2ADJA

Crystal structure of monoclonal anti-cd4 antibody q425 in complex with calcium
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
211
Chain Sequence
ETTVTQSPASLSVAIGEKVTIRCITSTDIDDDMNWYQQKPGEPPKFFISEGNTLRPGVPSRFSSSGYGTDFVFTIENMLSEDVADYYCLQSDTLPLTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Q425 Fab Light chain
publication title Interfacial metal and antibody recognition.
pubmed doi rcsb
total genus 43
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adjA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adjA01
1FZOA 1QQDB 2ZSWA 4UBDC 3QFJE 4M7LL 1F8TH 4MAYC 4PJ5E 4JPWL 1UWXH 4KHTL 1CDUA 3UROR 1IAKA 5DA4A 3QUMB 1RZFH 2IG2H 2X4OA 4QRUB 4XWOD 5GGQL 3G5VB 5T1LD 2YPKB 1DEEB 3KPRA 3OKOB 5AZ2H 1OT2A 1NAMH 3HKFA 5DEZA 4M6ML 3VFOB 3ULVL 4X98B 2DQUH 1MJJA 5EZLB 2PTVA 3GIZL 4MZ3A 1CU4L 2E6JA 4R8WL 4XNQA 4PJIB 3VGFA 3FQUA 1EAJA 1UB5B 5FYJE 1I9RL 1XGQB 2DQCL 2EDFA 4D8PB 5GISL 1GRWA 2OJZH 5I8CB 5D5MB 5JOFA 4U3XA 4GMTH 3ES6A 2Q8AL 4E0RA 2W1NA 3U4EB 4PRBB 2WUBL 3MXWH 4G43A 1A1MB 5EU4A 1Z5LA 3BIBX 1ZLSH 3O8XC 2YC1A 3MRGA 3B3IB 4G8EB 4KUCF 5JXED 3ARVA 1AGCA 2EEDA 3OV6A 4NNYA 1NH6A 4S1RL 4MYWB 3DX8B 4WV1B 4GKZA 4L4JA 3GO1L 2CRMA 4LCWD 5KG9A 2RAMA 1I7UA 2C3VA 4GBXB 5D9SB 5ADOL 4IOIB 2EIBA 1EX0A 4BFIB 1SM3H 5IBTH 2EDTA 4I4WB 1OAKH 4BFBD 5C1MB 2YBRB 4U6YA 1H3UA 3FHAA 4GXUM 1OSPL 5JW3H 1CD8A 4FQQA 4ZUWB 1ZT4A 4BSVB 1DANT 1UJ3C 3ROOA 3CVHA 2W0FB 5EO1A 3SE9L 1BLNA 3EYUH 2DQIH 4FP8H 1W0WB 4J4PC 4XP9L 2V9TA 3CDFA 4MXQC 3WIHH 1Q0YH 3BFOA 1HILB 4HGKC 4WHDA 4HCRH 3RZCD 1CK0H 1K3ZA 2X1PA 3FONB 2ESVD 3C09B 2LAGB 2OM5A 2XKNB 2NZ9D 3LH2L 5ID1A 1CGSL 4KJPD 3CSGA 4XP1L 2BY1A 5AZEL 3T8XA 4PRPA 3OJDA 2HAZA 5L8LB 5IB4B 1U3HD 1U3JA 2C3GA 1KENL 4XNXL 5EZOH 1RQ5A 4DZBA 3T2QA 3CU7A 3FRPG 1W8NA 4QXTA 5D7JB 4X4XA 4XWGH 2QHRL 2EDRA 4MNHB 2FEDD 1OVZA 4IHOB 1EEUA 3T4YA 1QR1B 2AJXL 3QPXL 1T6WA 4PGZA 1T5XA 1E4JA 4WGWB 4Z76A 1XF2B 4MAYA 2MSPA 1FE8L 3HUJF 5F7EH 3LN5B 2V6HA 4MDJB 4APQC 4HH8A 3RL2B 2UV3A 2VE6A 4JN2A 1ZS8A 2BNQE 2IANB 4HIJA 3Q5YA 2GUOA 3CMGA 3HUJB 4MA1B 3EOBA 3MRQA 4D3CL 1FSKC 2HYMA 4XXDB 3KPOB 5CBAA 4CGTA 1FL3B 1RUPH 3U46B 1K6QH 4DVRH 2XA8L 2OX5A 3MLSH 3OKNA 5E2WL 1QSED 3T0DA 2B1AH 3S9DB 2AEPH 3DO7A 1S7VB 1U8MA 2MQCA 2VLKD 2ADIA 3QNXB 4OCLC 4Y5YA 5DJCA 1OQXA 2VISA 4M1GL 2VDKL 2A77L 2A6JB 1OB1B 1SBSL 3T2NH 1JWSB 1TMCB 3HC3H 3IFPB 3OXRB 1NBQA 4LHUB 2OL3A 3BP6A 4XNUL 4OFKA 4WHTA 3MROA 1KJMB 5TF1L 2HJKB 4D9QE 3SKMB 5HVWA 4N0FA 4LU5L 1H3VA 1KJ3L 3WO3B 4RAVB 5FV1L 3FTGB 4P3DB 1W72A 1KV3A 5IK3A 4W4OC 1LHZA 1N7ML 1X3DA 4JQIH 3MLZH 4PJIE 1FAIL 5J11C 1S7WA 3HC0B 4DZ8A 4ZO9A 4RGOH 1CDIA 3WDJA 3SE3C 5D5ME 3UTSA 5E00B 2HKFL 1VHPA 4MA8H 1T83A 5TDNA 2FNBA 3MRBB 3HE6C 3RVVC 3LV3B 3WFHB 5JORA 1R3JA 3ARYA 4NT6B 2IMNA 2G2RA 5CD5C 3NACL 1CVRA 3L95A 4H8WC 5E99L 5FO9A 1MI5E 1HQ4B 1GGCH 3VE0B 3M8OH 3HZMA 4L4TD 5HHVL 3RQ3A 3KPQB 3CFEA 5EOCJ 3BRFA 3D48R 2X9YA 1NGQH 2BDNH 4DKFL 1ZTXL 1WJ3A 3TCXA 2DKSA 3SDAD 1XCTB 3OJMB 3V5KB 9CGTA 3LSOA 1OPGL 4ONOA 4JFED 4OQTH 4JFZH 1JZ8A 2J88L 5I18H 3TNNB 3BP4B 5FYKH 1NL0L 2YPLD 5F7MC 5I8EB 5C0GA 4QRTA 3RL1B 3JVGA 3VWKA 2ZWLT 5I17B 1AHWA 5GPRA 1T0MB 5GHWH 5FHBH 3AS0A 5IB5B 1LO2H 1UH3A 4TOYH 5IFAL 5ETUA 2FD6L 1CFQB 3NH7L 2CR6A 2XWTB 5C0BD 3BVNA 4APQA 1DQJB 4J1UA 2ED8A 3VXTA 3GNML 4IMLB 3VD3A 2QKIB 5E2TL 4ZFFA 3CFKA 2VWEC 3RVWD 1Z9SA 2D9QB 3ARED 3L5XH 1P5UA 4YPGA 2FEEI 4A6YA 3BN9D 4XBEH 5HI4D 2ZCKL 4K3HA 5CWSB 3KPTA 12E8L 2P8LB 3QEHA 4N68A 2OYPA 1FO0H 3FN9A 5F9OH 4QCIA 4YDJA 4LSVH 2Y36H 4HAFA 1U0QA 3BEVB 4Y1AA 4KK8D 1XGTB 2R9HD 5GXBB 1WK0A 5D7SH 2D7TL 2WM0A 5H94B 4TUJA 4BSJA 3LQZB 4XPFL 1BJ1H 4EVNA 2IANE 4YQXH 1J1PH 3VXNA 4CVUA 3BIKB 3QDHA 4L8SC 4MS8D 5HGBA 4G42A 4X6BA 2CKBA 2BVQB 3EUUA 4IRSB 4W4OA 3WFBH 3HPJB 3O2WH 1BWWA 4QHMA 4CKVX 3P77A 2CRYA 3ZO0A 3MUGA 5GS0L 4JG1L 2GSIB 4O58H 2X1OA 3GMOB 4WO4D 5DUBB 1IC5L 3BH9A 3TESA 2YD4A 4QRPA 4K7PL 3SE3A 4JFFB 3TBYB 4K9EC 4KZEL 5DT1H 5BRZA 1HSBA 1WWWX 1TFHA 3NGBB 4K7PX 1XGUA 3FB7A 5CUSH 2PN5A 2ZZUT 3P73B 4ZTOH 1MLCA 2E27L 2JF1A 3G9VA 1YUHB 2LVEA 3IXTB 1QFHA 1YZZA 1WAAA 3UDWC 1TETL 4GG8B 5DUML 2BSRB 1A7NL 2DDQL 3RWJA 3MLUL 6FABL 5J6GB 3N0PB 3OG6B 3IB4A 3PXJA 4EDWH 5BO1H 4ODTH 1DUYA 1JBJA 2W59A 5EZIH 1L9NA 3BKCL 3GKWL 2NNAB 2GJJA 1Y0LA 4P3CL 2BHYA 1HEZA 3PJSA 3IDIB 3ZYZA 3ZE1F 3UCRA 2ADGA 3FOLA 4LNVA 5FA3A 4TVPL 7FABL 3G08A 4K8RH 4N9OB 3Q6GL 1T03L 5I1LA 3VWJA 3WD5L 1B4JH 1FZJA 2VDNL 4JRXE 3ARFD 1FZOB 4TPRH 2ZSWB 5JPMA 3D9AH 3C87A 2X4OB 3RZCC 4WW1A 3GRWH 1UZ6F 5I1JL 1IVLA 3PNWA 2NZ9C 3KPRB 4QWWD 1BF2A 3WS3B 4YNYB 4LVHB 1BP3B 1SY6A 1DVFA 1MJJB 1ZGLA 1RULL 3S96A 3RZWA 4M6NH 1OAZH 5BXFA 4XNQB 5KSUA 3PWJB 1NKRA 4POYA 5D72L 4ZUVA 1HOCB 3GK8H 3QIBC 1OP3H 5MP6L 4HXAL 1S7TA 3MV9A 3QIUD 5JOFB 2I9LA 4HFUH 3ES6B 2JJSA 5FOJA 2XPGA 3H3KA 2VLMD 1AD0A 2EH8L 4HKXA 1UA6H 5JW4Q 1RURL 3EFDH 4R90L 1MRDH 1EEQA 2DBLL 3VU2A 4G43B 5EU4B 4OFDA 1UM4H 1Z5LB 4WWID 3PGCA 5BCAA 5LCVH 4TSAL 3MRGB 4CN6A 5HYJB 5C0DB 5I1GH 1KCKA 2DM2A 3MXVH 4NNYB 1QKZH 4L8SA 3JV0A 3LKRB 4G9DA 1T7WA 2RBLA 5KVFL 1MEXH 3BAEH 3NPSB 4WUUE 3SQOH 3ULUE 