1QPPA

Crystal structures of self capping papd chaperone homodimers
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
214
structure length
207
Chain Sequence
AVSLDRTAAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLDPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chaperone self-capping in P pilus biogenesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords PAPD CHAPERONE
total genus 39
structure length 207
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qppA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qppA01
4OFPA 2CLZA 2FH6A 4JLRB 2FEEI 3OR6B 3C5ZC 1ZVSB 1D7FA 2PO6A 1AKJB 4AIZA 1C8PA 3FN9A 2F58H 5A3ID 4DN3L 2J6EA 1NPUA 3N1FC 3UZQA 1WAAA 2ATKA 1VFUA 3NZHL 5IFAH 2PYFA 4KMQA 1EDQA 4ODHH 4ZO6A 4TRPL 1YEKH 3EYSH 4RFOH 5IHBA 1YA5A 2XA8L 3UTSE 1E4XL 1PBYA 2ITCA 4QRUA 3OKEA 2VDRH 3IAGC 1FFQA 2WQRA 3CC5A 4R0LC 1R3JB 1VFBB 3HE7D 4G8EB 2L7UA 5ECJE 2RHEA 2VQ1A 4JANB 5C3LD 4HGMA 5FM4A 4OT1H 3I02B 1Z5LA 4NQED 2AKRA 5KVEH 2F15A 4FNLH 4QRSA 3RWHB 4QRRD 3RQ3A 2FGWL 3M45A 4YDIL 5C0RH 2H26A 3PWPB 1ONQA 1BP3B 3QQ3A 2MWCA 1I9RL 1EEZA 5GRVL 5E1HB 5IBLC 5TDOA 4CVZA 4DZBB 1WCBB 4MJID 4BZ2H 3GIVB 5ALCH 3QJHB 5DJAB 4OT1L 4NQDE 3Q3GA 1GOGA 4FQJL 5J11C 1ZWIB 3ZLQC 4P5KA 4FTVE 3IDJB 3QDMD 1AI1H 1LP9F 3O2VL 4CVWA 3V5DA 1WZMA 1W72H 3B9KB 3OKNB 1AD0B 1BOGA 2P7TB 5J6HB 5TQ2L 1CICC 1U3ZA 4E41A 1A6ZB 1LO0H 1HILA 5FKPA 3X13B 1QRKA 3GJFH 3T4AA 5J06A 5KBNC 5KVFH 1E4WL 2FX7H 1ACYH 3O8XB 3NH7H 4HWNA 4P2OC 1JNNL 4XP1L 4HIEA 3IDNB 4UV4L 1KNOB 3OPZH 5IQ9A 5IOPB 1LO0L 1RSFA 1DQQA 1NBVL 3NIGE 4K7FA 1TPXB 2FZ3A 3ZKMC 3VFMB 4DZ8B 1EHAA 3V4VH 5HDBF 1RZIB 2YD5A 5I1HL 3D85B 1CLYH 1NCUA 3KXFE 2OI9C 4CAGA 1I7TA 5C0BE 5LKNA 4M8QA 1EFQA 1UA6H 4KDVA 4UINH 4QXGH 1FRGH 3NCYP 5HYQB 4OZGF 1QVOA 4D94A 2EXWD 5D72L 4KTEH 2D7NA 3V6OA 3AS2A 3D0LA 4JJHA 1FCGA 2OJZL 1X5IA 2VUOA 4XC3L 5AUMB 5GGVY 2FATH 2LAGB 2EIBA 2VXUL 3AROA 4RGOL 4PLNC 5I15L 4XH2A 2DQCH 1BM3L 1SY6L 5D1ZA 3V95A 5I1EH 5I30H 1VFMA 3SE3A 2NY1C 4TULL 1YEFH 3FKUS 3RGVB 4M61B 4AZ8A 1ZEAH 5ENWA 1KCVH 3D18A 3OZ9L 1GXEA 5AZEL 4XAWL 5LG1A 3I02A 3SBWC 3O2VH 2ESVD 3AMKA 3MC0A 5I1KL 3RUGB 5DD1H 4TUOB 1NLDL 4ZUSB 3AB0C 1PKOA 4GW1B 3SQBA 1I1FB 1F6AA 3PE9A 5GS0D 1HH9B 3O2DL 5E2UH 3PV7A 4YC2C 4U1KA 1X7QA 4AENA 3L9RB 2BVYA 3WN5B 1RY7B 2ZCHH 3WNPA 2QSVA 2HMIC 3I9GH 2R23A 1V3MA 1IAMA 1U8HB 1IC1A 1MHEA 5BRZB 1PKQB 3REWA 1Y0LB 2AJYL 3RGVA 3BPCA 3PWLB 3OJ2C 5H35B 4PRAB 2F19H 4B7LA 2ED9A 1OAUH 3NCMA 2GIYA 2VN4A 3CZFA 1BWMA 1KCRL 3C60D 4MHHG 1XF1A 4JLRA 5J13C 4R96A 2EDQA 5C0BD 4LLYA 2VDKH 4KMTL 3GSVB 1V8HA 4D9LH 5F96L 4PJ5B 3S4SB 4PRHE 4P57A 1A2YB 2VL4A 1BFTA 1CXHA 3U7WL 1HHGA 3S96B 3WJLA 4BH7B 4W4OA 2V7HA 3NIDF 1WISA 3NAAH 4HIEB 1AP2A 4WO4D 1KULA 3FFCA 1IM9B 4N90D 3LN4A 3SKMA 3HG1B 4P5MB 4XMPH 1GC1C 2JB6B 3TLRA 5DS8A 3OKMA 4BQ9A 3RHWK 4ZQKA 4ETQB 1IFHH 3B9VA 3EJZC 1BF8A 3D2UA 3ZL4H 1I8IA 1I3RB 1YNLH 5LJYH 3QISA 1VSCA 2Y72A 3PWNA 1VGKA 2M26A 5ALBL 4P5TB 3FL7A 2HKFL 5FFLA 1X4XA 3GBNL 1T22A 2ATPB 3MMEA 3H7BA 5K9KB 4X6CA 1A3LL 4NQDD 3LZFL 4P9HL 3PABB 2L7JA 1IC4L 4I2XA 3TWCL 4G7VH 4Z0BH 1SJEA 4X4XB 4MLIA 4DKFL 5A16A 1A4JB 2E7MA 1T1WB 3FHAA 1JWUB 2J1KA 4IS6A 2FLBT 3IRZA 1FGVL 3WUWB 4QTIH 1FC2D 5D2LA 1BX2B 3S3JA 1A21A 4BQ6A 5C07B 4ZOCA 4M02A 1B2WH 4JQXA 5EOQL 3OB0H 2GSIA 3GSQB 3EFFA 2H9GB 4GKNA 4KUCD 2Q6WB 2XOTA 1NMCC 2DI8A 5EBMA 4BFIB 3FQUB 5F7KC 4PJ9D 2R15A 4GQ9H 1QSEB 3GNML 5C0AA 1TXKA 4NOFA 2X4SA 5DO2D 3T1FA 5FHAH 1DLFL 3VG0L 1OGTA 5C07E 1ZAGA 3TN0B 4DGIH 2CRZA 4YBQC 1CD1A 1U9KA 4KVNL 1DJSA 1FNHA 4YK4C 1NC2B 3VXSE 3MR9B 1YPZB 4PBXA 4PRPB 3MJ9H 2KQMA 3VWKD 4MSWA 5FO9A 2YPKB 3RVXC 4GKOA 4N8VA 2YKLH 5EULV 4NYLB 3S88L 4WTWA 3WFBL 3RWDA 4PLJD 4PJBA 3N9GH 2W59A 1S9VB 1XF3A 2F74A 4CN6A 5HVHC 4M48H 1BEYH 1CDHA 3HFMH 4ORGA 1EA9C 3MRHA 4LBEB 1MCRA 1R3HB 2F53E 3QEUB 3WIFB 3MRKB 2QQKL 2A77L 3KVQA 5D7LB 2R69L 1FCCA 3IU4H 4QXUH 4PTTA 1DFBL 4MDIB 1JGDA 1CGUA 3A6OA 2A6JB 1UXWA 5TF1H 5C0FA 5JW4R 4ZUTB 4HIIA 3IAQA 2CIKB 3ARWA 3FB6A 4H88L 3P0VL 2GJ6B 5HBBA 4G9FE 1FDLH 2VDML 1TPXC 3CSBA 3BVNA 5F7EL 4IM8A 4KQ3H 2XZAL 5HD8D 1FIGL 1GIGL 3MQIA 3I3EA 1FYHB 3E0GA 4D0CA 4F9PC 1R3LB 3K4ZA 4MAYA 4OZ4B 3DBXA 5EOQH 5EZIL 4OQTH 4KAQH 2NYYC 1SY6A 1MVUA 25C8L 1L0QA 3OKDB 3P9LB 2A6DA 1CIUA 1JPTH 2OBGA 2UY7A 3VRLF 2F53B 2N7AA 3CUPB 1IQDA 5AZ2H 5HHOE 5D6CA 5A1AA 2CPCA 4EQ2A 2AV1B 4KJPD 4BELD 2E7BA 3FOMB 3ZZ1A 2XKNA 3RX5A 4JB9H 4JN1L 1RJZA 3VWKA 2NXZB 4OI8A 2EDYA 3CXHJ 3EZ8A 2WBWB 3QBTB 2Y9RT 1SBSL 3PJSB 1A3QA 3D1MC 2F54B 1J0HA 4WW2B 5HGGS 3TBTB 1IT9H 2ITCB 4FXGA 5FUZH 1R0AH 4PJXE 4F37K 4PREB 4YX2H 5E6ZA 3OX8B 3CFKA 4BKLA 2DM3A 4P4KC 2F53A 4Y5XC 4HS6A 4V2CB 4ZOBA 1NFDE 2E27H 1N2RA 3GMPA 4OCXH 5J4MA 2C3WA 1G0DA 1QBLL 4JO1L 4L3EA 5TF0A 5DR5H 4LARH 5HI5C 1R3KB 3MZGB 3EDDA 5D1XC 1AFVL 2AJSL 3BXNB 3KXFD 4NC0B 1TZGL 2NY3D 1RVFL 4YQXH 4YDVB 1ZGLB 3STZA 4WWKD 1UJ3A 1FZKB 2ZJSL 4YIQA 3DVFA 3VJ6A 2H2PD 3QIBB 1RZFL 5DD3H 2NYYD 5E6YA 2DQCL 2BSRB 1QPPA 1U91B 3WLBA 1YMMA 4I2XE 2JCCE 5IW3A 4YZFF 1O7VA 1MLCB 4LCCA 4AH2B 4Y4FA 1O7SA 4LSRH 4AK1A 2A6KB 2D0HA 1FZMB 