4BFEA

Structure of the extracellular portion of mouse cd200rla
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
188
structure length
188
Chain Sequence
QVNTTMSVQMDKKALLCCFSSPLINAVLITWIIKHRHLPSCTIAYNLDKKTNETSCLGRNITWASTPDHSPELQISAVALQHEGTYTCEIVTPEGNLEKVYDLQVLVPPEVTYFPGKNRTAVCEAMAGKPAAQISWTPDGDCVTKSESHSNGTVTVRSTCHWEQNNVSVVSCLVSHSTGNQSLSIELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL SURFACE GLYCOPROTEIN CD200 RECEPTOR 4
publication title Structures of Cd200/Cd200 Receptor Family and Implications for Topology, Regulation, and Evolution
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 32
structure length 188
sequence length 188
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bfeA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bfeA02
4M93C 3SDXA 5D71L 4U6VL 1ZXQA 2VDLL 1Q1JL 3RVUC 3VE0A 3SE9H 5MEQA 2G5BB 2WWKT 4PJHB 4EUPB 3SGDI 2DQHH 1AQKH 5F9AC 2J8UF 3FQUA 4G6KL 4PD4J 3C9NB 4X6EA 3GMNB 3IJYA 3WE6B 2XWTB 3CU1A 4X5WA 1J8HB 1REIA 4YGVB 3FQTB 1QYGL 2HLAA 1LNUA 1T4KA 3UTPD 4HJ0C 3O6FB 3ARYA 3UPRA 1QSED 4PJCB 1CLZH 4NT6B 3WFHB 5E8PB 1CE6A 2PYED 4WI8A 3LEVL 2A83A 2HKFH 2VDKH 4JY6B 2CDEB 5TE4L 3SDYH 2EYSB 3P4LA 2GCYA 4GG6E 5CILL 5DD1L 3LIZL 2OTPA 2IAMB 3LH2H 5CKAA 1E4KC 1P1ZA 2DLFH 4OBSA 1AO7B 1F8TL 1C8PA 2I60L 4OZGA 3ZHKA 4I8DA 1KB5H 2GUOB 3QULA 2YUWA 4Z8FL 3B3IB 3RZCA 4Z18A 5FUCC 3AB0C 4K7PH 3U36B 4M00A 4PP1C 5TE7L 2P1YA 2XFXB 3GBML 1RU9H 2W07A 4J6RL 5DTFA 2IPTH 4M62H 4H26B 4M7ZB 4PRHD 3DTXB 3EDJA 2Q8AL 2YD4A 2ESVD 3NBNA 4KKNA 4PGCA 2V2WB 3TWCH 4H0IA 4JKPH 4MHHG 1R5VA 2Y5TA 4X9FA 1R3IH 1PQZB 4K23L 1OQOA 3MRGA 4LSSH 1IFHL 2NY5H 4YHOL 4PJFF 2VITA 2VRAA 4KKBD 1XF1A 4GKNB 4Z77B 3RL1A 1LE9A 1UEYA 1CVRA 3SKNA 3WNLA 5EB9A 3PDDA 2NXYB 2FO4A 4LLQB 1T5XB 1RURL 5DQ9B 1L0YA 3PDOB 1U6AL 4TVPD 2EDQA 4M7JH 1YEIL 1XCQA 1MFBL 1SMOA 5DT1H 3INUL 5JTWA 3QDGD 3BP5B 2XG4A 2FJFA 2XZAL 5B3JE 1G7JA 5CGYD 3SDAB 4WO4A 2OMNA 3V2AR 5DMKA 5JW4M 5JXED 4YBLB 1NANI 1W8OA 1YYML 3MBEB 2NNAB 3G5ZB 1CFQA 3DGGA 4PJDF 1I7ZB 3HHRB 2ZUUA 3T2QA 3U7YH 3QDMD 5FYKH 5MEPB 5KAQG 3MLXL 1H3WM 1MJ8H 3G9AB 5FCUL 2GIYA 3V8CA 5GXBB 1ZLVH 4L4VD 3EGSB 1T22A 4EI5D 3EYFB 5FHBH 4LHJB 5HYEA 3T3PE 3AMKA 2W9EH 5HHOB 3P0GB 3O4LD 2VISB 3X14B 2QSTA 3FMGL 2E3VA 4OAWA 3FTGB 3RU8L 2Y07L 1ND0B 4LK4A 2IPUG 4XCEA 5IB3B 5I8CA 4PRBA 2BSSA 3W82A 4QRPD 2DWDA 1JGDA 1B0GB 2ZUXA 3HC0A 3O0RL 4P3WA 3CLEL 1A6AA 1D3CA 3WFZA 1DUYB 5D7IB 1U95A 4E5XA 3NIFF 3TVMB 2R0ZH 3ZTNH 3H9HB 3KYMB 1U3HC 1KCVL 4ODWB 3VDCA 5DDHB 5MEOB 1DQLH 2E9BA 5DI8B 5SWZA 3LD8B 2ZG2A 3GSUA 3EYVB 5E1HB 3SGJC 3ILPA 2P48B 4P4KC 2G9HA 4MWFB 1EMTH 1ZEAL 1OD9A 2JKXA 1SY6L 2V6HA 2ZNWA 4TPRH 3MJ9A 3HZMB 2BNUA 3LKNA 5CZVH 3GI8H 2FATL 1DQML 1BQHA 4OF0A 5I1AA 2PW2A 3HMXH 4XNQB 1A3LH 4JAMA 4LVOC 2OL3L 2FH8A 1Q9KB 4DFHA 4M48H 2ZUQC 4IMLB 4U2ZA 5J1SC 4RFNB 3IDGA 3PGCA 1S9YA 3B43A 2CXGA 3QG7H 5GZND 3BKCL 4G3YH 5EOCL 2AV7B 3BKJL 1JWUA 4I3GA 1DLFH 1DBBL 2BNQA 1CD8A 4M1GL 1RUKL 3OB0H 2BRRL 1U8JB 3WKMH 3K4DA 1ZHKA 2CQVA 3OGCB 2YXFA 3RTQD 5D7JC 5GISH 4ZXBA 1CTOA 2ADGB 1BBDL 3LRHA 4WV1B 3BUYB 3T0EA 3RX7A 1ZHNA 1NCNA 2EYRB 1WEJL 1Z9SA 5ALBL 5JQ6H 4F80A 4LAQL 4ZFZA 4I4WA 5GGUB 5J13B 4PG9B 4QRSB 4LPYA 3ZE2E 3QWOB 5JNYB 4U1HA 35C8H 1GGCL 4J7RA 3QO1B 3V4VL 3PQYB 3UJJL 4ZD3H 5DRZA 2HFEB 2AK4E 2NY3B 2IADB 1ZLSH 5E00B 1OTSD 1G0DA 1U8NA 4TUJB 4B7IA 1NL0H 4BH8B 4ODHL 2QLVB 4N90E 1N6QH 3KYNB 3D39E 5EZLA 2APBA 5C0JB 1LEKA 1K8IB 5I76B 2VWEE 1E6OH 2MSPA 5D9SB 3BZ4A 1A1OB 2P7TB 5FYKU 2EICA 3Q6FB 2Z93B 4CN1A 4MJ6A 5IVXA 2ZKHH 1RUPL 1AGDB 3TP4A 1F6LL 4DGIL 3HAEG 5IMLA 1MLBA 2AJUH 3FB8A 5ESAA 5B3NA 2CJUL 4ZUTB 4G8IA 3VXSE 3UMTA 3C5SA 1WBZA 5DFVD 4AL8H 1BQLL 1RI8A 1H5BA 4POZD 4N9GA 3PWVB 3G08B 1C5DB 1HI6A 2AABL 2J8OA 4IS6B 5CMAA 1P5VA 3CH8A 2J4WL 2WAHA 1NFKA 4ZSOB 1I1CA 2QSVA 2VXSH 3BH9A 5FF6B 2ZCLL 2E27L 4M5YL 4HKZA 2DN7A 4XB7A 3MJ7B 4XC3H 3BIKA 5F3BA 4GKZA 4MA1C 4JFEE 3DWTA 4RGMB 3ELAT 1I1AB 5IIEA 4BA8A 4XTRD 5E9DD 3LRSA 3FAXA 4HS6B 1UB5B 3BOVA 3TFKC 4LSRL 2AKRB 2JIXB 5FK9B 5SX4I 1NC2B 4JJ5A 1CU4L 1UA6H 1A7PH 1FNFA 4R97B 3PNWB 4PLJC 3NPSC 3T04D 2GJ6A 1I85A 1FV1B 1WWCA 1JZ6A 1DQTA 2YMXH 4U6HB 4NQCB 4RMVA 3TN0B 5I17A 1MVFA 2OTWA 2XG5A 3GSQA 4NJ9H 3S96B 2APXA 2W0KA 4MAYA 4P46C 5TPWL 4NQUA 2NY2C 4P5TB 5HYSG 2ZUSA 3OKEA 5L88H 2ICCA 4LVHB 3DARA 25C8H 4Z7VE 5BQ7A 2VH5H 3UYRL 4DZBA 1QFWI 2VDPH 2ITCA 2B1AL 4OCSH 3VWKD 2O5ZH 3HPJB 4FQCH 2WUCL 4KWUA 4OQTH 3JV5A 3G6JB 1G9EA 4F2MA 4Y2DB 2DQJL 1DL7L 4HWBA 1MLCA 5F6HJ 4DVBB 5DMJB 1J0ZA 2CGRL 4HH9B 3EYOA 3R0NA 4LHUG 4QGTA 4OGYL 1NANH 2W65B 2Y9RT 3O6FC 3GIVB 4LVNB 2Q3AA 4Y4KB 1K4CA 4P57B 2EC9T 2OYPA 2VR9A 1X5GA 2V2XA 1FN4B 4FZ8L 4U1MB 1I7UA 1PKQE 4G6AD 1IC5L 3LCYA 5C0RL 3LMJH 3PL6B 2DI9A 4QTHB 2HRPL 1CXHA 3A0OA 3NCYS 3QJHB 1P7KA 1G9NC 2IAMC 4JFYA 5E8DH 3IFLH 2VSCA 4LOUD 3IRZA 3REWB 4HQQH 4BSVA 4Z0XB 5IEHA 4EQ3A 4QNPE 4YHMH 2UZIL 4L8BB 1HSBB 1OAZL 1P4IH 1E4WH 4HWZB 3I6KA 4F37K 4LLVB 3EOYG 3QQ3B 4QO1A 4EDXA 5ID0B 2PXYB 4M7ZC 5K93A 4YZFF 3GHEL 1OWWA 5HHXH 5KS9A 1HIML 1PGRB 1HINL 3IKCB 1AIFB 3UJTL 4JY4A 3RRQA 3FONB 3VFTA 3GRWA 1MHPL 2CPCA 3NZ8A 