1PDKA 4ELMA 5KG9B 4RBPK 1S7XB 2Y6SC 4OCRH 4QOKE 4GH7B 1X5IA 4WWKD 3FFCE 4TULH 5GRUL 2V7HA 1K5NA 5E08L 1ACZA 4U6YB 2ITDA 5I1IL 2ZPKL 1N5YH 4X9IA 3QCUL 3E2HC 2D31B 2PYEA 1CR9H 4FQQB 1ZT4B 2JJTC 2PW1A 3C5JB 2QL1A 2EYTA 3T0EA 3CVHB 2HVKA 4OCMC 5EO1B 1BLNB 2V17H 2Q20A 5D2NC 4QTHA 3FO9A 4FQCH 1BFSA 1WICA 1QEWA 5CSGA 4M5YL 2YD8A 3TF7C 1B9ZA 4OTXH 3DVIA 3QG6A 5DLML 1WFUA 1S8DB 4MXVE 1NCDH 1NGPH 4F15C 3BPLB 5IBUG 3P4LA 1KTLA 4YWGL 2ZG2A 3KYKL 5ID1B 3MA9L 1MUJB 4HG4J 3T8XB 4PY7B 4JY4A 5GRXG 1NMAH 3BIAX 4Y16B 4ODHL 4Z7VE 1PEZA 3HNSL 3DWTA 3K4ZA 3WIIL 4HS8H 5I74B 2VDPH 3VA2C 2IPKB 4MD0A 4X4XB 1JPST 1ZANL 2CDFA 2EICA 3PV6A 5DVMA 4JCMA 5CIPH 3T4YB 4NC1C 2ZUYA 1H3PH 4JZNA 4MAYB 1PZUB 2X44D 4NM4L 1ITCA 3QCVH 1JNLL 4JY6B 4ALAL 1YC7A 1ZS8B 1H0DA 3EZJB 3SDAC 3Q48A 4HIJB 1X4XA 2Q6WB 3QXVA 2BFVL 4R3SB 3MRQB 1C5CH 3NA4A 4JO3H 4XVTL 3RGHA 2YS4A 2KBGA 3KYOB 3OKNB 2EDOA 3DO7B 3H9SB 1I8IA 1E4KA 2Y5TA 1U8MB 4W6WB 5DJAB 3QIBA 2ADIB 3RNQA 4Y5YB 3S88H 1PQZA 3M1BA 1I3GL 3FN0H 2VISB 4M7JL 4UILL 5CCKH 4UV7H 5J12B 4L29A 3LQAL 1EUUA 2ZKHL 1P84J 4NWTL 4RX4D 3C5ZD 3SPVA 3BP6B 1CD1B 1XMWA 3BYTA 1MF2L 5F9JB 3MROB 5C08A 1NEUA 1LO3H 3CXDH 4BZ2H 1WTGT 4M6AA 1TNMA 4DVBA 1X44A 1QFWL 2DM4A 1EO7A 5F7WC 3VDAA 1OGAD 3G9AB 3Q2CA 4P0DA 1U8NA 1A7OL 3RVWC 1QSFE 1IGIL 3AREC 5IK3B 2VZUA 1QLFB 3CPLB 2QJDA 4HV8A 3BN9C 4M7LH 5HI4C 1QSEA 1S7WB 4KHTH 3DVGA 3IF1A 1H15A 5CEZE 2VLKA 3PGDA 4OB5H 4OD3H 1GGYA 2RIKA 4P5MA 3WO4C 5DJDB 4J3SA 4WVRA 5TDNB 2V5TA 1CGVA 3QWOB 4KK8C 3KJ6L 1F97A 2R9HC 2E7LC 1ZLVH 1R3JB 1U58A 1CU4H 2G2RB 5CJQH 3DTXB 3L95B 4R8WH 5FO9B 5HYJE 5CP3A 3A67L 2JCCA 3HZMB 1IEAA 3I6GB 1BJ1J 3KHQA 4H25A 3BWAA 1XGRA 4S0SD 1ZOXA 4QXGL 1MIMH 4MS8C 3MJ9L 4ESKA 5IG7B 3LKQA 2YD3A 4X8XA 4R26L 5FYJL 4NRXA 1YEDA 1BBDH 3VXSD 4LMQI 1LE5B 3B8SA 2WUBH 3LSOB 1J87A 4WO4C 3ZKMD 4G3YH 1K2DA 2DIBA 4OV6F 2DF3A 1X5YA 4Z18A 2A73A 4YR6A 2YA1A 4JRYE 5D7LE 4ONGL 1F90L 3KXFA 3HAEA 4OZFA 4DJMA 4NC0B 5C0GB 1UXSA 3C5SA 1T0NA 1GAFL 4N8VA 3VWKB 4BH7A 1AHWB 1J18A 5SWSE 2VR4A 4RAUB 1T20A 3BEWB 5HHMB 3VCLB 3MLTA 4AIZA 5DVKA 3PWVA 1I85C 1ZKAA 5ETUB 2F54D 3BVNB 2FX7L 4J1UB 4PJXF 4APQB 4ENED 1V7NH 4S10A 3SDAA 3NMEA 1OSPH 4ZFFB 3CFKB 5D1XD 4P4RA 4DTGH 1JWMA 4GG6A 5KSBA 4KK5C 3X12A 3VFTB 3O9WD 4ODSL 1YECH 4A6YB 4M9PA 5IQ7L 1F2XK 4JHAL 4KVNL 1KTDA 4RDQF 1KOAA 4S11A 4J12A 2YPLA 2MPAH 5IB2A 3O45A 1HH9A 3QEHB 3VGEA 3HMXH 1B0GA 2HLFC 1DQQA 4QCIB 3KJ4C 3FMGL 3LH2H 4YDJB 5DD3L 1YMHA 3I02B 1OAXL 4OCWH 4Y1AB 5AZEH 5E4EB 4B0MM 3I50H 4ZUSA 3F5WA 3UZVB 1KENH 4XNXH 3IU3A 3LKOA 3O2VH 5C0BA 3A6CL 2COQA 5MI0C 1CBVH 4TUJB 5FYKD 2F19L 2Y72A 4EVNB 1NC2D 4EUPH 2D0HA 1LEIA 4N0UA 4KMTH 1T66D 5HGBB 4G42B 2EDNA 4X6BB 4XBGA 3AREA 2CKBB 1NC4B 4QHMB 2X1QA 3P77B 4Z78A 1RK1A 3MUGB 3H9SE 4U1NA 2YXFA 4GUPA 3P9LA 3V6ZA 1D5XA 3VDCA 2AEIT 3BH9B 4ZOCA 3HNVL 4KI5D 3TNMA 3QIUC 1NFDA 1QHOA 2Y06L 2Z31D 3BT2L 2WINA 2H41A 5E2VH 5BRZB 3Q3GB 3QUZA 4ZS7H 5EG6C 5FCUL 1KB5L 2W65A 3WFCH 2E7LA 4ETQA 3FB7B 2OZ4L 1TJHH 1WAAF 4YH6A 2XA8H 1P7QA 1MLCB 3G5XA 1CF8L 2XQYG 4RZCA 1BOYA 4TN9A 3MRMA 5B4MD 3N1PC 4PJHF 3LN9A 3C2AL 4QEGA 4DAGH 4Z7WB 4O4YL 3BMVA 4K23L 2DMCA 3X17A 3RWJB 3QXDA 4XNUH 4V2CB 3DUSA 1UACH 3VDBA 1A4KA 1DUYB 1TITA 3J8F7 3PP4L 1JZ2A 4NO2A 3TZVA 1MH5A 2YZ8A 3OKKA 1Y0LB 4ACPA 4KWUA 4QHNA 1K8IA 5LAXA 2X2YA 1FVDB 3PJSB 2UZIH 2ADGB 1R3KA 3FOLB 5FA3B 3G08B 1FAIH 3RNKA 3VWJB 3EGSA 5ID0B 1FZJB 2AXGA 3F6IA 4Y4KA 1FC1A 3L3GA 1JK8A 1WWBX 3JBG7 2EC9T 1I85A 2HKFH 5C0JA 1KXVC 4Z95L 2XN9A 4YHNA 1IMHC 4HWBL 4CNIA 3RI5F 4WW1B 2FR4A 3VW3H 2UWEE 1VB9A 3KPLA 5E99H 2XWJA 4KXZI 1DR9A 3QHZH 4KJWD 1DVFB 1ZGLB 5CKAA 1JN6A 4JGMA 3SGDI 3W0WE 3S96B 4DUWA 5BXFB 5HHXL 4G5ZL 1PZ5A 5KSUB 2ZOLA 2XOTA 2NY3B 1KC5H 3EKCA 1ZTXH 1RZJL 3SKJH 1XH3B 4LKXA 4HIHA 2WP3T 4X9GA 2V9QA 2I9LB 5FUCC 1XF3A 3QIWD 4YXKH 2EEAA 2XPGB 1AD0B 2P24B 2VB5A 1ES0B 2WP3O 2DQEL 4JEGB 1GL4B 5I2IA 3ARTA 3DXAE 3PGCB 4RMQA 2VYRE 2GY5A 4YHML 4K8RD 2BXYA 3U4BH 3FAXA 2J8OA 4ELMF 3CLEL 4G9DB 1T2QH 5A3IC 1DL7H 4LNRA 4MMZC 4UOW0 5IFAH 1UKSA 4ELMB 1GGBL 3F65A 4G7YH 4Y4HB 5JA9A 4R0LB 1X5ZA 1OL0A 1QD0A 2FYYA 3GNMH 5E2TH 1QBLL 3QIUA 5EC1A 4LPYA 3LMJL 1V7ML 2V7HB 4NGHH 3C5ZC 2BXZA 3DIFA 1I3UA 3RA7L 1PBYA 5CJBA 2ITDB 2OMNA 2PKDA 2IF7A 2PYEB 1KPVA 2PW1B 3BKJL 1IQWL 2EYTB 3T0EB 2HVKB 2DMBA 1UWGH 4WI8A 4GAFB 1MCHA 4QTHB 3FO9B 2YUWA 1EEZB 1QEWB 4HIXL 4NC2B 2SEBA 5DMIL 4YUEL 1KTLB 2E7MA 3RU8L 2LTQC 5H2BA 1LEGB 4X5WA 3UTQA 5E1HB 4Y88A 1T7ZA 1FFPA 1BGXH 1M6OA 5GGSA 5HYFA 2Y9RT 4JFYB 5F1SA 2XIDA 4MA7H 3BZ4A 3NOIA 4I18C 1NAMA 3MFFB 1ORQB 4MD0B 1KT2B 2AK4B 5EO9A 4F57L 4YDKL 2NTSP 3PV6B 3B43A 3RWDB 1MCOH 3X3FH 4C56E 5FKPA 2J3SA 4NQCD 1BQUA 2DQTL 4WFGE 4DN3H 1X4ZA 1NFIA 2ARJA 4LDLB 4Z7WE 4JZNB 2RGSA 4HAGA 3BSZL 1YYML 2V2XA 3GSOA 3MJ8A 3ZTNH 2A9NH 1MNUL 2B4CL 3DSFH 1T2JA 3AM8A 4P2YA 4WY7L 2AJZA 4I9WD 1CE6A 3NFNA 3ZKMC 1BQHA 1IC4H 2E27H 3O6KL 1ACYL 3A6BH 4FQXD 4GW1B 2HA1A 3LEYL 4L9DA 5CFHA 5E2UL 4NYLA 4QLRA 4NN6C 4YFEA 2X1WL 4HW6A 5E0QA 3NA9H 2VDRL 1I8IB 2O5YL 3RNQB 2DDQH 2BVEA 3MLUH 1PQZB 2W9EL 3VRJB 2FIKA 5FDWB 5DK0A 5DJ6B 3L1OL 4DFIA 4EBQL 4E9LA 