1E30A

Crystal structure of the met148gln mutant of rusticyanin at 1.5 angstrom resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
LDTTWKEATLPQVKAMLEKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTNFTWHPTAGTYYYVCQIPGHAATGQFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUSTICYANIN
publication title Role of the Axial Ligand in Type 1 Cu Centers Studied by Point Mutations of met148 in Rusticyanin
pubmed doi rcsb
source organism Thiobacillus ferrooxidans
molecule tags Rusticyanin
total genus 34
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1e30A00
2XUWA 3PCYA 2VN3A 2PP7A 4KOBA 1N68A 2IWKA 4A67A 2UX7A 1B3IA 1AS6A 1ZV2A 2ZXWB 4M4RB 1AAJA 2HX8A 3QJRB 2VW6A 2B08A 2X87A 3ZIYA 5B7MA 1QHQA 4DP4X 3FT0A 1AIZA 3WG7B 5AKRA 3KW8A 3OM3B 2FJSA 5AZUA 2EILB 1WS8A 4FA7B 2W88A 3FU7B 2I7SA 3SBRA 2R7EB 2BZ7A 4QKTA 3T6XA 1GY2A 2XV2A 2QDVA 1TEFA 3OD3A 4UANA 5I6PA 2IH8A 5I5MA 5IY5B 1OV8A 1YLBB 1A65A 4NERA 2PP8A 3H56A 3QJUB 1AZUA 1J9TA 2P80D 3NJGA 2BP0A 1OF0A 1A4BA 3JT2A 2UXGA 2FNWA 4HIPA 4DP6X 3S8GB 1OCOB 3ABLB 3T71A 1BYPA 1SDDB 2E86A 2QPEB 2BW5A 4EF3A 5I6NA 2BWDA 1L9TA 4JHVA 5D4JA 1AANA 1PZAA 2ZOOA 4KO5A 3X1BA 1OCRB 2GIMA 1NWOA 2HZHA 1CURA 1OE3A 1VLXA 1RKRA 4KNUA 1ASOA 3FU7A 1OE2A 2R7EA 2IDSA 3FU8A 1JZGA 2DYRB 1IKOP 1CYWA 3TASA 2DYSB 3WKQA 9PCYA 1UATA 3JTBA 4G72B 1IUZA 3NJJA 1AR1B 3QJVB 5FC9A 1JVOA 3PPSA 1MG2C 4UF7C 2YAMA 3T6VA 4W9ZA 3UABA 2CAKA 3EH3B 4NB7A 1KYAA 1J5CA 2BWIA 3ABKB 4GP5B 4KOCA 1A4CA 1BAWA 1NIFA 4DPAX 5I5JA 3FQ1A 3OMNB 2HRGA 1WAEA 3WI9A 2J57A 3CDZB 3FQYA 1JZEA 1SFDA 5B7FA 1W8EA 2XX1A 2AZAA 1NPJA 1JZHA 2DY2A 5I6KA 2GSMB 1FFTB 2H5UA 6PCYA 4G7SB 3BQVA 1PZCA 1AOZA 4ENZA 4KNTA 1A8ZA 2QDWA 4KO6A 1X9UA 2UXFA 3NJLA 4YSAA 3QJQB 4YSTA 4HHWA 2FT7A 3IEAA 1NWPA 2N0MA 1XB6A 3ASOB 5D4HA 1ASPA 3PLYA 1ETJA 3AG1B 4GY4A 3CDZA 1NICA 4QLWA 5I5IA 1KCBA 1GY1A 3MX0B 4F7KA 5B1KA 2VW7A 4WTQA 3DIVA 1DZ0A 1L9QA 5I26A 1E30A 5B1JA 1GYCA 2XVBA 7PCYA 1KV7A 1TEGA 2AFNA 5ANHA 1CUOA 2X88A 4YSEA 2CUAA 1QLEB 1OOWA 3ZBMA 3ERXA 2PCYA 3DKHA 2VM4A 5B7EA 3FPYA 4PCYA 5I6OA 3QJSB 1FA4A 1JOIA 5I28A 4GXFA 4BK5C 1ILSA 1FWXA 3IE9A 4A2HA 4A2FA 4DPCX 4YSSA 2IDTA 2IWEA 3V9EA 1AS7A 3CG8A 4N4YB 1GSKA 1XB8A 1AZRA 4E9RA 5I6LA 4KO7A 3FPXA 2BHFA 2PPDA 3KW7A 1AZCA 3S8FB 2XYBA 3NJIA 1V10A 4W1TA 2I7OA 2FT6A 3IN2A 2Y1AA 3T6WA 3HB3B 3X1FA 4E9TA 3L45A 3OMIB 1J5DA 1QNIA 1CC3A 3PXLA 3AG2B 4ZK8A 1W6WA 1PNDA 2J56A 3FSWA 7PAZA 3TBBA 2YXWA 4P5SA 1IC0A 2VSKB 1JVLA 4BWUA 2AANA 8PAZA 1JXFA 2BZCA 2YXVA 4WKXA 5TK2A 1L9OA 1J9RA 1GS8A 3FSZA 4CSZA 2J55A 1BXAA 2Q9OA 4E9WA 1L9PA 2IDUA 3IBOA 2FWLB 1W6LA 4GYBA 2GHZA 1MG3C 2PPFA 3AG4B 4GP4B 1M57B 2J5WA 1PY0A 2NRDA 4G7RB 3NP4A 2GI0A 1SDDA 3UADA 2XXGA 3NJFA 3QPKA 4E9XA 3BVDB 3QQXA 1PAZA 3HEIB 1SHXA 1OCZB 2UX6A 2EINB 3WIAA 2PCFA 3FS9A 4L0PB 4AZUA 1AACA 5F7AA 1MZYA 1MDAA 1I53A 1IBYA 3NSCA 2JFCA 3GXUB 4P5RA 1ET7A 1SHWA 3NJKA 3NJNA 6PAZA 3FYIB 4KO9A 1RZPA 3AZUA 3IN0A 4YSCA 1PLCA 1T5KA 1ID2A 2YAFA 2WO2B 3NSFA 3UAEA 1SNRA 2TSAA 3CVCA 2QT6A 3ABGA 4YSRA 2BW4A 3WKPA 4E9QA 4DP1X 2HRHA 1NDTA 2EIKB 2IH9A 1KBVA 4UAHA 3TA4D 3OQRA 1AS8A 3PAUA 3U25A 3X1NA 1EZLA 2FQGA 2FQFA 3ZX1A 1NPNA 4YL4A 3EF4A 1TKWA 1WS7A 2BP8B 1RZQA 1BYOA 4NAJA 1CYXA 3QJTB 2PPAA 1XMEB 2TSBA 1N70A 1J9QA 1BXVA 1NZRA 4YVNA 2FQDA 4JHUA 2MTAA 2VSMB 1IBZA 1ZDSA 1MZZA 4BXSV 3S3CB 4MFHA 3FU9A 3NP3A 3CZUB 2YAPA 2WSDA 2PPEA 4F2FA 2B3IA 4A68A 2P80A 1JXDA 1JZFA 1ADWA 4BWTA 1E5ZA 2JXMA 5EHFA 2LLNA 1NTDA 1BQ5A 4A2GA 4HCIA 4G7QB 2OCCB 4YSOA 1ILUA 4YVUA 4DP5X 2PLTA 2BP8A 4HHGA 2ZWNA 1HAUA 1AQ8A 2DWTA 4Q89A 3WNJA 4AKOA 1AG0A 2QPDB 2Q5BA 3S3BB 4DP7X 3UAAA 4E9SA 2IWFA 4M3HA 2YARA 1L9SA 3FSAA 4HAKA 3GYRA 5B1JC 2CALA 4G71B 1ET8A 1WA1X 1ZIAA 4DP2X 2OV0A 2HX7A 4E9VA 4FAAB 5LDUA 3ASNB 1KBWA 4YSPA 1E67A 3TBCA 1GS7A 3MBWB 3C75A 1E5YA 1GW0A 2XV3A 2GB2A 3G5WA 2AVFA 1ET5A 3WNIA 2VW4A 2VMJA 4Q8BA 2YAQA 2RACA 5TK4A 2ZONA 1GS6X 2I85A 4TXVB 5D4IA 3N2JA 1X9RA 2H3XC 2UXTA 1ASQA 3H4FA 3T6ZA 4DPBX 1NIAA 1PCSA 2XXFA 4A2DA 3AY2A 5I6MA 1NIDA 4A66A 2XU9A 3DTUB 1KDJA 3SQRA 2GC7C 1V54B 3ABMB 3EHBB 3FQ2A 2UXVA 5A7EA 2VM3A 3X1GA 1ZIBA 3FSVA 1PLAA 4AKQA 1BQKA 5F7BA 2FQEA 4DP9X 1SF3A 1E65A 1AZNA 1JZIA 4GP8B 3AG3B 3V9CA 2IDQA 1KCWA 1PMYA 3EH5B 1RCYA 5B3SB 1DYZA 1OCCB 1TU2A 2DV6A 3RYMA 4BWWA 3D12B 3S3DB 1R1CA 2EIMB 3SBQA 4X4KA 4K9JA 4YSDA 3T9WA 1OE1A 4HALA 2BO0A 3GDCA 3N55A 1J9SA 2CCWA 2HLEB 2FTAA 3UACA 4BDVB 4HZ1A 3X2QB 1URIA 2PPCA 4HCGA 2YAOA 4CSPA 1BQRA 1NINA 3ZDWA 2MRYA 1AZBA 1JZJA 1SFHA 4E9YA 3PAZA 2CJ3A 3SBPA 2YAHA 1HAWA 2XWZA 1KGYE 1JERA 2XLLA 4G70B 3CVBA 4AI7A 3AW5A 5E9NA 2W8CA 2EIJB 2HX9A 4BXVA 1WA0X 3NSYA 1A3ZA 1PNCA 1F56A 3NT0A 4YSQA 2DWSA 2FT8A 3EH4B 1M9WA 3PAVA 5AFAA 1GR7A 3NJHA 4RH4A 2AZUA 2YQBA 4KNSA 4PAZA 2GBAA 4N8UA 4YSUA 1L9RA 2GC4C 4HCFA 1HFUA 4AKPA 3H4HA 4AX3A 2H47C 3NYKA 1EHKB 2XX0A 2CBPA 2IAAC 2OJ1A 4BDVA 1SJMA 1XB3A 4JKNA 1AG6A 1SF5A 2IDFA 1ZDQA 2XV0A 1BXUA 5B1AB 1NIEA 4F2EA 2HXAA 1JXGA 1NIBA 2WO3B 4DP8X 3NSDA 1WA2X 1PZBA 1V55B 5PCYA 1BEXA 1M56B 1A4AA 5PAZA 1KDIA 5B1BB 4DP0X 3FYEB 2PP9A 3CVDA 1ZPUA 3OMAB 3X1EA 2A3TA 2JKWA 3NJMA 4A2EA 1PLBA 2YAEA 1PF3A 3TU6A 3UGEA 2Y69B 2BP0B
