4BFEA

Structure of the extracellular portion of mouse cd200rla
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
188
structure length
188
Chain Sequence
QVNTTMSVQMDKKALLCCFSSPLINAVLITWIIKHRHLPSCTIAYNLDKKTNETSCLGRNITWASTPDHSPELQISAVALQHEGTYTCEIVTPEGNLEKVYDLQVLVPPEVTYFPGKNRTAVCEAMAGKPAAQISWTPDGDCVTKSESHSNGTVTVRSTCHWEQNNVSVVSCLVSHSTGNQSLSIELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CELL SURFACE GLYCOPROTEIN CD200 RECEPTOR 4
publication title Structures of Cd200/Cd200 Receptor Family and Implications for Topology, Regulation, and Evolution
pubmed doi rcsb
source organism Mus musculus
total genus 32
structure length 188
sequence length 188
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bfeA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bfeA02
4L8DA 1N5YL 3H3PL 3JVGA 2R69L 4GLRI 4RA3A 2ICEB 5GJSL 3WHXA 4XVJH 5C0JA 3RWEA 4LLUA 4X6EB 3MNWA 2GJJA 4H1LA 3DARA 3BYYA 4LCYB 3BHBB 1BQHB 1NBYB 5DRXB 3MOAL 4YK4B 2JIXA 1H5BC 1I1YA 5HGAA 1T21B 3AREA 4IRSC 3BGAA 5H94B 6FABL 2ZUXA 4NKIL 3REWA 3BPOC 4IMLA 1L7IH 4PTTB 1CIUA 1FNEA 2R0KL 3WUWA 2L4OA 2BSTA 3BN3B 1ZA6B 4MX7B 2IANB 3MYJA 5BZWB 4F8QA 3AU1B 1KTDB 1AXSB 2EKSB 1UM6L 4LF3A 4EXKA 3LH2L 4BSWA 5IHLB 3AB0B 1F3DJ 3E0GA 2QKIB 3EO0A 4S1SL 5J1AA 2IJ0C 3CJJA 3VXMB 3MGOB 1DCLA 3CUPA 4OZHB 1SJEA 3QIUC 4DOHE 4RWHA 3QA3A 1MQKH 4H20L 1KIPA 4QRPD 1KPRA 4XMLL 4XPFH 4N8CH 4EVNA 4MB4A 2BHUA 4FXGB 4JJ5B 3UTTE 3DYOA 4OZIB 3N9GL 3QZWA 3GIZH 3O6FB 1BZ7B 2EIZB 1RU9L 3WJJC 3LKOB 3WS3A 4C56A 2AI0L 3BKCL 1WV7T 1CCZA 5CINL 1KULA 3LN4B 3SKJH 1S5IL 1W8NA 3FRPG 4XCFL 1HILB 1OP5K 3L3GA 4H25A 4PJFB 4U6XB 4MNGE 2OK0H 4WFGE 5CD3A 1YNLH 5EU3A 4NQXB 1AR1D 4HEPG 4X83A 5E2UL 3I3EA 4HUUA 4OFYD 3BH8A 3BOVA 3S9DB 4QEGA 1FZJA 4UAOC 1RK0B 3WKNA 3ES6A 3VCLA 3WE6B 4OZGE 3CU7A 4M43L 4GAGH 1FBIL 3I6GB 1CGXA 4V1DD 5DURD 1TQBC 3HNTL 2GTZA 3FCTA 4EZMA 1EXUB 2PCPA 2YPLE 1FPTH 3EIFA 2F19H 3T2OA 1WCBB 4L3EE 1IGCL 4FQHB 1YPZE 2HKHH 1JNNL 5GZOD 4D9QE 5KS9E 4CVXA 4HCRL 2GAZA 1K5NB 4N9GB 4ZQKB 1P7KA 1VCAA 2NX5B 4IIQC 1IBGL 2YN3A 4GAYA 4J3OC 1SEBA 4KH2A 2V5MA 5KSBA 4JZOB 1ES0B 3L3HA 3B9KA 4UI2A 4MSWB 2AK4B 1URLA 4J3XA 3Q2CA 1UZ6F 3QQ4B 4HULB 3OL2A 3N50A 5T1DH 3GBMH 4R96B 1M05B 4XNQB 4FQLH 3ULVD 4YHYC 4OSUL 4P9MH 3QFDA 5HDOA 5C0ND 5FHAH 4Z0XB 3VA2C 1A9EB 1YYML 3QT2A 4ZS6D 3MLSH 4YGVB 1J8HE 2KQMA 4JANA 4S2SA 5JPMB 1ORQA 5FA4B 2FX9L 1Q38A 2CMRL 5SWZD 1LD9A 4HT1L 3LZFH 5IEKA 5MEPA 3RIAK 5JOFA 5DS8B 3TVMD 4QF1A 4S1QL 4Z7UE 3WFHB 4OCWL 3C5ZD 4Y16C 1F4AA 3S98A 4AENB 1JZ3A 1UWGL 3AROA 3VXRB 5IF0A 2PO6C 2X4PB 4D0CB 2NY2D 3DRTB 4OZGA 2VR9A 1FNGB 1NJ9B 3OKDB 1JE6A 5C0EB 1UB5A 2OLDA 5JZ7C 3QWOA 1UFUA 4WI4A 2WAHA 3LRSA 3SJVA 4JFQB 4HIJB 3HMXA 4X6DF 2R4RH 4WWID 5DJCA 5AD0B 3ZE2E 5FXCH 4L3EA 5AYQA 4MA3A 3GIVB 4XP9L 3PXJA 1KLUA 2XXCB 4XI5D 3HR6A 5KS9A 5HSFA 4ZYKA 2VRAA 2BSED 2C1OA 1J9CT 1RV6X 5DLML 4U0RB 4WDIB 1X5ZA 4Q7DA 4DK3A 4K2UL 1ZLSH 4HZLB 3SGKA 3KPSE 5IMOB 1PX4A 2Y36H 1WITA 4H8WL 1I1AB 1GIGH 5ADOL 1OAUH 4JREC 2FHFA 5JIIA 2ZSVB 4G9DA 3P9MB 1D5MB 2BK8A 1BMGA 1J1PL 1ZT7B 2COQA 1LGVA 3QUML 5FYJH 3FQUB 3V4PH 4O02H 4DZBB 3B5TA 2AQ1A 3W0WE 4LLMB 5GSVB 3O4LD 3R8QA 1E6OL 1HHIA 4YHKH 4KK9C 1T4KA 4AIXA 4GMSL 1CLZH 1UXSA 3FOMA 4WTXA 2CGRL 4WW2A 5DEZA 5D6DC 5KSAD 1JF5A 4UDUB 4Z7UA 1U0QA 5IUSA 1IQWL 2Z31D 2YD6A 4NPYA 5I1LA 3IAPA 4OI9A 4UOW0 1BM3H 3L6FA 5FA3B 5GS0D 3GNMH 1HOCB 5KZCB 4MCYA 1DQDH 1W72H 2GIYA 2A74A 4M5ZH 4KMTL 1FYTD 4Y4FC 2P4AB 4JM4L 4YXHH 4JKMA 3PDGA 5CS7A 3LCYA 3S88H 4JQIH 2CKBA 1IGML 2VLKD 4MYWB 5DVKA 5BVPH 3S34H 1FN4A 5ISZA 4P5TD 2XN9A 1QNZL 2AXJA 4EBQL 2V5RA 1FZOA 4HGKC 2P44B 1CQYA 4WWKC 1PGRB 4CUCA 1HSBA 5T3ZE 1UJ3A 5EN2A 1JNJA 2D03L 4JKWA 3BDBA 4FQJL 1JHKL 4RQQB 2C1PB 2OR8A 4OV6F 1I85C 1QSFA 1V7MH 4KROB 3L7EB 1C08B 4NO0A 1BFSA 5J9PA 4GOSA 3FT4A 4TULL 3MROB 1F3JB 2ADFH 3IFNL 5K93A 1F45A 4Y19D 3V7MA 1R3JA 2VNCA 1P1ZB 2OZ4H 4OI8A 4DKFH 1CYGA 1G7JA 1RUPH 3IDJB 3GUTB 4QRPB 5L0QC 2JJSA 1NGZA 4XC3L 2DMBA 2DQHH 3T08A 3ARYA 2VXSH 2O61B 2P47B 2DLFH 4EUPB 4RFOH 2HH0L 4MD0A 2VZSA 1GCFA 3EGSA 2V17H 1YNTA 1XGQA 1RHHB 5C6TH 4OQTA 1UCBH 1ZGLB 4O2FA 3O9WD 2G2RB 1R3HB 3AY4C 3WEXA 2VDOL 1WGOA 1N8ZB 2DLIA 3VRLE 3RNQA 1T7XA 3TPUA 1DL7H 3DNKA 4PJAF 3STZA 1A3LH 1HE7A 4LCWA 4MQSB 2M26A 1GGCH 5C0NC 1NFIB 1CDYA 4ZDHA 2V7HB 1TQCB 1JZ7A 1L0QA 3KLAA 4NUJA 1VFBA 3TA3C 4V1DB 5DURB 4KV5F 1NDGB 2J8OA 3DXAA 5JHDD 3THMH 3QJHB 2DQEL 4P2OA 3TVMC 4JE4B 4WHCA 1YECL 2X4SA 1G7MB 5ID0A 5C7XL 4K07A 4L4TD 3PWPB 3RIFF 1OGTA 1NCCH 4U3CA 3MBEC 5IMLB 3V5HA 3DYPA 3QULA 4NGHH 1ND0B 1JZ8A 3GI8L 5JOPE 4WU7A 1AI1L 1LE9A 3BP7B 1JTOA 5KN5B 3Q3GB 5J3HC 3CXHK 1R3IH 1JHLH 1AFVL 5HI4C 1NEZB 2A9MH 5T5FH 4XI5C 2YK1H 2VYRE 3NA9L 1U91A 1A5FH 1YEDB 3LEXB 1H3PL 2AEPL 5IG7B 5I76B 4AT6B 5CKAA 1RAMA 3QH3B 4GRLD 9CGTA 1DUYB 5DHYA 5C1MB 4KUCF 3TT1H 1TITA 3BW9B 3GSQB 1J8KA 2IANE 5L9DL 1A9BA 2VDRH 2VKWA 3BRDA 1IAMA 5SWZB 4UT9H 4DW2H 4XVJL 4XXDB 1U8LA 2P46B 2P42B 5IFJB 4RGMB 2LABA 3PWUB 3FOLB 5DZOA 4XCEB 3C5ZB 5E8NA 4YXKH 3BQUC 2WZPD 2OSLB 2R56H 1FFPA 5K9OA 4H0HB 4EOWH 3I85A 2NY2B 4XAKE 4P57A 2W9LA 4JQVC 1DVFC 1JTTA 