5DHYB 1XF3B 1NDMA 4Y5YB 2E9JA 4FS0A 2APVA 4UINL 5E0QA 1UM6H 5CEYB 1QG3A 2ORBL 4RIRB 3MJ7A 5DQJB 3SDXB 4P5TD 4C83A 4ORGB 5IHUH 1ZANL 3D85D 4OAWB 5E94A 1WIUA 2KH2B 2V9QA 3NGBC 2NX5A 4A2LA 4Z18A 2AGJL 4AYFA 4WFGD 4EI6A 5F9OL 1EHLH 4S1DD 3DUUA 3GO1L 3O9WB 4E0RB 4JVUA 2Z91A 3LQMA 4GRLA 3X3GL 4DVBA 4XHQA 1CQYA 3O2WL 1NC2A 3FOMA 3MLVL 4U33A 3DYMA 1XT5A 2K9UA 4K71C 3K7UA 4K8RD 3SPVB 3HAEH 4G6KL 3CUPA 3KNBA 2Z31A 1JF1B 2BRRL 5LQBL 3T77B 3Q3GB 4GMSL 4PJ5E 2R1WB 4GJTB 4QRSB 1FC1A 3RWHA 3RY5A 2XIDA 1AQDB 5C6TL 2DYPA 1X5YA 4FQXA 1ONQB 4I3SH 4LP4A 3U7AA 3N1PC 4R2GC 4G6FB 2HWZH 4WI6A 4PYHA 3ALPA 1I9JH 2WUCL 3BP7B 3MLXH 1MRFL 3UC0L 1YYLH 4LAQL 1C16A 4F7PB 1QRNB 1BD2E 2RAMA 2OR9L 5KZCB 1M7DB 1YN6A 1K5NA 4FRWA 2HFGL 5LXGH 1YMMD 4QWWD 2CLRB 4LVEA 1ZVSA 1CE1L 3LKQA 3MRKA 3BW9A 2Q8AH 3IS1X 1A6VH 4M62L 3RL2B 5AZEH 2R2BB 1EV2E 1SJXA 3BKYL 3SE9H 4FN0A 3S5LB 1R3IH 2X9WA 3ARFD 3RX7A 4Y8DC 4PRHD 3EKCA 4IEFB 3N50A 2DLFL 12E8L 4EJ1C 4X6DA 3CMOH 3IDNA 1O5DT 4QRQB 2XYCA 4F9PA 2NY4C 4R3SB 3MACH 1JPTL 3QI9A 4QHMB 3WKMH 3F5WB 5T5NG 5ACLA 4GG8A 3SJVD 3AVEA 3LB6C 3TFKC 4PGDA 1DVFC 4IBLT 3FMGL 2Y7QA 4X5WB 1MJ7L 3KJ6H 2YBRB 4Y4FB 1LGVA 2W9EL 2ZUQB 2BSRA 3GMMB 2Z8WC 4XCCH 5SWZA 3RWFB 5IVXF 3VJ6B 2EXWC 5JR1H 4R9HA 3QQ3B 2LVEA 3BHBA 4MNQD 4UDTB 4Y4KC 3VI3E 5I19L 4OGYH 1GGTA 4LHUD 1FFRA 3QIUD 1GOFA 1LO4L 4HBCH 1YUHB 2CLVA 2DYPD 2AJVH 3QH3B 1JGVL 4Z7WF 1JPFB 3O45B 4APQA 4RGNB 5GSRA 4FFVD 5FUCC 4FXGB 2FX8L 5DGRA 4DFHA 5KSAB 3DX6B 4PJDF 1RJLA 5AAWA 5BV7H 1JZ5A 3IDIB 4J3WA 5DJZA 2AK1H 2ZUUA 3TJHD 3EYSL 4B5EA 3PHQB 4OFKA 1NMCB 4MQSB 1CFTA 4XVUD 1EX0A 3VXUE 1KTDA 5EZIH 1CLZH 4O02H 3ULUE 3FONB 1NANH 4JJ5B 4X6CB 1N6VA 5KSBB 3GM8A 3HMWL 4GBXD 1Q0YH 4RSVA 3SDAD 1OGAD 1SEBB 1G9MH 1TITA 3UTZA 2Z35A 4BQ8A 4H25A 4JG1L 1IKFH 1HQ4B 5GRYA 2H6PB 5HYEA 1ZT7B 4P3WA 4OCRL 5AD0B 5B3JE 4XNQA 3VGEA 5HHNB 1AXTH 3TYFB 1U92B 3EHBD 3KJ4B 1NGZB 4R26L 4FFYL 3SJVA 5LAXA 2KDGA 4XVTH 1MH5B 5DA0B 2HT4D 1A3RL 3IDMA 3MRDB 3DX7B 1RJLB 5I74C 1EERB 4JFHE 4RWHA 2LQRA 5KW9L 4ONHA 1M6OA 4JDTH 5HYSA 1T3FB 5SWZD 4UNUA 3P73A 4DVRH 4QWWC 4ZPTA 3F8UB 2YD4A 5FYKU 1IMHC 4P0DA 2V9TA 4OZHA 4Z8FH 2XA3A 1T04A 3JV4B 5FYLE 4O4YL 2XI9A 4WEUD 1IVLA 2R2CA 1OCWL 4N8VB 3VW3H 4LSDA 4BSJA 1K2DB 4ZUUA 3TO4B 1MCLA 3EYFA 4UMGA 5H2BB 5DRWA 1FYTB 4AM0B 1S9XA 1NEZA 5BQ7A 4NN5C 5LCVH 3SDYH 4UUJB 1UA6L 5GIRB 1UACL 4RA0C 3MLXL 4J3XA 4XZUA 4NNPH 1VCAA 5C0JA 5IOPA 1OAYL 5TE4L 3CH1B 4JREC 2DM2A 4KJYA 3QZWA 4Z7VE 4LMQI 4MYWB 4KV5F 3V9FA 5I1KH 3PF2A 1F8TL 2CR3A 1JNNH 1R24A 4JHWH 1BJ1H 1WFTA 3HFML 3VWJA 4H8WC 5CP7A 3MCKA 4KVCH 3SY0B 4BFGA 2AJUL 2H1PL 5CS7A 2QQLL 1P5UA 1F2QA 1Z5LB 2CSPA 2V7NA 1OAKH 1PSKH 1XGTA 1A1NB 3HRPA 1EFXB 3OKYA 4LDOB 1N6UA 4ZXBC 3WFZA 5INCB 3VXSB 2H26B 5D93C 3SDDB 4HUXB 2XRAL 4PJ5D 1NGYB 4N5ED 4KZDH 2B2XL 4NNXB 3CNKA 4YDJA 5TPWL 2VOTA 3IDXH 1DANU 4H1LG 3CCHA 4G7YL 1FJ1B 5EU4A 1M4KA 2VLMD 5IW6B 1UB5B 5C0EA 3D0VB 1IT9L 4X80H 4Y2DA 3QCVH 1R24B 5CJXC 1ZVHA 5KSBA 4HDIA 3O3BB 3ROOA 3L3IB 2ICWB 3A6BL 4I3SL 3GBML 1YQ2A 2PCPA 2P4AB 4QOKA 5DZOA 1D5BA 3S98A 3L3HA 5K9OB 3IF1B 2QL1A 5K33A 4QTHA 3DV4B 3ARDC 3DXAA 5C2UB 3H7BB 1F3DH 3MCG1 1A1MA 4RFOL 5MEOA 3O6FB 1D6VH 3U0PA 1QFWL 2FB4H 3VMNA 1G84A 4P2QB 3CLEH 1PJ9A 4XPBL 5E2WH 3MOBH 3CXDL 3MUGB 3U48A 1UC6A 2C7UB 2NCMA 1R3LA 1WTGT 4MAYB 1QLEL 5F7LB 3O11B 5I1CH 2AP2A 2O61B 5F9OH 5IV2A 1EHLL 3UJJH 1NEZG 4Z77B 3OKKB 1KELL 5C7XH 3T1WA 5HVGB 2VWEE 2D03H 4PRAA 4FG6C 4YXLL 4UIMA 1JGEB 3CFDA 4KJWD 3WV0A 1RUML 2DI7A 4ETYA 5KZCD 1UZ8B 3HC0A 4L29B 3VXRA 5FF6B 1YMMB 5EU7C 1IJ9A 2XY2A 4JFPB 3EYOB 5J1AB 4PJ5A 3S34H 3ZDYF 3PWPA 3I3DA 1XR8A 5JO5A 5J89A 4S2SB 1UWGL 2A6IA 1IILE 3VXQA 3S96A 4BH7A 1C7SA 1Q1JH 2LU7A 3G5VA 1BIIA 2FBJL 5IJVB 2R29H 3BN9C 1NCTA 4XGZA 5FYKL 5F8RC 2W0LA 5HHNA 4XCFH 3QUZB 4JKPL 2SEBB 3V5KB 2J2ZA 1CLZL 5F7WC 1TCRA 5IM7A 4ESKA 4JQXC 3MLVH 4TUOA 4DKFH 1FVDA 4ODHL 3TJEL 1E4XI 3CFEA 1BWWA 4YHOL 5DR5L 3QIWC 3DMMC 3FQXA 4PJ8B 3NBNA 2F5AL 1Q9WA 3D39A 4EN3D 1LEIB 1IM3B 2Q76A 3LRGA 1NAMH 4DUXA 5INDA 3ARGD 5D4QA 1QSVA 1HH9A 3MRJB 5T1MB 1XF4A 5HYJA 5KVMC 1IM9D 4Z78A 2CGRH 4ODTL 5ESAA 5EU6A 3BEWB 3V0VA 3U1SH 4K9EC 1RIHL 5L6YL 2Y07H 3QUYB 1MAKA 4FQXB 1P69B 1NCWH 1EMTL 2CIKA 3FB6B 1ZS8A 4MGXA 4MD5B 1FFOB 4CU7A 1U3HB 4DKEL 1T5WB 5C0BB 3PWVA 3MYJB 1BBJB 3ILQD 4HK3J 1G9NC 2NY4B 4CU8A 1JTOA 5I18L 3PP4L 2LVCA 4FFWD 3QDGB 3JTSB 1QR4A 4GBXB 4I0KA 3BP4B 3FN3A 1ZEAL 2H2SD 5GRUH 3MRIA 3MUGA 4U6YA 2VDQH 3T04D 2F8XC 3NZHH 1DBAL 2IANA 1U8JA 1AGCB 4IDJH 1CICA 4HWBL 3HI6L 4MJ2A 5DURB 4NO0B 1DBJL 1CL7I 1INQB 2H3NB 4KY1L 2Q86A 3UEZA 2APWA 3QI9C 3OQ3B 1PYWB 3B2UD 3F7PC 4MXWL 5C1MB 4Z76A 2Q8AL 1BOGB 4HCRH 2MQ0A 4ZFZA 3LEVL 1H8NA 3JWOC 4JFOA 2QQNL 4PJ9A 2OI9B 2M8XA 4IMKC 3B5HA 1KCSL 3RWDB 1JGUL 4U7SA 5B39G 1MAMH 1KCKA 4XAKE 1CN4A 2WUCH 1OCWH 3ARGA 3TO4C 1EZVY 4WV1B 5FO7B 3CSPA 3RY4A 4PRNA 4Z0XA 3JZ7A 3I2CL 3MGTB 4HS8L 3NABH 1PSKL 3DRTB 1CDYA 3MRNB 4L4VB 3SGDI 4OQ1A 4PY8J 4M48L 4OTXL 1NCBL 2B4CH 4FZEL 1CXFA 5FYJU 3TT1L 2VITA 2K1MA 2JTDA 2Z31B 3CZFB 2XWBB 2X1PA 3VD9A 2ZWLT 1ZGLM 2VE6A 1WGOA 4HJGB 1OP5H 4ZAKB 