chains in the Genus database with same CATH superfamily
1XGRA 3L4UA 4PFEA 4QXGL 5EB9A 4MB3A 5JHDA 4P5TC 1OSZB 4UV7L 4JPKH 3GBMH 3GSVB 2C3GA 3W9EB 3QJRB 5AW8B 5F0JB 5JLZB 4BFOA 3C60D 5DEZA 4FQXA 3P0VL 3ZL1A 4NNXA 2YRPA 1HH9A 3HZMA 4JFEE 3WG7B 4HG4J 4A7SA 4JL2A 5A16A 3ULVF 3O2DL 5AZUA 3KXFD 2MEJB 5IQ9B 4UQBA 2R9HD 1KLFA 3GC3A 4IBVA 1S8DB 4LSDA 1PU0A 3MLWH 3VW3L 2CLVA 5BS0A 1WT5C 4TNWK 4WI2A 2YD9A 4Q6IB 1PGRB 5GRJL 3VE0B 2PO6B 3KPQB 4FZEL 4AQ1A 1BCIA 3IDMA 3VSTA 3CDGB 4IMLB 3HZKB 3MGAA 4LCUA 3GKZA 3TBWB 1FZJB 2WNXA 4HIPA 3OQ3B 4PLNC 2E86A 1M05A 5IW6B 4XHJD 4NBXB 5DMKA 1WBYB 3GD1C 3BUQA 1K3ZA 1O6VA 2FSDA 3O9WA 2QVIA 1P4LA 3RI5F 5LWYL 1M7IA 2B9BA 1NANI 1CL7I 5EU6E 1DLHA 4KZEL 1TJHH 1K4DB 4JFVA 3RVXC 3U82B 2Z91A 1CD0A 1FC1A 2P3YA 1Q1JH 4L18A 2BJMH 3GMLB 4Z95H 4FXGA 4L1SA 5D1XC 1CFTB 1VACA 3TH4T 1HOCA 5IHZA 2RBLA 3BPNC 3QCTL 1E40A 3BH4A 5E6ID 1JK8A 4G6ML 1RZJL 3L5WB 2WVUA 1H6UA 5EZPA 2FR4A 3ARBD 4JLRB 4QTIL 4U4IA 3O4OB 3HFFA 1AD9B 4XXCC 2BVYA 1XZWA 5KAQF 4DUWA 4URKA 3B37A 4EIGB 1EO7A 5EOTB 3SE6A 5FM8A 4HIXL 3LQZB 1D5BB 4ZUTA 1SFDA 1FIEA 4CJ1A 5B7FA 4HFWA 1EEYB 2K45A 2CK2A 5IBLD 3AUVA 1R5IA 2ORBH 2XICA 3B9AA 3HE6B 3ML8A 2EJ1A 3CXDL 5IB1B 1AOZA 3RVTD 2FEEL 4L1BA 3E8UH 4AV5A 3CMGA 3O41A 5C2UB 1DQLL 3O4LA 3QDHA 4S0HA 2FX8H 5CZXC 1KPVA 1S5IL 3PJSB 5J8OA 4OFYD 1MCJA 4X7EC 4APQD 4BKLB 1S9WA 2JIXA 3U6XA 1YYLL 4PD4K 1JZ2A 1A3RL 1M71A 2FT7A 2B7DT 2BNQE 5DRXA 4MD0B 1BGXL 1E6JL 3OKEB 4L3EB 3Q48A 1V7MH 5IMOA 3MJ6A 1DUYB 2VNCA 4U3XA 1K72A 1NC4D 1AKPA 1FZKB 3WE6A 3C60A 3THMH 3F7VA 1KCBA 1ZVHA 3Q8BA 3UAJC 2P52A 3KPNA 1TZIB 2O30A 3GLEA 3U0TB 1DL7L 4JG0H 1IAOB 3ZSSA 1O7VA 3KXFA 3B2XA 1G4MA 3LKRA 3RFZC 2LTQC 4BSWB 1DJSA 1E9QB 5HHQB 3VFTB 4M1DH 4OKVA 4WNQB 5DVPA 5DHDA 1IVLA 4FCAA 3H7BB 2A74C 1RSYA 3HFML 5CKGA 5IMMA 5EZIL 5IQNA 5HI4D 2HUHA 3IDGB 4MB5A 2DTML 3FPYA 4YDNA 1I8IB 4LCWB 2FGWH 1KB9K 2IV8A 4JHWH 3KLHC 2C3VB 3Q6GL 5D5ME 4Z76A 3QCUL 3FDWA 3O0RH 4OLYH 4XXDB 5IIEB 1QQDB 4GXFA 4K3JL 4LL1A 3FAWA 5GGSB 4OD3H 4ABQA 1FUNA 1UWEL 4NJ9H 4Q9CA 4YGVB 2R23B 4M7LL 1DFBH 5ICZA 1K8DA 4J3OC 3N3EA 25C8L 5AW2B 3HVNA 4Z78B 4OBSA 1ZK5A 5AL8A 4O58H 1AZCA 2XWTB 3NTCL 3S8FB 4GH7B 1GC1H 3VI3A 2YQ3A 4KX8A 1C5DA 3R0MA 4K7PL 3OGOE 3LVTA 1N67A 2HN7B 1OL0A 4IOFD 2CD0A 4JGNA 3BIAX 3OAZK 2MQ0A 3QEQB 2HG5B 2APFA 1KXVC 4AT6A 3ILQC 3W81A 3BHBB 4XAKD 4LNRA 4EI5C 5G55A 2CDEA 3PHQB 3ZE1F 1JVLA 3IDYC 3HIZA 4HEPA 2XFXB 2CGRH 2H26A 4WKXA 2WBXA 2EEDA 4KX9A 3DV4A 5CINL 2WVVB 4D8PA 4UIMB 1U92B 1S3KH 3QEUA 1YHPA 3BPLC 3DJ9A 5FUCC 4O02A 1BXAA 4LGRB 3GSXA 3T09A 2GFBB 3ARWA 2J88H 3UZVB 3D8MA 3K72B 1TYJA 1DQML 5KVDL 4HMEA 4KJQC 5LGYA 2BOBB 5GRYA 3D2UB 3NEOA 3QFDA 5CCKL 4OZIA 2EYRA 3OAYH 2WKOA 3QAZC 3QQXA 4M5SA 4WU7A 4Q97A 3QR0A 4PJFE 3HEIB 5E5MA 4FG0A 2E74C 2NY2D 3BUIA 3LEVH 2UX6A 4FNSA 4OFYA 3E2HC 4OIIL 4J5VA 3VXRE 5DJ6B 4BSVA 5CGYC 1AACA 4WRLA 3DNKA 3T2QA 3D0LB 1SBSL 4MJ6B 2WXGA 3G5XA 1ET7A 4XP5L 3NCCB 4OCSL 4B97A 5IJVA 2Y07L 2P5ED 4MXVE 1YEKL 2YEZB 4FFYA 4UT9H 2YAFA 3RVVC 4LBEA 3D50A 3CN4A 4KRNA 5I8OH 4Z7UE 3G6AA 3FO0L 2ENPA 5HHMB 4E9QA 3NFPB 5C9JA 1XCQA 2Z31B 4JFUA 4EIUA 4AQEA 3AT9A 4NQED 1G7IB 1UJ3C 4PR5B 4WV1B 1Q0XH 4WEMB 3CN2A 1HHHA 4H8WH 4E42A 3WS6A 4LIQH 5HPOA 1TKWA 2FL5B 5T5FL 4OCXL 3U2JA 1MQ8A 2HFTA 4OZHF 1LP9F 3VXUB 2DQCH 1UZ6F 2DBLL 4F1ZA 2APVA 4G8GD 4S1DC 4WJG3 5GRZA 2NY1B 3BW9B 3GEWB 4YVNA 5AW0B 4F5CE 5JXED 5DHYA 4EDXB 3ARPA 1JBJA 1TENA 2A9BA 1I8UA 3KPMA 4M5ZL 3LZQA 3KGRA 4N6RB 3SO5A 4BQ8A 3QDJB 3QE5A 4WVRA 1UH3A 1L7IH 1ZHKA 3ZUCA 5L2KE 2DQGH 1SN2A 3N1MC 4X50A 4CDGC 1IBGH 1YMHB 3QEQE 3GJEB 3FQTA 1BD2A 2OXHB 2YPVA 2WBJD 1ILUA 2MHAA 2C9AA 2UWEB 4CA4A 1OAXH 3NCJL 4U3SB 5GS2H 2DWTA 4Q89A 5C3IA 1FI8C 2WZ0A 1C7SA 2WWKO 3S2CA 1HL9A 3CX5J 4H1LB 3BWZA 3TCLB 2AJXH 2XKNA 4UM8B 2OS7A 2WLHA 1LE9A 4FQ1H 4MKTA 1SJEB 5IB2A 2IAMD 43C9A 1TZHA 3DXAA 3TA3C 1CZ8H 1WRFA 5F1OB 3P2BA 3DDFA 1BBDL 2WTRB 3CDCA 3NZHH 2WUBH 1EHXA 2OMXA 2ZUQC 2X44D 2IEPA 3FCSA 4YSPA 3LKSA 1FCGA 1MCEA 3B2UC 3RY6A 2GSIB 1Y6KR 5CJXC 2J73A 2XV3A 5F9JB 5J9PB 2R83A 5T3ZE 2VMJA 3P9MA 3H3PH 3ETBJ 4KH9A 4DZBA 4N9OB 2A9AA 4PJCB 4FXKB 2VDKB 4Y4KC 4JRYE 1CU4L 3N2JA 4OW6A 1I75A 1T6WA 1UTDA 4M8QA 1NCJA 5EUOE 1XR9A 1QLEL 1NIAA 4MDIA 4JW3A 3SEPA 2H6PB 5C0BA 1Z9SA 3T1WA 4DEWA 1DANT 3ATAA 1T4WA 1CCZA 2DIJA 2XU9A 2YD1A 5GGUB 3GXFA 1C08A 4NP4H 2VITA 3EHBB 4Z7AA 3QEHB 1BQKA 3A22A 3MCLH 4F8PA 3X11B 4ZUSA 3MJ8A 2NYKA 1C12B 1SXBA 4Z0BL 5EO9A 5GSVA 5HHME 3K0YA 3V4PH 4JFFB 5IOPB 1O9ZA 2QSQA 4NP9A 1JNHA 5I9QB 5DI8A 1EHLH 1PX8A 3A6BH 1DFXA 1JHKL 3LS5H 1GGUA 1CDBA 3RGVC 2ZOKB 5C0DB 1E42A 2YUZA 3DPBB 3P77B 1EFXB 1MVYA 1P7KA 2ZXDA 3CSBA 4TRPH 4WWID 2VRKA 4NZTH 5D7SL 2VAJA 1RXLA 2FTAA 2W60A 2G75A 2VXTL 2HFEB 1NSNL 1IAIL 4QUOA 1PQZB 1ZVSA 1KGCE 1MHPH 4CVXB 3SOBH 1L9MA 5KSUB 4IRSB 2OP4H 1IC4H 2ESVB 5DLMH 3N91A 5DD0H 1KB5B 5C0IA 3WNLA 5T3XD 1LEGB 4Q9QH 3AM8C 1HDMB 5ADOL 3UTTA 4AXWA 4ZD3L 3O45B 1KIQA 1KBBA 3DX8B 1VB9A 1K9TA 2WIMA 2H3NB 4IU3B 3WDHA 1XBDA 1XGRB 4NO0A 4OUUA 5JUEH 4M61A 5J6GA 5JHDB 1ETZA 2NY4C 1WISA 