NL 2PYEE 3HPJA 5J9PA 3MLSH 3O9WC 3OGCB 4I48A 5E8DH 1YRKA 2A5UA 5FFLA 4HBQA 1YG9A 2DBJA 2Y25A 4R4FH 1I9RH 3JV6B 1DL7L 1ECYA 1LO4H 1KJMB 3VD9A 1ZIAA 3S97C 1BZ9A 1J1OH 3C5ZB 2UX7A 5JPNC 3KVDD 5E00A 4EBQH 6TAAA 2RIKA 4Z3JA 3CSGA 4ZT1A 5L9DL 2X1PA 3KW8A 3WNOA 1GZPB 3NA9L 4ORGA 1ZLWH 1P84K 4KUCD 1KTDA 4HW6A 4XPBL 1FQ9C 3RVUC 5E5MB 1QHOA 4GRWB 4JE4B 5IQMA 2G2RA 2V33A 3HC4L 5JHLL 1JF5A 2I26N 3OLGA 2BJML 1E28A 4JFDD 2NLJB 5CLZA 1WT5C 4PRHE 3EYSH 2QFRA 2YMXL 1BF8A 3ZT7A 1S9VA 4UV4L 3MLTB 3LS4H 3ECQA 1ZSDA 2DYPA 3DOSB 1SDAB 5LG1A 1W8OA 3JYCA 2ID5A 1GY1A 3FQNB 4CL7A 1ZDSA 3MBEA 1FAIH 5FB8A 5FYJU 5BZDA 1YQ2A 3CIAA 3ATAA 3DXAE 4YK4C 3K6SB 3I6GB 5TF1H 2H41A 4X6CE 3GS4A 4LU5H 3DO4A 4LSDA 4TVSa 4MMZB 2CUAA 1RK0B 1PSKH 2FLBT 5CJQL 1L3NA 1KGCD 5CS7A 4AGOA 3QSKB 5TPWH 2G9KA 1DQVA 4PY7B 1LEIA 1OAZH 4G72B 1U8CB 4C4KT 2I5YH 3BP7A 4NQVA 1B0RA 4KY1L 2YZ8A 5AB9A 2P4AB 4JPWL 5IUSA 2NTSP 4NRXB 3QG6A 4YQXL 1AJ7H 2OW6A 3BXNB 4M56A 4WDIA 2K8MA 5IBTH 1P4IL 5EU7C 1F86A 5JOPE 1HDMA 1TVHB 2AK4D 5LBSH 3QRGH 3QWRA 4D0CB 2W1NA 2P5WA 5MEND 2B5IB 1AC6A 4PJ7B 1R3LB 1E5AA 2ZG2A 1T83A 1CVSC 2N3JA 2WNKA 3GZKA 1P6FA 1V8HA 1XIWC 4LASL 4OKDA 2GHWB 1RHFA 3MRRA 2LR4A 3BP5B 5C08B 4TUJB 1FRGH 3VXMA 2RFXB 3EFFA 4AT6B 3VD2A 4NAMA 3S35X 1KPRA 4HKXA 3PQYB 3HE6C 5HY9A 5SWQA 3N06B 4A7SA 1B3IA 4AZUA 1RUAH 1XSJA 2CUMA 3E2HC 3EH5B 1S7UA 4OLVH 3TBVA 1E65A 4BEIA 4AM0A 2WUBH 4N0RA 3S96A 3E6FA 4W6YB 4KDWA 5HJ3B 2Z8RA 2HUEA 5CSBA 4FQJL 2XKSA 4J6IA 5JTWA 3MA9H 3TT1H 4GUQA 4OLUH 2P5EA 2W0LA 5IF0A 1WF5A 1JUFA 4PMEA 3VWJD 4UZSA 1P4LB 2P46B 3PFQA 3F7QA 3FONB 3L5WA 1ILSA 3BYYA 1NKGA 2BZDA 1B90A 4K94C 3RDTC 3U9UA 4BK5A 5HGHB 2ED8A 1Y1DA 1F6AA 4FNSA 1VZHA 2WSPA 4GEJA 2X2UA 3M1CA 4XN5A 3T1FA 2CIIA 3LYRA 5JR1H 3P30L 1FGNL 1A4KB 3RZCB 3OM3B 2VIRB 3BMWA 5ETUA 3O2DH 1CBVL 2F8XC 2VWEC 3QWOA 1MCPH 1DN0B 5EB9A 3LTVA 3O3DA 4GIAA 1G5AA 4NQCD 3N1QC 5G4OA 4P23B 1BQHG 2EVJA 2EADA 3TPKA 3DO3A 4JFPB 5D70H 1NTDA 3H53A 3JV0A 4GS7B 1TNNA 1P5VA 4KO5A 5EU6B 3IU3B 3ULUE 1DBKL 2HN7B 3OPZL 5BQDA 1KT2A 5C9KA 5MEPA 5F96L 4PFEA 5EU4B 1TTFA 5D1XD 4NSKB 1LEGA 5DJ6A 3RDJA 4L8BA 4QLWA 5DI8B 5E08L 2R23B 4PD4J 4UQ2B 1A1MA 1Q9KB 2Z1KA 4JCLA 4K94H 2V5YA 5KSUA 3ZPDA 3RGVA 2UZIH 1XZWA 3FT4B 5E1GA 1NLDH 2A6JA 4IBVA 1EZVX 1IFHL 2CR0A 4NM8H 1P5UA 5CKAA 3M8OL 1NBZB 1I1AA 4U0QB 1S7SB 3S7GA 3X3GH 3Q8AA 4L05A 3VXNA 4E42A 3O4LA 4RFOH 1DQQB 3P40A 1MVYA 2NXZD 1YEFH 1HOCA 2DQIL 2W60A 1JGEB 3NACH 3DSFL 4LEOB 5D2NA 2G3XA 3C5XA 3TJPA 1FORL 1XO8A 3UZEA 1NCBL 3J27A 2VDRL 5HBBA 3EO9H 5FUCE 1IM9A 3GBNL 3RI5K 4XN1A 2VO8A 4WTQA 1X5AA 1P6WA 4HP5A 5HYSG 5LGJB 1DBBL 1EDHA 3TT3H 3H0TB 1CD9B 1BQUA 1N8OE 3ARGC 2NRDA 3GBMH 3L81A 4KOBA 2WLHA 4LRNH 4B9GA 3T04D 4K8RC 1K5NA 2VLKE 2ZYRA 3UTOA 3X3FH 4HEME 4U3HA 3UC0H 4QYOB 4J6RH 1G4MA 1TQTA 3BVTA 4BZ1H 2E6JA 1VAHA 4F1SA 3IPBA 3VFSA 1NKOA 1EHKB 4YDVA 5C0GA 5EZIH 1U8HA 3QZNA 5DF0A 1G7MA 4HIEB 5D1QB 4CC4A 4WWKD 4OI7A 4RVBA 3BT2H 3ZY7A 5ICYA 4PRDB 4RDBA 1UEYA 3LZFL 2Q0ZX 3C6LB 5LAPA 2E75C 5MHSD 1I1RA 1NCAL 3EBAA 4XXCC 4YSSA 2X4PA 4DVBA 2A6DA 3QXDA 1WA0X 3VQ2C 3VI3B 1OTSD 1CTMA 1YNTF 3JSSA 1MFVA 5AZUA 2VERA 4JRFA 1J1PH 4KUZH 2QDVA 3BISA 5CGBA 1QQDB 2OZNA 2QHRH 2YUXA 4YHPA 3VD0A 2J44A 3BJLA 1ID2A 4JRXD 1EEZA 4HGWB 4MSWA 4UQAA 5JQ6L 1MFAH 5KSAA 3MLYH 3KLKA 5D5MA 4QXTB 4UOZA 3FN3A 4PV9B 1MCIA 3ILPB 2GPZA 2ZUQC 3FT2A 3GUFA 2X2JA 1CB4A 3G6JA 3WNIA 3P02A 3MSPA 4B9ZA 4NNXB 4PGZA 2FR4B 2OXGB 4GW4B 2G5UA 5FOBA 1RIVH 4F8NA 4OIIH 3IE4A 4UMSA 4F15C 4PSRA 1L4IA 2VLJD 1RL1A 3BFQG 2E7BA 3TCXA 5CN2A 5AW9B 3WN5B 5CN3A 5GSVB 3V8CA 3OF6A 4WI7A 5DEFB 3VXSE 5GS0C 2BVPA 3OL2A 2XJKA 4M61A 5B21A 2CK0L 3OB0H 1GZQA 3KLDA 2KZ1B 2XZAL 3FN0H 5EUOA 1COBA 2FL5B 5DRXB 4QHMB 5L2KA 1DVXA 4NCC2 1QVOB 3BH9B 3OKKA 4HIHB 4HCRL 1DUYB 2VXQA 2XOTA 3BGFB 4JRWA 4NQTA 4MWFA 5EUKA 1ZAGA 1OSPH 1NMBL 2LU5A 5JNYA 4YHML 4LGSB 3OKNA 4XC3H 2K9UA 3TA4D 3KXFD 1G1YA 4PGDB 1XGQB 2MKLC 3MRBA 4PJ9D 1HZHL 3BOVA 4CJ0A 1II4E 5KYNA 1NCNA 1F97A 3VXPB 3EZJB 1CFSA 1KBBA 1DQDH 1KGWA 2ROYA 3NH7H 2YRLA 4MMYB 5IMLA 1Q9LA 2WO2B 1UM4L 3QFDA 1SBSH 3FT1A 2JK5B 4JKKA 2CK2A 4XNXH 1E27A 5GGTL 3DUSA 1B0IA 4OFVA 4A38A 5CCKL 1IT9H 4UU9B 4NC1C 3OAWA 3QCVL 1NBQA 1VF5C 4L8SC 5GRVK 4YO0B 3E6HB 