2ADJA

Crystal structure of monoclonal anti-cd4 antibody q425 in complex with calcium
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
211
structure length
211
Chain Sequence
ETTVTQSPASLSVAIGEKVTIRCITSTDIDDDMNWYQQKPGEPPKFFISEGNTLRPGVPSRFSSSGYGTDFVFTIENMLSEDVADYYCLQSDTLPLTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Q425 Fab Light chain
publication title Interfacial metal and antibody recognition.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adjA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adjA01
4X6BA 5DDHA 2XRAH 4I0PD 3IS1X 4NRZB 2UZYB 3GJFH 4C54A 3PHSA 4R90L 2BY0A 3HI6L 1AQDA 1E4XH 1KT2B 3LEYH 2APWA 3T65A 1SJXA 4ZFGH 1A7NH 5CSGA 3KPRD 2DDQL 2A83A 3BKJH 5ANME 4PJBE 2HRPL 4GRWB 4HKZA 4NNYA 4NWUL 5E2VH 1MCJA 1G7PA 2NW3B 3ZTNH 4FXKB 3FRUA 2R1WA 4PJDF 3CLEL 4XPAL 1HSAA 3BAEH 3MLWH 2V5YA 3ULSB 3NCJH 1AH1A 3CH1B 3EHBC 2P24A 5ITBH 1PX3A 4CDHA 5D1QC 4IIQA 4TULH 3P73B 1RY7B 5JIHA 2O5YH 4HS6B 3DGGB 2P8MA 3I6GB 2VUYA 2C4FU 4IOIA 1U3HD 3GMLA 1JN6A 2OJZL 5CJQL 1MQKL 2DM7A 1SEQH 1FV1B 3QUKB 4XCFL 2HJFB 3OKLB 4NQDE 4WY7L 1DQLH 3QI9C 3FN0H 1T21A 5IG7B 4U3HA 3VFUB 4S0TD 4WTWA 1P2CA 3SDAC 5H94A 2PXYA 5D2NA 3WNOA 1KB5L 2A1WL 3HI5L 3NZ8B 3QIUA 2NY3C 4MDJA 5H2BB 5TH2A 5KJRH 5E08L 4FQXB 4KMTL 5HGBB 4NC0B 3PV6B 1X3DA 1Y18B 2R1YB 3QXTA 4NDMA 2BNQB 1G1CA 5C07B 4BH8B 1T66C 4M00A 4OLYH 3BD4A 3KXFA 3B9KB 3DVNB 4ODSL 4GAJL 5FUCE 5DFWH 3MGTA 4MDIA 4X8JA 3VWJC 1HHKA 3MRJA 4JFQB 3IYLW 4N0YL 1T0NB 4XB8A 2QHLA 3G6AA 4N0FA 5F72S 5TJWK 1U8KA 2VIRB 1X7QA 5I73B 1FGVH 3QQ9C 1LO2H 3NCFB 1NGZB 5DD6A 1EEZA 3L9RB 3WJLA 2XQBH 4OQTA 1NEZG 5DRWA 2QQKL 3QNYB 1A3LL 1EJ6A 1QSEB 3P9MA 3CJJA 4LHUA 4NN5B 3NFSH 5EU7C 3BDBA 4PTTB 3RP1A 5DJZA 4X99A 1I9JL 5AUMA 1WIPA 3QEGH 4ONHA 5IHUH 3ZT6A 2IH3A 5INCA 4QGTA 4FQLH 4EUPA 3Q6FB 5DD3H 5AEAA 1QBAA 5FYJD 3SY0A 1AGEB 1IZJA 5BO1L 4I18A 3STLB 1AI1L 3GI8L 1DVFD 2A73B 2IALA 3GGWB 4U3CA 1HZHL 4LP5A 1JYNA 3KS0H 2D4FA 5DJCA 4WTXA 4FMFA 1LEIB 5D1ZB 1U3YA 3O8XD 4Y16A 4KK6C 3LPFA 3SDYL 4M7KH 4KDTC 2FX8L 1ERNA 1ZSDA 1A6ZA 3P11H 2CXKA 2D0FA 4J3XA 5LBSL 4L9LC 2FR4B 1SMAA 3IDJA 3KLAA 5EBGA 3QUYA 1QRNA 3OKKB 5T1LB 1FHGA 4PRID 2EKJA 4GQPH 3TNNA 1ORSB 3KR3L 4U1IB 3E3QC 2FIRT 2CR6A 4JFXA 3EOTH 5IVOA 1CK0H 1EVUA 1NH6A 1RMFL 4L8DB 2G9HA 1IILE 2OQJA 4QT5B 1UWGL 2IAMC 3HE7B 3SDDB 1BQHB 2X40A 3OZ9L 3BQUD 2IFGA 4DGIH 3WLWD 4XCNA 4JFZL 5D71L 2MNUA 2P8PB 3OJDA 3C5JB 5KSBE 5E24E 1IGIH 2ENSA 2XG5A 1F58L 3KLSA 4OFYA 3C8KB 3LQAL 1MHHA 4PTUA 5FAAA 4OFVA 1Z3GL 2AV7B 1RIHL 4WI8A 4Z7NF 4GFTB 3M07A 4C4KO 1F6LL 1OT1A 1JUFA 5E56A 4BZ2H 2NY0D 1IAKB 2YD8A 3MRNB 5HSFA 2FZ3A 1EH9A 1ONQA 4F3FA 3JVGA 1C5DB 3O4LA 3GSVB 3D48R 1RIUH 2BMKB 2C3WA 4YNYA 3TO4C 3LZFH 3VD9A 2NLJB 1ZK9A 2FBJL 4WWID 5H37H 4CVUA 1D5BA 1SYVB 4JZJB 4ZO8A 5IVXE 4OD1L 4XBEL 4BA8A 4OGXL 4YEEA 3PHQB 1RJLB 2GUOA 1WTGT 4UI2A 3ESVF 4PRAB 4Z95H 1NBZB 1PG7W 1HI6A 2I07A 5AZEH 2FNBA 4QEGA 2LU3A 3MLYH 2EO1A 4YXLH 3AB0C 1WZKA 3AAZA 5DHVA 3H8NA 3UXFA 4YDLC 2NNAA 3MRBA 1TZIB 2AK1H 2CLVA 4JDVA 2F53E 5LGJA 3LKRB 1KC5L 2P1YA 1YY9C 4QXGL 4RAUB 4BFIA 2Y25A 1YYML 4WDIA 1CFSA 3IDIA 3LKQA 3P0VL 4PRPE 3OB8A 4KJQD 4WJ5A 1DBKL 1PBYA 2HH0L 1JZ6A 5I1HH 2NY6D 4EDWL 4GAGL 4Z0XA 4X5XB 4ZTOH 1DQQB 4NUGL 4PJ8A 3RWFB 1P5VA 1PX4A 2YA1A 3Q6GH 4Z78B 3NPSC 1FJ1A 2AJZB 1YN7A 2AK4B 5C0AE 1A22B 1J8HE 4PG2A 3UBXI 4XPBL 1R24B 4YBLC 4YX2L 5GIRB 5HHPA 1YEKH 4TPRH 5C0BD 5AYUL 1UENA 5D7IE 3BI9X 3C87A 1TZHA 4LPVA 3QFJA 1JPSH 1OHQA 1M1SA 1EX0A 2BNRA 2C1OB 1HEZA 3MMEA 1JV5A 4Y2OA 1I1YB 4DTGL 4IHOA 3ILPB 1BEYH 4XXDA 4P3DA 5I2IA 3VXQB 4OCMC 1YEJH 4BUHA 1WFUA 1OPGL 1N6QH 1NUFA 1UWXK 3UBXA 3QSKB 5ISZD 1F00I 4NT6A 3F12A 1YQ2A 4JR9H 3RDTA 1MNUH 2P7TA 2VLLA 1X44A 2X7LB 4WUUD 5F7KC 1OAXL 1ZVHA 4F37K 5DEGB 4LLDA 2HWZH 3WIFB 1QSFE 1V3JA 3VGDA 3RTQB 4NO2A 5IJKA 1EFXA 5EC2B 3LN5A 4ZFZA 4Z7WB 3DMMD 4PJ5D 2FECL 4ZAKD 3WFHA 4YQXH 2P5WD 2V7NA 1AFVH 5HJ3B 4QRRD 2AERT 5SWSB 1ZS8A 1JHLL 3JUZA 1R3IH 1FP5A 4WFED 4MA7H 4UIMB 5GGSB 2CRYA 4YXKH 3WS6C 4OI8A 3RHWF 3G5ZB 4G6JH 2XXMB 2VZUA 1S7RB 3DARA 2P47B 5HHOE 2DQFA 1HIML 1KOAA 1KB9K 1KV3A 2DWEB 3VGAB 5LGKA 3ZE2E 4MJ5A 3UAJD 1UB6A 4HK0A 2ED9A 1NBYA 2A38A 4PRHE 4F15B 3MV7B 2C4FT 1MRCL 4NM4L 4P9HL 4F7CB 4L3EA 3O11A 4ZOEA 5DI8B 3BPOB 4ZPTA 2OMBA 3X3GL 1MJUH 3FO0H 5DC0A 3HAEB 1W0VA 4JG0L 4Z77B 2MOVA 4QCIA 2F19L 4LVOB 4KJWC 1CE1L 2YD1A 2D03L 5CEXA 4EN3A 3UZQA 3CK0L 2GTZA 4OAWB 2Z91A 3BXNA 3GO1L 4WHDA 1AXTH 2EIBA 3ILQC 4LSTL 1DLHB 3BKYL 4HV8B 3UTTA 4ZNCD 3PGFL 1AIFB 4OSUL 5GGTH 3RKPA 3RZCC 3MRIA 3LY6A 1DE4B 3QG7L 4Y19B 4R8WL 3QNZB 2JCCA 3IXTB 2ZCKH 4RX4D 2OTWA 3SJVE 1EO7A 1M7IA 5M95B 1R5IA 4X0KB 3ULVF 4NKDA 4U1HB 2A9NL 1YMMD 3BP5A 3CDYA 3GDBA 2AGJL 4PJAB 1V8HA 5E7FA 3SCMD 5EBMA 3D25A 4JDTH 4PGBA 4KY1H 4R2GB 4JVPA 3DRQB 4MMZC 4CMMA 3K7UA 4MA8H 3JBG7 4XVSL 1MHPH 2NMSA 3M8OH 1F42A 3WIHL 4G9FE 5CD3A 3TLRA 4HKXB 5T1LD 4NQVB 4HZLA 1CT8B 1TIUA 5DO2C 1EK3A 2VXVH 2W9EH 1HSBB 2J5LB 3R0NA 5EOCJ 3TPUB 2NX5B 4GAFB 1U42A 2MQCA 5DZOA 4FMKA 4ZDHA 4QHUA 4LMQI 2DWDB 3KHOA 4JCMA 1CFVL 3X14B 3C5ZD 4AEHH 5C0CD 3HRZB 5IOPA 3O81A 