1E30A

Crystal structure of the met148gln mutant of rusticyanin at 1.5 angstrom resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
LDTTWKEATLPQVKAMLEKDTGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTNFTWHPTAGTYYYVCQIPGHAATGQFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the Axial Ligand in Type 1 Cu Centers Studied by Point Mutations of met148 in Rusticyanin
pubmed doi rcsb
source organism Thiobacillus ferrooxidans
molecule tags Rusticyanin
molecule keywords RUSTICYANIN
total genus 34
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1e30A00
3PAZA 4KO5A 4HAKA 3EH5B 1XB6A 2GIMA 3AG1B 2RACA 3TASA 2BP8B 3KW7A 2Q5BA 1WA0X 2CUAA 3T6WA 4BWUA 2DYRB 3SQRA 2P80A 4YSUA 2DWSA 6PAZA 2YXWA 2ZONA 2QDVA 1GYCA 4F7KA 2I85A 1AZRA 4YSTA 1ET5A 2I7OA 1R1CA 2VM4A 3PXLA 4F2EA 1AZUA 1AOZA 2Y1AA 4ZK8A 3AY2A 4GY4A 2FQGA 1ASQA 1SF5A 2A3TA 1MZYA 4G7RB 4DP9X 1PMYA 3MBWB 1TEGA 1JOIA 1JZFA 1ZIAA 3EH4B 4YSQA 3UAAA 6PCYA 3NT0A 3FS9A 2YAMA 4BXVA 2XV3A 4E9SA 4HALA 1AS6A 4YSOA 3TBCA 1ASPA 3S8FB 2YARA 3TBBA 1J5DA 3JT2A 1I53A 1BYOA 2E86A 3WI9A 4DP1X 1MG2C 1OCRB 1NICA 2NRDA 3T71A 4A2EA 2GBAA 3EHBB 5F7AA 1PAZA 4HCFA 2DWTA 5I6OA 4YSEA 4X4KA 2XYBA 1NIDA 1NWOA 2ZWNA 4HHGA 2VW6A 2BZ7A 2BWIA 3QJTB 3FU8A 4GP5B 2YXVA 3X1GA 1AQ8A 1TU2A 3NSCA 3WIAA 2XVBA 3EF4A 4DP7X 3DTUB 3H56A 4G72B 2BW5A 4Q8BA 1ZPUA 1W6WA 1QHQA 4Q89A 2YAQA 4DP4X 3NP4A 3U25A 4KNTA 1J9TA 4W1TA 3NYKA 2PLTA 1MDAA 2BP8A 1AZCA 1OCCB 3PAUA 1JERA 1JZEA 2CALA 1KDJA 4DPAX 2IAAC 4EF3A 1KCWA 1IKOP 4GXFA 1J5CA 3QJUB 1EZLA 3CVCA 4E9RA 1E65A 2XV0A 1OE2A 4A2FA 3JTBA 1X9UA 4KOBA 3QJSB 2VN3A 2X88A 3FSVA 4G70B 2XLLA 4DP8X 2HLEB 1ILSA 4WTQA 4YSSA 3WKQA 5F7BA 3FPYA 4MFHA 2BP0B 1GS7A 4P5SA 2HXAA 2XWZA 1AANA 2BP0A 1SHWA 2UXFA 1IUZA 2UXVA 2GC7C 2HRGA 2AZAA 3X1EA 1WA2X 2IDFA 2XU9A 2QPDB 4KOCA 4G71B 3ZDWA 3T6VA 1SNRA 1OCOB 3UACA 4CSZA 4PCYA 1WS8A 2FQDA 3L45A 4KO7A 2AZUA 1JZJA 2OCCB 1OE3A 2W88A 4PAZA 3D12B 1ILUA 2B08A 2PCFA 4DPCX 1E30A 3WKPA 1NTDA 2EINB 2PP7A 1A4CA 3KW8A 4NAJA 5PCYA 2GC4C 2J5WA 1PNCA 2DY2A 4RH4A 4DP6X 2PPDA 1RZPA 5I28A 1SJMA 2VSMB 3H4HA 2R7EA 2X87A 3NJGA 3WG7B 4G7SB 3CDZA 4YSPA 3UAEA 2JFCA 4E9WA 2IDSA 4YVNA 1L9SA 3OMAB 2PPEA 1ASOA 3TA4D 1MZZA 4UAHA 2FT6A 3T6ZA 4BDVA 1PF3A 1XMEB 3ABGA 1F56A 4W9ZA 1EHKB 3GDCA 4BWTA 2AVFA 1NIBA 4AKOA 4GP4B 1GY2A 4A2GA 2OJ1A 3S8GB 2QPEB 1CUOA 1AAJA 1AS8A 1GY1A 1A65A 4M4RB 3FPXA 4F2FA 5A7EA 2QT6A 2FJSA 4GP8B 1L9OA 5AKRA 3ZX1A 2IH8A 3FSZA 4YSRA 1JVLA 1ETJA 2BW4A 2PCYA 1A4AA 2PP9A 3HEIB 3OMNB 4KO6A 3PCYA 5I6MA 1A8ZA 1VLXA 4DP2X 2HRHA 3ABLB 4A2HA 2BZCA 1URIA 3V9CA 1HAUA 3AG4B 1BAWA 1FWXA 5I6NA 1IBYA 1NINA 3NSYA 1N68A 2IDTA 4FAAB 5LDUA 1AR1B 4DP0X 1HAWA 1MG3C 3IN0A 1E5ZA 1NWPA 4BDVB 2H47C 3ASNB 4P5RA 4BXSV 3NJIA 5B3SB 1BQRA 3QJRB 2CCWA 4NB7A 1XB8A 2BWDA 3N2JA 4NERA 2YQBA 2PP8A 2YAHA 3UADA 1HFUA 4AKPA 3ABMB 7PAZA 1PLBA 1M9WA 3PLYA 1AZNA 3SBPA 4A66A 1OCZB 5I5JA 1CURA 1BEXA 1CYXA 4QLWA 2FT8A 3DIVA 1SFHA 3NJKA 1BYPA 1A3ZA 2BHFA 3NJNA 2IH9A 3FSAA 1NPJA 2H3XC 3S3BB 8PAZA 1PZAA 3V9EA 3NSDA 3FQ2A 1JZHA 2TSAA 3NJHA 5AFAA 4UANA 2HZHA 1BQ5A 3BVDB 4KO9A 4YSCA 3IN2A 5TK4A 3T9WA 3AZUA 2XV2A 4HIPA 1PNDA 1NIAA 1E67A 2B3IA 1ZIBA 2WO2B 1SHXA 5EHFA 3OMIB 1GS8A 5B1AB 9PCYA 1WA1X 1JVOA 1QLEB 5B1KA 1KCBA 4AKQA 3SBRA 3X2QB 1KGYE 3UGEA 2WSDA 1OV8A 2ZOOA 5AZUA 1UATA 5FC9A 4HHWA 1KBWA 4KNSA 4HCGA 1RKRA 1J9QA 2EILB 1RZQA 1KBVA 2VMJA 5E9NA 2EIJB 4GYBA 5B7FA 2XXFA 4DPBX 3CVDA 1PCSA 1OF0A 1JZGA 3ASOB 5I6KA 1ZDSA 2QDWA 2MRYA 2GSMB 2UX6A 3NJJA 1AG0A 1SF3A 1FFTB 2XXGA 3ABKB 3QJQB 2HX9A 3WNIA 4E9YA 3FU7A 3ZBMA 2IWKA 1FA4A 2Y69B 1DZ0A 4JKNA 1ID2A 4ENZA 1NPNA 2GHZA 3ZIYA 4L0PB 2VM3A 4JHUA 1PZCA 2HX7A 1DYZA 1QNIA 5D4IA 4YL4A 2W8CA 4QKTA 3QPKA 2AFNA 2FQFA 5B1JC 3UABA 1JXFA 1L9RA 2GI0A 4WKXA 2CBPA 3HB3B 1GS6X 3FYIB 3X1FA 3OM3B 3BQVA 5B1JA 4G7QB 1KYAA 2ZXWB 1ZDQA 4N8UA 3H4FA 2YAEA 1IC0A 1SDDB 2Q9OA 2FWLB 5PAZA 4BK5C 1KDIA 2IDQA 2PPAA 1SDDA 1V54B 5ANHA 1ADWA 1NDTA 1T5KA 5TK2A 1NZRA 3OQRA 2H5UA 3ERXA 1BXAA 1W6LA 3NP3A 5I6LA 2AANA 3IBOA 3IEAA 1SFDA 5D4JA 1J9RA 1YLBB 2PPFA 1BXUA 2JKWA 1V10A 4M3HA 1GW0A 1JXGA 1RCYA 1CC3A 2R7EB 5B7MA 1CYWA 2YAFA 1AIZA 3PPSA 4K9JA 4YSAA 4E9TA 1PLCA 1PZBA 2UXTA 2IWFA 3CDZB 1ZV2A 1M56B 4HZ1A 1PY0A 1AS7A 3DKHA 2DYSB 1BQKA 2P80D 1X9RA 4AZUA 2JXMA 1WS7A 2CJ3A 2FQEA 5B7EA 3RYMA 2EIKB 2UXGA 3AG2B 1BXVA 3WNJA 1GR7A 2FNWA 2TSBA 3FU7B 2IWEA 5I6PA 3FYEB 2GB2A 4N4YB 3FQ1A 1AACA 3EH3B 3FQYA 3X1NA 2XX0A 5D4HA 4E9VA 2FTAA 1IBZA 5I26A 4A67A 2J57A 3C75A 3FSWA 3G5WA 2I7SA 4FA7B 1PLAA 1WAEA 7PCYA 1KV7A 3X1BA 3NJMA 5I5MA 5IY5B 2VW7A 1AZBA 2WO3B 3CG8A 4A2DA 4E9XA 4E9QA 3AG3B 1M57B 3AW5A 3CZUB 2BO0A 4UF7C 3IE9A 3N55A 4AI7A 1XB3A 1NIEA 2OV0A 2VW4A 2YAOA 4YSDA 4KNUA 3NJFA 1V55B 2YAPA 2IDUA 3S3DB 1OOWA 2EIMB 5I5IA 2N0MA 2PPCA 1A4BA 2HX8A 3T6XA 2XUWA 3PAVA 1TEFA 3CVBA 2MTAA 3NSFA 1NIFA 1TKWA 1AG6A 1OE1A 1GSKA 2CAKA 3GXUB 2VSKB 1JXDA 3QJVB 2LLNA 2J55A 3QQXA 4HCIA 3SBQA 4TXVB 4BWWA 2DV6A 1L9PA 3MX0B 2XX1A 1B3IA 3TU6A 1J9SA 1N70A 4A68A 2UX7A 4AX3A 4JHVA 3GYRA 4CSPA 1W8EA 3OD3A 3FT0A 5B1BB 3S3CB 1ET8A 2J56A 1JZIA 2FT7A 1L9TA 1E5YA 1ET7A 4YVUA 4DP5X 3NJLA 1L9QA 3FU9A
