1QPPA

Crystal structures of self capping papd chaperone homodimers
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
214
structure length
207
Chain Sequence
AVSLDRTAAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLDPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords PAPD CHAPERONE
publication title Structural basis of chaperone self-capping in P pilus biogenesis.
pubmed doi rcsb
source organism Escherichia coli
total genus 39
structure length 207
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qppA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qppA01
5C9KA 1VHPA 1E4JA 1ZOXA 1LK3L 5HJ3A 3QIUA 4HWNA 4HKBB 3VFUB 4TUKH 1A22B 4LSSL 3QHFH 3KS0H 4H88L 4PGCA 3PGCA 5T5FH 5CBEB 2FZ3B 1MFEH 4WHTB 3QXAB 4RMSA 1JV5B 1ZWIA 3QFJB 3DPBA 2O26U 1M7DA 1X5XA 1E6JL 3QFJD 4P2OA 3Q6FA 3F7PC 5HI4D 1FNAA 1U8OA 3S5LA 3WKNA 4KJWD 4RISL 2FRGP 3SDCC 1I7RB 5EO9A 5HGHA 4NKMB 4C83A 5GIRB 3MLYH 4JHBA 4PJ5E 4NQDE 1DQDL 1DEEA 3RI5F 4MD0A 1T7YA 2ERJB 5C2UB 2CQVA 1BREA 1UCTA 1RIVH 4P49A 3UTTB 3BO8A 3ESVF 3FT3A 5EZOH 5BJTB 1F4YL 4PB0L 3BP7B 3QB7C 3UTTD 3RNKB 4N9GA 1CDJA 2NMSA 2P24B 1FC1A 1JCKA 4Y5YB 5HHMD 1NDMA 1UM5H 5IJKA 3F7QA 2E7BA 5B3JE 4LSVL 5KSAA 3GIZL 4N0CC 3CU1A 3VXRD 3LQAC 2ZNWA 2VXTL 3QCTH 5I6XB 2VE6A 2OR9L 5JIPA 3JTSB 4NQEB 4LIQH 4JFDA 3CFDA 3F7YA 3PV6A 5HHNA 5F9WB 3TV3L 4ORGB 2R2BB 1K4DB 1V3JA 3OPZH 2FH8A 3A0OA 4XBGA 4XMKH 3TA3A 1ZA6B 4X98B 5DFWH 4ZUUA 5T1DH 4KRPC 3V7AE 3TJEL 1R3JA 2VTFA 1R3KB 4KHTL 2VC2H 1S7RB 4WCYL 3RY6C 2AQ2A 3D0VA 3H7BB 2HJLA 4UV4L 3V95A 3EOYG 3GK8H 1PBYA 4TNWF 3CLFL 3WIHH 4ZOCA 1H0DB 2X1WL 3VRJA 4JJHA 3DXAA 3C2AL 5ETUB 2DLFL 2V2XA 4XVTL 5K9JL 3L3IA 5ALBL 2ZG1A 4U1JA 2GUOB 4WRLA 3ULVD 4JRXD 2C1OA 2WQRA 5TH2A 5FM5O 4UOW0 1INDH 5E56A 3T08A 1UZ8A 5J1AA 1A14L 3PXJA 2R0ZH 3AXLB 4MNQA 1I7UA 1MCNA 4NM4L 3NCJL 3TIEA 1LE5A 1PD6A 4MQ7B 1WT5A 4PB9H 4F37K 3MNZA 2YN3A 1E6OH 1J1XL 3LDBC 2X05A 1IGTA 1R3IH 4ODHH 3SO3B 1E4XL 4ZTOH 1S7UA 2X9WA 4IJ3C 3ZL4L 5DRWB 4F7TB 1I9JH 2YRPA 1BJ1H 2ZUQC 4Q9CA 3G5ZA 5HHOA 2Q3ZA 2NX5A 3G9VA 3CXDH 4FTVE 4HXBH 4EUPG 4JHZA 4X7TB 3T77A 3I85A 4ZTPL 1DBKH 1SYSB 1X5GA 2DIBA 5BVPH 3G6JE 3ARFA 4WV1B 1OB1B 1FVDB 3L3DB 1FG2A 1FFOB 5I1AA 3P9WB 4JO2H 3MRCB 4PJBA 1YEHH 2XWJA 4NYLA 4OFKA 4QF1B 1I4FB 4YDIH 4GW4B 5KAQF 2ID5A 4L9DA 1U0QA 5C0EB 3EYUH 3X12A 2AJVL 1Z5LB 4OCWL 1EHNA 2BY1A 1HNGA 4JQIH 1IGIH 2D03L 3ULUL 3GGWB 3QEQB 3QUZB 5SX5H 3KYAA 1PYWA 3HE7B 3BKYH 5ID0A 1KB5B 3QEQD 3QUZD 3C2SA 2PXYD 3RVUC 2X4RB 5DUMH 4IRSB 2EE9A 4LASL 3Q6GL 4X9FA 5DD0H 4R96A 4IRSD 4G8EA 1K2DB 4MAYA 2EDFA 3I2CL 5DZNA 1PZUB 4U7MA 2R0WL 3MRKA 1FDLL 2DYPB 5JHDA 1N59A 3H0TA 4MXVF 1LEKB 2XZAL 4PJAE 3D85A 2X9XA 1S7QA 2DYPD 1NC4D 4QWWD 2LU7A 1QSVA 1R24A 4XGZA 3BWAB 1CK0L 1A21A 1FN4A 3WDHA 4K55A 2R23A 4IRJC 5B38B 5IWLA 4EI5B 1CFQB 5MERB 5KSBA 1VA9A 4EI5D 4HIJA 3KJ6H 2C4XA 4W6WB 3AAZB 3W2DL 4OKDA 1DSFH 5FGCE 3O8XB 4OCSH 3FQRA 4LLDB 2BNUA 2QHRL 3BJLA 1P84J 3MC0A 1AIFB 3O8XD 1F6FB 2WWMC 1N3NB 5DRXA 5ICYB 3LQZA 1YY9C 4HJJH 4Y2DC 1RJZB 1RZJL 4YNYA 5D7KE 1EERB 2XRAH 2VR9A 3Q3GA 3ZKND 4R90H 3B9DA 3LV3B 4P2QA 3GHEL 4UV7L 5GRJH 1ZT1B 1SM3L 4XHJD 1DANU 3KNBA 5FUZL 3QO1A 3KGRA 3VWKC 2I9TB 3MROA 3EGSB 4JM4H 3H3BC 1I85C 4AIZB 4HFUH 3MRGB 3QEGL 3FKUS 4P9HC 1HE7A 1JBJA 3HAEB 3KPLA 4R4BA 1I8KB 3KLAA 1A64A 4XB8A 3OAYH 1F5WA 1T2QL 5DK2B 5T1MB 2YD6A 4D9QE 2MNUA 1JRHI 4HF5H 4YPGA 1TQCB 2BERA 4LSTL 1L7IH 5GGSY 5F9OH 4KK9C 4LF3A 5F7MC 2D31B 1KCRL 4M7ZC 1S7SA 4UUJB 2GJJA 4HGMA 2A6KB 4FQPA 1JHTA 1CT8A 4ZAKA 4XWOC 4Z0XA 4PP1C 2ZZUT 4ERSL 5T1LD 4LCUB 3IDNA 3SJVD 3ULSA 4PREB 2BHZA 4WFED 4MA8L 4KVNL 1ZHBB 1TCRA 5IMOA 5C0BE 2GT9A 3FB7A 2XA8H 5AAMA 2ATKB 1KXTB 4OLUL 1I8MA 3NIFE 1ONQA 4W4OC 2X44D 3DVFA 4NJAL 3KLHC 4NQDB 4PJHF 4NRZA 4PJ7F 5DEFA 1DQMH 4JY4B 4K94L 4KV5E 3RWIA 1V7MH 2L7JA 1SBBA 3MV7E 4NHUA 2DMBA 3TO4B 3L95A 1LVEA 3PHQB 5AZEL 1K8IA 1LO3H 5D5ME 1NAKH 1IT9H 1YUHB 1JPTL 4YXHL 4HJ0C 1GC1L 5D1QB 5E4EC 4TOYL 5T3ZD 2DN7A 1JNNH 1GGCL 3KPQA 4WUUE 1N4XH 4CU8A 5AAWA 3EYFA 4CVZA 2VH5L 1MRFH 1REIA 3I3EA 4YFDB 3WLWD 4AEHL 2VQTA 5D2NC 2WINB 1CGUA 4M5YL 3AU1A 2FB4H 1UACL 4O2CA 2QBWA 4NZTH 3QIWB 1OTTC 3GJEB 4HC1A 4NJ9H 4IMKA 5FUCE 3QIWD 4QO1A 1C16B 5FYJU 3DI2B 4GMTL 4ZDHB 5I8KL 2VDOL 3EDJA 4AEIH 5IK3A 2FCBA 3WXVH 1QYGL 1ZLUH 5L7XL 4J1UA 4GAFB 2F19L 2D9CA 4F7PA 5B4MD 2A6IB 2P5WB 2AXFB 4XNQB 5LQBH 2YEZA 1C08B 4EDWH 3BYYA 3D48R 1G7IB 4X6DE 5GZNC 3ZDYE 3BP6A 4F58H 2P5WD 3O2VL 1IL1A 5ICZB 1HZHL 3PWPD 4YX2L 3VWJC 5IB1B 3MZTA 4JDZA 5ERWB 4TPRL 2NXYC 4OD1L 4CRPA 1IQDA 3UTSB 3VGFA 3GUTA 4UOJA 3WIFA 4ETYA 3U4BL 1NGYB 3OSKA 4U33A 3QXVA 3UTSD 4U1LA 5J12B 3WHXB 1PDKA 1TZGH 3FT2A 2G60H 1KB9K 5H35B 1HKLH 4KY1L 1WBZA 4DGIL 5HVHB 1YMMA 1N8ZB 5JUEH 5I1EH 2G9HA 2XV6B 3EHBC 2AK1L 3RIFF 3V9FA 4R4NC 1BM3H 3VXSB 1TFHA 2LQRA 1H5BB 2EH7L 1BZQK 2DM7A 5TE6H 1BQUA 1N64L 3VXSD 1EGJH 1IRAY 3PL6C 5MEPB 3PP3K 4MDJB 4NO0A 2AEQH 2XY1A 1A6VL 3RTQA 3IVKA 2BVPA 5BZDA 3MODH 5BQ7B 1WLHA 5D6CA 1MCOH 4UTBH 1P6AB 3WFCL 1FJ1A 4W70A 4JDVB 5DJYB 3FQWB 5FHAH 1KCUL 4ISVA 4GLRI 2F54E 1KCVH 5L2KB 4P46C 5C09E 3RGVC 