3N2JA 4XMTA 3B7UX 4KKCD 4LSTH 4XCYA 4LLUB 3LNHA 3N50A 1Y7VA 4WJG3 1U8LA 3VFWB 3INOA 2QDWA 3TFKC 1MRFL 1T66D 1KTKE 1G7PB 1UQSA 4HCGA 5C0CA 1C5DB 3GMMA 3QB7C 1AY1H 4DO5A 1UXSB 5DK3A 2PPCA 4GY4A 2C1PB 3AG4B 3N41F 2CKBH 5M94B 3TO4A 3QNXA 3ZDXF 2ENJA 1B0GA 1SXZA 3LKSB 5KEZA 1L0PA 2OMWA 5F70A 4TV3A 3UTZA 2JSFA 3BWAB 5HPOA 4FTVA 4JN2A 4ZO9A 5K59F 3APFA 3OR6B 5CR1A 3REWB 3QDGB 2B1AL 1NQBA 5F7AA 4KJPD 3GMOA 2AJVH 4ZX4A 1ZJBA 1BOGA 4FG4A 4KJQC 2MPAL 4U6HB 1JHTB 1L9RA 3CZSA 1HILB 1LP9E 4YUEL 4A66A 3EDJA 2AP2A 3D7PA 2V5TA 2XBTA 4TNWK 4AUYA 3SYPA 4XZUB 1RIHL 4PI2A 4ANXA 2BVYA 1BVNP 2KLSA 5AWNH 5BS0A 3SCMC 4L3CA 2YKLL 4JO1H 1YEKL 5GZNA 3DIFA 1PEZA 4NPJA 3STLA 1NPJA 2KYIA 4GSUA 3UYPA 2PCYA 3ECWA 4IDLA 4MJIB 4Y9EA 3HKFA 1FN4B 3IKCB 3IS1X 2HT3C 1GH7A 3BZEA 1GGCH 1VCBC 3QXVA 5GZOA 2NY2B 3L5IA 2HG5B 2OQJB 4QXVA 4HK0B 1MNUL 2LV4A 2C3WA 2AVGA 1B4LA 1I4FA 2VMJA 2YRPA 5KVGH 5IEKB 4FZEH 2YXWA 1V5JA 2FTAA 3LNDA 2IGTA 1CURA 4DGYH 1S5IL 3BIBX 1AZRA 2H3XC 2WTOA 4HJEA 3DX8A 3F12A 1H3UA 5F9DC 1FCGA 4WUKH 4K7FB 3VDCA 1TU2A 2VJ8A 1VIWA 1KIPA 4FFYL 4IK7A 4XCEB 2YN5A 2BSED 2FUQA 4JVUA 2EYRB 2GTZB 1SNRA 3HPLB 2DYRB 3IMSA 4Y5YB 3VW3H 4JANB 4Y7MA 4MAYB 4F7CA 3HS8A 2KS0A 3QE5A 5D4IA 3WEXA 1Z9SB 5EIVA 3L1FA 3DETC 2X70B 3S36L 3C09B 3GSQA 4LCUA 1KPUB 4CVZB 1SDDA 4FLOA 1AIFB 2HH0L 5D8JL 2YD6A 3MV9B 3C5JA 2AQRA 1JYNA 3X14B 2ZT9C 1BQLH 2R59A 5IR1A 1NIEA 2HB0A 3IRZA 1IAKB 2YWYA 5L7XH 1UUNA 2F53A 4G6JL 2KDYA 2ADIB 4GG6E 2V7NA 5FYLE 3K1DA 4S0TD 1C5BL 2WN3A 3EXJA 2JQMA 1J8HB 3P69A 1E42A 3VCLA 2FX7L 3UJTL 4ZXBA 4HMEA 5BZWA 2V17H 3E8VA 3O3AB 1KLGB 5ICZB 3FTGA 4QWWC 5CFAA 3VRIB 3GPSA 5CKGA 4NUGL 4I3RL 3BRGC 3NAAH 1TTGA 1WUNT 3PWUA 1FZOB 2NY6C 4AMXA 3O6FA 1MELA 3ARFD 4G1MB 3LKPA 4ONHA 1IBZA 3D18A 4PIBA 1MAML 4JPSA 3U0WH 3K5SA 4TQIA 2DW5A 3RWFA 2ODHA 3PWPB 2AJ3B 3MCKA 2ZXCA 4U3CA 5EBLB 1S7VA 1YEEH 2BP3A 4JFEA 4PW3A 4V1DB 4MA1B 4AK2A 1CGSH 1KGXA 1OPGH 1PFOA 3O8XD 1O5PA 3US9A 4HOMA 2V7HB 1OE3A 2ZUTA 4GRLB 4OBSA 4DKAA 3ZHLA 3KDPB 2L7QA 1WIOA 1N0LB 4GRMA 3K2UL 3DPDA 2UXFA 4BFFA 5HYJE 5IESH 1GCFA 3JBG7 3UEZA 5ADOL 5ISZE 5DQJB 5KYUA 3NJXA 1OP3K 5D7LB 2ZKHL 4I13B 1QUNA 2IV9A 2G9HB 1P7QD 3NJIA 4KKAC 1XAUA 5HDBF 3PXHA 4DZ8A 2CBPA 5CBAA 5D9SB 5GJTH 3I75B 3UGEA 4ESKA 1N8ZB 4X9FA 2ICEA 4WU5B 1AHWB 3REVA 3B9EA 4OD1H 3ARQA 2YGVA 2IH1B 2R0KL 4Z3EA 2WQAA 1Z1WA 1T83C 4M48H 3W5MA 4BQCA 1BD2D 1KJ3L 2BK8A 2ITCA 3P2TA 2OI9B 4OFPA 3ZTEA 5A43C 3A4AA 1LE5A 1E8WA 2GUOB 3DNKA 3UH8A 3QJUB 2XRAH 5T1KD 1T4WA 3LNEA 4WSJA 1MCJA 2ZWKA 3N0AA 4PGBB 5CGTA 4A7TA 2ENPA 5HHXH 2J72A 3CFJB 4PJHE 4RDQF 1HKLH 1CICD 1XXDC 2W8CA 2CWRA 4IDJH 5KWYC 1G7QA 4QUOA 4OIBA 1QSFA 2Z7UA 4GAGH 2VITB 2PN5A 2P52A 3ZRSA 4B9PA 3FRPA 5DUMH 4XOEA 1FYTD 4BKSC 3CUPB 4HPOL 4WV1B 2BNRB 3GINA 2DN7A 3NOIA 2PF6A 1Z9MA 3DV6B 3KH4A 1ZIBA 3KYMB 4YHKL 4ZS6C 1R47A 2C9PA 3SY0B 4L4VB 4AXWA 1JIBA 3I6GA 4QDGA 4TQEL 3MRCA 4ISVB 4BK5C 1W16A 2VDPL 3GKZA 4MFHA 4HFWA 1A6WH 1WUZA 4OGAD 4MMZA 3SDCD 4WFHD 2P5PA 2ZWNA 2COVD 5DMGC 2W9EL 1GS7A 3P0VL 2HFGH 2X9XA 5CIPB 1ED3A 2JJSC 4PJ8D 4PJFB 5J1TC 4PY7A 2EKJA 4YC2C 1AMXA 1IGCH 4OU3A 4P5TA 1P9MA 4L5FL 4WUUD 3ZDZB 4F3FA 3IFOB 3I2CL 4N4YB 4XAKE 1KWKA 5KBNC 2RQ8A 4NRXA 3BQUA 1CQYA 3M07A 5JW5A 2QSQA 4UDTB 1BQHA 5I1IH 3V4UL 3WHE1 4BKTC 4F20A 4F80A 4F2ME 3Q5OA 1R5VB 5HHQA 4FLSA 4EE2A 4YXLH 1DBML 2DKUA 3D2UB 1F00I 3F64A 4ZOBA 1CLYH 1JF1A 1GY2A 2IDCA 3IETA 2OPCA 3WO3B 4UAOC 3HBZA 2RFXA 3NEXA 4TVPL 3R8QA 3VSTA 3WEOA 1E7UA 1JZ2A 1DE4B 3PQYA 1ZVYA 4U6VL 4J12A 1U8PA 3H9YA 5G4NA 4FHJA 2CGYA 4TLKA 3W38A 3RGVC 3TVMB 4CADA 3K7UA 3NIGB 1ZA6B 2FEEI 4KHTH 4PG9B 3T71A 4GMSL 1UC6A 1P5UC 4XX1E 4ETYA 1CD1B 3FTSA 1AKPA 4UIKH 4A2LA 3TEWA 1I1AC 5MP6L 3C60A 4PRBB 3P4OB 1ZTXL 5I6NA 3MV8B 2JF1A 1NGYB 3HAEB 4I2XA 4M43L 5JORB 3U1SL 4TTDC 5EC1B 1VCAA 3FOLB 5DK0B 4Z7NF 3FONA 5J56B 2BXZA 2VR7A 4WQOA 3WY1A 1H3WM 4PWIA 2UWEE 1KYOK 4EI5A 1ZK9A 4FQCL 3UZEC 3FH5A 3CZFB 3B7SA 3HG4A 3ZE0B 5HVGB 2MQ3A 2WKOA 4FXTA 4ANKA 4DZBB 5HYSA 5D1ZA 1CLOL 1MJ8L 2QSVA 5IP4A 3PFUA 4P9MH 4NCC1 2VIRA 3RFRA 3E38A 4FQIH 1U0QA 3BVVA 1IE4A 5BV7L 1JDAA 2VDKH 1OE1A 2E6QA 1ZTMA 3OXRB 3IM1A 3LPWA 4AMKH 1IC1A 3FU8A 4CC4C 4I89A 2C26A 4OLZL 1AO7E 2Y1AA 4GQ9L 1UH3A 4Z7VB 5BRZD 2VN5A 