5DJDB 4PGZA 2K7QA 3D85D 4JDTH 2VXQH 4H25A 3TZVA 1EGJA 1OP3H 4X4XB 3U0PB 1NUDA 3DMMD 3LN5A 4JFFA 4FMFA 1AY1L 3WUWG 2DAVA 4PRNB 5B8CB 4FTVB 2NXYC 5ADOH 4M3JA 2XWJB 3IU3A 2X4OA 4R90H 3SN6N 1RIUH 4IM8A 2R4SL 4LL9A 1BP3B 3QZWA 2OJEA 4X4YB 3ZE0E 4J1UA 5DMGC 2JE8A 3SY0A 3SDAC 3TO4A 4JHAL 3QXAB 4HIJB 3LV3A 4YBLC 5FUCE 3LS4H 1ONQA 3MBEC 3O6MH 5GJSL 4ENED 3GI9H 2JJTC 5CD3B 1FNGA 1LO0L 3WD5L 1CICD 3IF1B 3B4NA 4LHUD 1XF4A 2B1HL 3ECBA 2XY2A 4TN9A 5FYLD 3DX6B 1KJ2A 5DC4B 3HPLA 3ZDYF 4APQD 4Z76A 4W6XB 1WC7A 1UACL 5EIVA 1KPUA 4KUZL 1QKZL 4FQJL 3B2UC 3L3OB 3BWAA 4UU9A 3STZB 5INDB 4PJBF 5CEZL 5IJKC 4JO4H 3CDYA 2R1XB 4F7TA 1Q72L 2DQTH 1DUZB 1MJ7L 2X40A 12E8H 1K4DA 3NAAL 4QY8A 2VLRB 5C0CA 3DBXB 3MLVL 5IFHL 3EYSL 5F3HA 4TOYL 2AQ1A 1BJ1J 1ZT4A 3G6AB 1JZ8A 5CD5C 3MXWL 4ZFFB 4RNRA 3DUHA 1MWAL 4HS8L 4PJ5A 4AIZA 1PD6A 2FB4L 4BUHA 3UTQA 1TETL 3X12B 3T2NL 1P2CA 3LD8C 3KPTA 3ORJA 3QNXA 1G7PB 4OCMC 5I16B 2IQAA 1B6DA 5IMOB 4RMSA 2BHZA 4JM4L 4N0UE 2Y6SC 2IALB 1J5OL 3UPAA 3SO5A 2HVJB 1AC6A 2DRUA 3BRDA 2AEQH 2UVEA 4L3CB 3UROR 4P99A 5TDPA 1BJMA 4NNYB 4YFLI 5T3XE 4OFYA 4EUPH 3GHBH 4OZ4B 4M4PA 4HIHB 4NKIH 1QPXA 4JFDA 4CN6A 5ICZA 1U8PA 4ZPTB 3ULSB 5GRJL 5D1XA 3AVEA 2FIRT 3MXVL 1P7QA 2YC1B 1V8HA 4ONFL 5ESVB 4HUVA 2O26U 3KJ6L 2NPLX 5J3HC 2BVQB 3WNKA 1EXUB 5C07D 4WTZA 5HHMB 1OARH 3OAYH 4FZEL 3HFMH 4KH2A 4CDGC 1LO5A 2EIZA 3SCMA 1J9CT 4YPGA 3B2VL 4NGHH 4WV1C 1GPOL 5SWQB 4C4KT 2EH8H 1G9NH 2GTZB 2I25N 4NQVB 5I1DA 4FQ1L 4OJFL 4KKCD 3NABH 5SX4H 1CT8B 5J13C 3AXLB 5DYOA 32C2A 4GSDH 3OKNB 2GJZB 1SJHB 2B0SL 5B38G 1HQRB 2ZCKH 1NCAH 2Z35B 2E8YA 3QUMH 2NY3C 3RNKB 4L9LB 1NBQA 2BHUA 4QXTA 1QA9B 4IDJL 3P73A 3X11A 1FQ9C 4V1DA 1M7XA 5FGBC 4OGZA 4XWGH 4LEXL 1RJLA 3F65A 1F90L 1LILA 1IEBA 2EE9A 4GW5B 4P9HH 3IJHB 4F7MA 3FQNB 3QAZB 1QFWH 3RWJB 4Z7UE 2YPKB 1QFUH 4UQ2B 1KYOJ 1CWVA 5HJ3B 3VFSB 1KIPA 2E7CA 1EZVY 3FO9B 3FZUD 3HA0A 1F11A 4Q9QH 4ODUA 5KAQF 1VFAB 3IETB 1CXFA 1VGKA 2H9GA 5HHPA 3QCVL 5F1IB 4OD3L 2C3GA 3TLRA 3CPLA 4QKXB 2AEWA 5IVZA 1ZTXH 2EEDA 3P77A 5DEFA 3ARVA 3IXTB 1FGVL 3GNMH 4PJ7A 3V4PH 2EDEA 1IGYB 1S78D 1PY9A 4Y4FA 4WWKA 3MV9A 4LRNL 3H3PH 1UJ3B 1VFOA 5D93B 1N3NB 4K3DH 3Q5YA 4H5SB 4HPYL 4RFOH 2B4CL 1B0WA 4MA8H 4XI5D 3VW3H 3HS0A 4OZHE 2GK0A 1N7MH 1T1WA 2OS7A 5T5FH 2BFVH 3P4NB 4YK4B 5FGRA 4RGMC 1I1AC 1QRNA 5KVEH 5E94B 2GSIA 2R4RH 3MJ9L 5T5NF 4PGJA 1KJMA 3PF2A 1IM3A 2O5XH 3DX9A 4L4TB 3SOBH 3ROLB 4R97C 2PKDA 1T1YA 1JZ3A 5FB8B 5IK3B 1QOKA 3WXVH 2EDTA 4GT7A 1FLRL 2AERT 5GGTH 2VXVL 4JGUA 1AHWB 3UTZB 4JR9L 3OJMB 1BGXH 3T0ED 1LK3H 3J7HA 5KVDL 1YYLL 1HH9A 3MLZL 4P5TC 2PF6A 3UTSE 1S7TB 4LVHC 1OTUD 1N26A 1TDQA 3O3DB 3W9EB 4QRRB 4AEIL 1RIVH 4XRCA 3RKDC 1BQUA 1NLBL 3O2VH 1BVZA 2VJXA 3PWPA 3FT3A 3LQZA 1A5FL 3QUYB 1YJDH 4V2BA 4Y2DC 1NJ9A 1Q94B 1XF2A 5C08D 4R0LA 4XX1E 2LVCA 2A6IA 1D5XB 3O9WD 1OCWL 4TUOA 4OF3A 5C0BA 2IANA 2CRYA 4Z78A 3VG0H 5HBBA 1ZANH 1XF3A 4CU8A 1NCDL 3PWJA 4LVNC 4Y4KC 1G9ML 3KR3L 1IT9H 1PJ9A 3S97C 3WN5B 5KSVB 2W60A 2FD6L 2VAJA 5DHVH 1Z9MA 4X6DF 1KEMH 2UWEF 3U7AA 1JF1A 5D2LB 5DD0H 5CJQH 3MUGA 3O2DH 1WCQA 3PL6C 3LEXA 1V3JA 3QUZA 4ELMB 3FOLB 3CFCL 5FGSA 1VA9A 3QIBA 1JI1A 1NH6A 4LKXA 3SEPA 5T3ZD 1LMKA 3QNZB 5D6CB 2VAAA 1SJEB 5EU5A 4G6ML 4PJIA 1NGXA 3C6SA 4XPAL 2ZCHH 1XGTB 3H2WA 3QSKB 1W72H 2GAZA 1GC1H 4EZMA 4KI5D 1IC1A 5EUOB 4PJHE 1MQ8A 4WFFE 3MRHB 3HUJF 1LO3H 2PXYC 4F9PA 4U7SA 1QRKA 1HHIA 3HC4H 4LQFL 4M61B 4XAWH 3L1OL 1TTUA 1J8HE 1MAKA 1T0MB 4ZS6D 1NC4D 4TQEL 5IQ7L 3IU4L 3V5HB 3MRQA 1UXWB 1J12A 4LSQL 3K7UA 4DKEL 4P2RE 5D7KE 1LP9F 3FT2A 4HAGA 3IGAB 3FOMA 4PJCE 4HXBL 1A7QH 4ODXB 4NFCA 1SYVA 3WHXB 2CIIB 4XCYB 43C9B 5CIPB 2YN5A 1L6XA 1U93A 2XN9A 4HC1H 2XZQL 4RAVA 1NSNL 5H94A 5FKAB 4P3DA 1C12B 1RY7B 1JK8B 1D9KB 3VRLF 2DL9A 2Y06H 5HHQB 1SEBB 3OKOB 1A6WL 4FXGB 4JPVH 4OZFG 4YHIB 5CP3H 5JW3H 4HXAH 5JDSA 3U82B 1X9QA 2H32B 2Q76A 3SE3A 1Y0LA 3H7BB 5GGQL 4Y88A 1GGBL 1RZJH 5DJ6A 1XR9B 2X41A 2P5EA 3NOIA 1X5FA 1OAQL 2KZ1B 4HLZH 2VXTL 5BO1L 4L3EB 2C3WA 3MTRA 4DFIA 2XKSA 3RWIB 3MRKB 4YHNA 4LSUH 4M6NL 2EH7H 5HGDB 3CD4A 3AAZA 3MFGB 5DJZB 4CBPA 3FFCD 5BV7B 3SDXB 4F57H 5IROA 3MLSH 3HZYA 4OKVA 3QFJA 3VE0B 4JFOA 5A3ID 5DJAA 2AEIT 5F89B 1VADA 2VNCA 1U92A 1MCWM 3R0MA 1IGCL 4HWBL 1MIEL 2H1PH 4R2GB 2DQEL 4KHTL 1BFTA 4HFWA 4X6EB 5C3LD 3L3JA 3IJYB 5GRXG 3FQRB 5EZOL 3BEVB 2HJLA 2O5YH 3M8OH 5TJWK 5K9QI 1T4KB 4AYFA 4UBDD 1UVQB 1JE6A 5E0QA 3SKOB 1XF5A 4BH7A 3P4MB 1HYRC 4JQXA 1KLGA 5D1ZD 1OAKL 2Z91A 3D3VA 5DJ0A 5IBUB 3BHBB 1HNFA 3CVHA 3I75A 2A83B 4HIXL 2RFXA 4I18B 2R0WH 2EO1A 1H15B 3V5DB 5DO2C 1OL0A 2YPLD 4BJLA 2YK1L 4PRID 2GCYB 2N1KA 2VC2H 4MNGA 3RKPA 1A3RH 4DTGH 3QQ4B 3ZKND 3ARSA 2BOCA 3OPZH 4TTDD 4OZGB 5E2VH 4NQSA 1BZQK 4YR6B 3RUGB 3QULB 5D71H 1UB6A 4U6VH 4PJAA 5HHOE 4PJEA 2VDLH 3RZCB 1Q1JH 2F53D 4MJIB 2HVKA 3QJFA 3RWGA 1MHCA 4OBRA 5E2TL 3D9AL 1HHGA 4G6KH 4X7TA 5DTFB 1QYGH 3GRWL 3KLHD 4GKSA 5D7IE 5FO8A 4KJPD 3VXRD 1A1NA 4XWOC 4RA0C 3NFNA 1EGJL 1JGLL 1A8JH 3OKLA 2Y5TB 3WLBA 4LSVL 3MRGB 5JMOC 3TO4D 2VITB 3LEVH 1TJIL 3VGBA 5TE4H 2YBRA 5CILH 5HDLA 1NAMB 5DD1H 4Z7NF 5BOPA 3LIZH 4HZLB 2FO4B 2KZWA 5JOPE 1VERA 3HMWL 1F8TH 4F8TA 5EO1A 3TBYA 