2AEQL 1JZ4A 3O6FD 4HHAA 3D5OF 1H0DB 4OF6A 1ZHKA 5ESQA 3REVA 1O7SA 4YHPA 1FO0B 3FAXA 3UO1L 1YZZA 1MFNA 1NCDH 3SKUD 3QI9A 5HI3D 3DX7A 3AREC 1SEBA 5FOJA 4RMRA 2V2WB 4G9DB 1I7RA 5ADOH 4LQ1A 1FZKB 1MCLA 4GG6E 1OSZB 5FHBL 4P5TB 1W8NA 3LIZL 4PJHA 5JUEL 4EVNB 4X7DC 2F15A 2O5ZH 5B3JF 2HKFH 3G04A 4LSVL 5D8JL 5C0GA 4G6MH 3MXVH 1FORL 5GGVH 2NY5L 5EN2B 1II4E 1OCWH 1QPXA 2EH7L 4LQFL 4BFBD 3GSOB 1PQZB 4P2OA 4IJ3C 5BZWA 2OS7A 4AEFA 3T77B 1UH2A 3CSBA 4JREC 1U6AL 3QEQA 4UTAL 1OGTB 4HX1A 4L9DA 1JNLL 1I85C 4XVTH 1CDIA 5D5MA 5MENB 3BGAA 3C2AL 2Q3AA 1SY6H 4LASL 4HJJH 4HF5H 3O0RH 1S3KH 3CAFA 5EWIL 2VDRL 1KTKE 3ULVL 5HI4C 2B5IB 2X1QA 2EC9T 1RJCA 3VFSA 4L29B 3CZFB 1B0RA 3PV7A 4ONGL 1QFUL 25C8H 4NO0A 5CCKH 2APFA 1J0KA 5K93A 2DTML 5F6HJ 5ANMB 1CR9H 1WCQA 3SKJL 4PJDE 1INDH 4Q9RH 4PJBB 2F9BT 2M26A 3L5IA 3IDMB 1GPOH 3ZDXF 1TVDA 5I0DA 3QDJE 2EH8L 2J1KA 5EBWA 3VCLA 3STZA 4D9QE 4MQXC 2WUBL 1NCCH 2E6JA 4FQHB 4MJ6A 2EDDA 5DK0B 3C6SA 4G7YL 1VPOL 5EFIA 1PLGL 3WFDH 2ZG1A 5E5UB 5ACZB 2GEEA 3WFEL 2CDFB 2WQRA 3PP3H 5FO7B 4CKVX 1LP9A 2OR8A 4Y4HA 5HYJA 4CVZA 3QDME 4Y1AD 4P23B 2ZPKH 4JY4B 1G9MH 2I24N 3M1BB 2DKUA 1EHAA 5C7XL 5E00B 2AV1B 1IC7L 3MUGB 3U4BL 4OF3A 3H3PH 2UZIH 4ETYA 1T6WA 4NQDB 3UTPD 4LKXA 4C55A 2BVOB 4E0RB 1E4WL 4Y4KB 1T20B 1XF4B 5EIVA 1IGFL 3UPRA 4OLZL 1DQTA 2FH8A 1F5WA 2R0WH 4G6FB 4NZUH 4OLVL 1BQHG 1U2HA 3ARQA 2F54E 1INQA 1D6EA 4CN1A 2X4PB 1KCSL 3RX7A 1NUNB 5JHDE 1ED3A 3CPLA 3RVTD 1A6TB 2PO6D 1N5YL 4JJ5A 1ADQA 1L6XA 1OP9A 3DO3A 4BYHA 12E8H 2P49B 5DT1H 3P2TA 2CDEA 2BVYA 4PJIA 4XMPH 4XTRD 5CP7B 2EEDA 1FDLL 1U8LB 3TO4A 1KTLA 2HTLD 3OKNB 4OUUA 4XNZC 3WD5H 4EI5B 3S4SA 4TOYH 3VD4A 5IM7B 5J89A 1HILA 1BIHA 1QTYT 4M6OH 3NOIA 5E5RB 5GRZA 5BOPA 5D6CB 3BP6B 1VA9A 3L6FB 1L0YA 1NMCC 3JTSA 1GL4B 4KTDL 2APXA 4IRJC 5EZLA 5JOPE 2I9TA 1RZJL 1F3RB 5IFHH 3DUUA 3QUXC 4YXHH 2Q7YB 3QIBD 2EKSB 3MOAL 1RVFH 4NBZB 4KPHH 3GKWH 5DJAA 3QCTH 1G6RH 5CBAB 3MRRA 3VXRA 4G5ZH 3O3EA 3VXSE 5E6ID 3BSZL 3KYNB 4DZ8A 1FIGH 3C5SA 2X4NB 4JKPL 3KGRA 3ZZ1A 5L8LB 3FQWA 2BRRH 1MFEH 3MRLB 1VEOA 1QFHA 4RMVA 2DJUA 4MB5A 3KPQB 2ZSWB 1BIIB 4WW2F 1U2CA 1U8PB 4Z7VA 1T0PB 2JIXA 3MLZL 5DURB 3TZVA 5DYOA 4LNRA 4UQ2B 1AD0A 2Z8VC 3J8F7 1E0OB 4XP6L 2GSIB 5B39B 5F3BA 5I1IH 1MFDL 3C09B 1MCFA 2XA8L 4N0UE 4I3RH 4JO1L 1HINH 5FECA 4RISH 5DLMH 4F7PA 2XPGB 1TJIL 3K2MC 2GITA 3LD8B 4X6FA 2CO6B 3HMXA 3MO1B 3QAZC 1UB5B 5CAYB 1LK2A 4Z7NE 3GRWL 5KSBB 1MHEB 1TETH 5IB3A 1IC4H 3TN0B 3WUWB 2Z31B 5E2WL 1NCTA 2HFEB 1WBXB 2EYSA 3OPZH 3GJFA 3IDNB 5CMAB 1JVKA 4WUKL 2MQ0A 4L8BB 1EJOH 5DTFB 1Z5LA 5J11B 2IPKA 4WEBL 4QY8B 3VFOA 5C0DA 5KZCD 3TH2T 3VXME 2EIZA 1K4DA 4PV9B 3V95A 3TIEA 1IAIH 3CDGB 3DPBA 1MRDL 4P3CH 3RWIB 5C0EB 5IVXB 4L8SB 1BAFL 2N7AA 2X1PA 4M61A 4NKMA 1LQSR 3U9UB 5I76B 5I8KL 3SDCD 1WBYB 3KNBB 3UTQB 4TVPL 1YMHB 2BSED 2WBJB 4LCCC 3MACH 3WO4B 5CLTA 1NMBH 5JPMA 4JDZA 4Q6IC 3I9GH 2R69L 5LJYH 4UNUA 1LO0L 3LDBC 3PGDB 1MUJB 4HH9B 3TA3A 1A7OL 3H7BA 1E6OL 5CJXC 1IFHH 3P9LB 4NQXB 2F53B 4NUJA 4Y2DD 5SV4A 5JORB 5GHWL 3K3QA 5J9PA 1XIWA 4X80H 2E7MA 1P9MC 1RZ7H 2XZCH 3LSOB 3T0ED 1J1XH 5D7JC 2F58H 4XNYL 2VKXA 3C60D 3MC0A 4KFZC 4ESKA 4PRPB 4KVNH 4D8PB 3DSNA 4KI5C 5CEZL 5HYEA 1HN1A 2R2EB 3TBTA 4KWUA 5IFJA 5TE4H 5AD0B 4TSBH 5BVJA 5DFVC 3HAEG 15C8H 5DUBB 3HNTL 5C0AB 3IXAB 1GCFA 4CU7A 1J8HB 1EGJH 4NIKB 1MJ8L 4DN3L 5KN5B 1F6AB 1FFNB 1TLKA 2BSTB 5AZ2L 4HWEL 3ULUF 2XIDA 5EO9A 5D7IB 5JXED 1FGNH 4I0CC 4P57B 3MV11 3RY6C 4L8CB 5F21B 1MFCH 1N5AA 4DUXA 2JCCF 4LOUC 4W6WB 3IB4A 4K3HA 2VL4A 2L7UA 3TO2B 4KK5C 4XNUL 1RUMH 4TQEL 4JHZA 1GJIA 5CINL 2VLJD 2Z9TA 1MLCA 1A64A 3JWDL 4J12A 1M05B 5DD1L 5INDB 3BMWA 2B0SH 2VXSH 4LCIL 3O4OB 4AENA 4LPWA 1CGUA 5EULV 1JPTH 4LLMB 2Q3ZA 4FQQB 4I9WE 4NOBA 1MCCA 4DVRH 1QSFB 1DLFL 2D7OA 5GS1C 4I5BA 4LU5H 4S0SD 5CKGA 1OTSD 4P2RD 1J1PL 5C0RL 1IM9A 2VXTL 3DURA 1U58B 3OAUH 3SE8H 4GUPB 5FKAA 4JJHA 3UTSE 5A2FA 4BQ9A 2JB6B 2QHRL 4M4RA 1M7XA 4KRPB 4RSVA 3C6LB 5DA4A 2NY4C 4LPUA 1YDPA 2YBRA 1H9VA 1SJHB 1RD6A 3RWCA 2C4XA 5F8RC 5F9WB 2VZ1A 1OTUC 2EXYD 1M6OB 1KPRB 3NFNA 1NL0H 4PJ9B 5HHOB 4NQCE 3MLRL 3AREA 3PABA 1S9YA 5E8OB 4NZRL 1XR8A 4PRHB 1QSVA 3RRQA 1E27B 5CZXD 1ZHNA 4JN2A 3FL7A 4LLYA 3LVEA 3DX8A 4E5XB 2ZG2A 5L2KA 4PJHF 5A40E 2CK0H 5FO8B 1K5NB 5EOTB 4L4VD 4MAYC 3EDDA 3L5HA 2ZKHH 4JY6A 1A2YA 5FHAL 4LEXL 3H9HB 3DROB 2GJ6D 3TH4T 2YPVL 2ARJA 4Q97A 4U1GB 1V7ML 4G8EA 1CXHA 4NZTH 3S35H 1IM3B 1CGTA 1MH5A 4MZ3A 4OJFH 3R8QA 2R8SL 1FFOA 1YY8A 1UM4H 2G5BA 3ARTA 3ULVE 1NC4B 1YA5A 2MJWA 5D5MF 1GZPA 3VFMB 3LN4B 4GO6B 4UBDD 1N3NB 4WTZG 3SJVB 1HKFA 4BUGA 1BVLB 3QUMB 2DMCA 5HI5D 1IC5L 2ADGB 4IRSD 5EZJB 5IMMA 1U91A 3ARXA 2Y5TA 2MTPA 3ES6A 3OV6A 2OLDA 1R3HA 2X4QA 5JQ6L 3MCKB 1RQ5A 4AIZA 4ENED 5D1XB 1RK0A 1IGJA 5M7QA 4MA3B 2FJFB 4CMHB 4HIIB 2HT3C 4G9FB 3RGVD 3TYGH 4YLQT 1KPVA 5F7DB 5MEQB 2B7DT 3KPSA 3IJYB 1E28A 4MWFA 3VFRA 3IFLL 1MFBL 4ODWB 2PTTA 3TBSB 4DVBA 3RWEA 2E6QA 4ACPA 2ILLA 3FCTB 4YGAB 4UDUA 4JB9H 2F8XC 3UPCA 4QLRA 5JIPA 1HXYA 2GHWB 3BP4B 5HBBA 1GC1C 2X4RA 3SE9L 1LP9F 1IAIM 2HFTA 4HUXA 2V5TA 5TF0A 4G6KH 5DQ9B 1F11A 1ZHLB 4E9LA 4OCWH 3L3DA 3IS0X 4YE4L 1TVBA 2CSPA 