4FMFA 1TQVA 2NNCA 3HS0B 2H0FA 1F2XK 4M4RB 5B38G 3CN2A 5LCVA 1QRND 1EVTC 4BA0A 4MMXB 2LOEA 2EABA 3EF4A 1JZGA 2ENSA 4JFSA 3KVQA 3OKOA 4BFKA 5E8DL 2EKSA 3QPXL 1NAKH 1XV8A 3CZUB 5DRWA 3HC0B 1INQA 1MFMA 4LOVA 3WFHA 5AVWB 2EVIA 1K3IA 4R4FL 1I9RL 3I6SA 1LO4L 4D9RD 2D9CA 1N64H 3CAFA 3SE8H 1J1OL 1E30A 4JUTA 5F44A 1DBAL 3UTTB 1PZBA 5TF0A 1CZ8H 5FGRA 1S7SA 1A7RH 4MNQB 4NNYA 5D7KE 5J5EA 4DT2A 3ULVD 4IEFB 2WP3O 1ZHNB 4DEPB 2IDTA 3B43A 5EC2B 3UP1A 5KSAC 4FG2A 1U6AL 3OAYH 2H5UA 2O5ZH 4ABUA 2GG1A 4J8RB 3RX9A 5E8EB 2CBQA 1FZJB 2PP9A 3EYSL 1E7VA 5J0BA 4NZRH 3V9CA 4W6WB 2WCSA 4AY0A 5C7XH 2Q2LA 4NO3B 1JMZA 4FTDA 3CMGA 2PP8A 5LGJA 2DQEL 3G5ZB 4AYEC 4XO8A 3PDDA 3H0TA 3SJVA 3L3OA 1EHLH 3JTSB 1NL0L 3B1TA 3FCTB 3T0DA 5DC9B 1OGAB 1CUOA 3IDUA 3QHFL 5TF1L 3GWJA 4IGBB 2OYPA 3V6OA 3SYOA 1ORQB 1FHNA 3MUGA 3TTSA 3S5ZA 1ZJAA 4YN3A 1HVXA 1M7UA 3AROA 4HK3N 4OI9A 1OP5K 5D1QA 3G3LA 5AW6B 5TPWL 3Q6FB 4Y0GA 1PD0A 3WKML 2A4ZA 5KBKA 2EDBA 4JQIH 4RMWA 1EGJH 4YDLC 4OIAA 2DWEB 1BLNB 4DQOH 3IK2A 5IHHA 2DL2A 1BMGA 2DLFH 4YSRA 3SDDD 3NN8A 2QPSA 1AJ7L 2YD7A 5A2FA 5IBTL 2CLZB 5E9DE 5HHOE 1GW0A 5DHVH 5LBSL 3QRGL 2EDJA 4LCWB 1N7ML 5EULV 2BOCA 1XSKA 3QDHA 1UH2A 3VG0L 4HIXL 1NAMB 1RJYA 4U1GB 3K6DA 3OSVA 4JRYD 1HFUA 4S1RH 1FNGB 1WJ3A 3O45A 5IROD 3RB7A 3FSVA 1ITBB 1U2HA 3FB5B 4O2CA 5B3NA 5T3ZD 4N6RA 3WIHA 2W07B 4N87A 5I0ZA 4LZKA 1KN2H 2CO1A 1NGZB 1RUAL 2XY2A 4A1RA 4QXTA 4OLVL 3GHEH 4G6FD 2WIIB 3ILPA 1C16B 4ONGH 3RVVD 1ZY9A 2AK1H 1LTXA 4NNXA 3TO4C 5FFGA 4OSUL 3ZTNL 2Z3FA 3LZLA 3MA9L 3MRMB 3TT1L 1QLEB 2ZYHA 4OLUL 4LCYB 1AD0A 4BFBD 2FJHB 4Z7UE 3VSUA 3X13B 4NGHL 4R7XA 4JPIB 2XJLA 4HUMB 1MWAB 2V9QA 1IAIL 1SJXA 4ODUA 1A3LL 1F6FB 4H26A 3FPYA 1OT4A 2XV0A 4G6AC 1NOFA 1I7TB 3AQXA 1QVOA 2CNZA 3OHXA 1YPZE 1X5ZA 4QRPA 2MPVA 4G42B 4W1TA 5IW3A 2ZUUA 5DJCA 2E4TA 5SWSB 4FA7B 2PXYB 4QHNA 3MJ7A 4DCQA 5B3SB 3V9FA 5HVFB 4NQDA 4HD5A 4F33B 5IIEA 1JS4A 1A0QH 4FYTA 4PGDA 3PNWA 3TWCH 3G9VA 4G8FA 3ZYJA 1H0DB 3FBKA 4UZGA 5C07B 5D70L 1S7XB 3U36A 1MSPA 3ERXA 5DJAB 3GRWH 5GZOC 4NN5B 2IWKA 2YA2A 2Y69B 3NDYE 4LLVA 3F83A 1S7QB 1D6EB 4G8EB 1KJVB 1NANI 2YHGA 1VFAB 3GDCA 2VE6B 4FJ6A 4ILDA 3RVTD 3IMRA 5EOQL 1SEBA 2X3CA 1XTMA 2FDBP 4GYBA 1U91B 4S2SB 1BM3H 3QJSB 1XF4B 4YO0A 4G8GE 3SKOA 3VGGA 4JHAL 4LLUA 4YHNB 5MEQA 4XHJD 3VFWA 1VRSA 5IVXF 1RHHB 2UZIL 3MRPB 2XWBB 1NLDL 1DCLA 4M7LH 1G7PA 4OTXH 5T1LA 4NM8L 1DEEB 1S8DA 2H1XA 1OOWA 4JG0H 4AJVA 3LVTA 1VACA 5LGKA 2ZAIA 3WFEL 2P26A 4PWKA 3DXAD 4RFOL 4P05A 2V9UA 5LG6A 3OR6A 3RTQD 5D55A 3ZKXB 3QQ3B 3RWEA 1F6LL 3BVNA 4PRPA 1YEFL 4PLJC 3NACL 3CZJA 3WEAA 1LNUA 1F4WH 4MA8H 4MDJB 5DHYA 4DNLA 2CHNA 1PFCA 4IOIB 4HOWA 3EO9L 3HB3C 2PPAA 1ZEAL 2KLTA 3QNYA 3WTTA 3UABA 1WWWX 4X9HA 2RHEA 1UOLA 1QPKA 2AEQH 3B2XA 2IBBA 4ZXBC 3TT3L 3T0EE 2Z64C 4LRNL 4XB3A 1HL8A 5JOPD 4E5XA 4H1LB 4PWJA 3D12B 3X3FL 5PCYA 3UC0L 5IWLA 3JWNE 2OMNA 4HGKC 4BZ1L 1L6ZA 1BQRA 2ZF9A 3CLEH 2XQBL 4OUUA 5I19L 3O6FC 5KVDH 5F9AC 5EZIL 2KPWA 5I1JH 2VL4A 2R69H 1MCSA 3GKWH 1G6VK 4O58H 3A21A 4WKXA 3PLYA 1I7RB 4WLCA 3V0HA 1QZNA 5KZCD 4IYKA 5IEKA 3IJ7A 2ZAHA 3MFFA 4QTFA 5DMIH 5E2WH 2IDFA 5F7HA 3BUYA 4GXVH 4FJYA 2QEJA 4U6TA 1FVCA 4NKDA 3GBDA 3MO1B 1UT2A 3T6WA 1K85A 1A9EB 4AIZA 4CN4A 5T3XD 4OCRH 4AQAA 2C5DC 1J12A 1EXGA 5ANMA 1KFGA 3GHBL 1TT6A 3FU6A 3SPCA 2XZCH 4B50A 5E5UB 2Q76A 3QJQB 3WLWD 3KCPA 1JZFA 5DC2A 4XVJH 5GS1B 3V0WL 1ZPLA 4I1NB 4IJTA 4WO4A 1FG9C 2ICEC 4ZDHB 1G7JB 1EH9A 1I7UB 4R90H 3MLYL 1B9ZA 4BWWA 2GW5A 2BNQB 3AREB 3MV9A 4X7FC 1KEML 4JFFE 4UF7C 2Z34A 2X4NA 1XH3B 3MJ8B 3X14A 4OZIB 2VDOL 4XCCH 5CHNA 3OKEA 1UH4A 2DKSA 3SBPA 1OTTD 4OIIL 2IADA 3MAWA 2RA1A 1HSBA 4P2QA 5I17B 3TZVB 3FCBA 4UTAH 4HJIA 4LK4A 5FGCB 2Y5QA 3PREA 4HKZB 3O3AA 2YBGA 3GI8H 4NLHA 5T8IA 1NEZB 3ULUD 2TSAA 1CC3A 4JL2A 4W9ZA 2O4EA 3Q43A 3RL2B 4UM8A 3SGKA 4HVBA 4OQ1A 1DQKA 4QNPE 4HUKB 3WIFA 3QUKB 4IRZH 1IC5H 32C2B 4BELD 3PDOB 1GR7A 4M8RA 3W9DA 1BFSA 4LLAA 2HKFH 1GC1C 5HDLA 4LVNC 4D3CL 1JPTH 1IGMH 4Y9FA 2H6PB 5CZVH 3GRBA 2IMNA 5TQ2L 4X6EA 2XV3A 1DO6A 1PKQB 4N5EC 1BIIB 5I8EA 4U1JA 3TNMA 3VG9B 1VADA 2D73A 3O2VH 2QGCA 4TNVK 4MMZC 7FABH 1FHGA 3VFRB 3NJVA 4DSYA 5SX4H 3KPSE 4ZFOL 4ZAKA 4LFHD 3KPTA 3S2AA 1EFXD 4RRPA 1XEUA 4PLKD 1SBSL 1CGUA 4OZHF 2H1PH 2HVJB 3E9UA 