2MCG1 4TSCH 4X6CF 2Y5TA 2VISA 1NANH 1L7IL 4QTHB 5K9KB 4BJLA 1DLHB 4ODUB 2DJSA 4MDJB 1GOHA 4DZ8A 1BVKB 3FQXB 2XQBL 3QRFM 3D9AH 1QFWM 4QRRE 4UNTA 1YDPB 1T83A 2DJ4A 4GG8B 3N06B 5F1IA 5D5ME 4GW5A 3E6FB 3ZDZF 4P2CG 3D85A 2CKNA 4XPGH 1QTYT 3KLDA 1MFCL 1MQKL 4PRHD 4PJ8C 4XPFL 4N8CL 4G42A 2O5YH 3MRPB 5EU5B 4P2QE 5T5NG 3GIZL 4Z7VB 4KTDL 3FJTA 4N9OB 4X6EA 3MUHL 3ORJA 2J8UE 1QZ1A 2ILLA 4LCYA 3BHBA 3ROLB 1NBYA 5DRXA 5JIPA 1MCLA 1D6EB 4YAQB 4JKPH 4J3SA 5JXEC 3SKJL 1T21A 4NIKB 5H94A 4MNQB 1HEZB 2OK0L 2WWKT 2AQ2A 4MS8D 1UT9A 1ZA6A 2IANA 1YNLL 4IRZH 5BZWA 1NAKH 1DFBL 1KTDA 1AXSA 3O4LB 2EKSA 3AU1A 4X9FA 5T1KD 2MTPA 4RMRA 5GGSB 1JFQH 3F7YB 1RZKC 4HKBB 2QKIA 2NX5E 4DKDC 4NOBA 3U1SL 5KSAB 3MGOA 4OZHA 1MY7A 3K80A 2Z31B 1I1FB 3ECBB 4GAGL 4LEXH 3VFSB 2AKRB 4Y5VB 3MUZ1 3ULUH 2AK4E 4FXGA 3PGDB 4JJ5A 2A0LD 5IFHH 4X9GA 5F1OB 1FYTB 3MLZH 5J6HB 1FPTL 4OZIA 2F19L 2P8LB 2HFEB 1AGBB 3O6FA 2HKHL 2HJFB 1BZ7A 4QHNB 3ZE0E 2EIZA 2W38A 1IILE 3LKOA 3GO1H 4QRRA 3O9WC 3TYGL 4Z18A 3LN4A 4LLDB 2CLVB 4P5TB 2R29H 2R9HD 4N0FB 4BZ1H 1OP5H 1QFOA 4PJFA 5HHPB 4HW6A 3HI6L 4U6XA 5FIEA 1JPSH 1C12B 3O3DB 4NQXA 4J8RB 3WD5H 3RVVD 4ZO6A 1PSKH 2DS4A 2N7AA 3VXRE 1RK0A 4KJWD 4PJCB 4PJ5E 3EKCA 2VLJB 5T1DL 3GBML 3WE6A 4FQLL 4N0UB 1KCUH 4K3DH 4Y5XB 1UENA 2J8UA 2P5WE 3CH8A 3I6GA 4Y19B 5FHAL 1IGFH 3NCYS 3MLSL 1Z5LB 1IT9H 4JJHA 4EI6B 4MMZC 5IEHB 1WCBA 4FQHA 1UADC 3AMLA 1BFVL 2L0DA 1MCKA 3L7FB 1K5NA 4AIOA 4N9GA 4ZQKA 2X1WL 2FH8A 2PTVA 5EUOF 2NX5A 4PBXA 1J10A 3G5YB 4JDVB 3PV6B 4AEIH 1IARB 3O9WB 4PGDA 4JZOA 1ES0A 3GMOB 3VMOA 3LDBB 4MSWA 5MEOB 3QIBC 2AK4A 2R4RL 3OR6B 5ALCH 3W82A 5KTEH 2NZ9D 3Q6GH 2AEIT 4X7CC 4R4FH 3QQ4A 5FCSH 4R96A 1M05A 1CLOH 2YD1A 4XNQA 1EJOH 1JMZA 5F9WC 3MV8B 4Q97A 4Y4HB 4I3GA 4Z0XA 5C6WH 1A9EA 4YBLC 4YGVA 1OTSC 1NQBA 4WV1B 4NUGH 5FA4A 5HGDB 2Y07H 5EU6D 4ODSL 3N1QC 4OF8A 2X1PA 3DURB 1ZLSL 4YFDB 5DS8A 4J1UB 5I8EB 2C26A 4XNZB 2Y36L 4RAUB 5BOPA 3WFHA 3BO8B 4ZAKD 1GIGL 1OAUL 1Q0YH 4AENA 3VXRA 3EOBB 4HV8B 3TBWB 4U1GC 2FECI 3DO3A 4PJ9C 2X4PA 4D0CA 5IMMB 5F72S 1FNGA 1NJ9A 3BPLB 3OKDA 5C0EA 4Y5YC 4KJPC 4Z7NF 4MJID 4G9FE 4BZYA 3V4PL 5FYJL 1D5BB 4O02L 4K9EH 4JFQA 2MKWA 5AD0A 4YZFE 2DQCH 1MFDH 2CR6A 5I1IH 3QO0B 1OTTC 3GIVA 1YJDC 4KK8D 4JFOB 3BKYH 5KBNC 5C08E 4APQC 5J12B 4LIQE 4W6YB 1ADQA 1BM3L 4GRLB 3ZKXC 3GNML 1TLKA 3ARGC 1DQDL 3S8WA 1W72L 1EJ6A 4GRWB 3B2VH 4WDIA 4ZFOL 1WTGT 4HZLA 5CJ5A 5IMOA 4HWUA 1WICA 3O2DL 3S88L 1I1AA 4JQIL 1R24B 5DUPL 5HI3D 3G5ZB 1HDMB 5BVPL 4U0QB 2ENSA 2RQ8A 3S34L 3U46B 4Z76B 4OCNC 4RDQG 1HSAB 3P9MA 1D5MA 1T2JA 5T1LD 1ZT7A 1GC1C 3FQUA 3SQBA 3OHXB 4DZBA 3S3PA 1VFUA 3DETD 4LLMA 5GSVA 3T3MF 3HC0B 3B5GA 3WNPA 3EYOB 5BRZD 5C07D 1UWEL 2D4DA 1V7ML 4UDUA 4NQCD 5FGBA 4M1DH 3MJ6A 2ADFL 2NXZD 4PJDE 4MHHG 2A0LC 5DD0H 3NPZB 4NYLB 2OZ4L 1HOCA 3S7GA 4DKFL 1RUPL 5C9JB 2JKXA 4PLKD 2VL5B 1L7TH 1FZMB 2ZOLB 2DQHL 4NNYB 2VXSL 5DHVB 1ZHLB 3MA7B 4LIQH 4K8RD 1OOAA 4UQ2B 5D8JH 4RFOL 1MCEA 1U58B 4JY5H 3ARUA 4N0RA 2R9HC 1I3RB 2V17L 2ED7A 1TTUA 3JWOC 2FIKB 3SDAC 5C6TL 1UCBL 2BJMH 3IF1B 4YHOH 3TWCH 1DQJB 3RVVC 4PP1D 1PKQB 2BOBB 4NBXB 1T03H 3PWJB 1DL7L 3MRIB 4H26B 2DBJA 1A3LL 4RQQA 2C1PA 4R97B 5DMJB 1WEJH 5D2NB 3V0WH 5CIPB 3L7EA 1C08A 1GGCL 3RX5A 2HTKC 3MROA 1F3JA 5EG6C 1P1ZA 5ESAA 3PG2A 1HCFX 5D1ZD 5CJBA 2VITB 3IDJA 4QRPA 3THML 4FFWC 1J12A 4HK3N 4X98B 2QL1A 3DMMC 5CGMA 3LKSB 2O61A 3L95B 5DO2D 4EUPA 3QCUH 1TMCB 4YC2B 2HT4D 3UXFA 4NGHL 4HZAA 3ARXA 4RBPK 2NY0D 1RHHA 1OW0C 5KOMC 1ZGLA 1U3JA 1XGUB 2G2RA 1R3HA 4X7FC 3SO5A 2R4SH 2NZ9C 3IJHB 1N8ZA 1R3IL 1EHNA 1JHLL 2DOCA 4ODTL 2R0ZH 3ARDA 4OFYA 2BHZA 3SBWC 3BUTA 2A9ML 5T5FL 4FMKA 5B38B 1OGAB 2YK1L 4M7ZB 5DWUH 3B2UD 4PRAB 1NFIA 1A5FL 4DQOH 2BVUA 4UMGA 4RMWA 5C9KA 1QP1A 4H88H 1GJIA 3MFGB 3VWKC 4HH9A 4V1DA 5BS0E 1NDGA 1B4RA 1YYLH 4Y8DC 3TT1L 3QJHA 1WAAA 2FX8H 5GGUB 1S78D 5IR1B 1G7MA 3QWRA 4DW2L 4TTDD 1I8KB 3PWPA 4JRXE 3MV01 3RWCB 2W07A 2ZG3A 1QQDB 4IBLT 5DSCB 3LHPH 5IMLA 1T1WB 4R6UA 1ND0A 5HPMB 5J6GB 4YXKL 1UZ8B 4U31A 1R0AH 4KRPD 4EOWL 4ACPA 2EDWA 2EICA 5EFIB 3BP7A 4PJFF 2XYCA 5KN5A 2DN7A 4C59B 3Q3GA 4PD4J 4TSCL 3KLHC 2E7HA 4YHLL 1JPGB 1S3KL 5DGQA 4PLJC 1NEZA 2YXFA 4QXUL 3D9AL 4KK8C 4ONOA 4PJHF 1QYGL 1FFOB 1YEDA 3LEXA 1U8KB 3QDJD 1MVFA 5IG7A 5I76A 4LL9A 4CRPA 1RUAH 5DRZB 4BH8B 4MNQE 1CVSC 1CD0A 4NCC2 3QH3A 3ZYZA 2CXGA 4XPGL 1DUYA 4HUMB 3BW9A 3GSQA 4ELMF 2H3NB 4N8PA 1EFXD 5EU6B 5SWZA 4HLJA 4MDIB 1MUJB 2O5YL 4G6KH 1OLZA 4M7KH 2J5LC 3IETB 4XXDA 2YUXA 4B0MM 1Z6JT 5IFJA 3PWUA 3FOLA 4XCEA 3C5ZA 4KRNA 4ZAKB 1AJ7L 4KXZI 4R2GC 3BD4A 1EERB 4G5ZH 2OSLA 4XX1G 3CMGA 3GSNH 5EOCH 2CDFB 4JKPL 3U4BH 3A6CH 3S5LB 1XCQB 1DUZB 3AAZB 4QTHA 5K9KA 3F6LA 1DLHA 4CBPA 3NCYP 5GGTA 4ODUA 4IRZL 4KI5D 1NAKL 1BVKA 3FQXA 1JFQL 1YDPA 1CD8A 2EE2A 2NXZC 4GG8A 3KJ6H 5DC0A 1J1OH 4TOYH 4WHYG 3OGCB 1EUUA 2BSRB 3E6FA 4K94C 3FQTB 1UEYA 5I1EH 1YEIL 4UIMB 4GS7C 4LEXL 3CD4A 3K3QA 5DEGB 1VFOA 5TDNB 2GEEA 4UNVA 3ULUL 1F3DH 1QLRB 5IFHL 4GO6B 5C0AD 3MRPA 3MLZL 4HK0B 4P23C 5EU5A 1X5LA 3BWAB 2VLJE 2R1WB 4IS6B 3UTSB 4Z7VA 5MHSD 1EZVY 1SVCP 5C2UB 4C83B 3BT2H 1D9KC 1MWAH 4O51B 1DQMH 5DTFB 1Q1JH 1CE6B 3SE3C 4A6YB 1FGNH 3ROLA 