2E27L 1KB5B 1UACL 2XTJE 4NRXB 3CFEB 3FQRB 4JVUA 2RHEA 5HVGB 5D2NE 2ESVD 1RU9H 4FQPA 2YPLA 1Q72H 4DFIA 4QRSB 4UTBL 4XPGL 5B3JE 4F7MA 4GG6B 3MRDA 1KIQA 2YZ1A 2DIAA 2J12B 3FO2A 2V9QA 2VQTA 2ZJSH 2Q20A 1D6VH 3V6FB 2YXMA 3KXFE 3WKML 2ERJC 4FTVE 2KL6A 2VDKL 5FEBA 1N4XL 1MCHA 1Y0LA 3DV4B 4EBQL 1FZJA 1G7LA 1P84K 5DRZB 4W68A 3SGJA 3QR2A 4PJIF 5K9JH 2R4RL 4C4KT 1KLGB 5F1SA 3HNVH 2PNDA 3RKDD 3F58L 3VFWB 5EBLA 4BZ1L 5J4MA 3B43A 5ITFB 2ZG3A 3J7HA 2XZAH 1YEIL 5I74B 2MCPL 4Y5XB 4W4NA 3GKZA 3LMJH 4RGND 4TRPH 1JRHI 3WXWH 1G9EA 5CGMA 1OAZL 4OCNC 4OF7A 4X6EA 4IRJA 4JY5L 4NFCA 3IFNH 1VKXA 2J4WH 4F2MB 1ORQA 5ABDE 4GRMB 4X9FA 2XICA 3ZDXE 4YWGH 4PJDB 3O3BA 1QLEH 3F7QA 2IQ9L 2AJ3B 1ZLUH 3BFOA 3MBEC 2IG2L 3KYAA 5F1IA 1A4KA 3RVXC 5IEKB 1XF2B 2B4CH 3QDJB 3QUZD 2PTVA 4HDIB 2XWBA 3KAAA 4U7MA 4LSSH 5FO9B 5E4EC 1NCNA 1D5ZB 1RHHA 4XCCL 1NLBH 4JFED 4RIRB 4U6YB 4XVUD 3CXHJ 4ZUTB 4PRBA 1AGCA 4JQXC 3NN8B 35C8H 3PDGA 4MHHI 1UWEH 4Z7VF 1IT9L 1DQML 3SE4A 3QDMB 1QQDB 5E8EB 5I15H 3BISA 3PHOB 5T5NG 1SHMA 3Q1SL 2DLFH 4YHLL 2CPCA 1HOCB 3A67H 1T0MB 4NQEA 4G7VH 3AY4C 1A1NB 2Q86A 3EAKA 4RQQA 1N7MH 4JRXA 5CD5D 5GGTA 2K1MA 2DD8H 1ZEAH 4P5KA 2OZ4H 2FB4L 1IGMH 1I3RB 1K8DA 2I9LB 2F54B 5GRUL 3NIFF 3RNKB 1S9VB 4DGVH 4TYUA 4MZ2A 4H5SB 1F4WH 1QFOA 5JHDB 5TF1H 1NAKH 4N68A 3BZEA 1BF2A 4YDVB 5TE7H 2CIKA 5ALBH 3ESUF 3O4LE 2LTQB 3UMTA 4GXUM 1RZFL 2XNAA 1ADQL 1I3VA 1DCLA 4NJAH 3ARYA 4OGZA 5J6HA 3U0TA 4M1DL 3L7FA 1BVZA 2X44D 3FB7B 1ZA6B 4LLVA 1UEYA 1ZVSB 5F89B 2P8LB 1CDJA 3WN5A 2KQNA 4P2QD 5DMIH 1JE6A 4NQSA 3PWLB 4OLXH 3NCCB 4JG1L 5AWNH 4J4PD 2QQNH 4ZO6A 4O4YH 5ICYB 1IQWL 1QNZL 4H1LB 3SDAD 4LCCA 3QCUL 4Q6IA 3BVNB 4JO4H 4H8WL 4HZAA 1UH3A 4PLJC 4OLWL 4RDQG 5CJXA 4JRYA 1S7QA 3KWWB 2AQ1A 4YGVA 1U8JB 4LGPB 4S1RH 3SQOH 1I3GH 1SJEB 1P9MA 5D72L 2H8PA 4OM0H 3VXSB 3S36L 3VWJD 5CEZE 3N1MC 4JCLA 7FABH 1Z9OA 2ZOLB 2DL2A 3H6JA 4NRZA 1IE5A 3TYFB 1JPFB 3KDMB 3X12B 1XF5A 2CDGA 3QG6B 2JJWA 1F4AA 5EUOF 3DRTB 3IU3A 1H3PH 3QQ9D 1IBGH 4NQUA 4QXTB 1QO3A 3GBNH 1IZKA 1RUAL 1T3FB 3RU8H 3X3FH 1WV7T 1N26A 4KKNA 3P4OB 2X09A 1TPXC 3HB3C 3HTLX 3BN3B 1B90A 1U0QA 4U0RC 1KN2H 3PDOA 3OTTA 4HJ0C 1YC7A 4LSRL 4UV7H 1FVDB 3HC3L 3F7VB 4LARH 1GRWA 4FFYH 3P77B 4RA3A 4XT1C 3QFJE 1WEJL 3WV0A 4N0UB 1B3JA 4OLUH 4WO4C 2BNRE 1MPAL 5CP3H 2EIDA 3VRLE 1DBJL 4ZQKB 3DHMA 2GT9B 5I1KH 4IRZH 1QBLH 3DVGA 1JGEB 5JO5A 2BVPB 3I6GA 5DRXA 4N8CL 5T3ZL 1LEGB 4F9PA 2KZWA 5EZOH 1IEAA 5L9DL 1T89A 1I1FB 1WZ1H 1RURL 3LKSB 2HJFA 4YO0B 3OKLA 2YN5A 4WW1A 2YKLH 2VLRE 3RBSA 1T1XB 2A77H 3D0LB 1E4XL 3ARGC 5GS1A 3L3OB 4ZFGL 3VFVA 1A7NL 4PFEA 3PL6B 3RPIA 3VXMB 1ITBB 2EDTA 1OD9A 2A9MH 1INEH 3BKJL 4YHMH 3I75B 1UKTA 5LXGH 1Y18A 2R1YA 5T5FL 2IAMD 4BH8A 4KGJA 2SEBA 3ZTNL 3QDGA 4LCUB 2PR4H 1XR9B 2VISA 2YD3A 4WHYG 3BAEL 3MFGB 3G5YA 3NCJL 4RAVA 4U6VL 1PEZA 5IFAH 5BV7B 4WU5A 4CVXB 2PF6A 2RCSL 2DQUL 2OJEB 1T22B 3WHXB 2O5YL 1A6AA 4OT1H 4IMLA 2AXGA 4L3EE 2MQ3A 1AO7D 2D0GA 5FDWA 2YN3A 3O6LH 3L9RA 4QOKA 5AG9A 5DJ2A 5KBNC 3MREB 1OAKH 3UX9B 4BSVB 3O3UN 3DV6A 2BXZA 3LEVH 3LKNB 4MAYA 1JMZA 4FZ8H 3FN0L 2DKMA 2WIMA 4OIAA 3C08L 2CH8A 4K55A 4L3AA 1XAUA 2F74A 3ULUE 1CXLA 2IFFH 5KJRL 3WDIA 5IBUB 2R2BA 1SJVA 1X5HA 3BKMH 5FYJU 3DJ9A 2LABA 1MFAH 3GMRB 2Q7NA 3GGWA 3VI3F 3V79C 2JCCE 3EFDH 5CBEA 5A2KH 1LEIA 4OLYL 1RUPH 1CDCA 5D1ZA 3FFCD 5E7BA 1QKZH 1YY9D 1FNHA 5C0JB 3NBNA 1PFCA 1XGPA 5CZVL 4G8GD 1FYTD 2FR4A 3KYMA 3IT8D 3OKKA 4ISVB 1RZIB 3DBXB 3ZDZF 5SWQA 2D0HA 4C56A 1FNGB 2ZSVB 4N0CC 1MJJB 2IPUK 5LWYH 3TP4A 1WIOA 1U8MA 2XQBL 4APQB 3L3IB 3BRGC 4NQTA 4YAQB 5FYJH 3NIGF 3VXOA 1EFQA 3NFSL 5ICZA 1D9KD 3HE7A 4M7ZC 3VXUD 1MHCB 1ULVA 3QEGL 5F7WC 3EJYC 5IHUL 2P8PA 4GW1A 5C8JB 4FQLL 1J0JA 2ZP0T 4GW4B 1G6RA 1BX2B 5DD3L 5HGAA 3C8KA 1J12A 4H20H 3MGOA 3RVWD 3UTSB 1VACA 1OVZA 2B4CC 2WP3O 4PJEA 3VDBA 3T2QA 3IFOA 1CFBA 3Q48A 3MJ6A 4POUB 3QXWA 3OX8B 3MRNA 4LGRB 5EA0H 1U8IB 1ODAA 2BCKA 2PYED 3UYRL 5EG6C 1XCTB 1VFMA 4U1SB 4U6HB 5D2LF 3T0AA 4NQCB 3RWGA 1A8JH 3MFFB 5DJDA 1XF3B 4UUJB 3U4AA 3MV9D 5F96H 1ROWA 1HQRB 1T5WB 4PJHE 4NNPH 4AZ8A 3HPJB 1KLUA 4XAKE 3T0BA 4LMQE 4FRWA 3QQ3A 2V7HA 4LLQB 1L4IA 5E4IA 1T1ZB 1FLRH 1UFUA 1E6JH 3BT2H 4OIBA 5CEYB 2W38A 4X4YA 2X4UB 3U7WH 3EFFA 4PJXA 3MRQB 5BS0A 1NBZA 5T3XL 3O9WB 2WAHA 1FSKC 2BVUA 4F80A 1IAII 2F5BH 4K94H 2EYRB 2X9YA 4EXPX 4LGSB 4DGIL 3LKRA 1ZLVH 4MNQD 4KROD 1N8ZB 2VN4A 1IGIL 5D5ME 3SKNA 3LEXB 3FQTB 5EIIB 5J12C 4OV5B 1BBJA 5EU4B 1J0IA 1KCVL 3CU7A 4X6BB 4XI5D 5DDHB 1QEWA 5FA3B 2LU7A 3EJZC 5DD0H 2F5AH 1TJGH 2WM0A 2EDWA 5EU7E 4BZ2L 4ZD3H 1AQDB 1U9KA 3N1GC 4X5XA 1OAQH 4JQVC 3T65B 1WGOA 4EOWH 5D70L 4JFOA 4MS8C 5LG1A 4PJCA 4KXZH 4HKZB 3DXAD 3IDGA 1G7PB 3NGBC 1DTUA 3SGKA 4PYHA 5AYQA 5I8OH 5K59F 3AM8A 3FRUB 4NHCH 2R1WB 2K9UA 1QSZA 4JFFD 4KJWD 3MBEA 1FVCB 4X83A 1EHNA 2ICCA 2PW2B 1HSAB 3GK8H 5E6ZA 4Z95L 2ZUQC 5KS9A 1ZXQA 1CCZA 3D69B 1HNFA 2P24B 5CZKA 5AZEL 4YC2C 3RPKA 3WIIH 2DYPA 4TNWF 1FPTH 1T2QH 1YQVH 2EE9A 2ZUYA 4NGHL 2XQYK 3CX5J 4K7PL 4JQXA 1LP9E 2AK1L 5HYJE 5IGXL 4OGYH 3ILPA 5LQBH 2P8MB 3EO0A 4M1CD 1XFPA 3SKMA 3RY4A 3VXQA 3DETC 4IOIB 1J88A 3GMLB 1JN6B 4XMLL 1YUHA 2VXQH 5T1KD 3MODH 