3LN5A 4P5TC 1JGVH 4OZFG 1P9MC 2ROXA 4GNKB 3IN0A 1HS6A 3X17A 4LPXA 1SHWA 2G9HA 3K81A 4J3BA 4U0RB 5K39B 2HZHA 3MCYA 3WUWB 3BQUC 3N1FC 1D3CA 2OZ4L 2FECL 1RVFH 4WU5A 1AHWA 3JQOB 4NHUB 1FZKA 5DFVC 3B2MA 4KK5C 4M7KH 1NUFA 5C0IB 3VB8A 3BWUC 2BP0B 2DQMA 3MLXH 1SPDA 5TE6H 2CKBL 1X5HA 1W72H 1NDMA 3IF1A 4ETQB 5L8LB 1Q1JH 4F5CE 3GM8A 1SXBA 1MFDL 1OL0A 4OZGE 2OTUA 3EJCA 5IJKA 3FUKA 4LLDB 2EXWD 1ZE3H 4BE6A 4X4ZA 1DUZB 2ADJA 1USQA 1HQ4B 1QTSA 3T3ME 1FC1A 2NY7H 2E56A 4CMHB 5MERA 5F9OH 3RURA 4AV0A 1A1NA 1MREH 1T80A 4HEPG 2J8UB 1RULH 3C60C 1N3NB 3DBXB 3Q3GA 5K9KA 3BZFA 3BD4A 4PTTA 3L4TA 4LXFA 4RX4D 3U4BH 5E4EB 3VQMA 2A9AA 5AD0A 4NO2A 2XTLA 4I3SL 1P1ZA 5ELIA 2B7DT 2GT9A 4JO1L 5MENB 1EO8H 4QRSB 1TCMA 1WWBX 2YBRA 4KTEH 3FRUA 4PREA 5DD3L 1EJ6A 4L4VA 5DZVA 4EI5C 1IVTA 3CBJB 1AS7A 3O41B 3WCYA 3ARBB 4BXVA 2FX8H 4ZPTB 2IH8A 4ZFFA 3ZMEA 3BAIA 5GGQH 1GGCL 4XPAL 4KI5C 5D1ZC 4JFQB 1A6VL 5IEHB 4FNLL 2A83B 4PJFA 1ZLSL 3FF7A 1Q72H 3HKZA 1UA7A 5KVGL 3N6YA 1AG6A 1HL4A 3Q6GH 3K2MC 4LPWA 3TBCA 2JJVA 5IMMA 1MJ7H 2IPKA 2WTRB 3GHPA 5IW6B 1EHXA 4XVUC 4ZMVA 2NSXA 3V4VH 1A47A 3MOBH 3HI6H 5IV2A 2YMOA 4OAWB 5C0EB 4WUKL 2FQEA 3NIFF 1VJSA 1GMIA 2IG2H 3LD8B 4UQ3A 1T0MB 1W80A 1SY6A 3UX9B 3WMQA 3RKDD 1JPFB 4R7LA 1QABA 1V7ML 3HN8A 5FYJE 1DJWA 3VW3L 4KXAA 5DZLA 1H3PH 5B38A 1BJ8A 1ETA1 3EFDH 4G9FB 2DWDA 3GSOB 3R7RA 5CWSA 3CFTA 3EDDA 1DE4A 4Z3FA 1TFHA 5CXPA 1TO5A 1WIUA 5I0YA 3QRLA 2DQGL 3MV7E 1E9QA 2EDOA 3V4PB 2Z93B 2RB8A 2CUIA 5HYEA 3X12A 4ODVH 3MRHB 4IHBA 4PG9A 4Y16D 3T08A 3T2NH 1O7DE 2EEFA 2Y7MA 2IAMD 4U6XA 2JQAA 2EUXA 4X7SH 2B3RA 1R24A 2Y5TB 1QLFB 3QUXB 3WDJA 5INDA 1NGYA 1XIWD 2V17L 4U3XA 3LEVH 5EC1A 3GJEA 5ERWB 5E8NB 5DK2A 1QLRB 4AGMA 4OJYA 1U3HA 3ULUH 3K6FA 2IANE 4JQVA 1G87A 1MRDH 4X6FA 3QR1A 1JGDA 4ZSOE 5FKAA 4AL8L 5I8CB 4UZUA 3U0WL 1SVBA 2ITDB 5KOVC 1IBHA 4MBOA 1FFNA 5EO0B 3L3OC 1NC2D 4CU7A 1YEEL 1Q94B 2HTKD 1CTOA 1CGSL 1OPGL 3AXIA 3LRSA 2XWTB 5DJYB 5I1HL 1W15A 2AXFB 1RZKC 1X6NA 1RZIA 4Q74A 4AEFA 2E59A 4POZC 5CEXB 1JNJA 3S5YA 3OXRA 5F93C 3PGFH 4ENZA 3VRLE 2EC9T 2G5RA 1P2CB 3O3BA 1WEJH 2K6YA 3O0RH 3BGMA 2IBZY 4Q89A 3BO8A 3WL9B 1AXTH 4YS4A 5D1QC 5D7JA 5D2LF 5IESL 2BNUA 2Z31B 4EUPG 3LH2H 1TJMA 3GO1H 3FQ4A 4NKQB 2Y6SC 2YSTA 1JVLA 4JM2C 2Q10A 4XPHH 1U58B 3WIAA 2WYHA 1MW0A 4GI8A 4O2EB 1XGZA 2JFCA 3LH9A 1KJ2H 2AXGB 5AZ2H 1FJ1B 3P0GB 5GJTL 3K0YA 4ATWA 1HHJB 1AQ8A 4PJGA 2HX9A 4KZEH 4XN8A 3QEQD 2HYMA 4G82A 2QADB 3GSNB 4PJXA 2CHXA 1XGYH 1NBCA 1TMQA 2WANA 4GEIA 4HIPA 4LNRA 4OD1L 4CN1A 1UWYA 5CR8A 1XXFC 5HI4C 3ARYA 4RLDA 4M48L 2EDRA 3M1BB 2WCGA 3ESOA 3IU4H 2WXHA 2P44B 4GRWE 3BCFA 1H3XA 4UM9A 5AALA 2VRAA 2G3MA 4ZTPL 5JA9A 2W81C 4FQHB 1KY6A 4KH9A 5EA0L 3G6AB 1UVQB 4HCFA 2HX7A 2YD5A 5F7YC 4AVKA 3KPRB 4LSUH 4OGYH 4QEGA 3HRZA 5C3TA 3IAGC 3L4VA 1HKLL 5CD3B 2JKTM 5I6PA 1BYNA 5E8EA 2BERA 1FZJA 1GCYA 1QPPA 3D4GA 4GI9A 2BY1A 2BIOA 4HWBH 4N24A 4XCNA 5F7LB 3RX5A 4HWEL 4GB9A 4ERSH 4GAGL 3CIQA 1D5XA 1A6AB 2VZ3A 3V0GA 1FVEA 3SO3C 5DMKA 2X3AA 4PJDB 3JTSA 1A4JA 4X5XB 1UD8A 1AKJB 4X0KB 1NCTA 3WHXB 2VAAB 3FPXA 4APQA 1ODAA 4OM1H 4AQ1A 4AYGA 1YEGL 5B7FA 3ESPA 5AVTB 5K9QG 3OHXC 2PCFA 4U3SA 1A3ZA 3PF2A 4JFZH 4MZ3A 4L1BA 1PZAA 1BCIA 2X9ZA 3CLFH 1HH9B 2HFGL 3UMNA 3VD3A 2OSXA 3ARUA 3UXFA 3Q6FA 3DHMA 4PUBH 1CFTA 2NMSA 2NY3D 2HLFC 1TKWB 4PJ7E 4NRZB 4DN4H 4DFHA 3IGFA 3D51A 4ANWA 4RGMC 1KTBA 2MSPA 2AJYL 3GTVA 4F37K 1Q8MA 5FYLD 1HCZA 5C08E 4XN9A 2IQ9H 3VQ1C 3OC5A 1TJHH 3HJEA 2HT2D 3V4LA 3DX1A 3OAUH 1NAMA 2J71A 3LCYA 3GUTA 1IGJB 2F54E 3IJSB 2XN9A 1KGUA 3KPMB 1FNGA 3TM6A 2H2SC 1SLUA 1U3YA 1S7WA 4P2OD 4OF5A 2RMNA 2H26A 4KO6A 4OJAA 1B2YA 1MKFA 4WO0A 3ZDXB 2BSSA 5E6UB 5KVFL 1EVUA 3HG1D 5DQDH 3ZKQD 4YSOA 1KMGA 4NENA 5L4MA 1L6PA 2ZXDA 3FH7A 1NC4B 4KK6D 1E9OA 5C0RL 4ODXA 2I85A 4G9DB 1ULVA 3SDXF 5ACZB 1MJUL 4FMKA 3DRQA 3L9RB 5AVXB 5LO7A 1F3JA 3MRMA 5J6HA 1JTOA 3FFCA 4L0YA 1Y6NR 1ZGLM 4Z9KB 3PWJB 4RQQA 4P9HC 2WBJA 4IRSA 4RESB 1TCRB 5IFAH 1MWAA 3K8KA 5HYJD 2A74B 3QEHA 4GQPH 3SDAB 1QSED 4FFVD 4LLYA 5ISZD 1DO5A 4Y2DD 2XTJC 5I18H 5F72S 4O00A 3VE0A 2BIPA 1VEOA 4MQXC 3IVKA 1SUHA 1IGYB 2HT4C 4CNIA 5I15H 3FTVA 3EAKA 4NEHB 3QIWB 1SEQL 3G5VA 2ATAA 3U82B 5SWSA 1X44A 4P9ML 4BSVB 5EU6E 4NO5B 5FYKU 5L8KB 2EYTB 2P24B 2V6HA 2VJXA 5IWLC 