1QPPA

Crystal structures of self capping papd chaperone homodimers
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
214
structure length
207
Chain Sequence
AVSLDRTAAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLDPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPD CHAPERONE
publication title Structural basis of chaperone self-capping in P pilus biogenesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 39
structure length 207
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qppA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qppA01
1M4KA 3MV7E 3L5WB 3LS4H 5GRVL 3V5HA 1B4JL 4S1RH 1OB1A 3PG2A 4HEPG 4UINL 4PLNC 5C0RL 1G7QB 3VFOB 3F6LA 1A1MA 6FABL 1QSFD 1RIHH 2NY6D 1Z0MA 4CDGC 3BDBA 4L4VB 1MAMH 5HGHB 1N6QL 1A6AB 3P30H 5CINL 2OL3H 5IHBA 2W0LA 3RWHB 4LCCC 2W9EH 1G6RH 1IGMH 2H45A 2P45B 3T04D 2OSLA 2CKBB 4OFKA 25C8H 4NQSA 3IETA 5IR1B 2OZ4H 4K3EH 1OF2B 2VABA 1FNAA 3GSRA 4X6FA 3U82B 4QRPD 5JTWA 4CRPA 4EXKA 4NP4L 5F93C 1P7QB 3MCKA 4ZDHA 5DJAB 4RMRA 2WWKT 3O11A 4IRSD 1T20B 2FJGA 1X3DA 5CMAB 5T1MB 5I0DA 1JZ7A 4NZRL 1WWBX 4LLMA 3FQUB 4F15C 1I7TA 3EAKA 5E5UB 4DGYH 1YYMH 3KPSB 2I9LB 2L4OA 3MJGX 3ZSTA 1DUYA 3DRTB 4FQHA 4PGCA 4M1GL 8FABA 1INEL 4UU9B 3ME0A 1FZJA 4N1HB 4P5TD 3C6LA 1R3HA 4ZXBC 2YPLA 3OAYK 3W9EA 1A5FL 5C0BE 1FO0B 2DMKA 4ZAKC 4U6VH 2Y5EA 4X98A 4JZOA 3C5JA 3PDOB 4OF0A 3O6FB 5HVGB 4G3YL 4KZDL 5ITFB 1WTGT 2ARJQ 2V5TA 4XMKL 3Q1SH 4PUBL 4OLYH 5EU7C 4AT6B 1OQXA 4DUVA 3TBTA 4LCUA 3TBSA 5HHOB 1OW0C 3LQZA 2VDNL 3LS5L 1CE1L 4D9QD 4HLJA 3O41B 5DK0A 1RI8A 1XF4A 4LIQH 4JHBA 1QG3A 1FE8L 4NJ9L 4ONFL 5F9JB 1PBYA 2UV3A 3KJ4C 4M93B 1E4WH 4LEOA 2VLRD 4RDQF 3IDJB 4EI6A 3K7UA 3IETB 3C09C 5KN5A 2GKIA 1ONQB 1U95B 3RWIB 1FCCA 3FQRB 1XGUA 4XVTH 4P5MA 4MVBD 1A9EB 1ORSB 3LN5B 1UWGH 2VITA 5DDHB 4ENED 1A6ZB 3RVWD 3ZDZE 1U91B 1D6EB 1NEZG 3CZJA 4FTVD 1U8OB 3GO1L 