1KLUA 2H2PD 2ZPKL 3U48A 3VG9B 1XCQB 3FB5B 2NZ9C 3T08A 4GG6A 1GZPA 4Z8FH 4Z7WF 4MS8D 4NQDD 3OX8A 5EO0A 4M3KB 3CK0L 1HXMB 1LEIA 1IVLA 5L0QB 5TE7H 1N64H 1UADC 4P3CL 5FYJL 5JW4N 3GBMH 2FL5B 4J6RH 3VXOA 1CFQB 4D0CA 4XZUB 3DGGB 2BVOA 1JGEA 1OT2A 4X6CE 5JIPA 2HKHH 5HVHB 3DRTB 1IGJA 3EHBD 2Q8AH 2P42B 5L7XH 1AXSA 4NBZB 2D7TL 1KJ2L 4UTAL 3F7VA 1FLTX 3QUKA 5EOQL 1XCTA 4YHYB 5C0CD 5ADPH 4K23H 3CXHK 1XGPA 4YHOH 1IFHH 3KPNA 4MVBC 1T22B 1BPVA 4KKLC 3MRIA 2HYMA 4G8EA 1CFVL 2HT4C 5J0BA 4Y7MA 4X8JA 3ZKMD 4YWGL 3GZKA 3VXMB 1RURH 1U6AH 3DRQB 1G7MB 5I18L 1YEIH 1OTTC 1MFBH 3EDKA 3INUH 2MNUA 5I8CB 4PRBB 1FFPB 3D0LB 3NCCB 4MQXC 2XZAH 1A6AB 5L9DL 4FXKA 1UJ3C 5D93C 3IS1X 4UIKH 3AS0A 5IV2A 5SWZB 1Q9OA 4NKOA 4M43L 4LASL 5GS0D 3MLXH 4YK4C 3W2DL 5FCUH 5GIRA 1AXTL 2V17L 4JFDD 3ILPB 2P8PB 1OW0C 3U0WL 5J6HA 1CDJA 1P7QD 2EDJA 3QEUB 3ARGA 2BNUB 3LKNB 3SDDD 3QEHA 1LEGB 4S10A 4LLDA 2PW2B 5I1AB 2YRLA 1F4XL 2C3VA 5IOPA 4ZFOA 3FMGH 2NYYC 5J12B 4MGXA 4PJFB 3LSOA 3T77A 2X42A 5DUML 3RU8H 4F33A 2Y07H 3TBVA 3SCMD 1AHWC 5SWSB 4NUGL 1S9YB 1O7SA 2CK2A 4ETQB 5D72L 1F00I 4XGZA 3WIFB 3CLEH 5EH1A 2AVGA 2XQBH 5MI0C 1IARB 4PB9L 4EXPX 1KCVH 4BZ1L 1M71A 1AP2A 1P4BL 1ZHKB 3QUYC 3HNSL 4IMKA 1AR1C 4EVNA 1KJ3H 3DSNA 3U46A 4X98B 1U58B 1T20A 3VFWA 5B39G 1ZEAH 5EBLA 1ZHNB 1SY6H 3E3QC 2FATH 4J3VA 2X4TA 1DQMH 3NTCL 1M1SA 4ZFZB 5E8EA 4PJXE 5T1DL 2OL3H 4U1HB 3S5LG 4NRZA 3L3IA 4U1JB 2X1WL 2XT1B 4HJGB 4PJ9D 3WXWH 1F4AA 4NQCE 3T8XA 1QBML 3BKCH 3UTTE 5EOCH 1U8NB 3BWUC 3BKJH 4I5BB 3GDBA 4TNWK 4U1NA 3FRPG 3VJ6A 1DBBH 2VL5A 5JZ7D 4M1GH 1RUKH 3CFDB 3VXQB 1JHLH 5D70H 3LRGA 4XMPH 1BX2B 5DSCA 1BBDH 1OOAA 3F5WA 4MSWA 5IMLB 3EZJB 1MLBB 3MV9D 1FRGH 5EBWB 1QR1A 1YMMB 1WEJH 4HIEB 1QZ1A 2FX8L 3C08L 5ALBH 2LU3A 4LAQH 3T4AA 4MD5B 2CK0L 1WBZB 2X4RA 4K7PX 4L1HA 1R5IA 3ALXA 1I7TA 3NACH 4H88L 5EU6B 5E70A 1CXKA 1H5BB 2OJZL 3SJVD 4BSJA 3UJJH 1J86A 4P2OA 3GGWB 4HUNB 3WNOA 1FG9C 4R26L 5E2WL 2YZ1A 2AJZA 2IFGA 1RZIA 3RI5K 4ODHH 3NFPA 1IQDA 4RQQB 1D9KC 4DCQB 2AK4A 3BIKB 4HV8B 3D18B 2EC9U 1X4YA 3KLDA 1UH4A 4D3CH 4Q6IA 4OGAC 1CDCA 3RVVD 3ARED 5E95B 4WU5B 3D39A 4KTYA 4NRYA 3GEWB 3O3UN 1RUPH 3RDTA 3RVTD 1G6VK 5J7CC 4DGIH 3L6FB 2GJ6B 5KG9A 2XRAL 2CJUH 1OAXH 3CFIC 4UT9L 3S7GA 3D69B 4NCC2 3TH2T 4PBXA 4F8QA 3GSWB 4Y5XB 3K2UL 1QNZL 2OTWB 4EOWH 3QCTL 3GSQB 1BQLH 1RFDL 1RUAH 1IL1A 2NY0D 1K3IA 3VXSA 1VEMA 1R3KA 4P2QB 1AKJB 3B5GA 3DO3A 5BV7C 1ZE3C 2AABH 3OKEB 4LKCA 2J4WH 3MACL 3C6LA 4FTVE 2ZCLH 4M5YH 1P6FA 4EI6B 1GIGL 3DV6A 1X3DA 1E0OB 4R2GC 5BRZE 3VH8A 3HZVB 5TQ2L 3PWNA 2OK0L 1MI5E 1JCKA 4I3RL 3OKYA 1MLCB 2BVPA 1H3XA 1XGRA 3SPVA 5L2KD 4YHKL 1UQSB 1EHLL 5HI3C 2D2OA 1CTNA 5I9QB 1NQBA 3EYOB 4LSRH 4XNXH 4U1IB 5A2LH 4P59L 4JFEA 1N5AA 4G80A 3DYPA 5IQ9A 3ZYJA 3QCUL 5A16A 1FGNL 4JFXA 4G8GB 4BELD 1TPXC 1FFQA 5HGBB 1I7UB 2X9WA 4I18C 5F7LB 2ZWLT 3ARQA 1SYSB 2BVEA 1P7KB 3BKYL 1ETZB 2L7JA 5TPWH 2EDNA 1MCOL 1UZ6F 1KB9J 2FBJL 4OM1L 3KS0H 4YO0B 1G1CA 3FRUA 2FLRT 3VXTA 4LQ1A 2IWGA 3RZCC 5IEHB 3I6LD 3UYRH 1CGYA 2PYFA 2B1AH 4RMUA 4JO1L 2EECA 3GSNB 3WDHA 3CXDL 4Z7VA 3W0WD 1PG7L 1DL7H 2VLRE 4EDXB 2X6MA 1RV6X 4JDVB 2CGRH 1BZ7A 2NX5D 1AR2A 4Q97A 2V7NA 2XN9D 2Z31D 4JN2A 4P23A 3A6OA 5GGSA 3VFTB 1U2CA 3B8YA 1KCRH 4FZ8H 4OFDA 3GSVA 2GEEA 5EPMA 1T89A 4Y16A 1IC5H 1IKNA 2IH1B 5C0RH 3LN5B 3WL9A 1ZHBA 2HRPH 5T1LA 2R2BA 4N0RA 2NZIA 2DQGL 4QHUA 2M1KA 1PKQA 4O2CA 3DV4A 1GHFL 4MMXC 3VG9C 1QVOB 3RGVA 5JQHC 3QZWB 4IRJA 5KS9F 4MNHA 2NY1B 4J1UB 4XPHH 2UZIH 5L0QC 1NGZB 3BJLA 5DJ8A 1A4JA 3HE6A 3WFEL 4KUCF 1OAZH 4O5LL 3VD5A 3RBSA 5CSGA 4CVWA 1T6VN 1X5ZA 2PTTA 2P5WE 4D9QE 3GHEH 5LJYH 5HVHC 3VXUD 1FL6A 5KANI 1HIMH 3RPIA 3WEXA 2JCCE 2Y4SA 1HINH 1XF4B 3U30C 4DUWA 3ECBB 3UJTH 3IAPA 1MHPH 1GAFL 1KJ2B 4YHYC 3HPLB 4QOKD 3TCXA 4YEEA 1T66C 3VFOA 1AY1H 2HP4A 2WWMC 3KPMA 1T04A 5TDOA 4E9LA 5BJTA 4F7TB 4I77L 3TO2B 1GCFA 2VLLB 1KIUA 5EBMA 2R4SH 1K4DB 1U8HA 1QD0A 3ALPA 5H2BB 4QY8B 4UZGA 1KV3A 3OF6A 1I3VA 1OQXA 3HG1B 5D7LB 3U4EB 4JHAH 1E4KA 3PG2A 1U8QB 1W8NA 1CI5A 3CC5B 2DIJA 3MGOA 5GJSH 1OGTA 1O0VA 4X7FC 4XNYL 4AIZB 4JPWL 4PJ5B 1LO0H 1CFTA 3UTQB 2FDBP 3LZFL 1P2CB 3CVHL 1URLA 3PHQB 5I1GL 2DYPA 1T0NA 4PREA 4YDVA 3RJQB 2B1HH 3CZFB 3TJHD 1JYWA 3DETC 1H0DB 3RAJL 5EUKA 2VOTA 3BKML 4A6YB 1B4JL 1UACH 2E6QA 4ACPA 4KUZH 1QKZH 4HKXB 4FQJH 5IJVA 1QSFD 5TDPB 4RDQG 4JDZA 15C8L 4UILL 5J12C 4ZS7L 1FFRA 3QWRA 2A6JA 5KVMC 1Q72H 3OWEA 1MJ7H 5EU3A 3BESR 2N7AA 4JG1L 2ITDA 5CEYA 3NAAH 1EFXB 3FO1A 1NCUA 1U8PB 3H9SB 4KRNA 1NCBL 1CLOL 3MLVH 5D1XB 5IFHH 1S9XB 5I1HL 4TOYH 1TZGL 4NO2B 3QXWA 5F6HI 5KZCD 2X44D 1JV5A 3R8BB 3WIIL 5A2KH 1UM6L 2KKQA 1DDHB 1F6FB 4GRWF 3DVNA 3RHWK 3JWOL 3V6FB 5HYQB 1RJYA 1SJVA 1I9IL 1ES0A 5H8DA 4J4PD 1MWAH 4HS8H 8FABA 3H0TA 1IRAY 1TETH 3AUVA 3T2NH 4N0YL 4UT7H 2A1WL 2EKSA 4QLRA 3EO0A 5T1MA 2WQRA 5HDBE 5TGBB 1NEZB 4EIZC 2QQQA 1KC5L 4JM4H 4P5KA 4UOW1 1A64A 3VD9A 1J5OH 2ED9A 4KPHL 2F8OA 4WW1B 1QQDA 4H8WL 3QDJD 5I66A 5C09D 4TSBL 4OZFA 5DYOB 4L4TE 4N0UA 2YUVA 3CLFL 3PABA 4KK8C 2Z8SA 2PTUA 4OI8A 4JM2A 3BZEA 2ICWA 3RIFF 1JPFA 4PJBB 1HSAB 4PY7A 4U4BA 4XVUD 3P73B 3MXVH 4ONFH 3UDWC 3X11B 3OKKA 4RIRB 1VFBA 3KPOA 1GSMA 3KJ6H 