3QXVA 4L4VD 2ZUWA 5KSAD 1MLBA 1TQBC 1F8TH 1KLGA 1IM3A 3BYYA 2I26N 5I0DA 2BOCA 1OT2A 2YMXH 4DZBA 1OOAA 1XF4B 3PWPE 5CHNA 4FQIL 2XZAH 1TETL 3TC9A 3T1FB 3CSYA 3NCBB 4L1DA 1FZJB 1OARH 1S78D 5EU5B 1T03L 1F42A 2X70A 5FO7A 4M5ZH 1NFDA 2YUVA 1PD6A 5IFHL 1FL5B 2BJMH 4YC2B 4R97C 3V6ZB 2W9EH 2R0WL 3D2UB 1OAQH 1KG0B 2D4FA 1D5ZB 1FVCB 2BVOA 5GS2D 5CCKL 3BQUC 2AXGB 1BOYA 4Y5VC 4PRIE 2CXKA 3T0WA 5JA8B 5JW4Q 3FB5A 3ZE2E 4TSCH 3DV6A 4LEXL 5SV4A 1P4BH 4NJ9L 1MUJB 3ILQC 4LARL 3HNVH 3EOTH 4AIXA 4X9BA 3OR6A 3GMMA 4JKPH 1NSNH 3LH2L 4MA8H 2APXA 1FNGB 4OLXL 4HV8B 5JDJA 1I1AC 4ZPTB 5TQ2H 4EUPB 1N4XH 3JTSA 1QQDA 4F9LC 3FB7B 2NNAA 4YHKL 3RY6A 1CWVA 4JDVB 1Z2KA 5JXAH 1G6RL 3KPRB 3R1GL 3MRGB 2P5WB 3HZMB 4DGVH 1KB5H 3FT4A 4R7DB 4X98B 3TA3C 3E3QC 3MLSH 4YXKH 1QFWM 1I7TB 3WJLC 4M1GH 3T8XA 2P49B 2OSLB 4HWZA 1S7SB 2C3VA 3L7FA 5LWYH 4B53A 2I60H 5CD3A 5HHME 5JXAL 5KVGL 4NWTL 3NTCL 4QRPB 5C7XL 3BH8A 3BT2H 4HFUH 4LIQL 4WU7B 3WLWC 2BVPA 3NN8B 3WFDL 5BW7A 2CLRA 5JHDE 3WCYA 1JYNA 1B2WL 2ERJC 2EH7H 3Q5TA 3LHPH 2Y06L 4TOYL 2FR4A 2NXZC 1DBMH 1WQVT 2WLYA 1ZT7A 4DGYH 1KIRA 4OZIE 1CLOL 4NRZB 1NBYA 1JNHB 3KS0J 3PJSA 5HVFB 4WCYH 4GAJL 4HIXL 4JRYA 4G9FB 3NCJL 1MFEL 4XP4H 3A67L 4X7EC 2IPKA 3WHXA 1T0PB 1IRAY 4PRBB 3UPAA 5JQ6L 4U1KB 5I8EA 1KN2H 3JV0A 1F6AB 5DTFA 4UTAH 1IGTA 4NO2A 1TTUA 5IW6A 1YEHL 2FO4A 1MCNA 1AXSB 1ZA6B 1FRGL 1S5IL 1WAAF 3GSUA 1CD8A 3HZYB 4LPYA 2A6JA 3C5SB 1U8LB 5CBAB 4K2UL 3UTTB 1U41A 3B2VL 4LLDA 4M3JA 3D85A 3KPSB 4JZNA 3VI4F 5C0AE 1UQSA 1MFAL 1OTTD 4X4ME 1FL3A 2VLJB 4U6VH 4M8QB 4RX4D 3DBXB 1DQQB 3KYNA 1FO0H 5KSBE 4PJAE 2W9DL 3I75B 5JIPA 12E8H 5C08B 4NFBA 4PJIA 4PP1C 3W82A 1NCBH 1K4CA 1S78C 5EIIB 1MCKA 1VHPA 4QO1A 2GY5A 4JO3L 1JP5A 1RZ7L 2GITA 5J3HC 4C54A 1RUAH 1T6WA 2BOBB 3NA4A 2Y36L 4G43A 5HVHB 3EJJX 4ALAH 2VLRA 4LLAA 3V5HB 1QBMH 4G6JH 4JGUA 4HXAL 2VR4A 5F97E 3X12B 4GLRH 2X9YA 4Y1AB 2BVQA 5BS0D 2VLKD 3UJTL 5EC2A 5FB8A 3TO2A 5CJOH 1J8KA 1VADA 3UJIH 1ZLVK 4YBLB 5C6TH 5D9SA 1N3NB 5GSVB 2YUWA 4UQ3A 2HWZL 4RGMB 1U8NB 5MHSD 2I25N 4X7TB 4K7PL 1T2JA 5EU5A 1P9MC 1MI5D 3LIZL 4DTGH 4KI5D 1IEBA 1YPZF 1XH3B 2HT2D 4XAWH 2BNQE 5T1KB 2RCSH 2OP4L 4M93B 2V2XB 2R1WA 1F4XL 3QULB 1LP9E 5FCUH 3RIFK 1IKNA 2XPGA 3GK8L 4UV7L 2GKIA 4N5UA 5KTEH 4GKNB 3ULUL 5ILTH 2NY5L 3QIUB 2JIXA 4PR5B 5BXFA 2NZ9D 3R06B 4M43H 5HI5D 1C08A 5GGSY 1GGYA 2DQHH 4HKBA 4IS6B 4RFNB 4R2GB 3GIZH 4MJ5B 3HG1E 2IADB 4F80A 2E8YA 2UUDK 4WU5B 5HHQB 1U8NA 2PTUA 1T66D 3QYCA 4OLYL 3H9HA 1KJ2L 3OGCB 4EOWL 2XQYG 4V1DA 3MV7A 3UTPD 2IAMB 1VPOL 4NPYB 1U58B 3WFHA 4UUJA 1RUMH 5I1HH 1NDMB 4Y5YA 3FONA 2UWEE 1I8KB 3VDBA 2JB6A 4WUKL 1MCOH 4BSWA 2MCPH 4MAUL 4M1CC 3H42L 5IT2L 5JPMB 1W8NA 4APQD 5FF6A 3VRLE 1D9KB 1BBDL 2QADD 2X4TB 4PRPD 5L8LB 5AG8A 5DF0A 3OB0K 1R3HA 2MOVA 4DEPB 1R3IL 2W38A 5E7BA 3BP4A 3C09C 4LVHB 4YUEL 2IBGA 1X5ZA 4R7NA 4D0BA 1JFQL 4C58B 1W0VA 4X7SL 3LIZH 4CMHB 4DTGL 5D71H 1DBBL 3EGSB 3SO5A 2D7OA 5ANMB 3QPXL 2IEPA 1OWWA 5I1LA 4EXKA 4QHUB 3TA3B 3C2AL 5E08H 3VXUA 2JIXD 4TQEL 4OCYH 4RAUB 5IBTH 2AABH 3QDMB 3NCFB 1CF8H 3WIFA 3MUJA 1HCFX 4QGTA 1NMBH 4YEEA 5JW4M 3LN9A 4XBPB 4P48A 32C2A 5E2JA 3KPMA 2CO7B 1KXTB 5DC4B 3AREA 4XBGB 1HWHB 3BGFC 4G5ZH 3OBAA 3BN9D 4MB4A 2VZTA 4GMSH 3TPKA 1REIA 4O2EB 2ERJB 2CUIA 2YSSB 2ZKHH 2AJXH 2PXYA 3BE1L 1ORQB 1FNLA 4JJ5A 1BPVA 5BVPL 5HHXL 4ZXBA 3QNXB 1MPAH 3DTXA 4K9EL 4M7JH 2FYYB 1QSEA 2DQDL 3WKML 4JFDE 4QLRA 4TRPH 5MP6L 1CTNA 5AD0A 2DQIL 1FN4A 4PG2C 2A9NH 2B0SH 4NP4H 4XP6H 3QNYB 3T3PE 4WUKH 1CGVA 4LHUB 3KR3L 3QXDA 4D0DB 1P7HL 1NFDB 4KDWA 4LSTL 3KJ4C 4IHOB 4GRLB 5KN5B 4CADA 5F9DC 1V05A 35C8L 2AXHA 4XMLL 4GQ9L 3QCVL 4L8DB 4ZS6C 5FO8A 2F54D 1FBIH 5C09E 3RZCA 2EKJA 1LO3H 4N0CC 3BZEA 3QO0A 1KBGH 3UYRH 3O8XC 1I7UA 3FMGH 2CRMA 3S97C 1L0YA 5EDXA 2QHLA 4ONFH 1JL8A 1JGDB 4CL7A 3RAJL 3CSGA 4Q7DA 4JFZH 4XHJD 4MNGE 4WWID 4HUMB 4JHBA 3VFMA 5E9DE 1INQA 1FLRH 4NM8H 1KIQB 1WV7T 4MWFB 2X4RA 3RTQB 1E4WH 3B8YA 1K4DA 3GK8H 4Y19A 4PRNB 4Z0XB 1U8OB 4AMKL 1JPST 4PB0L 3VH8A 1P7QB 3B5GA 3P4OA 3GMLB 4KVCL 2ZCLH 1VERA 4PJCA 4OZFH 1S7UB 1AHWC 2R29L 3RVVD 1G9NL 3ZTNL 2HVJA 5I1IH 4YO0A 4ZXBD 1EJOL 1VEMA 5IQ7L 1T4KA 3S4SA 2CKBA 3TZVC 2B20A 2A0LD 4JM4L 4LASL 3LV3A 4BJLA 1U0QA 4AH2A 3UTQA 3TP4A 3ZDXE 2MNUA 2VC2H 5GRJL 3P30H 4MX7A 1N0LA 1G7JB 4I0PD 1UM5L 1AC6A 1IEAA 5I16B 5TE6L 3MBED 3C87A 3MUHL 3IB4A 3IU4L 4QXUL 4Y2DD 4FTVB 4X0KA 5SWSB 3FT3B 3PGDA 4JM4H 1MVFA 1MHHB 3DJ9A 1VFOA 4LOUD 1I1RA 1HILB 1GGCH 5FKPB 4AY0A 3WUWG 2B1AH 4PGCB 3NFSH 3SDDC 3I6GA 4LF3B 1H5BA 4BUGA 1J18A 3QIWA 3NA9H 1MFDH 3RI5F 3BIAX 5F1NA 5I17B 2C4XA 3DXAD 3G5YB 4JAMB 3B2UC 3CIQA 2HAZA 3SCMC 2F54A 5IMOB 1DL7H 1FYTD 3AB0B 4QXWA 2BK8A 2EIZA 1V7ML 4P99A 1HSAA 1NH6A 3WE6A 4F7CA 2RCSL 4UNTA 4QGYA 6FABL 4U6VL 1A1OB 2COQA 2DLIA 4UB0L 5T33L 2OQJA 3PP4H 4NO0D 5DT1L 4G9FA 1KIRB 4EBQL 3QQ9D 2FYYA 2MQ3A 5DC0A 2DMCA 3INUL 1TCRB 3LB6D 3TFKD 4ODTH 4WY7L 3QXDB 2JF1A 1SBBA 5I8EB 4OZHE 1RHFA 3AS3A 2ZUXA 5DJ0B 2AK4B 2A6KA 4WO4C 3MV8D 3W9DA 2IPUG 5EUOF 4FABH 4IRSD 1J1OL 4LQ1A 2CJUL 2V5TA 4Q2ZA 2EEBA 4XP5H 4OLUL 3FT4B 4XVJH 2YD9A 5BVJB 2EIZB 4G8GB 3MA9H 5J8OA 2ED7A 1MHPH 3B9KD 