4E0RB 5FA4B 4B53A 2NY4B 4UBDD 3B9KC 4LVOC 9CGTA 3JWOH 3P4NA 1H3TA 4XPFH 4DUWA 5B38A 5CBAA 4AL8L 4G8IA 1IGJA 1ZHLA 2OK0L 1A4KA 2C9AA 2AV7B 3DX8A 3VE0A 3VGAB 3VFGL 3NAAH 4GRMA 5GRZA 3T0ED 5E9DD 3MNWA 5KS9A 3G6JA 5J12B 3N50A 4UOJA 5LAXA 4HBQA 1MIMH 2NY7H 5I74C 5I1HH 1J0HA 4OV6F 3GBLA 3WKNA 1IEHA 4BFIB 1XGTB 4JFQA 4RWHA 1EEUA 3I75A 3OX8B 4I13B 3ZKXC 1AFVL 3SCMB 3N9GH 1NFDF 1UCTA 5FYJH 3TBTB 5FYKD 4LP4A 5KANG 4BK5A 1BD2B 1L6XA 4LPCA 2FEEI 4XMLL 3KVQA 4DTGL 3X12A 4HH9A 1S5HA 1ZA3B 3MXWH 1JV5A 4XC1L 3K3QA 3Q6FB 4CGTA 4LCIH 2DQIH 4JM2D 2X05A 1RHHA 5EU6D 2AV1A 1FFPA 3SGEH 3F8UB 4XCYB 3P0YH 1KJVB 3ARDB 3MUGB 1QRND 5D2LB 1TLKA 4MCZA 4KGJA 2JJWA 3BGFC 5IQ9B 5M94B 2OTWB 5IWLC 5L6YH 3KPTA 1F90H 2QQNH 1K3IA 3IU3A 2V2XB 4OCRH 4LLYB 1G7HB 1U8LB 4ODVL 4RNRB 5KZCD 3MV01 5T33H 5TF0A 15C8L 3DX8B 4FFZL 3ARFB 3CFJB 4J1UA 4OGXL 1NMBL 4PJFA 3GBML 3MNWB 4YDLC 3V0VA 5I75B 5CGYD 2D4DA 1CFTB 5LAXB 2APBA 3TM6A 4FXKA 4XBEL 1E4XL 1Q9KB 4V2CB 5GGVY 3QIUA 1EHNA 1KCSL 4KKLD 5CCKL 1EJOL 5D7LA 4JFQB 3ZE0E 3I75B 2C3VA 2VC2L 3MTRA 3ULVE 2X70B 5SWSB 2YA2A 4XCNA 5ACLA 3EGSB 4ODUA 4WFGE 3VXUD 3HC0B 3ROOA 5HHNB 1KJ2L 5GIRB 3X12B 4JFDE 1OGAB 1W72L 4U1LA 2IBBA 1NBZA 4MCYA 2R9HC 1M6OB 4KV5E 1JZ6A 1R5WB 5SX4I 3NMEA 2DQHL 4Y19D 4HJGA 3VGDA 1KB9K 1DBJL 1LE5B 5FO7A 3LPFA 4P46A 4GKOA 2EO9A 5EBWA 43CAA 4X5LA 4MCZB 2R1WB 4QTIL 3DLQR 1CLOL 4HJ0D 1T04B 4Y5VC 4RFOH 2NPLX 5CJOL 1HWHB 1LEIA 2DM7A 3GSOA 5IFHH 5DMJB 4NNYB 4P2OC 4ZUWB 4PRHE 2NY3D 3LRSB 4YLQT 5IT2H 4EIZC 3PGCB 4LMQI 4NBYB 3C2AH 1CDUA 4PRPA 3CMGA 1S5IH 4P99A 4KDVA 3LSOB 1CYGA 2AI0L 3D69A 4KRPD 3T2PA 2IANB 2DQUH 3QIUB 3H9SA 4GAYB 1QZ1A 4YHYB 5L2KA 1SBSH 2Z31C 3DX6A 5D7LB 1FVCA 3QG7H 5E8EA 1H3WM 5JUEL 3Q3GA 3CVHH 1YQVL 4WU5B 4EOWL 1X5JA 3CC5B 1CD1B 5AAMA 1FYTD 2V5YA 1UM5L 5IQ7H 5EDXA 3AC0A 3NA9H 3UTZB 2ZKHH 3WN5A 1K2DB 3HR5B 1YPZB 1T2QL 2P5WB 3GSNA 