chains in the Genus database with same CATH superfamily
2ATPA 3S34H 5GGRB 1MCWM 3FB5B 4NYLB 1A8JH 3JUZA 3QZMA 1MJ7L 4GXUN 1RJLB 1WFOA 3QFJE 1C5CL 5KW9L 1FDLL 4LSPL 4DGYH 3ATEA 5ESQA 4A38A 2BP8B 3CZKA 4NM8H 4UNTA 3KXFE 5C0FB 4PRBA 3QYCA 3RIAF 1C8QA 1GYCA 2D7OA 1A7NH 2CLZB 3DX7A 5KBPA 3TP4A 3LV3B 3NZHL 3MCLL 2VM4A 1MIMH 5LCVH 4QJ5B 2JIXB 4Y5VC 1URZA 4UNVA 2EVGA 3IK2A 3NUKA 5ICXA 3G5VA 4O4YH 3JWNH 3VGFA 4FA8A 1ASQA 3RL1A 3RVWC 3UX9B 1FC2D 4YAQB 4GQ9L 3CQQA 3MBXL 43CAA 4FTVB 4NZUH 3BHBA 5L2KE 4XX5A 2YZ1A 4JGUA 2HN7A 3RX8A 4IMLB 3QEHA 4PJ9B 4RRPG 1CJYA 5HYFA 3BCDA 3POCA 1OW0C 4QRTB 3RB7A 2XV3A 3GMRB 3HI5L 4XN9A 4ZQKB 4HALA 5DO8A 1U42A 4OFKA 5A2KH 4XB3A 3EZJB 3RY6C 2H1PH 3MUGB 5G2NA 3T3MF 3DJSA 3WTUA 2NRDA 3GBDA 3CDCA 4PJEF 2R2BA 3CX5J 1ZT1B 2P49B 5EU6E 1MCEA 4CW1A 3H2PA 2P28B 1U41A 2F7PA 2BWIA 4Y9CA 1W80A 5FECA 4XNYH 3QIBC 4XCEA 4DKDC 4E5XG 4IU2B 4R7VA 1YEHH 2OR9L 1KZQA 4GG6B 3APFA 1U8CB 3L5WB 4BGDA 4A7GA 4ILDA 2NSXA 4W70A 1I1FB 1Q9OB 2AJZB 4P0DA 5EZOL 3HFFA 2FSEA 4BV1A 2IPTH 3F7YA 4NOFA 4OAWB 3GUTB 2FSDA 5H35B 4PU2A 4HUUB 1EJFA 1I4FA 2ORBL 2VDML 4GPVA 1QBBA 4EF3A 1LE9B 2VXQA 1A7OH 3S37H 1BV8A 2XJLA 3S36H 2Z35B 1DBKL 2EP6A 2OMBA 3OSKA 3HG5A 4XBPB 1F11A 1TQVA 1KJ2B 5CD3B 5GGTA 4F20A 4KOBA 4OJAA 4FQHA 4HGKC 5L4IA 1E6OH 4W9GC 2CGRH 2AITA 2XLLA 3B7UX 4JFEE 3WUWG 4HWNA 5AAMA 1OALA 4DW2L 3FH5A 1KN2H 4Z77B 4MFHA 2FX8L 1S7RB 4P5SA 5L6YH 4HZLA 1LQBC 5EZIL 4N8VG 1X7QB 3N0PB 3O9WB 5GXBB 2XU9A 1XZ0A 3BVNB 3STBA 3ZO0A 3BYYA 3MJ8B 3L3IA 3RDTC 3BPCB 4X99A 4CN6A 3D12B 2F1EA 2HTLD 1ILUA 4FS0A 4R7LA 4UCFA 2CJSA 3SYPA 5HXMA 1Z7JA 1Z9SA 2I9TA 1EJOH 4HWEL 2GC4C 2HJLB 4RH4A 4D7PA 3HR6A 4PRHE 1PIFA 4DGIL 2C4XA 3DVGB 4N2LA 4IKNA 4MCYA 2NX5E 2FRGP 1UA7A 4NBXB 1YYML 2X87A 5E70A 4R7XA 3WFDL 3WG7B 2E7HA 2GJPA 2ZX9A 4Z3EA 3F7VB 1QBAA 1SYSA 3IU3A 4E9WA 1WISA 3IDMA 3D39D 4G9FB 1BBJA 2PPEA 3O45B 3VH8G 1S3KH 1DQQA 3QIWC 4X7TB 1WLHA 2W0KA 1OSZB 1ZLWK 3FH8A 5FUOH 3RX5A 1EHKB 2VIRB 2XRAL 4I1RA 5DJZB 1FO0A 3CU7A 5CGYD 4NO3B 2W94A 4OCYH 2OJEA 1OK8A 1WSST 1N9PA 2K78A 4PJHF 5I8CA 2RAMA 4JFPB 5E9DE 2ZPKL 4ZAKD 3QI9A 1VENA 5DJXA 4XC1L 5JTWA 5F88B 4M4RB 2GJRA 4OQTH 4J3VA 4MDIB 5CBAA 1CFTA 1U58A 5ALBL 5TE7H 2DWDA 1MAKA 5EU4B 5K5YA 2J20A 1AI1H 1W0WB 2ITEA 3NSXA 4IHOB 1RZIB 1I3RB 3PWJA 1DQJA 2LU4A 4YSRA 5F7DA 1F4AA 5IEKA 4GSDL 2JK5B 2J6EH 4CC4A 2VTFA 4QWWC 2WQUA 3ZTJG 4P5MB 2ILLA 3OMNB 3IGLA 2YEZA 2X28A 1Q1PA 2A9NL 3G04A 3Q3GB 3TS8A 3HG0A 4G9DB 1CU4L 5DD0L 5FO2A 4LL9A 3HG4A 3ZE1E 1T7WA 2BRRH 3U1PA 4X6CB 1URIA 3RL2A 3BPNB 4UV7L 3AG4B 2ARJQ 4G1EA 4JGMA 4ZUTA 5T1KA 3WUZA 3MPCA 3ARBC 1F4XL 5BQ7A 4NO2B 1N68A 3SDCC 5HDBB 5HHXH 3QO0A 4TUOA 3C5JB 4GJTB 4H25A 3HNTH 4WGVB 5J5EA 5EBWA 2ZYHA 3HPLA 5HPMB 1Q4NX 3MXVH 4LRNH 5I71B 3B5HA 1MUJA 4UAOC 1MCRA 4JB9H 4XWGH 4I18B 4DOHB 2F68X 2D9QB 2XETA 1NLDH 2Y5EA 3QUYB 1BZ8A 4ZFZA 1MCCA 3UPCA 3PHQA 1XB8A 2Y25A 5LBGA 2FECL 1J5HA 4AQZA 4KAQH 2BSTA 5EB9A 3T3MB 3GNML 1HFUA 3FQ4A 4N2MA 1MCHA 1R47A 4KMQA 1IAOB 3CIAA 5J13B 1S7TB 2ROYA 3GSNB 3IGFA 2XTLA 5MENA 3EJTA 5JIDA 3AXLA 3DX0A 1GOHA 1E2ZA 5CEZE 4XNZB 3KCPB 4FQIL 1UQSB 5CO1A 2IH3A 2NMSA 2X4RB 4PJAA 3VFSB 2CM5A 4XN2A 4ZOCA 5C08B 4YDLB 3S3BB 1KPRA 3OGCB 1BVLB 3UJIH 2XXCB 1B4RA 3VI4F 3QVAA 3ARED 2KUTA 3QIUC 1IC7H 3TCXA 3VI3E 2HWZL 1GJIA 1R5WB 4XVJL 1R24B 4H20L 2OXGB 3GXPA 1RUPL 4PI0A 3VD7A 5IF0B 1JWMA 4JM2C 4MNHA 4PFEA 3ZMNA 3MUJA 4WTWA 4UQIM 5I9QB 2YLKA 3DUSB 1FNSH 1YZZA 3QAZB 5T5NG 3UAJD 5F0MB 1D5XA 1B0GB 2H32B 4YHIA 2H0FA 5B21A 1A6WH 1YJDC 3I02A 4TNFA 1B4TA 2JI1A 3KLAB 3QE5A 1DBBL 1NCBL 2XQBL 4TSCL 5FUCE 1I8MB 5J6HB 2ZWYA 3MACH 2ED9A 5JQIB 4UIMA 3L3KB 2C9VA 1P6WA 2IQAB 1BJ1H 4F93B 3CFDB 1ITCA 2I25N 2RJMA 3GMMA 3V0WH 2R0KL 1RD6A 1TO5A 3GSOB 1BOYA 1KT2A 5EUOB 2VOTA 2FAUA 5C6PB 1V7NH 2D03H 5AVWB 3WENA 3P9LB 5EBLA 2AJSL 1KBWA 4RMUA 4RCAA 4DCQA 1HKLL 3V6BR 2WOYA 2MCMA 3TFBA 1X5ZA 1CF8H 1X5GA 1XAUA 2VMJA 1AD9A 1IAMA 3OJVC 5MEOA 2AKRA 4FQXC 3NFNA 1XH2A 3CLFL 4YC2B 3I6LD 3FCTB 3TH3T 4XVSL 1CXKA 5DGQA 2Q7YA 2WHVA 3LSOB 2OBGA 3N9GL 1JWUB 1TZ8A 4PJCB 3TO2A 3LXBA 4JFED 1KPUB 1AG0A 4GIOA 5I8EB 3OHXB 4DEPB 2HX9A 3AM8A 2P8MB 3AXIA 1N0LA 2XNAB 4Z8FL 3GSRA 4LEOA 1NCCL 1T0MB 3KYKL 3DXAE 4PRNA 3BGMA 4UM9D 3T08A 3BUPA 3NDZE 2GHZA 4QRUB 4ZAKC 3INUL 3ZIYA 4UI2A 1PZ3A 4U31A 2OP4H 3CFKB 4NJAH 4JY4B 2DLIA 2CBOA 2VDQL 2XHNA 1L9RA 4WKXA 3SN6N 1E8ZA 1T4WA 3HE7C 5K9QG 1FAIH 1MCOL 2K6WA 3VXRA 2XCMC 5SWQB 5IQOA 4QHUB 3V10A 2WSPA 2A7BA 3UBXA 4YHML 2E76C 3WELA 3TT1L 3GSXA 4U1IB 3H4FA 4NO5B 4Y4KB 3L8QA 3EDDA 5HHPB 3E8UL 2IPKA 3MRQB 5FM5O 1NKOA 4NRYB 3RJDA 2CCVA 1MWAH 3NPZB 4E42B 4LLVB 4UBDC 3QXAB 1PX3A 4LCIH 4Z9KB 3VSVA 3ERXA 2WLZA 3HC3L 1T0PB 3IDYB 4GRLA 4D7BA 3II1A 5J06A 2VLKE 4O2CB 2ENPA 3F7PC 4GIPD 4RGNE 2YBRB 2JKWA 4HX1A 4YDMA 2NTFB 1MHHA 4XRCA 2DQEL 4HMDA 1Q9WB 1KLUA 3RWFB 1YYLL 5T33L 3KPQB 5EC2A 1PZBA 5D72H 4KITB 4OZFA 1TO4A 1DCLA 2MJWA 3AMLA 4TQEL 1RK7A 4XZ4A 3IJEA 1WC7A 2FGWH 1FGVL 4ONFL 3I75B 2QMJA 1D5BB 2CR6A 1JS4A 4FNQA 4N2DA 2EIKB 1F6LL 1VJSA 3VRIB 2PW2B 4FEMA 3ZZSA 4DEPC 