4E42B 4P5TA 3U4AA 4R0LA 3NH7L 4MJIB 5DEGA 3VFNA 4ODWA 3HE7B 4QKXB 5DRXA 4I8DA 3QIBC 4PJHB 1HXYB 1GAFH 1I3RA 2YD6A 3GBLA 3FTGB 5GRUL 3SKJH 3PGCB 2NX5D 3FB7A 1AHWB 1AD9A 4I1NB 4S1SH 5FYJL 3FQNA 3RZWA 4BQBA 1PY9A 1MHPL 3C6LB 2OR7A 2AQ2A 3RWFA 2GYSA 1S7TB 4I48A 1MCWW 3GI8L 4FQ1H 4KHXH 2FWOB 3UYRL 4J12A 3K8MA 4ERSL 1DE4A 3D39D 4XVUC 2I9LA 2C3VB 3L7FB 5E6IA 4R6UA 4YXHL 2OL3H 2FECL 3HLAA 3ARPA 1J1XH 5BMFH 4DEPC 4WTZA 5HGHA 4YFEA 1YYLL 3DVIA 4IDLA 2YBRA 2QQNH 2IQAA 4JPWL 4G42A 2VO5A 4G80B 1J8HB 1GHFH 5DD1L 5GJSL 1QO3A 3MLTA 4UTAL 5E8NA 1L9NA 5GISH 1GVIA 4G43B 2ESVB 3IDYB 5L2KD 4XNYL 1YNTB 4KZDL 1YQVH 1ZA3B 4WJ5B 5E8DH 5LQBH 1M7XA 1S7WA 3LKOB 4LLQB 2JELH 1UZ6F 2ARWA 4Y2DC 4P3DB 5KG9B 2P24A 1MCJA 3SCMB 4WFED 1T1XB 2A73A 3GSXB 1T20A 3QG6A 4Q58C 2I27N 4LLWA 4KI5C 1HSAB 4IJ3C 3PHQA 5DSCA 2EYTA 1KENL 4NN6C 4CGTA 3IDUA 3VCLA 4N0UE 5J12C 3VXMB 3PQYB 3VG9B 4WEMB 2GJ6E 1QBBA 5C0GB 1YEGH 2DI9A 1CICD 3VFWA 5DD5L 1WCBA 4YK4B 2B1AL 3T0ED 4KJQD 5E5UB 2XPGB 1QNZH 1A1OA 3LQAH 4LSSL 4HWEH 3MNVA 3TF7C 1QACA 3WIHL 5H37G 1CLYL 3ARBD 3WE6B 4HKZB 4F7CB 5CIPH 3PGFH 3LKNA 4HK0B 4M6ML 3BMWA 5E8OA 3G6DL 5CJ5A 3L5XL 1Q0XH 1IGFH 4X6DE 5F9WC 3OHXA 4NCDA 4NUJA 3C6SB 3LV3B 4N0UA 3MUY1 3ARBB 4GO6B 5EUOB 4TN9A 5D7IB 4Y1AA 1YY9C 1RI8A 4UB0H 1C12B 1FH5L 1YEJL 4G6AC 1VACA 4F7TB 3H9SA 3HE7C 3N06B 5CGYC 1A4JA 3U0WH 1JGLH 3T0AA 3BRDA 5I66B 3NZ8B 4Z7NF 2DM7A 3X12A 3DUSA 5F6IC 3EOTL 4F9LA 1BD2A 1RZ8A 2X4UB 3LEXB 1ZSDA 4PY8I 5E8EB 1YEJH 5ESVA 5KVFL 2H1PH 2YPLE 4XC1H 4PJ9B 3TT3L 3U0WL 1DQJA 5EA0H 4PJHF 5IB2A 4XNYH 1B0WA 3V2AR 4DZ8A 2WAHA 1MHCB 3G6JE 4IMLB 3Q6GH 1QSEE 1JJUA 2P8MB 2E3VA 5KS9F 3BSZH 1FSKB 5D2NE 2NY2B 1MF2L 4Z7UE 3NFPB 5FECA 4XCCL 4K3GA 3EUUA 2OTWB 4RMTA 4P59H 1T0MA 4XP6L 1ZHLB 1W0VB 1U92A 5I66A 8FABA 4MD5A 3LDBB 1MY7A 3FRPA 3WL9B 4KJWC 1KN2L 4ZO7A 5IK3B 5KJRL 1WBYB 4I0PC 1G9MC 3H0TA 2YD1A 4ONHB 4E41D 4ZPVB 4YE4H 4K9EH 4M7JL 5GGRB 1BMGA 3OKOB 4HGKC 3CPLA 2RQ8A 3FO1B 5C0CA 1XGTB 3GMPB 3MRCB 4Y88A 4Z7OF 1F3JB 4XMKH 4XXCC 4L8BB 3OMZA 2VDKL 4KKBC 5CKAA 4TNVF 1BVLB 1YJDL 4R8WH 1ITCA 2VWEC 5IB4B 3H9SD 2XQBL 4LCIH 8CGTA 1MFAH 2P44B 3QFJD 5LGJB 1ORQA 2XTJE 3NTCH 4GW1A 4NWUH 4O2FA 3B9KC 1NBYB 2BCKA 1GGUA 5C8JB 3RIFF 1I9RH 5DJYA 3PQYA 3EIFA 3EYVA 1HQRB 35C8H 2OL3L 2XICA 5IKCA 4LCYA 1R0AL 5CEZH 3CX5K 4NWUL 4Y4HD 3VXOB 3TPUA 5B8CB 2HN7A 4MA1C 3FQXB 1EJOH 1JNJA 4HFWA 3UYOD 5H2BA 3HHRB 5DVOA 3QQ4A 4JB9L 2MHAA 5E5RB 3SKMB 3D25A 1CDCA 4LLUB 1ACZA 4RAUA 1LO5A 1EHXA 5MEQA 4F33A 1QQDB 4HG4J 4V1DE 3HB3D 5FYJH 5IV2B 1Y18B 4NQXA 3L3GB 1PAMA 3MRGA 3O2WH 4P57B 3WMSA 3TESA 2EDHA 4U05A 2PTTA 3HCVB 4QHKJ 4XP5L 2VXUH 4P9HC 3VWJD 4P2QA 2BERA 1V3JA 1I4FA 3MA9L 5I1LB 2ED8A 3FOLB 4HGWB 5EBGA 2DBLL 2R0ZL 1X5AA 5E8PA 2QR0A 3QI9B 5DMIL 3VGBA 5GZNC 5C08E 4P2RA 3EDEA 3EJYD 1UB6B 4YHNB 4NQCD 2VDMH 2R0WH 4EN3B 4LSRL 3SKNA 1JN6A 4UTBH 1U58A 3WFHB 3VGDA 3EDJA 4F15C 3QFJA 1FGNL 2CDGB 3THML 3RGHA 1CIDA 2GQHA 5F6HI 3VFUB 3GSOA 2VJXA 4ZNEA 1UADC 5EA0L 1LE9A 3B3IA 4M7LT 2G5BB 5FGCE 3IKCA 5IB3A 1S3KL 2CRIA 1Z9LA 1U95B 4Y2DB 2AXGA 3U36B 1IC7L 3ULVC 2VLLB 3NFNB 4YHYB 4L4TA 4I9WE 2FSEB 2VLJD 2X7LB 1HIML 3LH2H 3OKLA 2ADGA 5FCUL 1MCQA 4Y4HA 1E28A 1MJ8L 3DIFB 4HIHB 2X40A 5FIEA 1P4LB 3MLPA 1RZKH 1T21A 3EJZD 2XFXA 1RURH 5FGRA 3LKQB 3SGJA 4JO1H 4HUWB 4DGYL 1YPZA 3GDBA 4JRXE 4TVPE 1WZ1L 4GT7A 5FYKH 1ZWIA 2FGZA 2GUOA 5E2TL 4X5LA 5GGVH 1RULL 3C5SA 1DCLA 4AG4H 1HYRC 3H3PL 4F37F 1W72L 1JPSH 4NZTL 1GGCL 3LPWA 4HF5L 5FV1L 3PV6A 1KPVB 3QULA 4TVPH 3BP6B 5DURD 3ZMRA 3HNSH 1G7HA 1CBVL 4KHTH 4OZGA 4CMMA 3EAKA 3MLZH 3SDXF 3U4EB 2WBJA 3KHQA 1PFCA 3FCTA 1CU4H 4JZJC 2JIXB 4YWGL 1BQHG 1NEUA 3RVUC 1QBML 5GRZA 1HHHA 3E6FB 1WWWX 5HY9A 1NCCL 4H1LH 3UTSA 2PO6B 1KLGB 3VGAB 1E6OH 3HMWH 3OKLB 3O6FC 4KXZI 3RDTA 5I71B 3MFGB 4K7FB 5J13B 2AQ1A 2HVJB 2QSCH 2BOBA 1KJ2A 4NQDA 4HIXH 3IFNH 2D4DA 4OZFA 5IQ9B 3LPFA 2CKBB 1J1PL 4W70A 4TULH 1CDUA 3TCLB 1WZKA 4PJBB 1JV5B 1E4KA 2ZUQC 5A2JH 3QDGD 3BWAA 5ADPH 4FQLL 2Q3AA 2IG2L 5DHVH 1EHNA 4OFYA 2RFXA 2ICWI 3ES6A 2G60L 4IOSD 3U0TB 3WBDA 1NANI 1R3KA 4UT7H 1QR1B 2FZ3B 1ED3B 3P4LA 5DJ8B 5F6IB 3MRFB 4ODBD 5L2KE 4ZOEA 1IFHL 1FP5A 5GQBA 5MENE 4AT6B 2MKLC 4TQEH 4P2RB 4PG9B 2I9LB 2ZNWA 5HTSA 5CBEA 1AD9B 1U91A 4M5ZL 3QEGH 5MEPB 4OIBA 3FOLA 1J0KA 1IBGL 5J56B 1Z9OA 3PHOA 3QRGL 2NY6B 4C56A 4UU9A 4H20L 1XMWA 3EDKA 4ZMAT 5ITBH 1F58L 5CLWA 4KK9C 3X3FL 4YHYC 2H8PA 5DQ9B 4M93C 3S37H 4WI5A 3SE8L 3D69B 3GI8H 3VXRE 1NKRA 3SDCC 3GGWA 1T80A 1U42A 2AW2A 4LKCA 3R0MA 2A2QT 3MRJA 4OD3H 3ZE1F 4P3CH 1SEBA 1T21B 1TNMA 3BIKA 5H94B 3RGVC 1UH3A 2FHBA 2QSQA 1MCHA 3CFBB 3SE8H 1CDGA 2ADGB 3FT2B 5JXEA 3QO1B 2Z91B 4LHUG 1AJ7H 2IBZX 2IALA 5KG9A 1EGJH 3EO9H 4WGWB 3VD5A 1MCIA 4N0RA 5CEZL 4AJ0A 4ZSOA 4ZXBB 4H1LB 4XP9L 1HN1A 3LAFA 1IAKA 3VXTA 1LWRA 5TDPA 1U3HC 3CGTA 4HUUB 2CDEB 2B5IC 3VCLB 1A6TB 2ZUTA 4ZS6D 1MEXH 1KXQE 4JRYB 3RJQB 4APQB 5EC1A 3VFRA 4G8FB 4WUUB 5FKAB 1HHJB 4KRPD 4TVSa 1MHHA 3TBSA 1TJGH 3MODH 3GB7A 5H94A 1CD0A 3C09B 4LVHC 5EZOH 4AIOA 1MWAA 2DIAA 4NN7B 2DQIH 1IAOB 4WHTA 4ELKB 2H45A 4X9FA 2HMID 2Z93A 2QEJA 1KPUB 4HKXB 1FFNA 5CUSL 