4JN1L 5SX5K 1T2QL 1MF2L 1RJLB 2DQCL 3ARTA 5M94B 1IEBB 5CGMA 2A77L 4LMQE 2Z9TA 4F7MB 1F02I 4QRRE 3QDGB 4I3SL 4LSTL 1B9ZA 3QR2A 2AXFA 4UOW0 1QR4A 4YHZL 4NUJB 4I0KA 3B2VH 2JF1A 4S2SB 1RMFL 1F11B 1U3HA 4ODUB 1NFDF 2H9GB 4FQ1H 1R0AL 1U0QA 3WS3B 3G5VA 3EOTL 4R8WL 1FO0A 1J05A 3CPLB 3E3QE 3T1WA 3ZYZA 3SGJA 5C8JA 3P77B 5DEFB 3ZKSD 4MXWL 1H5BC 5C2BL 2X4NB 5DGQA 5D2LE 5IGXL 4PJ7B 3BRFA 3TA3A 4EI5B 5ITFA 3ARGD 4YBQC 4XVJL 2F74B 2JJWA 4NFDA 4PUBL 2BC4B 1JNNL 1MUJB 4K9EC 4IDJH 2V7HA 3DVGA 3O4LB 2QHRL 2C1PA 3MRNA 4LAJH 4LEXH 5IKCA 1LDPL 1YDPB 1F90H 1CGTA 3L3HA 4I9WE 2D7MA 1DEDA 1BZ9A 2IPKB 1F3RB 3RWDB 1FZOB 1QG3A 1QRNB 3T0DA 1AE6L 1WISA 3NN8B 3EAKA 4FQ2L 4JEGB 1IM3B 1TZIA 4GBXA 5IHZB 3DX9B 3WMSA 5BZWA 5AD0B 2G75B 5EUOE 4ZFOL 1F4WL 1RUML 1DCLA 4KJWC 1JF6A 2V2TB 4Z7UA 1RK0B 1BVKA 3GFUA 4ZOEA 5F9JA 4WDIA 2X89D 4WNQA 4OD3H 1K2DA 2XKNB 1TVBB 2R39A 4NCDA 4Y5XC 3CSPA 2A6KB 1QFHA 5GSRA 1FGVH 3ILQC 1S9VA 5DD6A 5L2JA 1TVDA 3V7AG 1NBVH 2Y1VA 3WUZA 4IOIB 3OHXA 4LRNH 4C56A 5LCVL 3BGMA 4G5ZL 1AJ7L 4HPYH 1FZMB 2B4CH 3QDHA 3GMQA 3M1BA 4Q7DA 5MHSE 1KTLA 2XPGA 1V7MH 4E42A 1BOGA 3JVGC 2ENSA 3FO0L 3ZE1F 3MJ9H 2IANB 3O2WL 5I9QC 4OZHA 1C16B 3TIDA 3BSZL 4NZDA 4YHPA 3PWJB 3VGHA 4QGYA 3KYOA 4Q2ZB 2W60B 2OM5A 1SBSH 3JWDC 1MRCL 1JF1B 2R9HC 4YUEL 1MRFL 3FQWB 3RTQB 1FLRH 3FQXB 2VXVH 3QUZB 3TBTB 1KG0B 4JR9H 5DQJA 5KVDH 1YYLH 3MLZH 3RWHA 3R1GL 3WFBL 5GRWA 3I3EA 2VAAB 2MTPA 1MY7A 4PJIB 3IDUA 4AEIH 4MCYA 3SDXE 2CLZA 2YD1A 1JP5A 1NLBH 2M8XA 5JORA 3UTSA 4JLRB 1A5FH 3OKMB 2YKLL 1KTDB 2H6PB 3I85A 3IFOA 1DVFD 4DUVA 5HD8D 4PR5B 4QWWD 1OCWH 4OV5B 1OSZA 2R2EB 2A73B 3CFBA 4LCYA 3QPXL 1CBVL 1FH5H 1I75A 3MNWA 3L3KA 1GGTA 1G9MH 1KB9K 2BMKA 1RK1A 5E99L 2FD6H 3MRQB 1X5KA 1XEDA 4MXVE 5BVPL 3FOMB 1WWAX 2WP3O 4XBGB 1U8MA 3DUUB 3L5WA 2JB6B 3PWUB 4GMSL 2A0LD 1RPQA 5HGAB 3CFCH 4GG8B 4M7LL 3L95A 1OD7A 3RDTD 2P45B 1L6ZA 1U93B 3AY4C 2G60H 1JUFA 4RGND 1ORSB 5D96B 4WY7L 4P3DB 1BBJB 4K94L 2DOCA 4GRLD 2NY1C 4G6MH 1FPTL 4R6UA 3RUGE 4XPAH 5GZOC 2MCG1 4YDJB 1JNJA 1H3PL 4MJIE 1J1XL 2HTKD 2H2SC 4Z9KB 1LK2A 4RAHA 3VXSD 3THML 3P9WB 4PJGF 5JDSB 3QIWD 2YRPA 4LPUA 4WFGE 4RMWA 1CXIA 3D87B 1Y0LB 4LQFH 1FAIL 3C6LD 3L1OH 1MJJA 4PJHA 4EN3A 2P5EB 5EO9A 2XXMB 1OSPL 3IJSA 4TQEH 4ZUUB 5IQ7H 3IU4H 1LWRA 3KG5A 2YA1A 1KBGH 3C9NA 4LSQH 3VRJB 1PKOA 1YNTA 4JGJA 2XWTA 2V5TA 2D7NA 4YGVA 1FG2B 1U36A 4HXBH 3OL2A 3AAZB 1EIBA 2Q8BH 1KNOA 3O6FA 5BW7A 1WZ1L 4P2RA 4X6DB 5C7XL 2UWEB 3HZYB 5B39A 2DF3A 4PJCA 4Z95H 4K71B 1C5BL 3G5YA 4NT6A 5EU4B 3WFHA 5L6YL 1HOCB 2XZQH 5DJAB 5L8LB 1VADB 1NSNH 2OZ4A 4PRAB 4JY6A 4J3XA 2GW5A 2WQ8A 1MCDA 4N9OB 2C1OB 3QIUA 2EYSA 4B5EA 4HFWB 4WUKH 3MNZB 4ZUWB 2IAMA 4ORZC 5DGRA 1A6WH 2J12B 4BK5A 4K3HA 2GUOA 1OB1B 3A67L 3T0WA 1PEWA 1YN6A 2LFGA 5FYKD 5GGQH 4JO2L 1GGBH 3MV7D 3RNQB 1KLGB 8CGTA 2XTJB 2Z91B 1OAQH 2C9AA 1A7OL 3CVHB 4YE4L 3HUJB 1NDMA 2XFXA 3QXTA 2K7PA 3MOAL 3JV4A 1MAML 4U3HA 4W4NA 2OSLB 3ARPA 3DTXA 3ESVF 3VRIB 5F7EL 1Y18B 4NQSB 4P23D 2F8XC 1UB6B 4PJAB 4PJEB 1MEXL 1JNHB 1PQZA 3HAEB 4L8DB 3JV0A 3BN9D 4JRYA 3VXME 1NKOA 1P6AB 1IGCH 5HYJD 4HWBH 1MIEH 4GKNA 4KHTH 5D1XC 1L9MA 4X9IA 4Y8DC 5DMIH 5T1LD 4LSPL 4AZ8A 4HPOL 1T5XA 1H9VA 5DQ9A 5EZOH 4NZTH 1AC0A 2F58L 4XVTL 1YY8B 1S7QB 4KQ4L 2Q20A 1A6ZB 4BSWB 2R29L 5FO8B 2DQFA 5J6GB 4PGDB 2HH0L 4LLMB 5JR1L 3G9VA 3MA9L 3SDAA 1OAKH 3FB6A 5SWZE 4OD2B 3HE6D 4GS7B 4HIXH 2MHAB 3G5ZA 4CMMB 1ZKAA 2YK1H 3V0VB 4FQXA 1GVIA 3CZJA 2FJGA 1IAIM 5KVGL 3RVUD 2R1WA 1N4XL 4QHKI 3DX7A 1KLUB 1YNKL 1NGYA 2QHLA 1L4IA 4S11A 3D85B 3V6OC 3GMLB 5EO0B 2WK2A 3EYFA 4PJFE 5INCA 5HTSA 5HHOA 5GRUL 5E2TH 3C5ZB 4RZCB 3DMMB 3D9AH 3VXOB 5SWSE 1OM3L 2VISA 3X14A 3EDEA 4NM4L 5IJKA 4U6YA 3FTGA 1VKXA 2VXUH 2PCPA 1P9MC 5HYSB 5DWUH 3F7VB 1EGJH 1JGLH 3QUKB 3WLWC 3R06B 4HMCA 3OF6D 1EAPB 2VUYA 3T4YA 4M03A 4LSVH 5ENWA 3AS1A 5CGYC 1CGSL 1DUYA 5D7IA 2MQCA 3TVMA 1TJIH 3Q6GL 3H9HA 3KYMA 3MRIB 4W70A 4G8EB 4ODWA 4OIAA 3Q2CA 4PJDE 5MEOA 4LPTA 2K3TA 1IAKA 4E0RA 1WBXB 3HMWH 1CICB 2J88L 2ZPKH 4CMHB 3EYVA 4LHUB 2DYPD 2BSED 4AG4L 3MZGB 4I48B 4PP1D 1QLFB 1I9JL 1Z9LA 3CK0H 4LPCA 4M7KL 2XNAB 1FIGL 2X2YA 4MYWB 3S3JA 4P3CH 5FYJH 4XNQA 3X3GL 1WIOA 1EPFA 5F88A 3GSXB 4P2CG 4NOBA 1A7NL 1F6AA 4OCRL 3TPKA 1Q9KA 1Q9OB 3STLA 3VDAA 2ZJSL 1RZ8B 2RIKA 2D7TH 4UTAH 5GIRB 3SGKC 3QT2A 3MRRB 3GBNL 4JKMA 4X6CA 5LXGL 4LCIL 5EOQH 5FECB 3U1SL 5BS0D 1ROWA 5FUZL 4N0FA 3NVQA 5MERB 2CR3A 1A14L 3QEHB 3NIFE 4ZYKA 4LLDB 3ZL4L 3MCLL 1MY5A 1CFVH 5DVKA 2VDMH 1A2YA 4TRPL 4ZFOB 4YWGH 4Y1AE 3DECA 4DUXA 3LSOB 4OCYL 3ZKQD 4P4RB 1EO5A 1YEEL 1YMME 1UKTA 5I18H 2ADGA 1MPAH 1Z9OA 2LU4A 3RPKA 1ZSDB 3FN0L 3IDXL 4WV1A 4YX2L 5HVFB 2VLJE 3VGDA 3AM8C 4RDQF 1NDGB 2EYRA 5EU6E 5DMYA 3BT2H 3FN9A 5L9DH 5ABDE 3ULUC 3VXPB 1A9BA 6FABH 3U0TA 3WJLA 4Z7WB 4M7LT 1AP2B 3WUWB 5E6IB 4WI7A 3QWOA 5JNYA 1CFSB 4M43H 4LASH 5IHBA 1XIWA 4EVNB 2O93L 3O4OB 4GRWH 3W2DH 1U3ZA 2L7UA 2HFEA 1AXTH 2Z8WC 2V17H 1T20B 2IADA 3U0WH 2F54D 5EBLB 1E4XL 4BH8A 3TYFB 3OMZA 3X13A 1VGEL 2YSSB 5CGTA 3KYNA 1KT2B 1QBLL 5C07B 2DMCA 2E7BA 1F4XH 1K8IA 2H8PB 5IBTL 2Q86A 1DQDL 3S35L 3KXFA 5M95B 2AEPL 4HAFA 4ZOBA 5D9SA 2GJ6E 5DUMH 3L3IB 3RTQC 5T3XL 