1H3TA 1MAKA 4AQOA 1D6EA 4YAQA 3QPXH 3UBXI 5HGHB 3K46A 3TJEH 2R29L 1J18A 1FC2D 4MNQA 4BZ1L 4QT5B 3AS0A 1HEZA 4HJ0D 2VDLH 4OIBA 4QGTA 2CUMA 4QNPF 1J11A 1JPSL 4HPOL 3ZKMC 4XNUH 3BIBX 1BLNB 3O4LA 5F96L 2J7LA 5HHOD 3VDAA 3WD5L 5GGSA 1PSKL 3F7YA 1Y6KR 3DVNB 3TZVD 3FFCE 4HKBA 3U83A 5BRZB 2EDFA 5C07B 4LLVA 3RZCB 4ZUSB 1C16B 1J0IA 2DYPD 3ESVF 3OG4B 5KSAA 4NQCB 5D1ZC 4LHUG 4HMCA 1KCUL 2Z31A 4K3DL 5ERWB 3ECBA 3V6OC 4RGND 5E1AB 3VFSA 1NANI 1IGFL 4PV8B 3GMQB 3QO1B 4LARH 1IT9L 3PGDA 5DO2C 1FYTA 4KKCD 5J6HA 5GRVL 2P8LA 4PJAE 2RJMA 2HT4C 5E5RB 2P43B 2HFEA 1FRGH 1AGBA 5CCKL 1CS6A 4PRPD 3WFBH 4U1JB 3UEZA 5M95B 2HJFA 3SE4A 1F2QA 1KBGH 4QHNA 3MV8E 1YZZA 2Y6SD 4IOFD 1S5HB 3UDWC 3I75B 4YPJA 1TCRB 2BMKB 4XCNB 5FM5O 3VXSD 3CC5B 4LLDA 5GS1B 1GGIH 2CLVA 4P5TA 2W59A 2X4NB 3MJ8B 4NC1C 1EBAA 2CUHA 5T1MB 3T0BA 5HHPA 4DEPB 5SWSD 4LVHC 2C4FT 4EEEA 5E6ID 3QDHA 1C12A 3O3DA 4J8RA 3B2UC 3GHEH 3MCKB 5ALCL 5F7HA 5DRNB 5ACMA 5KTEL 4P2RD 3Q6GL 4E0RB 4N68A 4PJCA 5D7IE 4R4FL 1K2DB 2VLJA 5I1HL 3IDXH 5B3NA 4XCYB 3MRFB 1M71B 1CLOL 1EJOL 4N0UA 1A7PH 1K3ZA 4Y5XA 2G5BB 1Q0XL 4GAJL 4Y19A 1KLFA 3IU4L 3KGRA 1Z5LA 2DM7A 2J6EA 4H1LH 4I9WD 4TTDC 4NUGL 2Y07L 1CR9H 4EI6A 5HGGS 2OI9C 5IEHA 4TNVK 3MUJA 3P4NB 4E41D 5L8JB 2F8XC 3HE7B 5GIRB 4MJ4A 3ARQA 1YEEH 3LEVH 3L7FA 4KRPC 5I66B 1Q0YL 5JR1H 2ZUUA 4ODBD 2NY0B 3BKMH 4GRWE 4OV5B 1DBAH 3G5YA 3PV6A 4JDVA 3RY6A 4WUUE 4Z95L 4CN6A 4OM0H 5ANME 5IB5B 4OT1H 3GMOA 4K9EL 4JB9H 1J87A 1VADB 1GYAA 5DA0B 1JF1B 2DQCL 1MFDL 3B8YA 3TN0D 5I1IL 1NC2D 5IW3A 3AFLA 1U95B 3HUJB 4TVPD 5I30H 1G6RB 3MV8A 3UJJH 4JRYE 5GGRB 1A1MA 4Y4HA 3A6BH 2DICA 3BKYL 5D96C 1S9XB 4WV1A 1WZMA 1WBXB 1ZGLP 4XBPB 5HGDA 3S3SA 3ILPB 4XWOD 4NN5C 3B2VL 4HBQA 3DURA 2GKIA 4J1UA 5HD8D 3KPOB 5I8EA 1UM4H 3QJFB 1H3WM 2LTQC 3PQYD 1RIVL 3BO8A 1HHGA 1RI8A 3TBWA 4HV8A 4K23L 4CN1A 5IMMA 1U8NB 4PGBB 2VAAB 4KI5C 5CD5D 2GY5A 2BDNH 2BXZA 3N1FC 1IZJA 3H42L 5B4MC 4Q2ZB 5HHNB 1Y18B 2CD0A 3RTQC 4MAYC 1OM3H 4U3XA 3QO0A 1P7HL 2Z35B 4X4ZA 4LKXB 4PRNB 3KPRD 2YA0A 3QDJB 3UYRH 5GJTH 1RD6A 3WFCH 1H15B 2X2YA 1MIMH 4GRLA 5DD0L 4TSBH 1WAAF 3VXNB 1OAQH 2BOCA 3WNLA 1EFXB 5D2NE 4K7PX 1L7TL 1DQQB 2MMXA 4YUEL 4LIQL 3K4AA 1R24A 5J13B 5D8JL 5DVNA 3G5ZA 4ZMAT 1HDMA 3OAZK 2VZUA 4JY5L 3U46A 4ZNEE 4Z76A 1MFEH 1HSAA 3C08H 3WS6C 3KJ4B 5GGRY 2BJML 5K9JH 3TWCL 3OHXA 3QYCA 1U8HB 4EI5C 1TVDA 1T03L 4JKKA 3EYOA 2F53B 4GMTH 5CSBA 5JW4M 1WEJL 1XGYH 3V0WL 5EU7E 4YDIH 3IJYB 1MI5E 1BVZA 3EO9H 1AR2A 3U4AA 2YWZA 5EZJB 1IAKB 3HRZB 3LS4H 4RNRA 4NYLA 1T80A 2PN5A 5J4MA 3QAZB 1QLFB 1H9VA 5C9JA 2VL5A 3BZEB 1MCFA 3RU8H 1FZMA 1OGAE 2ZOLA 5C0AB 4NNYA 5DHVA 1ZHLA 3MA7A 1QVOA 4UQ2A 1Q9LB 4ETQB 3QCUL 4KK6D 1U58A 3HMXH 3I6KB 1I3RA 4OQ1A 3R4DA 3FT2A 2FIKA 1IKFH 1I75A 3IF1A 4OZFH 2K1MA 3ZKND 1DQJA 4FXKB 2AJYH 2HP4A 4FABH 4AL8H 4P4KD 1E4XH 1NSNH 2R4SL 1I7UB 1PKQA 2QTEA 2BOBA 3PWJA 4MNHB 3MRIA 2WM0A 4H26A 5BCAA 4I8DA 1LDPH 5D2NA 2BRQA 4Z5RB 1BOGB 3TZVB 4LLWB 2YBRB 5CIPA 1KN4L 2PYED 3RPIB 4K3JL 4DQOL 3ARFC 4EDXB 2UY6A 2DYPB 4W81A 4H88L 4RGNB 4ZNEA 1PFCA 3U9UB 2VITA 1YYLL 1MCHA 2FX8L 4KDTA 4YH6A 3UYOD 3L5WB 1VPOH 5EIIB 4HF5H 1LDSA 3LKSA 3L95A 2VXVH 3QG6B 3LHPL 4ZO9A 2D31B 2V7NB 5CP7A 1QFUL 5IVOA 5C09E 5DQDH 3VXSB 2R0WH 5T3XD 4RBPH 1XGUA 4RFNC 3MLVH 5SWSB 1DBKH 3IJHA 5M7QA 5GZND 3HC3L 5E6IB 3TN0C 3ZTJG 4KMQA 1JBJA 4XX1E 5B38A 1GGYA 1OGAA 4P2RB 1QFHA 3TP4A 1XF5B 4PRAA 5L2KB 5I8OL 5HJ3B 2EEAA 3U2SB 2WBKA 3V5DB 1AO7B 3CH1B 1JYXA 2NY1D 4NBZB 2EEDA 4XXCA 3RVTD 5C0GB 2BVYA 2VXTH 5F6IC 1KCLA 5HDLA 4ETYA 2XT1B 5IR1A 4M7KL 3T04D 1Z0MA 1I8KA 1AP2B 2VO5A 1A14H 3RWCA 5DSCA 1QQDA 1NCAH 1T1WA 3VH8G 1IC1A 4KZDH 4U7MA 3LB6C 4I18C 5HPMA 5J6GA 3U6RA 4G5ZL 1UZ8A 3GSNL 3U4BL 5EFIA 3D39E 2W0KA 4S0SD 5EZLB 3A6CL 4I3SL 3JZ7A 4NN6C 2Q87A 4QXGH 4G8GB 3UTSE 4GKZB 1JPGA 2Z0BA 5D2LF 2A38A 4LGPB 4IRJD 1I7ZB 2NY3C 5LGKA 1RZJH 5IJKC 1FFOA 3OQ3B 1U8KA 1SVZA 2XG5A 3KJ6L 5A16B 4EQ2A 1ODAA 2P8PB 1J1OL 1WISA 2XA8H 4TOYL 5DRZA 4HUXB 4BH8A 4LVNC 1ACYH 3KPTA 2ARJB 4OGAC 5I1EL 2EDXA 1ITBB 3ARBD 5ID1B 4J4PC 2ZG2A 5I0DA 2H3NA 3WHE0 5EU6A 3P4OB 4MDIA 1MUJA 3DGCR 2GJ6B 4GFTB 4OQTH 3L1OH 4PJBF 3CXDH 3IETA 4OLXH 1NCTA 5DMGC 3RPKA 4G6AC 3PQYB 3PE9A 5D1QB 4NKOB 3BT2L 4ZAKA 1MWAL 3I84A 2H2PC 1DQML 1CGUA 1Q1JL 4WHYH 2B1HL 2CDFA 3QPXL 4HUVB 1JGVH 4HWBH 2GSGB 1XGPB 3D2UD 3S5LA 3TJEL 4HK3J 3EJJX 3DUUB 1KB9J 1DUZA 1XCQA 3EJZD 2FJHB 3AAZA 2VDLL 5HVHB 1BEYH 5MI0C 2NXYD 4ENED 4XNUL 5E7BA 3RGHA 2BY1A 4CU6A 1IQDA 3PL6D 3HAEB 4LCCC 3S96B 3OGCA 1FORL 1D5ZB 2BSRA 3KPRB 5I75C 3FQTA 1KG0B 5HYSB 5DQJB 2QHRH 3F12B 3UJIH 4UIMA 3DX6B 5I1GH 1VENA 4OIAA 5DEGA 3FO1B 5TDNA 3T0EC 5E2WH 4I48B 4LARL 1QLRA 3C9NB 4HK0A 3MGTB 4KQ4H 2FATL 4LPVA 3SDDB 1GVIA 4QOKE 4IS6A 5IVZB 1FRGL 3UTSA 4M6MH 4X6BB 3WFBL 1DBMH 3BMVA 1KBGL 4C83A 4O51A 3KDMB 5DTFA 1CE6A 2J2ZA 2CO7B 4A6YA 2OL3B 2XWBB 4K71C 1LNUB 2WBJD 5HGHA 2WLZA 3LN9A 1AQKL 43CAB 4Q6IC 1O7VA 1GGIL 5I9QC 3RDTD 1MPAH 4QT5A 4X80H 2HTLD 4KJQC 3CAFA 3RL1B 3MUGB 3ARZA 1EAPB 1BLNA 1FE8H 1QEWB 3GHEL 4RGOH 3OTTA 3MYZA 3IB4A 3DVNA 1MCOH 4GQ9H 3FRUB 5BRZA 3LV3B 5F44A 5C07A 4JHBA 4OD3L 3RZCA 2V9RA 4ONHB 4ZUSA 1C16A 1RQ5A 