3ZLQC 3NBNA 5DRZA 3U4EA 4K23L 2H3NB 4HPYL 4KROC 2VYRE 3D3VB 4PP2A 1ZMYA 4LLAA 5ILTH 4Z76A 1P84J 3MSPA 3TN0B 4RRPG 4X8JB 1FG2A 4DUXA 1QR1B 4PJ9A 3CLFL 2VLJA 3JZ7A 2JJTC 3DO7A 3CSPA 2ADIB 4FQLL 3DXAE 5L9DL 4S1SH 1C08B 5GGUB 5GHWH 5JXAH 2FIRT 4NUGH 5B3JE 2EYTA 5EUKA 4LSPH 5DWUH 2F5AL 2WBJB 3FQTB 1V3LA 4M5YL 4MA3A 4WEBH 5GGSB 5FO9A 1FL5A 3O4LD 2ITDA 3OKLA 1A9BB 3ZDZF 1L6ZA 2H2PC 4PFEA 3B6SB 3L5HA 3TT3H 4PJXB 3X3GL 1KOAA 1M7IA 2IBZY 1KBGL 2XN9E 5D6DC 1ZWIA 1KLGB 4S2SB 3DYOA 5GGQL 5L2KB 1HEZA 4M1DH 4BSJA 3U30B 1RULL 2IPTH 3RVUC 1ZGLB 4MQ7A 2Q6WB 1U6AL 5JNYB 1K4DB 4LARL 1TCRB 3A67L 4IS6B 4LPUA 1AGEB 2DL2A 5TDNA 1EEQA 3HNTL 3S36L 1RZJC 4ZYKB 4XC3L 1U58B 2JJVA 4YFEA 4HK0A 4TULL 2DQEL 1WEJL 5C0FB 3JV6A 4NWTH 5DXWA 4D9RD 1N4XL 3SGDI 1UADC 2AXFB 2W0KA 4KKBD 3GHBH 4Z7VF 1DFBH 1U36A 2EH7L 3LRGA 4P2QE 4WTWA 2D0FA 3KWWA 4GRLD 1D6VH 1G7LB 2FIKA 1D9KC 2BSSB 2AEIT 4U6YA 4KJQC 4NDMA 3T0XA 1FG2B 3OB8A 1MH5A 4I2XB 2MKLC 4N8VB 3V79C 1QFUL 2WUBL 1KGCD 2ADFL 1DANU 3VU2A 1NCNA 3QUML 3T0DA 2BRRH 5EUKB 1FORH 4D9LH 4MA3B 1NEUA 3VG0L 2NTFB 2BX5A 4X9BA 4J6RL 2PXYD 4PS4H 5C0EB 3VD5A 4NFCA 2NXZD 2XT1B 4G8GD 5IGXL 3VD9A 1OP3H 3ARZA 4KC3B 4L4JA 4TNWK 4JZJC 3EOBB 3KYNB 1BIIB 4NO3B 1T1WA 1NCTA 1Z9OA 5EC1B 4YFLI 1FVDA 4XVUC 5DRWA 5J57B 5FK9A 3JWDC 3U7YH 3TVMD 1VERA 4JFFB 5IMMA 3RY6C 5DLML 1KTLA 3BEVB 3UYOD 4U6HA 2A6JB 2NXYC 4Q9QH 1Y6NR 1U8PA 1YN6B 1JPGA 5KJRH 1L0YA 3TA3A 1PW3A 3OKDA 4MWFA 3EFDH 4YQXL 1IQDA 5I8OH 3ZE0F 3BIAX 4X6CE 3S35X 1KV3A 3QIBC 1UACH 4EI5C 3CX5J 3WYRA 5L2JA 4NDMB 1GGBH 1CLYL 5I73C 1HHJA 2JIXB 2VE6B 3NVQA 5D7SL 5IHUH 4K7PX 1WISA 4E41D 1I3RA 1Q9WA 2X1QA 3FO0L 3BISA 4KV5F 3JV5A 3RWDA 4UB0H 3FMGL 4F3FA 5C0JA 3MGOA 5D1ZC 4P2RE 3DVNA 5DFVD 2K7QA 1AD0A 3OB0K 1AE6L 2CIKB 3BP6B 2N7AA 3G9AB 4K7PH 4UDUA 1UT9A 1QVOB 4ONGL 4RGMB 1W72A 4P49A 2E5EA 2V9RA 3LEXA 2VDRL 1XAUA 4RAVB 2VDPH 1C7SA 