2YJQA 3CCHA 3QPXL 3RAJL 3IFPB 5CJQH 3FYEB 1HI6A 3RURA 2VN5A 4DTGL 4X5XB 3BQUD 3SE9H 4HU8A 3FQ1A 1AACA 1I8KB 4QXTA 2AXWA 5CNHA 4GAFB 4UB0H 2XG5B 5HGHA 5KYXA 1LDSA 3OAUL 1IT9L 4KPHH 1DANT 1Q0XH 1QBLH 4P2OB 2PCPA 4XNQB 4HDIA 5JW3L 2Q10A 2GTZB 5DYOA 4XO9A 4MA7H 3O11B 1QR4A 4QGYA 4UQDA 4QRPA 2P48B 4WTZG 5AALA 2AJVL 2ICWI 3CX5K 2XIBA 4KDVA 2JKLA 3MBWA 5EA0L 1OIOA 2B15A 2WM0A 4KNUA 5FHAL 4QRBA 4OCWH 4Y19A 1U8KB 1E9QB 4FA6A 1RVFH 5SWSB 1KJVA 1MAJA 1NCWH 1S7WA 4B9JA 2XTJC 2N0MA 3GXDA 1QP1A 2WTRB 4MKMA 5EG6C 1WWAX 5HSFA 3HMXH 3GRWH 4YMPA 4KMLB 4BQ9A 4M5YL 4APXA 2VLJE 1WHPA 4GFXA 4YEEA 3DYMA 1A7RL 1NCOA 2HB0A 1WCBB 3D18B 1U95B 3IMBA 3FKUS 5HGBA 3QNZA 4FQQB 3PWUA 3WS3B 4AK2A 3UGUA 4OLYH 3PL6A 4F8QA 1WITA 4AX3A 4JHVA 3GYRA 3FT4A 1XMWA 5EIQA 5HP5A 5C09D 4FJZA 1JMXA 4NM4H 4NPKA 2ZYSA 5FCSH 2K6ZA 3V0AC 2ODIA 4K2UL 1UZ8B 3QA3A 2B8OT 2YUXA 3M17B 2MKLC 4K9EH 4PV9A 5CWSA 5F72S 3M45A 4HHAB 1MHEA 1BOGB 1AO7E 1DBAL 2XTJB 3HZMB 3W3BA 3N43B 1NCGA 3SQRA 1VHPA 5D6DC 2BNRA 4OGYL 4HW6A 3Q01A 3WEBA 4WFHE 2OK0H 3NOIA 2I85A 4NWTL 5GS1A 5KSVB 4XCFH 2UY6A 4JFXA 2GK0B 4JVWA 3RY5A 5GZOA 4DAGH 1AQDA 4MS8D 4OZHF 5DR5H 5M95B 1AOZA 4JW3A 4AQAB 1MJUL 3RY4A 1T4KA 2WB7A 5I18H 4S1QL 2LFGA 5E2TL 3GBML 5I71C 2WUBH 4YXKL 3DMMB 3MNMA 1EEZA 1QLRB 1U36A 3CXDL 4YSQA 4M93B 5FW6A 5DVOA 4ANXA 1S7QA 3E7JA 3VDAA 3NT0A 1G7LB 2VZUA 1IRAY 3WEXB 4EI0A 3C60D 2FH6A 1QLFA 1AS6A 1GW6A 1D9KB 4ODSH 1ESOA 4UBDD 2KT6A 3GMQB 1JJUA 5DUPL 1UA6H 2WK2A 3MRHA 4LLMA 3GPEA 3SZKC 1MI5A 4O02L 3U7YL 1NICA 4ETQB 4NUPA 5CIPB 4OVVA 3RTQB 2QV4A 1IEBA 3FTGB 2E6QA 5DEGA 2EDMA 3ARYA 3VGAB 5IMOB 2VLLB 2XWTA 4EEEA 1PZUB 1LHZA 1E0OB 4NSKA 1MFEL 5DRNB 4AG4H 2UWEA 3B2UC 3HI6L 5AVVB 4YJZL 4GP5B 1VAHA 1WZAA 2DM2A 4FYRA 1TMQA 3VU1A 4DUXA 1FSKC 1I1CA 1NCTA 1QEXA 3QEQB 4ZDHB 4WW1A 4V2BA 4NKOA 2BW5A 4URKA 1DANU 5AYUL 4G59C 3LZFL 3O6KH 4N85A 3R0NA 3NP4A 4JPKL 4YR6B 5I1DA 1I9RH 4W9HC 5C08D 1SYVA 3FB8B 2J8OA 4E0RA 5MEPB 5IW3A 1CFVH 1XH3B 2GITA 1MJJB 4ZG1A 3BKJL 1KCWA 4IBZA 2VUOA 1ZJAA 4R4NC 5EIIA 1NH6A 2VKXA 2Y6TE 1X9UA 5FYKU 4PBVC 1N6UA 5JDJA 4HS6A 1V7ML 3W0WD 4MJ2A 5ID0B 1KACB 4KTDL 1AR1D 1RIHL 3T0DA 3P9MA 3AWGA 5DT1L 2KDGA 3GK8H 3TOPA 4Z5RA 2ZAGA 3JUYA 3C5ZA 3X13B 3T77A 3S35X 5D55A 1F18A 2UXVA 3NH7L 2TRHA 2APXA 3UYRL 4Y9BA 4ODTL 4TNWK 3T6VA 3L3HB 1XTLA 4XNDA 1A4KA 5H2BA 4CSZA 1S3RA 4J8RA 4O2FA 2FQDA 2W59A 2D2CC 1FRGH 4U1MB 5A6IA 4K5PA 5IBUG 4M3KB 1KOAA 1WT5C 1BAFL 1X5LA 3IJYB 1IM3A 4TNWF 5BJTB 1MW2A 5EU5B 3EOAB 2DH2A 4G7VH 1U8NB 2F61A 3PU7A 4Z3HA 1MFBL 3HLAB 2BERA 3WS6C 1JNHA 2NTSP 3ESOA 1V3KA 1CD1A 3TPUA 3MR9B 3SJVE 4JVUA 2WQWA 4OZGF 3WNNA 1VZGA 1E9OA 3IJ9A 1VKXB 1A3LH 3KBFA 4XXDA 1J0KA 4OB5H 2VXVL 4AW7A 1H3XA 5ICUA 2BFVL 4JUSA 3JVFC 5DEZA 2AGJH 3BISA 2FIKA 5IG7B 4I9XA 1KJ2H 2KKQA 2OA9A 2BNQE 4M5ZL 5ACZA 4RGOL 1RERA 5C0AA 3IFLL 3ZJAA 1MHCB 1TYEB 5H94B 2HPTA 3UDWC 3OPZL 5E1HB 5EFIB 2EYTA 1E7UA 3CHRA 1GY2A 4CSSA 3Q5OA 3DJ9A 3SODB 3F65A 4P05A 4GKZB 4G6JL 4ATTA 1DQDH 4PVMA 4KK5D 3RWDB 4K5OA 2WV3A 2FJSA 3GIZL 1E9PA 2DQTL 3FRPG 4LASH 1OTTD 2UZYA 4L23A 2BX5A 2EVJA 4R4FH 2O72A 1WH0A 2VQTA 1JV5A 1G9NH 4L3EB 4TVUA 4WHTA 4X6DE 1JGLH 4PJ5A 4AJVA 3MRJA 3M88A 3DWTA 3HC2A 1QX1A 3GMOA 2PYEE 3HI1B 3MLSL 3GXFA 3NMEA 3REVA 1M6OA 5EC1B 1KJ2A 5CD3A 4F58H 2Y07H 1Y1DA 1MPAL 3VGAC 4UNIA 1AXIB 3BWUC 3V9CA 5CU9A 4J1UB 2XVLA 3TO4B 4LNRB 4L2LA 1CR9L 3KLQA 5D1QA 3EOYG 2E27L 4K71B 4PJCE 2VRAA 3N1PC 4U05A 2RHEA 1BX2A 4XPFL 5G5DA 2G75B 2BVPB 2O5YL 3QWQB 4R4BA 3RFZA 2KPWA 1HEZA 3K46A 1MJ8H 4R97B 1UEMA 2YA1A 1BHGA 2DM4A 1EO8H 5CJXC 4F57H 3ECBB 2BS71 3HS0C 5E0QA 1T7XA 5I17A 4L9LC 3ZTNL 1XIWC 2VXTL 2JMRA 4QXGH 4JO3L 4PJFF 1RJYA 3AXHA 4G6KH 4FXKB 3I9PA 3ZDZE 4NHCL 2LE9A 1URLA 2JNZA 3MUY1 3L9BA 2ADGA 2F5BL 1WK0A 3HJEA 1I8AA 1KELH 3F00A 4KK9D 3IXAB 2WYTA 1CURA 3HZKA 3HR5B 2OMXA 3L5XL 4Q4IA 1I7ZB 1JV2A 1MN4A 4AMKH 3DIVA 3KJ6L 2GG1A 3DO3A 4LCCA 3LEYL 5TH2A 1L0QA 4FFWD 5I2IA 2F54D 1DQQB 2XFXB 1ZV9A 3CWGA 4M4PA 2NCMA 5FDWA 1G84A 3FUKA 4HC1L 4N0YH 1XGPB 3NSDA 4HK3J 5DRWA 1R5VB 5ELIA 3EYOB 3HG2A 4GQZA 3CFEA 1QSFD 2H9GB 4EDXA 3CFBA 2QKIA 5JYMA 4KH2A 4XX1G 5JOEA 4HIXL 4L9LB 1GGCL 3P3YA 4Y16A 3E2HC 5TF0A 4XN5A 4A39A 1HWGB 5IROC 1K2DA 3VXOB 1EFXB 1FC1A 1H6EA 1YAZA 2P8PA 4PJ9D 1EZUA 4ELDA 2VN4A 2VDNH 2F54E 2GSIA 3FFDB 4DIXA 5HYSB 1E67A 2K8QA 3T3PF 1SM3H 1IM3D 3ARRA 4QHPA 4K71C 5C08E 1ZLVK 5I1IH 1NUDA 3BZFB 3MAWA 4M5SA 4RZCB 1KGCD 2ICWB 4FXTA 1WGVA 2YA0A 5LAXA 3V0VB 4FADA 2Y2TA 3VXME 3QYNA 2H1LM 2R1WA 4OR1A 1YNKL 1PLGH 5E24E 1KEGH 2IANE 5IQMA 4GBXC 2ZUYA 5HGDB 4NNYA 3MV11 5FUZH 1RZJH 3MJWA 2B3RA 3Q2VA 1BF5A 3ZXAC 4OBSA 1M71B 3T3ME 3IWVA 1NOLA 2BDNL 4IRZA 2MOGA 3MRIB 4YHNB 4HHWA 1P7QA 2OSWA 4OVUA 2PTVA 3QDJE 4UM8A 3UYPB 5DUBA 2EIJB 1GYVA 5B7FA 1XXDC 4C59B 1FYTD 3EO0A 4TNVK 5DS2A 5KYWA 1OF0A 2CLVB 5C3TA 1JZGA 1Z6JT 2Y24A 1RZKH 3C2AL 5F21B 2XPGA 2GSMB 6FABH 2NY7H 2XXGA 2JWYA 3N40F 2WWNA 4NGHH 5H4YA 3SOTA 1Q0YL 5HI4D 4NZTL 2F54B 4PY8J 1D5ZB 3NCYS 5E99H 3WXVH 5IQ9A 5DRZB 2IWKA 3TIDB 1DZ0A 3S5LA 1ETB1 3D39A 3HZ3A 3KM1A 1EXUB 1HOEA 2ADJB 2NXYD 2B4CL 2OXHB 2YJLA 3JV6B 4L0PB 2F0CA 2CM6A 