1JI1A 5B8CC 4L1LA 4BH7A 3R7RA 2XWCA 2LLLA 4G3YL 4BDVA 2G0LA 1XT5A 1YY9D 4RNRB 3T0WA 2I9TA 1BF8A 3A23A 4FQXB 2HJLA 4NNXB 1T1YA 1HH9B 3HZMB 5A16B 1H9VA 3SE8L 1ACZA 2V17H 4NZUL 4DP8X 2M8XA 2QVFB 4JHBA 3QUYB 1CQKA 4XPGL 1KLFB 5D7LD 5E2JA 3VFRA 3BAIA 2P24A 2CLVB 4HJGA 4WEUD 3T3ME 4G80A 3WD5L 5BS0B 3PQYA 4LHQB 1ZPUA 3OZKA 1XHHA 3QDMA 4NGHH 4AQ1B 3IDMB 4GUQA 1JMZA 2XUWA 4LCUB 1LVEA 1TZGL 2W81C 3KYMA 2OSWA 1IGML 3JWNC 3VXSE 1TT6A 3KWWA 1P7BA 4L2YA 1PG7L 2AJ3A 1AAJA 2YBRA 3QIWA 1M05B 4P5TD 2EEFA 3VGEA 5C6PB 1Y0LA 5CP3A 2JVUA 5TE6H 5DMKB 5C7XL 3P54A 1JNNL 4YQXH 5C0CD 3O9WB 1JD7A 2AMUA 2FJSA 1EZVY 1RUQH 4HEME 3OJVC 3ZYJA 1M7IB 2AJSL 4XWOC 5I1CL 2I7SA 2APWA 3OBAA 4MAUL 1DLHB 5D7EA 5C92A 4DGUA 2Z91B 3FTWA 4N86A 3MLYL 5FKPA 2AK4A 4UANA 5JZ7C 4UM9D 2HVBA 4JFFE 4K5OA 2APXA 1J9TA 3QUML 3SQOL 3P40A 3L5XH 4FXGB 4HSQA 4TYUA 3DTDA 1VACB 2HT4C 4YK4C 1HOCB 4J2XA 4OVUA 1QZ1A 4CMHB 5DVKA 1BQLL 1H5BA 3U4BL 1JK8B 3QXTA 2FR4B 5DJCA 4QAWA 3QFJA 3OLDA 1G0DA 2C3XA 3J7HA 4ODVL 5I1GH 1OAQL 2XIIA 3DHPA 5EO0A 2ICWI 3ZZSA 3ULUC 4ZUTB 2NLJA 4F24A 4QY8A 4LDCA 4HFWB 1OE2A 5AUMA 4PV9A 3UTSA 4CC4C 4NHCH 1S7RA 1R5IB 2QADC 4NPKA 1IGCH 4YBLC 4MA8H 3TC9A 4GOSA 3IK2A 3O41B 4J3WA 5DVNA 3O4LB 2YGOA 5G5DB 3WLBB 1JNJA 4TKWA 1KPVB 4UF7C 2YAMA 3AADB 3WNMA 5EU4A 1YNKH 1S9WB 4XI5D 5EPMA 2JIXB 2J8OA 5D1XD 3LNDA 4MHHG 1M71B 5EOCL 5I0XA 4HD9A 1G1OA 1ZK9A 4KOCA 5DRXB 1GYAA 1CB4A 4JX0A 4HKZA 2E8YA 3MZGB 1ZLVK 3SGEH 5IMOB 5I19H 5JHLH 5LQBH 1QFWL 4LPYA 3WI9A 3WE6B 3C60B 3Q0HA 1T0MB 3KPNB 1CK0L 3B2MA 1NPJA 3FOLA 3ORJA 5TE4L 4GRWB 2WWKT 5DHVA 5IROA 4YDKH 3KXFB 3BPOC 3SDXA 5IEHA 1ZLEA 4GINA 1PZUB 2DQHL 5BS0E 4OKVB 1NUFA 1JCVA 4OKDA 4U6HA 4PRHA 3VQ2C 4MYWB 2WLKA 3RPIA 4YXHH 5IMMB 1Y07A 1KTKE 3TFBA 2Z8RA 2KMWA 4Z76B 5I1LA 2N0MA 3F83A 3GGWA 1I8LC 2Y36H 4GAGL 4LSQH 4J39A 1UOVA 3V2AR 4HZLA 4DJMA 4DUXA 4PV1C 4PB9H 2WCPA 4PIRF 3GMPA 1J8HA 1LO4L 1NGPL 1QTYT 2FO4A 3S36L 5ICZB 1K8DB 1JYXA 3VWKC 3EYOB 4K23H 5D6DC 4NZFA 2EDOA 1QLFA 2KQMA 2XPZA 1RHHA 4HWBA 4I3SH 3VI3B 1VFBA 3P3UA 1PCXA 3UTOA 1C5DB 3Q8EA 4JPKL 4G82A 2F8XC 1NKOA 3EBHA 1E4HA 4MA1C 2J71A 2WQVA 3WO3B 3VMPA 2EC9U 2J12B 5L0QB 4FL4C 5DQ9B 1CI5A 4TLSA 1ACYH 4AT6B 2K6ZA 3L5IA 1QNZH 1RZKC 4LNRB 2ED9A 2BOCA 1IE4A 5KN5A 2CDEB 5D2NB 1WBXA 3VD9A 2F53A 2VDLB 4IOSD 3KLHD 1R75A 2EDWA 4HWEH 3ZRFC 3TT3L 2H26B 3D18A 3ZR6A 2BX5A 2DWEB 2RQ8A 3DV4B 1TJIH 1E4XL 4D8PB 3QEUB 4W4NA 3U0WL 5BV7C 4KO7A 3VVWA 4O02B 5HVHB 2BHFA 1SXNA 3GSXB 5IJBC 4J3OD 3DDGA 1HHJA 3LX9A 3LZOA 1A0QH 4QI3A 1CBVH 1V10A 3RZCC 4KKCC 4AV0A 5SX4H 3C6LD 1MCPL 1G7HA 2ADYA 4G6KL 3QFDB 4OZIB 2EYRB 3PWPD 4B9IA 3BP4A 4WU7B 1Q9KA 3MOAH 4QHUB 4AITA 2R0WH 2WQUA 5AB1A 1O7DC 5FYKD 5E5MB 4DQOL 1RAMA 4KVNL 4NOFA 4BSVB 2VSKB 3ILQD 1T7ZA 8PAZA 1JXFA 1WBZA 4EI5D 1G9MH 2ZYIA 3G5XB 4M03A 3SB3A 4DO5A 1FGNL 2AW2A 1FVCA 3N43B 5DR5H 4EIBA 5IJVB 4FE9A 4LBEB 4GRWE 4GYBA 3S97C 2OMTA 3G6AB 1EAOA 3GMOA 5C9JB 4L4VD 2GIYA 2B1HL 3K2UL 4AQEB 3VDAA 2ZUSA 3ESVF 1HNYA 3I6SA 4C4UA 4FNLL 1YQVH 1BIIA 2NY7H 4H26A 3LEYH 4MNGA 1N0LA 2A9CA 4B9CA 4E42B 5DUBB 1TKWB 2YQ2A 4YHIA 1A22B 4UT6H 2D0HA 4U6YA 4EIZC 2JCCA 3BE1H 3FTXA 1CDGA 4N0UA 3E1F1 2CUIA 1LEKA 3ZDXE 5CGYD 2CKBL 1YYMH 5E94A 3LDBC 4JQVA 2BVPA 5AVUB 1IJNA 2R29A 1VGEL 5DHYB 3E8UL 3WNOA 2H1PL 2OLDA 3NCXA 2EIEA 3ROLA 4F7CA 1ZT7A 1MPAH 3MU3A 3NIGF 5IWLC 3CXFA 4PRPE 2AXWA 1MW0A 3KPMB 1L6ZA 1QR4A 2CDFA 2DLFH 3RVVD 3INUH 4NQDA 4NWUH 1BWWA 1FHNA 3ATDA 3WTWA 2NQCA 1KENH 1ZHKB 3FT4A 1S4IA 4YDIH 3X1NA 3QO0A 4G43B 2R0KL 4FMVA 3CVHH 1OAKL 3AQDA 3FQTB 1BD2B 2WO4A 2EEXA 3GS4A 4P3CH 4U7MA 4WFGD 2MHAB 4HT1H 4Y5XA 5IHBA 4QAMB 1R24A 2H0EA 1BYOA 4Y5VC 5F9WB 2EEAA 1KJ3H 3DK0A 3LH8A 5BVPL 2XKNB 3K2KA 3CJJA 4XBMA 2I60H 1LE9B 1A7OL 4AQOA 2J20A 4BZ1L 5EV7A 5LBGA 4S1DD 43C9B 1TZHB 1NCAH 3DXAB 1OZTG 2DJSA 4PIBA 1EUTA 3HS9A 1HZKA 2NY3C 5I75B 2LR4A 3QRLA 1X7SA 3BEWA 3AABA 3FCSB 3LKSB 4CU7A 3MLVL 2X1QA 1NMBL 2DEYX 4EBQL 3C6LA 4OZIE 4ODBD 2QJDA 4ZFOL 4LVNC 3P9MB 1XH1A 4WCYL 4S1RH 1MXDA 4DZBB 1UG9A 4F2MA 1ND0A 1JZ4A 4W6XB 2DS4A 4Q14A 1AGFA 4WIQA 2BP3A 3H7LA 3QNZA 4M8QB 5JNYA 1IU1A 4MDIB 2Q5BA 3MV9E 5C0BB 3S3BB 4JQIL 2R1YA 2BSEA 2KC0A 1VZGA 2L04A 1B0IA 1QD0A 4JO2L 4JO3H 5B1JC 1CR9H 2VITB 1XF2A 1WA1X 4ODUA 3ZJAA 5F21B 4F9LA 1JHLH 3AS2A 4LT7A 1AMYA 3MJ8B 4ZUSB 5GRWA 3TA3D 5KYXA 1GMIA 5CLYA 5EO9B 4KK8D 5GSVB 4F7MA 3BT0A 3C5ZA 4GI8A 4YAQA 2OYKA 2B39A 1JNHB 2CUHA 5DI8B 5SV4A 2DWXA 4MMYA 4UZUA 5K9JL 3B2UD 3W39A 3WELA 2VISA 1D7CA 2Z92A 5LO7A 1BF2A 4YLCA 4DOHE 2OZ4H 2Q3ZA 1USQA 1P7KB 6FABH 3T6ZA 3N85H 5AKTA 1QRND 4GQ9L 4NKMA 3JQOB 2W60B 2G75B 3B9KA 2B4CH 4TNWF 4Y4KD 1NGYA 5LAXB 1TQUA 4NAMA 5GGSY 1ZVSB 2JKRM 5J57B 1U3NA 4BHUI 3FQ2A 5C0AD 2VM3A 1F4WH 4JDTL 4M56A 3JV4A 5FYJU 5C0IB 4JGUA 2K3HA 4PS4L 1QYGL 3UTTB 2YMTA 3LEVL 4AXWB 4BM7A 4CMMB 1KIQB 1RCYA 2D7QA 3EYVA 5AQ0A 1J1PH 3KL5A 2B1AL 1DEDA 1MRCL 3JZYA 3QZPA 4I7ZC 4NO0B 4DIXA 4OUUB 4M61B 1OAZH 5J6GB 1IM3D 1ETZB 5KOMC 3APNA 3QT2A 5D1QC 3PHAA 1BD2E 2OBGA 3L5JA 3GDCA 2EICA 4PUBL 3FN0H 4BH7B 3RGVD 2CCWA 3UJTL 4BDVB 2BFVH 4XXWC 2I9TB 4HF5H 2NY5C 2IH3A 2HJLB 1T1YB 4JO1H 1RIUH 2ROYA 