3IDXL 2AJVH 2QHLA 3QEHB 4NQCA 1MFBH 1A7PL 5TQ2L 1NCDH 4FQ2H 5ERWA 4JKLA 4O2CB 5E1AA 4U3HA 1ZEAH 4YNYB 4PV8A 3GMQA 3QO1A 4HH8A 1VEMA 5E4EB 2YMXH 1XIWC 2QQQA 5DUBB 3G08B 3HUJE 5HGBB 1S9WB 5EBGA 4U1JA 3IDUA 2ZNWA 3N1MC 1S5HA 4XT1C 3I75A 1YEEL 1FLTX 1TCRA 2BMKA 4XCNA 1TZIB 4HGWB 3BD5A 2F58H 5GS1A 5ALBH 2X4NA 3MJ8A 2VXQL 3BKML 4HFWB 5T1MA 2I5YH 1DBAL 4JPWL 2P5EB 2YPVL 4R0LB 4OT1L 3H9HB 2WQ8A 4U1LB 4P4KB 2B4CH 4F9PA 5GRZA 4JB9L 3MCKA 1U8IB 5DRNA 4E0RA 4JM2B 1K2DA 3G9AB 4GH7B 4XCYA 3CFCH 1M71A 3MRFA 5I30L 2PYEB 3MRLB 1IGJB 2EDTA 2A77H 4Z7OE 3LOWA 3UJJL 2G5BA 1N64H 1SBSH 3QDGE 2J8HA 3CVHB 3K2UH 4OF7A 4G7YH 4P3WA 1KJVB 7FABH 4M9OA 1ZK9A 3P4NA 5TPWH 3P77B 3HE7A 4BQCA 1TZGL 1UM4L 4WCYH 4X7TB 5FM5M 3BP6B 4PJHE 5GIRA 5F7LB 3O8XD 5BJTB 4LMQE 1UACL 5DJXB 5I66A 2M1KA 1J5OL 3EO1A 3DECA 4CMHB 4OBRA 4OV5A 5CZVH 5IB5A 3UPAA 1U8JA 4Z0BH 2PXYD 4J23A 4N5ED 2Z8VC 4IRJC 3FZUD 2BDNL 3LKNA 5JMOC 1VADA 5C0CB 5FCUH 1JF1A 5KVDL 5CSGA 3FFDB 3GSOB 5L8KB 3NA4A 3HUJA 1U95A 4XTRD 5C0FB 2Z9TA 2KH2B 3KYMB 4ZUWB 5GGRA 3UYRL 5GJTL 5IROC 3GB7B 3WFCL 1G7IB 5CAYB 1S9XA 2NY1B 4YJZL 1MIML 2RHEA 4KGLA 1WBXA 4XBPA 3ILPA 3DSNA 2F53E 2IC2A 4KHTL 1MVUB 3KPOA 3GMRB 3KXFD 5D1XB 3QRGH 2R23B 3AM8A 1OVZA 4PG2C 4XVTL 5FYLE 5D7SH 1RMFH 1MFEL 1JIBA 1U8NA 4WEBH 5E94B 1X6NA 1UVQA 4PGBA 3O6LL 2NXYC 2VAAA 2EIDA 2XACC 4NWUH 3UTQB 4IOSD 1V7NH 1H5BA 2E27H 4Q2ZA 3PL6C 5HHNA 1Y18A 3OZ9H 3H9YA 3PNWA 1AIFA 4GMTL 1XGYL 1OQOA 2Z35A 4OF6A 1DDHB 4YDIL 4PRNA 3QDJA 3T4YB 3O2VH 3EO9L 3VFOB 3VFVB 2X5PA 1H15A 3D18B 3CU1A 3U9PH 1JGEB 2CSPA 5H2BB 3LS4L 1NKRA 2AJSL 3NZHH 3ARBB 1FFQA 5BVJB 3FAWA 3VXNA 4JHWH 1VFMA 4P99A 1QHPA 1EFXA 3RKDC 1DQQA 2XWJB 3RU8L 3NCFB 3ULUC 3OR7B 3HNVH 4DKEH 5DQ9B 1SYSB 3NIGF 2HMID 3OAZH 3HMXL 1QLEH 2LVEA 2XTJC 1R6VA 3HNSH 4NZDA 3OKKB 1DLFH 1IKFL 2ATPB 2YHGA 1O7SA 3D2UB 1EX0A 1IAOB 2D0HA 1XCTB 2AABL 4FABL 1U8HA 2I24N 4AL8L 1E4XL 3HG1E 1NSNL 5CZKA 5MP6L 5AG9A 1XGRB 4NN7B 4RRPG 4JY4B 1LDPL 2F53A 2ITDB 3M8OH 4HLZH 4HUWB 4FFVD 3IJYA 3SGJC 1MLCB 3VA6A 3UTZB 3QFJE 5EZJA 1IAKA 3T8XB 5FUCC 3V4VH 5HYJE 5CJXA 3HRZA 2BC4B 1QLFA 3HB3C 3HTLX 3KPQB 2XA3A 4TN9A 3OV6A 3BZEA 3GKWH 1NAMH 1NMAL 4M4RA 5C0AA 5L2KE 4Z7WB 3FB6B 2MNUA 4HF5L 1CICD 2J88L 4X9BA 1Q9LA 1AO7E 2HT2D 2VXVL 4ETQA 4WFEE 4PB0H 2Q8BL 4M48H 1OB1B 3I6KA 5K33A 1LE5B 4HS3B 2WBJB 4OD1H 5DQDL 2R0WL 2XKUA 2VZTA 1WFUA 2ERJB 3RDTB 4FXKA 4Y89A 1Q9OB 3MLVL 3QEQB 2RR3A 1DBKL 1I7UA 5BV7L 3RQ3A 2VDNL 2LVCA 1MJJB 4JAMB 1ADQH 4Q9CA 4CU8A 4Z5RA 1BOGA 3TZVA 4BFBD 2YBRA 1CN4A 1FNHA 3RPIA 5JA9A 2IBZY 5C2BH 4EDXA 1IEBB 1A3RH 1A0QL 4MHHI 2YRPA 1G9NH 1VEPA 1NMBH 4G8GE 4JLRB 3U9UA 2Q7YB 4M5YL 2FRGP 3IFOB 5CBAB 4TQEH 3WNKA 2VXTL 2J12B 3O8XC 5EIIA 5MEQB 4XHJD 3ZTJH 1A14L 3QG6A 2FO4B 3SQOH 2V7NA 2QADD 1NCAL 4Q9RL 5IBUB 4KZDL 4BQ6A 2V5TA 3V0AC 5EBMB 2PXYC 5HDQH 3MRQB 1SMAA 3EOTL 5SWSA 3ZDYE 3FHAA 2W9EH 4ZTOH 1X3DA 1WCQA 5E6IA 4QXGL 5C0BD 2BSSB 3B9DA 3C2SA 4E9LA 4P2RA 4UT7H 4F15B 3RI5F 3VG0H 1U36A 1XF5A 1RZJL 5L2KA 1NUNB 5HJ3A 1KTKE 3U2SA 3V5DA 5TDPB 1AO7A 1M7IB 1WBYA 2XA8L 3CH1A 4LNVA 1ACYL 1E4XI 2HRPH 5C0GA 1OAKH 2VKXA 4OFKA 3D6GA 2LU4A 4OQTL 1QSVA 3L1OL 1AP2A 3CXDL 5I73C 3W5NA 4L1DA 4M1GH 4HJJH 1EBPA 1NFDE 4UTBH 2X4RB 5IT2H 3DO7B 2MQCA 1ZHKB 1JGVL 4HWBL 1Z9LA 5EZLA 1RIHH 1WT5C 2ARJQ 3MZTA 2A83B 4K7PH 4G8GA 3VDBA 4GKZA 2VE6B 2OBGA 4JQXC 1BEYL 4JFED 3QUYD 2YPKB 3MRCB 1I7ZA 2DQUH 3FL7A 5A16A 2P8PA 4LCUB 4BSVB 4HUXA 3E1F1 2ARJA 4EUPH 4FA8A 3AUVA 3UJIL 5ID1A 5I1GL 3T0AA 1OY3B 2EC8A 5D9SB 5E2WL 1JRHH 4JFZH 1J0HA 3P4OA 2GJ6A 3RJQB 2WBWB 4KQ4L 2AV7B 3QB7C 4G8EB 2HMIC 4YO0B 3TO4D 4M6ML 3PQYA 5D1QA 1AGFB 1H3XA 2CLRB 4I0CC 4NKOA 1DBML 4Y4FA 5EPMB 3D48R 1TETH 5JQ6H 4HUVA 3BGMB 2GSGA 1FG2B 1XGPA 1ZA3B 4H0IA 4KDWA 3DUUA 1MPAL 4X80L 2FJHA 3E3QC 3M07A 3VXPB 3PDDA 3NFSH 2W1NA 1X4XA 4PUBH 4PYHA 4ZOBA 1FE8L 4RGOL 3O41B 1MCOL 4GQ9L 3DUSB 4LPXA 3HAEA 3ZMRA 3SO3C 3QNYB 3S96A 3KPRA 1D5ZA 2CRIA 2AJVL 3GJFB 3SOBH 5C6PB 1MFBL 2DIBA 5HYSA 1NCDL 2P5EE 4FQ2L 3F12A 5DQJA 3V6FB 2DD8H 3DX6A 1UQSB 1PLGH 3FO1A 1ZEAL 3P30H 3Q6FB 1JGUH 4I48A 1KEML 1CICC 3C9NA 2YMXL 2H41A 2Y06H 2HT2C 3MGTA 4Y2DC 3LVEA 3SDDA 3QIWA 5B8CB 5IVZA 3QDMD 1YEJH 4X6BA 1UXWB 2CRZA 1DANU 5F93C 4NO5B 4C4KO 5FYJU 1INQB 3KDMA 4DKAA 3PGFH 5FGSA 2OL3A 3F7QA 2XWBA 1LQSR 1LNUA 1A6WL 3X12B 2F58L 43CAA 3QUKB 5ALBL 5SX4H 1QPXA 5A3ID 4PJXB 1JTPA 2LFGA 2I5YL 3O4OC 5C0IB 4NQED 4YWGH 4Y4KC 3RL1A 4M8VA 3MUGA 1PJ9A 1KJ3H 1EAPA 4HWZB 1QEWA 2R1YB 5BMFH 3N85H 4KWUA 3WJLC 2BZDA 3FRUA 1JL8A 3LV3A 4NJAH 4XBEL 2OCFD 4ONHA 3NPSC 2EKJA 4GXVL 1WIPA 3CFCL 1YA5A 1RURH 3QEHA 2AXFB 4JG0H 2MSPA 1N64L 4NRZB 4O2CA 1CF8H 1SBSL 4FFYH 4RAVB 4YNYA 3K2UL 1CGVA 3ZSSA 4MZ3A 5C0CE 7FABL 1JPTH 5DUBA 3G08A 1S9WA 4Q58C 3RVUC 4N1EA 1F6FB 3P9LB 3PHOB 4OCYH 4LLYB 5TPWL 4MA8H 4WCYL 4YFLF 1MJ8H 2QR0A 3H3BC 1ZVHA 4NO2B 1TZIA 4JDTH 1J7VR 2D0FA 2JIXD 1RJYB 3ARED 4HFWA 3DVFA 1MELA 4IJ3B 5JTWA 2P5EA 5CZVL 1JI1A 4R0LA 3WO3B 1EGJA 3H9HA 4U1LA 4P4KA 4Z0BL 3QHFL 4HAFA 3WIHH 4KI5F 1U8IA 1KB5L 1KFAL 5E56A 4JM2A 5FCUL 1IEAB 3LD8C 3MRLA 1IGJA 1RJCA 3HPLB 3HI5H 5BW7A 5IHZB 3CVHA 2AEWA 4Z78B 2CJUH 4YDVB 