4PLJC 4F9LA 1CIUA 3ZHNA 5T3ZD 4J8QA 4C8XA 1JWSA 1HXYA 1J10A 2BHUA 2WIIB 3KHOA 5DWPA 2FEEL 4PQXA 1E4KA 1JFQL 1VPOH 3P2BA 3BKYH 3OM3B 4XGZA 2NDGA 1LO0L 5IMLA 3OWRA 5C2BL 5E8EB 1GA2A 2E3VA 2WCSA 3VGDA 1GMIA 4HK0B 3U9UB 3M6DA 4I0KA 5DHMC 3EOTL 5EIIG 5GISL 1QOKA 3PY9A 1LWJA 1S5HB 4NUJB 1GZPB 3MKKA 4DZ8A 2XY2A 5TK2A 4I5BA 3QG6B 1CXFA 4I9WE 1N12A 2DW5A 4TSBH 1Z0MA 2A0LC 1SFDA 1GJUA 1RHHB 3X12B 1E90A 1IGMH 3K0WA 4M3HA 2XFGB 4PRPA 3HAEG 5FHBH 2R4SH 4Q58C 3W37A 1DO5A 1AKJA 1T5WA 5E6ID 3TYGH 2ZP8A 1HDMA 2D2OA 4IRJD 4LEEA 3QIWA 1I7UA 5AOMA 3W9DA 4L3ED 3IXTB 3B5GA 5A7BA 3LNFA 3NCEB 1JYVA 3AQXA 3U4AA 1BVNT 3H9SE 4U1SA 2O5ZH 4RIRA 1MCIA 3F7RA 1HHJB 1I9IL 3D5OF 4NO0D 4D9LH 1P5UC 1DN2A 2A9AA 2SEBB 3ZDXF 3IMVA 3KE0A 2XN1A 1R3KB 3P73B 1E27B 5SV4A 1BZ7B 2AKRB 4X8XA 3UP6A 4ZO7A 1ETZB 3MV9A 1GTFA 4ZMOA 3KWWA 4JHWL 1WZLA 4L8SB 1J11A 4X6DB 4NN6C 4P46C 1UASA 2Z8WC 4A67A 3RDTA 4Q9RH 5IBTL 3HN3A 1MWAB 3QC6X 4OV5B 2HKFH 3LHPL 4JCLA 3DOSB 3X1BA 4FQXB 4QHNA 4AVIA 4DGVH 4FFYA 3VD3A 3II2A 3SDXE 4HJJH 4GS7B 4QRUA 4W93A 3AB0C 4H8HA 1CLZH 5GJSL 4CBZA 3BI9X 1E2WA 1UGNA 3DK2A 3ULVH 3T2LA 4Q2ZB 3P40A 2X4NB 3H3PH 4EIBA 3KVPA 3CZEA 5MP6H 3REWA 4JK0D 5IMMA 1RP9A 4HPOH 4XAWH 5DC4B 3S3DB 2EIMB 4YE4H 1YEWA 3L9RB 3K0YA 3ASWA 1YJDL 4BH7B 4FDWA 3IDGB 3H0TA 4Z7NB 4FC3E 3NAAL 1Q9LB 3RPKA 1J1XH 2PO6D 4GAJL 4PGDB 4GG6E 1QKZH 4UTAA 3TCTA 1KGWA 3C08L 1NIFA 1NGWA 4YLBA 3HBZA 3VWJC 2YA2A 3FO0H 1RULH 4MNQA 1OSEA 3WTVA 1O0VA 1DVXA 3R1GH 1Q9KA 4S2SA 2VSKB 4Y9FA 3QJVB 1S8DA 4NWUH 1C16A 2VDQB 5GRYA 3V0IA 2WUCL 3U1SH 4A68A 3L4UA 5GGVH 3ZW3A 3O81A 1LEIA 2P46B 3V4PL 2WLHA 3FOMB 4H88H 4PI2A 2CDFA 4P49A 4JX0A 4CGTA 3I50L 1S78C 32C2A 1AHKA 1HHHB 3RWEB 3TCLA 4YE0A 3LMJL 1VRSA 2DB8A 1KCSL 2NW2B 3IJEB 4B9FA 4WI9A 3OL2A 3KCWA 2ZSVA 6PAZA 5AL8A 2YD3A 1XGYL 1XX9C 2MWCA 3ARGD 3CFCH 4F2EA 4MYWB 3UJTL 5ETUA 5C2UB 5DEFB 4QXUL 3V0JA 1DLHA 2VDKB 3FUFA 4GY4A 3WYRA 4OFVA 4IRSB 3GIVA 2R23B 4GI8A 4NUQA 1G9EA 3DGDA 3ULUC 2CXGA 5D93B 3PGCB 4X5WA 3MLZH 1GAFH 4HFUL 1X5HA 2Z4TA 4MJIE 3MXWH 1EPFA 4K0OA 4YDJA 1J7VR 4ZD3L 5IB4B 2YAMA 2OR7A 4Z23A 4F5CE 2ATAA 3ZTJH 1W72B 3ZZ1A 3FO2B 3UBXG 1TJHL 5C0RH 3QEQE 2KHAA 2YARA 4U1JA 2V2XA 4N5EC 1XF5A 3I85A 4LOUC 4Q4EA 5BZWA 4BQBA 5CEZD 1ZA6A 3K4AA 1NC4B 4NLHA 1MCKA 2YGOA 3LEVL 5K9JL 5BO0D 3MA9H 4BKLA 3KL5A 5I6OA 2LQRA 2ZCZA 3O8XB 4ZW7A 2JQZA 2H3NB 5HHOA 1TJIH 3HVNA 5KVMC 4HF5L 3S9DB 1A6AB 4HQQH 4LF3B 3FUIA 2BP5M 3SHSA 1BJ1J 5GRWA 4ZNEA 1RSFA 1UKQA 1BG1A 1WCBA 3PS6A 2E6PA 2EDKA 4NQDE 3BSHA 4KJPC 5E4AA 2A6JB 2EJ1A 4WI7A 3HE6C 5JW4M 1N0XL 3VJ6B 2WD0A 4H8VA 3RUGB 4W1TA 4AVHA 1X7TA 3VI3A 3GMPA 3HB3C 1MDAA 4JN1L 4JRXE 5D5ME 2NLJB 1Q0EA 5K93A 3DHJA 1G4RA 5FA3A 1HH9B 2MCG1 3OJDB 3TTSA 3QA3B 5ISZE 3LZQA 1OE2A 4A2FA 3GLDA 2Y7QA 2EACA 3TBYA 3QJSB 1IC4H 3RWGB 1IM9A 1OT1A 4PS4L 3EIFA 4OGAD 1ZPLA 5DJCB 1IAKA 4CSTA 4FLSA 5ECJE 4FQJL 4XI5D 2ZCKH 1G6RH 2AABL 3CFJA 1FL6B 1AO7B 5CIPH 2BP0A 2ZOKB 1RH8A 1SLUA 3SPGA 4ZTPL 3ZSSA 4ZMVA 5KWYC 3DV6B 3HA0A 1WA2X 4JCMA 4XNMA 1DVFA 5F1OB 1ORQB 2O30A 1EUUA 2JQMA 1HH6A 3V4VH 5KJRH 1QHPA 5B8CA 4KI5C 2JJSC 2XZQL 3VM5A 3C60C 4P2QA 1U6AH 3FFCE 3WL9B 3LY6A 5JPNA 3EGSB 2EINB 2WZ6A 4IS6A 2VQ1A 4NAJA 3DO4A 4PYGA 4CN4A 4FQ1L 4DP6X 3H54A 1NAMA 1XCQA 2ALAA 3LHAA 2VSMB 1W9XA 2FE0A 3I9GH 1KYUA 3K81A 1L5GB 5EEUA 1TU2B 2CNYA 4L4TE 3N50A 3WBDA 2V3EA 4L0YA 3VWKD 1IGTA 4F8NA 1XR8A 2OULB 3VVVA 2C3XA 3H9SA 2MOQA 1IKFL 4HH8A 4NO0B 4TSAH 4RMRA 4HIJA 2J1YA 1F42A 3BSGA 4W4OA 4WFGE 4ZOEA 1U33A 4XPBL 4MD4B 4S1DC 1KPVA 2ZUTA 5JPMA 3ATFA 5CJ8A 2CKBB 4BWTA 3MNVB 3UMNA 4FFYL 3II3A 4ORGA 4OGZA 1H0DA 4IRJB 4LT7A 3S8GB 4RA0C 2I32A 1B2YA 3G08B 1CS6A 2N0KA 4B7LA 4D0DA 2A6IB 3SKOB 2DQJH 2X4PB 4KBPA 4KJQC 3P3UA 4GP8B 3LIZH 3WDIA 2ZUQB 2IOMA 4KI5D 3FSZA 1UTDA 1QFWM 3TJEH 3ZKXC 4GMSH 5IFJA 1P5UB 3ULAB 4H0HB 3HUJB 3O3AA 5BUPA 3CN2A 4JRYD 3Q1SL 5HJ3B 2YR3A 4Y1AB 4F91B 5HYJE 2HAZA 4JG1H 2JIXA 3ROLB 4XMPH 3FRUB 2NYKA 3NIGF 1D2OA 4NFBA 4POUB 2ED7A 5F9AC 3GJFH 1AP2B 5FGBA 1FL5A 1GOGA 5FO8B 3UDWA 2AEIT 2NY0B 2J44A 5D7IE 2DI9A 1LEKB 4MASA 4UT9H 3UERA 4FTVA 4Z7VB 3MNDA 1ZGLP 2F1BA 3LJ3A 4PWGA 1KCKA 2QKIC 1BJ8A 3QEHB 4PJ9A 4P46A 1KIQB 4MA8L 3RTLA 4TUKL 3BXNA 2ZNXA 2MCPL 3NJIA 4UOZA 3V4VA 2OQJA 4Y16D 1WE5A 1VDGA 3HAEH 5DHVA 4CVUA 3IGKA 1XGRB 2BPBA 5HTSA 4RGNB 2PP8A 3HPJA 2NY2D 1B9ZA 5IREA 2ESVA 3W39B 2W91A 3MGOB 5FIEA 4AKPA 3QNYB 4PJCF 3GS0A 4JFEA 4EVNB 4HUCA 1THCA 4MB4A 1OCZB 5I5JA 3SGKC 5F97E 4WCYL 3PGFH 3SPJA 1NAKH 4FXLA 1NM9A 3WE6A 1B3JA 3VFOB 1BYPA 2N7BA 2PTTB 2BHFA 3BZEB 4IKJA 3L95B 3L7EA 8PAZA 2CBMA 2VR7A 5AOIA 3WNOA 3FUEA 4WU5A 3A6BL 4XODA 4XH2A 4NIYE 4HWZB 2VWEC 5CAYB 1JDCA 3T6QC 4QJ4B 4LSTL 2L7UA 5DUML 3FN9A 3RWCB 2Y36L 1K8IA 1VFAA 4R0LA 3M1BA 1QFHA 3BAYA 1SVCP 1VADB 4I1PA 3W9EB 4UT7L 1M7IA 2FK9A 1OLZA 3LPWA 4NC1C 1PNDA 2X3CA 1MEXL 4AVJA 4ENEC 3QO1B 3KLDA 1KY7A 2G5UA 1VZIA 4BZ1H 4Y1SA 3BLBA 2WMPB 1CLOL 2XKUA 2QQQA 4PJ5B 2WWOA 5HPOA 1JVOA 4M6OL 2W60B 1TF4A 4N2AA 2FATL 1MCPL 3QQNA 4LHQB 3ZE0E 1XZ0B 3Q2LA 4GKNB 4QMEA 4E5XA 3R8QA 4F9PC 4ICWA 2OTWA 2WWKT 3W57A 2G3MA 3GSNL 4UQ9A 2WBJB 5KSBF 3FO9B 1M7UA 2P1YA 