3FQ2A 3IDNA 1ONQB 2YMTA 3L95A 5E6IA 5EPMA 4AMKL 1UA6L 4HFUL 5C07A 1T5WB 1BQKA 1O6TA 1BIHA 4AGNA 4X5RA 4XMPH 3STZA 3O6KL 4EIUA 4X4XB 4WI3A 5AFAA 4F7KA 5HGAB 3I9PA 3VXOB 1RZPA 4K23H 2KZBA 3B37A 1EEYA 1OAXH 1D5BA 3NJFA 3VGFA 3NPZB 4KTDH 4ZQKB 1JXJA 2HX8A 3HCVA 3VH8B 1XGPA 1L6XA 5IQ9B 2UUDK 4JX0A 1GRWA 4FNTA 1N70A 1PZ3A 2V9RA 2BMKB 1GOHA 4JFXA 4S2SA 3AT8A 3VFOA 3EJSA 1NAKL 4CA4A 1E3XA 1NJ9A 3OPUA 5EZOH 5KSBF 3BP6A 2B4CC 2VKXA 5C0NC 1JJUA 3RJOA 1N64L 2D7QA 3FCGA 3SE8L 3TA3B 3KLHC 4XBGB 1E4JA 1GGIL 1OVZA 3BZ5A 4CVXB 2JV6A 2JJUA 1KXQE 2DM3A 1A7RL 2JXMB 2XY1A 4JEGB 4FKHA 4WO4C 4XPGH 1DLHB 4Q6IA 3L4WA 1CGXA 3Q48A 4Z5RB 2ZJSH 3QJRB 2O5ZL 5DFWH 4F93B 5IG7A 5I1DB 4LP8A 3I02B 1AXSB 4TOYH 1WVZA 2CPCA 4XNDA 2GSGB 1TG8A 2ADFL 2VDQL 3MMEB 1AHKA 1YEHH 2HJLB 4NZRL 2WZ5A 4ACTA 4NZUL 3WKNA 1MH5B 4XAWH 5C7XL 2O6EA 2NY4B 3MOAH 1CGVA 4XAKD 2CM5A 1MCLA 1I3GH 1SJHA 5EV7A 1EHLL 3OZLA 3BEVB 5D7IA 3EBGA 2VZ1A 3RBSA 2C4FU 3QI9D 1QG3A 2WM0A 3B8YA 5EIIG 2A73B 1ZVSB 2B4CH 2EXTA 1JRHL 4J1UA 4R96A 3FKUS 3S35H 4W68A 3SGKC 3S36X 5J12B 3DECA 2NY1C 1JZHA 2CZNA 2RGSA 1D7BA 1K8IB 5J57B 4FQ1H 4X99A 1S78D 3TCLA 3UPRB 5I8OH 2FATH 2VLMD 4M3HA 1WSST 3QDMA 4WAFA 1I7RA 4NFDA 5C86A 2OMYB 3VI3E 4ZMAT 1EGJL 1FG2A 5F1NB 2G75B 3CMOH 3QUZD 3CBRA 2Q20A 3GZQA 4LSRL 3SCMD 3MO1A 5DTFB 1KLFA 2BH0A 4JGJA 4NC2B 4V2CB 3I6LE 5FYLH 3UMTA 4JY4A 1A9EA 1WG3A 4L9LB 3FFOA 5HDBB 3FCSB 3BI9X 2PW2B 4L37B 4ZAKC 3V6BR 4HAGA 1AQDA 1GGTA 1E43A 1BBDL 3EBHA 2CKNA 2HT3D 3H9HA 3MCLL 4OZFA 2B1HL 2FHBA 4FP8L 3F6IA 2PWHA 3PYCA 4QT5A 2JNZA 3HA0A 3GSVB 4BBWA 1R3IL 3WJLA 2R9HD 1KN2L 3MROB 5LNGA 3AREA 2BNQA 4XBEL 2WNWA 3GHEL 3TJEH 5JHDA 5DU7A 2AABH 1XH3A 3MJ8A 3N1MC 4N2BA 4ONGL 5GISH 3LOWA 1QSZA 1UB6B 1N59B 4HCIA 5E6YA 1I8UA 4PVBA 4ACPA 4QRQB 3UG5A 4I85A 2P8LA 4MB4A 3GC3A 4HBCL 3UAEA 5I73B 2PUQT 4NP4H 5IJKC 1PZ2A 2I24N 4XO9A 4FCAA 2AJUH 2CLRB 1RLWA 4JHWH 3VFGL 1K5WA 3K2IA 1RUQL 4GQRA 1ZXKA 4PJEF 1AZBA 1I1CA 1LXMA 1CDBA 5EOCH 4NQSA 4Y7OC 1FL6A 2O6FA 5FECA 2DLIA 5FUZH 4ELMF 1ETJA 5BXFA 5IREA 1RZJL 1DDTA 4GUPB 2CHZA 1VGEH 5FM5M 2GSIB 3DGGA 2QQLH 5DRNA 2C9RA 3RVXD 3MUUA 1RUML 5EOCJ 3ZDYE 1AOZA 4Y89A 4DVRH 2GJ6B 4BHUA 5EBMB 4LT7A 4B27A 2Y36L 3RNQA 5TDNB 1UZ6F 5CGYD 2X40A 2CO6B 1AE6L 4A6YB 3N55A 1HYSC 4XCFL 4XVSH 1IBBA 3A6CL 5D7KD 1LK2A 2FEJA 2IF7A 3LKQB 3QQNA 4PJAF 2OSLB 2HVJA 3WU1A 3C9NB 3RIAK 3L3HB 2CIKA 1UZ8B 3OJDA 4L8DA 2XWDA 4MD4B 3FJTA 5K39A 3UIZA 1F02I 1P4BH 4E9LA 1LMIA 4HUWB 2G4EA 4CC0A 3DJSA 4X9IA 1EAJA 3MBED 1JV2A 4NHUA 3UTSA 4UT6L 3QIUB 2FEDC 4N1EA 2ZCHH 4F9PA 1FYHB 4OTXL 3QDGE 5LKNA 4JG0L 4RDQG 3MZGB 4FL4B 5JDSA 1REIA 2EVFA 3RA7H 3BD5A 3B9AA 4PCSA 3ZLQC 3R1GH 3ULVL 2QL1A 2KUTA 3W11D 3AMKA 4F9LA 2B20A 1PQZA 5TDPB 2A1WH 4RAUA 3S9DB 4S0HA 3B9DA 1JDDA 2HFFB 1F4WL 4MA8L 3ABGA 3GNML 1DQLH 4PRID 1CYXA 3QQXA 4Z7WF 4Y2NA 1XSOA 4Z7NB 1A5FL 4BFJA 3BUIA 2HJFB 1MDAA 1CFNA 3QUMB 5IK3A 3KH3A 4MJIE 2NNFA 2CCLA 1FFRA 4JFHE 4UYQA 3ZKNC 4LEEA 3VYOA 4HT1H 3GD1C 2DLHA 4M5YL 5E9DD 5HHOD 5IGXL 1U3HC 1MHHB 2WVVB 1ZRUA 1K4DB 1KOAA 1R1CA 4XP5H 4JQVC 3TLRA 3VTAA 1BAFL 1ZLUH 1MCOL 3CLEL 4K5NA 1IMHC 1OAYH 3ARBA 5KVDL 4ZPTA 3H1ZA 3EJJX 3MA7B 5IKCA 2R69L 5AUMA 3NIDF 3GKWL 2UYLB 4O58L 4RGNC 2GTWB 2WGNB 2A83A 3FB6A 1ZD6A 4NQEA 9PCYA 1XR8B 5GSRA 5E2WL 1JV5B 2JCWA 2ZOLB 4GXVL 4TF4A 2P5ED 1QBMH 1UACH 3LZPA 2YAPA 3RWJB 3RFZA 1GW6A 3SN6N 1NFKA 3U46A 3UBXA 4OAWA 4K3GA 4WRLA 3FAWA 2EDQA 4URTB 1L9OA 3U79A 4OCRL 5D7JC 4WNQB 4N9GA 5GIRB 5I24A 2XZCL 3MRDB 4KTYA 3FTUA 5CO1A 5TE4L 3AG1B 1R17A 2ICCA 4LMQI 3II2A 3EYVA 4AJ0A 1TPXC 5T3ZL 3QZBA 4AG4L 5HGBB 1XT5A 2CMRL 2GITB 4UV7H 1IEHA 1LEKA 2EIBA 3GK8H 3LQZB 2DQUL 3MRQB 4GAJL 4J3SA 3RWHB 5EEYA 1J8HE 4IBYA 1NCGA 2IDSA 3VMNA 4KROC 4R97B 4XCCL 2XACC 5B22A 4EN3A 4XPTH 4L48A 5CSZA 5DLMH 5GGVL 3QCTL 5CILH 2VLLA 3U9PH 2RALA 5DVPA 4BCXA 1XL6A 4UTAL 3KHQA 3ME0B 4FQQB 4AYID 3HRZC 3AXLA 5ERWA 4KH2A 3GI8L 1QLRA 2XVGA 4W9EC 1EEUA 1O6SA 3MRNB 1HCFX 1FO0B 3CK0L 3MXWH 2D03H 3PWPE 1I8KB 1SN0A 3D69B 2O93L 4V1DE 5EDSA 2MTPA 3CLWA 4J4PD 4YPGA 3I9AA 3OG4B 4IRZL 1IC5L 3EFOB 5F0JB 5MI0B 3F5WA 2NYYD 4K7PX 5KYYB 1CE6B 1ZWIB 2Z92B 2HKFL 5EF1A 1F4YL 4M93B 3IMWA 3HBGA 5I66B 1IGML 3B1UA 4YAQB 4L1DA 3LKRB 2XWTA 4APQC 3F62A 