5FK9B 3SPVB 3BKCH 1NLBH 4P3CH 5C08B 3SBWC 4L3ED 4DVBB 2AXJA 5DQDL 4ENEC 4FXLA 3WUWG 1HHHA 4TVPH 3WHXB 5DQJA 5D1XC 3Q6GH 1U8NB 4DQOL 5SWZA 2I27N 3EDJA 1Q9KB 1I7TB 1T3FA 2X4SA 3O9WC 5HVGB 1JZ7A 3IDGA 4HV8B 2PXYC 3IF1B 3GHBL 3P11H 2BZDA 3RJDA 3PGDB 1V3JA 4P5MB 4KI1A 5EC2B 2J6EH 3O3DA 3CZFB 3NCBB 4U3CA 5GSRA 1EFXD 1UYWL 1YNTA 4TSBL 2AKRA 1D5MA 3C5ZA 2JCCF 4PJ8D 5BZWA 4FQIL 3L9RA 3MOBL 1U58B 4PJAA 4BKLA 4PGBA 4E41E 4JJHA 1F4AA 4ISVB 2JCCB 2X4UA 3BWAB 5MP6H 1XGRB 5J6HA 5T3XE 3K4AA 3P0GB 3QNYA 1D6VL 2CDEB 3IXAA 4RRPG 4S1SH 1T66C 1IGTA 5C6PB 4ZNCD 4PTTA 4OI9A 4Q6IC 3ZHDA 1RURH 3T4AA 1RUAL 2DTML 5ADPL 1CD9B 3HS0A 1RJLA 3BP7A 4TSAH 4IIQC 4KI5C 4NUGL 1F2QA 2N4IA 2WUCL 1JGUL 3CK0H 2Z31C 3OSKA 4ZNEA 2VLJA 2CXKA 1IILE 1IAII 5KVFH 4NFCA 3KXFB 1C1EL 3HAEB 4OZFB 4Z7QE 5F96H 1UXSB 3C5SB 1T0NB 5HVHC 3NCYS 3RY6C 4N8VB 4BH7B 4G6FD 3B5TA 3UJJL 4H1LG 3MLTB 5JLZA 1F4YH 3PWVB 5B4MC 1JGEA 5DD1L 3ULUL 2J8UB 3UTZA 1NSNH 4ZPTB 5F89A 1I8MB 2VJXA 2L7UA 5E08H 4GG6F 4GKNA 3RWHA 5I1IH 1IC7H 3QCUH 4A2MA 1YEEH 3C8DA 1JWMB 5KSBB 4JFXA 1RUQL 3X12B 3R8BB 1YDPA 4HUUA 4KDVA 2OR7A 2HFGL 4IM8A 3RWFA 1LDPH 1KTDB 1HXMA 3K8MA 5DLMH 2AK4E 2BY0A 3B4NA 1NJ9B 5IB2B 3O45B 4NKDA 1HH9B 4LEXL 3UTTD 2UZYB 4ZXBA 4L4VD 3ZLQC 2F5AL 3KYKH 1YMHB 2WSKA 3DV6B 2NY6D 4EZMA 3S4SB 4GRMB 4ZUSB 4HX1B 3F5WB 2V2WA 3G6DL 5E9DD 3SBWA 5KVEL 4ODHH 3LKOB 5DXWA 3FRPA 3GSWB 4F37F 1K8DA 5DZNA 1RUML 1XEDA 4HLZH 5D1XA 5M94B 5B22A 4NDMA 4X7SH 4GLRH 4XBGB 4KJWC 1P2CA 4Z78B 1QSVA 2JELL 4DW2L 4U1NB 4NM4H 2PXYA 4GUPB 2A74A 1NCTA 3P9LB 5HHNA 1JNLH 1I8LC 3OAYK 4S1QH 5ITBL 1S9XA 3TNMB 5J1TC 1NFDB 4L3CA 3O4LA 2DYPD 2WINB 3QIWC 5AYUL 5KW9L 2VC2L 3W39A 3QUZB 2W65B 4M48L 1XIWC 1PSKH 4UDUB 4QGYA 4ETQB 2C4XA 3PWUA 4ZODA 2D4FA 1P7QB 2RCSH 4OGYL 4X99A 4YBLB 4XGZB 3G5XB 2NXYD 3G5ZA 4RZCB 5DR5L 2ICCA 1IEHA 3IETA 1SVCP 1L6ZA 5CS7A 5DD0L 4K8RC 1I3GH 4LCYA 4M7JH 3HI5L 1V5JA 3E8UL 1LO5A 4Z6AT 1AQDB 1EZVY 4Q6IA 3QXDB 3IJSA 3VFMA 3DUSB 1MF2H 1JRHI 2H2SD 4NOBA 1PG7L 4NO2B 3TZVB 1MH5B 1QFWH 3OKKB 4IIQA 5HHOD 2EKJA 3O11A 4QHNB 4MDIA 5AD0A 5FO8B 5KVGH 2Z31A 1K8IB 4RMWA 5D8JH 5LAXB 4NM8H 4Y19D 1PG7X 5IUSA 4D2NA 5HDBE 2B39A 1R3KB 3TLRA 3TIDA 3RNKB 3QDGD 3RY6A 1BFTA 3EGSB 2AXGB 4YGAB 2NY5C 4WDIA 4Y4KB 3L3GB 1JK8B 3ZYOA 5TH2B 3SDDA 5D6CA 1DCLA 1UXWA 5C0JB 2XN9B 4YHNB 1U42A 1S9WA 3BO8A 4CNIB 1X7QB 4P2OD 2VDMH 5CEZL 2FR4B 1JMXA 4KKLD 3H3BC 3KPLB 4KRPD 2LVCA 2XWJB 4JHWH 5CEYA 5F6HJ 5J06A 2PO6A 1JN6B 4RWYL 4QXGH 1PZ5B 3MJ9H 4U1SA 3SKNA 5IOPA 4D0DA 4R4FH 4R26H 5FYJH 1ZSDA 3OJ2C 1GIGL 4HIHB 2F74B 3SY0A 1A4JA 4RGMC 4P57A 1XF3B 4NPYB 3FT4A 2VLLA 1J8HD 4AEHL 4HBCL 2K3TA 2BSED 3DI3B 2J8UE 3U2SB 4JFPA 2XFXA 5M7QA 3H9YA 4G6KL 5I2IB 2CD0A 4JG0H 1BOGB 4TSCL 3IDXH 3EYQD 3VXUB 1DFBL 1EHAA 1F90H 2CLVB 3BE1H 3NCYP 1GAFH 5KSBE 4LNRB 4FQXC 1GGUA 1YQVL 2BNRE 4PGEA 3D39D 1GXEA 1F58L 4M7KL 1Q9OA 1UC6A 4M43L 4DK3A 1JHTB 1I8LA 2FYYB 1MJ8H 2XXMB 3SDCD 5EC1B 3QSKB 1S7UA 2R2EA 3MV8D 3DIFB 3FQWA 1H9VA 1XIWA 5GZOD 4MAUL 4PFEA 4ODSH 3V6OE 5IQ7H 4KVNH 5IJVA 1UCTA 1QFWM 4TYUA 4X6FA 4AZ8A 4ZTPH 5IEHA 4ZUTB 1HHKA 1IGYB 5DD3H 3BUYA 4MMXC 35C8L 1ND0A 3DROA 3AS3A 1RZ7L 4YDLC 2SEBB 5E5RB 4KMLB 4M62H 4XMPL 3QQ3A 4X5WB 2Y7QA 3A6CH 2QSVA 2F19H 4HS3A 3WJLC 1M6OB 5GGSB 2LV4A 4OSUH 2GI7A 3BZ4B 1OP9A 4YE4H 4PJ8C 2I5YL 1KN4H 4M93C 4IDLA 4OM0H 3MRNA 5A2KH 5E70A 2YXMA 4YHPA 5EO9B 1L7TL 2WBWB 4LLMA 3VGDA 4MQTB 3O0RL 3D85A 2E7BA 3SN6N 5FKPB 4TNWK 3D0LA 1FVCA 2ARJB 2EO1A 3C6LA 3BT2H 2A0LC 3NCFB 5E7FA 1KN2H 2V2XB 5GS1C 5FCUH 1KB5H 4FQ1L 3GSOB 3MJ8B 4GKSA 5I30H 5KS9F 1WBXA 5EA0H 1G7QA 2AJZB 2YPVH 1CE6B 3NFNB 2ATPA 3NCCB 4YDVA 3RDTC 1BQHB 2IC2A 4YAQA 1AY1L 2BC4A 1M7IA 3K2UH 1TLKA 4G8FA 4NYLB 3NIFF 4HKJA 4UZGA 5I6XB 3MNWB 3RUGA 4HMEA 4L8DB 4O4YH 4K23H 5T3ZH 5FGSA 43CAA 1CWVA 1INEL 3DRQB 5F9DC 1GJIA 3VFUB 3UTPE 1IM9D 4JM4L 1PYWB 5IEKA 2Q3ZA 4OGZA 2N7AA 2YD2A 2VXQL 3QUMH 3AY4C 3U83A 5IMLA 3ULVC 1HHHB 1C16A 5ITFB 1MFNA 5DQJB 3DETC 3OBAA 2NY2D 3DHMA 2L7JA 4AYFA 4OUUA 4EI5C 1EH9A 5SWZB 4FQXA 2X4SB 5KTEL 2FHCA 3IDGB 2R56H 4KK9D 4RNRA 4UNUA 5A2LH 2FGZA 5BQ7A 1N4XH 3RKDD 4S1DD 4HWBH 2RB8A 1KYOK 3VG9B 4PJAF 4PTUA 1F02I 1S3KH 4KPHH 5GSRB 2MHAA 4GT7A 2G5RA 2NY6C 1D5MB 3PHQA 2AJVL 1IGML 1CTOA 5GS3A 5BZWB 3L9RB 2C3HA 4PJAB 4X83A 4BKLB 4NN5C 1CLZH 4L3EA 1B4RA 5HHXH 4LAJH 5JA8B 5DRZA 4P5TD 3MGAA 3VXUE 3WYRA 1RZJH 1MFBH 1U9KA 5J6HB 1JIBA 3QNYB 3IXAB 1GOFA 3NCMA 2AERT 3IDMA 4XPGL 3WKML 5FGRA 5CIPA 2NY0C 5E8NA 4AIOA 4PTTB 2ORBH 5MHSD 4K7FB 3T4AB 3HS0B 4PV9A 1RJLB 3BP7B 2VN7A 5EU3A 1IE5A 2HT4C 4P46D 1A1NA 4TVPD 2HMID 1Y6NR 1ZVHA 2DLFL 4XC3H 1GPOH 4Z7OE 1Z3GH 4URTB 2IQ9L 2VLJB 4GAYA 3V5DA 1L4IA 2ZUXA 1CIDA 2FJGA 1DUZA 4LHUG 3V4UL 1BHGA 1UEYA 4ELKA 3JTSA 3VMOA 2ZG3A 1FGNL 2NXYC 3IFNL 5F97E 2F58L 4HULB 5I16B 5JLZB 2X42A 1JGEB 4MSWA 2XZCL 1G0XA 4RIRA 3UTZB 4LMQE 3LMJH 1V7MH 5GS1A 2NX5D 4P4KD 4GKNB 3RWHB 5FYLE 3RAJL 1CN4A 3HZYA 1AO7D 1KTKE 5LXGH 1TQCB 5DRWA 2GQHA 5J13B 2H2SC 2JKXA 1D9KD 2LU7A 2R69L 4OQ1A 3RDTA 1IQWH 1NCBL 4JFXB 4J6RL 2XZAH 4NN6B 2D2OA 3OZ9L 5CMAA 3RWFB 3DX6A 2WANA 1HXMB 2AJSL 2VZVA 3AXLA 2AJUH 4NKDB 