1DN0B 1DVFB 4NWTH 2EICA 5L2KD 3DWTA 4LP4A 5HYIA 1T83C 3IU4L 2YKLH 1HDMB 5HYJD 2R8SL 1DVFD 2VQ1A 5D8JH 4P23A 3OR7A 4RGND 3DURA 4ODVL 3AROA 3SE9L 3S3SA 1ZLWK 4HDIB 1MH5A 4YO0B 4M1GL 4U31A 5I1CH 3BPNB 1MCEA 2ED9A 3PWLB 4LSUL 1R5VB 1T04B 4H1LH 3P30L 1HHIA 2FJGB 4ZPTB 4H0IA 4JPVL 2VDNH 1XR9A 2QLVB 4OZGF 5IW6B 3FFCA 2O5ZL 4GQPH 1B2WL 4JFFA 3WJJA 1VEMA 2VZOA 2C3XA 3BUTA 4Q6IB 3HUJE 2VLMD 2BVQB 2CKBB 4UTAH 5IFHH 1D6EB 2MPAH 2NZIA 5B21A 5C08A 4N0YL 4DAGL 3IFLH 3STLB 1A7RL 5DSCB 1MEXL 3QNZB 5EBWB 5SX4H 5DJ0B 2FECI 1FLRL 2E7HA 4QTIL 1DQQA 3LKSB 5DMGC 1S8DB 4ZFGL 5DUBA 3D9AH 3CFKB 4KUZH 5E8NB 1D5XB 3UBXA 2DQIH 1R5WA 3V5KA 1Y6NR 1LP9E 4RFOL 3SDAC 3PDGA 3T0VA 4Q9RH 4FOMA 1XGQB 3CAFA 1FNHA 3VFRA 5JDJA 3REVA 1EUUA 1OY3B 5E2UH 4L9LC 4P3CH 4DOHB 1XGRA 1FORL 5C0NC 3LIZL 3SKNB 4JREC 5JW5B 3B2VH 1BX2A 5FA3A 2BFVH 4S10A 2HRPH 3TC9A 3TFKC 2ZSVA 4YIQB 4PLKD 4X5WB 5E6IB 2HH0L 4PJFA 3SE3C 4WJ5B 4G8IB 2B1HH 3B6SB 4PR5B 3ARBD 5I71B 3OAUH 1QRKA 3C5SB 4ONGH 3ROLB 3RL1A 3ARRA 1S5IL 1M05A 4R4FL 3UMTA 2J7LA 4NIKB 3HI5H 1MHHA 4PRIA 3S98A 4UNUA 5SWSA 4LCIH 1A9BB 3QBTB 4L8DB 2EDKA 3BZ4A 1RJLA 3NACL 2ZPKH 4GG6A 3MLRL 2HA1A 3C6LB 4LHJB 1I8IA 1EXUA 2CLRB 2D4FA 1XGTA 4OZ4A 1TETL 5FM5M 2ZUVA 5D7LE 1D7FA 1QSEB 4P5MB 2OR7A 5CJBA 4OCMC 3MXWL 1MI5A 4PYGA 3SKOB 2E6JA 5F7NC 3V2AR 1F3JB 1JWMA 1C1EH 1QSED 4KJQD 3MOBL 1Z3GL 5KSUA 5TF1L 4WWKA 3VXOB 5I2IB 1NBYA 1HOCA 1BF8A 2P7TA 2DIJA 4C56E 1VKXA 5IF0B 1NC2D 3QP3A 4I13B 3L3GB 2Q6WA 4EUPA 3QAZC 4YZFF 1AJ7H 3T0WA 5TE4H 4JQVA 4FQXA 4LARL 1FIGL 1A7OH 4PJCF 4GAJL 4QRRA 3VXNA 2HTKC 1BD2B 4BKLA 4HS8H 5ENWA 5F7EL 3VFOB 5AZ2H 1HI6A 3JBG7 2MHAA 4K9EL 4DGVH 1BD2D 3DRTB 2C7UB 1P5VA 5KTEH 4OKVA 1OAZL 2IBGA 2IH3B 4KDTA 1MFDH 4P4KB 4XMLH 2EC8A 1CL7L 1U8QA 1EPFA 2WANA 1PFCA 4P4KD 3K81A 5CBAA 4YFLI 5SWZE 1YN6B 4DEPC 3NFNB 5CJ8A 4BH8A 1CLOH 3I75B 4WFGD 1KT2A 1T21A 4M93C 3CVHL 4KTDL 5KS9F 3ZKMD 3WNLA 1DQTA 3MUGA 4HV8A 2BSSB 3U0PA 4G6MH 4UDTA 5D93B 4FZ8L 1Q9WA 5J6GB 4GW5A 1G9MC 3BKMH 1INQB 4HX1A 4LLVB 1T5XA 2E6PA 4GXUM 3QO0A 4OGAD 2YK1H 5E2TL 5JA9A 4MMZC 4R8WH 2X42A 1R6VA 1HYSD 3NCYP 2XOTA 3O6LH 4Y7MA 3N1PC 4OZFB 3TVMC 1WBYA 25C8H 5I9QC 2BHUA 1RK1B 1QO3A 2BNQA 3R4DA 2PYEE 3KYNA 4ELKA 3QDHA 1I7TB 5FYKU 1X5FA 4KI5C 2X4OB 4X0KA 3V6OA 4G6JH 4WEUD 2BRRH 3BAEL 1HHHB 1UC6A 5FGBA 1TZHB 3QDJD 4PJGA 2W9DH 4MA7L 3CFIC 1VESA 5E5RB 5CIPH 3IAPA 1MLBA 4ZYKA 4NSKA 5HHVL 4NPYB 5E08H 1HINH 4XVJH 5BV7H 1U8HA 4PJHE 4MCYB 5EBLA 4PJ7E 4PRNA 3RWCB 3ELAT 3HNVH 1VPOL 3HI1B 3MJ9H 2LU3A 2RBLA 4GAGH 2HJKB 3QUYA 3K2UL 4CMMA 3EO0B 5TFSL 1IEAA 4NKOB 5IQ7L 3RDTC 3UTQB 1MJUH 2F53A 2VSCA 4NP4H 3S96A 1NAMH 4PY8J 1O7VA 3PHOB 1YEEH 5SV3A 1EJOL 4HUNB 3RWJA 3SDYL 4FQJH 3U79A 1A47A 3O3AB 4FFVC 5ID1B 3V0WL 3MLVH 4MD4A 1AXTL 1T6WA 4S1RH 1EZVX 2CDEB 2EYSB 4KAQH 3ISWA 3VXRA 4ETQB 1BJMA 3PWJA 5F9JA 1F4AA 3RUGA 2F5BL 5E8DH 1BGXL 2AKRA 4WHYH 1T3FA 2Z31D 3I02A 1IBGL 4IMLB 4X4YB 5DJZA 2XZZA 4XBEL 1G6RL 5SV4A 5IMLA 2H6PA 2R0KH 2ZG2A 1OTSD 1MAML 1A6AB 4TUOB 3VI3E 5MEQB 2YUZA 3TH3T 2BY2A 2HJFB 5F3HB 1S9YA 4XZUA 5IQ9A 3NFPB 5FYJE 2IWGA 4OV5A 2A6JA 4I4WB 3ZTJH 4XCFL 4BZYA 3D5OF 5DLMH 1A7QH 4CVXA 3X14B 2VIRA 4XVUC 1FYTE 5C09B 1AGBA 1QSFA 1FPTL 4S1DD 4QNPF 1M7XA 2XIDA 3DO3A 2OI9C 3BQUB 5GGRB 4DZBA 1KCSH 1P9MC 2GSIA 2JJWA 4JGJA 5E5MA 1CTNA 3QDAA 4JPWH 2FWOB 4JRXA 3BDXA 2QSVA 4L29A 1MCSA 3WSQH 3HRPA 2KQMA 2UWEE 2IQ9H 4XNYL 3P73B 5IEHA 3QHTC 5J11C 2OTUB 3ZHLA 3NIGF 3RU8L 4X83A 3RWGB 1E28A 4G9DB 5E8EB 5DQDH 3B8YA 1GGYA 1X4ZA 2FO4B 5K33A 4PJ9D 4IOIA 1XIWB 1XR8B 3FN0L 3I50H 2X4QB 5DK0A 3TN0A 3DROB 2HT2D 1WCBA 2HAZA 1DLFH 1XIWD 1T4KA 3DVGB 5D2LF 1T1ZB 1V8HA 4Z7OE 4N0FB 2XNAB 4G6AC 2QQLH 1KN4H 3OKLB 2NXZC 3O3EA 5CSZA 4P59L 3SKMB 2B20A 2W0FB 3JTTA 3BDYL 4FNLL 1YNKL 4ZNCD 1JTOA 1GHFH 1OP5H 2B39A 1CU4H 1RZFH 5LCVL 3IFOA 3X11B 3BVNB 5T1KB 4X7SL 4NDMB 5C0AA 4Q2ZB 1CLYH 5T1KD 3VGDA 1XGUA 3OHXA 3P4OA 4X8JB 4LDEB 5DHVH 3HPLB 3TA3C 2RIKA 1WITA 5JPMA 1JGLH 2NY2C 2EEDA 3MJ8A 3WXWH 1AQKH 5DJXB 1S7WA 3MMEB 1F97A 5D1ZD 2Y7QB 3D3VE 3N9GL 4FQ2L 4MAUL 3RJQB 4DFHA 4MXWL 2JCCE 3TGXA 5KG9A 4O5LH 4TSAL 2PXYA 3QUXB 3U2SB 3FRPG 3RVVC 3TM6A 1ORQB 1V3LA 3ARGA 3QUXD 2J8HA 3RA7H 4XT1C 1YC7A 1MLCB 2Q8AH 2HFTA 1JGUL 4WI5A 5DJAB 2HFFA 4I3GA 4F57L 4QRSA 4M1CC 4ZXBD 4K7FA 2WM0A 1T5WA 4HJGB 5KOMC 1FVCA 4QRPD 1QZ1A 2FSEA 4ZUVB 3AGVA 1NC4A 5DRNA 2B0SL 2DQCL 3UYPA 3VGBA 3EJZC 1AR1C 4KKCD 2JELL 5KN5B 1ZLSH 1IZJA 4G9FD 2IGFH 3PIQA 4C56B 1FIEA 1IZKA 1WT5C 2BSTA 1SEBA 4Z78B 5C07E 1HEZB 1MHPL 1Q94A 5JMRA 3N1FC 4PLNC 3S88H 4CMHC 1YYMH 1HNFA 4K07A 2YR3A 4HS3B 4XPFH 5E9DA 5FOBA 4AL8H 3KXFA 3DMMB 5EFIB 4TNVF 2IANE 4HFWB 4YHIB 4FXGA 4LKCA 2VDQL 4LLWA 4HUUA 1ZTXH 2R0LL 4K8RH 3O2DH 1NUDA 1G84A 1FGNH 3NCYS 1RUAL 2CDGB 1CR9H 4HH9B 1S7VB 3MBXH 4I3SL 4UIMA 3ARFC 3GM8A 1BWMA 1C12B 2MSPA 1JUFA 1QFUH 2E27L 4GAYB 4I48A 1TJIH 4LVOB 2X4TA 3QUKA 2HVJA 5EU6E 1I75A 2UV3A 4ENEC 4ZMAT 1A3LH 4X7FC 1EEYB 2NW2A 1OP3K 1MIML 1HYRC 3LZFL 4BYHA 1PVHA 3GMOA 1RD6A 3DRQA 4EXPX 4MD5A 3MGAA 2ADGB 1C5DA 4ZUTA 2COQA 1CDGA 3CGTA 2DTMH 3ECBA 3DVNB 3HA0A 4GQ9H 5EUKA 3MXVH 1F00I 1BFOB 