4Y16C 1HCVA 4RDQG 3V7AG 3UPRB 1U8MB 4GQPH 3AAZA 2NW3A 4MZ2A 3QDGD 2YWZA 5IFAH 4MDJA 3GMNA 1QLEH 1UWEL 4MJ6A 4U1SA 2HRPL 4LASL 4RGOL 3NFSH 1M7DB 4N5EC 5DD1L 3TA3B 3RIFF 1IQDB 3O0RL 1BREA 4LCCA 2B5IB 2OMNA 1K8IA 5FHAL 4YR6A 4HUWA 3O2DL 5FGSA 5GGTA 2F54B 3UROR 4L3EA 5D1XC 3K2UH 4MJ5A 3U1SL 1T5XB 5F9AC 4WI9A 4M4RA 4G7VH 1MEXL 5CKGA 5C1MB 2AABH 2BVQA 2YRLA 3G08B 3QCUH 1Q9WB 3G6AA 1J8HE 4Z8FL 2VLKD 4I18B 1YMMD 1VGEH 3S37L 3HAEG 4JDVA 4O5LL 5ACZB 1BLNA 5CD3B 4AG4L 5ID0A 1A3LL 4WHYH 5EO0B 2WANA 4YX2H 1AP2B 1KLUA 5TE6H 1P4IL 4WW1B 1KJ2B 2GSGB 2WAHA 5B3JF 3PJSB 4X8XA 5IBTL 3S5LG 4FABH 4ODBD 3LEXB 4NQXB 3SOBH 1FC1A 4ZXBA 4FFVD 2HJLA 4UTBL 1CBVH 1QFWL 4RSVA 5KSBA 4JRXA 4ZAKA 1MF2H 4JFEA 5AZ2L 1AC0A 1NLDL 2X1XR 1I1CA 1HHKB 1J5OH 2PYEA 2JJSA 4PGBA 5GS2H 1UWXK 4YR6B 4G6ML 1J18A 4HZLB 2NY6C 4D0DB 4RFNC 2X4PA 4ELMB 1JF1A 1TVHB 4U1NA 5IESL 1OAKL 2Q3AA 2QSTA 4L3EB 1OAXH 3QPXH 2VRAA 3M1BB 3ZTJG 3GJEA 4JKWA 1NUGA 5CEZL 5KVFH 4J7RA 4KRNA 1RZJL 4KK6D 3TPUB 1NJ9A 2C4XA 5IG7A 1IILE 4JN2A 3LEYH 5EZOL 1NLBH 3VXQB 3UAJC 4S0TD 3RL2A 1J0ZA 3STBA 2PF6A 3B9KA 2BNQB 3WFDL 5DS8B 4OZFG 4F15B 1JGUH 2ID5A 1AO7A 5KVEL 1DLFL 5ID0B 3PWJA 1RZ7L 2VXUH 1T7XA 5K9KB 4IRSC 2NX5D 4R97B 1KLUB 4WY7L 3K74B 1RK1A 2O5YL 1Z3GH 1AI1L 3RUGB 4NBXB 1S7WA 4KMTH 5KS9F 3G6JF 2CGRH 1DP0A 3QEQD 3T0AA 3VFVB 2IQ9L 3KPQA 1MHCA 4DGVL 1Q0YL 4ZXBB 3DUSA 4I9WD 5TQ0H 3BOVA 1F5WA 4LCWE 3MZTA 1WFTA 1ZHBA 1MWAA 4BQBA 2I9TB 5I15L 1XEDA 2EIZA 1OAYH 1E0OB 5MI0C 1DCLA 4PJIE 3KHQA 4J12A 3QH3B 4Z7UA 4QHKI 3KR3H 3H42L 3QQ4A 3QUMA 3TNNA 1CXIA 1PDKA 4UAOB 1BQLL 3U46B 4XP1L 3F65A 2VUYA 3O2VL 4N0YH 1NC4A 2AJUH 2X4PB 1UKTA 4HIEA 2IBZX 3LD8C 3TGXA 1TZIB 3C09B 3L6FA 3B9EA 1JK8B 3LPWA 3JWDL 4MYWB 4KQ3H 1L9MA 2VIRA 1VACB 2IADA 4HDIA 1T0PB 1HI6B 4N0CD 3U0TB 4X6CF 4H88L 4YE4L 1R5VA 3FFCB 5IWLA 3LZFL 2FDBP 1RJCA 3PWPA 3MUJA 3C08L 4L4TE 5MEQA 