5DMIH 4YUEH 3Q1SH 4ZXBB 4NQED 2P5EA 5IJKC 2P8MA 4CRPA 3ZDZE 2UVFA 1CLOL 1YN6B 2DL9A 3OPZH 3MV7A 1JZ5A 2YD1A 4JJ5A 4YXLH 4PRID 2A83A 3MO1A 1K8DB 3HPLA 1FORH 4IOFD 1G9ML 4KKLC 4U6VH 3MFGB 4KRPC 2P8PB 3ARSA 3HR5A 1E4XL 4P2RA 4EI5A 1P1ZA 3BPNC 1MJUH 1HIML 3CFBA 3PHOA 3GI8H 1X4YA 3W5NA 2DQTH 3DJ9A 1P2CB 1YNKH 4MB3A 4KGJA 1X5GA 2PXYB 2A74B 5HHNB 2FLBT 1FG2A 5C0IA 4UT6H 1GOGA 2Z9TA 3L3DA 1MNUH 5FGBC 1JNHB 3ETBF 4X4ME 5D7KE 1CFBA 3O4LB 1I4FA 4P9HL 2YA0A 5EBLA 3V7MA 2XZZA 3QWRA 5HPMB 4FN0A 2CUHA 3FFDA 4Y4FC 5E2UH 4X99B 3G5ZB 2VDRH 4PJ7A 2O5YH 1F4XL 5ESVA 4FFZH 4LCYB 4CVZA 3GSNL 5CGYC 2VLRA 4UTBL 3RWIA 1LO5B 3CC5A 1BFVH 4XCNA 4KI5F 1ONQA 4Q6IB 4FOMA 3T2PA 3IJSB 4O9HH 3VFMB 4GKOA 2XTJB 1A0QL 4M5ZL 1QRNE 3MZTA 5KJRH 1U2HA 5DQDH 1ZT7A 1TJIL 5LWYH 1MCPH 3O11B 5AD0B 4MDIB 1MFCH 4YIQB 3SDCC 2DYPA 2NLJA 4FZEH 2BHZA 3RVUC 3ZL4H 3K2MC 2FATL 1AI1L 5C7XL 1I1YB 1JGLL 2HKHL 1W8OA 5J3HD 5C0EA 5GZOC 4HQQL 3S37L 4AG4L 4RFOL 3CX5K 4WDIB 4NBYB 1X9QA 2OSLA 3NZ8A 4WJ5A 3S37X 3V4PL 3ZZ1A 3SDDB 4FNLL 3FB5A 1BZ7A 1QBAA 3QDMA 4UNTA 2DQFB 4XT1C 1S9WB 4TSBH 3BO8B 1K9TA 2OR9H 3R0NA 4OZIA 4KVCL 4J3UA 1BD2D 3MYJA 4FQIH 1KCSL 3MOBH 3P30L 1A9EA 5ISZA 5DA0B 1AQKH 5IKCA 1H5BC 1UB6A 2VAAA 4XP6L 1RZKL 4N8PA 4ODXB 1DLFL 2PO6B 1VFBA 1PX4A 4X6CA 2FGWL 1D6VH 4J3TA 2VTFA 4Y19A 3SKNB 4AEEA 3RGVD 5JXAH 2HT3D 3BWUC 4D0DB 5DI8B 5BOPA 2DIAA 1ZSDB 1AFVL 2F8OA 5D2LE 5CILL 5T3XL 5IJKA 3SO5A 3C60A 4LHJB 5EBMB 3FT4B 1UG9A 2FL5A 4NUGH 1CGWA 1GYAA 3VXOB 2XFXB 4Z77A 5EO0A 1LMKA 3RPIA 1FGVL 4JO2H 4TUKH 4BK5A 3RP1A 3VMNA 4HC1H 3ARBD 1H8NA 3CFCL 4HJGA 4Q2ZA 1INQA 2JJUA 1KB9K 4ZOBA 5L88L 5I1AA 4UDTB 5FUZL 5L2KA 3W9EB 1IKNA 5ILTH 3QAZC 4WHYG 1HYRC 4OT1L 3EBAA 2P5WD 3EDFA 4PGEB 5F9AC 1Q9OB 4G80B 3QFJD 1HXYA 2LE9A 2VR5A 1S5HA 4U6HA 2IFFL 4MLIA 2AGJL 5FGBA 5C0AA 3VFGL 4F7EA 4WEBL 4HH9A 3GM8A 1J8HA 2R2EB 4V1DB 2QQLH 5D1ZD 3FQWB 3GFUA 4PBWD 3PWLA 3VI3F 1XIWB 1J5OL 3TEUA 2ZCLL 4Y4FA 1FL5B 2NY4D 4PJBA 4KZDH 5JOPE 3QP3A 4W68A 3GBNL 3B8YA 4MJ5A 5FYJD 4X6FB 4LEXH 4NP4L 1SQ2N 2NY2C 3RWCA 4E42A 5IEHB 3HR6A 1HHKB 1QFPA 4O51B 1LE9B 1ND0B 5T1MA 3D39A 3HCVA 4KK9C 1U6AH 2QTEA 3QQ3B 5KVEH 4S1DC 3HG1A 1S7RA 3QB7C 4HS3B 5BVJA 3QJHB 4U1KA 3O4LE 4OF3A 2D7QA 1WUNT 4OBSA 4LKCA 1DQLL 3RBSA 4FABL 3IYLW 4R7NA 3MRNB 3H9HA 5I8KH 5IFHL 5D6DC 4QT5B 1YMMA 2OMBA 3UYRH 4LLMB 2FO1A 4EJ1C 1EVTC 5MEQB 4P5TC 3S5LB 5IGXH 3D85B 1IKFL 5DJXA 4NRYB 4BA8A 3F7VA 4QF1A 1FVCB 4WFHD 5ITBH 4KJQD 2BRQA 4W6XB 3C6LB 3ZTJH 1AE6H 2Z8SA 5AYUH 4CDHA 4I5BA 2VC2H 2W92A 2YK1H 5FXCH 5K93A 1FYHB 4WCYL 4ZSOB 3L5WA 4N1EA 1G7QB 3RUGF 4X5LA 1OF2A 4OGYH 4YDVB 1H5BA 4HF5L 4NFBA 5DR5H 1I7RA 2BC4B 5I0DA 2HMIC 5DD0H 4QNPF 4TTDD 2HP4A 4RMUA 1BJMA 3TYGH 2X9XA 4QO1A 2C26A 3E8UH 3MGTB 1O7SA 1V8HA 1JNNH 4XPHL 1MJ7L 4YHOL 4X6EA 5T1KB 5IESL 5IW6A 4JB9L 43CAB 4JKPH 2BRRL 2KKQA 2HT2D 3BZFA 5HGGS 5F1NA 1A14H 3D87B 3FRUB 2XZQL 3BPOB 3WHE0 4KV5E 1XFPA 2X89D 1F6AA 2QSTA 2OP4L 5IEKB 3ME0A 2EE9A 4OLWH 4P4KC 4JGUA 3BGAA 1JGVL 5ELIA 3H8NA 4HUWA 1WIUA 5DURD 2R23A 3EYFA 1JP5A 1H3TA 1VCAA 2FECI 5CSZB 1HN1A 5GZND 4OUUB 4N0CD 3ORJA 1R3HA 3VXMD 3H42L 2VXSL 2I07A 1NAKL 3NIDF 5BQ7B 4L1HA 3GEWB 3LKPB 5TF0A 5TPWH 1FNGA 1A21A 2VXTL 4PTUB 4X80H 5C0CA 2BNQD 3MRCA 2MHAB 1NUFA 2XQBL 3PDGA 1GSMA 3TH4T 4CU6A 2XTLA 1NBVL 1FNSH 1IM9A 4NQDD 4RWYH 3AFLA 3BI9X 2YRPA 4PRHB 5DRZB 5JZ7C 3GSUA 4NKMA 1A5FL 4IOFC 5T3ZD 2Y23A 4XCCL 3OX8A 2F8XC 3WXVL 5E8NB 4P23C 1RFDL 4HBCH 4M9OA 1SEQH 4G6KH 4UNVA 4PV9B 1R5WA 4D9QD 3JSSA 2JB6A 4HIIA 4FQLH 1SBBA 3FO0L 4TNVK 3KLAA 4NWUL 5DUPL 1A1NB 3HTLX 4D9LL 2X7LB 3VXRE 4GAYB 2CJUH 4V1DE 3W81A 3V5DB 4Z7UE 2R2HA 1OCWL 4M93B 4PJEE 3FCTA 1DUZB 1MRFL 5D6DA 4ELKB 3O6FC 4JN1H 3CCHB 4M7KH 4TRPL 3CVHH 1AKJA 1OP5H 3L3IA 1WZKA 1SMAA 4MSWB 2NY1B 2JJWA 4RIRB 1JI2A 4AL8L 1HHGB 4MJIE 3UAJD 5CGTA 2IMMA 5C09E 1F3JA 1RZGA 3HZYB 1WITA 2VRAA 2ARJQ 4MAUH 3VXQA 5DRXB 5HPOA 3ZYIA 3OMZA 5T1DH 4HT1L 3RDTB 1N6UA 4N0YL 4JO1H 2AQ3A 3N1MC 4K55A 4QXUH 4XAWL 1NANI 3GJEB 1T0PB 4HZLB 2C4FU 2XWBA 5CMAB 4N8CH 5JQ6L 3DX6B 2KQMA 35C8H 5J3HC 3CSBA 4G9FE 4XHJD 5IBUB 3AXLB 4OLZH 1XCQA 5B3NA 4KUCD 4OFPA 2V2TA 3L7FB 2P5EB 2P8MB 4GXUN 4GBXD 5I9QC 3ULVF 4YBHA 3MV7B 2AW2A 4JJ5B 4GW4A 5JMOC 4ZSOE 4P4KA 2I5YH 2A83B 3TH2T 4OV5A 4PPTA 1L7TH 4G6ML 5ACZB 3HR5B 2WNGA 1QPXA 4P2RB 43C9A 1P1ZB 1PKQB 4EI5B 4CJ1A 1A6WH 5B3JE 1TVBA 3PHOB 1U92A 1J0KA 4JFHE 5EFIA 3LQAC 3RGVC 4FZ8H 1FG2B 3S35L 5C0IB 3AMKA 4FQ1H 3L3DB 3O3BA 3UEZA 2VDQH 4PJFB 5CEXB 1OM3L 3BW9A 1I4FB 5IV2A 3LD8B 3S35X 2OL3H 4PJ7F 2Z0BA 1OGTA 3FFDB 4UUJA 1UM6L 4NN5B 4PGCB 2VL4A 1F3DH 2BVYA 3O6LH 4PJ7B 3FN3A 4YHKL 5ESVB 1DEDA 3ARBC 5D7JD 1JF1A 5BVPL 4CVZB 1CXFA 2VLRB 2QQKH 3RWIB 1W72H 4ZOAA 4Z0BL 2NY0B 3CC5B 4LL9A 4P23A 4XCNB 1ONQB 4LDEB 5DK2A 4JM4H 2FH6A 1MCSA 3WUWA 3SE8H 4ZFZA 3SOBL 2VXQH 5C07A 3DRTA 1KCLA 5DMGD 2IAND 2NLJB 1GOHA 1FL6B 1I1FA 3IS0X 4LVEA 5D1ZC 1TJGL 1DBAH 2EDYA 4FFYH 3R06A 3DECA 4PRHE 5D7IB 3O6FA 2NY4C 4LARH 3TCLA 2CRZA 1CD0A 3ET9F 2MFNA 2EXYD 1JI1A 2ESVB 2R0ZL 3NZ8B 2OSLB 1BQLL 1OW0C 3JWOH 2IGFH 4ODUA 2D7OA 2X4PA 4WJ5B 1KELL 2ERJB 1DBML 5DJ0A 5ENWA 