3M45A 3QA3B 1D5MB 1XF4A 3DX7A 4M9PA 2CK0L 5C8JB 3MCKA 1NGPL 2PYEB 3A67H 4PJXA 3RL2B 3K8LA 3NCCB 1PJ9A 1U93B 5ESVA 1CXHA 4JG1H 5FECA 5IFJA 2Q3AA 2VXSL 5GHWL 4BUGA 4BZ1H 3V8CA 4DK3A 3F58L 2NY4C 3JWNC 1MFCH 4PJCE 3FO9A 5JNYB 4FQHA 2DLHA 5AUMB 3ZE0E 3QXDB 1YMHA 1BAFL 1KPVB 2CIIA 2SEBB 5E6ZA 3AM8A 5T1LA 3MRJB 3HMXL 5IWLC 4AZ8A 1JWUA 5FOJA 1LWRA 2Q8BL 4XP1L 5GGUB 4PJHB 1WAAF 4U1HA 4UZGA 5ACLA 3RHWF 4PJ7B 4EUPH 5KW9H 2AVGA 3MNWA 1MCHA 3HZYA 4JN1H 2AJSH 5E6YA 4MNGB 2EH8H 3HR6A 1EVTC 3BEVB 1PQZA 3DV4B 4GFTB 4D0BB 3TJHD 5KS9E 2FL5A 2AABH 4RIRA 2VDML 3A6OA 1CBVH 3R8QA 3V0AC 4XP5H 4MA3B 2VLRB 1UXSB 1L0XA 3LKPB 1U3HB 4F80A 4GSDH 2OYPA 2R4RL 2VLRD 4GBXD 4ZO7A 2W65B 1U3HD 4HUWB 4RDQG 4QY8B 2A73A 1SJVA 4JO1H 5ISZB 3RVXD 4I9WD 1FH5H 1RULL 1Q9LA 2ARJB 4OSUH 4PG9B 5ISZD 4JHAL 3O2WH 5F21B 4PTUA 2FIKB 2NZ9D 4XH2A 4X80L 4WEBH 1INEH 4XVTH 3U7AA 5MI0C 1UWGL 1D9KA 5BS0A 3IB4A 1I8LA 3MLZH 3U9UB 3S37X 3GKZA 5C0RH 3K2MC 3S4SB 4QYOA 5DK3A 4NZUL 2HKHL 3DTXA 4NGHL 5BCAA 4DKFH 2PW2A 1UCBH 5FA4A 3BIAX 5HY9A 4E41D 4KROB 3P77B 4NN5B 2MOVA 5FYKE 3W81A 4KROD 2X7LB 4X6EA 3ILQD 4L8CB 4YEEA 5EULV 4OT1L 3C9NB 3P0VL 5A43C 2GAZB 5CSGA 2IFGA 2YBRB 4MCZA 4LU5H 3IS1X 3CSYB 3QWRD 5C0GA 4Z6AT 4EDXB 1Q0XH 4ZAKC 3RY4A 3GI8L 2Z93B 4JKPH 3WFHB 4BQ9A 5BV7C 4LSDA 1T1YB 3DV6A 2O5YL 3H9ZA 3QI9B 2A2QT 2ESVE 4Q74A 1MCPL 3I6LD 3PWPA 4NUJB 1NBVH 5E2VL 1JVKA 2R15A 3QI9D 3MREA 2X1OA 3MRPA 2JTDA 2V5SA 4DJMA 3MLXL 5F6IC 5JW4N 3PGDA 3LHPH 2FD6L 1SYVB 4V1DE 4QXUH 3MR9B 1VACA 4Y4FA 1ZT7B 5H37G 2XQBH 1YQVL 3QEHA 1J1OL 3D2UA 12E8H 3MJ7A 4NKQB 4RGOL 4RA3A 3T0AA 2HG5A 3QYCA 1BVLA 2AJVH 3QFDA 4U1SA 3UC0L 4RWYL 5HVFB 1VGEL 4Q58C 1FG9C 1OAXH 4YQXH 1OARL 2FEEL 2XTLA 4YDJB 3PWNB 4K2UH 3TYGL 1RY7B 1IE5A 3WNKA 2XZQL 3CFJA 1RU9H 4JAMA 1QTYT 4YGVB 4KI5F 4C54A 4CW1B 5J06A 4KI1A 4QHNA 2EKSA 4LASH 1NLDH 5LAXA 5EG6C 3WO4C 1GH7A 4E5XA 1J0HA 2R56L 4LSRL 5D7JC 4OGYL 1HXMB 3TBVA 5JPNB 3SDCB 5KANG 1FDLH 3P0YH 4FP8L 4PJEA 1RUQL 4YE4H 3B3IA 5BO1L 3VCLA 3W5NA 3JXAA 3MRIB 2DICA 1UH4A 2GTWB 8FABA 2ENSA 3MLTA 4NQXA 4J3TA 3NCFB 4HBCH 4KKAC 4IMKC 1KV3A 4QEGA 4LHUB 4LPUA 5I8OH 3SPVA 1WBXB 4UILH 5I1HH 3NPSC 5KBNC 4MQXD 5EBMA 1M7IB 1T20B 2JCCB 3L3JB 1JL8A 1N7MH 3D25A 3NZHL 5HYJA 3NA4A 1J86A 4MX7A 1BF2A 1BBJA 3SCMA 3BZFB 4N0CD 2X4PA 4Z7WE 2JKXA 5DZOA 2G2RA 1EHLL 4Z0BH 1ZS8A 3V4VL 2F74A 3BRFA 1EDQA 1MRCL 3RIAK 3ULVH 4OZGB 3HR5A 3CVHA 3PF2A 1KN2H 1LD9B 2ADFH 4YFLF 4UV7H 3T0EA 5GS1A 5D2LE 1EFXB 4ODSL 1CI5A 4RGMC 4G5ZH 3RPIA 5FUZH 4IHOA 4R2GC 4WO4B 4X7EC 3WFZA 1G7QB 1ZK9A 3GIVA 4PIRF 2Q1EA 4KRPB 1U8NB 3D39E 4WO4D 1B3JA 5D7IF 3O3BA 3W9DB 1MFAL 5FHBH 4MB5A 3KR3L 1MPAL 4OF8A 3UYOD 1D5IH 4RFEA 2VZVA 2Z8SA 5C07B 4KQ4L 3TYFB 4HWBL 3CZFB 4LK4A 5SWQB 2Y4SA 4Z77B 3MRNA 3V7MA 2DQHL 1YYLH 4D0DB 1IQWL 4HG4K 3PABA 2OSLB 3RWDB 3PP4H 4JPKH 3VFPA 1KF9B 1G7LA 4AH2A 1CFSA 1JZ8A 4X5XA 1HH6A 1QBLH 3BRDA 2OXHA 5IMKA 3QULB 1AI1L 5C6WH 3JV6B 2B1AH 1SBSL 1ZANH 2CRYA 4XWGL 1FVEA 2DMCA 5EU6B 4NO3B 3TBSA 3IGAA 2VKXA 4BQCA 3FONB 4JRYA 1FHGA 1KYOK 3VXMA 4M6NL 5DVMA 3CUPB 2EXWC 3LDBB 3ARBA 1NGZB 4QGYA 3FB8B 5J57B 3LMJH 4HUVA 2AW2A 3BMWA 2YXFA 4ZUWA 1JNLH 3A6CH 3RWFB 2MKLC 5DS8B 1H3XA 2OTWA 3CDFA 2R2EA 4P23C 2DQUL 4NKDA 4DVBA 5F3BA 1KB5H 3P4NB 2B4CH 2Z8VC 4LIQE 3MLSL 3ARDD 5DZLA 1AD0A 8CGTA 1TJGH 3E1F1 4Y5VA 1UB5A 4F7MA 3C8KB 3BGMB 4OM0L 2UYLA 5I18H 4PJCB 1DDHA 3QQ9D 4GS7C 4HZAA 1JPTH 4U6HA 4YXHH 4PRHD 2PR4L 4BK5A 1NC2A 5C2BL 3WJJC 3DBXA 4PTTA 4J6RH 2W60A 5I73C 3AMLA 1H8NA 1WZ1L 2GFBA 1G6RA 2J1KA 4H8WL 5EN2B 2IFFL 5IB3B 2Z92A 1RVFH 2VH5H 3MOAH 2JE8A 4OB5L 1KTLB 4XPTL 4R3SA 2PW1A 4M5YH 4OD3L 4UDUB 5EC2B 5EH1A 4M43H 1VB9A 3OKMB 3LSOB 1OAKL 1QRNB 2HKFH 3BEWA 4D0CB 1J7VR 2LV4A 5AYUH 5KS9B 1EO5A 3T0BA 1NCDL 4FFYH 2VZ1A 3G04B 4LVNC 3JSSA 2J6EL 4LDLB 1FYHB 1U58B 3L5WA 2DJSA 4UQ2B 1JPGA 3GSNB 1QR4A 3HTLX 2G5BB 15C8H 4LAQH 2FYYB 1J18A 2BVUA 1BMGA 1JF1A 2QR0A 1KIRB 1Q1JL 4L4VD 5A2IH 4QCIA 3ARVA 4JFOA 5EOCJ 1IM9B 3MV8B 1G9EA 3FRPA 4S0TD 4M7LL 4G42B 3GMMB 3BPLB 1MJJB 3GI9L 4IRJB 1L7TH 5CEYB 1KPRB 2WK2A 5C0IB 3MV8D 4ZFFA 2C1PA 4HS6B 3IDIB 6FABL 1X5ZA 4U6XB 5CKAA 4K7PL 1ZV5A 3PWUA 4LFHD 1MREL 1JWSB 4DWHA 2YMXL 5FXCH 2OQJB 4BQ6A 1U8JB 2FJFB 3QCVL 5E5UB 5HPMB 4WGVB 2AAVA 4PGDA 3HAEH 4D9RD 1QLFA 5F1NB 2BJML 4Y2DB 3K46A 2WWMD 2V7NA 4OQTL 4Z7UA 3Q5YA 2APXA 2J5LC 4L8SA 2L0DA 4PGBA 1HXYB 1L9MA 3QDJA 1A1NB 5IVXE 4X99A 4PRPB 2DQGH 4DQOL 3TZVD 1RJYA 3W0WA 4AY0A 3LRGA 4PRPD 3VWKB 3BPOC 4OZIA 4O51A 4OQ1A 5I16B 2ESVB 1JYNA 4JQVC 2X4UB 4FQXC 5FAAA 5JHLL 3JV5A 1A5FH 1ZSDA 4B0MM 4PJBF 1ZHKA 4L4TB 4MWFB 1N0LA 3HNTH 1UH2A 3L5XH 1T03L 4U1KB 3VG0H 3STZA 4KRMB 3SDDA 4CVUA 1DE4B 3QXTA 3WUWG 1GZPB 3OG6B 4KDTC 43C9B 1NBQA 4LNRB 4XBPB 1RUPL 3ES6A 3INUH 1A7NL 3KPSD 5A3ID 3U46B 4ZFOB 4CJ1A 2XTJC 3EUUA 4Y4KD 3EFFA 2XACC 4M7ZB 2R69H 4F9PA 4O2FA 5LXGH 2OBGA 3V4UL 2AGJL 1MIEL 1X5LA 3B8SA 5DWUL 4MLSA 1UYWL 2AERT 2ZUUA 1UKSA 3PWVA 1UM6L 2Z0BA 5T3ZH 4B50A 2Z31A 3SE9H 2AJZA 1L4IA 4G8GB 1CD1B 1J1PL 4LSUH 3WLBA 3G5XA 4G8GD 1ERNA 5DD6B 5LVEA 5KSBF 1X44A 3V6ZA 2CDFB 1NBZA 1WEJL 5CEZL 1CDHA 3F8UB 1SVCP 4MVBC 