1AO7B 2R2EB 4X6BA 4RFEB 3RVWC 3VRLE 3HE7D 4ZTPH 1IFHL 4CDHA 1T1XB 1CGVA 2ICEA 4UBDC 3BP5B 3HZYA 2D4FA 1YEIH 5FECB 3GNMH 4LPTA 4WEMB 1S7WB 5DMKB 2DQDH 2GFBA 2OQJB 2BNRB 1NGXA 4DN4L 3T0EC 7CGTA 3E2HC 5TH2A 4H0GA 3ZKXB 4ZFOL 5K9QG 4ALAH 3T65A 3DV4B 5EZIL 3DETD 4H20H 7FABL 5JHDA 1FL6A 1P1ZB 3PWNA 4MNGB 5DD3H 4ZUUB 4LSUH 3MRBB 4WRLA 4C56E 2GHWB 2HVKB 5LVEA 2HH0H 2AEQH 1NC4B 4PG2A 4RQQB 3TBYA 4QO1A 3W2DL 4U1HA 1WUNT 1Q9OA 4IM8A 2E7MA 1IAIH 5I1CH 1NDGA 2VUOA 3QQNA 4FNLL 1IGCH 4KVCH 4HEME 3RNKA 4Y5YC 3FCTA 3PQYE 4IOIA 1I1AC 1VHPA 4MX7A 3MACH 1KPRB 3BFOA 3RWCB 5KVGH 1ACZA 2W0FA 1MY7A 1N6UA 4K2UH 2DQFA 3DI2B 4Y5VA 4NQEB 4BZ1L 1LK3L 4U1IA 3WFBL 5GRWA 4F7TB 5CSZA 5F72S 1JYWA 4FQJH 3W0WA 3MUHL 1HQRA 5DJZA 1IM3A 1ZKAA 1HINH 3HG1A 5C9JA 4JO4H 4G80B 4P9ML 1YNKL 1MNUL 3GSWB 4OF7A 4TVPD 2R0KH 2J7LA 5GS0C 2ZUSA 4W6YB 1WFUA 5FYLL 1CR9L 4BQ9A 1JHLH 1S8DB 2PR4L 2Z31A 1RFDL 3DHJA 4NM8H 4P23A 3SJVE 2HMID 2ERJC 5C0AD 1S7SB 2CK2A 3R8QA 5CGYC 1MVUB 2EC9T 3SDXB 3RI5K 3QPQC 5D71H 1IGFL 4JG0L 3CLEL 5B39G 1NFIA 3TIEA 3QQ9D 4QRRD 4UT7H 1MSPA 1A1OB 3KPRB 1A7NL 3CCHB 3T4AA 1G0DA 4R4ND 2HKHH 5DA4A 1N5YL 5A43C 3MV8E 2VDKL 3O9WD 3ZKQD 5E8OA 4I3GA 2X09A 4KH2A 5DK2A 3KPNB 2XQBL 1A6UL 2BFVH 3VGFA 2A77H 4GAJL 4KDTC 4UUJB 3BAEL 1R3JA 2YKLL 2XZAH 3LQAC 3PDGA 3VGEA 4JPIA 2JJTA 4X7FC 1IAIM 4EUPA 1D5MA 5BS0A 3D39A 3FQXB 5F3HA 3ZKMD 4HWBA 4YDVB 1HQRB 4NZUH 1BQHB 3AREC 2QBWA 4P2OB 5T1KB 4XPBH 2Y4SA 1B0GB 4FQCH 1VGKB 3PHSA 2E27L 3ULSB 1ZSDB 1DBKL 1FLRH 3I6KB 1N26A 5D93B 2VO5A 1IM9D 3WO4C 2EIBA 1B4JH 5D6DA 2Z92B 4O2FA 2CLRB 2Q86B 4XZUA 3MLRL 5F7WC 3OKNA 4ONHA 3VXOA 3SDCA 1YC7A 2DJ4A 2OI9C 1YC8A 5E8DL 1WWCA 4M62L 1N6QH 4R4BA 3WHXB 5CINH 4XVJH 1I9JL 3W39A 5DZOA 3SGJA 5F8RC 5H37G 2A74A 1MCHA 5ANME 5JQ6L 2BERA 2XG4A 1G0YR 1S7VA 1AXSB 3TWCL 4RGND 3SKNB 1T7WA 5BRZB 2EDHA 5C07D 1DL7L 2GK2A 4ZS7L 3HZVB 3LKQB 