3O4LD 5F89A 2X4UA 4OZIA 5E23A 4AQ1C 3EGSB 4BH7A 3CDCA 2MQGA 4EDXB 5D7LE 4KKNA 5DHXB 3PL6A 1FLTX 3KLAB 3PUUA 1B4JH 3O2VL 1WZLA 3TYGH 7FABL 2D0FA 3VI4F 2ZOWA 5A6LA 3CFBA 1SRDA 3ESUF 1A66A 2H9GB 1YNTA 5E2TH 3S37L 5ESAB 3T8XB 3LY6A 2VMEA 3UO1H 1USZA 4Q2ZA 2XV6B 3TBTB 3WO4B 5B7EA 2AXGA 5DEZA 5K5YA 1R3HA 1A3RL 2PCXA 1OW0A 3BZ4B 1RVFL 3C87A 3QCUL 5T1MA 3PUCA 5AZEH 3QEUA 1RJZA 3DHJA 4M7KL 4MNGB 3S3BB 4F8OA 2Y7QB 3NDZE 4JZJB 4P4KD 4MZRA 3W37A 2NX5A 3T0ED 2B8OT 4P59H 2WVUA 3KPPB 5TE6L 2CO7B 3ZDYB 5H35A 4I0PB 1G7IB 4QHUB 2DIBA 3ZRFC 2HPOA 2ATKA 4HF5H 1MI5E 1MHEA 4XOCA 5L4FA 1EUUA 2ZXBA 3LIZA 3K5RA 4KC3B 1QO3B 2IEPA 1LK3H 3VWKA 4JM4L 1BF5A 2BNRE 2OJZH 1YY8A 2CCWA 4XTRD 1MOEA 5F9OL 5KANG 1GVIA 3AACA 1NBYB 3NCYS 4DKDC 2RCSL 1RULL 1JFQL 4MJ2A 4B3VA 1N19A 1F4HA 3U4BL 1MQKH 1O0VA 3V52L 3BLKA 5IBLC 2WBJC 3K4DA 1JPSH 3O11A 4IRSC 5GRJL 4KTEL 4UT9L 4X0KA 4YGVA 4KDTA 1YYMH 3NPSB 4JY5H 4ELKB 5FDWA 1N2RB 1DZ0A 2WUCH 2Y2YA 5G5DB 1LILA 1FF5A 5AOZA 5F1IA 3CC5A 3ZDZE 2FWSA 5E2VH 4ATTA 3ZKMD 15C8H 4L29B 1S7RA 2J1YA 4KJYA 3FQWA 4IBTA 5I1GH 1HH9A 2YQ2A 2JELH 3CXDL 2JCCB 3I84A 3Q6GL 3T77B 1G7LB 3CQPA 4JFFD 3WJMB 3X1GA 1U8QB 4PJIA 3V4VL 2MOGA 1OSYA 3HI6L 5E6IC 1JNNH 2B0SL 3LQAL 5EF3A 1FIGL 2QPDB 1YY9C 2NR6D 3EGDB 7TAAA 1CE1H 3UADA 3NZHL 4MS6A 4AVJA 4QTHA 2CLVB 4C4UA 3CFDB 5DJ8B 5E1HB 5L2KD 3OGOE 1B3JA 4NT6B 1FGVH 2E3VA 1PIFA 1H3PL 4QHKJ 3AU0A 3NIGE 4E9VA 4NIYE 3EFDL 5CZKA 2FGWH 1A9VA 1OB1B 1QI3A 4MDIA 4X42A 2GKIA 2IDUA 1TZAA 3LPFA 2Q8BH 1NM4A 2NTFB 4JHVA 3MV8E 5F0MB 1IUZA 2BZCA 3K72A 3NQIA 3PP4H 3QIBD 5I74C 4M1DH 5D5MF 2EE0A 4XVOA 1NC4A 1RUKL 2EO9A 2FJUB 2NZ9C 3T2NL 5IMKB 1TYEB 4AYBA 1CDUA 1I9EA 2A9NH 1GYVA 3ILDA 2Q6WB 3DX7B 4NUQA 3ZE0E 2VUYA 3EUDA 4Q6IC 2ZTBA 3QDJA 3LEVL 4UUJB 1T03L 4FQXB 3H9SA 1WBYA 3ECBA 3ULUL 3KPSD 3RIFF 5SX5K 3TBSA 2X87A 2MNJB 1MRDL 2HVKA 2ZWZA 1FL3A 3DX9B 2X53A 1T7VA 1QA9A 3CN3A 1A6TA 5DS2A 1RURH 2FD6L 4ADJA 3Q06A 4HHAB 1T1ZA 3K4ZA 2ZXAA 4X4ME 5FK9B 5GRUL 2OL3B 3BX7C 4HIQA 4OCXH 5AOLA 4PB9H 4BSVA 2F9BT 3UZQB 2O5YL 3VM5A 2NDFA 4DW2L 3P73B 4Z7VE 5JHLA 4FTVD 4XO4A 2F5AL 2WYTA 4G7RB 4HD9A 2OMTA 3PGFL 1MG2C 3Q1EA 3O6MH 1T5WA 1E90A 1EO7A 1U8IA 1WEJL 3O0RL 3PABB 4KK8C 1NEUA 4XMLL 3WE1A 1AXTL 2NY0B 4JPKH 3P9LB 3UACA 4KZDL 1UXMA 3LH2L 3GO1L 2IPUG 5D96B 4YHZH 3VXOA 3A24A 1IAOB 4XPHL 3UYRL 4KRNA 3IMBA 3VH8A 5KG9B 5IQ9A 4LVHB 2QT6A 5HP5A 1KJ2L 2EIMB 4HUNB 1ES0A 3BT0A 3UTTE 4KZEL 5GZND 2OSYA 1Q0YL 1FFTB 4PMFA 4RAVA 3L3DB 4MNQE 3TN0A 1XGYL 2UX6A 1ANUA 1UG9A 3DHUA 3LPGA 3CVHB 2QSCH 4KTGA 3K1KC 1N10A 1GSMA 3BN9D 2EXYD 3FZUD 2H1LM 3QQ9D 5SX4I 5GZOD 2JXMA 2PCPA 3JWNH 5FV1L 2R7EA 3CDZB 3S48A 3GIZH 1YDPA 2YR3A 5TQ0H 5BO1H 5J3HD 4B5ZA 3FTXA 3KDMB 3WJLC 3AREC 3WTUA 4OGYL 4FDWA 2VZUA 5FA4A 1SBBA 3I02A 3ZXAC 4DESA 4HWBL 1X5IA 4ECNA 1A3QA 4ERSL 2HJLA 1XD1A 3WS3A 2MQ0A 1OGAE 4IRJB 2JE8A 2B77A 3TPUB 1IQDB 4J3VA 5CP7B 4KKRA 1BXAA 3EYQD 3QORD 1YNKH 4Y1AB 1TQBB 1U41A 3UBGA 4WI0A 5I28A 4P57A 3VU1A 2BIQA 4NFCA 4G3YL 3VTTA 3ZO9A 1TO4A 1IGIL 1U8KB 3F7VA 4OM1L 5F88B 3IJEB 5C0JA 5I16B 4Z7QF 1ZKAA 5FYJD 1U8OA 5HI5D 4YHYB 2LFEA 5LLIC 4JFZL 1S7TB 1CU4L 3D85A 2BP5M 4OZFH 4W4OA 3MZTA 4ZFZA 3IBOA 3UPRA 1BEXA 1JN6A 3D0LA 3L5JA 1DQMH 2FNBA 2J88L 4JAMA 3HB3D 4PUBL 3MV7D 4LCWE 4LSVH 3PRZA 5F1NA 1NCCH 2FLMA 2Z4QB 3CJJA 4HS3A 5KJ4A 1E4HA 4NQXB 2ESVB 5DTFA 4Y1SA 1IL1A 2VQ1A 5AKVA 1W6LA 4NWUH 4PWEA 3IPEA 5DQ9B 4FNQA 1BF2A 1BZQK 2LAGB 5IB5A 1QACA 2EQDA 1R19A 5H94B 3RYMA 4HDIA 4D9LH 4K3JL 3IMUA 4M7JH 4IU2B 1NUNB 1I7ZB 3FYIB 5JOEA 4U0RC 4HJ0C 4B5EA 3JUYA 4E68A 1HH6B 1P84J 2AI0H 4AYMC 4X8JA 4NAJA 3WLBA 4DKEH 1AR1C 4JFED 3DTXA 3CXFA 4EPSA 1KYAA 5H37H 3JVFC 3TU6A 4H5SA 2X4SB 4OLYH 2AEWA 2LLLA 2V4LA 1P0SE 4GSDH 4F9PC 2IH3A 1BP3B 4GIOA 4LOUD 5DYOB 1NA8A 4J2XA 1UB6A 3GMPA 1N59A 4DH2A 4ALAL 4L3FA 4KNTA 3U2SB 1J18A 1GYCA 1WAPA 4F9LC 1OAUL 1NDTA 4TNEA 2G5BB 1MCHA 2ZSVA 2NNAB 4FI7A 3RU8H 4BQ9A 3QJFB 5I18L 1HIML 3V6FB 3IDYB 5DUPH 2UY6A 4K3DL 3BHBB 4N8CH 2AV1B 1LO5A 1UXWB 3GXMA 2FBJH 4LNVA 5CU5A 2GCYA 5D1ZI 3C5ZD 1TF4A 2GSIA 5C0FA 3DPBB 5E51A 1EEQA 3BDYL 5KVEE 2VLRB 4AVHA 4DGUA 3ZTDC 4NZTH 1JPST 3FSAA 1NFDF 2F74A 2WQWA 3VVVA 5L88H 5TDNA 3JV4A 2OMZA 4P3DA 4Y4KB 3T9WA 3D05A 1CS6A 2YS4A 3P4NA 3RTLA 