1UCTA 1BAGA 3FXIC 4N2CA 4E9YA 1RUPH 3SBPA 3DXAE 4S1QH 5FF6A 2ZUWA 4AVIA 4F8LA 2V0AA 4Z18A 3BCDA 3CC1A 4XR8C 4LPWA 4YWGL 3VFRB 1GPOH 4JN2A 3VFVB 2P24B 4HJGB 1JZ8A 4G80B 5ALBL 3T77A 1ZSHA 3PQYB 4HCRL 4IIQA 4AQ8C 2BY1A 3NJHA 2DQCL 2YQBA 1B0RA 1FNFA 3QULA 4Q4EA 1UM6H 5F1KC 3KYMB 4M6MH 4HFUL 4GMTH 5K1NA 2H47C 1O0VA 1BWMA 3KWWB 5I1DA 4J3XA 4XBGA 2AJ3B 5F7LB 4XBPA 2YBRB 1XB3A 2HFGL 2NY4D 3QIWB 4PJ9A 1WWWX 3O6FA 2D4FA 1IM9A 1Y0LB 5DYOA 1HJBC 1C9SA 5CR1A 1NMAL 2WYTA 3G6DL 1UB5A 3ZE2B 1G9HA 2WKLA 5DQDL 5GS0H 1D5IL 1TTAA 4OLZH 3JWOC 4YUEH 3A4AA 2L7JA 3K2MC 3TZVA 1PZBA 3UYRL 1V55B 3GNMH 4M6NL 4QRPE 2BK8A 1SMOA 4IU3A 5FKPB 2IOIA 5PAZA 2AK4B 5I18L 3QXUA 1THAA 2DPKA 1RURL 4UQ3A 1TJGH 4WI5A 4LLMA 4KROC 4P9MH 4FA6A 5KVEH 5EBWA 1OM3H 4YSRA 4XB7A 3OSKA 1AI1L 3L3DA 3ZL4L 2GEEA 1MFCL 2IWKA 3V0AC 1H5BB 4ZMWA 1XEUA 4WGKA 1WD8A 3RAJH 3WHE0 2E7LA 5DJCB 3S36X 3QFJB 4GEJA 1CZ8L 3O6LL 1IIIA 1FYHB 4Y2NA 3JV6A 3BSZA 4ZX5A 4ETQA 4NN7B 4QHNA 5K5YA 2IVFC 1FGVH 3Q1EA 5EO0B 1OARH 4YX2H 5FLVA 1IARB 3LZPA 2A6DA 3MRKA 3PE9A 2NLJB 4PPTA 4XN4A 3G9AB 5AUMB 4PV9B 3UTSB 1W8OA 2XTJB 5DFAA 3TH3T 3F85A 4XWOD 5CJQH 4NZJA 2K8MA 2ZSVA 3HLAA 3Q6FA 3OB8A 4GKNA 3GSQA 4YFLI 3BIBX 4KY2A 4NERA 2PP8A 4ZFQA 4LCCC 3U4KA 1AZUA 4M7ZC 5GQBA 5DJ8A 1F3JA 5FDWA 5JZ7D 2ZXGA 2X6MA 2XZZA 5K9OB 2VZUA 4XPBH 5T1LA 1AIFA 3IAPA 3NPSC 5EU4B 5FB8B 5EPMB 4M48L 2Z0UA 1JPEA 2HT4D 2BW5A 2EECA 1DBBH 1U8OA 2HYMA 4I77H 3MCLL 3QJOA 4HKZB 4ZX3A 4OIAA 3BP7B 4ODHL 3NFSL 3W3BA 4X7TA 4MGXA 1LNUA 3I6KA 1GMEA 4N0YL 1RKRA 3FOLB 3QUZA 3ULUD 4DT2A 1PSKH 5DHVB 1IKOP 4DAGH 1NM4A 2O5NA 1KLUA 15C8L 5IEHB 4RRPA 4U6VH 1IEHA 4QT5A 4EPSA 1TVHA 3Q1SH 3CCHA 1G9NL 1ZHNA 4R0LC 4IEFA 3PQYE 5DHMC 2L7EA 5FC9A 2CJUH 2F7PA 2QADD 3LZFL 1MG2C 3QDME 4U6HB 3HS8A 4PRHB 4UDTA 3H42L 1YEFL 2VLKD 3RPIB 2K3TA 2QQQA 4R7VA 1RZ8A 3BT2L 3O3UN 1E3ZA 3UABA 1IBBA 1OAUL 3ZTNH 3KMDA 3SE9L 5I1LB 4NC2B 2E76C 3S35L 3GGWB 2J4WL 1LILA 3VXNA 4JAMA 4I1PA 1FNSL 1U42A 3H9ZA 3LQAL 1IBFA 7FABH 1O5DT 3ZKSD 3GMPB 1J8HB 4WZ9A 3IAGC 2FO4B 3M1CA 1F42A 1RZJC 2N59A 2GSMB 4Z7VB 1IKNA 5BXFB 2BP5M 1CFBA 1MEXL 3GI8L 3EO0A 3FH5A 1RHHB 5LDSA 4Z6AT 4IOIA 4KMTH 1W0WB 1VFBB 5GJSL 2DDQH 3NZ8A 5FGBA 3V0JA 3QG7L 1XDTT 2A38A 4OUOA 4PY8I 3JZ7A 3FTVA 3LY6A 1IL1A 4KO6A 1FNGA 5FCUL 1MCWW 2JSFA 1RQ5A 1Z9OA 2GBUA 2VMEA 4LSSL 4D3CL 4RSYA 5KN5B 2BOCB 3A6CL 1WBXB 1X5YA 2F53B 3ISRA 4JZOA 3I9PA 1OGTA 1SVBA 2Z7YA 3MRGA 4WW2C 4LAQH 4GRMB 1QHPA 1YUHA 4RDBA 5FYJL 5I0YA 3RB7A 3D18B 3IFOA 3TV8A 2AITA 4OI8A 1UWXK 1U8LA 2G60H 3LPPA 3E3QC 4QHMA 5EIVA 5E24E 2PWGA 3MVSA 2XTJE 2ED7A 4WO4A 3VWKD 4ZFGH 1HHJB 2X4PB 2GK2A 5KBMA 3RPBA 2APBA 2MCPL 1NBZB 3CFNA 1G7HB 1SEQH 1EFQA 1Z7JA 3TV3H 4OV5A 3BP4B 4LIQE 1Q9KB 2VMDA 3FUDA 4WI0A 1RUQL 4FEIA 5C0RH 1KN2L 1UWGH 4KGLA 3TEWA 3H55A 4LP5A 2VXVH 4P49A 4MXWH 5GIRA 3NAAL 4YSSA 1G6RA 4LSPL 3WMPA 3IU3A 1WBZB 3TLRA 2BNRA 2W5PA 3MNWA 4PHXA 3ZDYB 1T4KA 3OJDA 4X8XA 5KSBF 4ISVA 1UB6A 1FVCB 1XH2A 4KXBA 2HPOA 2EDXA 3EFOA 4FP8L 1NBVL 4JPWH 3ARSA 3NEXA 4QJ3B 4EN3C 3F58L 4XNXH 4H88L 2Y1VA 5DMGC 2OMTB 3SDXE 1JZ5A 1MLCA 3GMOB 1SVZA 1DBJH 2FCBA 2FT6A 2Y1AA 4TLUA 1MF2H 3T6WA 5DGQA 2BVQA 3RZCD 1BIIB 2ATPA 1J5DA 2GCYA 4KKCD 4H26B 4PRHE 4YHNA 4MNGB 1N0LB 2J56A 4AL8L 3FSWA 5DRZA 1CWVA 4HIQA 4AJ0A 1ECZA 4EJ1C 4YHIB 2KH2B 5FYLL 2LAGB 1XCXA 4U6YB 2Z8SA 2JCCB 2K78A 4V1DA 1P1ZA 4N0UB 1RVFL 4J3BA 4DN3H 2AABL 5E94B 3F62A 1IGCL 3WDIA 5G2NA 4N8VG 1J9RA 3ZQXA 1N5YL 3SBWC 3V7AG 3ROLB 1U30A 3TJEL 2FWLB 2XPGB 5I15L 1I9JL 1RP9A 2Y7NA 2QHRL 4GP4B 4RA3A 3CQQA 4DK3A 3WFDL 2D8KA 4NQDB 2X9YA 4OFPA 4MRCA 1B6DA 2MCMA 4L23A 3FT4B 2CHNA 1B4JL 1ADQA 1F58H 4EOWL 2MOVA 3RFZB 4NUQA 4FJZA 2X5PA 4KC3B 5IFAH 4Y5XB 1UOLA 2E6QA 3CTTA 5CS7A 1R24B 2R2EA 1ZOXA 1ZSDA 3FH7A 4OCRH 3V4VA 2WQWA 4IHOA 3VDCA 1E4KC 1KGUA 5EF0A 1D5ZA 5F72S 5IFJA 3A67H 1GGBL 3EUDA 1JHTB 2HUEA 5TQ2H 3NRPA 2ATAA 2WXQA 1A4KA 3BDYH 4JBSA 3CV5A 4YXHL 4S0SD 3BEWB 2NYZA 2EIKB 1X5FA 2Y7SA 4LSRL 5IB3A 1AXSA 2AV1A 2CZNA 1OQOA 3QIUC 3P9WB 4NZRH 4UTBA 5IKCA 3C6LB 4NIKB 5M7QA 3Q2VA 1INQA 3LN4A 3M6DA 5L4FA 3OLEA 3FQ4A 4R9HA 4F2MB 1ND0B 2YMXL 1X7QA 3QPQC 3T3PF 2R4SL 3QNZB 3WENA 5JNYB 4P9HH 2MQ3A 3ZDZB 4MD5A 1L3WA 1CICC 3QJTB 2R1YB 4FX5A 1DVZA 2JTYA 1BXVA 3E0GA 4YHZL 1H19A 5DJXA 4JHUA 3U0PA 1TSRA 4FFZA 2X1XR 2Y5TA 1XF2B 4ODUB 4MNQA 2WSPA 3SDCC 2FBJH 2EDKA 4HK3J 5KYXB 1BVOA 1GOHA 1BJ1H 1NCOA 2PPEA 3KVDD 5IHUL 2MKWA 3B7UX 3QQ9C 4F7MB 1ZGLP 2HKHL 4OJCA 4WK0B 4DGWC 4N0RA 2NY3D 4BA8A 4YAQB 4DK6A 4K15A 3FBQA 4X6EA 2CLZA 5DVMA 3CHXA 4MMYB 3W39B 2VISB 1RI8A 3C09C 2Z92B 3NPZB 5DRNA 3DO7A 4FTVD 4HCIA 1WIPA 4P06A 4P8QA 1EHNA 2JNZA 1G7MB 3RX9A 4B9FA 4NKMB 3FMGL 3B9KB 1NGYB 4DP7X 2IJ0C 2JCCE 5FW7A 2DL9A 4MJJA 4N0UE 4HPHA 1T1ZA 1L9SA 3FSAA 2WQ8A 4I1NB 2AGJL 3K4ZA 2GJZA 3GYRA 1EMTH 3FO2A 2DQ6A 4JRXA 5LDUA 1EAPB 3GJFH 3JV4B 4LGSB 3RVUC 2ED6A 3RUGE 3FNKA 2R0WL 2FZ3A 3KEDA 5I1JH 3BH9A 4NQDE 4ZMQA 2WNGA 3EYVB 5TF1L 1ZLDA 4WFFD 3WBDA 1JWSA 3GKWH 1U91A 4LFHG 1WWBX 2DLGA 1MJJA 3IMSA 3W11C 3OL2A 4YHYB 2N56A 1IGTA 2EC8A 2MTPA 2PKDA 3IFNH 1CVRA 2ZWKA 4GSDL 2IH3B 4XRCA 3CFBA 3C2AH 3BD3A 4XAWL 