2Y07L 5GGVH 1E6OH 3QDMB 1TIUA 3JWNC 2AJVH 4LHUD 4OZIB 3MYJB 4X6CF 3H9ZA 1A9EB 5ISZB 1ZHNB 1JZ6A 3DGCR 4U31A 5IKCB 3QFDA 2VAAB 1YEIH 4IMKC 4QRRE 4OJFH 1KCRL 4X6CB 1WCBA 4RRPA 2ZP0T 1EHLL 4XBPB 2ZUWA 1BIHA 1S9VA 4LSUH 3WFEL 3MOAL 1FYTE 5IHUH 3O6MH 1SYVA 2V9RA 4F8QA 2K7PA 3RHWF 2VDOL 2VN4A 1MFAL 2GAZA 3H7BA 4KAQH 3C60B 1QYGL 1A3QA 2FL5B 2FBJL 4NZTL 5GGVY 1FH5H 4MNQA 4KJQC 2DLFH 4Z77B 2AVGA 2IQ9H 4XCEA 5EO0B 4Q9RL 5F7YC 1G7HA 1LEKB 1BD2A 2YR3A 4HJGB 4BFGA 2OQJA 15C8L 3PWPA 5I1AB 5L2KB 3IFNH 4H1LA 4I0PB 4ZO6A 1JCKA 4TTDC 2FX8L 5HXMA 1A6ZA 4Z5RA 4A6YH 3IVKB 3QO0B 5MENA 3ZE2E 3CVIH 2A6IB 2WBKA 1TXKA 1DDHA 1S5HB 4U6HB 4EXPX 4ZAKB 5EBGA 2F5BL 5C0AB 3S36H 3F7QA 4F7EB 1LD9A 1KJ2L 4PJBF 3VRLE 2R69H 3QO1A 4PBVC 1R5VA 3MV7E 3SGEI 5GJTH 5FYLL 1YPZA 4Y4FB 1YY9D 1MVUB 2NY7L 3OZ9H 2VIRA 4WW2B 1N3NA 1FBIL 3QXWA 1PKQE 3RWCB 2I60L 4LCIL 4O2FA 3I6KA 4N0CC 2CKBH 1VFUA 3WJJC 3K81A 2HJLA 4HJJL 3LS4L 3FAWA 1NDGB 1B2WL 3QA3A 25C8L 4LSPH 4PJ5A 4M6OL 5LQBL 3HG1B 1S7RB 5BVJB 1ODAA 4U1KB 2H2PD 4PJFE 5ERWA 4LKCB 1EXUB 2D03L 4P9MH 4M7LT 1T1XA 5D1ZA 3W11D 5DWUH 4ETYA 4R7NB 3H9HB 3RPKA 2L0DA 1YMMB 1DN0A 5T33L 1IAMA 3MJ9A 5EN2B 1RK0A 1W2KT 4LCWE 5DJXB 1OD9A 3QEGL 3U30C 3TFKD 1YY8A 2CIIB 3F7VB 4QF1B 3I9GL 4F37K 3MLVH 4XAKE 5TE6L 2D7MA 5FOBA 1MY5A 1YEFL 4XP5L 4NZRH 1EJOH 4P9HH 2DLEA 1OARL 1OSZA 3L5WB 4N5UA 3GJFK 4MD5A 1OF2B 4QYOB 3EYOA 1DLHA 5D1QC 2H9GA 1I7RB 4LDOB 2APVA 4UT9H 5DHYB 3SE4C 2DMKA 5CP7B 4IRSD 3PP3K 2IBZY 5D7IE 2OI9C 1YC8A 5IW6B 4NO5B 1A0QH 3ARDA 2BVTA 4M5ZH 2ESVE 2R4RL 3CDGB 5DMJB 4PJCB 3BZFB 4Q7DA 1TTFA 4FTVD 5F1NB 4KHXL 3UJTL 4JFFD 4XCFH 3R1GH 4CW1A 5F7KC 3P0VL 5K9QG 4NJAL 1F6AB 3UAJC 4LRNH 1OTUD 2FATH 5DD5H 5C7XH 3TH3T 5BV7L 2ZUVA 5CZKA 3S37H 3EYFB 3U9PL 3HFMH 3TT1L 3WEXA 2J5LC 1SY6H 1RZJC 1R3HB 1NLDH 4ZG1A 2N56A 1I9JL 2AEQL 4NCDA 3N50A 4Z9KB 4WV1C 1J0ZA 4XHJC 1Q1JL 4KVCH 1FNGB 4OFYA 1KCSH 4KKAC 4ERSL 5C0CB 3MRCB 1A1OB 4GBXC 3PL6A 4XP6H 4DFHA 1DLFH 4YHLH 1RZ8A 1CG9B 2X89A 5CD3A 5EIVA 3P9MA 2VAJA 4NJ9H 4EIZC 3GSUB 3BZDA 2BY3A 1AFVH 3KWWA 5CILH 5E8DL 3OX8B 4BM7A 2JB5H 3MLXH 4WEUD 5F9WB 4XC1H 3WJJA 3WNLA 1RIUL 4PBXA 5BS0B 4MJ6A 2DKUA 4LSRL 5FEBA 5TQ2H 5ESAA 1KB5A 3MNZB 4R2GB 5C0AE 4HIIB 1QPPA 4JAMA 5E5MA 3C09C 3KLAB 1IAOA 5GQBA 1SHMA 5C2BH 1TZIA 1RIHH 2OZ4A 3AS2A 2BNQA 1KIPB 2C7UA 3KPRD 1CXIA 3QXAA 5FUZH 5D2NE 1MHPL 2R2HB 3FCTB 1A47A 5JMRA 1RV6X 1J8KA 3U7WH 1LNUA 2UY6A 5TQ0H 4ZFOL 1F3DJ 1XF4A 4CN1A 1AKJB 3L3IB 5D7JC 3VFGH 5I1DA 1SYSA 5L0QC 3ARGA 1VPOL 5IHZA 2R0KH 4XXCC 4KKBD 1UCBL 1F3JB 1H8SA 1RZGB 4Y2DC 5IW3A 1PY4A 3VXQB 3NFSL 4XPTL 3ZE0F 1A7PH 3RVXC 4KY1L 3MCLL 3HG1E 3QZWB 4FFWD 5D1QA 3GBNH 5HYJD 4QRUA 3MUJA 5DMGC 1JF6A 3G5VA 1DEEA 1JHKL 2XWBB 3SE4A 1HKLL 2P48B 4MA1C 1LP9E 4NRZB 2DQJL 3EHBD 1YMME 1XCQB 2CGRH 2G9HB 3DNKA 1HZHL 4M61A 3KLHC 4L5FH 2EXYC 2LFGA 4FHBD 4WUKL 1ZGLM 2H26A 4GQPH 3S7GA 5I8CA 5D5MA 2DD8H 2WMPA 4GW4B 1DQLH 4R96A 1WZ1H 1UWXK 5EULV 1UVQB 2GJZA 5C0FA 3I3DA 1ROWA 5TE4L 4OV5B 3TWCL 1ZT1A 2ZJSL 5KVDH 4WENB 1MI5A 1BPVA 4G8EA 1GVIA 3B9KC 1TVBB 4JZJC 1WIPA 5EFIB 4WV1A 4WCYH 1NCAL 2WWMD 4OD1H 1CL7I 3BP5A 5C86A 4PJCE 3BW9B 4GBXA 5D9SA 4HGMA 1OGTB 4UUJB 1U8JA 2VXUL 4Y16D 2Z93B 2Y5EA 3LHPL 4PJDB 4HPYL 2BSSB 4WRLA 1E6JL 1WTLA 2YMXH 3IU4L 3NCJL 3EYVA 4XPHH 5IESH 1JF1B 1FNLA 5I75C 3PABA 1T7XA 5ABDE 1BQSA 2C3XA 2ENSA 4P23B 3QUYA 1W0WA 5DK2B 2XZQH 4MAYD 2PR4L 1RIVH 2OP4H 3WUWB 1N6QH 1HILA 4ZFZB 3UX9B 2E9JA 1QG3A 4K71C 4LOUD 5C07B 3DRTB 2BERA 2QHLA 5J89A 1A7RH 3LCYA 1I1FB 1JVKA 4LSTL 2JK5A 3MA7A 3R06B 5FDYA 3OKMA 1QBBA 1YY9C 2VXSH 4HFWB 3TCLB 2W0PA 5F7NC 1WT5A 3H9SD 3OKLB 4ODUB 3HC4L 1MAKA 4RGNB 1ULVA 5D7JA 1A2YB 3VXPA 1Z9OA 4HDIA 4MNHA 5DJ0B 4X7FC 4CDGC 4XXCA 5BS0E 4Y2DA 1CGTA 1N0XL 3DV4A 4U6XA 4Y5XC 4XP4H 5EUKA 5CJXC 3LN5A 3QFDB 3RL2A 1A6UL 2H2PC 1WCBB 2ICEA 3SDXE 3NABH 3VI4E 3W11C 1RFDH 1SYVB 1CVSC 4OZFH 3HAEH 5EUOB 3AU1A 1UH2A 3RIAK 2Z8WC 4JPKL 3ULUC 2GAZB 3H7BB 2R1YA 4JREB 3N85L 3AGVA 5I9QB 2ZSVA 3PF2A 5I8OL 3TFKC 3QNXA 5HDQH 1T4KA 4MNQB 3CU1A 4NWUH 5DUPH 2AJ3A 3PG2A 4D9LH 2Q76B 1RAMA 4I3SH 4JRWA 2CIKA 4XHQA 4AMKH 1G7HB 3IFPA 3OXRA 4IRZH 4LHUA 3LIZH 1IT9L 2JIXA 3RTQC 4TRPH 1MFEH 3PWPB 4G8IA 4H1LB 1OY3B 3B9KA 1U91A 4JZJA 1A6ZB 4Z5RB 1D6EA 1FZKA 3CXHK 5MENB 3FTGA 4P3DA 4LK4A 4IRSC 4BZYA 4CVXA 2R4SL 1LD9B 3U7YL 5JIKA 5I1HL 4U7SA 4WTZG 3QO1B 1OGAB 4N0YH 3T08A 5J0BA 1VDGA 1EO5A 1YPZB 2LU3A 4XH2A 1IGJB 4PG2A 1LO0H 2RQ8A 1OTUC 5K9KA 2VIRB 3LV3A 1WFNA 3IJYA 3WFHA 1N3NB 4NT6A 3QUKB 3MMEB 1F11A 4F3FA 1IAIL 1UKTA 1XGPB 5C70A 3VWKD 3I6KB 3VFRB 1JWUA 4UQ3A 3VE0A 5FUOH 2HJLB 5CLTA 3TBVA 2WV3A 5GGRA 5HHMD 2ENYA 1IZJA 3KPQA 4JRXA 4Y5VA 2VLME 1MCKA 4UOW1 3PE9A 4PJ5B 1QFUL 4APQD 1G7MA 1MIEH 3GIVB 4OM1L 3VRIB 5L8KB 3LRGA 4XTRD 5F8QC 1XCTA 2QV2A 3V5KA 1BVKA 2UUDH 1KPRB 1N8ZB 2AJYH 5JHDB 1DN0B 4PJDE 5JR1L 5E8OB 1GC1L 5K59E 1D7FA 1X5FA 3EOYG 4FXGA 1RUKH 4HUMB 3RL1A 4IDJL 2XKSA 3ULSA 5FOBB 2EEBA 3LKSB 4JO4L 1G1CA 4Z8FL 2DQGH 2R1WB 4Y1AD 1P53A 5FA4A 1OSZB 1E28A 4JDTL 4GRLC 4Y5XA 2O26U 4MD5B 1DLHB 1DQJA 4LSSH 2H9GB 1X5LA 1YNLH 2QKIA 2FIRT 4XMLL 4GRWB 3OAYH 4QHUA 2EECA 