4MYWB 3T0XA 1AGCB 1NFIB 4GW1A 3MRLA 2D7NA 2A9NL 3UJTL 4MZ3A 1I1FA 2BMKA 1LHZA 4NT6B 3F12B 2AJUH 2IEPA 2Q20A 3GSVB 4MS8D 1FO0L 4P3DA 4RZCA 3QUMH 2RR3A 5E4EB 3AY4C 4X6BA 3VFMA 1IGML 4HJ0D 4L3EA 4Z7WB 4K23L 2VISA 3KPMA 2E7LA 1MFBL 2DQEH 5I66A 4KJWC 4P2CG 1CQYA 2LAGB 2VZ3A 4AG4H 3HZMA 3KS0J 1G7JA 1ZMYA 1IC4L 5D2NB 3QUYC 1N0XH 1ZHNB 3QDMB 4YR6A 4YWGL 4HGKC 2IJ0C 1G0XA 4NHCL 5D2LB 3QDMD 3LS4L 3UPCA 2VNCA 4ZO9A 2J4WL 4S11A 4C55A 1MWAB 2EZ0D 1A4KB 4KI5E 3QWOA 3TNNB 1AR2A 3QNYA 3F62A 1WJ3A 4HKZA 3L1OL 2O93L 5CZVL 4Y19E 4M1DL 5BRZD 1KELH 3KYKL 4IM8A 2QHLA 4OFPA 1ORSB 3C6SA 3EO9L 4XP4H 1T6VN 2GJZB 5JR1H 1FZJA 5FDWB 2ITDA 5A16A 3RZWA 4F7EB 4OCXL 4FQCH 3VWJB 3QZWB 3ILPA 3E6HA 4U6YA 2P43B 2NXYB 4NNYB 5DO2D 3I9GH 5LKNA 5I6XC 2APVA 4JFQA 4Q9BA 3HMXA 2D7OA 2OMNA 4BZ2H 5T33H 4XX1E 1HQRB 4MGXA 1P4LA 3VMPA 3FCTA 3CSPA 2EDDA 5I1GL 5D1ZA 5DHYB 2FR4B 3QRGL 3CLEL 2DWDB 1N6UA 1UM4L 2CUIA 3GSXB 2HVKB 1UH3A 3CFCL 3EOAB 3T4YA 4UINL 4WFHD 4M61B 5A40E 3Q48A 3AREA 3RWHA 5FO8A 4WGWB 3EHBD 1GSMA 1XGYL 1RZJC 4J3WA 2YS4A 2Y5EA 4OCYL 1NGWB 1TENA 3ULVC 5JXAL 4HWZA 2I9LB 5JOEA 5I8EB 3EO1A 3DIFB 1B0RA 5DD1L 2H1PH 2OTPA 4NQVB 1G7HB 4ZQKA 2ORBL 5DGQA 4KTDH 5EIIA 3OJDA 5HVWA 5ADPH 2ZCHH 1W72B 3DECA 2JB5L 5DURB 4AMKL 2EYRB 5KVMC 1SY6H 5DUPL 3OZ9H 1NDGA 4KK5D 3O41A 4TVPD 4N8CL 3SDXE 3MV9E 5EZIH 3W39B 1NMCC 2EYTB 3L7FB 1LEGB 2ZUTA 5F1KC 4P46B 3RGVB 5A2KH 3RAJH 4CAGA 1PW3A 3MFFB 2Y36L 2H32A 4PJDA 5INCB 3RGVD 2CKBH 1M71B 1YJDL 5IBTL 3C5JB 3KPRA 1J0YA 2I25N 3TIDB 4WEMB 4XMPL 3LPFA 4G43A 2Q7YA 4TRPL 1DBMH 4TULL 3UP1A 5DA4A 5TQ0H 1LO2H 5BXFB 2F8VA 2D0HA 4PY7B 3QG6A 3WKMH 4KQ3H 1R3HA 3TBYB 1JPST 2Y07L 4OLVL 4JCMA 4ELME 2YWYA 2IG2L 3V7AG 1P7HL 5CHNA 4WI3A 3BKJH 2NW3A 3HI6L 4P99A 1MCRA 5CP3A 3MA7B 3LN5B 3CDCA 3MLWL 3B2UC 5JO5B 3X13B 2QJDA 3S37H 4PD4K 4EN3D 4F33B 4JRWA 1OPGL 3NH7L 2YC1A 1FL5B 2PXYC 1A2YA 3WNMA 1DLHA 2KPNA 4HGWB 3T1FB 3CSBA 3OG4B 3MYJB 1JRHL 2Y06L 3VFGH 4QOKD 3MV7D 1UA6L 3SDAB 1NSNL 4GG8A 2IALA 5I17A 3S6CA 4JFDE 3AB0B 4L9LB 3SDAD 1AGEA 2APWA 4LSPH 5EZLB 1KPUA 3MGOB 4KU1A 3NAAL 4H26A 4JREB 1TJHH 1U8KB 5C0ND 4ZO6A 2RQ8A 4CADB 5LGHL 4Q0XL 1IGJA 3KPTA 1K9TA 1QEWA 3H9HB 3TFKD 2F5BH 5GGVL 3LEVH 4UU9B 4QHUB 4EI5C 4PRBB 4XBEH 1KGCD 1FBIH 5JORB 3EFDH 4X7CC 2DLEA 3PGFH 4JFEA 3O8XC 1JGEA 4LLUB 1N5AB 1AKJD 2H8PB 2VZUA 4AYFA 4XVSL 1BPVA 1KJ2L 3MA9H 1GJIA 4XNMA 1F3DJ 1EO8H 4GBXA 4OIIH 1YEIL 1BQHB 1KJVA 3ZKNC 1NLBH 3G5VA 3OJVC 5EO0A 4U3CA 4MNQE 4QT5B 1RHHA 2BNRE 4XHJC 5L9DL 4UT9H 1BBDL 4XXDB 1N26A 2BSED 2OLDA 3GO1H 2JJSA 4K3HA 1RHFA 1A1OB 1J88A 4ZFZB 3QAZB 4IS6B 5HDQH 1EHAA 1U8LB 2W9EL 2LVEA 1P2CA 3BH9B 1U8MA 5HDLA 4PGZA 3R06A 1I9RH 4L3CA 2WIMA 3HS0B 4M5ZL 4BFEA 4RBPH 2HTKD 4Q6YA 5D71H 1VFBB 4E41A 1EZVY 3J7HA 1NCWL 2NX5E 2ZCKH 3GZKA 4NQCB 1J0KA 3TBWA 2QADD 4AIOA 4E42B 5IIEA 5IMMB 2E8ZA 4NQCD 3MRFA 3T3MF 3RNKA 2VAAA 4HWBA 4DEPB 4Y5YA 2VLKD 1JHKL 1L0YA 3S8WA 4HT1H 1B88A 4M93B 4P9ML 1W0WB 3UTZB 2P5EA 5ECJE 3GJFK 1EEZA 3E6FB 4UQ3B 1YEFL 1E0OB 1RIHL 1ZVSA 2GITA 3AM8C 5HHPA 4FNLH 3IJHB 2YD4A 3OAZH 1Z6JT 4F15C 1QNZL 2PN5A 4HIEB 4M48H 4EOWH 1FNEA 4LKXB 4Z5RB 4RAUB 3EYVB 2VB5A 3HNSL 5C7XH 1RUML 4RMVA 5EWIH 5CEXA 3FQTB 1JI2A 3HC0B 4PJFF 5FKAB 1E4WL 3HPJA 4GRWF 5I9QB 2I60H 2F8OA 3MACH 4D94A 3HE6A 5L6YH 3FO2B 1S3KL 1NL0L 4MJ5A 3LH2L 1BZ9A 3OXRB 4NKIL 4UB0L 4ZUSB 4FQ2H 1SHMA 4MAUH 4OJFH 4Y19B 3DX9A 5IB4B 3WE6B 1H3PL 1N2RB 1AFVL 4LGRB 4Q7DA 4OCRL 4GG6F 4K3GA 1MHCA 3FTGA 4HPYL 3GMPA 3BWUC 1FAIH 5CD5D 4KKNA 2O61A 5BOZG 1J8HD 1UG9A 1TLKA 3L3OA 5HGAB 1YEGH 2JIXA 3MRRA 4Z7NF 1D9KC 5SX4I 1JGUH 1MELA 1S9XA 1ED3A 2XFXB 1XCTA 5JMOC 1EMTL 5IOPA 4Z95L 3MRHA 3T4AA 3WLWC 1IC1A 1YPZA 5IKCB 4JFZH 3RDTB 3S34H 4BFIA 4G8FA 1P7QA 1AD9B 3CD4A 3S36H 3NABH 1O0VA 3QIWC 3VW3H 1CL7I 5ANME 3QHZH 4LGSB 5HGDA 2P46B 1P53A 4GT7A 3SE8L 2A6DB 3ZKQD 3FB5B 4P5KA 5LWYH 2DLIA 2FLRT 2BC4A 3DSFH 3PJSA 4FABL 3HZVB 4FFVD 1XMWA 1MCKA 4GUPB 4N5UA 1A0QH 1O5DT 1JE6A 3RKPA 3BE1L 1CGSL 2A77H 4JFYA 1MHEA 3IFPB 3FB6B 2J6EA 4NUGH 3VXQB 4QHLA 1K5NA 3WUWA 5C0DB 3JWOL 5IVOA 4TQEH 1GPOH 1KB9J 1KTDB 3I3BA 1S9VA 3UZQA 2Z9TA 3AS2A 4J12A 1G7MB 1AHWA 5EA0L 4Y1AE 4FQIH 1Q9OB 4N8VB 1ETZA 4OAWB 4YGAB 4DGYL 4G3YL 1XF2B 2WV3A 2FLBT 3V52L 1CDUA 3O3DA 3QIBA 2EDTA 4Y4FC 4KPHH 1KLFA 2UUDK 4G7YH 1NCCH 2DBLL 5J12C 3QJFA 2OJEA 5DC9B 1EHXA 3WFEL 4WFFE 4UI2A 5FUOL 3BJ91 5HJ3B 3HFML 2BK8A 1RZKL 3P11L 1OAYL 5DR5H 4YHOL 1UT9A 4PGCB 3QIUD 3PGCB 4JO3H 1ZLVK 3VXUE 2WWKO 3MCLH 1YNTA 2AEPL 3S35X 5ACZA 1KC5L 2FECL 2OI9B 5CJOH 3QCUH 2D2OA 4XPGH 3P9MA 1ZWIB 1I9IL 5DJ6A 4O58L 4NRXA 1M7DB 5E1AA 1EO7A 3DYPA 2FHFA 2VZTA 3Q6FB 5CGTA 1F11A 4GRLD 1H5BC 4PJGF 1U8OB 3S5LB 4P2OD 4OZFG 5D7LD 5EOQL 5J11B 5EO9B 5HGHB 4N1CA 4C83B 5EO1A 5F9DC 4F8QA 3THMH 1TITA 1EVUA 1DEEB 4MD0B 1GL4B 1QBAA 5I1KL 1Q0YH 3IDUA 4YK4C 4BA8A 5C0CA 2VDRL 4F37F 3TT1L 5MENE 3BO8B 3FT3B 1FFPA 2Y72A 2FATH 5E8OA 4I0KA 5J1SC 3BGFC 3RFZC 3U36A 1NDMB 5L8KB 2NXZB 2ZOLA 1N3NA 2R4SH 4WU7A 4WY7L 3VXTA 4AEEA 3ULUF 1DVFC 5KSAB 1UFUA 4G6AD 1T1XA 3F5WA 2NXZD 4RGNC 3SCMC 5KSAD 5IBLC 1XAUA 3ARDA 3U6RA 1KLGA 3TNMA 3IFNL 3N1QC 