3QUXA 1HINH 3BZEA 1J5HA 5E4AA 3X1GA 3Q5OA 5FF6B 4AKQA 4AMWA 2XQBL 1AQKL 1KCVL 3K46A 4V11A 4DKFL 3HNVH 1OSPH 4BELD 3OJMB 1TCMA 1PIFA 4ZSOE 4JN2B 1KCWA 3KAAA 3P0YH 1II4E 1JS4A 3T77B 4IIQB 4OLXL 1DYZA 1F4AA 1AYRA 3QQDA 3HN8A 4MJID 1LMKA 1B0RB 4X6DF 1V05A 3QULB 3HN5A 3ULVE 1Z0NA 3SBQA 4XB8A 1Y1UA 1ZVYA 3NGBB 5SWSD 4TPRH 4K8RH 1OE1A 4HALA 5I1DB 1OTSC 2I25N 1BMZA 2VXQH 2WZAA 3HNTL 4XBPB 5DYOB 3O6FB 5D1QD 4F3FB 2EUVA 1CLOL 3ZDZE 5GGTH 1F4XH 4LPVA 3V0WL 1GAFL 3ZDWA 1UB5B 1OT2A 1JZJA 2VAAA 3HG0A 3PAZA 5H37A 2GJ6D 2X4OA 1MNUH 3TZVB 3BLPX 1YECH 3TIDA 4GO6B 2HX9A 4P57A 3VH8G 3HB3C 4JANA 3NT0A 2GBTA 4Y0GA 4UQ3B 5JIMA 3VSUA 2CLRA 2AZUA 1RMFL 2CG9X 2N01B 2WBKA 4RMRA 4AOFA 4KNSA 5EBWB 4PBDA 3KPRD 1XR8A 4XX1G 1WYJA 3L3DB 4FD0A 1DTUA 1ZA3A 4UT7H 3FN9A 2CBPA 4B50A 2EE2A 1T83C 2VABA 2DQMA 4HAFA 4WFEE 3JV6B 1YO4A 1DN2A 3T0EE 3FULA 4ETQB 4QHNB 4K3DL 4Y4KB 4WI7A 4LO9A 2YS4A 2A6DB 3MRKB 1QSVA 4UNUA 2B9AA 2ZOUA 5CEZL 1U58A 2KZ1B 5CLXA 4XNQA 2YQGA 2D7OA 2VERN 2HPTA 4LEXH 2CCVA 1E7VA 3NA4A 1M56B 2UZPA 2ZSVB 1N7ML 3HLAB 3Q6FB 4GKNB 2NYYC 3GSQB 3KWUA 3X1EA 2A3TA 3JV0A 4A2EA 3ZE1B 4UQEA 2OW6A 5DJ8B 1F3JB 2BHYA 4YL4A 5FDWB 4K3HA 2OI9C 5EU3A 1PDKA 1LK2B 1AIFB 3QQ3A 1WZLA 3T2NH 1QFPA 4V2CB 4KROD 5C6TH 4KQ3H 1MCIA 2MQGA 1DQQA 4HJ0C 2IQ9H 1DLFL 3VFSA 1U8OB 2DQDL 2ITEA 4UINL 1AIZA 1GKOA 1I1FA 1LNUB 3ETBF 3I6KB 3OM3B 1D9KD 1AHWA 2WANA 2DBJA 5KEZA 2RB8A 2W94A 3KPPA 3PUUA 5D6CA 1AZZC 3APMA 5I74C 3M1BB 5L8KB 4G42A 3ESNA 2W38A 1KLUB 3MLUH 4QT5B 1BFTA 2IH8A 1TVHB 4LSUL 3CCHB 3H56A 1ZHNB 6FABL 2N7AA 4XNUL 2XZQL 4Y19A 2W65A 5KSAC 4UDTB 2UXGA 3WJLC 2FAUA 2Y1YA 5F44A 1LTXA 3US9A 1KCRL 1KGJA 4L8CA 5HJBA 3W5MA 3NA9H 3UROR 5KANG 5L6YL 4DSYA 2RAMA 3FU3A 3CLFH 4J4PA 1ITCA 2CXKA 4RFEA 2MPVA 5E8DH 5ADPL 3F7KA 4I48A 3EXJA 3U9PH 3VXNB 3VU2A 2BIIA 2GIMA 3II1A 3OLIA 4JAMB 1XD0A 4N8CL 4ONGH 2Z1KA 4F7TA 1OE3A 2IXQA 5HHXL 5EOQH 1KYUA 3BD4A 4A6YA 4PGDA 1QTSA 5TF0A 2AJZA 3FU8A 4IRZL 3FO1A 4BCZA 5AVSB 1FV1B 3DO4A 4NCC1 3QHTC 3EO0B 2MNUA 5F70A 3JTBA 2LGNA 3UG5A 4IOIB 3BUDA 1KCUH 2WWMC 3QZWG 1UM5H 4WK4B 3AT8A 4ADIA 3NZ8B 3WS3A 1IL1B 1FNGB 2Q7YA 2DN7A 4HF5L 2IFFL 1JUFA 1TFHA 2WKGA 5C70A 1RPKA 1RIUL 3VFGH 4MVBC 1GGIL 4RWYH 5KVFH 1MWAH 1QACA 1KYAA 3WJJC 3OAZH 4S1QL 3MODL 4DN4H 3LD8C 1PZDA 3D69A 4JZOB 1P1VA 1OGTB 1OPGH 3MRGB 5L2JA 2HRGA 4ZDHA 3ARFC 1YUHB 4ALAL 5T3XH 2VDKL 1PIGA 2IPUG 3IFOB 2FE0A 5I24A 1TQSA 1UKSA 1E2ZA 4L0ZA 1U8LB 5EOCJ 4QHMB 2D03H 3F05A 1LXMA 3WFEL 2FJUB 4J8RA 2QEJA 2ZP0T 4JY4A 2Y4SA 4ZPTA 1J0IA 3ZE1E 3NDYE 4HC1H 1UM4H 3F6IA 4OV5B 3EO9L 4NEHB 5JO5A 3QHFH 2DQJL 3TF4A 3GINA 5T1MA 5BW7C 1YJDH 4X99A 4WI0B 4LESA 5IVXF 3ROOA 2ZCKH 3MREA 3MV8D 2ZG1A 5HJ3A 4UNIA 1S2EA 4TVPL 3I75A 4YK4B 2ETWA 1G6RB 3IU3B 2GPZA 1J1XH 3RURA 1NICA 5IT2L 3NOIA 3MNWB 1T4KB 3OJDB 1PYWA 2VW7A 4ANKA 1UB6B 1KY6A 4BQ9A 1EO8L 5C0EB 1D9KA 2JELL 1TJGL 4KRPC 4X5RA 3EFOB 5E8NA 3V0HA 2I9LA 3V55A 2CH8A 1N6QH 2VDNB 5IVNA 1MLCB 3PPEA 4J27A 5J13B 1A7PL 4KI5D 5GGVH 5DO2C 2PWFA 5IREA 1ZV9A 1QP1A 2BVQB 1F4YL 5LGKA 1KB5L 2ATPB 3VTAA 1R0AH 3MXVH 4LDOB 1HCZA 1R9FA 4YHNB 3WUWA 2MCG1 1P53A 5DRZB 1FA4A 2WWOA 1PEZA 3CLEH 4Z5RA 2ZIDA 1AKJD 3NQKA 1GJIA 1K5NA 1P1ZB 4V1DB 5FFOA 2IWEA 2OR8A 5KBDA 1KGWA 1WO2A 2K4WA 2WXPA 5B39A 4X6CF 3VFPA 3SDDC 1WLHA 3D4ZA 1FDLL 4MMZA 4UIKL 3V5HA 3OVUB 4NUGL 4TM9A 8CGTA 4FZ8H 3ULUF 3JV5A 4OGAC 4FXLA 2IPTH 2I07A 4HHAA 4EN3D 3BFWA 3P1VA 3IN2A 1LP9E 1GGYA 5DMGD 2OKMA 3VSQA 5FECA 5GGRA 1R19A 3FRPG 2P8PA 5LXVA 1LD9A 1BVLB 5MI0C 2H32H 5H94A 1JNLH 3S7GA 1BMGA 3UFIA 7PAZA 1DSYA 2BS8A 4BA0A 3ELQA 4ABVA 4ZYKA 3NCFB 2CU9A 3SKUD 3P3RA 1RZGA 1C7TA 2Z8VC 1CGSH 1ZSDB 4PS3A 3V4VB 4IHOB 2RJMA 2KERA 3N5AA 1DVFC 2K0RA 1D5ZB 1EWHA 3VNZA 5HDBF 2XG4A 5HHVH 5IFJB 1BLNA 3ZOAA 1NCUA 1S7SA 3OKNA 2WYHA 4QJ5B 1FFOA 3G3LA 1A4KB 2NDFA 2QGDA 4NM4H 1M3JA 2WK2A 1TETH 3LRGA 4XPAL 2EEBA 5D96C 1EV2E 4GLRI 5HDRA 2HLFC 4F58H 5INDA 5IB3B 3PIQA 3RA7H 2AV1B 1FE8L 2JJSA 1INQB 2YK1H 1DBAH 2F7OA 3LN4B 2V8MA 3RP1A 1BFSA 5I5RA 1O5PA 4P4KC 1X7QB 3HAEA 4I4WA 3VWJA 5IQ7H 1E8WA 3KGUA 3CZEA 3NSCA 4MD5B 1UGNA 2YO3A 3WTTA 2ZKMX 2B77A 4FL4B 4XPHH 1Z3GL 2BNRE 3ULSA 5DJXB 3U0PB 1FNLA 2DOCA 5ITBL 4JFQA 5D8JH 1YMMD 4E36A 4JO8A 2QELA 4MNQB 5T1KA 4GQPH 1MCRA 1KJMB 1WF5A 1V7NH 4PGBA 3FZUC 2UZIH 3TA4D 5BVJA 3DGDA 4JFZL 5HHOD 2NCEA 2OTWA 2BXZA 1T2QH 1Q9OA 3MRLA 1BZ7A 1Z9NA 3DO7B 3OAUL 3S5LG 3QIUD 5D1ZC 1IC7H 3RBGA 1PZ5A 2YZ8A 2DICA 5JQIB 4PG2A 35C8H 2YIHA 4V1DE 2VJXA 1UCBH 5C07A 2CM6A 2GJZB 1CICD 3FO2B 3SPCA 4M43H 3MV01 4NO5A 4BXSV 4JRXB 1EAQA 2VLRD 4MFHA 3KL0A 3EJSA 1FBIH 4P2OA 1FFPA 4F2FA 5AD0A 5I1EH 1CLYL 1RZ7L 3RIKA 3AT0A 3BH9B 3SDCD 5BOZG 5F7YC 4NO2A 1OB0A 5FDYA 1BQ5A 1DANU 3QQ9D 1SXAA 1JWSB 5MHSE 1W0VA 1U91B 3WHXA 3QFGA 4YVUA 3OMZA 4DP5X 2PLTA 1UURA 1MJJB 2BH0A 2O6CA 1I9EA 1V5JA 4LDLB 5AVRB 5GHWL 3UZEC 3CQFA 4XMZA 2O5YL 4W81A 3B2VH 5J12B 1V3KA 3QJFA 1IGTB 3MV7D 4JM0A 2QR0B 4XRCB 1W72A 1H3UA 2NXZC 3CFBB 2VJ8A 4AWJC 4CUCA 4MBRA 4BJLA 5HYSA 3QUXB 3BZEB 1KNOA 5BNXD 5K9KB 1MF2L 3DBXB 3LXCA 1EDQA 4KMLB 1BG1A 3KLAA 1J18A 4Z9KB 1Y7VA 4Y4FA 1U8IA 2R56H 4Z3HA 2YD4A 2AI0H 1Q90A 