2G2RA 1NJ9A 2RB8A 2QQLH 4MA1B 4ZS7H 3UMTA 1YEKL 4JDVA 5CP7B 1I8LC 4XWOC 3OR7B 3KAAA 3BISA 3D9AH 4O51B 4PJXA 3QPQD 3DXAE 5DC9B 5ACZA 2QLVB 3ARZA 1AXIB 5F9AC 5IEKA 3BWAB 3PDOA 5D7JA 1KJ2B 2HKFH 4X9HA 1PY4A 3KPRA 3LEXA 4I5BA 4ENED 3RUGF 2Y25A 4JO4L 4NZUL 1KCUL 1RD6A 1L6XA 5HYIA 2UY6A 4MAYC 1LDPL 1ROWA 3JWDH 5FM5M 4CDGC 3S8WA 4N0FB 5DDHA 3X13A 2E7LA 3AU1A 5F1OB 3V0WH 1G0XA 5B4MD 4IMLA 3RBSA 4JRYE 4OD2B 4RDQF 4WFHD 5ABDE 1XCQA 5HHOA 4MNQB 5F93C 4EDWH 3WXVH 3ULVD 5DFVC 1KUMA 1UCBL 3QEQB 4XC1L 5CZVH 1AGEA 1M1SA 3C8KA 3TJHC 2VNCA 5CJ8A 4GW4A 2D31B 4H8WH 4PB9L 4NNXA 4LPTA 3BP7A 4F15B 3JV5A 3CSYB 5DK2B 3QDJD 4BFEA 2NY4D 2DYPB 1FO0L 3KNBB 1CDIA 1DL7L 3EFFB 2APFA 3QEHA 1DSFL 4WTXA 2X42A 5D6DC 2C3XA 1F5WA 3IFLH 3LSOA 3TT1H 4HK0A 4S10A 5GGRA 1RZGA 3LKSA 1C7TA 4N9GB 4PJCF 3VFSB 4OLUH 1OB1A 1JHTB 2AAVA 5FO8B 4KC3B 1U8KB 3BZ4A 3C6LD 2YEZB 1B6UA 3BZDA 4RFNC 4CADB 4FQCH 4WW1B 3BKML 5C0AB 3GMQA 4GXVH 3FQRA 2GJZA 1R5IA 3DUHA 3HR5B 2H32A 1R5WA 1G6RA 3TN0C 2A0LC 4X7CC 5DK0A 3PIQA 2GI7A 3MUZ1 3L5JA 3KR3H 1UWEH 1XGYL 5IB5B 4F3FB 4LASH 1MFNA 4BSVB 4OV5B 4WNQB 3VMPA 4P2RE 5EFIB 4ZFOL 4OGZA 3B4NA 3MCKB 4LCCB 1RJYA 2DLHA 4F7EA 4PP2A 2UYLB 5BZDB 4ZQKB 1JYWA 1SJEB 1AKJA 4CNIA 1FL6B 2E9WA 3TZVB 2KL6A 3SGKC 4Y19B 3K74B 2AEWA 4KJPC 2UWEB 4IRSB 3VXPA 4YDKH 4E5XA 5F7HA 1JRHI 2PYEE 3DURB 1BIIB 5FB8B 1TQCC 1UFUA 1YEEL 2ADJA 2NLJA 1KIPA 2DQEL 3SGEH 3OV6A 3BH8B 4XBEL 2EYSB 2JELL 3Q5YA 4F8QA 1CR9L 3NIGF 4X4ZA 5GRWA 2Z8RA 3BPCB 2HTKD 1PW3A 3DX9B 1Q9KA 4X6EB 2ORBH 4D8PA 2DAVA 2FX9H 5I75B 4OIAA 4OF6A 3BKCH 4G7YH 3K8LA 2YD8A 3HNTH 2RR3A 1UWXH 5HGAB 5J6GA 1NDGB 1MJUH 3H3PH 4XPGL 4A6YB 3A67H 3FFCE 5DTFB 3RKPA 4NQSA 2DDQH 1S5HB 3F7VB 4KMLB 4IRSA 3VXPB 1BQUA 4ELMF 2WIMA 4KI1A 3QWRA 4P4KA 1KCRH 3NPSC 1GJIA 1Z3GL 1MELA 3VFPB 4WI8A 1KTDB 1Q9LA 3FJTA 5CUSH 3GHEH 5IKCB 3QI9D 1WFUA 3BKYH 1DQDL 2FSEA 2R4SL 2X7LA 1RJZB 2ZP0T 3F12B 2R9HC 4JKWA 4PV8B 2YRPA 2P5EB 3P2TA 2BCKB 3WFEL 3O81A 1SJHA 2XTJD 3BO8B 3B43A 1NUDA 4YFLF 2PW2A 1HI6A 3NCCB 1ZLUK 3ULSA 1N8ZB 3G5XA 1G6RB 4Y1AE 4U1IA 1NGPH 3WIHH 4AEIL 4PRDB 4YPJA 4DGVL 4Z7VB 1YYMH 1B3JA 4JFYA 4FQ2L 3QHTC 4OCYL 4EBQH 3IVKA 5IEHA 2Q8BL 2F5BL 3QUMH 1ZHBB 4UT7L 4GG6F 4P4KB 3W39A 1SHMA 4PJIE 3LD8C 5C2BH 3RVWD 4Y5XB 4HQQH 2DQGH 3QCTL 3IJYB 1OM3L 3LKPB 3P11H 3DSFL 1DN0A 4XNUL 3BDBA 3REVA 4MDIA 5IESH 4X5XB 3P9WB 1URLA 2X1WL 4DCQB 4OI9A 5F1NB 5CSBA 3LN5B 2BVQB 3OL2A 4E5XB 5HJ3B 2G75A 2FIKB 5DJCB 5KANG 1OAUL 5DD0L 3WDIA 5J9PA 4Y0GA 4QRTA 4Y16B 1NCCH 4Q6IC 1A7OL 4EUPG 1CFVH 2X10A 3L5XH 3GRWH 5JPNA 4J3VA 4UT9L 3L95A 1A3RH 2HFTA 2J88H 2EE9A 3MRQA 4WV1C 4EI5A 2R0KL 4PUBH 5ADOH 1MRFH 3T0EA 3KYOA 4KKCC 4DJMA 4RGMC 3DURA 4UOW0 3O3EA 1ED3A 2OR9H 1DDHB 4HF5H 5DUBA 1P4IH 1JZ4A 3MV7B 3SDCB 2YC1A 1OSZB 4L8SA 4UILL 3QA3A 4P46C 1P7QA 2I9TA 4WU5A 43C9A 4I18A 5DMGC 5HJ3A 4OKVA 2NTFA 3NPSB 4U6YB 3U4EA 3NCJH 2PYED 5FAAA 5EU4B 4K94H 1FVCA 4MXVF 3V0AC 1PG7W 2QTEA 2E9BA 1JPGB 3PV6B 5CILH 4F3FA 3OSKA 1UKQA 5HY9B 3LOWA 2E6QA 2OR8A 5T1DL 1A3LH 1QRNA 1T1WA 4PJBF 3FCTB 2CQVA 2W9DH 2E6PA 4HS6B 5C0EB 5F3HA 1QLRB 5EZOL 1OY3B 5KN5A 4FXLA 4YPGA 5C2BL 2FATL 2R1YB 4RGOH 5I15H 1J5OL 4XX1E 1WBYA 1KC5H 5J11B 3K4AA 3JUZA 3WEXB 1SVCP 1AI1L 3VRJB 2VQ1B 3O4OB 1LE5A 1CF8L 3RVVC 3H3KA 2KZ1B 1UZ6E 5BRZD 2HLFD 3FFDB 3MJ8A 5C86A 3IFPA 5INDB 3G6AA 1I9JL 1CFNA 4ZFFB 3GNMH 5DHYA 5JQ6H 4Y19E 4PS4L 4LPVA 3LQAL 4HWEL 5CP3A 4LU5H 1BFVH 3BPLB 4C83B 5IHZA 3ORJA 3N85L 3WNKA 1JMZA 3BH9A 1AIFB 2D9CA 4ELMA 3JWNC 4GAGL 3ECBA 2OMBA 1S7SA 4O2EA 2K7QA 5I76A 3SDAB 1FGVH 2E8ZA 3F7RA 4MD4A 1AR1D 4XZUB 4WFFD 5FGCB 2FO1A 5CINL 1ADQA 2GK2A 2DLFH 2I07B 1ZLWK 5L8JB 2FD6L 2WWMD 4Z77A 1BHGA 1NJ9B 3UDWC 4NZRL 1QHPA 2O5ZH 1V3KA 1S7XB 5DUML 1FIGH 5HDLA 4LLUA 3L3DA 3LN5A 3BKCL 4X6CF 1K3ZA 3HAEA 5A3IC 2IF7A 4QYOA 1KV3A 4PY7B 3HTLX 1MI5B 1KEMH 3I6LD 3T0DA 4Y4KB 1AC0A 4KGLA 3IF1A 1DQLH 2FLRT 4JO2H 3WHE0 5IR1A 2OTPA 4XNXL 4O02L 3I85A 1NL0H 1DEDA 2XV6B 1JTTA 2VZ3A 4OLVH 2B0SL 4JFFE 3HUJB 3SDDD 1DZBA 4UV4H 3MA7A 2VLRE 4Y4KD 4Y89A 5ACMA 4OIIL 2R4SH 3O3UN 1M05A 5C09A 2HJKB 3SO3C 1HNFA 1E4XH 5ANME 1C5CH 4K07A 1YMHA 5E4IA 1BVLA 4PG2A 4GAJH 5IMLB 4MA3B 2NY6D 1NGZA 1X5LA 3C60C 1WBZB 2DDQL 1MRCL 3RL1A 4NBXB 1XAUA 1YEIH 3AFLA 1MCPH 4KK6C 3O4OC 5FDWA 5DJ0A 4PGZA 2D7QA 3JV6B 4U1LA 4ZAKA 5I1GH 5TF1L 4NSKA 4YAQB 2F5BH 3QUML 3DX8A 2X1OA 1J10A 3QHFH 3WO4C 3ZKXB 5C92A 5C6PB 5F7EH 3OJDB 5CJOL 4U1HA 1TTFA 1YNKH 5CJBA 3MV9E 4KU1A 1PG7L 2LFGA 3RVUD 2YZ1A 4MHHI 4TUKH 3NCYS 3KYKH 1GL4B 5HI3C 3C2AH 5E08L 3K4DA 1YUHA 1FNAA 3G04A 4XBEH 3ZE0F 5IWLC 1EEUA 2C26A 2X89D 3BJLA 1JF1A 3O4LE 4K8RH 1A6AB 5D1XA 2V2TB 1H3PH 3NVQA 2P5ED 3HKFA 1AE6H 4MMXC 2IFFL 1JPFA 4N1CA 5L7XL 2LTQC 2WBKA 4MB3A 2YA2A 5L9DL 2W9LA 3L6FA 4JRWA 4WIQA 1MCEA 1WITA 5ERWB 1NCDH 5T1KA 2EZ0D 4K94L 5GSVA 2UWEA 2YN3A 1G7JA 3HE7A 4YHLH 1I7RA 5HVWA 3HC4L 1F45A 2ADJB 1KGCE 4AL8L 5IHLB 2B1HH 2X4TA 1FL6A 5ICZB 4U7MA 1F02I 3GKWL 1ZTXL 4FTVA 1F4WH 3G08A 4LEOB 3TN0D 1OSPL 1N3NA 3S37L 1X3DA 5AWNH 2QJDA 4P49A 4QRPD 1JWMB 2A1WL 1A7PL 2X4NA 4XAKD 3UJTH 3P77B 3LEVH 1F4YH 2P7TA 2AXFB 2GTZA 4D9RE 1RZ8B 