4L3CB 4PB9H 5EUOE 3V5HA 1S9WA 4Z78A 4KNSA 5A2FA 1HHKA 4OCRL 5AW8B 4QY8B 5IBLD 4NQSB 1DUYB 3VCLA 2BY0A 4CVZA 5J6GA 4LP4A 5EMYA 3ZPDA 1P84K 3POHA 2HFGH 1FIGL 3L6FA 3P30L 5D8JH 4MD0A 1Q8MA 2E9JA 3NJJA 3O45A 1F4WH 3PNRB 3WSQH 3ZKMC 1LE5B 2VDRL 4Z6AT 4E9YA 5JW5A 1K4DB 3EYVA 2A1WH 2Z64C 2FVNA 2NZ1A 3DIFA 2ZUQC 1NEPA 3KPOA 4G7YH 5HHQA 1J86A 1MH5B 4APQA 2QQNH 1UWEH 1UD6A 4W9LC 2EO7A 1ZE3C 3HN5A 2E7DA 3WFEH 5B4MC 1HHIA 3Q8AA 3O0RH 4H26A 1NL0H 3HE7A 4JREC 4OLUH 3ROOA 4IBTA 4LCCB 5TH2B 1DVQA 3WY4A 4I3RL 4ZRGA 5TPWH 4X5PA 3QNXB 4RGMC 1FVCB 4NN6B 3STLA 3O6FA 4Y5YA 1G5GA 2ZXWB 3R7RA 4N0RA 1ETA1 1KC5H 1YMHA 1ZDQA 4N8UA 1NBYA 2AQNA 5IEKB 2PYEA 2UZIL 5H4ZA 2DBLH 3BRGC 2Z31B 4KRPB 1IC0A 3CSYA 2O4EA 4KVCL 4P5MA 3VFTB 3ZTDC 5KBMA 1HT6A 3TBWA 1N5YL 5FWRA 1KN4L 3AABA 4ZUVA 2YD6A 5AW0B 35C8L 4Z7OB 1KNOB 3U7WL 4ZMWA 5I6LA 3C9NB 2EE0A 3QRGL 5DJDB 1LP9B 4Z7QB 3TH4T 1J8HA 4MSWA 4BKSC 2HRPL 4TRPL 5AVXB 5JHBA 25C8L 2R7EB 4P23C 3T4AB 1OSPL 3AS1A 3GMRA 5CILH 5DMGC 4FG6C 1M1SA 2YRZA 4DOHE 3VD4A 2VDKL 3HW7A 3LQAL 2VERA 4FGMA 2RALA 2OMTA 3QCUL 5KTEL 4L8DB 3T2OA 3QQ9C 1TTRA 3GJEA 1KTLB 5IVNA 5FS5A 4K8RH 4QTIL 1BAGA 2CHZA 4OLWL 1S5IL 1G94A 5I1GH 1C5DA 3WNJA 4X6CE 4YHOH 5BQDA 4BFRA 5K9QI 2QL1A 3O9WC 3EDKA 3KMDA 3AT8A 4DQAA 1TTAA 4XVUC 4NX0A 4N4YB 4ELKB 2N59A 2NY1C 3T8XB 4LHUA 4RISL 5CGBA 2D3LA 2OMWA 2WLLA 2J25A 5I1KL 2P7TA 4G8AC 5TE6H 4PWEA 3BEVA 3D48R 1CIDA 1LGVA 3D85D 4N22A 1FZMA 1PLAA 4NKMB 4IJ3B 4HJGA 3UTSB 5IGXH 4XMLH 4E9XA 2W0PA 4JJHA 4N8VB 1QR1B 2ZXQA 3E38A 4LLUA 4N1HB 4PTUA 2VDLH 4K7PH 2NY3D 4LCUA 4MS6A 4I85A 1WPCA 2IPUG 1MDTA 4KRPD 4PIRF 3WUWB 3JWDC 3BC9A 2RIKA 1SXCA 4OZIE 3NTCH 5AAMC 1OCWH 5BMFL 4JZOA 2JKTM 4P4RB 4B5EA 3L81A 3I84A 3PRZA 3P11L 3QI9C 4LCCC 4ZUSA 3PAVA 4WY7L 2X89D 2EE3A 4M8RA 2K3TA 1QFWL 3IU4H 4RDBA 4JFUA 2X6UA 4EIUA 3ISRA 1OXYA 3O9WD 3FAWA 3E9TA 4LOVA 1JMZA 2DQCH 3L3IB 3QHTC 2QQKH 5FB8B 1JXDA 3QDME 4PRHB 5ID1A 5EU3A 3QAQA 3TIEB 1SVBA 3PHOB 3B9KC 3WFBH 4WEMB 2A38A 4OT1L 5A16A 2UX7A 3LN4B 5LGJA 1EDYA 2ITFA 1U8HB 5B1BB 3P54A 2E9BA 2J88H 1A25A 3L3JB 4JZJB 3I3DA 4DN3H 4LCYA 1SOXA 5T3XE 1IGFH 4ODWB 4PHXA 4EI6A 4MQ7B 2ZKXA 4GRWB 1L6PA 3LD8B 3D3VE 3PDOB 4XN1A 1U4EA 3QDMD 5FV1L 4KZEH 3RWIB 1YPZF 2DKUA 3KW7A 3RY6A 3MLXH 3VWJA 4YSUA 5C6TL 2YXWA 2GBUA 5LLIC 2ZUUA 5FYJE 3DGCR 4Q0XL 1PJ9A 5IJKA 1Z5LA 3JWNG 3ULUE 1P1ZB 1X44A 5J7CC 3IAGC 3KBPA 4AW4A 3I2CH 1K5WA 2YD9A 5T3XD 1ES0B 1TCRB 4ZK8A 2NY6D 4AOFA 1I1AA 4NQVA 1XSKA 2IPUK 4DP9X 1UB5A 3RG1C 2R59A 3K1KC 3PG2A 1BFVH 1OANA 2FJGA 4LCWD 4JM4L 1XQ4A 1RUAH 3QUXB 1BPVA 2WXHA 5F3HB 2B20A 3SKNA 1KTKE 6PCYA 2EYSB 4KY1H 2XZCH 4HKXB 3LNIA 2YPVA 1UWXH 2EXTA 4MMXC 4AQ8A 5I19H 4NRYA 4OM1L 1LMKA 2CIIA 1G1YA 1QACA 1FFRA 1XGQA 1HYRC 4HH9A 3NRFA 1DBML 3MLWH 3STZA 1LK2A 3LH2L 3QJFA 3EHBB 2V3DA 4HCFA 5EU6B 4ZZKA 1A6PA 4JDTH 1UJTA 1IEAA 1NIDA 5DFVC 4OCLC 3MODL 2XPZA 4BFKA 3PXJA 7FABL 3WIAA 4DP7X 1B4JH 2VZ1A 5B38G 4JHAL 2YD8A 5GGTL 3RVTD 3VB9A 3QQ4B 4E41E 1AQMA 3DRQB 3BZDA 5D1ZI 1W6WA 2EDOA 1UEYA 2K7QA 4KNQA 5JR1L 1EGJA 1XO8A 2B0SL 3N40P 1WF5A 1NCAH 4EPSA 5L2KB 4PW4A 5K39A 2MQCA 5TE4L 4BGLA 3SDXF 1KGCE 5A43C 4I4WB 5IHBA 1QG3A 4JN2A 4O2EA 4AH2B 2AJ3A 3CC5A 3RA7L 3RX9A 1ICTA 3PV7A 1KY6A 4DPAX 2JCCE 4G5AA 3GS7A 1EA9C 1NOFA 1BZ9A 4V1DD 3NABL 4BH8A 2P5WD 2EH8L 5HHOD 3NA4A 4WNSA 2WLJA 1BQLH 4JJ5B 4P2RA 4JPSA 4U4IA 4ANKA 3KXFB 4D9RD 4BK8A 4B5ZA 2AK1L 3MRRB 4MDJA 2JB5L 4FCHA 2XN9E 1FLRH 4IU3A 2TAAA 4P9MH 5IMKB 5D5MF 1E50A 3QFJB 5FO7B 1CCZA 3MLVH 5EO1B 3LRLA 5SWZE 1UCBH 1F8TH 1VFBB 2NY4C 1QA9B 4IOSD 1W8OA 1K4CA 1JFHA 2AAAA 1C5CH 4N2EA 1FDLH 1X6NA 4PAZA 4S0SD 5KYYA 1MLBB 4WDIB 3WKPA 1QRNA 3CZLA 3KLAA 3RGVA 2DOCA 5PCYA 5JHLH 4P2RD 3JV5A 5F0JB 3IS0X 4H0LC 1A7NL 2WTRA 1AGDA 3NZHH 5LCVL 4D8OA 1JNLL 3ARGA 3NJGA 1VFUA 4PV8B 1ZWIA 1RZKC 4KUCF 3QZOA 4Z7WA 4PRIA 4IOIB 4FQLL 2I9LA 2UWEE 2YBGA 1L9SA 3T5WA 4HWBA 5JO5A 4DO5A 3ARDA 2D9CA 4L4VE 2KDYA 4GQ9H 5TJWK 4X6FA 1JUFB 4NZUL 2GJZB 4N28A 3NN8A 2GIXA 2GY5A 3MCKB 1IGCH 4YZFF 3LIZA 3SDDD 4L8CB 5DMKA 4TQHA 5DUJA 5B8CC 3N06B 3V52L 4OF6A 1O7VA 4BFIB 2V8LA 1CUOA 1A7PH 3U6RA 1B0WA 3M17A 3I9AA 2H1PL 5DO2C 4BBWA 2XWEA 2XY1A 5E6IA 4L5FH 4Y5XC 3HBPA 4OF8A 2DLTA 3ECQA 1UH2A 4M1DH 1L9OA 5IVZB 4HOMA 3BLPX 2GABA 2V9QA 4Q97A 4L5FE 1FZJB 3UIZA 1G6RA 4RNRB 4KJYA 4PRNB 5AW4B 4MMZC 5HVWA 1ZANH 3FOLB 2WXRA 4OGAC 4PJ8B 4XNYL 3QQDB 1TTFA 4EE2A 3J07A 5C07E 2Q7AA 3PCYA 1YEHL 2OR9H 5HI4C 3ILQD 1ODUA 1S9YA 1T0NB 4DP2X 4Z7IA 4Y9GA 4EOWL 1J8KA 4IDJL 1UYWL 1HWHB 2AV7A 3HFMH 3IDXH 1U3ZA 4HBCL 5FYKD 4F7MA 4ABVA 1BAWA 1U3HD 5I0YA 5EZOH 3L3OA 4YH6A 2IDTA 1R3LB 4LEXL 4EQ2A 1MG3C 3IN0A 1WG3A 2GUOA 1EEYB 3K8MA 3OB0K 2C3VB 4N68A 2FLBT 2ALWA 5E8PA 5IOPA 2KLRA 4UTAH 5DU7A 2J2ZB 1T7ZA 4J4PD 4TL5A 3S36L 2FR4B 1BVKA 2CCWA 2QSCH 4L48A 1Z3GH 4NB7A 2GT9B 3APNA 4FMKA 1X9QA 1R3IL 2OI9B 3KAAA 4PJXA 1LEGA 3MFGB 4KXBA 2AS5M 3WL9A 5JPNB 1KN2L 5KBLA 1U3NA 1WFNA 1WZ1L 3BWUF 3LDBB 5BS0D 1QSZA 5L6YL 1T0OA 4HX1B 3DHPA 2DIEA 1QUPA 2WXNA 2XBDA 3DTXA 2IANA 2ZWZA 4DHLA 4DESA 4AM0B 1RUQH 3IVKA 3SDCD 4UM9A 1INQA 2BSCA 3RZCB 1AGFA 3O3DA 3ZL2A 3QSKB 4NKDA 3GB7B 