4XT1C 2AQRA 3N41F 1E5YA 1WZKA 5KVEE 3RVUD 3ALPA 4HUXB 1L9NA 3GRWH 2HCZX 3RY5A 3QQDB 4JZJA 5FYKH 1KEGL 4OM0H 1HHIA 1HXKA 4FABH 1SRDA 4Z8FL 4GPVA 2FEDC 4N1HB 4YLQT 1LDPL 5E5RB 1TCRA 2I85A 5KVGH 3I50L 4W68A 3UL4A 3EAKA 2VSCA 1YEHL 1CD9B 3W11D 3V52L 4HYTB 4N1EA 4NM8H 1E43A 2WD0A 4RFOH 5EBGA 4A66A 3CUPA 1WZ1L 4FGMA 3FF7A 2X2UA 5KS9F 4PJ7F 2X4OB 5E5UB 3REWA 3SO3C 4QRRD 4HK3N 4OFIA 3TIDB 2VDLL 4OT1H 2V5YA 2WCGA 2VDQB 4MNQE 1XV8A 2VB5A 3L13A 4JANB 4HC1A 3G5YA 1TZAA 3MNZA 1I85A 2CLRB 3DSNA 4K2UH 1XR8B 2RCSL 4QMEA 2VH5L 2KUTA 2X70A 4X4KA 1ZA3B 2BHUA 2P1YA 1A3LH 2VN4A 2BRQA 3EYSL 3KR3L 4QOKA 2D73A 5IGXL 2VABB 3IGKA 3M45A 4JM2F 4N2NA 2KHAA 2AVGA 4QKXB 4XCFL 1NCNA 4AENA 1OTSD 3CN1A 5FFGA 4LSVH 4WWKA 4W70A 2CJ3A 2XWZA 1KGYE 1U58B 2H0PA 3E8VA 1DCEA 4LMQE 4XNQB 4KRMB 3D39D 4JRXE 2D0GA 3DIDA 1MW2A 5ERWA 3BDXA 4N90D 3I85A 5DZLA 5JOFA 3B2DC 5EEYA 1M9WA 2FJFA 5AKSA 2VXUL 5BUGA 3HB3D 4FFYL 3KD4A 1EHAA 5MENE 5CJOL 1OK8A 4PJGF 5EU3B 2V6HA 1FVDA 1PDKB 4AUJA 3QQ3B 5E08H 2F74A 3CFCH 1DQQB 3S98A 3F12A 4XPTH 5KJRL 2IANE 3B2PA 3VFSB 4B0MM 3STZA 2CDGA 4P2QE 2Z7ZA 1I1FB 3Q9QA 2FBJL 2OL3H 2OMUA 4TSBH 5L88L 1NIEA 2E9IA 1AHWB 2EZ0D 4KUCD 1LQBC 4AIEA 2EXSA 5EZLA 3PF2A 4O00A 3KPPB 4KKQA 5D6CB 1Z5LA 2D9CA 4LHUD 5DJZA 5C97A 1YEIL 5AB2A 4G42B 4Z7OF 3VGFA 3QDGA 1IC5L 1RZFL 3B34A 3OMAB 1MFEL 4DGYL 2Q2LA 5E9DD 1DQVA 3TU6A 2R69H 4Y19B 2W65B 2NYYD 4JQXC 1EH9A 2KZKA 4FNPA 5ES4B 5KSBA 1JGDA 4L8CB 4KK9C 2WWNA 4XC3H 3G6JF 1MY7A 5IHHA 1BJ8A 2EO9A 2ED8A 3BKJH 2Z93A 5C08A 2J8UF 4KWUA 3D3VD 3K4DA 2WUCH 1C1EH 4I48B 4HJ0D 1CE1H 4C58B 3AREC 1UA6H 1G6VK 2YPKA 4HVBA 2IXQB 2YPVL 4A6YB 5D7JC 2MFNA 3T0BA 4L3FA 4I13B 1T22A 4PGDB 1OAJA 3FO1B 4Y4HC 1BFVH 2V7NA 2XV2A 3DX7A 4AZ8A 5I6PA 3NESA 1OGAD 4NXKA 3WS3B 4OH2A 6TAAA 4TL5A 2Q7YB 1OF0A 1L6XA 1J8KA 2FHBA 4JUSA 4BGDA 1JUFB 4ZTOH 4Y7MA 3S0PA 3EJUA 3NZUA 1GRWA 1OCOB 4G7VL 4ORZC 1HWHB 2EE9A 5KSAD 4EF3A 1RJYB 4LPTA 2FB4L 5DD6A 1E5CA 3KYKL 4KO5A 1HJCA 3OC5A 4C8XA 3D69B 2CK0L 3DSFH 1G7PA 2HZHA 5L2JB 2Z8WC 4ZDHB 1VLXA 3K4AA 1UFUA 4W4OC 4L3CA 5HJGA 4XP6H 2F6AA 3FU7A 3LXAA 5EFIA 2ZOLA 1F8TL 4OTXH 2XY2A 1FFNA 2AAVA 4G72B 2J21A 3F7QA 4MDRA 4J8RB 4KHXH 4Z3FA 4JY4B 4ZPTB 4MS8C 1A5FH 5CP7A 2NR6A 4HWZB 4M6OL 2WWMD 2YUWA 3QXVA 5J11B 1G7QA 5JO5B 5D7IF 3I6LE 4W9ZA 5T1MB 2Y2YA 4X99B 3U6RA 2X3AA 3ROOB 5DURB 3MREB 5IQOA 1J5CA 5HJ3B 4AGOA 1XD1A 2PYFA 1X5KA 3I75B 1G9NC 4MVBD 5HYJD 4FQJH 1S7UA 4OCLC 4PN6A 5EF1A 1WAEA 1NCWH 3FAXA 2QGBA 3DJZA 4UNTA 3VA2C 5AW4B 1PYWB 3HHMA 4PJ8C 1LWRA 2E56A 5J89A 3WSQL 1D9KB 3Q5TA 3ARFD 1TPXC 1CJYA 2H45A 3I3EA 4HXAL 2I9LB 5CWSA 1SEBB 5E8NB 2AAAA 5EWIH 4HETA 3NUKA 1DCLA 1CXEA 4PJ6A 3PHSA 3ZKMC 3R4DA 5D7KE 3SQBA 3LQAC 2N7SA 1DEEA 3MRIA 4OLWL 2VSDA 3MRCA 2UXFA 3MR9A 4N28A 5FV2A 4R97B 4Y19E 5ABDE 2IALA 1Q38A 3QJQB 5E5LA 5AVYB 2JKNA 4D9RE 4HJSA 1VENA 3LH2L 1A6VH 4LL9A 3HI6L 2XNAA 3LKQA 4C4BA 5DQJA 1MH5A 2VLMD 1ASPA 3HPJA 5ISZA 4LEXL 1K5NB 2F08A 4GY4A 1MWOA 1OGSA 2YWZA 2O61A 2G5BA 5B1KA 5B39B 1KIRA 3ZZLA 4HS3A 4OLUL 4QDGA 3VFPB 3WN5A 1MHCA 4YS4A 4MMZB 4OF6A 3V5HB 4Q9RH 2EH8H 2KI6A 2X2YA 4KRPD 3GEFA 2FBRA 2TAAA 2I07B 4X9FA 4HHAB 4KKZA 1EXGA 1A1MA 1OOWA 2J6WA 3UBXG 3VX1A 5FECB 4PU2A 2EQDA 1HN1A 2VM4A 5DO2D 1W2KT 2P8PB 3EOTL 5GGRB 1LD9B 1OGAA 4WFHD 2V37A 2OMZA 5KBPA 1B4RA 3FO9A 3JWNH 5H94B 1QO3A 1CF8H 3R18A 2LV4A 3GHEL 1WAPA 4U33A 3IJEA 3NIGE 4ZTPH 4ZYKB 2NY6C 5I1AA 4KITB 1RZGB 2WXKA 2Z35A 5LBSA 2IBZX 2EDYA 1MAML 5E23A 1SUJA 4XN8A 3JWDL 2XG4B 4QNPF 1AY1H 5KYUA 4EXPX 2D31A 4YHOL 1S7SB 3OKNB 1U8KA 1FFOB 3Q2WA 4RZCA 4N2OA 2IH1A 3SDDD 3NJIA 4GI6A 4H0GA 3VYPA 4F27A 4ZUUA 2Y7OA 3CSGA 2XZAL 3UCRA 3M1OA 1KCSL 1DQDH 2JQAA 1KBGH 4E9TA 5INDB 3CLFL 3L45A 2XETA 3PIQB 4OGAD 5SWZD 3UC2A 5E8DL 4PREA 5LHDA 3WGUB 4L1DA 5F6HI 3HAEB 4I4WB 3VWJB 2Q0ZX 4RBPK 2BY3A 1HKLL 2AANA 3ES6A 2WGNB 4AMKL 2J6EA 4GBXC 2CMRL 4YXKL 4G9DA 4TSAH 5TK2A 1J1OH 3ULUH 1N6VA 3ULSB 2IG2H 3ECUA 1PJ9A 3TN0C 4DTGL 2YFNA 1U3YA 4WSGA 5E00A 4JFQB 4X6DA 1S7VA 4AL8C 4AEEA 1DVFD 2QZ5A 4FYQA 1XGUA 4KPHL 4Y5YC 3RWJA 1FHGA 3APCA 4WW2B 5T1KB 1QLRA 4OD2A 4WI3A 3V0GA 3GHPA 3QEGL 1NC2A 1P9MC 3L17A 5DUPL 2BCMA 4GRLC 4PGBB 5AAWA 3WGVB 5BVJB 1WGOA 2XQYG 2YEQA 4M6AA 1MWAL 3NP4A 4XGZA 4CU6A 2LFGA 2OTWB 5E2VH 2NX5A 1ZANH 1HIMH 4DN4L 5JW4Q 1Q9OB 5K93A 3MRLB 2HLFD 2RTTA 2R0ZH 2WC7A 3HHSA 2FBOJ 4F8QA 5T3XL 1ZLSH 2XJKA 5EZOL 5C7ZA 3BGMA 3TP4A 1FZOA 1PZ5B 1QPXA 4RGMB 1MRDL 1BQHA 3WTVA 4PGJA 3RDTA 1JPTL 2DQEH 4KXDA 4BQBA 4P5RA 4XP9L 4P4KD 1ZPLA 4BE6A 3BAKA 3HS0A 4XP4H 4NZ8A 1NCTA 2XQ0A 1AO7A 1RZPA 1HC1A 1TO4A 4V33A 5GZOA 2C9UA 4PJ5D 1T5WA 4NENA 1PLCA 2Z9TA 4N2BA 5GRVL 3V0VA 4NO5B 3EFDH 4HBQA 4Q6IC 4B41A 3TGXA 2PO6C 4P2OB 1CE6A 4OB5L 1FFPB 4BE5A 5AD0B 2IH9A 1VHPA 2LHAA 3UX9B 3O3DA 4X8JA 1WUNT 2A77H 2HT2C 1KULA 2GTWA 3DHJA 4NO3B 3FZUD 3MLTA 4KQ4H 3RBSA 5JTWA 1U2CA 2FQFA 4LFHD 2AK1H 1W0VB 1BAFL 2IPUK 1S7XA 3WHXB 1NKRA 1RFDL 2WNKA 4OZFA 3MRNB 4MA7L 4ONHA 1XGPA 2BDNH 4Q56A 4KZCA 1EEZA 1T03L 1SOKA 2P5EE 3QJFB 5D1ZD 3HC0A 4HQQH 5TTRA 3QYNA 1W72B 3EGXA 2YSTA 4NQCD 5LCVH 2FQDA 5ECJE 2C1PB 5A2AA 4EUPA 5ACMA 1KXHA 1X5ZA 5HYSB 1KNOB 