4A2LA 1KJVA 4OJFH 1FAIH 4HKXB 3CVIH 4GG6B 2X70B 3P77A 4X7TA 3BP6A 1MCQA 3QRGL 4PG9B 3WN5B 1UGNA 4C56D 5BJTA 1I8IB 5DJXA 2QADB 3U82B 5D7SL 2VERN 4KY1H 4WEBL 3RI5K 3L9RB 4FHBD 3QUYC 4UV4H 3ZT6A 1FSKB 1YY9C 2HFFA 4WW1B 5C0BB 2EXWC 4PJBE 5HDBE 2E27L 5D7KE 5C0CA 5GS0H 2G75B 3OZ9L 1LP9F 4M1CD 4R4BB 5IQ9B 3FFDA 4F9LC 3GSOA 1TJGH 5C0FA 3BJLA 2L7UA 3UAJD 4XNXH 4MB5A 4PJEF 3CX5K 2UWEB 3KYMA 3O2VL 3QUMB 4ZUWA 4ZFZB 1ZLWK 4AH2B 1AC6A 1HYRC 4AJ0A 1G7IA 4PJIB 1KENH 3U9PL 3RKPA 4D9RE 3GSVB 1MHEB 1ERNA 4JHWL 5J11B 3KG5A 4L8BB 3TO4C 1NCNA 1S7TB 3JUZA 1N7MH 1EVTC 3GMRA 3BXNB 5D1XA 2R23A 3BISA 4OF5A 1L0YA 4DKEL 1BJ8A 1LO4H 3LEYH 4MA7H 1BJMA 1QLEL 5E94A 2F54B 2V2TB 5ICXB 4AY0A 1DLFL 2EE6A 1JN6B 3E2HB 2YUVA 5CUSH 5DK3A 4D3CH 3STLB 1IM3B 5IHUH 3MSPA 1NFKA 1RZKH 3UTQA 2IAMC 1OP9A 3UTTD 1S7SB 4ZUVB 4JFEB 3GMNB 3PGCB 5KVEL 2PW1B 3MGAA 3M8OL 4ODXB 3BPNB 1DDHA 1LVEA 3T4YA 3TJHD 3FB7B 4OUUB 4JPKH 1B0WA 1YUHB 3VFOA 1CL7H 3VFVA 1M6OB 3QEQE 3V4VL 3D18A 1DP0A 3ARVA 1JGEA 2XQYG 2VOTA 4OCMC 5E99H 5H2BA 3SCMD 1TCMA 3TIEA 3ARBA 5BVJA 3MRDB 1I1CA 2CIIB 3IS0X 3MLUH 4XHQA 1M4KA 2D9QB 4JFHE 3QBTB 2XWJA 3KYAA 4WFGD 5EIQA 3WNNA 1NAML 2ICWJ 2NW3B 3HCVB 3OR7A 1KJMB 4JEGB 3BUYB 5DQ9A 1SYSA 4L8SB 4PB0L 3NZ8B 4M48L 3VGBA 4FXLA 5A3IC 3Q0HA 4NQVB 2GFBA 3OKKA 2DKSA 4FQCH 1TTFA 1RUQL 2ATPA 4OD1L 1KCSL 3GMPB 5DFVD 3D2UA 3MRMB 1IAOA 1FDLH 1XCTA 5EZOH 4L9LC 4TRPL 4NQTA 1HHJB 1JVKA 1VGEH 4RRPA 5J56B 3JUYA 1JV5B 1XGRA 3W11C 4AZ8A 5A43C 4JY4A 1ADQL 1HXMB 3ILQD 2ITDA 2MPAH 4L3ED 2JELH 1KN2L 1T6WA 1MLCA 4S11A 2EYRA 3UTZA 5FV2A 4D9QD 2ZOKA 1HKLH 1K9TA 3MPCA 5EH1A 5C2BL 3T8XA 1A3RL 4LMQI 1WWCA 3EOAB 4ERSH 1MOEA 1EHAA 1NMBL 2BC4A 3JVGC 3LRGA 1EO8H 4DAGH 3KPQA 1F90H 4LBEB 4TQEL 4TUOB 3BFOA 5FGCB 5C0RH 4OCLC 3FB6A 4KFZC 5C8JB 2APTA 3OKOB 5D70H 3QDMB 4N0CD 1QRKA 3FQRB 3AREC 1CXFA 1OB1A 3RAJH 4NO3B 5IWLC 1VGKB 5I71B 1LE5A 4HS3A 2WBJA 4LFHG 4D2NA 4MCZB 3V7AG 3RDTA 5HDQL 1V3KA 1Q9OA 4KTYA 3QEQA 4U7SA 3VI3E 4OI7A 2JCCF 1HIMH 4NQEB 4ZTOL 1ZGLM 5F7DB 1I3UA 1MJJA 4JAMA 4DUXA 1W0VB 2HA1A 3PHQA 3NBNA 2YEZB 4D9LH 2YD3A 1XF2B 4R4NC 4G6JH 4QKXB 3OF6D 4HMEA 4KKBC 1IE5A 5SV3A 2HRPL 4JLRA 1OAYH 5HTSA 3IFOA 5CBAA 1V5JA 1G9MC 2E8ZA 5F6HJ 5MEQA 4YQXH 1IC7H 1PY4A 1WWAX 4NQDB 1A2YB 5C0JB 3QXUA 5EZIH 3L5HA 2FO4A 2HLFD 5CZXC 4PGJA 1FFNB 1CDHA 1UB6B 3WDHA 2AQ3A 3REVB 5EBMA 4LSTH 5IT2L 1I1YB 2IADB 3BIKB 3OBAA 4LHQB 3MRQA 3U7AA 4P46D 5FYKE 1JF6A 1RIHL 3QNZB 4M1CC 1Y0LA 4K7PL 3MTRA 2BSSA 3HE6D 1YJDH 4LEOB 1RZ7H 1Y6MR 3KPSD 3ZE1E 2DQUL 1B2WL 4NO0D 1IAIH 4X5WB 3H6JA 1IRAY 3MREB 5TDPA 2FBJH 3I6LE 5DHVH 1TJIH 3S36X 1YQVH 2X9YA 4LOUD 4HWEH 5GPRA 3EZ8A 1KIPB 4EVNB 4EN3C 4OCSH 1JRHL 4JFZL 4WI2A 3G5XB 1XZ0B 5E8PB 3W0WD 3MJ9H 3SGDI 5C3TA 1TETL 2X4RA 4NKDB 2OP4H 3DO7A 1ZHKA 4U1IB 2FYYB 3B9KC 3L3GB 3LKPA 2A83A 2EC9U 2E9IA 1NUGA 5I74C 2VE6A 4OCXH 1GPOH 4LCWD 1AGCB 2YPKA 3MRCA 3NFSL 3HI1B 4PUBL 5FEBA 3TJHC 5CP3H 1T66D 4F7PB 1FZJB 1IM9D 3MC0A 1L9NA 4X5XB 5FYKH 4OLZL 3NIGE 4X99B 2ITCB 4LCUA 4BSVA 5KW9H 2UZIH 3SOBL 5I17A 3KWWB 2GTZB 1PLGL 2Z4QB 5D9SA 2ZUVA 3A0OA 3P30L 1JGUL 4KDVA 3ZHDA 1TPXB 1SJHB 2Y06L 5T3ZD 3P40A 4G8EA 4YO0A 4JGJA 1YEJL 1AGFA 3JWOH 2FEDC 5EPMA 1FGVL 5DFVC 3MODH 1MJ7H 3E8UH 4K7FB 4MZ2A 3BGMA 5CEYA 4Z7QE 3EYSH 1ZA3A 2JTDA 3EUUA 2ZUQB 3ILQC 4YWGL 3VXPA 4WENB 2CK2A 1IL1A 1GGUA 1F00I 3SDAA 3UTTB 3TCLB 1F5WA 5BMFL 4AEHL 1BQLH 3N85L 3O41A 3DUSA 1FNLA 3SDXF 3UMTA 1MCNA 3QNYA 4BYHA 3ARPA 1RURL 3GJFA 4LU5H 4JG0L 1JUFB 5HHXH 3V6FA 3TEUA 3TIDB 1UQSA 3SGKC 1CF8L 3SCMB 4FFYL 4XPBH 4YE4L 1BVLB 3Q6FA 4U2ZA 3PJSB 3LPGA 1JPTL 3KNBB 3W9EB 4MNGB 1OD7A 1HQRB 5B8CA 4IM8A 1EVUA 2FWOB 2FR4B 4OCYL 4NO5A 4MA8L 3UTPE 1MJ8L 5EC1B 1INQA 3AMKA 4JDTL 1A47A 2VJXA 3X12A 3U7WH 3VDCA 3QUKA 5GS2D 5GGQH 4PJXA 1JNLH 2P45B 5I8CB 4PY8J 2G5RA 5C0IA 3FN0H 3A67L 4LQ1A 5KANI 4WW2C 4M7LT 3ULSB 4HCRA 4W4NA 2X7LB 4HWZA 3WIHL 2R1YA 5IVXB 1JI2A 2A9NL 2YPLB 1DQLL 1QRNB 1YPZB 1GXEA 5KS9B 3ETBF 3LPFA 3VGAC 4HUKB 5JNYB 2FGWL 3D85D 2DQJL 2AXFA 4NBYB 1KCKA 4MA1B 4KPHH 4NRZA 2P48B 4RAVA 5JOPD 2NR6D 4X7SL 4GBXB 3UC0H 2X1QA 5FOJA 4WY7L 1QA9B 4OJFL 2GUOB 3F62A 5JUEH 3CVIL 1V8HA 4RMTA 3PHOA 2CLZB 3IKKA 4LDLB 5A40E 4WFHE 1K6QH 3RUGB 4NO2A 4YDLB 4J3VA 4G9DB 1UJ3C 3PWNB 4KY1L 2PNDA 4HDIB 1X44A 4UV4L 1J8HB 2IAND 1XT5A 3IDNB 4JHZA 1HHIB 2Y5EA 5DT1H 1UA6H 5I19H 3BD3A 5GS0L 1IEAA 4A2MA 3PV7A 3O3UN 1TJGL 2F54E 2VMFA 4XNXL 5SX4I 1LEKB 3CFIC 2NY5H 3HPLA 4LASL 4DJMA 2JJSC 4I0KA 2OTUA 2AW2A 5IHZA 1KENL 1OSPH 4Z78A 3H8NA 4YDVA 2MQ0A 4XAKD 5GRUH 1SY6H 4HKXA 4GG6A 4Z7WF 5EORH 3O6FD 1N7ML 1S7VB 3CDFA 2X70A 5E5UB 4NRXB 5JW4Q 3TBTB 5KVGL 4PG9A 4QRRD 1I8IA 3SKNB 1GGTA 1LO4L 4MA7L 1RHFA 1W72B 4PR5B 5HHMB 4ZFOB 1FZOB 4HKJB 4WI3A 4XP1H 4JVPA 3L9RA 2W65B 5E7FA 5CKGA 5CUSL 4P46B 4D3CL 3V6OE 5IHUL 4JN1H 3FO9B 1RZKL 4WW1A 2G75A 4R4BA 5GGVH 1DEEB 5IQ9A 3HE6B 4K94H 4P2QD 3ARSA 5FDYA 3KPSB 3GBNH 1GSMA 5TH2B 4EKXA 2UWEA 3QUMA 4JPKL 4ZFZA 1PG7W 3VD5A 2Y9RT 4AH2A 4P2OC 4K8RH 1CL7L 4PJIA 3EDDA 3TM6A 4R26H 4OF3A 1DSFH 5E99L 3GSVA 5FO8B 1MHEA 2X40A 1EEQA 2BY2A 3MLUL 1BIIB 3GHBH 4L8BA 1IVLA 2DKUA 1NBZB 3S35L 3BXNA 3QCVH 3W0WB 