4M1CC 3Q6FA 2Z93A 3QUZC 4NUGH 1ZVYA 5C0EB 5D72H 3T8XB 1AGDA 4F58L 3ARFD 4FFVD 1XR8A 2D31B 4EQ2A 1D6EA 4ZUTA 2NW3A 4NRXA 4U1NB 1FC2D 4NQTA 1MHHB 4PB9H 3VJ6B 4P2QE 4RMTA 3AFLA 2FZ3A 4BZ1H 1P4BH 4Q0XL 4P4KD 1IGTA 3HNSH 3PWVA 1PDKA 1ZAGA 2IBZY 5DSCB 5B4MC 4IS6A 3V0WL 3LQAC 4YPJA 1PEZA 2DJ4A 5FF6A 3RX5A 1YPZB 2EDDA 5FCSH 1FO0L 2R1YA 4POUB 3ES6A 1TZHB 3MJ7A 4KKAD 3NTCH 3JBG7 4YLQT 3T4AB 4YC2B 2FR4B 3H3BC 2X4RB 5T1DH 4JFPA 1I1AA 1I7TB 4G8GE 2RGSA 1UB5A 4HS6A 5MENB 2AKRA 2JIXA 3AMLA 4TVSa 2UVFA 1F97A 4PJXA 4NHUA 3PNWA 3D1MC 1J0HA 4IRSB 4ZNCD 2AJZB 2YD9A 1RZIB 2WANA 1KGCE 1V7NL 4NBYB 3BXNB 4NQCA 1UENA 5FYJU 4RWHA 5C86A 3KPSD 2AK4B 5D7JD 5ELIA 3UTTA 3TN0A 3S88L 3S96A 1K5NB 1FJ1B 4JZOA 4Q6IB 4HCRA 3UYPA 1J1PL 1M6OB 4NNXB 4P5TA 4JVPA 1EUTA 2F15A 5LGKA 4KRMB 2ILLA 6CGTA 1I3GL 2CDGB 1RUQL 4FQHB 1SMAA 1MCJA 2BOBB 2QKIB 3HPJA 2FX8H 3BYYA 4WFHE 1U8KA 3C08H 3BP4B 1YN7A 4LCWA 2R2CA 1JI2A 2CK0H 5FKPA 1H3UA 3WV0A 2AI0H 1UXSB 1YC7A 1IL1B 2AAVA 2OJZH 4CNIB 3GIVA 1T3FB 4TNVF 5IROC 5JW4Q 4Y4KA 4K71C 5E2WH 3TF7C 3AGVA 5FM8A 4I0PB 2EDYA 1FN4A 4U1MA 4FXLA 3QEGL 5DJXB 3PL6A 3QRGL 1T21A 4AEHL 3HKFA 2BVPB 4M8VA 3HTLX 4K2UL 4N1EA 3L3GA 5B38B 3DVIA 3MLUL 2PUQT 3U2SB 2I9TB 2FLBT 5IQ9B 4Z0XA 1QFWM 3CU7A 2XRAH 1MCFA 4L8BA 4NYLA 4X0KB 3V5KA 4AJ0A 3ULVC 2XTJC 3CMGA 2LV4A 4HWZA 2BVTA 4KTDL 4LLVA 3QQ3A 1QNZH 4LNRA 1ACYL 3O9WB 3NCMA 4NDMB 2K1MA 1RFDH 1AFVL 4C58B 3B9KD 5C0GB 3FRUB 3FONA 3VI3E 3MACH 3VXTB 5DJDA 3SBWA 4AH2B 2D4FA 4CN4A 3BUTA 1RHHB 4S1RL 3S37L 1GIGH 1N5YL 1X5XA 1FORH 4X4XA 1IM9B 3U0PA 1T80A 5TQ2H 3UAJC 2OK0H 3TFKD 4Z7VB 5B8CA 1N0XL 4FTVA 4I3RH 2CUIA 5D5MF 3HG1E 5D7LE 5BRZA 1EHLH 4HK3N 2DBLL 4PLJD 2RJMA 1MI5A 3MV8D 4LBEB 3JWOC 4P59H 3WSQL 1TJHH 3QCUH 4KMTL 1FGNH 5GGSB 2UUDK 3QXAA 3GSVB 4GS7C 1VFUA 1WFNA 4P46D 1RZFL 2XA3A 4X7EC 2NY2D 4JANB 4N1CA 4U1KA 5CD3A 2DIBA 5ISZD 4YZFE 1V3LA 2CKBB 4O2CB 1E27B 1MCOH 2R23B 3HLAA 3IF1A 4X5LA 3OTTA 2A6DB 2ZG3A 3QNYA 2JJUA 4H8WC 3DX6A 4IRJB 2APTA 4Y19B 1JHKL 4XH2B 4OZIF 2E9IA 5DJ8B 3GSRB 1J87A 1J8HD 2E9JA 3QXVA 2G2RB 3C5ZC 3DMMC 3CXDH 5E2JA 2PYEE 1PG7H 3STZA 43CAA 3H9SE 3O6FD 2PTTB 2R1XA 3H9YA 1EEZB 2DDQH 2J7LA 1X44A 1DUZA 3RPIB 3WEXB 3S3PA 4DW2L 2VLRA 3TIEB 1Z3GL 3DBXA 3DHJA 4JKLA 5KSBF 2IAMD 2VTFA 5I8OL 2ADFL 4JCLA 1AO7D 3VFOB 4ZFFA 4ENEC 2DQGH 1JVKA 2OZ4L 1IAOB 3X12A 1W0WB 1GHFH 4KRLB 5E5UB 1G7PA 4CMHC 4LARL 4OIBA 1U8HB 3BPOB 5IMOA 1JIBA 1S7VB 2WUBL 2HVJA 1FE8L 4HUWB 1CD9B 3WFEH 3V6OE 2WIIB 4KV5F 3OR7A 4O5LH 3FFCB 4NNYA 3MGOB 4K55A 1OGTB 4PJBE 4MLIA 5FA3A 3IDJB 1CFTB 3DURA 2E8ZA 4OZ4A 3KLAB 1IKFH 4YDVB 5DUPL 2BJML 4TVPE 5DQDH 4JPKL 1HKLL 1GAFH 2P5WA 2JCCA 2CO6B 3QDGE 2EXYD 4R7NB 4OLXL 2BVQA 1EXUA 1BIHA 1YEFH 3BIAX 5IJVB 1A4KB 3TPUA 1HQ4B 3GB7A 1D5MB 3GBLA 3DHMA 4ZPVB 5D1ZB 2ITDB 1KSRA 5CEYB 5SWQA 5LGJB 1NUGA 1F4HA 2V5RA 3QDME 2GTZA 1YEDB 3MBED 4NQVA 2YPLB 4PRIB 3CSBA 4XP1H 2JK5A 2DTML 4L4VE 1DANT 4KHXL 1FFNB 3DX8A 2ATPA 4NQED 1MQKL 1S7SB 4XMLL 2N56A 3AXLA 5E6IC 2EIDA 2MQ0A 4KGLA 2G5RA 4S1DC 4XNYH 3RWCA 4JPWH 1XAUA 8FABB 1SJHA 1HQRA 3LZFH 3O4LE 5I1GH 4IMKC 3L5JA 2IJ0C 2WSKA 3O4OC 3KNBB 5ESQA 3EO0B 3K8MA 5DC0A 4LLAA 3WDJA 2WLZA 1IAMA 3RNKA 4L9LA 1XZ0A 5DLMH 1QA9A 3VFVB 3B2UD 1JL8A 2EIBA 3RAJH 2MOVA 1QRNE 2R0KL 1B4JH 2B20A 1R3JA 4O02L 1J11A 2I24N 4QHNB 4LGSB 4OZFB 15C8H 1EERB 1YEKL 3IJHA 4UILH 4X80L 3FQNA 4I2XE 4ZS7H 3RWJA 4JQIL 4OKDA 1UWEL 2YPKA 1I8IB 3TEUA 1CD1B 2BVYA 4JM2B 3VD3A 4JG1H 2VLKB 4DGYL 4KZDL 2QQNL 5IWLC 1NCBH 1CLOH 4HUMB 1VFAA 4PY7B 5CD5D 1TZGH 1MIML 2CDFB 3OKKB 4AQ1B 1G6RH 3WIIH 1VFBB 3KPOB 4KKCC 5F1IA 3JWOH 5DRNA 3NCBB 5E5MB 2GQHA 3UZEA 3CVIL 3DLQR 3ULUE 3FT4B 3IXTA 4ZOAA 5K9OB 4N0YH 2AXHA 2A1WH 2Y6SD 1IGYA 4G7YL 5CFHA 3U9PL 3OV6A 3H8NA 2E9WA 1WICA 1HKFA 3RIAK 1UJ3A 1KC5H 4HLZG 4H5SA 4YFEA 3G5VB 4KPHH 1DN2A 4H8WH 1HDMA 2YS4A 1IC4L 4YC2C 4TSBH 2EDLA 3CLFH 3BYTA 1ULVA 3U4BL 3WNNA 1U91B 4XP9L 3VGAB 1D7FA 4CGTA 3HI5L 4P2OC 2IH3B 3TM6A 4L4TA 1KOAA 3ROLA 3K2MC 5J3HD 1KJVB 4IRSC 5FB8A 3DVGB 5IK3A 4DAGL 4M1DL 1H8OA 4JN1H 1T2QH 1MF2H 5IKCB 2DQCH 2N4IA 3L3HB 1ZT1B 3UTZA 1BZ9B 2A77H 5DJYB 1WIUA 3BIBX 4Q6IC 4PJIE 4I3SH 4NSKA 2FJHA 1TZIB 4GBXB 3EUUA 5BZWB 4X9BA 3B6SB 3W9EA 1RMFH 4QRRA 3VWJD 4XCFL 5HY9A 1TCRA 4Z7UB 1BVKB 2FIKB 1NGQL 1R0AH 4IHOB 4DJMA 4WDIB 5SX5H 2FEEL 4XP6L 3EOTH 5CJ8A 4OFIA 2VLMD 1IGFL 4R8WH 5GRYA 2V9RA 3PQYD 1D5XA 2APFA 1QSZA 1QO3A 1EV2E 1NMBL 2NY3D 4MXWH 5GSRB 4MNQB 4UT6L 5T1KA 5DD6B 3OQ3B 5L2JB 2Q6WB 4LHQB 5GS3A 3C8DA 3SDDB 3BDYL 1JFQL 1NBYB 3T0XA 3WN5A 3OHXB 4GQPH 4PUBH 5KSVA 1JNNH 1MRDL 1MCKA 4C56B 4I0PC 1EX0A 5D2LA 1S3KL 4CDHA 1LDPH 2XPGB 3MRDA 3FOLA 1PG7W 1BOGB 1AE6H 4U49A 4CL7A 4FQ2H 4OZHB 3TIDB 3QNZA 5KW9L 5D6CA 1SJEA 4YHPB 3WFDL 5KN5A 2KL6A 1F4WH 1RUMH 3ABZA 4RBPH 1XGTA 2HAZA 4DOHB 1BREA 4PBWD 3CCHB 4K07A 4XC1H 3VFPB 3L3DB 1CLCA 5AEAA 1X5JA 1CN4A 1NFDB 3T3MF 4OLEA 4N8VG 4M61A 4W6WB 3L9RB 1T0MA 5IT2L 2NW2A 1NFIB 3BH8A 4H0GA 4OLVL 1D5IL 3V5HA 1NAKL 5LCVH 1W0VB 2ZOLA 4MCYB 4X6DE 4G5ZH 1AJ7H 3NFSL 2UWEE 1I1AD 3TGXA 3UTSB 3KS0J 1K8DB 1I9RL 4C4KO 4ODXA 5IESL 3ME0A 3RBGA 2Z8VC 2JIXD 43C9A 3WHXA 2CIIA 1NC2D 4PJ9B 4B41A 