3QDMB 4PJAE 4TTDD 3IDGA 2CR6A 1GYAA 3STLB 3FOLA 2L7UA 2GUOA 2OJZL 4RISL 2WNGA 4MXVF 3L95B 4NP4H 3UZEA 3EYVA 3ULUC 3FN9A 4XNZB 5IHLB 3IYLW 1YY9C 5E94A 1FL3B 5C8JA 3LEVL 1MLCB 3OBAA 3QWQB 4ZSOA 1J10A 4ZPVB 1LO4L 4NZRH 1K6QH 5JQHC 3MGTA 4M7LH 1BAFL 4GKZB 1JYVA 3OPZL 5FUCC 1X9QA 4MLIA 1DSFL 3SE3C 3T8XB 4XNMB 3DYPA 4QRUA 3RPIA 2PW1A 4K3GA 3VI3E 4UNUA 5MEOA 3O4OB 3VXME 5C0DB 2RHEA 4M1GH 2FB4L 5SWQA 3V6FB 1PSKL 5E00A 2DLEA 3QEHB 1QBLL 2XPGA 3MRLB 3FT2A 2DIBA 3VRLF 4G3YH 5LGKA 4KZDH 2DQTL 4FXLA 3QT2A 4XMKH 4PUBH 4KI5E 3NN8B 4L8DB 5BOPA 5GSVA 4KK5C 3PUCA 5EN2A 3R06B 1JTPA 1QOKA 3K1KC 4NRXA 2VDNH 1I8KA 3FO1A 4AEFA 3QDJE 4XRCB 4ONFH 4NJ9H 1Y6KR 4XPGL 5D5ME 3H7BA 1SJXA 3VJ6B 4MA7H 3QIBA 5MEND 2GAZB 4EI5A 1D9KB 5TF1H 3MR9A 4K3HA 4PRID 3HKFA 2DBLL 1ZVYA 5J3HD 4HGWB 4LLUA 3RDTA 1T7ZA 2GJ6D 3HPJB 1H0DA 1QSZA 4KKBC 2ZCKL 4Z5RA 1WIOA 1IC5L 3L5XL 5AYUH 5LBSL 3V5DA 3KPOA 1H9VA 2QQQA 3GO1H 5KVMC 4GRLC 4NT6B 3WNNA 3C6SB 5IB5A 4AL8H 4G5ZL 4H26A 5FYKL 4JQVA 2BHYA 3I6GA 3GMOA 1F11B 2OK0H 3L3HB 1U8QA 5D96C 1UG9A 1R3IL 5ICXB 5D1ZA 4G6FB 4RX4A 2HFGL 4BH8B 3RFZC 3MNZB 4W6XB 1W0VB 3B3IA 5I8CA 5E99H 2J2ZA 4KKAD 3VFUA 5HGBA 4JZJB 5ISZD 5F7DA 2R69H 2W1NA 3HI1B 4DK6A 1X6LA 2PXYC 3QNXA 1DVFB 1FGNL 1PKQA 3LKOA 4MQXC 1MAJA 1TIUA 4MJIA 4Y16A 1AFVH 1JP5A 1U41A 2R2CA 3MRRB 4HS6B 5GSVB 3MOQA 2D7TL 1QSED 1Y0LB 5I19L 1HSAB 3E3QC 3PNWA 1H5BB 1MCIA 4XMLH 5GS0L 3D85A 1BQUA 4DTGH 5D7JC 1WV7T 5C9KA 3PXJA 5FB8A 1ITBB 2L0DA 1JGEB 3HFMH 1JI2A 3WFCL 3QIBB 3TVMC 4XC1H 3UTTD 1R3LA 1WFNA 2P24A 5C6WH 5HYJB 4QT5B 5KSAD 5JW4N 2A9NL 1MHPL 4LLUB 5I73B 1FDLL 4X9FA 1MRCH 5D1XA 4O02L 4D2NA 5IW3A 4HX1A 4L3AA 4C59B 2I5YL 3HRZB 5F9DC 5GRYA 4I8DA 4IRJD 2PW2A 4JN1L 2BZDA 2OS7A 2P5EB 4Y1AA 1AD9B 3EW3B 2ZCLL 5HI5D 4R4FL 1HWGB 4J3VA 1UB5A 4ODVH 4OIIL 1U3HB 5DUML 4O00A 4HIXL 1MCCA 4ZFOB 15C8H 4FFZH 4OGXH 3MRIB 4XGZA 1NMBH 3NA4A 