5DS8A 2VKWA 5HVFB 2X70B 3LRHA 4Y5VB 2DWXA 3NCFB 3DX8B 5CHNB 4OD1H 3PWNA 1C5BL 3D06A 4HIJB 4HEME 4QYOB 1EJOL 4HWEH 4Z3TA 3OR6A 1MW0A 4WI0B 3W81A 5EF3A 3FU0A 4UU9A 1ADQL 2BOLA 2PW2A 1W0VA 1GTNA 4DGIH 2DMGA 3QXTA 4NN5C 3TEWA 1DVZA 1PKOA 5I1LA 3HE6B 3KVDD 3MYJB 5KJ7E 2P44B 3MLUH 2IAMC 4K3EL 4J6IA 3CXFA 3ULUH 1YEDB 4R90H 1PFCA 1S3KL 4ZT1A 2CHDA 4ZZFA 2F8XC 3B8YA 5D7LE 1CICD 1SN5A 2ICEC 2YIHA 3SKMA 4KVNL 5DHYB 5FUOL 4MCZA 2E7CA 4LP5A 5B1AB 2XRAH 3BPOC 1ZEAL 3O4OC 4I87A 5IBLC 4BFBD 4OCYL 1E8XA 1TYJA 3GBEA 4NOBA 2MPVA 5I16A 2HFTA 2K70A 2ZPKH 3RZWA 4P9HH 1OHZA 3QORB 2K1MA 4HV8A 5ES4B 2WSDA 1OP3K 3UG5A 5F7WC 4LQFH 4NRZA 1QEWB 3KYNB 1SEQL 1UM5L 1T5XA 1ZRUA 4NXSA 2G9KA 1TQUA 3CHXA 1OGPA 2J6EL 4I77H 1J9QA 4ISVB 3KEDA 3SJVA 1YEIL 1DN0B 4LIQH 4XAKD 5C3IA 4HEPA 3ZT7A 2YMXH 1O6TA 2A9NH 4PJFB 5JZ7D 4P57A 4JRWA 5E03A 5IVOA 2Z93A 2QPUA 3TBVA 4QYAA 5F1KC 3FB7A 1VKXA 3G6DL 4KQ0A 5E8DH 2J1KA 2DTML 3W82A 3TA3C 3VX0A 1F4XH 3CJJA 4WLCA 3ZQXA 3JWOH 3B2VL 5FYLL 3FU7A 2ITCB 3R06A 5HHXL 4NEHB 1A3RL 4PW3A 3BT0A 3EYUH 4LBEB 3N43F 1LE9A 1JE6A 2IAMB 1IQDA 4MJ5A 5DSCA 2ZG2A 4RFOL 4BSVA 3FU5A 3GD1C 4OTXH 1OM3L 3UABA 4HIIA 3QUZC 4ALAL 3L7EB 2A83B 2JCCF 2XKNA 4EKXA 4R2GC 3TF7C 3CXHJ 4PJ7A 2DQUL 3BPNC 3MRGA 3OLDA 4XH2B 2DM7A 4WHTB 3TN0D 6TAAA 3FUDA 4FLHA 4PS8A 3ELQA 3MRJB 2MCAA 1FF5A 3AB0B 3ARFA 3KJ4C 5ANHA 1ADWA 4FQIH 2P5EB 5CP3H 4HYTB 2WBKA 1MIEH 4NI3A 1TZGL 1AZVA 4I18C 2P24A 1UD8A 2BSED 3NIGB 4E41D 1DEDA 1IC7L 1RLWA 5D7KD 4ZXBD 3VD2A 3UC0L 3AC0A 1P6AB 5B7MA 1R6VA 2CRZA 2FYYA 4U6XA 3HE7D 1BGXL 5D2LF 3EDJA 4R4BB 5HJBA 3VO0A 3BUTA 1OP9A 2YPKB 1AFVL 2L7JA 3FMGL 1FNSL 3VA6A 3VXSD 3UP1A 2KYIA 1BREA 4KTEH 1R33A 1BQKA 5AL0A 1BBJB 1QQDA 1E4JA 5LG6A 4A7VA 4QOKE 3RYMA 4UQ3B 1DBBH 1NCBH 2E56A 4DKTA 3WIIH 4JM0A 3MV8B 2XACC 4X9GA 4KVPA 4JFQA 5KVEL 4EKJA 4EIZC 5FYJL 3MRLB 1GXEA 3IF1B 3VI4E 1T89A 2J8UE 2OJEB 4QKXB 3S2CA 3VB8A 1K6QL 4J2XA 3U2JA 4FNLH 1E8YA 1HESA 2FHBA 3VFNA 4OM0L 1B4LA 4MDIA 4ODXB 2UYLA 5J1AB 2XN0A 3NJMA 1HKLH 3Q7JA 3D9AH 5F7DB 5J3HC 2WO3B 2F5AH 1SQ2N 5JXAH 2ZICA 1XV8A 1M7DB 5EWIH 2NW3A 1F6AB 3S2AA 4XVSH 4YOKA 4ZI8A 2H4EA 1IBGL 5IOKA 2R9HC 1G9MH 3N9GH 5B3NA 1JGVH 1NFAA 2WLYA 3E3QE 3O4LE 5TQ2L 4X50A 3RNQB 4OIFA 4KKBC 4N0FA 1ZLVH 4L1SA 5BS0E 5TDOA 4JKPH 1U8LB 2ZUSA 4PJAE 2V2WB 4CUCA 2VITA 4AIZB 1YUKB 2FNBA 5KANI 2Y7SA 2W07A 3INUH 3MNWA 3G5YB 1BMWA 2AJYH 2OP4L 2X44D 4NJAL 1TSRA 2JB6A 2ATKB 3BOVA 3MRNB 2CAKA 4WHYG 3IU3B 4XXCC 5KOMC 4GW5B 1NA8A 3QQXA 4YBLB 5GS0C 3OHMB 2H6PA 3VM7A 3KPNB 3ZE1F 4OJFL 1M71A 5DMGD 5FX3A 1LP9A 1N70A 1JNJA 3MRIA 1I8LC 1BW8A 1J8HE 5T1DH 3FT0A 5J1SC 2ZIDA 3FQUB 1LWHA 4OFYD 1QHOA 2HRLA 2IAMD 4BD4A 5J57B 4GAGH 3FU9A 1HOCB 4S1RL 3DURA 4KRMB 4HFWB 1C12B 3NIDB 3KCPA 5I73B 4CBPA 4IGBB 4Y4HC 3RQ3A 3SIKA 3HBQA 3HC3H 3T0EA 1BD2A 5DJ2A 4IOFC 2BVTA 3WMSA 4N2HA 3D33A 3HMWH 5AW6B 5C0AB 1NBCA 2NZIA 3VXUA 5FO9B 1TZIA 3VD0A 2DQEH 4DFIA 4NP9A 1PZ5A 3S5LB 4HETA 2XOTA 2Z92B 1AZUA 2OXHA 4WNQB 5C0JA 4RQQA 5HHMB 3O3EB 3SPCA 3V5KA 1NCHA 4HKJB 4FMVA 5E4IA 2HFEB 2PXYD 3LXAA 3VYOA 3ZKND 3U9WA 1LILA 2V5SA 4K94C 4FQCH 1MVUB 2A5UA 2FO8A 1NMBH 2QVFB 1CF1A 2XICA 4J6RH 3A21A 3UAAA 1QMUA 4X80H 5F7LB 3MRMA 4Z1PA 3N42F 4IBYA 1Q1JL 3RJQB 1AC0A 4DTGH 3SE9L 2OYMA 3EUUA 4HK3N 3UZVB 1A9BA 4UB0L 3SGKA 4PRDB 1IGYA 5D7JA 4L1HA 4OZGE 2XJKA 3AITA 4ANWA 1QBLL 1OLLA 2K9UA 4K94H 1KT2B 4YHKH 4QDGA 2BOBB 4H8QA 4MA7L 4L4TA 4XMUA 2VW6A 3QG7H 4XBGB 5DDHB 3RFZC 2C26A 1TQSA 3GXMA 1MFCL 3Q8EA 1TVHA 4DETA 3C5SA 2QTEA 2QADD 2CO7B 3ECUA 4TF4A 3ZR5A 3WGUB 4X6BB 5FHAH 5EU3B 3TIEA 4OCWL 4LDOB 3WHE1 2KZKA 3T0ED 4Y19E 1NCWL 3CH1A 1PD0A 4HG4K 4WW2F 3MNZA 1JERA 1LWRA 1NFDE 1KLFA 2VSDA 3HG1A 5IR1A 2HG5A 2J72A 4FCAA 4HGWA 3GBNL 3SDCB 3CVCA 1T1ZB 3HG1E 4OCSL 4WJG3 3TGXA 4DUVA 3KNBB 1NFDA 3FTYA 4TVPD 1J5OH 4I9WD 1YO4A 1HQ4A 1P84J 3O3UN 2BOCB 2GK2A 3QH3B 2VL5A 4Z7UB 5JYLA 1BD2E 3WLWC 2FJHA 4TTDC 2EKSA 4X0KA 1TR7A 2GAZB 2WYIA 1ITBB 2IQAA 4KOCA 4DPRA 4U49A 4WO0A 4XMKH 3UACA 2C9RA 4QRRB 5D2NC 3UXFA 4LAJH 2ZWKA 4ELME 3P0GB 2HG0A 4NQCE 5EUOA 5LNDA 3DO7A 1RIVH 2PP7A 2NNAB 4H1LG 3EJZC 4OGYH 4U3SA 1PNCA 2G30A 3BH4A 4C47A 4ZNEE 3H0TB 2JVUA 5IK3B 4H25B 4DQOH 5FDYA 2F19L 5MERA 2MQGA 5C07D 8FABB 5TDPA 1G5AA 3AT0A 2HFFA 2JFCA 2Z91A 5HHOE 5TF1H 1T21A 1DQIA 4LKXB 3UTTD 4PJDE 1UWFA 3CSFA 1Q72L 2WY3B 3COOA 4JDEA 4YXKH 4OCXL 4XP4L 2LLLA 1T3FB 5ICZA 4U1GC 2EO1A 2DI7A 3KR3H 4BSWB 1HZKA 4AENB 3OBAA 4HUWA 4KRLB 1NKGA 4IJ3C 3S88H 2AVFA 1NIBA 4UV4L 1H15B 3BSZL 1OF2B 3QQ4A 3NEOA 1G7PB 4YLQT 3WIFB 3BH8B 1TSHA 2R1XA 2XG5A 4RAHA 3VXRE 2WLMA 5LNGA 2FWOB 3GJFK 4OZHE 1MLCB 4CC4C 2MQ3A 3MV7B 2ADFL 1LO5B 5DJ0B 1KBKA 2NY4B 4L9DA 3VXSA 3T0AA 4EN3B 1MFEH 5HVHB 3AU1A 3OZ9L 4WJKB 1V3MA 4Y4KA 5DD5L 5DA4A 4XPHL 4CADB 2HT3D 2IPKB 4MA3B 3OKKB 2NY5L 1H19A 2OL3H 2HRHA 4IKKA 4NHUB 5IB2B 4F27A 4E41A 3C8KB 4TUJA 4ALAC 4ZTEA 4NUMA 1D5MA 1HAUA 3LZFH 3O6KL 4B53A 1D5XB 5AD0A 3GSVB 3K8LA 3VE0A 3NSYA 4FAAB 1I9RL 5DZOA 4M1GL 1KTRL 3SBWC 3U0WL 2Q8AH 5KBDA 4IRJC 3QDGB 2X7LA 4LAQH 4YDJB 4BDVB 4NZRH 4LP8A 3CN4A 4M7KH 1QSEB 1H5BA 2IV9A 2A9ML 4FFWC 3MROA 2V5TA 2FX9H 1PKQA 3GSWA 