3MUZ1 5DHXB 2NXZB 3KYOA 5I1HL 1PAMA 1T21B 4W4OA 3DVFA 3U1SH 4ZMAT 3AS0A 2XTJB 4MQ7A 4YFEA 5H94B 2PXYB 5D2NB 4K7FA 3QIUB 3S37X 2L7JA 1IGCH 4D9LL 1JHTA 1MJ7H 5TH2B 1EGJA 2G60L 4P4RA 4AIOA 4L4TA 2VLKD 3P30H 5D93C 2FO4A 1YEKL 4NDMB 4TPRL 2M2DA 5GGSA 3G5ZA 3KXFB 4DEPC 3MGTB 5I9QC 4MDIB 3B5TA 1IL1B 3MRJB 4PJIE 5KW9L 1JPSL 3OB0K 4R3SB 2DWEA 4KUZH 4PB0H 2A6KA 3G6AB 4N0FB 3IU4L 2RGSA 4JN1L 4KMLB 3RNQA 1XGYH 1EEZB 1FQ9C 1N59A 4XPHL 1YEJL 3FHQA 4G6AC 2R4SL 3CCHA 2KZ1B 1PG7L 4HXBH 4V1DA 3P9MB 4LHUB 3BOVA 4JR9L 4M48H 1KEGH 5DJZB 3K2UH 1JFQH 1WISA 4NPYA 4UNVA 3LV3A 2IH3B 5INCB 4OCSH 3V9FA 3MCLH 4D3CH 4EUPB 1Z0NA 1KJ3L 3MRFA 4NYLB 1AIFA 3W9EA 3SY0B 3QIWD 4I18B 1DL7L 3BEVA 3VXRE 1BZ9B 1AFVL 3A6BH 3ZYIA 1HH9A 4MA1B 1FE8H 4MAUH 1R5WA 5DWUL 4K8RD 5IQ7L 5DUPH 1B88A 3QNZA 5CGYD 5DJCB 2VDNH 1R3IL 3IETA 4MA7L 3MR9B 4G6JL 4JFHD 4Y16B 2KBGA 4K3GA 1T1WA 3SO3C 4Z7VE 2ORBH 1ZSDB 1A6ZB 3QQ4A 4E41E 4P46D 4KI5F 2APBA 3KLAB 3QUYB 4PB9L 3HHRB 3W0WD 4MB3A 3ARDD 1L7TH 3TNNB 3OXRA 4TSCH 3GIZH 4UILH 4JFXB 1S9WB 2VAJA 4U4BA 1QPPA 4NQVA 3CSGA 2ICWI 4MCYA 1CT8A 2G9HB 2OQJB 2VZOA 4WV1B 3FO0L 3WXVL 4ODVH 5CJBA 2HYMA 5IB2A 1OQOA 4HWBH 2VL5B 3C9NA 4QRPE 4XCNB 3GHBL 3NIFE 1YPZA 1AXTL 2DWDA 3VJ6A 1REIA 3OAZH 5J8OA 4PTUB 1MHHB 5GGTL 3HRZA 3D3VD 4DAGH 4DQOH 4PJFE 1UA6L 5EU3A 4GG8A 5FUOH 3I50H 1JUFB 5ESVB 4FG6D 2N4IA 2FZ3B 1ONQB 2ZCKL 4OBSA 4F3FB 1I9RL 3O4LB 4UV4H 1A3RH 4LRIC 4J3WA 2DQCH 1KJVA 5DVLA 2ICWA 1EHLH 2RQ8A 4GRLD 4YNYB 3F6IA 3ARGA 1VB9A 1NMAL 1UJ3C 4MJ4A 4I2XA 4CJ0A 1D5BB 4JDTL 2R56H 4MA8L 3TBVB 2GUOB 2AJVL 2H2SD 1MHPL 4HEME 1RJZA 3M8OL 4WFFE 1KCUL 4CDGC 5L0QC 4PGEA 1HI6B 1DVFC 2I07B 5EN2A 3TJHC 3WMSA 4RMUA 1RK1A 2VXVL 2W9EL 3FQXA 4PD4J 4KZDH 4KZEH 5DHVB 2E7LC 3VGFA 4BH7B 2NNAB 3MRBB 4KUCD 2CLVB 4JDVB 5LGJB 2DQJL 2QKIA 1QR1B 4Y89A 3T77A 5I16A 1UZ8A 3ARBD 1A14H 3KYKH 3WBDA 1WICA 4BFIB 4ZNEA 5MENA 1S7VA 4GMTH 3QEUA 2QADB 2UVFA 3LKQB 2XI9A 1I75A 4K7PY 5J0BA 4NO3A 4WJ5B 5EUOE 1FL6A 3PP4L 4WW2B 1KN4H 3IVKA 4Z0XB 4PJ8B 1NCDL 1FJ1B 4JEGB 1YN7B 4ZXBA 5ADOL 4WGVB 2E8YA 1CLYH 5DUML 2R0LH 4Q58C 1BBDH 4Y4FD 1PSKH 4F8QA 5HHPB 3VH8A 2O5ZL 3T0VA 1NFDA 5C09D 4M5ZH 1WWBX 3DX6A 3C2SA 4G6ML 3WEXA 2DQTH 5IBUG 3RQ3A 1TQCC 3QFJB 3MXVL 1W2KT 3QUXD 4K94C 3IKKA 1JTTA 2BNRB 1OCWL 1HEZB 1LDPH 2NY0C 3MMEB 1JV5B 3ZHDA 3JV4A 1L0XA 1T80A 2CDFA 3IRPX 1OP5K 3JV6A 4IHOB 3W5MA 1GOGA 5IHLB 2ZCHL 4XXDB 4M6MH 4LHJB 4U1LB 1ZLSH 4XVTL 1T83C 4YHKH 3M1BA 3IJSB 4FFWD 3UBXB 1H3VA 4NT6B 4BK5A 4HJJL 1PY4A 3F12B 3RDTB 3O0RL 2EZ0D 3VRJA 2P7TB 2VLLB 3STBA 5C08D 2VLRB 3NFPA 4LLDB 2BVOA 4NO2B 3TVMA 2VC2L 2IAND 1EFXB 3LN5B 1Q1JH 4ZFZB 4Y4KA 4UAOB 3T0DA 2FCBA 3WFHB 4DCQA 5TE6H 5F7EH 5JPNA 3IKCA 25C8L 2Y6SD 5CCKL 2V7NB 3IAPA 1CR9L 3ARFD 1ZWIA 2HVKB 4Q9RL 1RJYB 2X4PA 2FDBP 3MNVA 1ZS8B 1B9ZA 4U6XA 2JTDA 4IS6A 2IGFL 1RSFA 1BJ1H 1Z9MA 4PJEF 2WLZA 2W9LA 3OAYH 3RI5F 4NCC2 3AVEA 1CBVL 4RGOH 5E9DA 3W81A 1G7MA 2DQFB 4KJQC 4ERSL 1NCCL 5F44A 4HK0B 1NLDH 3H9SD 3WFDL 1NBYB 1U8LA 4DKEH 2YUXA 2R0KH 1GGTA 4L3EB 3O11B 4LAQH 2ZPKL 3U7AA 5L2KE 1G9ML 2HJKB 4M7JL 2CXGA 3CVIH 4PP1D 2A6IB 5D6CA 1J11A 3H3PL 3UYPA 2UZIL 1JI2A 4QCIB 4WI7A 2H6PB 1DZBA 5CEXB 4EN3B 4PJXF 2GTZB 1YEHH 5I18H 2Z91B 3BXNB 5HHVH 5MI0C 4J3TA 2Q7YA 2OZ4A 3UTTB 4R4NC 2Y72A 3VI3E 1MLBA 3MRIB 4NZUL 1AKJB 4YBQD 3FQNA 4FP8H 1BJ8A 5IBLD 3RIFF 1AR1D 1CD1A 1TNMA 2JCCB 3BPCA 1SMOA 2OTWB 1UM5H 2X89A 1M7IB 3MRLA 1CQYA 1R5IB 4NKDB 2LAAA 4JZOA 2FATL 3BP5B 1SVZA 1P7KA 3ZDZE 5IB5A 4XMPL 4POYA 4BM7A 1TENA 4BK4A 1F90H 3BJLA 3PXHA 5D7JD 5EBMB 3D25B 5E6YA 4PGBB 4UQ2A 4NFDA 4S10A 4CMMB 3DMMC 4LEOB 3FO1B 5B39A 2BHZA 4ZAKC 4NM8H 4PJCF 3NIGE 3OQ3B 1KUMA 4TOYL 3D2UA 5EB9A 1QRND 2I60H 5T1MA 4HZLB 3KPSE 5LCVH 3OWEA 3W82A 2E7HA 2XPGA 1VFBA 5D7SL 4FFZH 3HE6D 5DA0B 5FM5M 2EEAA 4HAGA 4HLZH 5KS9F 4QRQA 5D1QB 4ZDHB 3MBXH 4QHUB 5IFHL 1OGAD 1RZGA 4YXHL 2YMXH 1NC2D 4HCRL 3O6KH 3WUWA 3KPTA 5IOPB 4KPHL 3UAJC 3GSNH 4IM8A 3QCTL 1WIUA 3G9VA 4HHAB 2NY1D 4G5ZL 1ZHKB 3MYJB 5ESQB 3REVB 4YHPB 5CMAA 5D2LE 1OLLA 1PDKA 2X1WL 2V6HA 3QI9B 1MFEL 3E2HB 3DX7B 3MA7A 1SEBB 5ID1A 4JPWH 4MXQD 1NEZA 2YPLE 1T04A 1I7RB 4GSDH 4YR6A 1BFVH 4W70A 2NY3B 4BSJA 4PV9A 1ACZA 3CDGA 4MMXC 1YNKH 4PJHB 5IVXA 4MCZA 3OJVC 3S34L 4NN5C 3G04B 4G8FA 5IUSA 2XFXA 5C0GB 3UJJH 5I76A 3LQMA 3D39A 3ZTJG 3QISA 5IIEA 3CVHH 1DBMH 1OAUH 4Y88A 1BVKB 3ZKXB 1BZQK 4TVPD 4K3JH 4OFDA 2JLLA 4I0PA 4QKXB 1K6QH 5BZWB 2DQDL 5FDYA 2F53A 2IBBA 3MLUL 2NY4D 2C3GA 4HX1B 4XRCB 1TETL 5D5MB 1XH3A 4CVWA 4MB4A 3SCMC 2AABH 1L7IL 4XNXH 2AAVA 3KPRA 5SV3A 1OTUD 2QSQA 2CUMA 4PRPA 3VFTA 1C08A 3OPZL 4YHOL 1H5BC 4H0IA 1EJOL 3VFSB 1FG9C 1Z6JT 4J6RL 4LHUG 1B0RB 1VEMA 2IF7A 1J0HA 1C5CL 1T7YA 1U41A 4NO0B 1KF9B 3NABL 5K59E 4WNQA 4YDKL 3ZKSD 3KJ6H 3SDXA 3A6CH 4JPVH 1F6AA 4EUPG 1YEFH 3U0WH 2BVEA 5DF0A 4YHYC 1I9IH 3C5ZC 3SDDC 5EBWB 4P57A 3STZB 2N1KA 3MACL 3O6FC 5KSUA 2VSCA 5L6YH 1U3HA 3C6SB 5EFIB 2WQ8A 3H0TA 2MKLC 1LP9B 5HYJB 1IEHA 4CVZB 2EEBA 3UC0H 3QHZH 5I1CH 4CW1B 5INDA 5IB1B 4LVNC 3EYSL 1RZ7L 2XZCL 1CZ8H 1NGPH 4N1EA 4XBPB 1J1XL 4TUKH 4MNGA 3K4ZA 1HHJA 4DJMA 1KFAL 1B0WA 1FAIH 3NH7H 4NQEE 