1MFNA 3SEPA 4MMXC 5IW6B 4ZOEA 2NX5D 4MXQD 3ALXA 4Y8AA 2F54A 3VD9A 5ICXA 2V2TA 4FQCL 3STLA 1FDLL 1IM3A 2XRAH 5EZOL 2KZWA 4XBGB 5BXFB 1MHPH 5JA8B 1TIUA 1VGEL 2AK4D 4OD2B 3STZB 4BFGA 1S7SA 3GMNA 4P5MB 3PGCA 4NKQB 2MPAL 2JELL 1IM9B 5K59F 3FB7A 4OUUA 4Z6AT 1YUHA 3B43A 1HKLL 4KK5C 2XKSA 1IEHA 4L4VE 1M6OA 1CE1H 3BN9C 1P9MA 1VFBB 4ERSL 5FDWB 5IM7B 2KPNA 3MRDA 1LMKA 2CIIA 3MCLH 5ESQA 1EO8L 3MV7E 4DAGL 3HMWH 3MLRL 3MNVB 2B5IC 2E9WA 2NW3A 3HCVA 2IMMA 3Q5OA 5C0RL 1KJMA 5D70L 1T20B 3CLFH 4LK4A 1U42A 3BUYA 3QULB 1CXEA 3VXRD 4L8SA 3NZ8A 3R0MA 1MQ8A 4PJ5D 3RAJL 2BY3A 4WU7B 1NCWH 3GMPA 1UJTA 4PS4H 5H37H 1AXTL 1B4JH 3UDWA 2P5WD 3MRMA 1EFQA 1G6RH 4NZUH 2BNQE 1HHJA 4NQDE 1HIML 1T83C 3EW3B 4XVUD 1JV5A 3RP1A 1HHKB 4YBQD 1HXMA 1S7QB 2B4CC 2BVOB 5LCVH 4CKVX 2HLAB 3GGWA 3F6IA 2HWZH 3B8SA 4G6JL 3T3PF 3EOAA 1MRDL 1U92A 2YD5A 1T1YB 3DROA 1OAYL 4LBEA 2LQRA 1EO7A 1C7SA 4TUOA 5C8JA 4YQXL 1IC7L 3OKOA 2C3HA 3IFPB 4YK4C 3QDMA 5EZIL 3C5JB 3ROOB 3FQRA 1CL7I 1MJUH 1G0XA 4WNQB 4FQXD 4QY8B 4MAUH 4ZO7A 4NO3A 3UBXB 2WSKA 4DUVA 1VGKA 3SE8L 5I6XB 3GSWA 3I9GH 4LSTL 3UBXG 4MCZA 1K4DB 4F37K 4D0DA 2ZCHH 1IKNA 3AB0C 3MA9H 4NQEA 5E8EB 3MCG1 2WV3A 3L3OB 1J0YA 2DI9A 2FLRT 3KVQA 1W0VA 3EHBD 3F58H 1DR9A 1N6UA 1N6QL 3U0WH 4HS8H 2EH8L 1YJDL 4QHMB 1RZ7L 1A6UH 5HI5D 2YEZA 1IAIL 3BAEH 2DI8A 1XF2A 2FBJL 1KIRB 1TJIL 1LO2L 5DJ6B 1YQVL 1CDCA 5B3JF 4HWEL 1S9VB 3IKCA 2F5BH 5CHNB 3O6FC 1J0KA 2KL6A 5EOCJ 5DA4A 4OCSL 4G9FD 4KGJA 4NQDA 1A2YA 1VSCA 1LP9E 1JP5A 3J7HA 3OKEB 1C1EH 3MJ9L 4TUKH 4NWTH 1FFNA 4PJEE 3QI9D 1UB6A 3REVA 4NHCH 5LWYH 1GC1L 5A1AA 5JDJA 1GAFH 2OP4L 3MRNB 2IADA 3BIKA 5MERB 15C8L 1PQZB 4PJXF 2CK0H 5C08D 3BEVB 3QNZA 5CWSB 5IFAH 4UB0H 3NN8B 2BNRB 3EYQD 4OCXL 4ELKB 3WO4B 3C8DA 3GEWB 4LEOA 4PRPE 5DXWA 1QBMH 1KXTB 4KROD 4X5WA 5FYKL 3HC4H 1C5BH 3MREA 4AEFA 4JFFE 4LSQH 3TCXA 5KW9L 2UZIL 3LQAH 2X89D 5JW5B 3PWLB 4PJGF 4LQFH 4NNPL 3G5XA 4IOIB 1XZ0A 1FL5A 4TYUA 5E8PA 1LO0H 3GSXB 4LPWA 1CIDA 3TT3H 4JZJB 1DEDA 3MXWH 2XZCH 3JWOL 4QRRB 2DJUA 4NKDA 3MODL 3ARWA 4QXTB 1MJ7L 3P0YH 3E8UL 4U1IA 5D5MB 3FO2B 2FYYA 3EYSL 1BZ9B 1VEOA 3PP3K 1NL0H 3R06B 4WEUD 1AGCA 3ARDD 3HI1A 4F7PA 1MCJA 4WFFE 4X5XA 4P2QB 4BK5A 4FFZH 3MJGX 2ZZUT 4X99A 3OWEA 1LK2B 2P49B 4NC0B 2ITCA 4J7RA 4LU5L 2J8UB 3KWWA 5HHXL 2Z4QA 4ZXBD 4XPBL 2WWMD 5IVXE 3RVXD 4LPUA 3ZYIA 3QWRD 1SJHA 3L5IA 2KDGA 4UZGA 2EDKA 3ZTNH 1IAII 1QRNE 4P3DB 1K8DB 3PWPD 4DN3H 2ZUWA 3JV6B 1GHFL 1QFWH 1N5AB 4WRLA 4ZS7H 5HHQB 1G1YA 2E7LA 3Q1SH 3TC9A 4K7FA 3MRRB 2X4UB 3OKYA 1R3LB 5GGQL 4LRIC 3QNXB 4PGDB 4WO4D 1GZPB 1OARL 1RK1B 2JJWA 3FN0L 5F7UA 2AJ3B 4I4WB 4K3GA 5DJYB 3SDCB 5DMIL 2IWGA 3UTTA 1QUNA 3RUGE 2F8OA 3TCLA 5L2JB 4WU5B 2F8VA 3NAAH 4WTZG 4X9HA 1CVRA 2DLHA 5F88A 4U0RC 2AK1L 4CAGA 1P53A 1E4KA 1JUFA 4G43B 4KPHL 3TIDA 1JZ5A 2AXGB 3SCMA 3AGVA 1BVLA 1H3UA 4ZOAA 1I1AC 2JCCE 1G9NC 3PJSA 5CMAB 3KNBA 3W9EA 4MNGA 1HQRA 5JUEL 2FWOA 2FR4A 2EDEA 4HEME 5EC1A 1B0RB 5FYJE 4POZC 4PJ5B 1KJ2H 3VD4A 1G84A 4G8IB 3T2NH 5I8CA 2P5WB 1QFPA 2H45A 4G3YH 4KJYA 4LSUH 5BS0D 1DQTA 3EHBC 2NYYD 3ULSA 2X7LA 5HI5C 1KC5H 5F7FA 5FGBC 5IVXA 5DT1L 2YPLA 3CFDB 2CQVA 1QRNA 1YPZA 4JRXD 5HHME 3B6SB 5CLWA 4KQ3H 4XP6H 3IDMB 5LGHH 5JNYA 3P9WB 4AG4H 2VDMH 2GI7A 2FGZA 4M3JA 1OSPL 4GBXA 4X8XA 1QA9A 5GRUL 4FQPA 1A6PA 2GUOA 1SY6L 4JFDB 5EORL 4U1NB 2CLZA 4UU9A 5DC9B 2CDEB 5DJ8B 5ICYA 4PJ7F 3LMJL 3RUGA 4KZEH 4FQXB 1FZKA 2LAGB 3S36H 1XF4B 1HYSD 3PWNA 1AKJD 4MNQD 4HDIA 1WZLA 1IZKA 3HAEH 1U8OA 1MCWW 1J8HA 4OFIA 4JN1L 4O9HL 3P4LA 4KROC 3IDNA 3T0EE 3WV0A 4C4KT 2GW5A 2OTWB 5GGVL 2A1WH 4K94L 4K3HA 4KRLB 2ENYA 1LEKA 1F8TH 4PRDB 2XY1A 4ISVB 3OF6A 4Q9QL 4LSPH 5IJKA 2D7TH 1DSFL 3GHBL 3G6JE 3CK0H 1M1SA 1QACA 3GRWH 4G9FB 2PW2B 3VG9B 1S7VA 2R2EB 3GI9H 4NRXA 3TBTA 3VW3H 3JWNC 4ODHH 3SKNA 1F4YH 5A2KH 4PR5A 3QI9B 1W72A 2X9XA 3VI4F 4ZFOA 3VFMB 3X14B 3U0TB 1A64A 1RUKH 4HKJA 4G6FD 1MCDA 4XVSL 3MLPA 1OCWH 2W65A 1AR1C 3DRQB 5C08B 4P46A 3UCRA 3ARDC 3O2DA 3QDAA 5TE4H 2XRAL 1MHPL 3FO9A 3KPNB 5EU4B 3VWJD 3VGEA 1HQ4B 1T0PB 1X9QA 4R7NB 3IDYB 1TQCC 5F7NC 3RL2B 1DEEA 3HE6A 3ZL4H 2VLJD 3KPSA 5TH2A 3V79C 4CDGC 4BH7B 2DWDB 5JIKA 5IBLD 5A2IH 4YHPB 3WDIA 5ESAB 1CE1L 2ZWLT 3W9DB 5IMKB 4U7KA 5TFSH 4WI7A 5FO8A 3MCLL 1UM5H 1BIIA 3ZT7A 1KEGH 1MCSA 4HG4K 3D87B 5LAXB 4ZPTB 3SKMB 5GZOC 1NBZA 4Y2OA 3W0WA 2Z92B 3KLSA 1F58H 3QHZH 5IW6A 5BQ7B 3CLFL 3SDXE 1P84K 2OZ4A 2A6DB 3FFCD 5IW1B 2JB6B 3QXDB 3C6LD 4LP4A 1ZANL 3MNZB 43C9B 4MD5B 5DRWB 4C55A 4PJDB 4PS4L 3F7RA 2BVTA 5BXFA 1G6RL 4XBGA 4NZUL 1A3QA 5CBEB 5AEAA 1IGIL 4OD2A 1WF5A 4RZCB 5AZEH 3G6JA 1KGCE 4MXVE 4P5MA 3ARDB 3ULVC 1E27B 2RCSH 3VFGH 5ILTH 1J88A 1OL0A 3C87A 1IM9A 4U6YA 4P49A 2X6MA 4ZS6C 1CXIA 4J6RH 3MV8D 4XPTH 4Y4HD 2HWZL 1CGSH 3QG7L 4HH9B 4LDEB 5FB8B 5FDWA 3C60B 5IM7A 4AMKH 1BQSA 1MAMH 4ZXBB 4RGMC 3MNVA 4PTUB 4JFYB 3C5ZC 5T3XH 2WMPA 1I1RA 2E3VA 1T20A 3BZFB 1E4JA 2NY2C 3I50H 1MJUL 2JJTA 4MAUL 3OKMB 4E42B 4GSDH 5FAAA 3OG6B 4IDJH 5FUOH 3MFFB 4BFIA 2L7JA 2UVEA 2ZCHL 2EYSB 4CADB 1MFAH 1MIEH 4WO4B 1MEXH 1EEZB 3MA9L 1IC4L 2NY4B 2J4WH 1HHKA 1S7QA 2BVOA 4HS8L 5KVMC 1AGEB 1A6UL 2HLAA 4DN4H 3FQNB 1CGTA 3NIDE 1ZLUK 4L1HA 3VJ6B 1K3IA 2VXUH 