4RQQB 3RKPA 1NC4D 3CZJA 4G7VH 4WUUA 4WI2A 3ARDB 1F5WA 4M7ZB 2QLVB 1MRCL 4QOKA 2IAMC 1DQDH 3QHTC 4C59B 3FFCA 3TN0A 5BRZD 4KKBC 1TJGH 4K2UL 1NQBA 1XGTA 2CUMA 3ISWA 3RVVD 1BAFH 4H8WL 4MJ2A 3HRZA 1TPXB 4ZUUA 3RTQA 4FFWC 3WEXB 5H94A 2JJVA 2R0ZH 1BQLH 1KGCD 1YEJH 5FUCE 4OLUL 4ZD3H 4NZDA 3SDYH 4FQJL 2HFTA 3LEXA 2DQDL 4GMSL 3BIKA 4WFGD 2DM7A 2Y07H 5EOCH 3LEVL 3BDYH 3EHBC 4IRSA 4AH2B 3NPSC 5EUOE 1N26A 3LB6D 2X40A 2FBOJ 3EW3B 4DGIL 4L8BA 3F8UB 5DUBA 3PL6B 1JRHL 1XR9B 2ZNXA 5SX4I 2BJML 3GMMA 1RZ8B 3TBYA 4AIXA 4LLYA 1X5JA 5CD3B 4JVUA 1TTGA 4Z7VA 3P9MB 2CLRA 2X6MA 1L6XA 3PWPE 1GGIL 3P73A 1MFAH 4NNPL 3U79A 3VWJD 1NUGA 2QADB 4JGJA 4Z7NE 4I77L 2FBJH 4NZTH 2FX9L 1U8PA 1BWMA 1YN7B 4MJ6B 5LBSH 3GKZA 2MCPH 4JR9L 2BHUA 1UM5H 4JM2A 4GG8A 2DOCA 4X9FA 2WWMC 4JAMB 5E5MB 3BPLC 1R3IL 1TZIB 1OGAE 3SGKC 1FRGL 1X5AA 3QXAB 3W2DL 1QNZL 2XV6B 4XPAL 6CGTA 1YPZE 1DVFD 3KR3L 5E56A 3OF6A 2EIZB 4Y16C 2X41A 4XMKL 1FLTX 3IDIA 2NY3D 1XF4B 3WSQL 5I74C 1KIRA 3U30B 4N5ED 3IGAA 4ONFH 1FIGL 1NCCH 5CZVH 4UQ2B 2F5BH 4CJ0A 1Y6KR 3ARGB 5IHZB 1KTRL 2BY2A 5ALCL 3U0PA 3U1SL 5FYLH 1KEMH 2CLZB 4GRLA 5L2JA 5MEPA 4OLXH 5D1QB 2A1WL 2VR9A 4LOUC 1V3MA 2W60A 4LQFH 5JHLL 1ZEAL 1YEHH 4PJIF 3STBA 5JDJA 3WS3A 1N64L 3DYMA 1A3RL 1QSFA 4YNYA 2OI9B 5JHDE 1ADQL 3LS4H 5D5MF 2ITCA 4X4ZA 1A3LH 4M61B 3PWJA 4JKWA 1B2WH 25C8H 3GMPA 4Y4HD 5H37H 3VH8G 3VXSE 3KPSA 5LQBH 1HOCA 4Y5YC 3FL7A 1BBJB 1E0OB 2H26B 1NCNA 2IAMA 5J12C 4R96B 5C0FB 2GJZB 1ZT1B 2AABL 4O5LH 3SJVB 1EMTH 1FCCA 4NFDA 5GGSY 3HNTL 2PYED 3T0ED 1MI5B 5HYJA 4PUBH 1YEKH 2PTUA 2J5LB 3QEGH 5C0DA 1I75A 4GRWE 1G6RL 1NEZG 5HHQA 3LKRA 4XP5H 4Q9QH 2F54E 1OARH 1OP3K 3BP5B 1S7XA 4X6DA 4K3EL 4HEME 3BRDA 1OWRM 1U8JB 2BVOA 1T83C 3W82A 3CX2A 1Q72H 3B9DA 1U8QA 1EO8L 1E4XI 3EYVB 3TV3L 2AK4D 4JRYA 5D7LA 1YYLH 1N5AA 4OD2A 5DVNA 1T04A 2D31A 3PABB 2R4RH 3C5JA 4RWHA 1UFUA 4HUVA 1SJHB 1NMBL 3MBXL 3JWOC 3WXWL 5SWSA 2Z35A 3QUYB 1J1OL 1IGCL 4HS6A 4NJAH 5K9OA 5KN5A 1DQTA 5I1KL 1S8DA 2DWDB 2X4TA 5FYKE 5DEFA 3MJGX 3T1WA 4ZFGL 5IIEB 3SGKA 4ZPVA 3TT1H 1OAYL 1MUJA 2J2ZA 2YOCA 5GS2H 4PY7A 1G6VK 2JK5B 3MA7B 2VUOA 3OKMB 1CDBA 4Y16A 1QHPA 1IEBA 3JV6A 4X9BA 1C8PA 3THML 1HSAA 5EU7E 1HDMA 3QIBD 1Q1JH 2IPKA 4OLVL 4AM0B 1DSFH 4JFDB 4CAGA 5CJ5A 3VXPB 5L0QB 1QLEL 4HDIB 4KI5E 1KCUL 3JVGC 4OKVA 3VWKC 4U4BA 1AHWC 4EOWL 2G60H 1L0QA 5T5NG 1JNJA 4Y2DB 5GSVB 4BQ9A 5HYIA 3DV4B 5C08D 1EVUA 4U6XB 1VESA 5EUKB 2ZCHH 4EQ3A 4JY6A 4XTRC 2ICEB 3B9EA 3N9GL 4UIMA 2Q6WA 4IEFB 4R3SA 4DKEH 3QHFL 1RIUH 4PJGA 4FXKA 3AU1B 3KYOA 3V9FA 4HBQA 2R1YB 2Y6SD 3T3PE 3H9SA 5DJAA 3T0BA 1NCWH 2ZSVB 1T4KB 2BNUB 1C5DA 2AJ3B 3ZDXE 3O3UN 1F4HA 3DOSA 1T7VA 2CIKB 4OGXH 1BIIB 3GSRB 1MWAA 3S3SA 4CUCA 5E4EC 1CD1A 4J7RA 5F9JA 1DN2A 4KXZH 2JIXB 3N1QC 4G8IB 3QRGL 3SGDH 3RRQA 5DHVA 3B9KB 4OIIH 4M02A 1MHEA 3IFLH 1U91B 4DGVL 4JZJB 3S98A 1D6EB 1FZKB 1VPOH 2CUIA 5TFSL 5KANG 4DN4L 1QLFA 3CPLA 4CVXB 4MVBD 1A9BA 4X7TA 4KUZL 1EAPA 4OLYL 2C5DC 1UENA 1PLGL 1G9MC 4MB5A 4XH2B 4FS0A 5DJDA 1S78D 5DC9B 3K3QA 5K9KB 3QWOA 1LQSR 2DQJH 2EYRA 3IJYB 3SJVE 4F3FB 4C57C 1F11B 1XGYL 2F53B 3KXFD 4WNQB 1P5VA 5I75B 3DTXA 2DI9A 1JWUB 4UQ3B 1BREA 3TBVB 3I6GA 5GGRB 1JPTL 4JRXB 3B2UD 1MHHA 4POZC 4H20L 4Y5VB 4PV8A 4XZUA 5IG7A 5K9QI 4YJZL 4P9HC 2HFEA 1G7MB 5TE4H 4K71B 4N9GA 3LB6C 3TWCH 3QCTL 4YGVA 1YEGL 1LE5A 2EH7L 5FF6A 1BVKB 5TGBB 3FQTA 1CFVH 2UWEA 2EXWD 4U0RB 1DBJH 3QDJB 4UV4L 2H32B 3PUCA 3S6CA 1BEYH 3WFDL 1KBGH 4B5EA 3W0WA 4MJ4A 2CMRL 4RA0C 1VGEL 4FXGB 4O02L 1A6VL 1MPAH 3ULSB 3VWJC 2R39A 4MNGE 4RAUA 3BEWA 2Q7NA 3LPFA 3GSXA 3VCLA 5FA4B 1E28B 1KCVH 1U8KA 1MREL 2HRLA 4KTYA 4Y5XB 3UJIL 5ACLA 3LHPH 1KG0A 4HPYH 4NKIH 3DXAA 4H88L 3N06B 4G6FB 5C0RL 3ULUF 3PGFH 4QHUB 5DFVC 2NYYD 3VFTA 1DVFC 1PGRB 1UWEL 2ADFH 5ICYA 4QTIL 5E5UB 4WUUB 3HZVB 2YWZA 2FZ3B 2NY3C 3EYSH 3EOTL 1J1XL 5HGAA 2QQNL 4JFDE 4N5EC 3IDNA 4QOKB 3IKKA 4NQXA 3P0YL 4DCQA 3STLA 3FFCB 1W0VA 1BM3L 3TN0B 2JJSC 3I02A 3QUZD 1RZKC 3MRRB 3BQUC 5J7CC 3DX9A 3HRZB 4ZUUB 4YFLF 3RTQB 1P7QD 4OCYH 3BPCA 1MAMH 2Z91A 3FB8B 2RR3A 3H0TB 4M3JA 2J4WL 3D18A 4MXVF 3KPNB 2DJUA 3LEXB 1OAUH 4NQCE 4MLSA 1XF5B 2HH0L 3K74B 3OJVC 1MCNA 1NC4A 2CR3A 3TPKA 2HWZH 5L7XH 2RFXB 4Y4HC 3LS5L 4L8BB 4Z7VF 3S5LG 3TZVD 4R0LC 3GGWA 1MELA 5T5FL 3GMMB 3BKYL 4LLYB 3F7PC 2IFGA 3Q3GA 4Z7VB 2CLRB 5A1AA 4LLWB 4YFDB 4IJ3B 4U33A 3F7RA 4JDZA 4JPKH 4G6JL 4JM2F 4NHCL 3T0EC 3SO3C 4GAJL 4Y4KD 3NZHH 1MCEA 2VH5H 1U8PB 4C56A 4R6UA 1FZMA 3VFWB 1CICC 4MXWH 4Z7WA 3MV11 4JM2B 3VJ6B 4UTAH 2XN9D 2HVJB 4RDQG 1UT9A 1CDJA 1CXLA 2GY7B 3EZ8A 1I9IL 4HXBL 1TZHA 4WFED 2YHGA 3G6JE 4KK5D 1Z2KA 4EXKA 5DQ9A 3GSNA 4K3DL 1RU9H 1FVDA 4X0KA 1KIRB 1EGJL 2F53E 4AEIL 3IGAB 1VACA 4AK1A 1BJ8A 2R4SH 3EO9L 3REWA 2HLFD 2OTWA 4TQEH 4O2CA 5ID0A 3GM0A 5EU6B 2X4NA 3K8KA 1EBAA 3U0PB 1IGFL 4XVUD 2D3VA 4GRLB 1HINL 2Q3AA 5L2JB 5MEPB 5HYEA 3ILPA 1U2CA 3L3OA 3O2DL 2YD9A 1IFHH 4KROC 3VXUD 2W60B 3EJYD 1IAIH 5DS8A 1F4WH 5F21B 5GJSH 4LPVA 3QDJE 4PJ9C 1D3CA 4UI2A 1QSFB 5IT2H 3O4OB 1C7SA 1AXSA 4K94L 1IM3A 4PS4L 2ITCB 3VFNA 3OAZK 1QSZA 3GMPB 2NY5H 5INCA 3FZUC 1E4KC 3KPSB 3KPMA 1XH3A 1II4E 5F3HB 3TC9A 2IAMB 1FVEA 3UO1L 