4HPOL 3D0LB 1RUKH 2IPTH 3M8OL 2VE6B 3O4LE 4JFDB 3CFDB 1GGIH 3F7YB 1P1ZA 3PV6B 5HHNB 1RJCA 2BOBA 3RUGF 3T0EC 5J4MA 3V79C 4HUXA 2A1WL 1XCQA 3HG1A 4WW1A 4PRHA 4XBGB 3B9KA 3TA3B 2XKNA 3TLRA 2NY2B 4LRNH 2FBJL 3H3PH 2FNBA 4YEFA 4P2YA 3GSRA 3ZDXE 1AE6L 2NY2D 3D0VB 4XPAL 4L5FH 2HJLB 1DBAH 3G6DL 1RV6X 4I2XE 2G75A 1J9CT 1A7PH 1NCUA 5EB9A 1PKQE 3VRJB 3DXAB 2H3NA 1OVZA 3ZYIA 2V2XB 3DXAD 3L3IB 3U4EA 3RVVD 2NY1D 3ARQA 4UIKL 4HK0A 4KKBD 4U1JB 5JW3H 2C1OB 3HC4H 3BPCA 3M17A 2VXUH 4LAJH 5TH2B 5HYQA 4YHLL 4JFHE 2DD8L 2BZDA 2N7BA 3WS3A 1FO0A 1UZ8B 4M1CD 5J1AB 3V5HA 3K8MA 4L4VA 2WUBH 4JN2A 2X40A 2QKIA 4MNQB 5KJRH 2W1NA 1I7UB 5HVGB 4P2RE 1AR1D 1ZHBA 4PLKC 1PZ5A 3HLAA 3TIEB 4P0DA 1LE5B 1JNHA 1OF2A 4M3JA 3MNZB 2PCPB 5FCSH 1IGTB 3ARBC 4U1MA 4CMHB 4M6MH 3HRZA 1S7UB 5I71C 5D9SA 4PJ5A 2ZNXA 1GRWA 3I84A 4ZSOE 1PG7H 3G5ZB 5GZOD 1MY5A 2AJXL 1KEML 2NX5B 3ZYJA 5ITFA 1VSCA 5HHOD 1Y6KR 2W0KA 2BVOA 3T77B 2RCSL 3LEXA 2D0GA 3X3GL 1D6VH 1JGVH 3DO7A 5IT2H 4U6VH 2NNAA 4H5SA 3ARFB 1ND0A 4Y5VC 1MQKL 3WMSA 3LKOA 1FG2B 3ARFD 3TZVA 3MTRA 3QG7H 5I1AB 3X3FH 1BLNA 5D1QA 4KJQC 4PJBB 2XWJB 2NTFA 4NYLB 4OUUA 5D72H 3X12B 1MAJA 3BSZL 2R56H 1P4BH 3HC3L 3WL9A 4LPWA 3ZSSA 1XF5A 1OCWH 1OAQL 1X6NA 1PYWB 2EDHA 1AGFA 1BFTA 1VGKA 5ID0B 2BDNH 5BVJA 1J87A 1MSPA 5D70H 4R96B 4L3AA 4G8EB 5JW4Q 4M03A 4MAYB 3KPSA 2QQKL 1KBGH 4XI5D 4MAYD 3MRKB 1GOHA 2DB8A 4FFZL 4KHXH 4Y4KA 1FYTD 5JHDB 1N59B 2LTQC 3H0TB 3D85B 2NY4B 5F97E 4FQ1H 4LNVA 35C8H 4PJIE 1S7QB 3ZKMC 3ZO0A 4YHML 5JHDD 1NCAH 1R24B 2A6IA 4XGZB 3D85D 3KVQA 1PG7W 2M26A 4OLXH 3FFCE 3N06B 1PY4A 1OM3L 1F90L 1IAIH 2FGWL 1FN4B 1PSKL 4NWUH 2R23B 2GJ6E 2GY5A 2JB6A 2Z4QA 5KSBB 1RFDL 1TIUA 4OGAC 4AM0A 4HIJB 2DQJL 2MTPA 2ZKHH 1HYSC 5DRZA 4C57C 1YZZA 2F9BT 5IM7A 5KVGH 4YUEL 3BRGC 1BOYA 3FQRB 2BNUB 5D6DA 3WHXA 1A9EA 1F8TH 5IFAL 3ZE2E 5ADOH 43CAA 5DRXB 3IKCA 3LQZB 1ACYL 3D18A 5EU7C 1JZ4A 3UXFA 5EDXA 3VFTA 4YAQB 4YNYB 4XAKD 4L8SC 4J3VA 5GS0L 2QEJA 1PEWA 5LBSL 3Q3GB 3E2HB 3RVTD 4XC1H 1QBML 1NMBL 4P2QD 1BVZA 2DM4A 4FTVA 3KNBB 4JFPA 5FYLD 4BH7A 4OLZH 4NQSA 4K3JL 2DI7A 1IM3A 2DF3A 3QO1B 4HMEA 4K3EL 4GKSA 3MROB 1IQWH 5MI0B 3BI9X 1X5IA 2AJYH 4MXQD 4FG6D 3ZSTA 1F13A 4LQFL 5GRUH 3G6JA 4PJ8A 3CH1A 4JVPA 5FFLA 3SN6N 3KPLB 4R4BB 4FZEL 2R1WA 5EOTA 3KLAB 5I1JL 3O6KH 5SWSE 5C1MB 3SDDC 2D7QA 3MUZ1 3FQWA 4ONFH 4YPGB 4PRDA 2GTZA 5F7FA 4MB4A 4I0PA 1FZKA 2JJVA 4LF3B 2BY0A 1A6UL 3ARPA 5BRZA 1S7SB 3T3PF 4F9PC 1SMAA 1JHTB 5F6HJ 1CT8B 4NNPH 4PJXF 4ZAKB 1A4JA 3V4PL 2W07A 3BKCH 4Z0XB 4MDIB 5BV7B 5KVFL 4O9HL 1XZ0A 3IDNB 3ULSB 2KBGA 1RZGA 4GRMA 1B0GB 2PTVA 3M1BA 1NJ9A 1TCRB 4DVRH 5IMOB 1FL3A 2GT9B 2Z31C 1L0QA 2A83A 4PJAA 1U9KA 3FB7B 3QDGE 2FJGA 4D9LH 5F6IB 1I8MB 1OTSC 2ITCA 1ONQB 4NN7C 3ALWA 1UWEH 2EIZA 5IW6A 2ZSWA 4NRZB 3N85L 4LOUC 5DEFB 2BVQA 4P5TA 4OFIA 1FE8H 1G9NH 5FYJL 1F4WH 3QPXL 4J3SA 4JEGB 3RWIB 1BQSA 2XTJE 4GXUN 5GGTA 4NHUB 4XC3L 3L5IA 3L95B 3LKSA 5FO7A 3GMLA 4TTGA 1D5XA 2ICWI 4JVUA 1K8IB 1V7NH 4CBPA 3T8XA 3CVIL 1MCQA 5B39G 5IHUH 1OAKH 3W11D 1IKFL 3H42L 1KJ2A 3WO4B 5GGQL 5D7JB 3KPQB 4M7JL 3UJJL 4OBRA 3EYFB 3RVWD 4CVZB 2E7LC 3KG5A 3LQAH 1KJ3H 2V9TA 1Q72L 5AD0A 3VRIA 1LGVA 3WDIA 2HN7A 3OB0K 2JK5A 3RNQB 2H26A 3AU1B 1A6WL 1HWHB 3GNMH 5GGRY 3GSOB 5KANI 2YPLE 1TDQA 3H9SE 2PYFA 4PJ9C 5EIQA 5HSFA 4HXAH 4KKAD 5F96H 2HT2C 3MX0A 4B53A 1A3RL 4HLZG 4C59B 3NPSB 3U30C 2OP4L 3C60D 4L1HA 5DMIL 4XNXH 3MLUH 1N6QL 1CFTA 4J1UB 4LCYA 5I1DA 2DDQL 4F7PB 2V17L 1CICA 5DJDA 1H3TA 3QFJE 2YEZB 4N90D 1FP5A 2EE6A 3BP6B 3FT4A 4Y8AA 1IL1B 2X89A 1UEMA 4JDZB 4ZO8A 4GMSH 1IQDB 3GUTB 3WIFB 2CIKA 1UZ6E 2H2SD 4WI7A 3DUUB 2MCPL 4R2GB 5FCUL 5M7QA 4KKLD 1J5OL 4DCQA 3FT2B 5C0BA 4OZHA 4EBQH 3UTTE 3VFOA 5D1ZC 1U3ZA 4EN3A 5HHME 3VXPA 1WBZB 4ZNEE 4IOFC 4XRCA 2DLTA 3EYQD 4YDLB 1K8DA 2G9HB 5D7SH 3NTCL 2YD1A 3VXRE 1YMMD 3GJFA 1MJ7L 2VMFA 1G7PA 3U0WL 4QOKA 2QQNH 3MV7A 4NC1C 4NZDA 4TN9A 4ZOEA 4KC3B 5CINH 4LDOB 4JDTL 3SOBL 1GVIA 4ZXBC 3VFWA 4NO0B 3RTQB 5FV2A 5D5MA 2HWZH 1EAPA 1H3GA 3IVKB 5DT1L 2BVPB 3CX2A 4NO0D 5BZDB 4KVCL 3RTQD 5DFVD 5D6CB 4KKCC 3ZE1E 1JZ2A 1F3RB 4LEXH 4WUUA 2HLFD 2MQ3A 1NEZG 2QSCH 1FJ1B 1HK6A 2KL6A 2OMBA 3CX5J 1T7WA 4HAGA 4Y2OA 1YDPA 4ISVB 1EX0A 3SY0A 4A6YL 3K4DA 4OZFA 3UO1H 2EDOA 4LVHC 5JQ6H 3EOTH 1NUNB 5EZJA 4Z8FL 3CMOL 4P23B 3OR7B 4YHKL 3WN5C 2Q7NA 1AKJA 3DURB 4BFBD 3ULVE 2X4OA 4JRXE 4KZEL 3WS6C 1MCWM 5T3XD 2M2DA 4QRUA 1SQ2N 1DFBH 3O6MH 1MH5B 3DETC 2ZJSH 5CSBA 4FXKA 1HHIB 3N0PB 5KVEL 4M7KH 5I30H 2WUCL 4GS7B 3GSNH 1XR9B 4X6DA 5CCKL 3FFCB 4JFFB 4HCRL 3IAQA 4CVWA 5I73B 5HHXH 2YHGA 4JFFD 2GYSA 2HJKA 4X5LA 3V0VA 5C08B 1KEGL 4K3DH 1S9KC 5CKGA 5C08D 1DQQB 1OL0A 5DUBB 1QPXA 2GCYA 4YHYC 1LO0H 3UBXB 2ICWJ 3FFDB 1CFNA 1MCCA 1R5WB 3GKWH 2XXMB 4OTXL 3V5KB 5I19L 4LVNB 3I6GA 1WWAX 1JHLH 5GQBA 4J8RA 1SEQL 4OD2A 3VFRB 4ALAL 3REVB 4ZPVA 1R0AH 4WTWA 1X5KA 1Q8MA 5CILH 2FEDD 7FABH 1XGRB 3NA9H 2CDEA 4M1DH 3PHSA 3CNKA 2HFGH 5FA3B 4TSCL 2EO1A 1QLEL 2ZSVB 3E8UL 4GRWB 5E8PB 3EYSL 4LLQA 2M1KA 3RL1B 2WBJA 3R1GH 4HQQH 3QEQE 1M05B 3VGGA 1FSKC 1MHHB 4O02H 4P9HH 1FGVH 1HILA 4PRIB 2F5AH 5DJCA 3WYRA 5ITBL 5SWSB 3TJHC 4RMQA 3U0TA 2ZCLL 