1N3NA 3OJ2C 4YHIB 1FO0L 1T04B 1ED3B 1T1YA 2IPUK 2BNRE 2F5BL 2Y23A 3FTGB 4WUUD 1RIUH 5GRWA 1CK0H 4N90E 5HY9B 3IAQA 3NACH 3UPRB 4HX1B 6CGTA 3IFPA 1A4KB 3BDXA 3C5JA 3EYFB 3ROOA 4LPCA 1C1EL 5JW4R 2E6PA 4WNQA 4TUKL 2YD7A 4NWTL 4QY8A 1L9MA 3UBXA 4NHCL 1LK3H 4LKCB 4JRYD 1K4DA 3RBSA 2XZAH 2CK0L 5KSBF 2H32H 2WNGA 1DJSA 2XQYK 5BS0B 2DL2A 5E8EA 1H3GA 1GL4B 4UB0L 3L3OA 1EIBA 3SHSA 3MZGB 5KSAC 3FONB 4QHMA 1RZGB 1QBML 2Z31C 4W6XB 2X1OA 3ZKQD 3ULUE 4JRXB 4Y5VC 3HC4L 5GS0C 1C5BL 1A7OH 4UINH 4LSQL 4POUB 1KIRA 1RVFH 5DJ6A 2XTJE 1S9VA 5CHNA 1FNAA 4HXBH 3SE4C 4LQFL 1OQXA 1LEIB 1INEH 2XXMB 5F70A 2OYPA 2LU7A 1LO0L 3OKEA 3MLWH 4UDTB 3PXHA 3TT3L 4P5TC 2MKLC 3MXWL 1KXVC 4OZGF 3H9SE 3MRNA 5MERA 1PQZA 3P0YL 4N8VG 3IFLH 1AKJB 5IJVB 3BEVA 5FUCE 3UP1A 5F1KC 2F5AH 2FHCA 5CWSA 4WI9A 1GH7A 5DEFB 3NN8A 5LQBH 5IESH 1NL0L 2BNRA 4J3TA 1MWAB 3DHJA 4ELKA 1I9RH 1KV3A 3I2CH 3T4AB 4F7MB 4Y5XC 1YPZF 3M45A 4PYGA 3VMPA 4LLVB 3V5KB 4FFZL 5KS9F 4GLRH 4Y1AE 4I0PD 5JW5A 3DYMA 3PWLA 3JWDH 1YQ2A 4LSDA 2GHWB 4FP8H 4QHKJ 3I3BA 1HNGA 3QR2A 4IOIA 4M6NH 3RHWF 3ZTNL 2MWCA 2FJFB 4ZFGH 3GSXA 4DN3L 4UNUA 3TH2T 4HC1H 4GJTB 4JZJA 1BJ1J 5C71A 3RY6C 4JO1H 4ZS7L 3FRPA 4YFLI 1MI5D 3Q1SL 2XNAB 4DVBB 4QXTA 4O2EB 5D5MA 3FO2A 3K4DA 3LDBC 4G6FB 1BZ9A 4FQQB 3T0WA 1KNOB 2EE3A 5AUMB 3PP3H 3R06A 3VWJB 5EO1B 1I7RB 4L29B 2EDBA 1OGAD 5E9DB 4WW2F 4Y4HC 5E2VH 4P2QA 4KI1A 2HYMA 4YLQT 4Z7UF 1LK2A 3NAAL 1JGLH 4WV1C 4QTIH 4PIRF 2D4FA 4P9ML 2Z8SA 2AEQH 4BZ2H 3QXTA 4XNZC 3H9SA 5DZLA 5GRJH 2CIKB 4NM4H 1O5DT 3LZFL 2RB8A 4P3DA 1K8DA 4DTGH 4W4OA 1NH6A 3U30B 1IC5H 3JV6A 3ZE2F 2GTWB 5LBSH 3BPLC 1N5AA 1MRCH 4AIZB 3FHQA 5HHQA 4D94A 5E00B 2YN5A 3FFCB 5EDXA 1KJ2L 3C6LB 3MRRA 2X4UA 4LVOB 1UEMA 1AH1A 4H1LG 1RULH 3CCHB 1R3LA 3QNXA 3HZMB 1FYHB 3KYNB 3QCTH 3T2NL 1GZPA 4JFDE 1RK1A 4G3YL 4LSUL 3WLBB 4HSQA 5CILH 32C2B 1X7QB 2AJ3A 1B9ZA 4PY7B 4I4WA 5DJYA 3SDCA 4U4BA 1KC5L 5L2JA 1B0GB 3ZDXE 4PJAB 4R7DB 4QGYA 4WU5A 5J12C 4GRLC 1X6LA 4KQ3L 4XP6L 5LGHL 3FN9A 1A1MB 1VESA 2FO1A 1BOYA 4AG4L 2Z91B 5C09D 4G43A 2K9UA 1BD2E 3TBVA 2AXGA 2BVQB 4UIKH 2OMNA 1BWMA 2ZP0T 5CMAA 4F57H 4ZSOE 4FOMA 1HZHH 4YGAB 1B0RA 1HHGB 1OD9A 4PJ5A 5D7IB 5DR5H 1T0MB 3S36L 2MJWA 3RWFB 1D6VH 3MOAH 4G8IA 3WFEH 5B3JE 2Q8AH 3C2AH 2P5WA 2X4QB 5D71H 4MVBD 4NKIH 2V9QA 4CMMB 1JCKA 4YHKL 3CFDA 1UM6H 3ARTA 1CLZL 3LH2H 2A1WL 3B6SA 3IDMA 4YR6B 2C3WA 4M93B 2F74B 3WMSA 1AHWB 4LSPL 2D7TL 2BOCB 2G60H 3D39D 4M5ZL 3SGEH 3AS1A 4WUUB 5SV4A 4YXHL 4IHOB 5ANMB 3GM8A 2NLJB 3GRWL 3RY5A 3IVKB 2NY6B 4JFDA 3UTSD 1KTLB 4U1NA 3E3QE 4NHUB 5FKPB 2CDEA 5DJ8A 3RY4A 1HH6A 1NMCB 2R15A 4WI6A 3MRJA 2DAVA 4ODHL 3X11B 1F4YL 4FQXA 1XF4A 2AI0H 3BYTA 4M02A 3S37X 1RUKL 4MS8C 4JRYB 3NGBB 2FZ3B 1HI6B 4R97C 5HVGB 4O5LH 1OTUD 4PJGE 5D2NC 3MACH 3AVEA 5TE4L 1JWMB 4XRCB 3OMZA 3TO2B 4X6CB 1FL6B 2OTWA 2Z8RA 4JPIB 3D3VB 4I2XE 3RZCD 4LHUD 3DI2B 4ZODA 5FHBH 2CO6B 2F15A 4PRDA 4ISVA 4KDTC 4RNRB 1FBIH 2PKDA 3UTOA 3K8MA 1UM5L 4FTVE 1KEGL 4YDKH 4YC2C 4G9FA 2PW2A 3VRLF 1QVOB 1CFVH 2R2EA 4OGYH 2DLFL 1F58L 1Z0NA 3T2PA 1B6UA 4X0KB 2B1AH 4N1CA 4OFPA 3FT2B 1OSZB 3QI9A 1QSEE 3VFMA 5AG8A 3X14A 5ELIA 3U0TA 4OZ4A 4OM1H 3JBG7 3VRIB 1GZQB 3DRQA 5C08A 4B53A 1WVZA 3PABB 4M7ZC 1BFOA 3KPNA 1H0DB 4KJWC 5EU4A 5INDA 1HQ4A 5AZEL 4R7NA 4PGEB 2BCKB 3BGFB 3RL2A 2N4IA 5IHBA 4MJ2A 1QR1B 2AVGA 1RSFA 2RCSL 3VFGL 4QOKD 2D7QA 4PGCB 4Q6YA 3RHWK 4BH7A 2DWDA 4Q74A 4XXCC 5KAQF 2W9DH 4OZFB 4XPTL 4YHPA 2V2XB 1P6FA 3GZKA 3O3AB 1RJLA 4OZFG 3KPMB 4I0PB 5DJDB 1CGSL 2X89A 3W9DA 5EBWB 4UBDD 5IMKA 2H2SD 1V3JA 4AMKL 3QUZD 1MAML 5MENE 2ZSWB 1JJUA 5LAXA 5D7JD 4ZPTA 3SKMA 2CMRH 4TUJB 3HE7D 5T3XL 4DWHA 3NOIA 2Z92A 2BY0A 1UZ6E 1NCCL 5BQ7A 5JDSB 1MF2H 5CP7B 2A6DA 5IW1A 2JB6A 3OJMB 3NMEA 3QXDA 4Y2DA 3CLEH 1MI5B 3MNZA 4MXWH 4TNVF 43C9A 4GSDL 3MV9E 4MD5A 5DRWA 3B9AA 4PJDA 5FUOL 1A6ZB 1YMME 3BIAX 3LN5B 3OAUH 4ORGB 5DYOB 1B3JA 2YR3A 3P11H 5CBEA 1MEXL 2PR4H 4RZCA 5DC4B 1N0LA 1CDBA 2J4WL 3EDJA 4F80A 1E27A 4V2CB 3IJSB 4HIEB 3FAXA 1WK0A 4OZHF 1EMTH 4XP4H 4V2BA 4XP9H 2VLRE 3S97C 2VXUL 1ZLVK 5BV7B 5FB8A 2APVA 3C60A 3FN3A 5TDOB 4ZXBA 2VDRL 4OZIF 1RIUL 4PTUA 2C5DC 4JFYA 4X6DE 4UT9L 1OT1A 1CK0L 4ZAKC 5F8QC 3DVGB 1AGDB 2FLBT 3NACL 1BBDH 4H8WH 3BZFA 1NKOA 3U6RB 2R56L 3OKMA 4E42A 1LK3L 4U2YA 3K8KA 3MFFA 5EUOB 2XZAL 3QDGD 2EYSA 4CADA 2M2DA 3QUMH 1U93A 4WO4A 1EEZA 1OWWA 2A6IA 4IRSD 3VRJB 5MENA 3VXUB 1E6OH 5J06A 1AGEA 4PJ7E 3EBAA 3FQNA 2CGRH 2ICWI 5KG9B 1FQ9C 1A7OL 2J8UF 3LY6A 3VJ6A 1TFHA 4UINL 3T0XA 1MHCB 4YHIA 1RVFL 1G7LB 2VUYA 5C09B 4PB9H 1T04A 1ED3A 2NY5C 2A73B 5B22A 3FTGA 4PP2B 4HXBL 3QIUD 5HI3C 1YEKH 5HY9A 3B9VA 3UPRA 4HX1A 1A4KA 3EYFA 3MLWL 4HXAH 2VC2H 3MMEB 4U33A 2YD8A 2ESVE 4M61B 3C09B 3G5VB 2X10A 3L5XH 4K55A 4LKCA 4IMKC 4EBQH 1QNZH 3DETC 3QUXB 1WFNA 2VLRA 4U1SB 5I1AB 5BS0A 1A21A 5LQBL 3RZCC 2F53D 3FONA 4JRWA 4X6DA 1RZGA 4M7JH 3I2CL 2W0LA 1JHKH 3MRBB 4MGXA 1IQDB 1A7NH 4JRXA 2D9CA 1YEGH 3T65A 3ZHLA 4UUJB 2DQFB 5FYLD 4PLKC 4XB7A 4URTB 3M1BB 4K8RC 3VFTB 1I9JH 3D39B 3N1GC 1LEIA 5FF6B 5E9DE 4FP8L 2DQTH 4S0TD 4O00A 2PUQT 2UZYB 4M6NL 4M9PA 1CFBA 4ZFGL 5HVWA 1ZT1B 4UDTA 5GS1C 5BZDB 4HC1L 4QCIB 3NH7H 1EHLH 3GO1L 