2WAQA 4ESKA 5LVEA 1M1XB 2DI8A 3KLAB 3OGCA 4Y4FB 5DUML 3CZUB 1U8IB 3IJHA 4I2XA 2JB6B 1EVTC 3NCMA 1UXWA 4MRBA 3VG0H 2P80A 4PJDA 1T1XA 4G5AA 1QR1A 3VXTA 1ZJAA 1J5OL 1F41A 1FRGL 4PWHA 1ECYA 1HHIB 1TF4A 4PJHB 4TQPA 4G8GE 4HWBL 3VGAB 1MLBA 1TCRB 3MXWH 1BVZA 1E6OH 1RZKH 3WNJA 1D7FA 4ANXA 4IBTA 3QR2A 4MJ5A 2DB8A 2ZP8A 3ZQ9A 5DZ9A 1L0PA 3II3A 4NRZB 2NXZD 2WW8A 4PGZA 2VDMH 4AIZA 5BV7H 1TITA 4GAYA 3REWB 2YD0A 2QQLH 4FMKA 5DD1L 4DGVL 4JPIB 1U6AL 2FYVA 3DECA 3SJVA 3TBCA 1YMMB 1GS7A 2PXYA 1F3RB 4WHCA 4QTFA 3UMNA 2EVGA 1V3MA 2P28B 3G5YB 3D9AL 1WFIA 3MNZB 5HY9A 4J6RH 2OA9A 4WTWA 1ET5A 3D33A 4YXLL 4UILH 3DSNB 2B59A 2OR9L 2X70B 1GHFH 4MCYA 2ADFH 5IZ7A 3IT8D 2FEDD 1DO6A 1X5GA 3FCBA 4QOKB 4QXUL 4K3EH 1A1OA 4BKTC 3BAEL 4AENB 3U83A 3GBNH 4O51A 4ELMA 4WWKB 3VMNA 2Y7QA 3NIDF 2HJKA 4IJ3B 2PNDA 4ERSH 1LWJA 5C07E 2AF2A 2ZUUA 3FSVA 1PLAA 4W9LC 1EJFA 1RIHH 3QG6A 1M53A 1JRHI 5G4MA 1TR7A 3OV6A 1REIA 3LHPH 4X7SL 1RUAH 2D9QB 1FAIL 1DBAL 2YK1L 4L05A 5ERWB 4JRLA 2X6AA 4NPYA 5JOFB 1DVQA 4J23A 1BECA 3REVA 3MRJA 2DV6A 2FJFB 2OZNA 3QS2A 4NYLA 3GIZL 1RERA 4LASL 1FVDB 2DQTL 1B4TA 4K9JA 3U7AA 3N42F 4PBVC 1IO4C 4OCYL 1DUZA 2V8LA 1KSRA 3WXWH 4CVUA 2AEPL 1J9SA 2F74B 3FUIA 4JDZA 3F12B 3WIHA 3DOHA 2KZBA 5TH2A 3W2DL 2PPCA 3STZB 2CDGB 2F5AL 1NINA 3MCG1 2IGFL 2OMUB 1S9XA 2OMYA 4Z7WA 4QXWA 3CGTA 2HB0A 3M8OL 4CKVX 1P69B 5EZLB 4HLEA 4UTAH 3N44F 1Z5LB 2IF7A 4HKXA 5DJZB 3CBJB 5DT1L 1LWHA 1EXUB 5FM5O 2EIJB 1RPQA 5DCCA 4YPJA 3QDGB 5IVXA 1DJIA 1NL0L 1F56A 5IK3A 2R1WA 4WGVB 4XMKL 5BCAA 2R29L 4KXAA 3ZKXB 3S4SA 1ODAA 4KDTA 4PAZA 3LEXA 3QPXH 3RGHA 3V6OE 1QMUA 2LOEA 3PDOA 1HFUA 3DROA 5KSBB 5KVFE 3C8HA 5EDXA 1JGDB 2XX0A 4X4YA 4JFHD 1O9WA 2DIAA 2Z93B 2AV7B 5C08B 1AE6H 1WD9A 2Z65C 3BLBA 3DX6A 1IFHH 1FC2D 2HVKA 5B1CA 2HXAA 4GKZA 2YPKB 3UPRA 4WUKH 1YEGH 2GJPA 1WA2X 3NSDA 1GJUA 4ZO7A 4H8VA 2MNJB 2EO1A 2XDHA 3DX7B 1GH7A 4AZ8B 5H8DA 2DF3A 4DP0X 4LRIC 3OPZH 4QGTA 1A7BA 1LK3H 4X80L 5C8JA 4TULL 4PW9A 1F02I 2WJ7A 2R8SH 3BKMH 1QUPA 4I8DA 5HDOA 4X6CA 2AEWA 2ZXWB 4NSKA 4GAAA 4XMUA 4PGCA 5BRQA 3JT0A 1QHQA 1EGJA 5DD6B 4KK9D 4UUJA 4QOKE 2AJVH 1RV6X 3W56A 1MVUB 1LO3H 4HEPG 1G7PB 1NKGA 3S88H 1MI5A 5DEFA 5J0BA 3BGFB 2D7NA 4L3CB 2A4CA 3O6MH 3FU7B 3IPEA 2UY7A 1DQIA 2ILLA 4IRJA 5EFIB 3EJJX 3ARED 5ENWA 1AOHA 2Z31C 3VXMD 3MLRL 2GTQA 4FQQB 5D7JD 2LU4A 3CDFA 2ZOLB 1UWXH 3ZPDA 4WV1C 1FFNB 2OTPA 2OMBA 4Y4HD 3MOBH 4GG6F 1U2YA 4L37A 3B1UA 3D4YA 5CP7B 4BCXA 4N20A 5E4OA 4XVSH 4TNGA 3KHQA 3CC5A 4PWEA 4NM8L 1G7QB 2EIBA 3SKNA 3T71A 1R6VA 4A7GF 3U6RB 4PMFA 1L9TA 3PWUB 3F5WA 4PB0H 4QXVA 5DS8B 2Q76A 2NY1C 2PYFB 1UUNA 2ZOOA 4X6BA 1VGKA 5FR3A 4OT1L 1NWOA 1S7UB 2AXJA 4YHPA 2PCFB 3QARA 3IETA 2Z7UA 3OPUA 2QKIA 3ULAB 3SIKA 4LLVA 3VXOA 4O9HH 5JQ6L 2VDRH 5CWSB 4ZBJA 2VLJA 4PRID 2DYSB 1OOAA 4LHUB 1SLVA 3EBAA 2MSPA 4MJ2A 1IUZA 1I3GL 4UB0H 3P11H 1WGVA 3NIFB 4EO5A 2AJUH 1DEEB 1LL1A 3MRIB 3MRCB 4J12A 4B9JA 1XFPA 5FUZL 2IALB 1MXGA 5FGSA 4MS8D 3VCLA 5KSBE 4H2AA 3RWIA 1OW0A 1QG3A 3TO2A 2XNAB 1A4CA 2BVEA 5C08E 5D70H 2MPAH 1FIGH 5DQJB 1MH5B 2NY5H 3OR7A 3HPJB 5ISZB 1T0OA 5F7UA 1T21A 5IV2A 3U7YH 2O61B 2G5BB 4HS3B 1QUNA 3WN5B 1MHCB 2SEBB 5AOKA 1FFTB 5I6KA 4PHZA 4QO1A 2EDRA 4YHMH 1IT9H 2Q86A 4KUZL 4PJ8D 4NKIL 1CGYA 2WOBA 1JGLL 4KV5E 4OU3A 4B5ZA 3WTYA 4KNTA 5D1XE 1SZNA 1A1MB 4XPTL 1N0XH 5I74B 2QSCL 4ALAC 4FXKC 1Q9WA 5DYFA 3ZKMD 4DQAA 1OGAB 1RUML 5F2FA 5EEVA 2OMZB 3FO9B 1JWUA 4GG8A 1CXIA 1QO3B 4GQQA 5F3HA 1D6VH 1NWPA 3IJEB 1SQMA 3HMWL 2G3ZA 2EDQA 5F7NC 2UVEA 3O8XA 5D4HA 2LLGA 4XMPH 3PLYA 5I1AB 3Q8AA 2Z35B 4LLWA 4L4TD 4JQXA 2NY0C 3EHBC 3AG1B 2YN5A 4A1RA 4HOWA 1LO5A 5J9PA 4TUJB 3RL2A 3DV6A 4NI6A 3RJOA 3Q2LA 3N0PB 3JWOH 4LPUA 3MN8A 5I26A 1E30A 2A73A 2D31B 2J1XA 3R1GH 4XN7A 5DMIH 5KYUB 3P3TA 1ES0A 4FLOA 4XVTH 4LPXA 3B3IA 1CL7H 5BZXA 7PCYA 4RZCB 1KB3A 3VXMA 5I9QC 3ARUA 4ZUUB 4OCWL 5CFHA 2CUAA 4LLQA 3SGEI 1QBML 4Z3EA 3NACH 2NTFA 3KDPB 1FFQA 3HUJA 1XTMA 1IQDA 3HI5H 3WIFA 5DFTA 2VDOB 3GSNH 3EJQA 2XN9A 4PREB 3WMSA 3QJSB 3TBVA 2X2JA 2DAVA 3BKCL 1X4ZA 1MCOH 4DF9A 3QJXA 1MUJA 2FECL 1CYGA 3ES6B 3HMXA 4JKMA 2IDTA 1VSCA 2FNBA 4IRSC 5FUOL 5E6UB 3QEGH 2NY6D 4G9DB 4RESB 1CFVL 4QXGH 1SLWA 4ANWA 2ITCA 1E50A 2E27L 3FFCD 5E00B 5EU6D 4X6DB 1NFAA 1IX2A 3KYOA 4UV7H 2W9EL 1D5XA 2WN3A 1XGUB 3RWJB 1H0DB 3BSZL 1SMDA 1WV7T 2XYBA 4OAWA 1QLRB 3MACL 2QLYA 4OD2B 4XTRC 5CXPA 1NC2B 3TWYA 4NKDA 3V5KA 2VR8A 3P0VH 4KJPC 3T3PE 2G3NA 3DWTA 2P8LA 4XGZB 2IO5A 3O2DH 2NX5B 1ZLUK 5J3HC 3BMVA 5I8KL 4LRNH 1AD0A 2IV9A 4DVBA 5F9AC 5DZAA 4P2RA 3HHSB 3NRFA 4PJ7A 3I84A 4FQXC 4XO3A 5DA0B 5C6WH 5KS9A 3BGMB 1FZOB 1IC0A 5H2BA 3TPUA 3VW3H 1BQHB 2J44A 3RDTB 1DVSA 1KZYA 3I74A 5A3IC 1PS3A 5GRJH 2G3MA 4FZEH 4UTAA 3R4RA 4UQ9A 3HS0B 2EVFA 4ZZKA 4XNZB 3MRPA 4FQ2L 4NENB 1BSIA 1Z6JT 1N12A 3GRGA 4GBXD 4LVEA 4NC1C 3V0VB 4APXA 3FB8A 1WWAX 1B0GB 1XBRA 2YBGA 3CMOL 2Y22A 3BVNA 3PWPE 3TN0D 5J06A 4YE4L 5IJCC 4AQ1C 4GQRA 1CE6B 2CR3A 4I88A 4ZMYA 3IJ9A 1M57B 3MTRA 5FO2A 3O3DB 4X8JB 5FYKE 5FYLD 2Z4TA 2GTWB 3PL6A 3PYCA 4GRLD 5LWYH 3AU0A 1PAZA 3DBSA 4FQJL 4JPVL 2WHVA 5KVGE 1RL1A 4KZEH 1KBKA 3KBHE 5EF3A 2QV4A 4OZFB 5ELIA 5JW5A 4ONHB 