2KQNA 3NZ8A 4PRID 4O4YL 1JTPA 1UB6A 3IJYA 1RJLB 4GG6B 2J5LB 3UYRL 3Q0HA 1I8IB 2F54A 1EXUB 1GAFH 4GBXC 1XGTB 1B4JL 4M6OL 1U3HC 3G08A 5I15H 5D96C 4R26H 3RJDA 4O00A 3FMGH 1MI5B 1IGFL 1JWMB 3OKEA 3LEYL 5KSUB 3S35H 4HK3N 4WWKB 1MI5D 1J8HA 1GIGL 2NZ9C 2JJSC 1NBYB 1FRGL 1HOCB 3BPOB 1VKXB 3EDKA 3QH3A 3RKDD 4WWKD 3JV4A 4NM8L 4ZS7H 2Q6WB 4EUPB 4RSVA 3EAKA 4FQXB 1PY9A 4D3CL 4HIXL 4O2EA 3ZT5A 4BKLB 1CF8L 4FQXD 4NBXB 3GRWH 5ENWB 3WJLC 2W91A 1HI6B 2DJUA 4QRRD 4R0LA 4XCNA 2MHAB 3KDMA 5E99L 3K74B 4BSWB 3SGKC 4HULB 2BP3A 4OKVB 4QXTA 1T7ZA 4JKKA 1H3VA 2OX5A 1ZE3C 5FYKL 1U8QB 3HUJA 1F2QA 1KENH 4HWEH 5CBAB 1LNUB 5T3XL 4KZDH 1NMAH 1DQJA 4JZNA 5FO9A 2XTJB 4BH8B 2XNAA 1VADA 4A2LA 1KT2B 1T21B 4I77H 1Z9OA 3IF1A 4GKNA 3MUGB 4OM1H 4HV8B 3DGGA 5GSVA 3U0PB 1CLZH 1LP9A 4S1QH 4UDTB 1I1YA 4BFGA 1Q9WB 2NYYC 4GW5B 1OWWA 1YNLH 2O5XL 2CJUL 5INDA 1T5XB 4AT6B 3QO0B 1MRDH 1P4IL 3VFVA 4WIQA 1T1WA 1I1AA 2DWEA 2IH1A 1Y18A 1DUZA 3LS5L 4NBZB 3CC5A 3VFNA 5KZCB 5D1XA 1WBYB 5D7IA 3T3PE 1QO3B 1KTKE 2BNQB 1A8JH 2D7TL 3TT3H 4ELKB 5C0JA 3LRHA 2BNQD 3HZKA 4N1HB 4X0KB 4MVBD 3O81A 5ILTH 1BEYH 1MWAH 4XP9H 3ZDZE 4PJGB 4Z7UF 3TWCL 4XP6L 4YDKL 1MLBB 3SJVE 2RFXA 4WFEE 4NSKB 4RRPG 4GRLA 1WWWX 1U8HB 5EBLB 1EK3A 4PRNB 5D7LA 1F4XH 2VDKH 4JZOA 3D69A 1KG0A 1K85A 3QUYB 4OUOA 3IU3A 4X4ME 4CMMB 1IEAB 1T0PB 2F53B 4OZIF 5AWNH 3QUYD 4LPTA 3S96B 2AI0L 1D3CA 1G9NC 2NY7H 4DTGH 2F53D 2VDLH 3DX8A 1GXEA 4LCCA 5EBGA 3UCRA 3WFBL 4XNUL 2P47B 3RWJB 3DMMA 4DW2H 3RQ3A 3ULUD 5GJSL 4I3RL 3O0RH 1CXKA 5GGTH 5TPWL 3UTPD 1BFSA 4MQXC 5HHMB 1GGBH 4MD4B 1YEKH 4YXLL 4HEPG 4OGXH 4NZRH 5F89A 3VXRB 5T3ZE 1QFOA 3PWJB 5F9JB 3QXWA 3ABZA 4M8QA 1BFVH 1HN1A 5DD3L 5SWZA 1GCFA 2AKRB 1T3FB 1ZEAL 3I02B 5DJZB 4TSBH 5C70A 1FNSH 5IMLB 2H6PB 1AHWC 3EJYC 3FHAA 2UZYB 3L3HB 1BHGA 2HMID 4HG4J 3QIBC 1S9YB 4XZUB 3PDOA 5IQ9B 5CZKA 4OV5B 4TUKL 5DA0B 5GISH 2P8PA 4WO4C 1W72H 2V7HA 1QA9A 3QHFL 4CVXB 4TVPH 5T5FL 4DFIA 3F7VA 5J13C 3HB3C 5DI8A 5TQ2H 1MFEL 2KUTA 1AGBB 1IFHH 4LBEA 1QSFB 3ZTNH 1ADQH 3GSQA 4DZBB 7CGTA 1D5MA 3MRMA 2GSIB 4OIBA 1KYOJ 1QSFD 1S5HA 2P5WE 4JRXB 3PWPE 3U9PH 3EJJX 3FRUA 2DKSA 4UT6H 2NQCA 1FFNA 3MLYL 4Z76A 1XF1A 5IEHB 4HKJA 2SEBA 3UTSE 2EDBA 4MJID 3LKNA 2OZ4H 1E28B 4S0SD 3O9WA 1RIVL 1IC5H 4YXKH 5EZOL 4PS4H 5E94A 5B39A 4HZLA 4IOIB 1CZ8H 2IPKA 4DN3H 2A74A 4RDQF 4Y16D 5DK0B 1NMCB 1YEJH 3TN0B 1OQXA 1WCBB 1MF2H 1T4KB 1QLRB 1JYVA 1WK0A 1UM5L 5EORH 3TN0D 4QRQA 2FX8H 3RWEA 4CUCA 2C3VA 5ESAA 3VH8G 3GSUA 3O3EB 5CSZB 1P69B 3JTTB 2ARWA 3SQOH 4Z7QE 1DBBH 3VXSE 3QCTL 2DIAA 1U3YA 1F6AA 4LIQL 3ARDC 3NN8A 5I1LA 1B6UA 3LKRA 3CK0H 4U7KA 3IFOB 3OPZL 4PG9A 2NY6C 4PJEE 3OB8A 3UZEA 9CGTA 5C0AB 4HIHA 4XMKL 3LRSB 1Z9SA 5TDOA 3QQ9C 5T1DL 4XHQA 5C0AD 1K3IA 1XGUB 3OHXB 3P4OB 3B9KC 2EEBA 1QFWH 2X2YA 3O45A 5JPMB 3BUYA 3GK8L 3MJ8B 1XF3A 1S7WB 3WIHL 1JPSH 3UJIH 1ZVYA 4ODTH 5CD3A 5L2KE 5TDNA 1BQLH 5KG9B 3B2UD 3CSGA 1U36A 4LEOA 3WD5H 5HYJE 2PXYB 2XWBA 4RGNE 1WV7T 1SMOA 3ARGB 4WUKH 4QHMA 3GMQA 1INDL 4W6XB 3O11A 3ARGD 5E2WH 3U7YL 2HFFB 4QRSB 1NKOA 1FYTA 2R0ZL 1T5WB 4GLRH 1YY8A 2ED8A 1FVCB 2FSEB 1RZ7H 1NC4B 5DRNB 3OWEA 4OLEA 4XCYA 4PB9L 5BMFH 4KJYA 3OJMB 1E6OL 1DBJH 3PIQB 1EIBA 2UZIH 1R3IL 4ODHL 2VLME 2BSTB 3BPLC 4WW2A 4ZTOL 1SEBB 2UWEA 1BJ8A 1Q94B 3REWA 4XB7A 1I9JL 4PP2B 4LRIC 3PNWA 1AO7D 2W9LA 5HGBA 4JB9H 5E9DB 5EPMA 5FOBB 3KXFB 1IAKA 3CXDL 1ES0A 4HXBL 4ONHB 5E9DD 5SX5K 3OKYA 3KXFD 2I24N 4LKCB 2YA2A 4LLWB 3RP1A 4HUUB 1G1CA 1MJ8H 1IC7H 2AXHA 4YDJA 2R9HD 1NCBH 1EUTA 4PJDF 1NEZA 2YPVH 3BZEA 1U6AH 4UIMB 4Y4HD 4JO2L 5CWSA 3ARYA 2R2CA 4DOHE 1JUFB 1YEHL 4I48B 5IGXH 4YDIL 2X4TB 1R5IA 4DKEL 2VXVH 3QUKB 3TZVC 3WFDH 2HVJB 3MUY1 3EYUL 3RPKA 5I0DA 2NW2B 1IGIL 4JQIL 1JZ7A 3CCHA 3GMOB 4DUWA 1H15A 3DRQB 1CGWA 1G9MH 1CD8A 1I3GH 5DUML 1FZMA 1C5DB 4ZUTB 2NCMA 1HHJA 3SKJH 3OMZA 2K3TA 4AQ1B 5DD0L 2VZSA 3ECBB 5CS7A 2PF6A 1CXIA 5EUKB 2YUWA 1BVKA 4JY5H 5IJVA 3L7EA 1XF4B 3DX7B 1UVQA 3MCKB 1DEDA 4PJXB 5ESVB 1NH6A 5FECB 5A3IC 3D3VA 4B7LA 5F93C 5IFJB 3K1DA 3L3JA 4Y4KC 4PUBH 2IMNA 1QSEE 1PX3A 4FQHB 3BZFA 1YMHB 2CR6A 5T1LB 5DTFA 3SJVB 2Y9RT 4F15B 4QHKI 3C08H 3KJ6L 2XPGA 1MUJA 1DSFL 1DUYA 1IEBA 4U1HB 5TF0A 4OCSL 3IKKA 4KH2A 1XH3A 2J8UA 3MNWB 3KPPA 1BD2E 3HZYB 2DI9A 5AG9A 3ZHDA 4HJJL 1PQZB 5D6DC 4G6KH 1FL6A 4RIRB 5FK9A 2XRAL 3OAYK 4R6UA 1WFOA 1IAOB 4LSQH 1IGCH 4CDGC 4R90L 4A6YA 5GRJL 4WFGE 1X5HA 4L8BA 2A73B 5JA8B 3PE9A 1YJDC 4MJ6A 2IANA 2OL3A 5HI3D 4MS8C 4JJ5A 4JG0H 5DMKA 1W8OA 4JM4L 3L3KA 2NY0B 4PTUB 4XH2B 3FO0H 3IDGA 4HFUL 2NY0D 3P4MA 1D9KB 2VDPH 2FHBA 5BS0B 3ZMRA 5HPOA 2E7MA 5JXEA 5L88H 4XXCA 4PJ8C 1D9KD 5BS0D 4ODUA 3DTXB 3ZT6A 2PW2B 5JLZA 5FA4B 3G5YA 3MCG1 5HY9B 1OGAD 5F7DA 4HF5L 2H41A 2AV7A 4JLRA 2DQDH 1L7IL 3K80A 1J0ZA 1RSFA 3LKQA 3WEXA 5F9OL 2EZ0C 3NIDF 5GXBB 3MBED 1HCFX 4X6EB 4KTEH 2E9IA 1OLLA 5DJ2A 1OSZB 3QDJE 4DKDC 4MCZB 3C60A 2BHYA 5C0GB 1UXWA 3QUMB 1S7TA 2Q86A 5F9AC 3VGAC 1HH9A 4J3OC 3DV6B 1T66C 4EXKA 3FN3A 2XA8L 3RIAF 2Y6SC 4CKVX 1U8IA 3PWPB 4MSWA 3MREB 3MRPB 1J0IA 5DO2C 4XNZC 3PGDB 5DEZA 4NO2A 5HI5D 4PLOB 1X5YA 4EI6A 1DQML 1Z0NA 1UGNA 1VACB 4Y4FB 1V7ML 3MGTA 1Y0LA 3QEHB 3D2UB 3MJ7B 