4QRQA 5AWNL 1A7OH 5IMKB 2OJEA 3L6FB 4JREB 3MRMA 4JQVC 1RK1A 4XT1C 4JO3H 1A6ZA 3RPIB 3S5LG 3KPLB 4QTIL 5CHNB 1IZJA 4PJ8D 5T1DH 3S3PA 4LSQH 2CR6A 4TSBH 3KPSE 2XWTB 2HT2C 5ISZA 1KPUA 1YEFL 2NXZD 3RY6C 5HD8C 1K85A 5EOTB 5KTEL 4HWBA 1A1NA 5KOVC 5M94B 4FQXC 2F9BT 3QXAA 4JFZL 4Y4FD 1G7MB 4LLWB 5GZOC 2P5EA 2WWMC 5FXCH 3G9AB 4M7ZB 1CCZA 4XC3H 1J1OH 1YNLL 4LKXA 1TNNA 1AQDA 3P0YL 4NHCH 4OZGB 3LKRA 1S5IH 2WLZA 4URTB 2GTWA 2D3VA 5FDWB 3U1SL 3U7YH 1WSST 3ESUF 3LD8B 5TDNA 3GMOB 5IBTL 3CU1A 3SEPA 5J3HD 5J1SC 4F57H 3LEYL 3TNMB 1U8QB 2EKSA 3O3AA 5F7DA 1X5JA 1RZJH 4NHCL 4H5SA 5E6ID 4NP4L 1FIEA 2VXTH 1IQWH 1HEZB 1JF5A 3VXME 2K7PA 4PTUA 4KKAC 2PN5A 3HR6A 2YR3A 5F71A 5FHBH 32C2B 2Y5EA 4IRJC 5CFHA 1I1AA 3LN4B 1NEZB 5BQ7B 1H0DA 2VB5A 2BY2A 4QT5A 4AMKH 1WJ3A 4JPKL 5T3ZH 4CMHC 1D6EA 5I8CA 5F1SA 1UZ8A 4JRYD 4KK8D 4V2BA 4P3DA 1DBAH 4OF0A 3DX9A 1CGXA 3BN3B 4Q6IB 3TJEH 3MJ7B 4HUVB 4MS8C 1ZA3A 4WJ5A 5I0ZA 5JORB 1X6NA 1CVRA 4NM4H 4DCQA 4HWZB 5E8NB 3RWGA 1DTUA 3KPMB 2YXMA 3EYUH 2AERT 3H8NA 4K8RC 1U3HD 5IGXH 3MV9B 4K8RL 4KQ3L 4JFPA 3O4LD 3ULVH 4K23H 1WCQA 1MREL 4LEOA 2Z93B 1MCCA 3BAEL 1U8HA 3HZVB 3GMNB 4I4WA 3PGFL 3TVMD 4F58L 2FIKA 5H35A 5F21B 1T2XA 4POZC 1T83C 4QF1A 1F13A 3T3ME 2HYMA 1YPZE 2QSTA 4JRXA 5T3ZE 3O9WD 3TYGL 4WUUE 3RGVD 2C1PA 1KC5L 2YPLB 5JOEA 3TIEB 5FUOL 1D9KA 2NTSP 1XF2B 5E2TH 3ULSB 2EO1A 3GJEB 1KCVL 1NKOA 2DBJA 3CXDH 3GSNL 4Y2OA 3SDCD 1H3VA 3DETD 1JCKA 3MACL 3DARA 3K1KC 5DD6B 4U1NA 4AEHH 1TZIB 2VDQL 3E8UH 4X7DC 4FQHA 1CGSL 2EC9U 1AGBA 3FZUC 2VDPH 1VA9A 2AJSH 4MD0A 4OGXL 4M9OA 4Y1AD 4J3OC 3VD3A 1YN7B 1GZQA 2VLRD 4LEXH 2AK4E 2XKNB 3M07A 4WWKC 4JFFD 3MREA 1Y6NR 3V6OE 4HLJA 3QIUA 5I6XB 5EBLA 2VLKA 5TDOB 5ESQB 5JR1L 4LNRA 1GIGH 1F90L 2YPLA 2XXMB 1YC8A 4OGYL 3UBXB 5C0RL 1CD9B 2DOCA 1A4KB 1YECH 5GZND 3WEXA 4RQQB 4ODSL 1G6VK 2CGRL 1CT8A 1GC1L 2VXSH 1J1XL 2ZUSA 1M7IB 3QSKB 5BMFL 3RVWC 4JG1H 3L5HA 5JW3H 1PX4A 4L9LA 9CGTA 3AAZA 2D2OA 4JEGB 3V4VL 2IH3A 5I16A 5IGXL 4IMKA 3QUKA 3OB8A 3WNLA 1MFEH 4NGHH 3VGHA 1EPFA 4YHOH 2X1XR 4WO4B 1XZ0B 3RIAF 2P42B 2AEQH 5GGTA 4EUPH 3ZKNC 2GCYA 3CDYA 5DUPH 5CEZE 1XR8B 5IMKA 3I6GB 1EO7A 3BHBB 3GRWA 2VYRE 1GCFA 1OAKL 3ZSSA 3OJVC 4WFFE 1A8JH 5K9QI 2BSTA 1KACB 1HHKB 3OJMB 4XVJL 3ZE0E 4JFOB 2LTQB 3SDCA 5F6HJ 4OCNC 3T09A 1AIFA 5HPMA 1KB9J 1NC4A 1S8DB 3O3EB 4R90L 4TNWK 2WUBL 3AU1B 1RU9H 3MV7D 4S1DC 5BCAA 4Y7MA 4S1RH 1RQ5A 3IDJA 3S5LA 3QFDB 5K9QG 2I07A 3T3MF 3KLAA 4ZTOH 1QA9B 4EOWH 2VC2L 4X6CE 3HPJA 3GIVA 5GRJH 3V7MA 2J8UA 3DECA 2DWDB 3L5WA 4TSAL 2LU4A 3BSZL 3MLZL 2QQQA 1L4IA 1ZE3C 5GGUA 1ZXQA 3SO3B 3W39B 2ADFL 1I3GH 3BIBX 3C2SA 5TFSL 2XQBH 2YMXL 2CDFA 3SE3C 4N8CL 5AEAA 3C60B 1MRDL 4P4RB 1DN0B 1KB9K 1E6JH 2Z92B 5C08A 5IWLA 4XPAH 3V0VB 1A9BB 4RX4A 5A43C 4S0SD 1F6LL 4PR5A 5BXFB 3MRPB 3OKNA 3RUGE 4XVSL 5HYSB 2DJSA 4UV7H 1N2RB 5F7YC 5L0QC 3PWVB 1E6JL 1G7HB 5E8DL 3GSXA 3WDHA 4Z7UA 3QNXA 2CUHA 2XY1A 4NN6B 3RWCB 1IGML 1X7QB 4NKIH 4BH8B 4JFHD 4PP1D 5CP3H 3FO2B 5LWYL 3SE4A 1FN4B 5E2UL 5D2LB 3HRZB 1MCBA 4FXKB 4HAFA 1B6DA 4HC1L 4D9QE 3CC5B 4OM1L 5DQDH 2B7DT 4NKIL 3HAEG 5BO1H 3BGMA 3F58L 1PZ5B 4MCZB 4NZTH 2PETA 3QO1A 1S9YA 2ZSWB 1RIVH 2WK2A 1AH1A 1J8HA 3BQUB 3GHEL 3QEQA 4Z95L 3B9AA 4NUGH 5D96C 1QHOA 2G5RA 3LKOA 4C4KT 5LGHH 2GCYB 4R7NB 4WFEE 2AV7A 2NXYD 4OCWL 5DS8B 3MV11 5C08D 1I3GL 3F5WA 2RJMA 3M17B 2E27L 1FAKT 4P23B 1NUFA 4YHPA 3GSNA 1J05A 3BDYH 4AT6A 5IMMB 1UXSA 3W9DB 3VDAA 2E7HA 4OCSL 1Y0LA 5D7JC 5DMKA 1N59B 3DVGB 1I1YB 1T4KB 3RA7H 2VERN 2YRLA 3PWUB 1FL5A 3WNOA 3VRIA 5DJ6A 2NY0D 4AENB 5JPMA 2PTVA 1I8MA 4K3EL 4HG4K 1P7KB 3BFOA 5C0DB 4JN1H 3G6JA 1OAXL 2FJFB 3D0VA 4NQUA 4XB8A 2MMXA 3SGJC 2ZZUT 2HFFA 1WBZA 1TCMA 1CK0L 3DXAB 1K8DA 1TVBA 3TBYA 1ORSB 2HLAA 5IESL 5DVMA 1XCTB 2UZYB 3MRPA 3H42H 5EORH 2NXYC 4KUCF 4CVXA 5FOBB 2PW2B 1A9BA 2YK1L 3PWPD 4X8JA 1F3JA 2VRAA 1SYVB 3H9SE 4HBCL 2IAMC 3W9EB 2VR9A 3UC0H 3GSWA 3M8OL 5D72H 4OUOA 1OWRM 2PO6C 3D18B 3GSRA 5CD3B 4LKXB 1RU9L 5E9DA 4EVNB 2OQJB 3I50H 5IVXA 1QEWA 4OZHF 5AG9A 1MFBH 2DJUA 4YXHH 4KFZC 4WRLA 1A7QL 4G6FD 3QPXH 2R2EB 1TVHA 2EEDA 1RZGB 3LPGA 2P5WA 3HZMA 4KUZH 2VDNL 1HYSD 1P7QD 1RFDL 4NQSB 4WUUD 1TJIH 5DSCB 1BVKA 1INDL 1LP9B 2UV3A 2PXYD 3HE6C 2GSGB 4X4XA 1AR1C 2MCG1 5JOFA 2XN9B 2F74B 2PYFB 3QG7L 1KNOA 1IL1A 3MV01 4HUVA 3VD4A 5K9KA 2HVKA 4HS3B 3MRMB 4Y16A 1Z9SA 3W0WE 3PUCA 4NO0A 3IFOB 1U6AH 2XG4A 3JV4A 4PJAB 3SOBH 4PD4J 4O51A 4PJXB 3ZHDA 1I8LA 5E99L 3QJFB 3MJ9L 5IHUL 1WFOA 4PGJA 1XIWD 4UTBL 4R4FH 1KBGL 4K7PX 1AO7D 4AEIH 3PDOB 5D7JB 3S34L 4FFZH 2XZQH 3MXVL 3T2PA 2WINA 3ZYIA 1YN6B 4GRWB 4H26B 3MNZA 4PYGA 4N0UB 4YBLC 1EEZB 3BGFB 4UT6L 4CVZB 1CFVL 2Q3ZA 1I7ZB 4X6DB 3UTTA 2X4SB 2DBLH 2R0ZH 5JOFB 1BZ9A 3LVEA 5EORL 3RZCD 1MQKH 5B22A 4U0RC 4Z8FL 3KPNB 5FDYA 3SJVB 4YPGB 2X4OB 1A64A 1KFAH 3GB7B 2DQDH 5I1AB 3H9ZA 4ZS7L 2AK1L 4OI7A 4H0IA 1FV1A 1ORSA 3HA0A 2BVUA 1ZS8B 4DN3H 3BZFB 1F4XH 2APBA 4G7VL 3FQRB 3QHZH 1Q9OA 4IRZL 3MRDA 2FBJH 5HDBE 4WUUA 1JGVH 3DO3A 3DIFA 1SYVA 2YEZA 4KUZL 5D70L 5LAXB 3IS0X 3P11L 4RRPA 5EN2A 4LIQE 4BZ1L 1TJGL 1NUNB 1NMAH 4RISH 3MZTA 1M05B 5CJQH 5CGTA 2AABL 4X9IA 5BRZE 3J7HA 4PJEF 