1VEPA 3FO0H 5DJCA 3O2WH 2W9LA 5HGHB 3CFBB 4LCYB 3BSZH 2FEDC 3L3KB 1X6NA 1C12A 1YEGL 3TH3T 1L0XA 1D9KA 3L7FA 2BMKB 3DOSA 4RMRA 5FM5M 1FYTA 5J06A 5HHQA 1MRCH 5ILTL 1SEBA 3OKOA 3ROOB 4FMKA 1L0QA 5FOJA 2WBKA 4FXGA 2EO9A 3H3KA 3L5WB 4YHIA 2PW1B 5MP6H 3RWFA 4P5TD 3ULVE 3JUZA 3HUJE 4G7VL 5FFLA 4PLNC 2H32A 3TCLA 5F7FA 3K3QA 2WMPA 3MROB 3R1GH 3WFBH 1RIHL 4KDWA 1HCFX 3RKDD 5E2UL 4MLSA 4IRJC 3EOAB 4NP4L 1ZGLB 1NBZB 2GHWB 4HCRL 5CS7A 2MCPH 4Y2DD 1KIQB 3MRKA 5HHNA 1LP9E 5D8JL 5HGDA 4K8RC 4XNZB 3FCTB 2YKLH 3MUZ1 2VR4A 1GOHA 1ZVSB 2WBJD 1V5JA 4HF5L 4PB0L 1FL5A 4DN3L 3CSGA 2CXKA 4K7FB 1CBVH 5F89A 3LB6C 3QPXH 3WO3B 1MJJB 4EN3B 5BXFA 5EO9B 2V5YA 3BW9B 3VMNA 3IJSB 3VRLE 1JPGB 2RAMA 1YNTB 5I1CL 1BEYL 1KENH 1KXTB 2QR0B 4S0TD 3FQRA 4MX7B 5BVPH 3BEVA 3GUTA 4O2FA 2BSTA 1JRHL 1KNOB 4LVEA 1BWWA 1HE7A 4O51B 1UVQA 4FP8L 4M7LH 2A9NH 4RGOL 3SKOA 4P2RB 5B39B 2XZCL 3P4MA 4UV7L 3G5YB 3FN3A 2RQ8A 3BHBA 2Q1EA 3E6HA 3Q1SL 3BPOC 4I18A 4K94H 3V5DA 1H15A 5GGVH 1FPTH 2UY7A 1INDL 3QIUB 1B4RA 5F70A 1E4XI 1TVHB 3LHPH 4WEMB 1H3PH 2PXYD 1CDHA 2A9ML 1J1XH 3QQ4A 3S5LB 4HS3A 3PJSA 1JN6A 3F6LA 3THMH 4YR6A 4ZO8A 3RUGA 2WW8A 3C60D 2LTQB 4F7PA 1YN6B 4YJZL 4MJIA 4PTUA 2ICWI 4BQ8A 2V9TA 1OSPH 4WJ5B 3ZKXC 1NDMB 1WTGT 5F93C 2FH6A 1INQB 4XMKL 1CXLA 3JV4B 4FTVD 5FV2A 1RSFA 5L2KB 5GRVK 3C09B 5HI4C 4UDTB 4E41D 4HKJB 5C0DA 4UBDC 1WZ1H 5C7XH 1C5BH 5L6YH 1XT5A 2NTSP 1BQSA 5D1ZC 1DEEB 4JRYB 3U7WL 5E4IA 3FKUS 2IMNA 1DBKL 1Y6NR 1J0IA 3QUXB 1NAMA 5FYLE 4HZLA 5GRVL 3LEYL 3DSFH 2B2XL 3SQBA 5JW5A 1KELL 3A67H 3FB5A 2DQFB 1WGOA 4JO2H 1Z0MA 1ZOXA 1ZWIB 1HXMA 1K9TA 2CLVB 1CG9B 4LLUB 3FB6B 1DBJL 5F8QC 2HT2C 4NZRL 3S36L 3TNMB 1A7OH 4YE4H 4PJGB 1S7UB 1T03H 3DYOA 4LCCB 2FL5A 5ICYB 5I8EA 1GGIL 4XZUA 3W0WB 3MOAH 1ODAA 5K9QG 1MAMH 4FQXB 3DRTA 2FJGB 5JO5B 2R1WB 3DX7B 2J8UA 1BF2A 2Z31B 5TF1L 1BM3H 2IFFL 1NGYB 3NIDF 1TNNA 2Q7YB 1U3JA 2HKFL 2VDKL 1MEXH 5GS2H 5J57B 1T0PB 3QEQD 4JM2C 4MB4A 5C6TL 1T2JA 5INCB 1JPTL 1ZV5A 4WUUB 3OZ9L 1CXEA 1KPRA 4Z7NE 3VXMA 4U6YB 1VKXB 3DRQA 1G7MA 5H37H 2F58H 4XVTH 4KQ3L 2H2PC 2PCPB 4KQ4H 2R29H 3BJ91 4YDLB 1FFPA 3D0LA 3LKSA 4KC3B 2HH0H 4Z7WE 4PTTA 5JR1H 4HGMA 3T09A 3T4YB 1RU9L 5DO2D 5ENWB 3MA9H 4ONOA 2YWYA 4JRXA 3DXAB 5FDWB 5T5NG 5J4MA 1NEUA 3OAZK 5FUOL 3TWCL 4DEPB 5KVGH 4NO0D 2X1XR 1IAKB 4E0RB 2MKLC 1N4XH 1YNKH 1H3TA 5C1MB 5HSFA 2P8PA 3SKJL 5C07E 5ITBH 3VGAC 4QRTB 4ZG1A 3GJFH 1DLHB 3QEUA 3V9FA 3TA3C 2QQKL 1S5HB 2X4UB 1LEGA 5GRUH 3IAQA 3E2HB 1IEHA 1OM3H 3BX7C 5F9DC 4NM4H 5F88B 5HHMD 4PJFA 4XWOD 3GJEA 2XWBB 1F6AB 1I8MB 3STLB 3T65A 1ZLVK 2GTWB 4ODTL 5SWSA 4PJ8A 3VD7A 4ETQA 4EJ1C 3MJ8B 4X6CB 3WIFA 2I9LA 1CGSH 1JWMA 4GBXC 3IVKB 4N0FB 4YQXL 4KDVA 4ZYKB 3D0VB 4KROB 5EORH 2C3XA 1A2YB 2NZ9D 4MZ3A 2AS5M 3DI3B 1YPZE 1YY9C 3VI4E 1TJGH 5GS0C 2J88H 3QB7C 1OGAB 4X98A 1U58A 1UWGL 3RL2B 4PJDA 2X5PA 1YQ2A 2W9EL 4H0HB 4MQTB 4M7KH 4KMQA 1SBBA 1FIGH 3FJTA 3SDDC 3TNNB 5MENE 4ZTPL 5LKNA 1A9BB 2YXMA 3IDMA 3U0TB 5D1QA 1F42A 3BE1L 3JSSA 3IYLW 4HK0A 4KU1A 1BD2D 4W6YB 4U1JA 2ZJSH 5D7SL 4HJGA 1XIWB 3P3YA 5CUSL 4G8FB 4MVBD 5IBLC 3V0AC 4UINH 2Y7QB 3GBNH 5IB5A 5LXGH 4LCIH 2EXWC 2R0ZL 5IB2A 4J12A 3U1SH 1U2HA 3UDWA 4I5BA 3X13B 1F13A 1FNAA 1G7LA 3TESA 1SJXA 3G5XB 3CFDA 3MCLH 2V5MA 3O6LH 4HLJA 5DA4A 1OTTD 5E1AB 3QHZL 3VXQA 2Q86B 5IW6A 1QTYT 1VPOL 4TRPH 3KXFB 4OCYH 1YEEH 1BX2A 1EMTL 1EEYB 4MQXD 3SGDH 2HA1A 1WAAF 3FN0H 1GGUA 3IDXH 1S7WA 4YX2H 3MGTB 4QYOB 1VENA 4Y1AA 5ICXB 3EFDL 4YXKL 4FS0A 2ATKA 1XR8B 4KK6C 5EBWA 1D6EB 1UM5L 1HILB 1YMMA 1JYNA 4HIEA 2NW3B 4NRXB 4D9RE 1UG9A 2VLJA 4MD5A 4QF1A 2FZ3B 3QDJB 5AG8A 2UYLB 3O41B 5EU6A 4CKVX 2VABB 3QG7L 1KCSL 1Q0XL 3FAWA 4GAJH 1IGTB 2QADB 5GGTA 2ICES 1YNLL 4G3YL 1ZMYA 3DIFB 4CVZB 3GGWA 4PJ9C 4DQOH 4YFLF 3BMWA 2CRMA 2R69L 4QXGL 1E4XH 1J18A 4PGEB 1RAMA 2R1YB 2ZUYA 3ES6B 4M4RA 4ZAKB 2NYYD 4D0DA 4RQQA 4LRIA 4CU7A 4DCQA 4HV8A 1XFPA 3D18A 5IBTH 3S35H 4OCXL 4JFPB 2WNGA 2CRIA 4XAKE 4U1LA 4C83A 4YAQA 5T3XH 4WU5A 5EU7C 5GS1B 4PY8I 4PJXB 4F58H 4NHUB 3L6FA 2F9BT 2P8LB 5C08E 2CIKA 2W0LA 5E8OB 2WM0A 3D69A 5IVNA 3KPLB 3KWWA 5DHVA 2XICA 3IXAA 2XXCB 3QG6A 3QUYD 3ARBD 3GSWA 1AR1D 2KQMA 4Y5XA 5GGRB 3UTTB 1HXYA 4Q0XH 3O2DA 4AM0A 1DQJA 3E6FB 3LKRA 4JZOB 4QXWA 5FGCE 2EE2A 4XPGH 2OCFD 1WLHA 4P2QA 1AKJA 3QI9D 1J0JA 2FCBA 3V0WH 1MCNA 1FFOA 3SHSA 3AS3A 4KVNL 2XA8H 2XTLA 1A21A 3ARRA 4EN3C 1FO0H 4EI6A 3LAFA 1LDSA 2J3SA 1U8KB 1ADQA 3HZVA 1YN7B 4LCWB 2EE6A 4QTIL 5T3ZE 3OXSA 4LP4A 5FKPB 2HMIC 2OXGA 4ZUSB 4BK4A 1CLYL 3JVGA 1UQSA 3BQUA 3BZDA 3S34L 3CH1A 4UOJA 4U1IA 3SQOL 4ZOCA 3OJDB 1NMAL 1YQVL 5E56A 5BW7C 1D5ZB 3CIQA 1MCBA 3AS2A 4G8GA 5EN2B 1BVLA 1V7NH 5HGBA 2AJ3B 4M8QB 3HI6H 3DNKA 1VACA 3QIUC 1T21B 1SYSA 1OVZA 5GRZA 5IEKA 1ETZA 3G6JF 4Y19E 4DK3A 3L3GB 1J1PH 3V6ZB 2VXSL 1IZKA 3HE7D 1UM4L 1ZT7A 3O8XB 4YO0A 4OV6F 2LTQC 1I3GH 1ED3A 1RUQH 4BKLA 4Y4HA 2Q7NA 4NYLB 3V5KB 3GSNA 3MRBB 3H7LA 2B7DT 1OY3B 2HJKB 3QO0B 3H6JA 2VDQL 4XXDB 1MCCA 4LNRB 4JDVA 5F7KC 4CJ0A 3C09C 5CWSA 2LABA 1P5UA 1JTTA 5A2FA 3QPQC 4GLRI 5MHSD 1FL3B 5C9KA 1IAIL 1D9KD 4IIQA 5KOMC 5CEXB 1WF5A 4GO6B 1HYSC 4AY0A 1X5HA 2OTUB 2HG5A 2IH1A 3DUSA 3QEGH 5HDQL 3TJEH 4EBQH 3QRGH 