1FYHB 2Y36H 4KVNL 4R7DA 4LKXB 5GSRB 1BGXH 3VRIA 5IT2L 1QSFA 1I1RA 4JRXE 4OM1H 4WFHE 1G0DA 2CKBB 3FT4A 3UPRB 4FABH 4G8IA 1I8LC 15C8L 3N1PC 3W11C 1GGCH 1HYSC 1INQB 1YPZF 1D6EB 4PP2A 1WITA 1A47A 1ED3B 2V5SA 3CPLB 5J6GA 2YA0A 4UIKL 4JJ5B 3UJTL 1FGNL 4NHUA 3Q5TA 4ALAH 3EO9H 1MIMH 4AQ1B 2JB5H 4PJIB 5IVZA 1CGWA 4RBPK 3ZSTA 4RFNC 2CR3A 4I0KA 5HDQL 3P3YA 5B8CC 1HXMA 3TO4B 1KTLB 1JJUA 1RUML 4UT6H 5DJ6B 1QR4A 4OUUB 4HC1L 5HHXH 4NSKA 1S7SA 1MI5D 1HILB 2VXSL 3WSQH 1F3JA 5MHSE 4HS3B 4P2CG 4JQIH 1KJ2H 1MCIA 3WUZA 1JPTL 4X5WA 3JTSB 5KG9B 3SQBA 4A6YH 1F3DJ 1RFDL 3DROA 3H9HA 4P4KD 2I9TB 3G9AB 3B6SA 3NPZB 4YK4C 3AB0B 2GJZB 4LU5L 3DUUB 4JRYE 2E7LA 2FLRT 3FB6B 4YDLB 5MEOA 4XBGB 4ODBD 1VHPA 3O8XA 1SBBA 3O2VL 4ORGB 5DJAB 2HT4D 4WI2A 2A0LD 5C2UB 3MRRB 3OAUL 3MLXL 3SE8L 3VXRB 3CDCA 1BQSA 3O3EB 4OFIA 3ZYOA 4OCYH 3UTTD 3MGAA 3I2CL 2X1OA 4Z18A 3VFMA 3D85D 4DZ8B 2M1KA 1B0GA 3FQWB 1QFWL 4X6DA 5LAXB 4KI5E 3PWPD 1AGFA 5KOVC 4HFUL 3QUMA 4Z7VB 2JIXB 1NL0L 4HUKB 5DYOB 1G7IB 1JZ5A 4LNRB 5JR1H 2FHCA 1AD0B 2YEZB 4QXUH 3BQUA 5TQ0H 1KELL 5D1XA 2E9BA 5F3BB 1UM6L 2H3NA 3E6HA 2CLZB 4YBLB 3QZWA 4M8VA 4DN4H 2R2CA 1BWWA 3IJYA 1NFDF 4U7SA 3V4UH 3AROA 5FECB 5I1DA 4F7PB 3RVTC 4KXZI 2ZKHL 2GITB 2PO6C 4XC3H 3OG4B 5BRZD 4X6FB 1WUNT 3FCTA 4QRPB 3LHPH 1LK2B 2YSSA 2W07A 2XWTA 5JW3H 2GFBA 1F02I 3G6JA 5IB3B 5IROA 4XTRC 5E8DH 4NZTL 4PR5A 3S35L 4PJFB 4OJFL 2EYSB 3JWOC 3MCG1 3GJFB 2VLME 1UM4L 2FD6H 5HDLA 3BKCL 5HDBF 2BFVL 1DSFH 2VMFA 1Z5LB 3CFEA 4S2SA 1F4YH 2IPKB 5MP6H 3VFOB 5C0DB 32C2A 1CF8H 2EIZB 1K4DB 3TIEB 5EOQH 4F9LC 3BPOC 2G75B 5KSAA 1BFSA 5EPMA 4M61B 4NKMB 1KXVC 1U8HA 4QO1A 2FX7H 3CH8A 3QIBC 1FIEA 1WZMA 4YFDB 4R4FH 5ETUA 5D7LD 5L7XH 3QDGE 3W5NA 4I77H 3V6FA 2EICA 5ACLA 4XPTL 2VDOL 3DWTA 4YIQA 3TYGL 5JPMB 4JDZB 4O2CA 4OFKA 1LHZA 1FBIH 5E6IC 3T3MF 5F7LB 3TA3B 1JHKH 1H3GA 4JZNA 3H7BB 3JXAA 1NKOA 3OL2A 3DX9A 4JO2H 2BRQA 2DQEL 4NUJB 4JB9L 5J9PB 1CN4A 1YJDH 2YD7A 1C5BH 5C0IB 1UWXH 1ETZA 4QOKE 3WJJC 4P2OD 2V2XA 5FOBA 2MPAH 5EUOB 4G6KL 5J06A 2RBLA 3QEQD 1KB9J 1UYWH 4HK3N 5C0BA 3UEZA 2P5ED 4AG4H 4R2GC 5BVJB 4LIQH 3LAFA 1RU9L 4UB0H 4GRMA 4YHIA 3DTXA 1Q72L 1ZVYA 3DSFL 5JXAH 4LFHD 5J3HC 4FQ1H 1FCCA 5JW5A 4LNVA 2Z8WC 4CADB 1A6PA 5EO9B 4BELD 1EEUA 1NJ9A 1XF2A 4WWKD 2ZJSL 1D6VL 3QDJA 4O9HH 4NNXA 3HG1D 1N5AB 1D5ZA 2H32H 2I5YH 5ISZA 4RIRA 1W72H 3QJFA 4WUUA 4MLSA 1SM3L 3MJ7B 4F7EA 5CILL 2EDXA 1MLCB 5GGSY 5K9JL 3V2AR 4C56E 3OR6A 3DMMA 4KMQA 4PJ5A 1ZT7A 3LRHA 4AENB 3HNVL 3ROLA 1TQBC 5IMOA 4LDLB 1HOCA 2X1XR 4Y4HD 4YPJA 2P5WA 4PGDA 4QRRA 1P1ZA 1VGKA 4M7LH 2XZAL 1EAPA 2O61A 3BUYA 5FGCE 3LMJL 4CNIA 3FO9A 4TRPL 4I5BB 3HI1A 5F9DC 2CMRL 1CICD 3IFNL 4HJ0D 1ZGLM 3P4MA 1I7UA 3M17A 3T1WA 5FKAB 4PJEE 1QLEL 1FZOA 4WO4D 3ISWA 5JHDA 1YDPB 2YBRB 3T4AA 3T0EC 2NR6C 4YDVA 2XN9E 1A4JA 3C60C 4LSPL 3NFNB 2X4TB 2D7NA 4LSSL 5DFTA 3AREB 1BQUA 1NLBL 3PABB 3UJIH 1S9YB 5IESL 1XR8B 1MRFH 4S1QH 1UWEL 1ZHNB 4LLYB 4FFVC 2DICA 3DX8B 4N9GB 3CSPA 4GQ9L 1KENL 2ITDA 5ID0A 2A74A 5L2KB 3HLAA 3BZ4A 3WCYA 4PJXE 1Y6NR 2DLFL 5BS0E 1JYVA 1EZVY 2EXWC 1NCAH 3V7MA 2YHGA 3A67L 3PWNA 4JY6B 1A2YB 1QG3A 3VG0H 2UYLA 5JXEC 3KHQA 4OZGF 3NAAH 3G6DL 2ARJB 4M3JA 3EZJB 4RX4A 4G8EB 2IADA 3D18A 4PS4H 3QRGH 3ZMRA 3HZVB 1U8JA 4LPTA 3VFPA 2DD8L 3ELAT 1ZEAL 4JREB 4TNVF 1MH5B 2HFGH 1YMMA 1IGML 1FFOB 1YY8B 2G5BB 1J1OH 3VXSA 3SCMA 1NKRA 2YD9A 4UQ3A 2ZOLA 1GZPB 1JK8A 1MWAH 4JGMA 1QD0A 1M7DA 5TF1L 3QG6A 1QHOA 3U0PA 1H5BA 5ALBL 1E4KA 3O3DA 1IGYA 1VFAA 5IMMB 1HQ4A 1U91B 4NJAL 4QXTA 2Y5TB 4PJCE 3ES6B 5HVWA 1L6ZA 1MREL 3L1OL 1R3HB 2X4QB 4O2FA 4JKKA 1HH6A 4AIZB 1OTSC 3MNZB 4PJ7A 2UUDK 1RK0B 1IGJB 5C6WH 1S5HA 4MD5A 3TZVD 1FL5A 5CGTA 3SDXF 4OLXL 1NDGA 4KHTH 4ZTPH 3TBWA 1JGLL 4AMKL 5AWNL 3C5ZA 3KPSB 5C0CA 2QQNL 4M9OA 4MWFB 4O4YL 3VFRB 5KS9E 5I0ZA 1N2RA 3O6FA 3QO1B 5EU6D 1DR9A 4DVBB 3DYMA 3RWEB 3NIDE 2Q8AL 4UDUB 4ELKA 4ZQKA 3PQYD 5E0QA 1X5GA 4OTXH 3UDWA 4PRNA 1J87A 2BX5A 1EDQA 4M9PA 1HXYB 4TUOA 1A3QA 1R0AL 3BZFA 4S1RL 2X4RB 4FXGB 3QFDA 5DJ0A 4D9RE 2DIJA 1MVFA 4K07A 4HUXB 4C83A 3RAJH 5FUCC 3HI6H 5BQ7B 5T3ZD 5CZXC 3WFCL 1XGUA 7FABL 2HG5A 2L4OA 3BZDA 5D2LB 1FNAA 3L3DB 1OT2A 3TT3L 1TVBB 4C57C 3LS4H 2DDQH 1T4KA 2VN7A 4WCYH 2MFNA 3U30C 4CRPA 4NWUH 2YPLB 1H3PL 4JFDD 1IBGL 1GAFL 2W92A 3WE6A 2NPLX 4N0CD 2OCFD 4F7MB 3GBNL 1TVHA 3MRDB 3RU8L 3X3FL 4J1UA 1KIQB 4L4TE 3FO2B 4HWZB 1KN2L 4UV7L 1Q0YH 4LARL 4JHBA 5DHYA 1XR9A 3EJYD 1H15A 3BN9D 2YR3A 3BIBX 4OLUL 5KTEH 1P6FA 3L5XH 1Y0LB 3MV8D 1G7JA 4UBDC 5SWZD 1FZJB 5I1KL 5B8CA 2OJZH 5CJQH 4ZUSA 3WO3B 2MHAA 3FN9A 4WENB 3WYRA 4XNZB 4XWOD 3QWOA 3L7EA 2WWMD 5EBLB 4XCEA 4F57H 4J7RA 4V1DE 5EZOL 2VE6B 1XIWD 3LKNA 2YKLL 3S4SG 5FB8A 3HI5H 3MLTA 4DK3A 1NMCB 5E1AA 5ILTH 5E08H 4X6EB 3S3PA 2A77L 4IRJB 2BDNL 1VKXB 1ORQB 2CKBH 5TDOA 2XZQH 3K81A 3REWA 1PVHA 5C9KA 2A9ML 1INEL 3SGEI 4YHML 3IJHA 3SEPA 1OAYH 1OP3K 1JZ3A 3MJGX 1A4KB 2BSRA 5F1IB 5C3TA 4Y1AA 2XWBB 4RFOH 1DDHB 4N0YH 1WTLA 4K9EL 2V9TA 3HR5A 1RHHB 1UCBL 5I19L 4AIXA 4PRBB 2P44B 4X6DF 4JHWH 3BH9A 5IJVA 1I9EA 1N6UA 4X7TA 5FCUL 2YRLA 1WC7B 3AMLA 1JWMB 4OT1L 4XHJC 3EJZD 4ZUUB 1IAOA 4U2YA 1MIEH 1I9JH 2VSDA 4K2UH 