3QHFL 4M1GL 1FZOA 1ZT4A 4HH9B 1YNKL 4HX1A 3UXFA 4I9WD 1LNUA 2RIKA 1C1EH 1I1CA 2NQCA 4IOFC 3RTQC 1NCAL 4KZEL 2WW8A 4U6XA 4L5FH 4XCEB 3CFEB 5FGSA 3QIBD 4Z76B 1YJDH 4R8WL 5KSAA 5E6IB 4Z7UF 4F2MB 4OB5H 2V17L 3GMNA 5HGHB 3GSOB 2KKQA 2J12B 4OD2A 3E2HB 4JRXB 2V2XA 5L2JA 5IT2H 3MV7E 4LP5A 4QRRA 2VN7A 1BZQK 2WV3A 2APTA 5F7NC 1IEBB 5DLMH 3ELAT 5TFSH 3FQWB 1MLCA 4I3RH 1B0GA 3VXUB 1DEEA 4Z95H 5ID1A 4OCLC 4JM2F 2V2TA 4Z7OE 2NPLX 4UOJA 1UJ3C 4KKLC 1NFDF 4WI7A 2BJML 4NCC2 3TV3L 1LILA 1DP0A 4NBZB 2FJGA 4N5EC 4Z7NE 4R7DA 3AS0A 3CFDB 3TPUB 1UM4L 4JPIB 4KK9D 2YPVH 4YH6A 5EIQA 5E03A 1WIPA 2DRUA 1T6VN 3PWJB 4WHYG 1LDPH 3JWDL 3CX5J 1EXUB 2ARJB 1P2CA 3AXLB 4P23C 5B4MC 2VXQL 3O6KL 4QXTA 3TO4D 4Z7VF 1A9EA 2W07A 5L8KB 4HIJB 2KZWA 3DGCR 4PJDB 4ZFFA 3KPOB 3MV8A 1UB5A 4ZSOE 2Q7YA 4PJ8C 1UYWL 1OQXA 3CCHB 3JVGC 2DF3A 3CH8A 1HNGA 2FX7L 2L4OA 2R23B 4MA8L 4PJGA 4PGEB 1J1PH 4WW1A 1WZLA 4FHBD 4BSVA 3VFTA 4OV5A 1JMXA 3G5ZA 5HHXH 4UAOB 5CD5C 4NDMB 3BX7C 3MGAA 1TLKA 3OHXB 4LSPL 3RVXD 3ZDZF 2VIRA 2VABB 2LAAA 2Z92A 3CPLB 3T08A 4KKCD 3VFGH 2GEEA 3TN0A 4OKVB 3VGAC 1P6FA 2XWTA 3FO0L 5ISZB 1FDLL 1DN2A 1G7IB 3S37X 5JDSB 2ID5A 1RPQA 3MRRA 2DQTH 3ABZA 4TTGA 1BECA 4ODXA 4LCCC 3O3DB 3IAPA 4HKJA 6CGTA 2UZXB 4X6EA 5JQHC 4DOHE 4GAFB 5GGTH 4ONGH 1IAIL 4ZYKB 2IAMD 5C0NC 2W92A 4YDLB 2ZCLL 2BFVL 3OWEA 3C6LC 3MRFA 2G9HB 2HH0H 3SKOA 1E28B 1NQBA 4NKMB 5KAQF 2P8MA 1A14H 3O11A 2D0GA 3I6LE 5C0CD 5F72S 4U1NB 5EBWA 4JCLA 1MHCA 1I7RB 5JPNB 4YO0B 4YGVA 4H8WL 5DJCA 5JHDB 4KROB 3EZJB 7FABH 2VDNH 5F89B 1OTTC 3O2DA 3DSFH 4GH7B 5IW1A 1FPTL 3DHMA 2BSSA 3KYOB 1A5FL 3WS3B 1NGQH 1MJUL 3VFOA 1Q94B 3NMEA 3VFVA 3L95B 4HJJL 3X14A 5IHZB 5EOCH 2R4RL 1IQWL 3QQ9C 5MHSE 1XGQB 1ES0A 4UDUB 4UOW1 3PQYD 4JPWH 3V6FB 4PJDE 4PJGE 2V9RA 4JY6B 4YHZL 4J23A 4LCUB 3TBVB 1A2YA 1CS6A 4X9GA 5DD5H 4L4TE 3ALXA 1MNUL 5IG7A 2FO4B 3RWGB 3VG9C 2J88L 1YEIL 2OS7A 4I3RL 4XXDA 4ORZC 3UJJL 2Z0BA 1FNGA 2V2WA 4LGPB 3UX9B 2C1OA 1T0NA 4JANA 2DQJH 4YQXL 3IJYA 1QFOA 4WO4A 3IFLL 5MENA 3SBWA 1AR2A 4YLQT 2YS4A 4Z78B 1I1AD 2CXGA 4DKDC 1WWBX 15C8L 4HZLB 4PRIB 3A6CH 4NJ9H 4HEPG 3HZYA 4O2FB 1JIBA 4XI5D 2ILLA 2DQUH 1Q72L 3AC0A 5FEBA 2NMSA 4P5TC 4O9HH 1IC4H 1A6TA 3TWCH 4J6RH 4ODUA 5IEHB 4L1HA 3V6BR 2EDNA 3DUUB 4OCXL 1K8DB 4HXBH 4P2RD 3QRGH 1DLHB 2WIIA 2FCBA 2DQGL 5D1QA 2P46B 5DD6A 2O93L 5D5MF 1G7QB 3G5VB 1JI1A 1XGRB 3RP1A 3C8HA 3MLSL 4XCNA 4YXKL 3ZT6A 5SX5H 3RRQA 3INUH 5BV7C 1H15A 1EZVX 5IMLA 3ULVL 2IWGA 4ZFOB 4HMEA 3EOYG 3OG4B 1BAFL 3IXTA 2YXFA 3BAEH 1YDPA 3MRQB 3UTOA 4I13B 1INEL 5JO5B 3LMJH 1OSPH 4YHPB 3QUZA 1NAML 4KHXL 1PGRB 5C0FB 4FZ8H 1V7MH 4L4TD 5GJTL 2HJLA 4HPOH 1BF2A 1JHLL 3HLAB 3KLHD 3BKJL 3DYPA 5D1ZB 5ICYB 2AV7B 4G6MH 4KJQC 3T4YA 4LCWA 4MNQE 3HCVA 1BFOA 5BJTB 1BGXL 3PQYE 4Q9RH 4G42B 3WL9A 1VEPA 3CX2A 3X11B 2CKNA 4H0HB 5KSBF 3MO1A 1B90A 3BQUD 1ZLUH 5A40E 4JG0L 2AGJH 4R4NC 4WV1A 1YQVL 4GW5A 5IFJA 5LGKA 4G5ZL 5EU6D 1LK2A 2JE8A 5T5FH 3WFDH 1VPOH 4ZUVB 5DVLA 2BNQA 3UDWA 3PDGA 4PJFF 1IBGH 1YY8B 4XI5C 1CQKA 4CN4A 1XGQA 3HNSL 5C0CE 1ODAA 3UBXG 3EYQC 1JI2A 3MLYL 1F3RB 5I1DB 1J11A 4OLZH 2OX5A 3IU3A 4NQEB 4PRPA 3H9HB 3OGCA 2H32B 4I0PB 3W2DL 5BOZG 4BZ1H 1FPTH 3W0WD 1RUPL 3LY6A 2QHRL 4G8GA 3U4BL 5SWSD 1NGQL 3SN6N 5BRZA 3DLQR 2DL2A 4NHUB 4NYLA 3ULUH 1VFAA 4PLOB 4HWUA 2X70B 3MV9D 1H0DB 1YEDA 4HK3N 2VL5A 5J1TC 3QDGA 4MVBD 1S7VA 3E6FA 4LHQB 5BS0B 1DVFD 4WI2A 4M1DH 3SGKA 4LQFL 3F65A 4P2QD 5C70A 1INEH 4RWYH 3K2MC 1M7IA 5FHBL 3TIDB 2HTKC 4OLWH 3C60A 4K2UH 1QP1A 1VKXB 3BGAA 4HFUL 4PGCA 3GSRB 4BQCA 1KEGH 4MAYD 2UZIH 3D0LB 1IAIH 3OJDA 4JM2B 4U49A 5IIEA 5FV2A 2YZ8A 4GXVL 3WD5L 2GJ6A 2AKRB 4TVPL 2ZOLB 3C5ZA 2FX9L 5AYUL 3AS1A 5HGDA 1IGYB 2LU3A 1JE6A 4OLWL 4JO4H 4NZUH 4RIRA 5EZJA 4C56D 3MPCA 1Q9KB 5DVKA 5C0IA 5LBSL 1YNTA 3QXAB 3OAYK 1YEDB 3PWNB 4PB0H 4JDZA 3ARBC 4XH2B 4KK5D 1RV6X 3VWJB 3SCMA 2Y5TB 3CDGB 5DEFA 1PVHA 1TQCB 3U6RA 1MWAL 2VAAA 2DLTA 4KY1H 1SM3L 4Q9QH 3G08B 3DVNB 4L4VA 1S8DA 4TTDC 4K3HA 1SEQL 2CMRL 2ICCA 2PXYB 3BYTA 4MWFA 3B3IB 1U8IB 3BPNC 4M4RA 2ITDA 4G8IA 4PLKC 4XTRD 3QFDA 4XPAL 5ICZA 5JHLL 5BS0E 3QCTH 1OM3H 4O00A 2BVPB 3NOIA 3NN8A 5CAYB 2CLZB 1FFNB 4HKXA 4OF8A 1BLNB 5CCKH 2FJHB 4JO2L 2D7MA 4M9PA 3ISWA 4ODVL 2VKWA 3VXMD 1NCWL 2A9MH 1EBAA 1HHIA 5J1AA 1RIUH 4LCWB 3V0WL 3U46A 1NMBL 4WW2F 5ALBH 1E27A 4E42A 3A0OA 4WY7H 3IXAB 4GUPA 4OLYH 4MXQD 3JXAA 4GRWH 3BMVA 3STZB 1OGTB 1KJ3H 2Q1EA 4N8VG 4KWUA 5IVZA 1DEEB 3ZKSD 4ZAKD 1FHGA 1OTSC 1S9KC 5EOCL 1V5JA 5JA9A 4X7SH 2CK2A 2GFBA 4MXVE 1KPVA 1WTLA 3MFFB 3LDBC 3GRWL 4F7TA 4Y19D 5C0AD 3I6KA 2NY1D 5E24E 5I8OH 4OGAC 2IG2H 2GJ6D 1UJTA 1PG7X 4Y5YC 4U1SB 3QNZB 1HI6B 3IXTB 1L9MA 2YA1A 3ETBF 4L8DA 2YKLL 3BD4A 2XKSA 4OB5L 1LO2L 4NCC1 3WLWD 2BNUB 3LS5H 1MIML 2YD2A 5IB4A 3NGBB 3O6LL 1HDMB 2X6MA 3KPRD 2AJ3B 4YNYB 4GRWE 4EI6B 2R8SL 3MBEA 3RWEB 3LHPL 2ATPA 5CGYD 5LXGL 2RBLA 3DMMA 3QUXD 2CJUH 1ZLWH 5BZWA 1I3UA 1CZ8H 3ARRA 4KKAD 2BY1A 2FJFA 1JUFB 2NY3C 4YR6A 3S3SA 5DJXA 4YDLC 4ZODA 1CU4L 1G7LB 3MFFA 4N1HB 1F4YL 4K3DH 4K71B 4ELME 5HHQA 5E56A 1VGEH 2FEEL 1TVBB 1QKZL 3I6KB 1RMFH 2PW1B 3MSPA 5BV7B 2YRZA 4UDTA 3SDXE 4FG6D 4TUJB 