1A7NH 4AJWA 1FV1A 3V0EA 1RU9H 3CD4A 4K5OA 3CGTA 4Q6YA 3TNNB 3AAZB 4WGWB 3BC9A 3QULA 4R84A 1OAXL 5ITBH 2OSLA 3O9WB 3E8UL 2X6VA 5DR5L 3H6JA 4MAZA 4AGLA 4BIKA 3W0WB 7CGTA 2BS71 3RFZC 1SDYA 3NG5A 3U4EA 5LHDA 4K3EL 5L2JA 5JPNB 1Z6JT 5ESVB 1XCQA 3L48A 4FRWA 1JXDA 4IHOB 1CO1A 4N5ED 1CT8A 3UERA 1J9TA 3TBWA 4HJGB 1BFVH 5F9JB 5DJDA 2VXVL 3GJFB 3FO1B 2FQGA 3FTWA 4Y2OB 1P7HL 4AMWA 2J2ZB 4NUJB 4DO4A 4PJ5B 1E0OB 4XPGL 3NJHA 1YEDB 1JFHA 1KBVA 2D0GA 2NQCA 2P47B 2YK1H 1X6LA 3BVWA 3IPFA 4YIQA 4DP9X 2AJSH 1NGQH 2P8MA 3CCHA 4TOYL 4Y19B 1PNCA 4EN3C 2ZUYA 1WGOA 4X6BB 2H32A 4XAWL 2WZPA 3CVIH 4N0YL 3MGOA 1HSAA 2B1OA 3U2JA 4HU8A 2E9BA 5C0BB 1Q9OB 3BEWA 4I77L 1DHKA 4PH8A 3KWWA 4YK4B 1NMCC 4GMTH 1CFQB 4NKMA 4DOHB 1BV8A 5C08D 3QZWA 1K4DA 3SKNB 1FIEA 2CG9X 3PQYD 4G1EB 3MNVA 1WFTA 3S35L 4EUPH 4Y5VA 4ZPVB 3TYFB 5DD0L 2CHDA 1SOXA 3TV3L 4ZMQA 2F7OA 4KNSA 4P5KA 3VYNA 4APXB 4JY6A 2VN7A 4UTCA 4N0UA 1PG7W 3OSKA 1XR8A 5FGBC 4X6DB 5D2LB 2EE6A 4HMDA 4K71B 3CMOL 2F1AA 3ENEA 3MI6A 5DEJA 4TQPA 1QFWH 3KPLA 1T1YB 2VCOA 3PL6C 4OGXL 5TTRA 3HVDA 5FYLL 4F8LA 5IB1A 4NUMA 1XIWB 3W39B 4HCRA 2FT7A 3H3PH 2VDLB 3FO0H 3KCWA 3UCRA 4A7UA 2HKAA 2R1XA 5KN5A 1RZ8B 1MLCB 5H2BA 4AYFB 1EZVY 4OQTH 2J5LC 4P2RB 2XVKA 3BWUF 1K8DB 3HE6B 3ARXA 4PRAB 5FKPA 1L3WA 3P2DA 2ED6A 2HMID 3E2HB 4FG6D 3DMMA 5IM7B 1OW0C 5HGBA 4HKBA 1WBZA 4WHTB 2DTMH 2FB4L 4CGUB 4IMLA 4P46A 3MRQA 3ZE1B 2WLIB 1KTJA 3MKGA 1LWJA 4H1LG 1R3JB 2AABL 4HX1B 1OF2A 5LNEA 5GISL 3PJNA 5FGCE 3ZE2E 4P23D 4BCYA 3TCTA 4Q9BA 2AFNA 3F6JA 1TETL 4HIJA 4O4YH 1D6VL 5GGTA 2WWMD 5EU6D 1ECZA 4XZ4A 2YA0A 4PTUB 5A16A 5JOFB 1X5KA 1MNNA 4Z7AA 4R26H 4GSRA 5CSGA 4PS4L 2AJUL 4DETA 3RDTB 3VWKC 3P1VA 5E99H 3B34A 2EUZA 4P2CG 3ZQ9A 3D69A 2YXMA 4HWZB 4RBPK 5FV2A 4WI9A 4MJ5A 5DO8A 1D9KA 4M1CD 1VGKA 5FUZL 4HLZG 3FMGL 1PKQE 3QEQB 5KYYA 2J6EL 2X4TB 5A2AA 4MKTA 3L9EA 2QQLL 4C83A 2GFBA 3CFMA 1F18A 4YAQA 4GFTB 4KDTC 1AQKH 2C3HA 4LKCA 1EDQA 3O2WH 2UZXA 3EGSA 2GI7A 4GRWH 4ICWA 4PVMA 3I9IA 4E41B 3L5XL 2AQ3A 2OJ1A 4Q6KA 3FQ1A 1Y0LB 2ZWSA 5C6TH 1YMHB 3POHA 4CU8A 3ULUF 4TL5A 4OFYA 2ORBL 5HHNB 2H9GA 2YRBA 1UWEH 3KLSA 5ESAA 2Q8AH 1FPTL 2MHAB 3LIZH 2VW4A 4PRNB 1H9VA 1F90H 1P4BL 4IKJA 3ES6B 4OGZA 2HLAA 5LNDA 3BZ4A 4ODTH 3TO2A 2RH0A 3MJGX 5E4AA 2BWQA 3M86A 3U7YL 2WMPB 4POZD 4KHXL 1X4YA 1H3VA 1NEZG 1KGCE 3FT3B 3HIZA 2Q3ZA 5EU5B 1KIUA 3FW6A 1TZOA 5I6KA 1E9PB 2H6OA 4HS6A 5D1QD 4N90E 2ZCLH 1HYRC 2XX0A 2Y6SD 3EH3B 3NFPA 3ELQA 1RSYA 2J8UE 2X89A 3MRLA 3C6LD 4NBYB 1ZT7A 1SYVA 4FFYA 1M7DA 1QO3A 4PP2A 2Q86A 3MPCA 5F7DB 1DQLL 2MKWA 5MENE 5GS2D 3GTNA 3SBRA 4AE0A 2ARJQ 4XNMA 4D9QD 2QLVB 5IFHH 4S0SD 3P11H 1L9QA 3ARGB 3KPQB 5LAXB 1OQXA 4P5MB 4C56B 4NRYA 1PLGH 1M57B 3QFJB 1G9NC 5DS8A 4ADGA 1ZGLB 4L4TB 4FA6A 2XCMC 2BOBA 1TQCC 2WJ7A 1HINL 4W9FC 1UGNA 2GBTA 3FUDA 4PCTA 4LHUB 4ELKA 2BSDA 3D0VB 3EUUA 1WFIA 3EOYG 1AD9A 4XP5L 2C4XA 1BVLA 3WUWG 3I50L 3PDGA 3BAEL 3WY3A 5IJCC 1YECH 3VXRA 3W5NA 1DDHB 4O02B 3ZT6A 1W2KT 2YPLA 3FFDA 5AOKA 3FULA 3U0TB 4XNYL 3MGTB 4OCWH 4X7TB 2AJZB 3QH3B 4GW5B 4JO3H 4IIQA 2X4OB 3D33A 1KBPA 2PW1A 2ICES 3PAUA 4K15A 1G7LA 1IBYA 4JFYA 1TTRA 1QBML 1RFDH 2WXGA 1PLBA 3EOAA 4JM2F 4PN6A 4QRRB 4HGMA 2J20A 1AZZC 3TJHD 1VEPA 3GJFK 3ZOAA 4QLRA 4DP0X 5I5IA 3ROOB 3V5KA 1TENA 5HPMA 3B3BA 2LLGA 2WWNA 4B60A 2R2BB 1NEPA 2OAAA 5KSBB 5IVXA 3AQZA 4LRIC 4Q0XL 3L7FB 2H2PC 2X09A 4YNYA 2OR9H 3LKNB 4AITA 5JXAL 1DL7H 2PTUA 4F7MA 4JKPH 2ZUQB 4QXUL 4UV7L 3G6DH 1JXGA 1JHKL 3TN0C 3PXLA 3GK8L 5HD8D 3BH4A 4NHCL 2VDNB 4JGMA 2ZX6A 4M5TA 3BWSA 1M6OB 2ZYSA 1T4KB 3RWCB 2E86A 3S5LB 5L9DH 2VQUA 5DLML 3D39B 4BRJA 3SQBA 5CILL 3CZNA 1WBXB 5D7HA 4X5WB 5C09A 2CD0A 5HTSA 1XSIA 1KTLB 1QEWB 4UINL 4YSUA 3LZNA 1J9QA 4JJOA 1P1VA 3MBWA 2FO4A 1IM3B 3L3IB 2W94A 3LRMA 3VFTB 1V55B 3DROA 3F00A 4R8WH 3MUY1 1KLUB 3FU0A 3LEXA 2HWZL 1Y6KR 3BLBA 5F1OB 1G6RL 1FZMB 3NCCB 2ICWA 2MRYA 3R06B 4QOKA 5T1LD 4D7BA 1X7QB 3T2LA 4JJ5A 3E3QC 3UG3A 2QKIA 1HKFA 1CJYA 1QFUH 1SOKA 5EOTA 5TJWK 5FOJA 4KJWD 1Z3RA 2F7RA 3QDGD 4GSQA 4L8CA 1B4JL 1ZANH 4JBSA 1OK0A 4JR9H 3TYGL 3FO9A 3WYRA 1NIBA 3SOBL 3Q5YA 2XG4A 4W4OC 3HZYA 5T1DL 3U1QA 2EZ0D 4B0MM 4HJJH 1C8QA 5DSCA 3ZRCC 3FB7A 1OLZA 4KY1H 4UMGA 4HUUA 5CJXA 4L8SB 3A5VA 4PLOB 4A2HA 1IGFH 4YQXH 1QKZL 3U7WL 