2EECA 1ZTXH 3BDYH 2VQUA 4JPKH 4BQCA 4MS8D 4NQEB 1NSNH 3LEVL 4PGCA 1U3JA 1A1MB 2CIIA 4OZFH 2Q86B 2V5RA 2PO6A 1MHCA 4JRXB 5C92A 1YPZE 4L8SC 5C1MB 1CIDA 2W9DH 1LE5A 5C8JA 3QAZB 4PJGF 4M5YH 1ITCA 1K8DB 2IFFL 3MUY1 1QZ1A 4ZOAA 3BKML 3G6JF 1H3XA 4RZCA 3KG5A 4HUVA 1IM9D 3BZEB 3RKDC 2IH1A 2FX8H 2XNAB 4EZMA 4M6NL 3P0YL 1XCTA 2FO1A 1KXQE 1S78D 4GAYB 5J6HB 1MVUA 3U0TB 5F6IB 3DETD 4RGNC 3L7FB 4HH8A 4I2XE 4JGUA 3HPJA 1RMFH 1JIBA 2YXFA 4LLQA 1T1ZA 3EIFA 3UTZA 1UWGH 5LWYL 4UNTA 2X4UA 1RV6X 2PN5A 3H3BC 4LCCB 4JFZH 2NTSP 4Q6IB 1TCMA 2NW2A 1KBGH 4PBXA 5T3XD 5JDJA 1Q9KA 3CFIC 2EYRA 1KCKA 4JRYB 4XX1E 1S7QB 2FYYA 4XVUC 3GSNA 1DBAH 3FQTA 3UPAA 4G42A 2H8PB 3ZE1F 1X5JA 1KIRA 3WJJA 4XAWH 4C59B 5FA3A 1LNUB 4NBXB 5E99L 2FIKA 1XF5B 2CDGB 5EA0L 5FYLD 3OKEA 1XGRB 4LCWD 2E5EA 5EC1A 4OGAD 1F45A 3IU3B 4O5LL 4UU9A 5KSVA 2VWEC 1QO3B 3QUML 4XBEH 5TDNA 5I1JH 4G6AD 3O4OC 2JJTA 4HS8L 3I85A 3H9ZA 1LO4L 3RL1A 3N1QC 5DVMA 5F96L 5CD5C 4NNPL 3FONB 3T08A 2BY3A 3PDOB 2ZUSA 3PGCA 1NFDE 3V6BR 2X41A 3HZKA 4YHZL 1JNHA 1FVCA 4JVWA 2PW2A 3I6LD 1E6JL 1NCBL 1CS6A 3MQIA 3U7WL 3CDFA 3O2WH 4HT1L 1KC5H 3D69A 3B2UD 2F5BL 4HBQA 3DVGB 5JHLH 1YYMH 5JO5B 2BERA 4KRPC 4IEFB 3EYOA 2CUIA 4RRPA 1T2XA 5DRXB 5HDBE 1MCKA 4F58L 5C6TL 2QQLL 1IEAB 2HTKD 4EDWH 4GAGH 4NUGH 2BOBA 4WW1B 2FH6A 3GSRA 5IR1A 4LSDA 4DZBA 4ZD3L 4J4PC 1NAMH 1C7TA 3SDCA 5GS1B 4BSWB 1JWUA 1OAQL 4XPBH 6FABH 3VFVB 4YX2H 3TH3T 4EOWL 3RPIB 3DLQR 3PDDA 4JM2D 4L1HA 3CSYA 1CLOH 3VG9B 1X5AA 4KJYA 3TWCL 4Y2DA 3RWHA 2SEBB 3QDGB 3O41B 1P4BL 4NHCL 3T3ME 1BWMA 1VGEH 4FTVA 2QQQA 2VISB 5HHME 3T0EA 1AP2A 4PG9A 5E9DE 4OKVB 3SGDH 3G5YB 1KPUA 1IL1A 4EJ1C 1ND0A 3C60A 4XZUA 4RAVB 2DQGH 4R3SA 4NC1E 4DTGH 4WU5B 3WIIL 3L3GA 3GSWA 4GKSB 4M02A 1OPGH 1A6AB 3JSSA 4RCAA 4IMLB 1Q8MA 2AXGB 4M4PA 4OGYL 5FF6A 5FDWB 5LQBL 2RFXA 4QOKB 3MSPA 4PIRF 3KS0J 1QBMH 5DJ2B 1N0LA 2VXQL 3MODL 3DV6B 3T2PA 2HKHH 4MAYB 3U1SL 1AGDA 4WGWB 2X4SA 5JXEA 2Q6WB 3JTTB 3L3HA 2F74B 1YECL 4NYLA 4CMHC 1MJ7L 2CD0A 2R2BB 5FUZH 1FN4A 3RY5A 1BZ9A 3U82B 3TJHD 4XP5H 4F7TA 3P30L 5T1DH 2VLJA 5D7KE 3E0GA 5CBEB 3MR9A 1QVOA 2P45B 1UGNA 3CZJA 4JFPA 4O02H 5CSZB 4HQQH 4LLWB 4R0LC 4D0BA 4NCC1 1ZGLA 1JBJA 3NCYS 1XGPB 4DW2H 4KUZL 1MRCH 1MF2H 3S9DB 3T0WA 3KYMB 1RPQA 1WFOA 2GK2A 4P2YA 2R9HC 5HYIA 5SWQB 2NCMA 4C56B 1HHHA 1CL7L 2ZOKA 1XGYL 5SX4H 5HGHB 4Q0XH 3WS3A 5H37G 1U8MB 3B9EA 4P49A 1S9WA 1KJ2A 4PJ7F 4HXBL 4M3KB 3CK0H 2DQIH 3VXOB 2BHYA 3GO1H 4A6YA 2H1PL 4WV1A 5ICZB 4LSTH 3VA6A 3BKYH 4W6YB 2VKWA 1KEGL 5FGCB 5L88L 5IK3A 4OSUH 2VL5A 1JFQL 3GMOA 4MJID 4K8RH 1N64H 4GW1B 4OCSL 5HYSB 1H8NA 3ZKNC 3V6OA 3MCLL 4KC3B 3VU2A 4D3CL 1G6RB 4R8WH 4GBXD 2XZZA 5HGAB 5ADPH 3OBAA 4RWYH 1AHWA 4K71B 3MGOB 1FFPA 1VACB 4PJEB 3IFOB 1CDBA 1OQXA 1ZE3C 4Z6AT 4OUOA 4MAUL 1RZKL 4KK9D 5DUPL 1MAMH 2A9NH 5ESVA 1IARB 2VDNL 2ICES 2XN9B 3EOYG 2BCKB 2J88H 4X6CA 5A2IH 5E8PA 3FMGH 3RWGB 5HY9B 1TTFA 2EC9U 3GEWB 2ORBL 4L4VA 5DJDB 4XVSH 3WNPA 1SBSH 3CFDB 1L9NA 2GJ6A 4YUEL 1I1AD 1KLUB 5K9QG 3QQ3B 2V7HB 1G9NL 3NCEB 4Y5XC 3OGOE 3TBVA 1L7TL 2XY1A 3D39E 4R97B 1P7QD 4TSCL 3SKOA 4OZGE 5I75B 5DZLA 4X4YB 1YC8A 3EFFB 4PJXB 5BS0B 2ERJB 3MRPA 2BSSA 1PKOA 1MCPL 3BMVA 2BC4A 3U48A 1QLRA 4ODVL 3CXHK 4MX7B 2EDYA 4BH7A 1BD2D 1QR1A 4X4XA 1PJ9A 2DQHL 5DJYA 3SKNB 3TC9A 1KGCD 1Q9LB 4LP4A 4IRSA 1BBJB 4JAMA 1CD0A 3GJEA 3BW9A 3KPRE 4RMSA 2IJ0C 4DQOL 1QEWB 1V7NH 5TPWL 3VD7A 2VABB 2V5MA 3V0VA 2BNUA 3I50L 4GKNA 3AS1A 4YFLF 5M94B 4WW2A 4XNQA 2ADFH 3G5XA 4HPOH 3RGVA 2X2YA 1A3RL 3LIZH 5FM8A 1NFIA 4JFOB 1JGDA 1EHLL 1D9KC 1DP0A 4QHKI 1DUYB 2IMMA 4PJCB 1QP1A 4LSVH 5D8JH 3SDXE 1BQLH 1VFOA 2VR5A 3IDGB 2NY5H 3RX5A 1CTOA 1MCSA 4V2CB 3MBEB 3RVWC 5KS9B 3LQAC 1RUKH 4R4ND 5E4EB 3TIDA 1P5UA 2DYPB 1U6AH 4UTAH 1O5DT 4KZDL 4KZEL 4UOW1 1DBBL 2GTWA 1KACB 3DI3B 4FHBD 3SKMB 3EO0B 4L5FH 1A14L 3KYKL 3VW3H 4U1LA 5IW3A 2ESVA 3TJEL 5EWIH 4MNGE 3IJSA 5J1AA 1YEDB 1YUHB 2C7UB 4X8XA 3BP7A 3PF2A 1BFOA 3KYOB 4UINL 2VLRA 1A6VH 1QFUH 1KN4L 2DTMH 4MQ7B 4WI3A 4H0HB 4K7FB 1JHTB 3EYUL 5DR5H 5TQ2H 1XZ0A 4P4RB 1CLYL 3WKNA 2QTEA 4YDIL 3ARZA 1BBDL 4H26A 4L4TB 5DVOA 1PSKL 2HVKA 1RJYA 2FO4B 4KROC 5DD5H 1B4JH 1U8OA 5TDPA 1FFQA 1VPOH 4FQXD 4NRYA 1IKNA 1DQDL 2H32A 4JFYA 4XI5C 3WFEH 3CMGA 1W72A 4HUUA 1LD9A 1Q9OA 2Y06L 1J8KA 2YZ8A 2BNQD 5C07D 2XKSA 3AXLB 2A6KB 3B9KD 3QDHA 2L0DA 4KKAD 1I8KB 1JRHH 5BV7L 3BO8A 5C7XH 3RNQB 1IC7H 2EYTA 3U4BH 3JWNC 2R29L 4WVRA 1N59B 4HUMB 3CCHB 3SE3A 4PUBH 1D3CA 4KRNA 1NGQL 2HJKA 4KQ3H 3FZUD 5FYJE 2FLBT 3OJ2C 4V1DB 1E4WH 2A6IA 4S1SL 3I3BA 3OMZA 2AJSH 2H6PA 2YD4A 4S1DC 2FJHA 4NPYB 3CFJA 3LV3B 3ROOA 4FNLH 4NJ9H 5BW7C 3QUZA 3IDUA 3WLBA 1QSED 4N90D 3MRFB 3W9EB 3QT2A 4WI9A 2DJSA 3BEVB 1N5YH 3GMNA 2DAVA 4JPIA 1AKJA 1HH9B 3VWKA 4LKCB 1R5WB 4Z76A 5EO1B 4PRIE 5FYKD 4M1CC 2EE6A 4R26H 3IETB 1U95B 4MSWB 4X6DE 5F1KC 1Q38A 1T1WB 4FQ2H 4Y5YC 2FEEI 3AGVA 3O2DH 4RGOL 5JNYB 1J7VR 5HHQA 3QQ4B 1FNFA 4WI4A 5DSCA 3UZEA 1NLDL 5D1ZD 3L3JA 3RWJA 1TPXB 4LEOA 4HIHA 3FO1A 4X7SH 2R0KL 3IFPA 4I8DA 2IPTH 4LAQL 4U0RB 3OXRB 2CK2A 4ZUWB 1EA9C 1QHPA 5JQHC 4MCYB 4RNRA 1RZJH 4CAGA 3CVIL 4Q9BA 1A5FH 4PRDA 2NZIA 2DM2A 5ENWA 2AVGA 2V2TA 