2XZCH 2V6HA 4N0CD 1T5XB 4PV9A 4PIRF 3C9NA 4OBRA 4M6OL 5B8CC 1J5OH 3MBXL 2IANE 3BVNB 3GJFK 4U0QB 3T0BA 3RX8A 1NFKA 2Z9TA 3BPOB 4I5BB 1ZTXH 1TTGA 4XGZB 4LSPH 1JWSB 4PJFA 2JCCB 5T1LB 4FMFA 4RZCB 4X99A 5GGRY 4Y16C 1J9CT 4JHZA 5EG6C 2CLVB 1SQ2N 4G9FD 5EC2B 3PHOB 4HUNB 1QFHA 3JTTB 1BM3H 4LF3A 4NO5B 1QPXA 5DMYA 2Y6SC 4MVBC 1BQSA 4HPYH 4ZUTA 2NW2A 5MERB 4MZ3A 5CZXC 4EIZC 3NABL 43C9B 4NO3B 3TCXA 3CAFA 2J5LC 5CLTA 4Y4HC 1A1MB 1FAIL 2HG5A 1WWAX 1HINL 4C56E 4MQTB 1BLNA 4MJ6A 2WWKO 1LD9A 4O5LH 3QEGL 3M1BB 5KSVB 3FRPG 4LSTH 4MNHA 4HH9A 3VE0B 3B9KA 5KAQG 3BW9B 1BD2B 5DJYB 1NAMB 1KIQA 2W60A 1OD7A 4GRMA 4P5KB 3PG2A 1RUAL 1V7NH 3MNWA 3TNMA 1U8LA 3VRJA 4Y4FC 2VDLL 2Z31C 1HSBB 3ZHKA 3GEWB 2NXYB 2ZOLA 3C5ZB 5J6HA 4OLXH 2GJZB 2IMMA 1ZOXA 2BRQA 5C0IB 2VUYA 4LVOB 3C5JA 4PJXF 1IC7H 5EBLB 2PR4H 5EIVA 1FLRL 4U1SA 4N9GA 2BP3A 1NGXA 3VFSA 5FOBA 5SWSE 3U30C 1CDJA 2JK5A 5CIPA 1IGFL 4KK5C 5FA4A 3VXNA 4DKEH 3UCRA 3KPNA 1EJ6A 3I2CH 1CFQB 4UQ2A 1R5IB 5JOPE 4NWTH 5FOJA 3OXSA 2ZCHL 1P1ZA 3VA2C 3UBXA 1LDSA 3F6LA 3SQOH 4APQC 4WWKA 4L4VE 4HHAA 1H8OA 4MQ7A 2BC4A 4POYA 4R90H 5ESQA 4HIIB 4M5YH 3H2WA 2NR6C 1FG2A 3JV6A 4U1LB 5DXWA 4UT9H 5ITFB 2R56H 3KYMB 1G9ML 1CBVH 4RWYL 5CEYA 2Q76B 1J12A 5JLZB 4IOIB 2R0KH 1WC7B 4U1JB 4DK6A 4GKZB 3T0VA 3VGGA 1XR9A 4F7MA 1HZHH 1QR1A 4ZUUB 5I71C 3WS3A 5DK2A 1KENH 2NX5B 1WEJL 1Y6KR 1I8MB 3NIFE 3SKJL 1ETZB 3Q1SH 4GKSA 3RIAK 3O9WA 4U2YA 5F89A 5C0DA 3HZKA 3D3VA 3QFJB 4LLQA 2DD8H 3DPBA 1CFSA 2JJWA 1U93A 4B41A 2E7LC 1RUPH 1OL0A 2AJYH 3T2NL 1INDH 2MPAL 5E7FA 4XBGA 5ICYA 4NGHL 1A6VL 4N90E 1UYWH 1BAFH 1GOHA 1LK2B 3J8F7 4PS4H 1K6QL 4DQOL 1I9EA 1LD9B 2Y07L 3D25B 3GM0A 4L3AA 4TNWF 3QDGE 4JFXA 2P8LB 4GG6B 3BDYL 1PG7H 3MBEC 3L9RA 3F6IA 4TYUA 3FQWA 1L7TH 4HLZG 3CVHL 2V5RA 2KQNA 1AQKH 2IH3B 2YWZA 1EAPA 1TZHB 3N1GC 2GY7B 4H1LA 1K3IA 3O6FA 2C9AA 1NCDL 3MJ9A 3PWLA 4FZ8L 4J4PD 4Z7VA 5F88A 1GAFL 4L8BA 1RJYB 2AV1A 1FZOB 4U1IB 1IAII 3HRZA 2AJVL 2ICES 4JKMA 5IF0A 4LIQH 5T1MA 2ENSA 4PGBA 3E3QE 4M61A 3KPQB 4WI3A 4XCNB 3LRSA 3JSSA 1XF5B 3LEYH 4NIKB 2XWBA 2XZCL 3FO2A 5ID0B 1VGKB 4PJ7A 4XMLH 3Q6FB 5JMOC 5EPMA 3L3KA 3S9DB 4P2YA 5I9QB 3ARED 1P5VA 1MREH 2QQKH 1QSZA 3EYOA 4XNMA 3EOAA 1XIWB 1CR9H 5KVEL 3ULVF 4B7IA 4UBDC 5C3TA 1T89C 1OGAE 2IQ9H 4RISL 5FYLL 1G9EA 5MEPA 3B5TA 1FORH 5GGQL 4CUCA 1SYSA 4NKOA 3D69A 4YFLI 2PYEA 2C1OB 3BPNB 4NN7C 2EE2A 3WFBH 5CINH 1DBKL 4LKCB 1KPRB 4YUEH 2V5YA 4KI5F 4NM8L 2YN5A 5EO9B 5KVDL 3CDFA 3X11A 2X4OA 5DVNA 2N4IA 3QT2A 1U8IA 5SV3A 5BV7L 4OQTA 3QAZC 1U3JA 3V5HA 4PJHA 4X6BB 5JW4N 1U3YA 5I30L 2V17H 4JFQA 5IROC 1P53A 4J3SA 1H3TA 3AM8A 2IFGA 3CK0L 1CG9B 3IDYC 4P46A 4JFXB 4HSQA 3ZDXF 3DVNA 3LQAC 4HW6A 2AXJA 5D7IA 3EO1A 5KSAC 2GSGA 1II4E 1A7PH 5TE6H 1WVZA 3W11C 2ITDB 4G8IB 1M7DA 1H9VA 1ZT4B 1CD1B 5JW5A 1S7RB 5C9JB 5I1GL 3U9UA 3K2UH 3DUSB 5C8JA 3AGVA 5TDNB 4LLDB 1ULVA 3FAXA 4FQIH 1FNSL 1KGCD 1U2HA 1RZFH 4MQ7B 1IGCH 2BNRB 3TIDA 1KLUA 2VABA 4M7ZC 1ZT1A 3MLUH 4BYHA 3LKSB 4TSBL 5LGHL 2MTPA 3D48R 2NY5H 4HZAA 1IAOA 15C8H 5JOPD 4J8RB 2ZG2A 3PIQB 4POZD 3MTRA 3Q48A 4G3YL 3JWOL 5IJKC 5EB9A 3FB8B 2X44D 2EYTB 4NQCA 3UAJD 5JZ7C 4MAUH 4JFEA 4GG6E 4KAQL 1QTYT 1UCTA 4DUWA 5KJRH 4HKJB 1PLGH 1KJVB 5IVXB 1P4IL 5TGBA 5CSZA 3PP3H 3RVTD 1D5MB 3MLWH 4LK4A 3GMQB 3S6CA 5D8JH 4M6NH 3UO1H 1H5BC 4MLSA 4F58H 2OL3B 2CK0L 5GS3A 3BPOC 5DFTA 1KN4H 3DMMB 5SX4I 4WHCA 2XZQL 1I85C 2I9TB 5K9JH 3PWJA 1Q0YL 4UI2A 3DO7B 2A38A 5IJVA 3TO2B 1ZT1B 4QXTB 1FFPA 4KROC 1FG9C 4IDJL 5DHVB 5TH2A 1X5HA 4RMUA 2NR6D 2FIRT 2Q7YB 1P9MA 3HMXA 4X7TA 5CD5D 5F9JA 1FYTA 4AM0A 4N0YL 1RURL 4I48B 3KDMB 3PL6A 3GSNB 1JRHL 2HRPH 5JHDA 3HG1A 2FH8A 2N56A 1WIOA 2HVKB 4NN5B 2EDLA 2AJUH 4W4NA 4IRSC 3MCLH 5DYOB 3MOAL 3K0WA 4RNRB 4RBPK 4NO3A 5CZKA 2BHUA 3QWOB 5IR1B 2EIDA 5JTWA 2BX5A 4ISVB 1I8IB 1KPRA 1DBML 4P46B 4NO5A 1AD0A 4G80A 1CE1H 5ERWA 4K7PH 4X4MA 1HK6A 4F2MA 1UWEL 3ARYA 5TJWK 4QYOB 4TSAH 3V52H 4EIGB 4FQQA 4Z5RB 4CDHA 2X9XA 4PJIF 5D1QD 4R2GD 1GHFL 1AGDA 3GI9H 5I75C 2NW2B 2EEAA 1D5IH 1MH5A 3QEUA 4JFED 2OZ4H 4XPFH 4ZNCD 4OFDA 1FO0A 1OGAB 5FK9B 3ZT7A 2VSDA 3WIIH 4KV5E 5DRXB 3TBTA 2XNAA 2IAND 5I1CL 2RGSA 5AAMA 2EIEA 4OGAD 3WFCL 2XTLA 4LVOC 4NM4L 4PREA 2E7CA 4D9QD 3V6ZA 4OFYD 3FB5B 3MBEB 4L3EB 3F7YA 1JNLL 1I8KA 1T89A 2DKSA 4PFEA 1EGJA 5I6XC 2CH8A 5DMGD 1OW0A 5L9DH 4OV6F 5KVDH 3GUTA 3GZKA 3S36L 3SHSA 3KWWA 1HCVA 3N85H 3MRCA 3LZFH 4OSUL 4P9HH 1MQKL 4ONFL 1IQDB 4JPKH 3FT2A 2ZG3A 1U8PB 3L3IA 4DW2H 1LO4H 1CGWA 4XPHH 5HDQL 3TVMB 3L3OB 4DN4L 4HQQL 4U6HA 3BPLC 2Z4QA 1XGRA 5JHDD 3ARDB 2VH5H 3QXUA 4WFHE 2OTUB 4YHZH 4YWGH 4ZSOB 2XNAB 3VMOA 4JQVA 2PUQT 4Y16D 2P5WE 5A2LH 4LSVL 1RZJL 4OZFG 2EYRB 4XBPA 3RWCA 1MLBB 1E0OB 4MB5A 1GZPA 3IJSA 1KJVA 5DUMH 4HKBB 2OMNA 4XP9H 3ARDD 4D8PB 5CIPB 3F7YB 2JJTC 4RAHA 2H2PC 1RULH 4NNYA 3RU8H 3HAEB 3NAAL 2DQFA 2P8PA 3WNMA 4ODVH 2GHWB 1PQZA 3MRLB 2J8UB 4ZD3H 5I2IB 3MOBL 2EDEA 3ILPB 5JXED 1MRCH 2V2WB 4S1SL 1F3DJ 4JCMA 4A6YA 2X4NB 2CKBL 2DN7A 2P1YA 2DQUL 4FQLH 4Q9QL 3DYOA 1OPGL 1H3XA 5DYOA 2DD8L 1U93B 1ND0A 3KPPB 4JR9L 3MMEB 5B3NA 4M62H 5GJTH 3KLAB 4NKDA 2DWDA 3L5WB 1LO3L 3WFCH 1T04B 3IU3B 2Y1VA 1OLLA