3UO1L 4L1SA 4N2FA 5KYWA 1P4IH 2A7BA 2VJ0A 1TMCB 5SWZA 4OCLC 4U6YB 1V10A 4NYLB 2HG0A 3WE6A 2J12B 3DSNA 3L3DA 1KXTB 3WFDH 2B59A 3LZOA 5AZEL 3SBQA 3D3VB 3GXIA 4LASH 4DGVL 1JERA 5GXBB 2O26U 4MJID 3DRTB 1JZEA 5FYKE 2Y72A 4RCAA 1E5YA 4JFHD 3KPRE 4LLQB 4K5PA 5C0AB 3SGEH 1R3KB 4P59L 4KAQL 2D4DA 4G8AC 4H25A 2NY2D 4PV8B 3IDXL 1ORSA 1XF2B 1JTTA 1HE8A 3EGXB 4HF5L 1ICTA 4Z0BH 4Y9BA 4DEUA 4GG8A 4J27A 5HDRA 4JDZB 4M6MH 6PCYA 4FQJH 3EOTL 4H0GA 5DDHB 5GS2H 2OJZL 5GHWH 4PJDE 4YLQT 2DQCL 3LB6D 3QYMA 5JLZB 3SCMB 3IKKA 5C0ND 4KKLD 1CD0A 4GBXA 4JRXE 3RY4A 2R39A 4Z0XA 3STBA 2QMKA 4UILL 4OKVB 4Y1AA 5B8CC 4MAYD 2IWFA 1JGLH 4GP4B 2DBLL 3V0FA 2IBGA 2PO6A 3HE7A 4JY5L 4HOZA 3SZKC 4K9EC 2DI7A 4MVBC 1OD9A 3PWLB 3MV9D 1E50A 2WP3T 5E2VL 1CD8A 3RE0A 3ILEA 1FFPA 1ACXA 5I1GL 5CJOH 4TSAL 3LRHA 3HZKA 5HJDA 3VU2A 1BGXH 2EEBA 4MBRA 1R9FA 5JZ7D 1HX0A 3BQVA 5L6YL 1JWSB 2NUPB 3OKMA 1J8HD 5CLWA 4OZHA 3V0JA 1PYWB 4AW4A 1KCRL 1BDYA 5KYXA 2Z0BA 1CE1L 4Y4FB 1F11A 4YBQD 2ZP8A 2ZAGA 2YOCA 5F96H 1N5AB 5IVZB 1U8NB 2W0FB 3S6CA 5J9PB 3CFKA 1SJMA 3HPJB 2X6BA 1IFGA 1NCUA 4I48B 2R4SL 5A1AA 4XWOC 2JIXA 3PWPD 2K8QA 1GPOH 2K3HA 3B3IA 1KV7A 4V1DD 5C92A 3FB8B 2Q8BL 1IFHH 4M3JA 1BZ9B 1CGWA 3T2PA 1YMMA 2NW3A 4GRLD 4DO6A 3PP4L 3D08A 1JTPA 1AYRA 4DIXA 2HLEB 3VJ6B 4L4JA 4ORGB 4G7SB 3EHBC 4BXSV 5EZJA 1KTDB 2GJZB 3X2QB 4WK0B 3VGDA 4EVNA 2DQIH 4Z7WB 2G2RB 2VO5A 4Q4IA 1VA9A 2I9LA 4U1NA 3DSFH 3P3UA 2IAAC 1FFOA 1E28B 1P6AB 1T3FA 4YSAA 2NY6B 4YHIB 2AXWA 1S9VB 4GKNA 4PP1C 1WV7T 4OLXH 2UZPA 2HJKA 4BYHA 3QJFA 2J43A 3PY9A 3UROR 5IUCA 2IXQA 2CRZA 1ZSDB 2EIJB 2WLJA 2DYPB 3L8QA 1VFUA 4F8PA 3V6FA 1XB3A 4CMMA 4HZLA 5L4IA 4AEIL 1RURL 3IEAA 3OB0K 5BZDB 4PB9L 3RUGE 2YGNA 4Y4HA 2O5XL 3QZMA 3W1ZA 4HULB 4EZKA 1E2WA 2I27N 1DJHA 4LSPL 4BH8A 3O6ML 4R83A 4Y5VC 3VXQA 4NJ9H 43CAB 1LEIB 2QBWA 4YZFE 4JPKL 3CPLA 5GQBA 1VZGA 3BP7B 5EN2B 4YHZL 4NQVB 1B0RB 2Y7OA 3HI1A 4POYA 1U3NA 1HWGB 3QG6B 2YOAA 4WDIB 5BZXA 3O4OC 2BNRD 5LUMA 1H19A 4FNUA 2P5WB 4KX9A 2FLRT 3N42F 3AU1B 1IQWH 1QW8A 4L4VD 4WY7L 4NCDA 2E9JA 3CFCH 1XF1A 3MRRB 3EF7A 4CC1A 3N43F 2K1MA 2QSCL 4NI3A 4HH8A 1M2OA 4HJGA 3VXMB 3WAKA 3P9WB 1XR9A 4XBMA 1KPRB 3BKYH 4HKXB 5HY9B 4K4KA 5SWQB 1YN7A 1HI6A 2UV3A 2V8LA 3AY2A 1BG9A 1S7UB 1WIPA 3DMMC 1G9ML 2QPUA 1YEDA 1H5BA 5LBSA 4P46C 3E6FB 3S96B 1YAZA 4CDHA 3A22A 1HT6A 4PJHF 3VFMA 5I8KH 1CLVA 1J05A 2N1TE 3AWGA 1YN6A 3EJZC 1O6VA 5IF0B 3BESR 2C3VB 3SYQA 4X6BA 2Y1YA 1OANA 1BVKA 2R2HA 2MJWA 3DBSA 3HMXL 3L5WB 3D2UD 43C9B 2EO1A 2VR8A 2W0KA 2CK0H 3BGAA 2ZKXA 1A6ZA 1CFQA 2AMUA 1V3LA 5CZRA 1FL5A 1J0ZA 4DP1X 1RMFL 4QPEA 1WHOA 1KB5L 5IVOA 3SKNA 4OCNC 4RMRA 3PGCA 1ROCA 3T1FB 1D9KC 4ZPVA 5MI0C 3TVMD 4U4IA 2L7UA 1NMBH 4YC2B 4YHMH 1CR9L 5ETUB 3BJ91 1AGFA 3QWOB 2P28B 4M93C 1DQML 3O3DB 5KBDA 4AQEA 2FUTA 4GT7A 4JHBA 2Q3AA 4LSVL 5D2LA 3MV8D 1NCCL 5CMAB 2V2TA 1P5VB 1VEMA 4MA3A 4OVVA 1HK6A 2JKJA 2G2PA 5E0FA 1KT2B 4W81A 5AB2A 1UM4H 2WWKO 3N85H 5MEPB 4NWUL 1KG0A 1LEGB 4LO9A 5DJ6B 4ZUUA 2DQFB 3MRIA 4FF9A 1SF5A 4L8BB 1O5DT 3MNWA 3OC8A 2EEDA 4UAOB 3T65A 1RZ8A 5CD5C 5KVMC 2WXJA 2VXQL 1I85A 3BSZH 3D9AL 4P2RA 5I0VA 3DO7A 1A1MB 3HNSH 1LD9A 2VDKB 2AI0L 3TBBA 5KSUB 2FJFA 4YDIL 3RGVB 3V5DA 1ZS8A 4DKEL 1AG0A 2A6JB 5CZXD 4POUB 1H6FA 1P5UB 1LO2L 3ETTA 4OLYL 3CDFA 3ZZLA 1I1AB 4GSDL 1NCJA 1JVKA 3C12A 3T0XA 4E42B 3O4LB 4QHKI 3G9AB 5D7JD 4FI8A 5JOFA 4L3EB 1AYOA 5CJ8A 4URKA 1HOCB 4M5ZH 1AS8A 2CDEA 3GSUA 2MPAH 5K1JA 35C8L 3B5HA 4QJ3B 4A2FA 1OP5H 3T0BA 3TS8A 3S37X 4YUEH 4WFFD 1ODUA 1CTNA 4NPKA 4PGCA 5B1CA 4JB9L 1IM9B 1UD4A 2UWEF 4W93A 5E9AA 1F45A 1RUPH 4Y1TA 1RIHH 4HWZA 5IHBA 4MHHG 3VA6A 2GJ6E 5GGUA 4JL1A 5DMJB 1B6DA 4QIRA 2YKLH 5DUPL 2R0ZH 4FC3E 1I8MA 4G7YH 1K5NB 2X4TA 1KBWA 8PAZA 2MH4A 1TTBA 3QO0A 2NUTA 2CE6A 5EH1A 2X6CA 3UTTD 1BLIA 3MC0A 2DMHA 2RAMA 3FQRA 3KR3L 3HBPA 4MNQD 4NZTL 2DEYX 3VFSB 4BFGA 5C0GB 4YDVB 3Q2CA 1U8HB 2IH9A 4JFDA 5L88L 3HN5A 3GTTA 1G7MB 4WTZG 3QXAB 1HHGB 3B7RL 1A7NL 5ICYB 4ABQA 1ZA3B 4RFEB 1INDL 5FO8B 1RU9L 4I18B 5KS9E 4XXDA 4NDMB 3U2IA 4AUJA 4GAAA 1FYTE 1RZFL 4IIQC 2X4PB 4DVBB 1U42A 2V9TA 2A6DB 5C3IA 3QXDB 4AIXA 2A0LD 1HNFA 2QTEA 4R2GC 4X5PA 1OIOA 2VUKA 1GIGL 4FFYH 3Q44A 4BZ1A 4DP6X 3QPQC 3ES6A 1KYDA 5HYFA 4E9TA 4H88L 3KJ6H 5E2JA 1OGAD 4XC1H 4ODHH