4AEHH 4KK5D 3QUXC 3JV6A 2RB8A 1HHHB 4K2UH 4UNUA 5DFTA 3EOBA 5BRZB 1WIPA 5A2JH 3AY4A 3SDCB 1UZ6E 2VZSA 3T0BA 3MLUH 1QVOA 2XV6B 1MI5B 2NLJB 2O5ZL 3L5XL 4H1LG 3ZHDA 3FFCE 1P53A 4WEBH 4L3ED 1NGZA 1OAUL 2BY3A 2AP2A 4L5FL 4LCCC 3IRPX 1DTUA 4KTDH 1N59B 4PV8B 1DVFB 4FQXC 1ACYH 3DPBA 4U1KB 5CJXA 2MKWA 1AFVH 1AGBB 3HLAB 2W9DL 4LIQE 5CEZD 3OJ2C 3GM8A 2J5LB 3ZT7A 3QNYB 5F44A 4R2GD 2OR8A 5L8JB 3F62A 4N1HB 5JW4R 3LMJL 4OGXH 3S37H 4FQLL 3EJZD 1N5YH 5BV7L 3MLRL 3LPGA 1BIIB 4Z0BL 5IMMB 4R3SB 5HI3D 1NCTA 3T2PA 1N0XH 2YRZA 43CAB 2B8OT 1KTKE 3TO2A 2VLLA 1N6VA 2FEEI 2YPLE 2DBLH 3ARDA 4PRIE 1KB5B 3KPRA 4IOFC 4YHML 1PFCA 1O5DT 2JJSA 1KIRB 5H2BA 3WSQH 4YDLC 5ALCL 3MJGX 4GRLB 4KMTH 1DE4B 3HG1A 5D7LA 3U4EA 1E4WL 4N0CC 1EO8H 3IFNL 3TVMC 1U8QA 1AGCA 2D03L 3T1FB 4XHJC 1RZFH 4X4ZA 1CE1L 1P84K 4TSCH 3CC5A 4OF8A 1BAFH 5KJRL 1YC8A 4DEPC 3MRJB 5ANME 3RZCD 4W4OC 1DANU 3PHQA 5IG7A 3VDBA 1JZ5A 4XVSL 1C08B 2VR5A 3CZFA 4CVXB 2UUDH 4NPYB 1I1YB 4WFGD 1JHKH 1H0DA 3VXRE 4A6YA 3ISWA 4FQPA 3I3DA 4WW2F 1UWXK 5C0AB 4HKXA 4O58H 3E2HC 1RIUL 2VLKE 3OR7B 2BCKB 1IC7H 5GGRY 2IQ9L 2XZZA 3M17B 2AXJA 1NUFA 4R7DB 4WRLA 5FA3B 3DURB 4N8VA 1QSEA 4RFNC 5F8RC 3QP3A 5DRXB 2PYEA 4DW2H 1EFXA 1Z3GH 2UZYB 3H9SA 2ZOKB 1FZKB 4J23A 1BQHG 4HULB 2P5WB 1S9XA 5D5MB 4NO2A 4YDIH 4JGMA 1WZKA 2JCCB 1Z0NA 2D0HA 3A6BH 1ZS8B 1DDHA 3GI9L 3MUY1 3V6FA 4KDTA 4NQDE 5HYQA 3BEWB 1PZUB 1R6VA 5I8OH 2ADFH 4KROC 5KANG 4GFTB 5K9JL 4YHLL 3TPUB 5CHNB 4NZJA 3ZYOA 3Q5OA 3BGAA 2OZ4H 3OR6B 4U6XA 3LS5L 3CFKA 3GB7B 1GZQB 1X4XA 2OQJB 3P0VH 5CAYB 3NCYP 1FC1A 4WO4D 2HLFC 2EZ0C 3IT8D 5TGBA 5F1OB 1R5WB 2W0PA 1NAML 1LHZA 4AQOA 1NEZA 4N8PA 2ICEA 3MBXL 1S8DB 3CSYA 5ETUA 2WUBH 2CH8A 5EC2A 2JK5B 4JO4L 1FE8H 4WW1A 4NKDB 3DX8B 2ATPB 3KYAA 3V8OA 3WJLC 5LG1A 5DA0B 3CXHJ 3A6CL 4OCNC 3RWCB 1I8KB 3V6OA 1XIWC 1RJCA 5FAAA 5ESQB 1QBBA 2QSCL 4ZNEE 5DUPH 2BJMH 4PJBA 4JPKH 1XZ0B 1HKLH 1HSAA 3W11C 2NXZB 2WWMD 4RIRA 3HN3A 1CCZA 4UQ3B 1R3JB 4OLXH 3OXRB 3AU1A 2VUOA 1P9MA 5JHDB 3ZLQC 1A9EB 4J4PC 3NMEA 3QDGA 4XPFL 1SQ2N 5KSBB 2DM4A 4NUJA 4S2SA 5JXEA 2Q3ZA 4JG0H 1YECH 3PHOB 4NNPH 5DS8B 4UDUB 2AEQL 4JFHD 4J3WA 7FABL 3WS3A 1FIEA 2DTMH 2DMBA 4MNQE 4OLYL 5DRNB 5SWZD 3QDMA 4KHXH 5F97E 4XMLH 1MQKH 5IHUL 2EDRA 2C5DC 1MCWW 4C56E 2QADC 4L4VA 2X4NA 3DETD 3NZHL 4OLWL 1SEQL 2PTVA 5CJ5A 4EI5A 1QACA 1JRHI 5E8NA 2F74A 4DGVL 2RCSL 4J3TA 3FFDA 2BC4A 2VZVA 1MUJA 4HIIA 1L9NA 3TBSB 3O4LA 4LGPB 3LDBB 4ZAKC 1KPVA 2R0KH 4IEFB 4O02H 1HHKB 4U6TA 1YDPA 4HBCH 4NKMB 1HDMB 1A1MA 2IPKA 3SGKA 4OD1L 5SWSD 1FZOA 1YEKH 2OI9B 3RWDA 4JQIH 3NN8A 4OCWL 1I1RA 1UWEH 4DOHE 2YEZA 4PYHA 2M2DA 4DGYH 5GS1C 5IHZA 4KZDH 5AD0A 1FNHA 2G75A 2QQNH 4I2XA 2V2TA 2BNQD 1RK0A 1NFDE 1MIMH 1Q9LB 3VFNB 1SM3H 5GGVY 2XKNA 4GLRH 1TVBA 3TN0C 4NQXB 4ZXBD 2ZCKL 2A6KA 3D5OF 2D9CA 3CVIH 1JPSL 4QCIB 4CJ1A 2AJVL 2COQA 3AM8A 3TBWB 2ARJB 4NSKB 5CSBA 2FJHB 1OWRM 4J3SA 4G7YH 4IOIA 3U9PH 5I2IB 1TITA 2CUMA 4K7PY 5HY9B 1TCRB 1FZMA 5CZXC 4R4BA 4KK8D 5IHLB 3HNVH 1IC4H 1QFUL 3EO9H 1QO3B 2EDHA 3U4BH 5T1KB 4XP9H 1C16A 5BS0B 1PG7X 3C2AL 4Q2ZA 4ONHA 5EU7E 1F45A 4JKWA 4M1DH 3NCFB 1GRWA 3V95A 2BSRA 3FQWA 3RTQA 5C71A 4K3EL 3B8SA 3FQXA 2OX5A 1VCAA 3MRDB 4TYUA 3TBTA 1KG0A 1FVCB 1CF8L 3QFDB 3KHOA 3N1FC 2J6EA 3H3PL 5KSAB 4KAQL 3O8XC 4QHKJ 4ZDHA 1YMMD 5IB1B 1TFHA 3ZDXF 4IBLT 5KN5B 4XCFH 2FNBA 3QHFL 5DRWA 1NGQH 5EU6D 4JLRA 5I30L 2R4RL 1IGFH 3OKMA 1KTDA 2H6PA 2DQIL 2HT3D 4QXUH 3V4UL 4LEOB 4PR5A 4OV5A 2R2EA 4YBQD 3ZE1E 1NMBH 2A73A 3SOBL 4XP5L 4ZMAT 1I3UA 4UT6H 4ELMF 2LQRA 3B83A 1MVUA 1CFNB 2NW2B 1UYWL 1QEWA 3BH8B 1JFQH 4PS4H 3B9VA 5IUSA 3SBWC 5GGTL 2ZOLB 3QBTB 1S3KH 1BGXL 4XBGA 3DUUA 3W39A 2JB6A 3PWUA 1LK3L 5TFSL 5B8CC 5HGAA 5JLZB 4GG8A 4K9EL 4WVRA 5F9OL 4OSUL 3ARFB 5DJCB 5EUOF 1U8IB 3SDCC 4KJWD 2GJ6D 1BJ8A 1ORSA 4PG2A 3MFFA 1CQKA 3O2VL 1BBJA 1QFPA 2AJXL 3VFMB 3WFDH 3L7FB 1WZMA 1FYTB 3L7EB 4YDJA 1Y6KR 4P4KB 4MAYD 1EJOH 4XBEL 2Z92B 3ILQD 1G7HB 3RWFB 1DVFC 3X3FL 1KCKA 3TCLB 1FSKB 3H42L 1RZGB 3MR9A 2J5LC 4F37F 4ZUUA 5L2KE 2DQDL 4KJQC 4MQSB 3O2DL 4OLVH 1D5IH 2OR9L 1NAKH 3P9LA 4JO3H 3VRJA 1TXKA 1CDUA 4MMZC 3NFSH 5E5RB 5HHNB 1FG2A 5E9DA 1I9RH 4C55A 1I3RB 5IESH 4JRYE 4NM8L 2FHCA 5IVOA 4X6DA 2UWEA 4JHWL 1FL5B 2AJSL 1ADQL 5EU4A 1HOCA 2X4QB 2ZCHL 2Y25A 4UV4L 5BXFB 1YEGH 3MNVA 4PRAA 1GC1L 2R9HD 1XH3A 2C1OA 2PO6B 3KPSB 1MFNA 2FSEA 3HRPA 3PGDB 2P44B 4FFZH 2DD8L 3MNZA 4ZUWA 1LVEA 5F96L 5ILTH 3HB3D 3FB7B 3I6LE 4UAOB 3ZDZF 3GUTB 4O2FB 2BSTB 1OB1A 4PLOB 4JPIB 4PJGE 4G7VH 1UCBH 3TT1L 3JWDL 2IGFL 4Y89A 3W0WE 2JELL 2QEJA 4M5ZL 3VWKA 3SDXF 4HBQA 4MXQC 4WI3A 3RNQA 3MLYH 2YD5A 5E08L 5E2UH 2NX5E 3E6HB 3HUJA 4NP4H 3OB8A 1MFDL 3ZT5A 4HCRH 2ERJB 5AUMA 5IW1B 1S9WB 3UPCA 2VDNL 4O9HL 2OSLA 5D8JH 1P7HL 3VRIA 2W0FA 3PJSB 2XKUA 4HS3B 1JN6B 1Y18A 4PRPB 1R24B 3HNTL 3N9GL 1LP9A 4HF5H 4F7PB 1JNHA 4WUUE 1TQCB 3GSNL 3HAEA 4L8DA 3WJJA 4DN3H 4PTUB 5FM4A 1MCEA 1JWSB 2Y06L 3TZVD 1WCBA 1I8LA 5HHVL 1MCQA 4JFFD 3MO1B 5FIEA 5I1CH 1BEYH 4HXAL 1NLDL 1JYVA 3MSPA 3HRZA 1YY8A 1S7QA 1RZJL 1A6ZA 1JRHH 4BSWA 1J88A 4RGOH 5C0DB 4UTBL 4FP8H 5J6GA 3DXAE 4PGDA 5AYUL 4KXZI 4LLMA 4WHCA 4OZGF 2XZCH 3LN9A 4UV7H 2HTLC 4MD4A 2XQYG 