4Y4FD 1C5CL 2HG5B 4QXGH 1BVLB 4U1SB 3QFDB 3D2UD 2DM3A 1UWXH 5CUSH 1CFVH 3TH4T 4OFVA 1DR9A 1NAKL 1MVUA 1IT9L 3CFJB 3LSOA 2EIBA 4JAMB 1DQLH 4ODWA 3CDGA 5GRZA 1C5BH 2R29H 1HSBA 1JNNL 4QHNB 2EKSB 1N4XL 1ZLUK 5LAXB 1P5UA 2MKWA 4E5XB 3EOBA 1MRFL 4NFCA 1JK8A 1T0NA 1OD7A 1ZT4A 3TBVB 3MPCA 2FB4L 4NZTL 1CD9B 2WSKA 4PJEB 1W8NA 3B3IB 3GMMA 4NJ9L 4YBLC 4Z7VA 5JOFA 3VCLB 4WTZG 5CEYA 5CMAB 5C0IA 1PLGH 5EC1A 3OKDA 8FABB 3MLTB 4YK4B 4NQXB 3O6FA 3OGCA 4DN4H 5IG7A 3EBAA 4KK5C 3MSPA 4RRPA 4JGUA 4AEIL 1YPZF 3P9LA 1J11A 3SPVB 3WXVL 1F58H 3BGFB 2FJFA 1B0WA 5EBMB 5CJQH 1RMFH 3D25B 5LQBL 5HYJB 4EDWL 4MX7B 1BBJB 3OR6A 4RGNB 4F58L 5HGGS 3DJ9A 1U2HA 3LN9A 1CICC 3SCMB 2X4PB 3FO1A 2G2RB 2A38A 3BIKA 1ZS8B 4WDIA 4UNTA 3SCMD 2F74B 1J10A 2CGRH 5IBLD 3HR5B 4PD4J 4QHKJ 3CVHB 5DJ8A 3F6LA 1OSPH 1SJEA 1RURH 1MVFA 3IETA 4FS0A 3T0EB 5GS1B 2IC2A 3VG9B 3RPIB 1TZGL 2P8LA 3T0ED 4IHOB 2G60L 5GGSA 3GIVB 3BP5A 1HKLL 2PTTA 2XKUA 2ADIA 3O3BB 4Y88A 2XYCA 3GHBH 4RFEB 2MMXA 1D5BA 5JUEL 5I1EL 3SGEI 3VU2A 4EN3C 4V1DA 1BM3L 3MRNB 4CNIA 1GZPA 1TZIA 1I1CA 1EGJL 5E24E 3FQXA 2IQAA 3PABB 4JZJC 2AEQL 3VFPB 1DL7H 1G7LB 5FF6A 3B5TA 4AH2B 1IMHC 3SKUD 1CFSB 2VUYA 3Q1SH 4X5XB 1HH6B 2VLLA 3LD8C 3L9RA 5IMKB 1MCOL 1J05A 3AB0C 3A6BH 3ZKXC 1AY1H 4UTBL 1FVEB 2F15A 3TBSB 3IGAB 4JRYB 3VXMB 4OV6F 5FHAL 1KCVL 4FQLH 2I07A 4JRYD 3VXMD 3ARBB 4EKXA 4NWTL 3VRLF 4F7CA 4NCC1 4HUVB 4ZUWB 2YKLL 5D8JL 2W38A 1R3LA 3T2OA 2OTWB 2R2EB 4W6YB 4MXVE 1EBPA 4NKDB 4DVBB 4JR9L 5F3BB 1AQDA 5I1CL 3T2NH 4GKOA 1AD0B 2E5EA 5JW4R 5E4IA 2LABA 4Y5VB 1UB5B 4QRPE 5C3TA 4F7MB 4UT7H 1OHQA 2FX7H 2UYLB 2VDNL 2VXQH 3IXAA 4UAOC 1BP3B 4AK1A 4G9FE 3VH8A 1KXQE 1U8PA 4U6HB 2EC9T 4UOW1 4Z7WA 3H42H 3JWOC 1NC2B 4UTAL 5IFHL 1T2JA 2MPAL 2PTUA 1I3UA 3DBXB 2W60B 4PTTB 3IFLL 2GFBB 1G6RB 2I5YH 2CMRH 3EW3B 4FRWA 3GDBA 2Z92B 2CLZA 1U3JA 3D9AL 4KUZL 1Q72H 4R3SB 1II4E 2PW1B 2DQIL 4JFXA 2EKJA 5MP6H 1WC7A 3BEWB 2QADC 3VFSA 3ORJA 4KXZH 3D39A 4Q9RL 2Z8WC 3K0WA 5E2UL 4P3CL 2KZ1B 5IHBA 1LK2A 4XAWH 3L5WB 1OTUC 4G7VH 1JPGB 2LTQB 4CN6A 2BCKA 3RZCA 2P45B 3B2VL 2BFVL 2ICCA 2CUMA 3JWDH 1JF1B 2QR0B 1N6QH 3LPWA 4JFOB 4QCIB 4M62H 1NGQH 1KXVC 2B1HL 4APQA 4Y5XA 2VKWA 5FYLH 3T09A 3OAUL 1KFAH 1A1MA 2DBJA 4ZFFB 2C1PB 4ONGL 4U0RC 3GBNH 3MNVA 4FHBD 5C6TH 3HI5L 3PWUB 2WBJC 2XZCH 4LCIL 1KCKA 1VDGA 2ZPKL 4PGDB 1QLFB 2GW5A 5FCUH 2A9MH 4H1LG 1GZQA 2V7NB 4Z7UB 4L8SB 4KRLB 1FFQA 2AXJA 2YD3A 4PGBB 1C1EL 4M61A 2H9GA 3QDJB 1ODAA 3TBTA 4PGEA 4X99B 3VD5A 1JNJA 1IGYA 2FGZA 5CD5C 3W0WB 1AJ7L 3FQUA 5TE4L 1A7OL 2VJXA 3PL6A 5DDHA 1JZ6A 3W0WD 2NY5H 3ARSA 4HS8L 4O51B 5EUOA 4OZIB 4NQVA 5B3JF 2CK2A 1ZHLA 5AZ2L 4C4KT 3BDBA 4JDTH 1ZSDB 2IF7A 3HN3A 4JANA 1ZHKB 5KTEL 1PGRB 4R0LC 1KJMA 1MFDL 4I5BA 4XMLL 4MNGE 4RMUA 3GBMH 3STZB 3SDDB 2FDBP 2J88H 4Q97A 2YD7A 4Z9KB 1CD0A 5CJXA 2XN9D 3SDDD 1LDPH 3ES6B 1CLOL 3WIHA 2VLRE 5C9JA 2AK4D 3B5GA 3EFFB 5INCA 1HQ4A 1M71A 1T83A 4I9WE 5F7YC 4BM7A 3MO1A 4O2FB 1CE1H 3ETBF 4G6ML 5ISZE 3VDAA 1SJXA 2C26A 3K8KA 4LCWD 4U05A 3QNXA 3U7WH 3BKML 2OL3H 2V6HA 2D3VA 2NR6D 4OLYH 2YK1L 3W9EA 2GHWB 4GXVH 3PWVB 1MNUH 5DVKA 3U1SH 2LVCA 4R8WL 2Z31B 1QKZH 4JY6B 2QSTA 3IDXH 1BIIA 2AJZB 3T65A 3O6LL 5IW1A 4NN7B 25C8L 3WLBB 1LO5A 3G5XB 4E41E 4YBQC 4D2NA 3VDBA 2VLJD 5E95B 5D1XC 3WUZA 3FOMA 4E0RA 2YA0A 3V6ZB 1TVHB 1NBZB 4ONOA 5DHXB 5CCKH 1Z2KA 4G6JL 4RMTA 2BRRL 3M07A 2F58H 5IVZA 3WCYA 4LOUD 3CXHK 3MRLB 5BZWA 1YN7A 5KVDH 2W9DL 4HC1H 1I1FB 2BMKB 3MOQA 4JKWA 3B83A 1IEHA 1J12A 3QIUC 3H9YA 1FC2D 5MHSD 1HIMH 1RIUH 3QJHA 5HD8D 4XPBH 5E08L 1HINL 4XVJL 4P3DB 4RZCB 1DZBA 1W0VA 1OAUH 5TDPA 3GMNA 4JO4H 3I6LE 3OX8A 3HNVL 4ORZC 3VFMB 4L3EB 4GRLC 1CIDA 3MJ9L 2VISB 5ESQA 3KPMB 4GAGL 5I66B 4FMFA 2DQTH 4P2OC 4ZOAA 4L3ED 2IBBA 3HZMB 2UY6A 1MJUL 1G7JB 5IVXA 4NP4L 4ZD3H 4P4RA 3VE0A 1X4XA 3G9AB 2X4NA 4LLYA 1NAML 4YR6B 4MJIA 3NMEA 3MJGX 5I75B 1YEEL 3G6JF 5E1HB 3RY5A 3K4ZA 4RFNC 4PJ9B 5JZ7D 3MUJA 3QWOB 5DMYA 4FQJL 1LO4H 4Y16A 3QNYB 1LEIA 2VL5A 4JHWH 4HKZB 3MLVL 1F2XK 3U30B 4YFEA 4S1RL 4ESKA 3VDCA 2C4FT 1IAII 4KAQL 5EU3A 3C6SB 2XT1B 2X6MA 3PQYD 5IJKC 1FZJB 5D4QA 5E8DL 2OJZH 2UVEA 1JIBA 5A2LH 5KSAC 4IDJH 2AXGA 2ITDB 5A16B 2X4SA 1ZGLA 2Y5TA 1EEUA 4H0HB 4KMTH 2R0KL 1DCLA 3ILPB 3E6HB 4U6YB 1CCZA 1CVSC 1Z9LA 5TJWK 3VI4F 5JQHC 3O4OC 4OLWH 4XCCH 4YHZH 4YH6A 1JFQH 1AXSA 5ALCH 4JFQB 5DXWA 2CUHA 3LEYH 2OK0L 3H3KA 2J12B 1UKQA 1U91A 1A7QL 5DLML 4PJAF 5LGKA 2EIEA 1P4LB 4NM8H 1E27A 2APTA 1GYAA 2EDYA 3FCTB 5I1IH 5D1ZB 3TPKA 5HXMA 1KCSL 3H8NA 1QHOA 1GGTA 5EOCH 5LGJA 4IOFD 3T4YB 4JPWL 3RWHB 5FO8B 4U1IA 1KCLA 1H3WM 3WSQL 2NY1C 1KNOA 2FX9H 2IQ9L 3ARED 4KKBC 5JOPD 3HMWH 3RX8A 3JZ7A 4HWZB 4Q9QL 3MUHL 2C9AA 3EO1B 4ZXBB 1B0RB 4OZGE 2GSGA 4QRPB 4PG2A 2B2XH 5DD5H 4ZQKB 5DQDL 3ZZ1A 1OP5K 4X4XA 3D87B 3OJDB 4F3FA 4PV9A 3O9WC 3VD3A 3I50L 3IXTA 4G9FB 5DGRA 3BX7C 1DLFL 3BHBA 1NDGB 3O41B 2YSSA 4V2CB 5IV2A 4HIIA 4S1SH 4E9LA 1P4IH 1HHGA 2QQLL 3BT2H 1AO7A 1KN4L 3TVMA 4LVHB 4BELD 5DC4B 4PJDB 2H32B 1YECH 2BVYA 4WHYG 1RZIA 3HCVB 3KPRB 2NTSP 3P2TA 1U95A 4PV8A 5GZOC 5IESH 3WN5B 4WTZA 5F7UA 2FBOJ 1WISA 3VMOA 3KPRD 5GJTL 4G43B 2Q7YB 3ESUF 1CU4L 1QP1A 1RZFL 