2HH0H 2KBGA 1LEGB 5E5MB 4DEPC 4PRIE 4PP1C 2VSCA 4F9PC 4YHMH 5DMYA 1AKJA 5IJVA 3ZKSD 3OSKA 2ED9A 3MBXH 5DJZB 5DEFA 5E8DH 3TF7C 1MWAA 1C5DB 1U8QB 3T4AA 1F02I 1F4XH 4F7MA 5LXGH 4RX4A 5E2VL 1CDIA 3V5KA 1CTOA 4LHUB 1F6AB 1JGLL 5ITFA 4QTIL 5D6CB 3Q48A 2AEQL 4BZ2L 3BWUC 2IMNA 2ESVA 2VDQH 2WIIB 3EJYD 5K9QI 2HN7B 3HE7C 1CZ8H 1QSZA 4KKLD 4NM4L 4RMUA 1PZUB 2FJFA 4MD4B 3RGVA 1DN0B 1IC5L 5F3BB 2NY0C 5LBSL 1MRCL 4YEEA 3AC0A 2DF3A 5CLTA 4G7VH 2XNAA 3QFJD 4DVBA 4ZD3H 4O2EA 1IGTB 2QJDA 2MCPH 4KV5E 1RULL 4Y16D 4FQQA 5HYJD 1KNOA 4AEIL 5FGRA 3GFUA 5AUMA 3QCTL 4M6AA 2PO6D 2R8SH 3RWJB 3VWJA 5EO1A 1I7RA 1U3HB 2FX7H 4L29A 5JZ7D 5E9DA 3IU3B 5L2KD 2AV1B 4C56E 4QOKB 1B90A 1Q9KB 1XEDA 1AO7D 2ZCKH 3P3YA 4WFED 2XZZA 1IGYB 1S78C 1TVHB 5M94B 4UIKL 4ZPVB 3QUZB 1ZE3C 2CIKA 3AM8C 3DX8A 5D7JB 4F57L 1HZHL 4YZFF 2GTWA 2DDQH 4JCLA 4AIZA 5E00A 3FFCA 3OKLB 3EO1B 3C6LA 5DR5L 4FNLH 5IB4B 1D6VL 3D25B 1OAZH 3ABZA 1BQHG 3CCHA 3WFEL 3BESR 2Q8AL 3HZMA 3KYNA 2VABB 3C2AL 1X4YA 1U8JB 3ARRA 4G8GD 3WLBA 5D71L 4JPVH 32C2A 1X7QA 3BEWB 5IWLA 4PY7A 2DIAA 3LKNB 4PGZA 3HS0B 5ACLA 1B0GA 2VAJA 2XQBH 4PJAA 4R7DA 3I02B 1MCCA 5L88H 4WHTB 1CI5A 3UZVB 4KK9D 3OXRB 3L3IB 2Z91A 3P4MB 1KYOJ 1WLHA 1G9MH 3P0GB 2BVQA 5KSBE 1MFCH 1SEQH 4X6CE 1KB5B 2NZIA 4Z8FH 2G60L 2GJ6D 5J13C 3D5OF 3T0DA 3D3VE 1BWWA 5D1QD 1TXKA 2EDYA 3BP4B 1CD9B 4Y4FD 3KJ4C 4KTDH 3K2MC 3Q5TA 3ZDZE 5D7IA 5EUKB 1T0MA 5D7LB 1ETZB 3RWFA 1MH5B 3CPLB 3F7VB 5JQHC 1G9EA 1UVQB 4PJDF 1V05A 2X4QA 3QDGB 1N4XH 4O5LL 2H26A 2NPLX 3MACL 1ZHNB 1V3LA 4CMMA 2QQLH 1H5BB 1M7DB 4WWKD 2H6PB 1DFBH 4IRSB 4EQ3A 3PNWB 3BMWA 4Z77B 1AIFB 4JG1H 5CJXC 1OAXH 4M8QA 3BPOB 1JYNA 4GW1B 5FHBL 4PJHB 4YR6A 3QAZC 4M1DL 3U1SH 2F74A 4DGYH 5DD3H 1AHWA 2IEPA 3CSGA 3LQAC 3SJVE 4Q0XH 1S7UB 4U6HA 4WUUA 4YDKL 4ELMB 4IHOA 3DX7B 5ANMA 2NLJA 3QIUB 5GRVK 3SDDD 3DOSA 3QIWD 3IVKA 1KTLA 1X5XA 4NHUA 5FKPA 1CFVL 4PY8I 4OGYL 2B2XH 4EN3A 2BVEA 1P7QD 3X11A 4XB8A 2B1AL 3TYGH 4HJ0C 4OLYH 4OM1L 2OR9H 4JRYA 4YHOL 2FZ3A 1HI6A 1NLBH 3T77B 3HI6H 4KU1A 1JWMA 3AS2A 5ICZB 3TZVC 4XRCA 3TO2A 1MCRA 2VDKH 1HWGB 4W68A 4X6CA 1FL6A 1E4WH 4TVSa 4EJ1C 2VN4A 4JPIA 3D3VA 5F89B 4NFCA 2D7OA 4UTAH 3ULVF 4RGNC 2W9DL 3EJYC 1I3VA 2W0FA 4ODVH 3HPJB 4UAOB 4KKLC 4KKCC 4LGRB 2BRRH 3EFDH 3FB5B 4RMQA 2VZ3A 4JY6B 3F8UB 2FSEB 2AJXH 5E1HB 2Y6SC 4IOFC 3TA3D 4HLZG 1TQBB 1VKXB 4QRUB 1T89A 4ONGH 1R5WB 3ZZ1A 1BFVH 3PWVB 1MF2L 5IV2B 3EZJB 3BSZH 5F7YC 4BA8A 2X41A 4X0KA 1XF3B 1BREA 1OSZA 2XWTB 3CLEL 3OJDB 5E6IC 3MBED 3SGEI 1MCWM 3VFWB 4MXWL 5DJAB 3MRHB 4OLWH 2P5ED 1X4ZA 1NAMB 1GZQA 2DIJA 3VRIA 3OAUL 3PABA 1N2RB 2XOTA 3P11L 1MY5A 1H0DA 4IIQB 2PR4L 3TNMB 1X5IA 2APFA 2R0ZL 2BCKA 4PGEA 4JM2D 4RCAA 1QR1A 5J3HD 4OAWB 1YN6B 5DWUL 5IIEB 4PGCA 5HI4D 2R39A 4OZFA 5ISZE 1EMTL 2XN9E 4XP4L 5EUOE 2V2XA 3MLTB 3O3AA 3KPMA 4I0PA 5DJDA 3EDEA 5EBWA 2H1PH 2H8PB 3BP5B 3ALPA 3KPPB 1P2CB 3B5HA 4JHAH 2ZSWA 5T5NF 1O0VA 3VXUE 4YHYB 4ODSH 3VD3A 5IP4A 4KHXH 4TUJA 4Z7VF 3HG1B 4KRMB 1S7WB 1QSFE 5JDSA 1BBDL 3F5WB 4RFEB 3K1KC 1G0DA 3KAAA 3NTCH 2Q6WB 2ED8A 5I1KH 1MI5A 1R0AL 3QFJB 1XR8B 3TNNB 3C6SB 3UX9B 5FYKU 4Y16B 1A6ZA 3LN5A 5HYJB 4ORGA 3BQUD 2Y25A 4NKMB 5DYOA 3QISA 2DWEB 1U3YA 2PO6B 4X9IA 3MRKB 5C0CD 3G6AB 1DVFD 4UILH 3IJSA 3UROR 4QXWA 1FV1B 3IT8D 2DLEA 4HIEA 3WXVH 1J0JA 1R5IB 3VFRB 1RUAL 1WBYB 3QQ3B 2CKBH 4XWOC 4XCCH 4FRWA 3T0VA 2D0GA 1ZLVH 2GYSA 4PB9L 4Z7NE 1H8SA 7CGTA 5HD8C 5TDOA 1VA9A 5D1QC 1G0YR 1RZIA 4G6KL 4LCWE 2VLME 1AGDA 3DVGA 5D1XD 1YEKL 1DBBH 4PJ8D 3VH8B 3H7LA 3O2DH 4OFVA 1I9IH 1J1XH 2BFVH 5JPNB 5DUPH 4HXAL 1ZWIB 4B7LA 2YA2A 2YRLA 2VC2L 2OXGA 4QHUB 5EOCL 5CD5C 5HVHC 1T7YA 3DXAE 3L5XL 4CN4A 4RAHA 5EUOA 5DK0B 4JREB 1NGQH 5C86A 3HHRB 3FB8B 1KIUA 1OF2B 5F97E 5JXED 4XMPH 1I8MB 3VRJA 4HKZB 3VXUA 4PJCF 4M7JL 3DUHA 1A7NL 1UWEH 1YEFH 5KG9A 3S37H 1YEGL 2DQDH 1MHCA 2E6QA 1G7LA 5C09A 3V95A 3D1MC 3C5SB 2AXHA 3SDDC 3QIWC 3V8CA 2A73A 2IQAB 4PP2A 4WTWA 1I9JL 2YRZA 4KVCH 2DQTL 3T3ME 4NOFA 3FKUS 4HS6B 1BAFH 3HZKB 4QRQB 3OXSB 5D7KD 4LP5A 4YDJB 2NY7H 4Y4FB 3NH7L 2BP3A 1EHLL 4EUPG 1FGNL 3MMEA 4M61A 2AJZB 2DBLH 2XFXB 3G5VA 1KT2B 4YHML 3QUXA 4PRBB 4U1SA 4EDWH 5J1SC 2WANA 5I1AA 2X05A 1AC0A 4D9RD 1KPUB 1BF8A 3MBXL 3BE1H 5E8DL 5KANG 3DV4B 4U6TA 4ZFFB 4WWKB 3MRBA 1F4XL 5LXGL 1T3FB 1BIHA 3RRQA 1T5XB 5ETUB 4HWBA 3QSKB 1T6VN 5T3ZH 2JF1A 5E4EC 4UUJA 2DQFA 3OKNB 1S8DB 5TQ0H 3SKOB 1NFDB 3GMLB 4FZEH 4KXZH 5TF0A 2VDQL 3G9VA 3M1BA 1UWXK 3VFTA 3D39A 1CZ8L 2R2BB 5FF6A 2OQJB 3SN6N 4U1MB 4DCQB 3LPWA 3QIWB 4KK6C 1ZT1A 3E6HB 5BZDA 4QCIA 5L0QB 2EECA 3TH3T 3ISWA 5E5MA 1LEGA 5D7IF 4NRYB 1P7QB 2OMBA 3ZKNC 1QBAA 4R0LC 5AWNH 4P4KC 2IBBA 4G7VL 4ZD3L 2IQ9H 4OUOA 5CEZE 2YXMA 2MCPL 3QEQD 3IXTB 4K7PY 4JM2C 5DJZA 5EBLB 1BJ1H 2R8SL 4JFHD 2WQRA 4OGZA 1C5DA 4ODTH 2NTSP 1U8QA 4RA0C 2FX7L 5B21A 4XZUB 5BW7C 1FNSH 5ENWB 4LHUA 1NEZG 1F6AA 2AS5M 2ZCKL 3QIBD 2APXA 5TF1H 5D6CA 2EDDA 2WIIA 4GRWF 2HN7A 2VQTA 1CR9L 2RFXB 1IJ9A 4J3WA 4MLSA 2ICES 4JGUA 4MD4A 3TA3B 1OTSD 3DLQR 5GS2H 1DN0A 3DHMA 3MQIA 4CMHC 2QR0B 2H9GB 5F3BA 2YSSB 1NGYB 3MXVH 2DDQL 3TVMB 3VXME 1A8JH 3LEVL 4RDQF 4OZHE 1AY1H 3J8F7 4ALAH 1LILA 3DX9B 5JR1L 1IGTA 5IOPB 5GZNC 4FNLL