3U2SA 5IB2B 3C9NB 4PJGE 3HZMA 5D1QA 5I18L 2FEDC 5EUKA 1YPZB 4RFEA 3S6CA 3VJ6B 3MLVH 1WQVT 3G6JE 4QTIH 5GISH 5MEPA 3HE7D 3SDDD 3BSZH 2FL5A 1QA9A 4KTYA 4HAFA 1FL3A 4GG8B 5EU3B 4EI6A 4MXWL 1MWAA 4FP8L 4G80A 2Y07H 3MYJA 1HHIA 4XGZB 5GRJH 4P2QA 2B1HL 4P9HC 1KJVB 2ICWB 3GBMH 4POZD 4J4PA 5DVKA 4PV8B 2DLIA 2NQCA 3ARGB 4ZYKA 3SDAA 2B20A 5CJOH 1F90L 4I2XB 1IGTA 4B41A 1S7WA 1KNOA 2XA8H 4NM8L 4U0QB 3OKYA 5BMFH 1RJZB 3QIWC 43CAB 4JKLA 4PGEB 2CJUH 5ICXA 2I60L 3EYFA 5LCVL 2J7LA 1BVKA 1RK1B 3QHTC 4HSQA 4K8RC 3O45A 2OXGA 3TV3H 5CGYC 3FQXB 1WWWX 3UZVB 3VWJA 3W11D 3GRWH 5F70A 1HYSD 2WV3A 2QKIB 5E2WH 4AEIH 5I16B 1UZ8B 3MBXL 3ZE1E 2X6MA 4XRCA 3VE0B 3O6KL 1S7VB 4P46C 4ZG1A 2UY6A 3QEUB 4XNMA 3GSNL 4NKOB 4NO3B 3MX0A 1FL6B 3O3AA 2EO9A 3ARDC 4B0MM 3JUYA 4OCXL 5EO0A 4TN9A 5C0BE 3IVKB 3EBAA 3QWQB 4Y5VC 1MRDH 4JPWL 4S11A 1BAFH 4XP4H 4ZXBB 4ETQA 2NY2B 4GSDL 3B5GA 1JZ7A 2OI9C 4APQC 4TVPH 3VH8B 1YNKL 1JPGA 1XCQA 1NFDB 2J2ZA 3K8KA 3VGGA 2R69H 2AK4D 3MUHL 1LO0H 3DX6B 3WEXB 2J6EA 5JOFA 1LO3L 4HUNB 2FHFA 1OAUL 2FWOB 5ISZE 1JL8A 4R0LA 2R23A 4K3JL 4KKBD 4FG6C 4WUUE 4XCYB 2CQVA 4KDTA 3JV4B 1EPFA 3Q0HA 1N0XH 3JV6B 1A0QH 4L9LA 3GSXA 4OZ4A 4CW1A 4GRLC 5IB1A 4PJ5E 5BVPH 4XBPA 1IVLA 2LU4A 3MNWB 2AJYH 2AABL 1ZLWK 4XNXL 3VRJB 2P5WE 1S5IH 5B38A 4QRRE 4D0CA 3KLHD 1VDGA 3NFPB 3MJ8B 5GSRA 4ZPVA 2H2SC 1HHGA 3TVMB 4WFEE 2E7CA 3O6MH 2IAMA 4JHAH 4UT7L 2CKBA 4DCQB 1UVQA 1CXKA 5AZ2H 4HWEH 5JPNB 3IKCB 2NY5C 3PWJA 5DK2A 4K3DL 3RTQD 2EE3A 3KJ6L 1ZWIB 2WSKA 2VDQH 3MNVB 4U6XB 2QBWA 3ARBC 1YEFL 4IS6B 3U0WL 4LVEA 1BLNA 5F1OB 1I9IL 4I3SL 3G5VB 4YHNA 1AO7A 3FQUA 5HHMB 2AJUL 5E9DB 4XNUH 1OW0C 3X11A 1G7MB 4TQEH 1NDMA 3K46A 1CD8A 5SWSD 5L6YL 2RB8A 3JWDH 3CFCH 1WAAA 5DD1H 5HPMA 2B2XL 1A7PL 2DM3A 4X6CF 2FX9L 2GAZA 4XPFH 5DJ6A 2Q87A 2W59A 3F6LA 3ULVC 3QHZL 4TUKL 4Y4FC 1A9EA 1DLFH 4HS3A 4OQTL 2APVA 3MV7D 3RBGA 3NH7L 1V05A 1FNSH 3BGFC 1J1PH 5KG9A 4OZFA 5B4MC 1P7HL 5C0RH 1FSKB 3MROA 1BGXL 2GJZA 4OM1L 3CX5K 3FB6A 1TDQA 4KDVA 4XBGA 5ALCL 5K9KA 5HYQA 4ORGA 4FABL 2Z8RA 1YMME 1MLBB 1GGCL 2LVEA 3T4YA 3FQNB 5CSBA 4G8GA 1FYTA 1CD1B 1GC1H 1J05A 3I02A 4PY8I 3BPCB 3MLRH 4P59H 4IIQC 4FFWC 5LAXA 5DRNA 4JZOB 1P53A 5BZDA 3X17A 4ALAL 2EZ0C 4NZRH 3EO9L 4Y19D 1MIML 4LLUA 1P7KB 5IB5B 2JB5L 4N8VA 4E41A 4PGZA 1G7IA 2AJXL 2CGRH 1D9KA 2YEZA 3D0VA 3AC0A 4H25A 1Q9WA 4PJ7E 3VXUA 5GS0L 2ITCA 2CLZA 5HHXL 3NGBB 5FHAH 3K8MA 2BP3A 2Y6SC 3D2UB 2Y5EA 1U3ZA 1EMTH 2IEPA 3NACH 4LEXH 5T1MB 3WSQL 3S3SA 3KJ4C 4R2GD 5C0CE 3ARFC 2OR9H 1GHFH 5HPOA 1I1CA 2PXYC 5D2NC 1KJ2L 2V17H 3QIUC 4QXWA 1VFBB 3THML 2DM4A 3VD3A 1CDYA 4A6YL 4YC2B 4QRPA 4QRQB 5J3HD 4WFGD 1U92A 1RZGB 2R8SH 2PYEA 3VRLF 2NX5D 5LKNA 1R3JA 4PJFA 2DI9A 5B22A 4B7IA 4OCYL 4F37F 1BOGB 2ED7A 2OL3H 4NO5B 3MA7B 5ID1B 3OHXA 4PP1C 1NEZB 1WCBA 5JQ6H 1T04B 1CD9B 2IMNA 3MOBH 4YR6B 2W0FA 1IJ9A 3WJLC 2VDML 4J3VA 2G75A 3I6KA 4MCZB 4QXUL 1GIGL 4ONFL 5CHNA 2VAAA 4G8FB 2XFXB 3B2VL 1RZJC 4MNQA 3D39B 3IFLH 5D93B 2E9IA 3WS6A 1WBZA 4OZGB 5IIEB 4P5TD 4YBQC 4RDQF 4DEPB 1UH4A 2DL9A 5IBLC 1VSCA 1AR1C 5I9QB 2D9CA 4I0PB 4ODTL 4XC3L 4KRLB 3QNXA 3GB7A 2Y23A 4JLRB 3LHPL 3V0WH 1WF5A 3DVIA 4LPYA 4MA1C 4PY7A 5JW3L 1DANU 3D1MC 3N85L 4QYOA 5C0IA 1XH3B 2NR6D 1X4XA 4CN4A 5E8DL 3SGDI 2ADJA 4XMKH 1DEEA 1B2WH 3KPRB 4HIJB 4X4ZA 2E27H 4QHMA 3EYQD 4GKZA 3VFTB 1C08B 1PZ5A 5EUOA 2AI0H 2FD6L 4OB5L 4YPGA 2BZDA 3F7PC 5MEND 3DXAA 1NAMA 4UTBH 4XPGH 3HFMH 3QUYC 2BY2A 4JFFA 3OKMA 1G0XA 3JZ7A 1F4YL 2W0LA 2KH2B 4FFVD 4CU8A 2QR0A 2YD6A 5MP6L 1E4JA 2GY7B 4WNQB 3HE6C 1ZHBA 3SDXB 2EDNA 4GMSH 2ID5A 2IQAA 5EOQL 2EDJA 2EXWD 3RZCA 1TZGL 2FECI 2Y7QB 4CADA 2VDKH 3MA9L 4Y1AE 5L7XL 4ZS6D 4I77L 4AM0A 4NOFA 3OB0H 5KSUB 4M93C 5DMJB 2Q8BH 1U3HB 3EO1A 2NY1C 1K8IA 4Y5YA 2R4RH 4K23L 3OGCA 1FBIL 3GMMA 2GIYA 5T1KA 3H0TB 4MD0A 1JHKL 1GGBL 2WUCH 4LPXA 3UTPE 3MJ7A 3F58H 1A7QH 5CKAA 4JO2L 5IMLA 4MXQC 2KUTA 1ZMYA 1YJDL 2IBZY 4AK1A 3MRCA 4MNGB 5D6DC 4FQJL 1HHJB 1JF1A 2QSCL 5CIPH 4P23D 2UWEF 4JY5H 4R7DB 3LN9A 4R4BA 4PGJA 2VLKA 4IDJL 3VRIB 1UYWL 4N8PA 1MCBA 3BH8A 5EORH 4PD4K 3S36X 4AG4L 5SX4I 1MSPA 3FT4B 4HJGA 5DJ8A 4G8IB 4NQDD 1EEYA 1G1YA 2IG2H 4UB0L 2ED8A 1CFNA 4LVHC 2O5XH 5JXAL 4PP2B 3PIQA 4GT7A 4Y4KD 1JGUH 3AS3A 4FQ1L 2AS5M 5J6GB 1GSMA 1S7XA 4G6FD 4NHUB 3TM6A 1NGYB 4JE4B 3CMOH 2X4TA 1PD6A 5IVZB 8FABA 1DQMH 2FGZA 2I5YL 3TBYA 4AEEA 5CUSL 1OWRM 1HXMB 4OV6F 3QBTB 2DOCA 3Q1SH 4YHLH 2DKSA 1FCGA 1QLFA 4N9GA 4NSKB 1S7SB 1R5VA 1CU4H 1Y6MR 1OTTD 3HNSH 5GSVB 3N9GH 2Z93A 4GS7B 1F3JB 3QPXL 4Q9CA 3S5LA 3QIWA 2ZCLH 4X5WB 4EI5D 1DVFB 5KANI 4M7LL 1CGSH 2CO7B 1EO8H 3B6SB 2FB4H 2ICWJ 1QRKA 4QHNA 4ELMA 1CDUA 5GRUH 5E2UH 5MEOB 4A2MA 5A2JH 3O8XB 1EXUA 3HZVA 4I3GA 5I17A 2PCPB 5I8CA 1I85A 3MRMA 3EYVB 3ULUL 4P46A 2HJLA 4ZODA 4PRIB 4R9HA 3W0WA 1B0GB 4JM4H 3ARDA 4X6DB 3JWDC 1AGFB 3V5KA 5ACMA 1C1EL 1D5MA 4MD4B 4Y5VA 5ERWA 4ZS7H 3MZGB 3UJIL 2GK0A 1RULH 3WFBH 5GRXG 4JG1H 1MRFL 3BQUB 3RDTC 3MNZA 2H3NB 3E6HB 1QNZH 5IB4B 5DURD 3QZWB 3QCUH 5GRVL 1TJHH 3S3JA 5IJKC 2FSEA 2YS4A 4H8WH 1XGTA 1HE7A 1TQCB 5DS8A 3VH8G 5I1DB 3FN3A 5DQDH 4EEEA 3QO1A 3MRHA 4NWTH 3VG0L 1R6VA 3OKOA 4JO3H 1Q0XL 3NAAL 