4LLAA 2KH2B 3LRHA 3BQUA 2P24A 1ES0A 2HRPH 5E94A 3QJFA 1OQOA 1HYSD 5JR1H 3RIFK 4E41A 3EDDA 4NO3B 1GC1H 1NGXB 2D4DA 3OKEA 5HHQB 2EDEA 4JO4H 5EWIL 1KYOJ 1KF9B 5I66B 4Z8FH 2F9BT 3MV01 4NZUH 4DKAA 2VQ1B 4U49A 5FYLD 1AC6A 4PLKD 4Y4HA 3I6LE 1RZFL 2IG2L 4X6DB 4R0LA 1I1AB 4LVOB 3BISA 4UU9A 1AP2A 4XMLH 5DJYB 2BVOB 3D5OF 2DQUL 1WWAX 1U8QB 3RVTC 4PB0H 3I2CL 1H3XA 3C2SA 4JRYB 5D7LB 1N5AB 4OD2B 1T04B 3CFJA 4HUVB 4L4VE 4HPOL 1MRCH 1WVZA 2OJZL 1B6DA 1JHLH 2PETA 5SWSB 2DJSA 2Z35B 4GMTL 3GB7B 1K3IA 2H6PB 1CICA 1J05A 2HLAA 4HS6B 3RX5A 1EEZA 1P6FA 5IMMB 5K9OB 5KN5B 5E9DE 5IVXB 2ZOKA 3MXWL 4MVBC 1I3VA 2X4TB 3U6RA 1LEGA 3OHXA 4ZPVB 5EB9A 1MOEA 2FB4H 1R6VA 3IRPX 4OLUH 4GXVH 1XR8B 1P4IL 3B83A 4JFYA 3GMQA 4FQJH 4KC3B 4GMSH 1IEBB 3JV6B 1S78C 3OWEA 1VEOA 5GRYA 2B1HH 3LEVH 1HSAB 3MFFA 2P46B 1HDMB 2Q87A 2AXHA 1NGYB 1ORQA 1KT2A 2AK4A 1IAIM 4OKVB 3RWDA 5D7KD 5C6WH 2Q7YA 4DGIH 4GS7B 1GH7A 1JRHH 1SM3L 4ZQKA 1CGXA 1QBML 3B2UC 4HLJA 1RHHA 4HK3J 1OOAA 5KAQF 5F1KC 1OAKL 5F44A 4O2EA 5FHAH 3FQNA 3UP1A 4JPIB 5JW3L 1AJ7L 4U1GB 1KSRA 4UIMB 4NNPH 5FM5O 4YXHL 2EXWC 4PJ9A 4EN3A 5A3ID 5SWZD 3EYUL 2DQIL 4FP8L 4GW1A 3VFVA 2FX9H 4OFVA 2FECL 4KQ3H 4PJGB 4FXKB 3WIHL 1Q0YL 4JR9H 2VITA 1LDSA 4HCRL 4ODVH 2GYSA 2PF6A 1C5DB 3OAUH 3CH1B 4NNXA 3VRJA 3RX8A 5HHOE 5EU6E 3VG0L 5FDWA 8CGTA 5DJ6A 1IL1A 1MWAB 1QNZH 5FK9A 5GS2D 4LASH 2OR8A 2WBJB 3KR3H 5CZXD 5EZOL 3V6OC 2APXA 1OTTD 1E27B 4Y2OA 3MLRL 2CH8A 3QDGE 4H0GA 4XWGL 3QQ9C 5DHVB 3WHXA 1FIGH 1MHEB 2DLGA 3IDYC 3V0WL 2YKLH 1Q9KA 1I7TA 1ORSA 2NYYC 3C08H 5ALCH 3HE7A 3U1SH 5EOTB 1A9BB 2EO9A 4JPWH 4X7TB 2H3NA 2CO6B 3WN5A 3KPSE 1EAPB 2A1WH 1FCGA 1HQRA 5E7BA 5BMFL 4MD4B 5GGQH 5EC2A 2N1KA 4OKDA 3CZFA 4HWZB 2VLJD 1URLA 2E9WA 3QUZC 4M6MH 4C58B 1A3RH 2EYRB 1RUPL 3ULVH 1K6QL 3MLSL 3GIZH 3WFZA 5I76B 2B1AL 4YBLC 2D7NA 1NCUA 1AR1D 1ZA6B 2QSCL 4ISVA 1I9RH 3B5GA 4O00A 3UMTA 4JVWA 2DQCH 3WKNA 5GISH 1BMGA 1MHHB 2CDEA 3T2NL 1S7SA 4PV8B 4XZUB 2UWEF 4Y7MA 2Q8AH 4YEFA 2HFEB 4OIAA 4N9GB 4YGVB 4PRNA 2NCMA 5IF0A 3D3VB 5FF6B 4X6DE 3PIQA 3FQTB 2UWEB 1T1ZA 3TZVC 3OB0H 1VKXA 4U1LB 3CX5J 1I7ZA 1DBKL 2AEWA 3O3EA 1U36A 4YK4B 4S1RH 3W0WB 1FFNA 4JQIL 3MLZL 2BVPB 4PRDA 2GSGA 3GO1H 3MZGB 4NCC1 4ZXBD 4JDVB 4RGOL 1NMCB 1R5IB 3DVNA 4Y4KC 5ADOH 4K3EH 3DX7A 3GSXB 3JUZA 3MV8E 5DRNA 1U8KB 1JPGA 1J11A 2J8UA 1J0HA 3FOMA 4ZPTA 3MRFA 5IVXE 1I8MA 1JL8A 3D2UA 1KG0B 1EBPA 4QRSA 3DXAB 3QI9C 5AAMA 3C6SA 3EJJX 3ZDYE 1GGCL 3SE9H 5ICYB 1FJ1A 4XP9H 2BNRA 3GBML 4I2XE 1J1OH 3R4DA 4LBEA 4DK6A 5KSAB 2BDNL 2PXYD 3TO2A 5HGAB 1MCDA 3QPQD 5I1KH 3IDNB 1NJ9A 2C3WA 4NQXB 2MWCA 1QO3A 5F8RC 4DCQB 3ELAT 3VFSB 3KYMA 4R7DA 3STLB 4U7KA 3O4LD 1CGSH 1IZKA 1W0VB 1NPUA 3DV6A 4XP1H 1NUNB 4OQTL 3W5MA 4JFZL 3S4SA 4XVUC 4GRMA 3DX9B 4HX1A 1ZK9A 3MRJA 5I18L 3G5YA 4X5XB 2J7LA 5FYKL 3V6OA 3ZKXB 2AQ2A 3BPCB 4L9LC 2Z91B 3GSWA 2GITB 3FT3A 4RFEA 1MCIA 1RJYA 2IPUK 3D18B 3ZSTA 3EJYC 1QLEH 2QHRH 1X6NA 4HZAA 5GRJL 5GHWL 5FHBL 8FABB 1AH1A 4RCAA 2YUXA 4PJGE 4TOYL 2AJXH 3IFOA 3QPXH 3GHEL 1CYGA 2XTJD 1FE8H 5SV3A 1QA9A 1Q9LA 3PHSA 3RWGA 2MQ3A 3GGWB 4LVNB 3WHE1 3L5XL 4D3CH 4UDUA 1B88A 4XBEL 4WU5B 4U2ZA 3PDOA 4JDZB 4Z7WF 1HYSC 5E2WH 4XGZA 3TVMA 5JDSA 1FO0L 4C56B 1FZMB 3SDDD 3QUXA 2EDXA 4M1GH 2VDKH 1P9MA 2A77H 2I24N 3TA3A 3V52L 1SBSH 3MCG1 2ZG1A 1AQDA 3AAZB 1P7HL 5D7SL 1QTYT 2XRAL 5TF1H 1VADA 4PLKC 2IEPA 1TZHB 3MREA 1CGYA 2IQAA 4YQXL 3L3KA 1J1PL 4LU5H 2PO6D 5DQ9B 5FO8A 1KJ3H 4DGVH 1T80A 3GSNB 4PD4K 3T77A 5FIEA 4Q97A 4X0KB 4ZS6C 5TFSH 3O2WL 2XG4A 3EO0B 1J0YA 3KYAA 4RMSA 1N7MH 2W07A 3BZEA 2VZ1A 1VACB 1HH6A 3REWB 5D71L 4WTZA 2OTWB 3MUZ1 2M8XA 4O2CB 1DE4A 2X4NB 2EDHA 3HA0A 3T65B 5TH2A 3MRIB 2B0SL 1PLGH 5DT1L 3L5IA 2A6DA 3PQYB 4M1DL 4TUOA 1C5BL 3ILPB 1X7QA 3L3OB 3QI9A 4BUGA 5CUSL 3PXHA 2EDJA 3D3VE 3AM8C 3F6LA 1XGYH 4ZTOL 5DS8B 3NACH 3DMMB 1TTUA 2XG5A 3UC0L 5FKAB 5HHVH 1AXSB 1IM3B 1MCJA 1OT1A 2VXVL 4H20H 5I6XC 2MMXA 3VFNB 4U7MA 4Q6YA 3MJ7B 4UAOB 5INCB 1FHGA 3KPMB 4DKFH 4EDWL 2CQVA 5BO1L 2F74A 3QCTH 4FG6D 2EH7H 5EZIL 1FVEB 4NPYA 1MCRA 1OPGH 2O5ZL 3IAQA 4MHHG 1MFDL 4V1DD 1AIFB 3BQUB 1XIWD 4L8CA 3U2SA 3WFDH 5DJZA 5E94B 3QJFB 2J88H 4L9LA 4E41B 1BOGA 4KJYA 2CMRH 1NL0H 3VXUA 2LQRA 1VGEH 4R4ND 2CLVA 1B4JL 1FN4A 3OKEB 2BX5A 2Z92B 2A6KB 3E6FA 1TQBB 2VZSA 4TPRL 2ED7A 4M03A 5J56B 3D9AL 2NX5E 2FD6H 1AO7E 1NKOA 3NH7H 3GRWL 2DWEA 1JHTA 3O41B 2BCKA 4H88H 3TGXA 5GIRB 3VG9C 4UU9B 1AP2B 1MSPA 5B38G 1LGVA 1QLRB 1FFRA 3BESR 4FFVD 4NZJA 4Z7QF 1J12A 5GRVK 3WLBA 1MY7A 1NGZA 1OAZL 1UWEH 1KLUB 5CZXC 4QTIH 2Q8BL 3CFJB 1OTTC 2FJHB 2ZCKH 4NQEE 3SO3B 3D85D 3EOTH 3QZWG 2QQNH 5SX5H 1R3LB 5IFJB 12E8H 3P0YH 4XNMB 1OHQA 4HFUL 3UPAA 1CICB 1KJ2A 1J05B 2HLAB 3C6LD 1IGYA 4ZUTA 2AV7A 5E4IA 2ZOKB 4OZGE 4PRIE 1UM4L 1MCLA 2D7TH 4JCLA 3U6RB 1VERA 3OHXB 3PDDA 2GIYA 3DI2B 5I1GL 1VENA 1NDMB 5EBWA 4XPFH 3MXVL 3KPPA 1QKZL 5DFWH 1PY9A 3GMQB 2FRGP 5HHPA 1IQDB 4F7CA 1RVFL 3SQOL 2YUVA 1AGDB 2OS7A 4OZHE 5KANI 5T1KD 3MRDA 4POUB 5GS0H 4JG1H 1AR1C 2Q7YB 3LS5H 1F3RB 5DEGA 1IC5H 4ZQKB 4K7PH 5T5FH 2XYCA 1RHHB 2PW2A 4O2EB 1MQKL 4KZEH 4BQ6A 3FQNB 5DMKB 3ALXA 1C12A 1N5YL 2DI8A 5E8EA 3UPRA 4KROB 3DURA 1TQCC 