4OJEH 1CDHA 1YHPA 4TQIA 3PL6C 3WKML 2BWDA 1CE6B 3KGTA 2KMWA 5EOTA 5D7SH 2G2NA 4KMTL 5HGGS 3GKWL 5D71L 3BDBA 2RGSA 3GK8L 5IIEB 1T6BX 1JHTA 4PRPB 3JV0A 3AWFA 4F15C 1U8PA 3NH7H 4AEEA 4B9GA 1OAYL 3O2DL 4Y8DC 3ZQ9A 2I26N 5FGSA 1BEXA 4NKIH 3B37A 4O51B 3EHBC 1MRCH 1UZ8A 3BIKA 4CU8A 1FRGL 5D1ZA 1D5RA 1AKJD 3ME0B 5DZJA 5F9WC 3HZVA 3EYFA 1GJWA 4X8CA 4ZODA 1CFMA 1DFXA 4R3SA 4G7VL 3KPSE 4EMZA 3U0TB 3X14B 5ABZA 3F12A 3VU2A 2FZ3A 2XKSA 4G43B 3NJHA 3WFZA 5AFAA 4DT2A 5I0WA 2AERT 1SPDA 2HZHA 3PJLA 3FCSB 4L8BA 4KO9A 3LKSA 2F15A 4YIQB 5TK4A 2BXYA 3CK0L 1A6VH 1A3LL 4CU6A 3QJXA 2NSMA 4OB5L 4QHMB 3VSQA 2P47B 4AYGA 3D4CA 4EN2A 4M6NL 1JYWA 1U8KA 2B16A 1PCXA 3WY2A 3LKQB 3RNKB 1KJVB 3EJUA 4K15A 4AMWA 3RU8L 4QT5A 4KJYB 1FL3B 1GS8A 4ZPVB 2Q20A 1EXGA 1Y18A 1ZK9A 2XT1B 3UAJA 3QZWB 3QUYC 1M53A 3OTTA 3C12A 4Q2ZA 1HWWA 2NT0A 1EMTH 4UAOB 3VD9A 2ZOOA 4AYID 3KPRE 5AWNL 4XOBA 1R0AH 4FRWA 1Z66A 3LH9A 4M8QA 4NC2B 5TQ0L 2IGLA 4ELMA 3D30A 4UQ2A 1J0HA 2NY6B 3NEEA 4HCGA 2DQGL 1N8ZB 2M1KA 3FZUD 5J56B 3KPPA 4PCSA 3SE3C 2NX5A 5D7HA 3VTAA 1NGWB 3S35H 1FFQA 3KPQA 5EC2B 4F58L 1UT9A 4N3UA 3EW3B 1MPAH 5DTFA 5MEND 2V3FA 1IGTB 3WEMA 3DSNA 1I3VA 3QJQB 5IROD 1CR9H 3TZVB 2V4LA 5T1MB 1WRFA 4R8WH 2FUQA 1BYNA 2V5RA 5JNYA 3VRIA 3R19A 1OB1A 4CDHA 2YPLB 1N64L 4XPFH 1LTXA 1GGIL 2UY6B 1XH3A 1MJ8L 1YN7B 2VUYA 3KM2A 3L4WA 1G0DA 4IKLA 4YGAB 3I6LE 3C6LA 4NKDB 2WXPA 3ZGHA 1JXFA 2FDBP 5DWUL 4D0DB 4FXKC 2VXTH 4FOMA 5KVDL 1BZEA 5CP3A 4P2OA 3JV4A 4F2MA 2CBTA 1CFSA 5TGBA 2Q1EA 4HEMA 4X4YA 2FX7H 5AOLA 1AHMA 2F08A 4J4PA 3DXAD 2YD0A 3GKZA 1OKEA 4JFZH 1B9KA 3EYSH 1NMCB 4DN4L 2PPAA 1SDDA 1MAMH 5GHWH 1UADC 3KJ6H 4Z0XB 5GS3A 2WP3O 2AXGB 2EDQA 2P4AB 2R23A 3BP4B 3HMXA 3LEYH 4BRVA 1IBHA 1XIWD 3QEUB 3FJTA 2JJUA 2IBZX 4NAMA 3NGBB 4Z7VA 3D52A 4PJGB 1V10A 4MB1A 2Y6SD 4U1HA 1CYWA 5FM8A 3PIQA 5AZEL 1CI5A 4GRMB 4HIXH 1AXSA 3BMWA 2OMZA 3QI9D 2WN2A 3P0YH 4PRAB 2W1NA 4RBPK 1FNLA 1CGUA 3A6CL 3HC4H 3ZZLA 1O5DT 1E9OB 1RJLA 4P07A 1IM9D 4UUJB 5CZRA 3P02A 1H8OA 1G9NC 3RWHB 2UXGA 2EDRA 4LPXA 5D1ZD 4BZYA 2D7TH 3WTSA 5IW1A 1JAEA 1R75A 1U93A 3D4YA 2FEDD 1NC2A 2GB2A 5D9SB 1KF9B 4GLRI 3VSUA 5CZVL 3GLAA 1KB5H 2Z6FA 4P57B 2RFXA 4ZUUA 1T1XB 3EDFA 2PW1A 3EH3B 3IGUA 5FUZL 5GZNC 2C1OB 3VFOA 3CIQA 4E9VA 2C7FA 1XGUA 2X5PA 1JNNL 3RWDA 3B7RL 3FXIC 5G4OA 3MRPA 3G5WA 3PF2A 5KSAB 7PCYA 1B6DA 3FHQA 4LARH 3K7UA 1L3NA 3UTTB 1JGEB 1HQRB 3C5ZB 4ORZC 3FT2A 4R7DA 4AGLA 4PJDA 3SE8H 2X4TA 3G6JE 2QLVB 3AW5A 4GOSA 1IGJB 2CMRH 4U6TA 4Y2DD 1OGSA 5E4OA 3NQIA 4N0CC 5E2UH 1RZKL 4YXHH 5BRZE 5IHHA 5KOVC 3NJFA 4ZX5A 1MFNA 3ARSA 1DSFH 1YSOA 2IPTL 4LLYB 1KTBA 1FYHB 2D0GA 3HB3D 1Y1UA 1EANA 5DC2A 3L1GA 4QRRD 4G8IA 1PVHA 3KS0J 3IT8D 1A7OL 2O6CA 3LN9A 1B2WL 2B59A 1A1MA 3I6GB 1TKWA 3D6GA 3ES6B 4GG6A 1RY7B 5IVXF 3SBQA 4ETQA 3MMEB 1SDYA 3HAEB 4P2QB 1JFQH 4WI4A 1PX4A 1LO0H 1I1FA 4GG6F 2GTWB 1E42A 4PJBA 1OAQH 1NCIA 5DZLA 3MGTA 3QUZD 4QJ3B 1HSBB 4HG4J 1JF5A 5KVGL 4UZUA 4G8GB 3AVEA 1YPZA 4KO5A 2RBLA 1FG2A 2X2IA 1CDGA 2BVYA 1XTMA 4B0MM 5F6IB 1WP6A 3PABA 2G5BB 3MRBA 4MAYB 4TSBL 2LVEA 1NGZB 5HYSG 4JQIA 4KJWD 5JDSA 2EXWD 5IM7A 4MD4A 3PUCA 4HIHB 2WOBA 2XQYK 4K7PX 4PWFA 5KVFE 1AZRA 2AI0L 3PDGA 4TTGA 4JFQB 4APQB 1R1CA 1RZJC 1SY6A 5D7IF 3LXCA 2DQFB 3GMNB 3QS2A 2DICA 5KANG 3TA3B 4G6FB 1KCUL 2CPUA 1SF5A 5EF2A 3I74A 4AY0A 2VZOA 1A14L 3EH4B 1F58H 2I9TB 4NO2A 3B1TA 1PSKH 3Q8FA 2VAJA 2VO5A 3BH9A 5JOPE 5BV7L 5AYTA 5AB0A 5ILTH 2ZX5A 3TPKA 4JHWH 4J8RB 5I8OH 4XC1H 2BNQA 2BSDA 4OQTL 5ALBH 5TE7L 4FFZH 5ABAA 3UJJL 4BUHA 4HULB 2CA3A 1QRNE 4NQXB 2B1AH 2VXUH 4GSDH 1ZAGA 1H9VA 4CJ0A 5IB1A 2VITB 2E9GA 3CUPB 3WN6A 4M62L 4NO3A 3LKNA 1L9NA 5DQ9B 4OLVH 3RPIA 1QI5A 2BRRL 5I6XB 5KVEE 1IL1A 1QHQA 3H3PL 5C0AD 4UV7H 4DP4X 4MMYB 3RDTD 3OXSB 4HPOL 4XAWL 1ULVA 2QGBA 3NYKA 4E9LA 4PRBB 1ZSDA 4OAWA 2B2XL 2C4FU 2XI9A 2QKIB 4TVPL 3LV3A 1AZZC 4I48B 4LRNL 1J5CA 3QUZA 2BHYA 2YKKA 2CIKA 3FO0L 3DPBA 1E5AA 5JMRA 4BRJA 4L4TD 1SJEA 2HT2C 3UTTE 2ZKHH 1PG7H 4G8FA 4S1DD 4ZSOE 1GIGH 5CEZL 4BUGA 3GJFA 5SV3A 1GOFA 4WFGD 1E9PB 3FPYA 2R8SH 4LVEA 1KMGA 4X9YA 3FU3A 4H88L 4G2AA 4OJYA 2D0FA 3AQZA 4NKQB 3LN5A 5GS1C 3C5XA 2BSRB 5T3ZL 3I50H 5CXPA 2QPDB 1U3JA 3WMQA 1FNAA 3I6KA 3L3KA 1OCOB 1N59A 4KKNA 4R6UA 5E9DD 3BVNA 3LMJH 4NIKB 5AVZB 1J8SA 5T3ZE 2W88A 1F1GA 1KCSH 3MJ8A 1HZHH 3CFTA 1E30A 2JKNA 1PTZA 2FUTA 4LPCA 3O6FD 5I0XA 3OKOB 3SYQA 1ZHBB 1RUPH 3TN0A 3CFCL 4LFHD 3LOWA 4GINA 3LS5L 5I0ZA 2EDWA 4KROB 4IU2A 5E08L 3MZTA 3LNHA 2YFOA 4NENA 4FXGA 4YSPA 1CTOA 3ZKXB 1OHQA 3CVHL 4F80A 3J7HA 1MRFH 2PR4H 3TO2B 1Z9OA 5D1QE 2IO5A 3LYRA 3MLZL 5IQLA 1KG0B 4BKTC 2YC1A 5CINL 1IFHL 2NUTB 2BOBA 5DVKA 4BFOA 3GZQA 4PJHA 1EAJA 4QIRA 4JPWH 1IAIH 2BIHA 2OZ4A 3L9YA 3ETBF 3HZKB 4X4XA 5D7EA 2CLRA 3DC0A 1AS8A 1KYOJ 1XCXA 2BFGA 4L8SA 4N20A 4FEIA 4X6DA 5I2IB 1U8MA 5IQNA 4M4RA 2GJ6B 1TDQA 2N01B 3ARBD 5DQDH 5EU4A 2D03L 5E51A 1PU0A 2AJSH 2BNQD 1S7RA 5GSVA 5SWQA 3VWKB 4RBPH 1MH5A 2WKLA 2KZWA 3LIUA 1I8MA 5E8NB 3JWOC 4HF5H 4UTBH 5BOPA 5GRZA 4W9JC 1C1EL 2WYHA 3D4ZA 3HE7B 2VDLB 1RIUL 3ILPB 1HHGA 3ROOB 3L1OL 3GS4A 4TM9A 1N2RA 4HCRL 1IQWL 4NN7B 3F64A 1EFXA 5F3BB 1IBYA 1WD9A 4DP0X 