3KHQA 4QXWA 2K7PA 1X7QA 4Y4HA 5IB4A 3LB6C 1LK3H 1CLYL 4CN1A 3Q5TA 3ZTJG 4JPIA 1HSAA 3V6FA 3DETD 3CX5K 2YWZA 3QG6B 4LSSH 1R3HB 4H88H 1CDCA 3QQ4A 4HK3J 3WXWL 1AQKL 2HRLA 5CHNB 3ZT7A 1H8OA 2NW3B 3AS3A 1U92A 1E6JH 4O5LL 1EA9C 3KYMA 5IB5A 4GRWH 4RISH 4U3HA 4YHPA 3UTOA 2YC1B 3RA7L 4YHYB 4OZHF 1A2YB 4J23A 2Q8AL 1DQDH 3NIFF 2ICES 1T22A 3IJSA 4KDVA 4GG8B 2IALB 5GS2D 5I17B 3STBA 4XI5C 4MAYC 1WFNA 4H25A 1AGEB 4XCEA 5DQ9A 1F4YH 3BIBX 4PB0H 1FNLA 4KV5F 4RQQA 4YZFE 2EXYD 1ZLSL 4H26B 1JGDA 3IDYC 2IGFL 1UJ3A 3VXQA 4PRHE 1IAIM 3KAAA 5DF0A 1RI8A 1A3QA 2LU4A 4LSVH 1IGJB 3GIZH 3ROOA 3S88L 1YYML 1QEWB 5D5MF 1G7MA 2ZOKA 4WW2C 4XPFL 4AL8L 1F45A 1MCWW 2VXTH 1X5AA 5DEGA 2OR9H 1EH9A 1FSKB 3QEUA 1ZTXL 4CL7A 4NQTA 4K8RL 3O2DL 2BOCA 1FGNL 4JFEB 1HKFA 32C2A 3TV3H 3GB7A 1JGEB 1CR9L 3DLQR 1QRNE 3SDXA 3MBXL 4JFED 3MV9A 4OF3A 1WF5A 4XNMB 1QFUL 3JVGA 4GBXB 1TJIL 3TJEH 1KJVB 2CKNA 5D96B 1P9MA 2Y1VA 3G5VB 3BXNA 3JWDC 4KHTH 5EO0B 4WCYH 4L4VE 3RVTC 1A3LL 2XWTB 4UV4H 1RHHB 4Y89A 4I0CC 3E2HC 3CLFH 3OKNA 4RNRA 4OF7A 3MV8E 3C2AH 3LN4A 2H2PD 1DP0A 3MRBA 4MXQC 2DLFH 4FG6C 5K9JH 5ALBH 1L6ZA 1P2CB 1U8MB 2WBKA 3K1KC 3R06B 2DTML 4L3CB 5H2BA 4M02A 4GQ9L 4X6DF 3ZDYF 1A6TA 3MXVL 3RRQA 3IDJA 4NO5A 4ELMA 4E41B 1OGAA 1NGXA 4D9RE 2ENYA 1A14H 5TE7L 3A67L 3TBWB 2B5IC 4JG1L 1Q9KA 5IIEB 3MBEA 5KSVB 2K7QA 2J8OA 3MRFB 4BZ1L 4NM4H 3NCJH 2VITA 2VAAB 3BN9D 1MFCL 3PXHA 1VFAA 1J1XH 5C86A 1UEYA 5HHQA 1E4XH 1I3RA 1EGJA 2P5EB 1EEZB 2VO5A 4PRPE 3ZL4H 3B43A 4JE4B 5A2JH 1ZVSB 2P5ED 2GITB 3D0LA 2NY5C 5HHPB 2EDQA 5HDBF 4FFWD 5KW9L 5EU4A 2NYYD 2R1XA 3ZLQC 5B8CA 4JN1L 1C7SA 1FNEB 2AJSL 4NQED 2EH8L 5J3HD 1TPXC 4ZTPH 4BSVA 3UBXG 2P48B 4L4TE 5CEXB 2AABL 3IDMA 4NOFA 1CBVL 3HPJB 4XP5L 3ET9F 3F7RA 3OKOA 5F88A 3HE6B 5JIKA 4GSDL 2OCFD 1XFPA 3KPSE 3HE6D 2GKIA 4POYA 4JO1L 4MJ5B 1BZ9B 2I26N 1FH5L 4OCWH 1F4HA 4OSUL 3O2WL 2D03H 4WNQA 3ULUH 3DX9B 4WEBL 1INEL 1YEDA 1MHCB 3FTGB 3GMPB 2O61B 3L6FA 3W11C 3MLZL 3L3OB 5C0RL 3TH2T 3Q6GH 3E3QC 2JIXB 3DSNA 4H1LA 3MRRB 3MLPA 3U7YH 1S9XB 4HKXA 3RVWC 1ED3B 4DKFL 1XCTB 1UCBL 5JXEC 5C0FA 5IOPB 2JIXD 2M8XA 2R2HA 4XXCC 3I2CH 3FOLA 3MRHB 1QBBA 4G8GE 3T4AB 4M7LT 3EYOA 2BNRA 2R0WH 4AQOA 3FHQA 1YPZB 2HT3C 3KWWA 4OF6A 4BFIB 4G8FB 2XZAH 1P7QB 4MZ2A 4GKZA 2DTSA 5ICXA 2EE2A 2PCPA 1CK0H 1P7QD 2OR8A 4QNPE 4LU5L 5HGDB 4I18A 1S7XA 1EFQA 4P5KB 1Q0XL 4XTRD 2BC4B 3PJSB 3C60C 4JKPL 3OQ3B 3HHRB 3GEWB 3HUJF 1EAJA 3W2DH 1EV2E 4AENA 4LMQE 2EDNA 4JFYB 1MHEB 1XEDA 2QHRH 1NBVL 4QHLB 1K5NB 3WUWB 4PRAA 3V5DA 3NIGE 5IR1A 5CP7A 1RZ8A 2EO9A 1S9VB 5GPRA 3LHPL 1RZJH 3DHJA 4WU5A 4YLQT 5J9PA 1AHWB 1TVBA 1LP9F 4QXUL 5K9OA 1J8KA 1ETZB 2AQ3A 2XQBL 5D2NE 1T7VA 4DKEH 12E8L 3QDME 3EJYD 2H2SC 3GHEH 2PO6A 2QQQA 3CFEB 3O3DB 3QIBB 4G6FB 4KKLC 4EZMA 1SM3H 4R7NA 4LPCA 1OAXL 2X1QA 3C87A 4EVNA 4YQXL 3QIBD 3QJFB 2OJEB 4K2UL 4G6FD 3TO2A 4NRYA 5F1SA 4KRNA 3JUYA 3FZUC 5C6PB 1RU9L 4WVRA 5J13B 5FKPA 5BRZE 5AYQA 3HE7D 3QEGH 3HB3D 4WWID 3EYQC 1YNTB 1NLDL 5ACZB 4N5EC 3VI4E 3P9MB 5J6HA 1G0DA 4YDLC 5DJ6B 4NRXB 5E1AB 1T2QH 1UQSA 1F11B 2R1YA 3P0YL 1LQSR 4LSTH 4YE4L 5EO1B 2X70A 5H94A 1KCRH 4HBCL 3RTQC 2NLJA 5DFVC 1WFTA 5FGSA 3IT8D 5C0CB 4G80A 3O6FC 5I8OL 2HLFC 1F3DH 2ILLA 4UILL 3NGBB 5I1HL 4ERSH 5C0CD 1FFPB 1VEPA 2IAMA 5E8OB 4MA8H 4KVNH 1N7ML 5IUSA 4WFHE 3U36B 5IHZA 5K9QI 2ZOLB 4OLUH 4WU7B 5E00A 3VXTB 4PFEA 4KK6D 4LMQI 1T1XB 4NJAH 4Z0BL 3F5WB 4YAQA 4ZG1A 2ADJA 3FQNA 4X9HA 3ULVL 5ANMA 2L4OA 2WIIA 4LLAA 3ARDB 3U6RB 1KLGB 3TNMB 1KN2L 5J7CC 1MOEA 2ADFL 4K94H 3TCLA 3UPAA 2IPUK 1P1ZB 2NY6B 4G5ZL 3CDYA 2BOBB 5AZEH 2NY6D 3OXSA 4HUXB 4JQXA 2MWCA 1MCDA 2RHEA 1XCQB 3HG1B 1CQKA 4WW1B 4PRHB 4TVPE 5FHBL 3B9KB 1MY7A 1V3KA 1D5IL 2XKNB 2Z35A 3HG1D 5E7BA 2VR4A 3B9KD 1GC1H 4YHNA 3BGAA 4TOYH 3GSRB 1GGCH 3UPRA 4Y1AA 1BZ7B 1I7ZA 1CLCA 4F9LA 2Q76A 1NFDA 1YYLL 2G75B 2HLAA 4KUCF 2YN5A 4AEHH 2APFA 3GMRA 3PP4L 2H3NB 4JPKL 5C92A 1T0MA 3U4EB 1MCIA 1UACH 5CEZD 3P3YA 4HK0B 5J56B 1QBLL 3G6AA 3BPCB 3M17B 1I3VA 5HYQB 5CIPA 3Q2CA 2B1AL 5JIHA 3VXUA 1ZANL 1AP2A 1KIUA 2FEDC 3WS3B 1FO0B 4GMTH 4MDIA 3V5HB 5I8KH 4L4VB 2VDOH 4JN2B 2QKIB 3UX9B 1B0GA 1QYGH 5L7XH 3MJ9A 2D7MA 1PZ5B 2F19H 3HLAB 1JNHB 3LMJL 4OZHE 1OF2B 5EU5A 1JNLL 3A6CL 5HBBA 4U1MB 5T5NG 1M1SA 3C5ZA 3O2VH 1NAMA 3HRZB 2AV1A 3N1MC 1HZHH 2A0LD 4YX2H 1JI1A 3BH8A 4PJ5B 5D9SB 1FV1A 4LPXA 4TPRH 4OD1H 1KB5L 2B4CL 4PJ5D 4NQDD 4JKMA 5ITFB 3ZHKA 5MENA 3U4BH 1TJGL 3WNNA 4QOKE 5IEKA 2BVOB 3LEXB 1C5CH 1S9WA 4MQTB 3DO7B 1QD0A 4U7SA 2NNAB 4H5SB 5I8CA 3TO4D 5I18L 2MQCA 4IIQA 1ND0B 2QTEA 3T0DA 5DFTA 3LKOB 4LLMA 3BOVA 4ODXA 3TZVB 4KY1H 1BLNB 4DGIH 1WAAE 4J6RL 2NTFB 5D7JA 2AK1H 5D1QD 4OUUB 3RKDC 4WWKC 4S2SA 4P57A 1RVFL 4X9BA 1QACA 3MOAL 1OD9A 2EH7H 3O4LA 1VFOA 1LE9A 1N64H 3WL9B 3RNQA 2G5RA 1KGCE 1XF5B 4M43L 1QR1A 1AGFB 2HKFL 2IPUG 1VGKB 3GSOA 5AYUL 2W0LA 2KDGA 1A6VH 4FFYL 3EZ8A 2V2TB 5BVJB 2XN9A 1OGTA 3VI3F 3KPSB 5MEOA 4X6CA 2AK4A 1EEQA 4U1GC 15C8L 3ARXA 3WFCH 3WO3B 4LAQL 4I2XA 4Y4KB 4RA0C 3SE4A 3RZCC 1PKQA 1KCUH 1JN6A 4LCWA 1L7TL 1WWBX 3V8OA 1FNFA 4YDVA 3IU4H 2R8SH 4APQC 4Y5XC 3PP3H 3CPLA 3EDEA 2JB6B 2Z4QB 1AGDA 4AM0B 1JP5A 1F02I 4ODVH <