3B5HA 4OD2A 3Q1SH 1UZ8B 2EH7L 2V9QA 2MHAA 4FFYL 4UB0L 2NR6D 5CZKA 5EC1A 4CMMA 1INDH 2WV3A 3V0VA 4G6FB 4WTZG 2VQTA 2PR4L 4U0RB 5FYJD 2I60H 3B9KB 5JW5B 5EDXA 3VGGA 5DVMA 3D85A 3GMLA 4MA1B 1XGYL 4L9LC 3C5ZA 4RZCA 3DMMA 4ZO7A 2NXZC 5I8EB 3M8OL 4XMKH 3MUHL 1JPST 4I0CC 5BVJA 2DKSA 2AJYL 1G7QB 2CMRL 2WZPD 1DSFL 2J8UB 4Q9BA 5HYSA 5GHWL 1UH2A 3QAZC 4RRPG 3R06A 3V6BR 1EAPA 1ITBB 3P11L 3V7MA 3GSOB 1FVEA 3HG1D 5D7LD 4KGJA 4LMQI 4KJYA 3U7WH 2X9XA 1D6VL 1MCSA 5I1LB 4XP4L 1JZ4A 1FZJB 1DBKH 2FBOJ 1OGAE 2ZUVA 1ZGLM 5E2VL 3RA7L 1KPRB 5ISZB 3LEYH 4PJ5D 1WBXA 1CICA 3EO1B 2B2XH 4X5XB 4S1QL 4LHUA 2UY6A 5IW3A 1KELH 3P4OB 1IQWL 3SGEI 1CGVA 4I48A 4OM0L 3T0AA 4MDJB 1QSFE 3LKSB 2DICA 1QLFA 4EIGB 2NCMA 4PTTB 1R3LA 4WHDA 4APQA 5D2NB 2XNAA 3V79C 4D0BA 1MFAL 5JIKA 3WNMA 1DBJH 1XGUA 4NZRH 3S36H 4JRXB 1MNUL 1YYMH 3O45A 4WTXA 4Y5VA 1GGIH 1M7DA 4LDEB 1BECA 3GSXA 5F1KC 3LDBC 5FEBA 5FO9A 3K81A 1KF9B 3I9GL 4OFYD 3GKZA 4HUXA 1RZ8A 2Z4QB 4J8RA 1MWAA 5TF1H 2IFFH 2OI9C 3MRRA 4ETYA 1EFXD 2FX7L 1CDBA 5FECA 3H9SD 4A6YL 3RVWD 2HJFB 5D1XD 3KXFE 2FGWL 5MERA 3U6RA 5C6TH 3F7RA 1JPTH 4Q58C 1CFBA 3OZ9H 2YHGA 1WITA 2ZUWA 4MD0B 3GJEB 4P4RA 4QHLA 4JFZL 3RY6A 2ZSVB 4KQ3H 3T65B 1ZSDA 2AXGB 4PJ8B 1N64L 5DZNA 3QDJE 2H45A 5C09E 1NDGA 3O0RH 2I9LB 3QUMB 1JWMB 2GI7A 3VXPA 2HKHL 3D6GA 1IAII 4JB9L 4Z7WA 5L7XL 3WUWA 5E6IA 5IFJB 2VZUA 4Q9CA 5FUOH 2X7LB 1CFSA 1KULA 5ADPL 4GW1A 1NCCL 3MCKB 4PJDB 3SKJH 4H1LA 5DURB 3TYFA 2QQKH 2R56L 4V1DD 3OKDB 2YSSA 1KT2A 4YBHA 1TQBB 4WFEE 3U9UB 3WN5C 3NCJL 3OGOE 5C07A 3IDMB 3QQ9C 3CFEB 2H8PA 5D1QB 3OAZH 1B3JA 4HK0B 1IILE 2O61A 3WLWD 4Y5YB 2M26A 4ODTH 5C0EA 3PHSA 3NIGF 5IWLA 5IB5B 2D31A 5IB2B 5IM7B 5KSAC 2IEPA 4TVPL 4UIKL 1UJTA 4YQXH 1MHHA 4HG4K 1G7LB 5BZDA 2DB8A 5DUBB 3CUPA 5ACMA 4NQEB 2DS4A 2BRRH 1ZHLA 5IW6B 1X4ZA 5HI5C 4FQIL 4DKFL 2QQLL 3RWEB 1GXEA 2LVEA 3W9DA 2ARJQ 3D2UB 5JOFB 1UWGH 1RVFL 1S7WB 4LCWE 1XGQB 1WSST 4Y4FD 5CP7B 1LO4L 3VXNB 4WWKD 4Y1AB 2ATKB 1YPZA 3GMPA 4P0DA 2AW2A 1TZHA 3LN4A 4ZTPH 2VLJB 4QF1B 2FR4A 1EBAA 2IG2L 3BE1H 1CIDA 3CDCA 4G9DA 1JTPA 1QRND 3VU2A 5MENA 4L8CB 1GGCH 5D7SH 3V4VH 3ZMRA 5CUSH 4YFDB 5JA8B 2OMBA 1MFCL 2XQBL 3ARFC 4FFVC 4IRSA 5IVXF 1LE5A 4RFEB 1ZA3B 3BXNA 4D0DB 1CR9L 2DWEA 3AROA 4MAUL 3SE4C 1KJ3L 1K5NA 1FJ1A 3QHZH 3IFPB 1VPOH 5FOBB 4OIIL 2MFNA 4U1LB 4C83B 4YAQB 1M6OA 4NNXA 1JHTB 2NY6D 3IDIB 4UUJB 4KI5F 4KRPB 2CDGA 4YXKH 4FQHA 3EFDH 3ULUD 1FSKC 1U3YA 1UM5H 2CIKB 2BOBA 2QKIA 2X4PA 1PAMA 3FHAA 4X6FB 3BP4A 3KWWB 3PWPD 4KKAC 5DHVB 3IXAB 3QG6B 2GFBB 4BQCA 1ZA6B 1YZZA 3BAEL 3G04B 1HXYB 4KXZH 4AM0B 3WXWL 1DQJB 1FDLL 3LKRB 1UXSA 1KCSH 1Q0XH 3BZFB 5C0BD 2P24B 1YNLH 2IAND 2D7PA 4CNIA 3ULUL 2IF7A 2P46B 4F3FB 4PLKC 1T3FA 2QSQA 4GMTL 4ZO9A 5ID1A 1DP0A 1FFOB 2MMXA 2R69H 4QXGH 2NY4D 4I0PA 2E27H 1WBYA 4KK9D 5DJXA 1JHLL 4AT6B 2PO6C 5D70L 4L9DA 4XMPL 3OXSB 4M1CD 1W72B 4NHCL 3QUZD 4OCXH 1CDGA 3BQUB 4QRQA 4UAOC 3CH1B 5B38A 4YDKL 1FRGL 3QIBD 3GMRB 3U2SA 4BZYA 2I9TA 1CU4H 3QA3A 3VWJB 4ZQKB 4X0KA 4FG6D 1LD9B 1BVLB 4W68A 3NACL 2R0LL 2IPUK 3MRLB 1VACB 4CW1A 2J6EL 2ERJC 5C08A 4TUKL 5B4MD 3WNPA 5ACZA 3O9WA 4HHAB 5IEKB 5K9KA 1B2WL 3GMMB 4NDMA 3W5NA 3S98A 4L4JA 4GUPB 1TIUA 1ZT7B 4R4NC 5C0GA 1U8LA 4HWEL 5DK0A 4AH2A 4QRUA 1TQCC 1ED3B 4XB8A 4BKLB 2VDRL 4KVNH 1RHHA 4Y4HB 1J7VR 5EIIA 3MYZA 4D3CL 2WUCH 1OP5K 1IM9A 1BMGA 3LQAL 1A7BA 2LU7A 4QTIH 4RGNE 3V7AE 3SGEH 4EDWL 2DQJH 4O4YL 1CLYH 4KVCL 5ERWB 3VFUA 3S34H 5CWSB 5K59F 3SQOH 3Q3GA 4OGYH 4HD9A 4LBEA 1OAXL 4WI6A 4B0MM 1NMAH 1YQVH 5KSUA 2BK8A 3JTTB 2CSPA 1QUNA 4IIQB 3QRFM 2Y23A 3W5MA 2J2ZA 1A6TB 4EOWL 2HG5B 4NO3B 3P9MB 1W0YT 3DUSB 1RUAL 4Q9RL 3MLPA 4JANA 3JV6B 4U0RC 5C9JB 3UTOA 2CKBA 1E27A 2R23A 3EOBB 1A02N 3BP6B 5J1AB 1UM4H 2A6DA 3B9KC 1CK0L 1NC4A 2P5ED 5C0AE 4ZFGL 4Y19A 4IJ3B 4XH2A 1MCIA 2H26B 2CUHA 3GSRA 4G9FB 2G2RA 5I1JL 1JGVL 4R96A 2VDQH 5KTEL 4XNXL 2BNRB 2VN4A 2APWA 1RZ7L 1FAKT 1EEZA 1YMHB 4X6BB 5D5ME 3P0YL 3QFJD 5KVFL 4OI9A 3TIEA 1F4YL 1EO7A 1IAIH 4A2LA 5I1EL 2QL1A 1PZ5B 4NN7B 4AEEA 5FYKE 5C0FB 5HDQH 5DC9B 2FWOA 3MV7E 5CIPH 4MJ5A 2H3NB 3EJYC 1Q8MA 4ESKA 1IAOA 4UI2A 1W0WA 2AV1B 2Z0BA 1KACB 4KMLB 3I84A 3ARDB 3KPRB 2MPAL 3BDBA 3ULVD 2XTJD 1T83C 3D3VD 3L5XH 4CVUA 1G84A 3CX5K 5FA4A 4QT5A 1S7VA 5D2NC 4OZIE 1AGFB 1OAUH 4HUWA 4WHTA 3MRPA 4L5FH 2WIIA 1AGCB 2QBWA 2H32H 3FFCA 4FQQA 5HYJE 4ODBD 2WBJB 4JJHA 3VI3F 3IDJA 3ULVL 3WD5H 2ADIA 2W9DH 5IG7B 1KCRL 3KLAA 4DN4L 4OCLC 1NCWL 4JE4B 1ZK9A 2X09A 2EEAA 5JHDE 3UAJD 4OF7A 4D8PB 4OTXL 4FQLH 5BV7H 4R7NA 5KSBE 3MLRH 2HFFA 4PD4K 4Z0BH 3LPFA 1A4KA 2PN5A 3ZZ1A 5CEZH 4ZTOL 2OR7A 3CFJA 1HQ4A 3DGCR 5I73B 1QLRA 4N8VB 1D5MA 1QSEB 4XPHL 4ZPVA 5D1ZA 2MQ3A 4MDIB 4PJ8C 2PYEB 3S35X 5ALCH 4OUUB 5LGJA 4NWUL 1YEDA 4ONGL 3VD4A 1MHEB 3EYSH 4ISVA 5CCKL 2YPLA 3JTSA 3TC9A 5KBNC 4PRIA 5LGHL 1B0RA 3IFNH 1IGIL 1FFNA 2D03H 1S7SA 1PVHA 4KV5E 4YH6A 3S4SG 1CE1H 3MXWH 5KJRH 3C60B 4GOSA 2FB4H 1RJZA 4Z7QF 5DJ2B 2F53A 1HK6A 4U6XB 4OFVA 1E28B 3I6GB 3KNBA 3CFKB 4P9HC 3OG4B 4XVSH 1QHOA 4JZJB 4NBXB 4AENB 3VFVA 5C0NC 3C5ZD 3QWQB 3HR5B 2ICEB 5ANMA 3PP3K 2OLDA 3CSYB 2ED8A 5EC2B 5ETUB 2EXYC 4PRHB 5F7MC 1TQBC 5HPMB 1X5LA 4A2MA 4CAGA 4QHNA