1RHHA 3X12A 3KYKH 1WAAE 4O2CA 3TBTA 1QYGH 4Y4FD 2IH1A 3MLTB 4I3GA 3DX4A 4Z7QF 1KBBA 1PZ2A 3HPLB 1RZFL 2QQLH 4AXWB 4IIQA 3BW9B 4MXVF 1RUML 5GZOD 5D1XB 1AYOA 4X5RA 2VDQH 1OAXH 5DVMA 1RFDH 2F2HA 1KNOA 1EGJH 4PJCA 3QJFB 1ZGLM 4L3AA 1P7HL 3NK4A 2V37A 4FQJH 5JXEC 2AABH 2ZAIA 4UOW1 1FFNB 3DYOA 2AV1A 2C4FT 3LTVA 5MEQB 4OF3A 3FW6A 5HHVL 1KJMB 5IBUB 4W81A 3E8UH 4AIOA 2ITDA 1FO0B 5DUBB 1OGAE 2P8LB 3OVUB 5DJ8B 1WZKA 5KJRL 1DJZA 4X9IA 4LKXA 4LCIL 2VR9A 2IH9A 4YHLH 4ES9A 1OSYA 2G2RB 2H3XC 4JDEB 2HJFA 1X4ZA 1U6AL 3OZLA 5EOCH 3FB6B 3RVXC 3ZMRA 3BP7B 2W9EL 2ZSWA 4S0TD 5D70L 4QXVA 4JFWA 4NCDA 4Q7DA 2LW3A 4GRLD 3TIDA 4NJ9H 1UXSA 2Z9TA 4RFEA 1T22B 4KTYA 2D0HA 5GZOC 1UD4A 2VDOL 2OSYA 4TQEH 4IBQA 1D7DA 3AZUA 3U6XA 3I3EA 4PP1C 3PWVA 4G1EB 3LXUX 4LIQE 1NIAA 2YWZA 4X0NA 3P4NA 3US0A 1OT4A 4XPBH 3AU1B 1ECYA 1S7WB 3ZKSD 3ARFD 1CPUA 4PGBB 1MWOA 4FFYH 4YNYA 2ZG1A 4LLUB 3O3BB 5CBEA 1QA9A 4Z76A 4LCUB 1ZLWH 5M7QA 4PCTA 2ENSA 2PO6C 3QS3A 3OAZH 1NGPH 2A9BA 1ZTXH 1A1NA 2D3JA 3WUWA 4PRPE 3OAUH 3QRLA 1IT9H 2XQYA 3QZWG 2VJ0A 1UXLA 2HTKC 5DYFA 4GH7B 1UB6A 3LIZL 4N2NA 5JW3H 1D7CA 3U9PL 3DECA 3CMOH 1NFIA 3BLKA 3WTTA 4PD4J 4KRNA 5D1QC 1MCFA 2IVFC 4DCQB 2ZUVA 2AJVH 1WO2A 4N9OB 1HDMB 3MU3A 1QSEE 3VFVA 1DQLH 5B39A 3RI5F 1T04B 1I85C 1YDPB 5F1NB 3WNLA 5JO5B 3EFDH 5J6SA 1DLFL 3LZNA 3KLKA 4UT9L 4U1SB 2V7NB 4WJ5B 3EXJA 4F33B 4PJAF 1EAPA 2BNUB 3S37X 2OX5B 4EZKA 2CJUL 4TUKH 3HMXL 5DO2D 4AM0Q 5AB9A 2MCPH 2V2TB 3SJVD 2GK0A 5I1HH 4HJIA 4EI5D 3VNYA 1JZ6A 3QDGD 3X1FA 3LNEA 2DPKA 4CA4A 6CGTA 4YHZH 3MV7E 3K6IA 4OZHB 1FNGA 4N2CA 3VXRB 3D09A 4OV5A 4Z18A 3U0TA 4JRXD 4TV3A 1USQA 3F5WB 4X6EA 1N7MH 4NDMB 4PJXE 1P4IL 2JF1A 1KBGH 2FWLB 1OGAB 5E7FA 4WCYH 4TULH 1DVFD 1NAKL 3KLHC 3Q2WA 3FBQA 5K1JA 1E43A 2GY7B 3ARFC 1Q94B 3WS3A 4TS6A 3FTGA 2X1XR 1R3LA 1U3HB 2VMEA 3M86A 3QXDA 3OKMB 2VL4A 3QFDA 2OK0L 4NWTH 1Q90A 5IOPB 4HKXA 1HEHC 1KLUB 5BRZA 4DAGL 4CKQA 1QI3A 2ZNWA 4ONHA 1SOKA 2WINA 3BUDA 3FO1A 3IFNH 3KS0H 5FLVA 1G4MA 5IW6B 3A4FA 3T2PA 5F7EL 3SKJH 4RWHA 1BOGA 1MEXH 1TENA 1TTUA 3ZSTA 1XSJA 4LDLB 3AG2B 4HJ0C 3VRJB 4ELMB 4XN4A 4BZ1L 1TVBB 2WVVA 4S1SH 3VDBA 5GS2H 2EC9T 5I6PA 1I3UA 4M6OH 5HYQB 5KSVA 3W5NA 4ODSL 1XR9B 5DUPH 3K71A 5G55A 5CMAB 1HILB 1JRHH 3FQYA 1PZDA 3V4UL 3HOGA 5DURB 3H42H 4OIIL 4IEFA 2JE8A 1M2OA 1KSRA 1F45A 2HTKD 4KC3B 1CL7H 1G0YR 4UIKH 2CBQA 2EE2A 4JFFD 1BFOA 2GJ6E 5FKAB 2WPGA 2V7HB 4HPYL 4OCRH 2QHLA 1UUNA 3O6MH 4GG8A 4A2DA 4XNMB 1ZHKA 3C6LB 2AW2A 2E7MA 2QFPA 3MYJA 4RFNB 3BZ4B 5FFOA 4B50A 4P2RB 3DV4B 4H0IA 4AEIH 3WSQL 4Y19B 3WNMA 2VDRH 4PG2C 4WFEE 3IJYA 3CSPA 3WTYA 4BE5A 2HX8A 2B7DT 4ZNCD 3EOAA 1D6VL 1NAMB 1XCQB 5L2JB 5HDRA 4NSKB 1U8NA 3VFRA 3BKJH 3WFEL 1FPTH 3HLAA 1NL0L 3MOBL 1H8LA 2R4RL 4OLUL 1KIRA 1J87A 4OLXH 3FK3A 5AZ2L 1JYXA 1V7MH 3BVWA 2JTDA 3LKOA 1NEZG 1KB5B 4XE0A 3MTXA 4KTDH 5A2AA 3TL5A 1KGUA 4B3VA 1NMAL 4KI5E 2ENQA 4KRPC 4OZGB 1QEWA 3KYNA 4I0CC 4CSPA 3S3CB 1NGXB 4L29A 5JLZA 1T7YA 2VJXA 1L9TA 2DBLL 2DLHA 4EO5A 3AACA 3DBSA 3SE4A 3IFPA 5KSBB 1L6ZA 4X5XA 3IETA 1NSNL 5EIIB 3OAWA 4HAKA 1IVLA 5I9QC 3WE6B 2ZKWA 2AEPH 2EDLA 4U6HA 1VACB 3U7WH 2YKLH 1D6EB 4FNRA 3V0FA 4JPIB 2ISDA 3F8UB 5DD6A 3MCKA 4ZSOB 5F7YC 3DDFA 4CVXB 3T0EC 3AU0A 1GCYA 5DMKB 4ZFOB 2H26B 1XVSA 2X0VA 4RGMB 2ZXDA 2RA1A 3BUYB 2YPVL 3PXLA 2XDHA 3D07A 1FYTE 3PGDB 4LBEA 5C09A 4BCZA 2VLJD 5E5RB 4GSQA 4BZ1A 1EXHA 4OW6A 1FUNA 3TJPA 4AQAA 5KTEH 1M6OB 3DNKA 3CNKA 4PJDF 1PMYA 5GS0L 4WKZB 1SJHA 2BFVH 1S5IH 1I7TA 3JTSB 1LEKA 2VLRB 2WQXA 4GW1B 4RGOH 2DBJA 4YHYC 4W6WB 4KK8D 2GBTA 1TMCB 3UIYA 5E9DA 4B27A 1BPLB 4ZFFA 4IOSA 2ZD0A 3MUZ1 3ZDYB 1MELA 3WLWD 4CGUB 3S8FB 2HVJB 3JT2A 5FYLD 1D9KA 2P5WE 2B5IC 4NNPL 3IFOA 3ZQWA 3L5WA 1U95A 5TE6L 4Z7NF 2GBAA 3QUXD 1XGRA 1WIOA 1XCWA 2DQTH 3ZY7A 3U1QA 1X9LA 3MA7A 1KWKA 1KXVA 1FQ9C 4HHGA 2WVSA 1RJYB 3FT4B 1RZ8B 4CN1A 3EG9B 4K7FB 4PJIF 3FRPA 1DVTA 1LP9F 3OJ2C 3L4YA 1AQ8A 3E2HB 3DTUB 3ZK0A 1L5GA 5AW7B 3U6XS 2Y07L 4AGMA 2Z35A 1ZPUA 1F11B 3EGXA 3MMEA 4IBUA 3B1UA 4R26H 5A2IH 5BRPA 3EUDA 3X17A 4JL1A 3RVWD 4NO0A 1U3YA 3KPSA 2HLFC 3CFNA 2BP8A 1LNUB 5I1DB 2GPZA 1CO1A 2BVUA 1OPGH 3NIDF 3P11H 3PAUA 4JMXA 4E0RB 2CALA 2Y5TA 4FZ8L 4WWID 5IHUH 1KXHA 4JFXB 3RIKA 2COVD 2W65B 1CZ8H 2ZX7A 5LDSA 3HI1A 1EO8L 5IJVB 3M1BB 1S7XB 3MJ7A 3OGOE 4DKAA 3K91A 1ROWA 3CZJA 3ZTNH 2VRQA 5ICXB 2YD2A 3DX8A 4R7NA 1KYFA 5D5MA 5EEYA 3ARGC 4QXGL 3LKPB 5F1IB 4JO1H 4YSSA 1MXDA 2Y0SA 3FQWA 4FN0A 1G7QB 3B2XA 1IUZA 1AQKH 2NYZA 5ABDE 3BT2H 2WMPA 5DJAB 5CEXB 5ANME 2ICWA 1MY5A 2Z31A 5E6RB 1IX2A 4G71B 3ULVC 4YFDB 2HLAB 3L7FA 5A2CA 1WS8A 1PZSA 1UM6L 1L4IA 4LLMB 4O2FB 4AVKA 3L54A 4NRXA 1DR9A 3L13A 4KZEL 4QOKB 1FV1A 3GWJA 4ODVL 3VXUD 3D25B 5C6TH 3ZYIA 2V2WA 3LRKA 4WHYH 2RH0A 5LXVA 2R7EA 1KIQA 1DE4A 1VSCA 3EDEA 3O0LA 5F9WB 3NJXA 1R3JA 2PYED 1GGCH 2IG2H 2J4WL 5AOZA 1CD1B 1SOQA 3O2WH 4PBDA 1JZ5A 3RWJA 5GRVL 4L3FA 2PETA 2ATKA 1ASOA 4HS8L 4PBWD 3EJYC 1JDAA 3PP4H 3VWJD 4UAHA 4ZMXA 2VDNL 2MKWA 1MF2L 1X5AA 3KYOB 4BQ6A 4FJ6A 5I73C 2IADB 4Z3FA 2XFXA 1S7VA 3U0PB 5I1IL 3MCG1 1U2HA 3F7YB 4O58L 2OTPA 3D69A 4EDXB 4NQED 2QPEB 4OM1H 3G6JB 2DLFH 4BSJA 3VW3H 3DURB 2O1AA 2YEZB 3O6LL