4XPBL 2HFFB 5TE7L 1CR9L 5J13C 3KDMA 1UADC 2QR0A 4JPVL 4M4RA 3E6HA 4LCCB 4NHCH 4PJ9B 4EN3B 1NGWA 4GAJH 3VFVB 4FQCL 3MNWA 4L8DA 4OTXL 2VITB 1NGPL 1TETH 2P42B 5DUMH 1A7NH 3WNNA 4CU7A 4KDWA 3B2VL 1JJUA 6FABH 1KNOB 1KFAL 2KZWA 1ZLWH 4ZXBC 4NNXB 4K7PY 4X4MA 4LP4A 4MZ2A 1I9IH 1IL1B 3DRQA 3TJEL 2X5PA 3VFUA 4I3RL 3GKWH 1NMAL 2PCPA 2UYLA 3PQYE 3QEQA 3V2AR 3D6GA 1PYWA 4PRHD 5SV4A 4HS8L 4PRAB 3SQBA 4FQ2L 2VDPL 2C1PB 5ITFA 3NN8B 4AEIH 5IP4A 1TZGL 7FABH 1T03H 4LRIA 4HUXB 3WD5H 3EO9H 4OCSL 3DBXA 2VDNH 1D5ZA 1ORSB 3HI6L 3RY5A 3HE7B 1H3PL 3X13B 4D9RD 2GEEA 4LLQA 1HINH 3WN5B 3QCVL 2H3NB 2DLTA 1QRNA 3QPQC 5EPMA 3O2DH 1HQRB 1JV5B 5I1JH 5E1AB 1U8IA 1G7LB 1C5CL 3T2OA 4JO3L 3RWEA 1WEJL 4K94H 1RULH 3OL2A 3VH8A 3MYZA 3HB3D 1DANU 2WIMA 5D72H 5F71A 3FN0L 1LWRA 4HXAH 5CCKL 4YX2L 3BGMA 2NY1D 1S7SB 3QXUA 2A0LD 3T3MF 2EH8H 1LO3L 3CXDL 4BZ2L 4K7FA 4PRNB 2XTJC 4R90H 5IF0B 1A6TB 5B8CA 2DBLH 3PIQB 3RDTD 1T1ZB 3X14A 4WI6A 5C92A 5K9JL 1VKXB 1I7ZB 3O3EB 2P5WE 3KNBB 2DS4A 2LU4A 5EWIH 1FFNB 4GOSA 2PNDA 2ZUTA 4AQ1B 4OZ4B 4PRDB 2GSGB 4KRMB 1EERB 2P5ED 2J8UF 5D2LA 1HK6A 3DVNB 2QBWA 3LZFL 4OB5L 2YEZA 4OD3L 4YZFE 3DX7B 1ZHBA 5I16A 3KS0J 4QKXB 3MV7D 5DRNB 3SDDC 3M07A 1JPGB 5GRUH 1JF5A 3FOMB 3MRFB 3D2UB 4QRSB 5KSBF 1KACB 4H5SA 3ULVD 3I2CH 5TDOB 3C6SB 5CJQL 2ZPKH 3ZT5A 3DETD 3TYFB 4ZFOA 1B0RA 4P2RD 4EI5D 2K1MA 4HPOH 2PO6C 1B6UA 1FJ1B 1MIML 2BNRB 3Q0HA 4LBEB 1ZHKB 5DVOA 1DZBA 4HKZA 4JQXA 2ICWI 4M5YH 4PLOB 3TO2B 5LJYH 1BBDL 2CK2A 3DUUA 1AR2A 1S7QB 3EFFA 3OXSA 1QO3B 2P7TA 4YWGH 3KYMB 4R7DB 4G3YL 3MA9H 3SGJC 3V0VB 1CL7L 1VFMA 1YN6A 1PEWA 3QWRD 4R9HA 1NFKA 1P4IH 3MRJB 1P6AB 2E8YA 3EDEA 3G5YB 5IHBA 2WW8A 3HNSH 3WIIH 3FT3B 4RFEB 1RJYB 2EDKA 2DKMA 2EIEA 4DGYL 1ZANH 4N90D 2P8PA 4XI5D 4NHUA 2VLRD 1GZPA 3BGFB 3EAKA 3IDYB 4XAKD 4WFHE 2KPNA 3K46A 5JQHC 2NY0D 3IFOB 1QBMH 1NFDF 5JOEA 1V7NL 1QA9B 1I3RA 1Q9LB 1ZVYA 3D1MC 3RWGB 2NMSA 2HT4D 4ALAH 1A8JH 1AJ7H 4FG6C 1JNHA 3DVFA 3WLWD 4DTGL 4YXHH 2BFVH 5HPMA 5E6IC 1YECL 1IRAY 4XVTH 1Q94B 4F8TA 3PDOB 3IDJB 3TVMB 3G04A 2MPAL 2VABA 4H1LH 5HYSG 5JDSB 3HMXL 4R4NC 3QUXB 4UILH 5B39B 2GK0A 3TA3B 4OCWL 3CSYB 3LQAH 3VG0H 1GCFA 3QDMD 4KMQA 2ZKHH 1ZVSA 4NWTH 3I50L 1TENA 2XACC 5HGHA 2QEJA 3TO4A 4P2QB 5ISZD 1VADB 3O2VL 3SHSA 3WBDA 1CBVL 2LABA 2YD6A 3MREB 2IQAB 3MLRH 3L3KB 3T0AA 4KMTL 4YIQA 4LEOA 4FFVC 1A7OH 1FNEA 1WCQA 3MUY1 3T77B 4W81A 4YHYC 3VXME 3V0WH 1IGIH 1I1YA 1KPUB 4JFQA 3N1GC 3BZEB 1HH6B 1BVZA 1RPQA 4NKOA 3C60D 2YRLA 1DE4B 3CFIC 5BMFH 1U8HA 3ARRA 5JTWA 5E2VL 2YSSA 2A6DB 3C6LC 4ZS7L 4TUOB 3WFCL 2DQFA 4NQDE 3KJ6H 3QI9B 2CDGB 2KUTA 1TJHL 3DARA 5IBLD 1WFTA 1OWWA 3BMWA 5T3ZE 1TDQA 1BECA 5L2KD 4I0PD 3A67H 2QSCH 4ODXA 1GC1C 4DAGL 4BSWB 4WFFE 1F00I 1ZV5A 1MCBA 1R24B 2DM3A 5DI8A 1GZQA 1UACL 4ZAKD 5C0AD 3O8XA 2JE8A 5EBMA 2ZNWA 4HKBB 3SGJA 3QH3B 3MBEB 4L8CB 3VXOA 4Y4FD 3BPOC 1DBKH 2UZIL 5DJZB 1MQ8A 4L9LB 1NANH 4KJYB 3H2WA 3UPCA 3SCMB 4ONGH 2VZOA 3OQ3B 1FN4B 3PWNB 5CGYD 4GRWH 1TCRA 3E6FB 4UDTA 4BJLA 3W9EA 1EJ6A 2R29L 2QQQA 4G80A 1KIQA 4Z7OF 2FX7H 2DWEB 3VW3L 3HG1D 2BCKB 5D96B 2DTSA 4OBRA 1UJ3A 3QHZL 3RVUD 3VXRA 4V1DA 3WLBB 1NGZB 3TM6A 4J4PA 4HK0A 4LHQB 4Z7UA 5E6IA 5JIIA 4PJEA 1CXKA 1YMMD 1FL5A 3GBMH 1KC5L 2GFBB 4JHAH 3SKJL 5HDLA 3H7LA 4ORGA 3S3JA 4JY5L 5ICXA 4G8GB 4YXKL 3P4NA 1KJ2B 3FMGH 2FJFA 2AV7B 1D5BA 1OAXH 4O51A 1LE9A 1H3GA 4MJIA 4PIRF 4ORZC 5C09A 2BOBB 3WIHA 1HI6A 3GUTB 5EBWB 1FC2D 1CFNA 3U4BL 3QJHA 5MERB 3KPPB 1X6LA 3K0WA 1T2QL 1KJVB 2NTFA 5HHPB 1DL7L 4BZ1L 5GRJH 4F7CB 3ZDZF 2NR6D 4OF7A 5IB1A 2OK0L 3GHEH 4G9FA 1FFOB 1CQKA 4QT5A 3MRDB 4LF3B 1U95B 4G7YL 4OAWA 1DQML 2DI7A 5MEQA 2MKWA 3S5LA 3HB3C 5DEGB 4NRYA 1IBGL 1QUNA 1JPFB 3AUVA 3HNVH 5HD8D 2PW2B 1JTTA 5LKNA 4PY8J 2NY1C 2Y06H 4NGHL 4PJXA 2R8SL 4CADB 4S0TD 1FG9C 3QNZA 1C12B 5C0NC 4ZSOA 5E8EB 3UPRB 4P2QE 1J0JA 3DURB 2OZ4H 3F62A 3KDMB 5KZCB 2QR0B 2X4RA 3E6HB 1MWAL 1CF8H 1UWGL 5DZOA 1NGWB 3OGCB 4MWFA 4NO0A 1DP0A 3DGGB 4CU8A 1FFQA 4WI3A 2ICWA 3C2AH 3V52H 3MGTA 1BVLB 3EIFA 4J3OC 1WC7A 3OR6A 5T1KA 2XRAH 2GJ6B 5C0CD 4TNWF 4V2BA 3PP4H 3ZT6A 5IVOA 4XWOC 4BELD 4YC2B 1BGXL 1QRKA 4RMRA 3HUJE 2PCPB 2UYLB 3FRUA 3QEQB 4MA7L 2FLRT 5FB8A 4WEMB 4NBZB 1PD6A 3H3PL 5JW4M 5KVMC 1MCOL 3X3FL 5D71H 4KK6D 4FTVB 5CSZA 5GS0D 4IRJB 3DBXB 4DN3L 2EDBA 3MR9A 1D5ZB 4AQOA 1ZAGA 5BS0D 2B0SH 2APWA 4LLQB 4XNYL 4M1DH 1BZ9A 1C5BH 2EC8A 4Z95H 1QRNB 3HE6A 3LKPA 3ZTNL 1F13A 2A9NL 5EPMB 1M4KA 1JUFA 3DSFL 4R2GD 1E4WL 5BV7B 1U8IB 1IC4L 2HJFA 3A6BL 1HHJA 4U1IA 3FJTA 3LD8C 3UC0H 3GMRB 3RWEB 5JXEC 1K4CA 5IVZA 5ANMA 2VXVH 4ZO7A 4PRHA 3NA9L 4G5ZH 3VH8B 4D94A 2CKNA 2WLYA 1REIA 1AKJD 4PJHA 1S9YB 4EKXA 3VMPA 4XI5C 3BGMB 4KTEL 1J7VR 4HGWA 5F1OB 3R8QA 1NLBL 2CK0L 2O5ZH 4MCZA 5A16B 1MFDH 1ZLUK 2DQEH 2EDQA 5B8CB 2IALA 3MGOA 2BK8A 1FIEA 3SGEH 1LO4L 3X14B 2NXZB 4YHMH 2X10A 1NEZB 3M45A 4QRRA 2X7LA 3WLWC 5D2LF 5JUEL 3CLEH 4LPCA 5D93B 4H0IA 1ZE3C 1FYTA 5GGTA 4UT7L 3CCHA 1IAKB 3P11L 5D2LB 1GGBH 4L1DA 4ZOEA 2YEZB 2EZ0D 1ZHBB 2J6EL 4G8GE 3IT8D 3EJZD 4J8RA 4KJPC 4PYGA 1QBLH 2ERJC 1RI8A 2EE3A 1HHGA 4PGDA 1U3HC 4H5SB 3RA7H 3QQNA 1UH4A 5DRXA 3FQUB 3RJQB 2Q8BH 3UTOA 4KFZC 3IDUA