4R4FL 5GS1A 1XGPB 4ENEC 2CHXA 2JJVA 3KPTA 3O9WC 4CADA 3HC3L 1EEZB 5I66A 5J6HB 3O0LA 3KVPA 1UKTA 2ZX9A 4P04A 3S5ZA 1BPLB 3HC0B 5SX4I 6PAZA 1BW8A 3EGXB 2GHWB 4M9OA 2D7PA 3L2LA 3WY4A 3CPUA 3IN0A 3QCTH 1CTNA 4EUPB 1F5WA 1VF5C 4JFEA 5FUCE 3SKMB 4G6MH 1RZJH 2TSAA 3L48A 7TAAA 4TV3A 4QTIH 2RR3A 3OGCB 4YDZA 4N0CC 3IJHB 3CFQA 4FXGC 4I2XB 3T6QC 1UXWB 2K4AA 4UAHA 1T66C 4PJDB 4RCAA 1T1XB 3SYPA 1A25A 2RIKA 4AH2A 4CMHC 4HIXH 1QR1B 2PO6D 2BCKA 1EZLA 3VXTB 3I2CL 1IGJA 5AKVA 3BJ91 4U6TA 1MCSA 4FFTA 1VEOA 5I8EA 2HT2D 4AC4A 1WS7A 5IP4A 1NLBL 3RWDA 2NW2A 1UT1A 3CXDH 4FHBD 3V0EA 2EDDA 2KPNA 1FNEA 1N8ZA 1WFNA 1N19A 4JMXA 4HBCL 1DQLH 3BQUA 4MJ5B 4XNYL 1S9YA 3LRLA 1S5IH 4P59L 4C57C 4UNVA 5EBLA 2MTAA 2DYPA 4Y9EA 2AS5M 3KPOA 1I9RL 4BEIA 3PGFL 4GW5A 5A2FA 1GOGA 1YYLH 4AIZB 4CJ0A 4X6DE 1A3RH 3S3CB 2AQPA 5EU6A 3G6JA 2X05A 1E6JH 3SJVB 4XO8A 2DI7A 1CBJA 3CLWA 2PXYB 1CF8L 3RIFF 5ID1A 2RH0A 2A9NL 2P46B 3FT2A 3HLKA 3JVGA 4G8IA 5FHAL 1ZA6A 5HY9B 1G5GA 2NX5E 3WFCL 2AQ1A 4WAFA 3ZZQA 5EIIA 1DL7H 2B59B 1J0ZA 2HRLA 3BFQG 2NZ9C 2NNRA 2BP8A 2EACA 4MCYB 1IGFL 1BJMA 3TEZA 4PLJC 4XN9A 5I8CA 1LQSR 2N1KA 1Z5YD 3C60C 4LQFH 5IVZA 2AKRA 3UAAA 4C4KO 4HUVA 1A1OB 3G04A 3H2PA 4FRWA 2ZSWB 4MQXC 4O51B 4HAKA 2JQMA 4ELMB 2A4ZA 3HFMH 3A24A 3LIUA 1AO7E 2HJKB 4P4KB 5E2WL 5EZIH 3HBQA 5FA3A 1BM3L 1TEYA 1KBGL 2DTMH 3EYFA 5SX5K 4F8OA 1EERB 3QG6B 2VERA 2QBWA 4PJ5B 4UV4L 5CBAA 3Q6GH 2ATKB 3QCUH 1G6RL 4DGIL 3CHRA 1TMCB 4K3JH 3CFTA 4NPYB 1UWEH 3REVB 4XCNA 4NYLB 3SCMA 4NWTL 4CRPA 4M7LH 2QPUA 2VKXA 3O6KL 2LVCA 4HH8A 25C8H 1F6AA 2LU5A 5GGRY 2VDNL 1DE4A 4K4KA 3SY6A 1A9EA 4PY7A 1SBBA 1DUZB 3NTCH 4JDZB 4N2KA 1XF5A 3PRZA 1XGYL 5F9DC 1UC6A 1Z66A 4L3ED 4MWFA 5I6MA 4K7PH 2BNQA 3ZN6A 1ACXA 3MA9L 3DTUB 1KDJA 1S9XB 2OMYB 5FX3A 4Z7WB 2BINA 4GKSA 1QW8A 4P0DA 2X9XA 3CHQA 4HKXB 1ZT1A 3BVUA 1ZANL 2YLKA 5F3BA 4Y9BA 2WQAA 4E41A 3CZSA 5IVXB 4A39A 1JZIA 5I1HL 4F7PA 5IK3B 2R1WB 3QXWA 3FQWA 5L0QC 3H9SA 5BQDA 5C09A 5CINH 3S4SB 2ADJA 3BSHA 1QRNE 2DQEL 1ZE3C 3LEXB 3L9RA 2X4RA 3IGAA 3PDOB 5IG7A 1WEJL 1H6EA 3DROB 4X4YB 5FO7A 1DQJA 4UOW1 1DSWA 3X2QB 5D5MA 1DQMH 5KVDH 4R26L 3Q2NA 2YAOA 1ADQL 2GKIA 2VR5A 4X83A 2KLRA 1NAMA 5CCKH 3DX6B 2XQYK 1R3IL 3TESA 2HVKB 5HVHC 4GKZB 4U1SA 2Y5QA 4ICWA 3UPRB 4AI7A 3GMRA 4G1MA 4LCYA 4J2QA 4OIIH 3V4VL 1KUMA 2G2NA 1KC5L 3SJVE 1CIDA 5AW3B 3GUTA 1JYNA 4CU8A 3AMKA 3STLA 1H8OA 1Q9LA 4XP5H 4MA3A 4E5XA 2P44B 5C8JB 3RRQA 4IKNA 4OCSH 2Y07H 2GC4C 3QEQD 1YEKH 3KVQA 1FSKB 4WEBL 3NYKA 4X6CB 3LRHA 1RD6A 4NSKB 4R90L 3FO0H 1SJMA 4TQEL 4PGCB 5E8PB 2E7MA 2JH2A 2YD6A 3UG3A 4UUJB 5TFSH 3OZLA 4PI2A 4BK5A 5DF0A 1PZ3A 4GAFB 4E2OA 2E8ZA 2NQ3A 1MI5B 2NUPA 5DEFB 1JI2A 3W57A 4C83A 4EKXA 4ELME 4M7JL 1JYWA 2UY7B 5ENWB 3TF7C 1OY3B 2D3NA 1U3HD 1VIWA 5T5FH 1OAYL 3GTNA 4OCXH 1ZTXL 1BREA 2E46A 2VZ1A 3A6OA 5L9DL 5E1AA 4L1TA 2DBLH 5LG6A 5JA8B 1F90L 1BJ1J 1JFQL 1VEPA 4L37B 2B0SL 3D2UD 4FFZL 3CFIC 3WS6C 4HIIA 3VB8A 1SJVA 2VN3A 3IS1X 4K9EL 5CSGA 3CC5B 4DETA 2N4IA 1EO5A 2UX7A 3FOMA 4JRYD 3F3HA 5F89A 3SKNB 5CEZD 4M5ZH 2HX8A 4PJFA 4YLBA 3F5WB 4DVRL 3P30H 2Q76B 4AJWA 5FHBL 3FT0A 1VGKB 4X6BB 3N1PC 3VXRA 2E75C 4YZFE 5AKRA 4FCHA 4WQOA 4R7LA 4YHPB 5TDPA 3IETB 3PWVA 4ICXA 2BZDA 5IW1A 1GJWA 2FX7L 4KK5C 4JJOA 4LLVB 3VXOB 2HTKC 3ZHDA 3RU8L 1T89A 1MRFL 3NCJH 2Y6SC 3UBHA 2GYSA 2VLJB 4L4JA 4P2YA 5HHMD 4A7UA 2J72A 4DKAA 5IVXE 2Z31D 5IY5B 5DC0A 3GXTA 2ZWYA 4QRSA 3NJGA 2YJLA 4KXZH 3V5DA 2C9PA 4AGLA 4JJ5A 1T0PB 1DVYA 1KJ2L 2A5UA 1BBDH 5DJ2A 5F9WC 3VCLB 4X9GA 1IE5A 2Y9RT 5D2LA 4U49A 3PGCA 3RWIB 5ESVA 3TO2B 1PZAA 3VXUD 2VOTA 2Z4QA 5BPPA 4RX4D 4WENB 2DM3A 3X1BA 3O11A 3OR7B 4CN1A 1FL5A 1CURA 2NY1D 3VTMA 1T21B 4MCZA 3D30A 5IV2B 3D4GA 1QUNB 5I75C 2R7EA 4F5CA 2AEQL 5LG1A 1CU4H 1E2WA 4QO1B 4K7FA 3MLPA 2Q86B 3GBLA 5INCA 3RY6C 1RH8A 3UJIL 1BZ8A 1UATA 3IGFA 1QLEH 1F6FB 2IWGA 5ICUA 3QDJD 4PJXA 1HCFX 3GS7A 3KS0J 1FPTL 1H3TA 3EBGA 3MKKA 3U30B 1Q9WB 4XWGL 3D85A 5L2KA 2A6JA 4M1GL 2C26A 3EDJA 2G4EA 1JWUB 4GG8B 5F3HB 4X6CE 2JI1A 2FSEA 3WXVL 2WXJA 4Z0BH 1CG9A 1T7YA 5J5EA 1YNTA 3O8XB 3T04D 5I0WA 4LLWB 3ULUE 1BZEA 3BZFB 2CNYA 1LO5B 3OXSA 2ZG2A 5F7EL 2YC1A 1JHKH 3H3KA 3RL2B 3DV6B 1MI5E 2BWQA 2R51A 3KL3A 2YGPA 4BYHA 1JZHA 3BWUC 4RLDA 4EI0A 3I3DA 2A73B 1ES0B 4YBQC 4C4KT 3QPXL 3B3IB 3BQVA 3Q9PA 5D7SH 4D8OA 3VXMB 5HTSA 1U3HA 2VXTH 1E27A 3DMMA 3EGSA 3INOA 2IOOA 3NJXA 1IAIH 4LLQB 4J3OG 4MX7A 3AACA 3HUJB 5E8OA 5JIQA 1IQDB 3TL5A 1QPPA 4GB9A 2K9FB 2XN9B 4H8HA 3P73A 2Q6WA 3VXSD 5HDBE 3TBVB 2ZJSL 4LMQI 1RIVL 4JRYA 5L4IA 1D6EA 2VLLA 5ADOH 2XA8L 4ZD3H 1MUJB 5HVGB 3MJWA 3O81A 3QORA 1Z9MA 5EUOA 3CDZA 4F7KA 1EZUA 2NY0D 3EHBD 1L9QA 4FQIL 1UUSA 3RDJA 2ITCB 3WL9B 3KYOB 1XIWA 4OAWB 3BKML 2UVFA 3EOYG 4G3YH 3H1ZA 3VRLF 5ESQA 3NCYP 3HBZA 4NKDB 4JFFD 4MCNA 3QWRA 3LPWA 4U1NA 3K8KA 5EBMA 5CFAA 2P8LB 3SE8H 2ZPKL 1PBYA 3MBXL 1KCKA 4NZUH 4LCIL 3CN3A 1AD0B 3DUUA 3MUZ1 4DVBB 4XPGH 5CBEA 1WAAF 4P2RB 1EFXD 4PJ7B 1U4FA 3GI9L 5KS9B 1YEEL 5I28A 5H2BB 3TPUB 1EX0A 5EORL 3WD5H 3IE9A 4A2HA 4WSKA 3FUKA 2VMCA 3KLSA 2J5LB 1B90A 3K3QA 3TXAA 1GC1C 1IC1A 3OKYA 5C1MB 2JJUA 1TZGH 3MRPB 1X44A 2E4TA 2C4XA 4IRSD 3RTQA 4CAGA 3SPHA