4PJGB 5HGDA 1WWCA 2NY0B 2YSSB 2XWTB 4KK8C 2GFBB 1AD9A 3G6JB 3S36H 4DWHA 4PS4L 3QRGL 4PR5B 3QEHA 1X5XA 3U7YH 1T03L 2HFGL 4FXGA 4GRLA 2D7PA 1VADA 3RHWK 4DOHE 5TFSH 5BQ7A 1J1OL 1U8NA 1KG0A 2PKDA 4D0DB 3TN0D 2GSGA 4I4WB 5D2LA 2Z31D 1MWAL 4LBEA 1ACYL 2EIEA 5F71A 1UCTA 1RUAH 2VO5A 3KPPA 4MQSB 5JZ7D 1U36A 4S2SB 3KPMB 4XHJD 32C2B 5F9OL 1A21A 4U1KB 4P4KC 2I27N 1FZMA 3BPLB 3KPOB 3HC3H 2B1AL 2R15A 5KSAB 1F8TL 5I8EB 5EPMB 1ZT1A 1U8HB 5F93C 3FAWA 4HWZA 2BK8A 5ETUB 2VTFA 5KVMC 2HT4C 1YYLH 2DN7A 3BPNB 2JJVA 2A0LC 3VDCA 4LDOB 3WNMA 4KHTL 4YIQB 4ZTPL 3T0EE 4KHXH 4O2CB 3RZWA 5I1AB 5GRWA 1EV2E 5GGQL 2WZPD 3RWDA 4LLAA 3N1FC 4JZNB 4QRTA 1OP5H 1EUUA 1O0VA 4N8CH 2WBJD 3DX9B 2NY6B 5T3ZH 3QPQD 1YEEL 1UXWB 3GNML 4OTXL 1CI5A 1WAAF 5L9DH 5CWSA 4HFWA 1RURH 3LH2L 1ETZB 2V2XB 5GS2D 4ONOA 2F53D 5FOBB 3HPLA 3RAJL 5HD8C 3IDYC 2VE6A 4Y4FA 5ECJE 2D7TH 2ZZUT 5C0BB 3LS4L 5C09A 2AQ3A 4WCYL 4PRPD 3S7GA 4N1HB 1EHXA 3F8UB 5MI0B 1MAKA 2DLEA 2X9XA 3DTXB 3QUXA 4YHIB 1A02N 5T5FH 3QP3A 1K3IA 4KKLD 4XC1H 5JW5B 2DBLH 5FA4B 2VLJE 4KJPD 1UQSA 3IAGC 1NJ9B 3NTCH 3ZKQD 4I48A 5C0AD 4D2NA 4NNXB 4U6VH 1Q0YL 3GMQA 1DDHA 1J8HD 3IGAA 2P46B 2RCSH 2DQUH 1XGQA 2W65A 2J6EL 3LKPA 4G3YH 5ISZB 4L3CA 3QJFB 1J0ZA 4FN0A 4R7NA 2XACC 5KTEL 3L5XL 3D6GA 4WUUB 2JF1A 5C08A 4F7EB 2R2HA 4LSQH 4GKOA 1DANT 2IANA 1WC7A 1JWMA 2VDPL 3OR6B 3DMMB 1QACA 4PJ5B 1ZT7B 4ZUUA 4OZIA 4P2RE 5E94A 1LK3H 3DIFB 4ZAKB 3ROLB 5IMOB 4F57L 5T33L 3E2HC 4CJ1A 3EDFA 1FNEA 3C08H 5F9JA 2P5WB 2FBOJ 4PGDB 4QRRB 4HIEA 1P1ZB 5B39G 5EZIH 1VGKB 3S96A 3ARFA 4NKIH 1EAPB 2O61B 3BUYB 2EDKA 4CNIB 1GGYA 3FO9B 3HI1B 1F4XH 1A1MA 1A6WH 3R1GH 1HNGA 5ILTL 3QA3A 4HGWA 4XP1L 3LRGA 3V6OE 1UZ6F 3P4MB 4P9MH 3QXUA 1KJMA 1I7UB 2CKBL 3M17B 1FC2D 1QSFD 4FS0A 3VFNA 2XZQL 4U1JB 3F62A 2AXFA 2OM5A 1FZOB 3H9SA 3ZKXC 1JGVH 4NC2B 1OAYL 4CGTA 2WBKA 3FB5A 3T4AB 3WUWG 4PJFF 4P2OC 4M43L 4OZHF 4RFOL 1T5XA 5CZVH 1A4JB 1HDMB 3O2DA 1VCAA 4X6CE 4ZFOA 1EERB 5KVEL 4KRPD 3DUHA 3C6LD 1OARH 4GAYA 1YNLL 4L4VE 1DN2A 4KDWA 3DI2B 4JHWL 2DLHA 4L1DA 4AL8H 1CGXA 1X4ZA 2GJ6E 4WHCA 5HHOD 4PJ9D 4KAQH 3H42H 3K8LA 4LSUH 1LE9A 4O58L 2ITDB 5ID0B 2A74B 3HLAB 4K7PX 3BZ4B 4XP9L 3B9VA 3T0XA 1MIEL 4Y8AA 4K2UL 4PRHD 1J5OH 3WL9B 1ZTXL 3BDYL 3PWNB 2K7PA 4JPKL 2M8XA 2UYLB 1NSNL 4WWKC 2NYYC 1JNNH 3EGSA 3RUGA 1Z9SA 2C3HA 2WINA 4GOSA 2IADB 3D18B 2W9DL 3VFPB 1MCQA 1YMMB 4TUJA 4DUVA 4M5YL 4OD3H 4ZSOA 3SCMB 5D7JA 4UQ3B 3UYRH 1JK8B 1LNUA 1M7DB 5IVNA 4Z5RB 3MOQA 3U0PB 1H5BB 1XGRA 3R8BB 3O3DB 3X13A 4Y4HC 5FKPB 4F33B 1IGYB 1NC4D 1VFAB 5FV1L 1HQ4B 4M62L 3T8XA 1I7TA 4M8QA 1KEMH 4HKJA 3L5WA 3SJVD 4O2FB 3PJSB 1HH6B 3HE6A 4AH2A 4PJ7B 1V3KA 3FONA 1CICC 3BD5A 1S5HB 5T3XH 4MD5B 1FL5B 2JK5A 4U05A 1OGAA 1NDGB 3TBWB 1NC2A 4YHYB 3C5ZB 4X5LA 5C0CB 1C12A 3V52H 3RY6A 4K3EH 5D1XD 3GRWA 1N2RB 3O6FB 4HGKC 2ZNXA 4MNHA 1PG7X 4G9FD 1KBGL 4ELKB 1S9KC 3CX2A 1KCVH 4CL7A 4PRNB 2Z4QA 3HMXL 3FOMA 4TUOB 5FYLH 5C2BH 3BZFB 1SY6A 2ESVE 3FT2A 1DBAL 3QFDB 5DJ0B 3VGEA 4C83B 4LVNB 3H2WA 1SQ2N 4U31A 4TTGA 4XAWL 2XRAL 1XGUB 5D6DA 2HG5B 2W60A 5D70H 1T4KB 1NANI 4LIQE 2A6JA 3F5WA 4QTHB 2R9HD 4BSWA 3LEYL 1AY1H 5KAQF 3WE6B 1IEBA 5DC9B 4HPYH 3CIQA 2HFFB 1TVHB 2R39A 4KVCH 5FK9A 4J1UB 5I1JL 3TCLA 2EDEA 1EBAA 5E2VL 4H8WC 5F3HA 3O41A 3OXSA 1ZANH 5DHYB 2ADIA 5KSAD 4X4MA 3MLWL 4NGHH 1Q94A 1H15B 4OKVA 3ZKND 4K7PH 1DFBH 5ESAA 5IGXH 3O2WL 2YPKB 1G7JB 4HD9A 5ITBL 4GKSA 4RFNB 4TULL 4RGNE 5B8CB 5JHLL 1HWGB 4XMLH 4ZUSB 2MHAB 3QWOB 3L7EB 1FC1A 1IAMA 1S7TA 2AW2A 3GZKA 4XCEB 5E2JA 5KOMC 3G08A 1SEQL 3HMWH 1A9BA 3DUSA 5HVHC 3TZVC 4X98A 5FB8B 1DQLL 3MLTB 4D9LH 5E1AB 1AXSA 2G60H 5GGRB 1O7VA 2Q6WA 1NAML 2NY7H 3JTTA 3VMOA 4YK4B 1CLCA 6FABL 4WHTA 4TTDC 5TDOB 4JFEE 3RFZC 4ELMF 1U8QB 3REWB 2WIIA 2FRGP 5IW6B 3FOLA 3IJHB 4LHQB 1CLOL 3T1FA 1OWWA 1V3MA 2BSRB 4UOJA 3DNKA 3HC0A 4ODXA 5KW9H 4Y1AB 5DQJA 3W2DH 1VGEL 5CSZA 3HR5B 4LLWA 4RBPH 4U1NA 1HKLH 3EOBA 1NPUA 1T2JA 3IU4H 4JN1H 4NFBA 2DQGL 4ZUVA 3BH9B 5IJVB 3QDJD 2VWEE 3NCBB 4X7TB 4XPHH 4D9QD 2R4SH 3TGXA 3BIKA 1PG7H 1FGVL 1LO2L 2VYRE 1IAOB 3CXDH 5HGHA 4OD2B 2Y1VA 2UWEE 3EUUA 2ATPA 4QF1A 1QBML 1P69B 3T09A 5I1EH 3T2OA 3QDMD 5IHZA 1JTPA 4PGCB 5CJ5A 1TTGA 2HKHL 3QZWG 1KJ3H 2CIIB 3C8DA 2PO6B 1I8MA 1DL7H 3BN9C 5HYSA 1LE5B 3LB6C 1UT9A 5DWUH 5IQ7H 3E8UH 5FUZL 1CLZH 3KPNA 4RZCB 5K9OA 2XY2A 4GW5A 4XP5L 4HUVB 4RMWA 4XWOC 5T1DL 2IH1B 3TA3C 4P2QE 4DUWA 2WWMC 1LMKA 4GXVH 2XN9A 2F54D 4O02L 4HQQL 3T3PF 1MI5A 4UT9H 3RL2A 4RWHA 1XIWC 2D31B 4PB9H 2VDLH 5HY9A 4M7KL 3T04D 5CFHA 2HLAA 5JHDD 1MVUB 3GHEH 5KVFH 2WBWB 4DW2L 3P11L 2QL1A 1MF2L 5DMGD 3RJQB 3CFDA 2Q76A 4P4KA 3BWAB 3W9DB 1D5IH 1UC6A 3I84A 1A1OA 4PLKD 5D9SA 3UTZB 4Q0XL 2EDOA 3WXVH 3QIBB 2HVJA 1LEKA 3QHFH 3EOTL 4KUCF 1CK0L 1GVIA 1HCFX 2GY5A 3GHBH 2DQIL 3AU1A 2NW2B 5JIKA 2XOTA 2C1PA 3QULA 5E6IB 1Q9KB 4L4JA 1G7QA 2P4AB 4MX7A 3RIAK 3D85A 1GOHA 4K8RL 5KVDH 1N64L 1UA6H 5C0FA 1K85A 3ARVA 2FYYB 3PWPA 5F1NA 3GSNB 3WNLA 3NCYP 5ADPL 1Q9LA 4G42B 5JOPD 4RWYL 1KIRB 1I9RH 4MVBD 3TNMB 3VXTA 2VABA 2FIKB 2OL3A 3EOAA 1MAML 2WWKO 3OKEB 2OBGA 1NMAH 5EC1B 4IOSD 2APTA 3U36A 2J88L 1RUQH 3VXSD 3VDAA 3KPLA 4QGYA 4UU9B 3FMGL