4LKCA 4OI7A 1GIGL 4GXUN 3P9LB 3V7MA 1WZ1L 1HSBA 3CFIC 5I8KH 3MJ8B 2DOCA 3LQAL 1FQ9C 3U0PB 4PB9L 3P0VL 1E4XH 4LLQB 3QXAB 5HHMD 3WIHL 3MODH 5CCKH 5DQ9A 1C5CH 3V8CA 4MJIB 2VC2H 1T5WB 1HE7A 2COQA 4JHWL 5DFVC 4AENB 4OZIA 1WBXA 1U8NA 2E7BA 2IALA 3UZQA 5I18H 1QR4A 4R2GB 3MLVL 3D25B 1U3JA 5EU5A 1JGLL 1GHFL 1WAAA 4PBXA 2YSSA 3I9GL 4Z77B 5EOTA 4QLRA 1W72H 4G42B 3OHXA 4NC0B 2QHLA 1CG9B 2Q76A 2VZVA 2IPKA 1C1EL 4AEHL 4G7YL 2DQHH 1GXEA 1JZ5A 5EO1B 4L8CB 5IOPB 5D1XB 1DBJH 3EBAA 1II4E 3HC4L 4CN1A 1UEYA 3OG6B 4QTIH 2HYMA 1CLOH 2EDJA 3DARA 3ZTNL 2HP4A 3AU1B 5CEYA 4V1DE 1FH5L 1D5ZB 4PJAF 5DURB 5CJOH 5T5FL 5C08E 3DRQA 5GGTH 4XGZB 5FOBB 5IEHB 3IJHA 4WUUD 2YXMA 1TVBA 3SHSA 3PDDA 2Q7YB 3LAFA 3ULUL 5SWZA 3PL6D 4NNPL 2AI0H 3BD3A 3IDYB 4QOKE 4AEEA 4ELKB 1MCRA 3D6GA 5FM8A 5JA9A 3V8OA 1BJ1J 1YQVH 4EOWH 1OARL 4WFHE 5GRJL 1MCBA 1CDIA 2FSEB 3QCVH 2IALB 1EUUA 1H3PL 3OAYH 5F88A 4EJ1C 3VI3F 4MNQE 2YK1H 2HAZA 3KLSA 2ZUTA 4FFVC 3ZO0A 3PGDB 4PRDA 4K23H 3MRNB 2CLVB 3AMKA 2JB5L 1QSFB 1KEGL 3CPLA 4HPYH 2NY6B 1NQBA 4RFNB 3U48A 1P53A 2DICA 4POZC 5I1DA 4Q7DA 1LILA 4CVXA 1HXYB 1U92B 4I0PA 1RJLB 2GT9A 2O61A 2HVJA 3FN3A 3JTTA 5E1AA 4X7DC 4J8RB 3CLFH 4QKXB 1EGJL 2VLRA 4FQLH 4KUZH 5L9DH 3N85L 3TCLA 1OTSD 2BJML 3U4AA 2X42A 4LPXA 4P5KB 2F5AH 4G43B 1V7ML 4QRPB 4L8SA 2AKRA 4M5YH 1UZ8B 4QHLA 2AAVA 4GKNB 2IH1B 1MFBL 3S36X 4Y2OA 1SMAA 2ICWB 3DGCR 1VB9A 4IRSB 2VR9A 2BVOB 5SV4A 3X3GH 4WI2A 2FEDD 1GZQA 3IJSB 3O3DB 3MRJB 4LVEA 4RWYL 5EBMA 3W82A 1UVQB 1PG7H 5GGQH 4OGAD 5C09D 4L4VE 4G6KL 5DYOB 2R4RL 1CF8L 4N8CL 1RULH 4UILL 2C4FT 1JGDA 1MFAH 1RZGB 1SEBA 4WW2A 3F7YB 3MRFB 4LARH 3IFNH 3A67H 4WEUD 2XQYG 4L1HA 4YC2C 5MI0B 4E5XB 1VFAA 4XC3H 3VWKD 3GSXB 3BN9D 3PGFH 4P5TB 5DTFB 5AEAA 4LRIC 1WEJH 1GZPB 1ITCA 4N8PA 4JVPA 3HAEB 3NACL 1D5XA 3G6DH 3E6FB 1FAIL 1UXWB 2EH7H 4OZHB 3LD8B 1I85A 1MWAH 4C4KT 4XNUL 1PX4A 5HI4C 1J1XL 1U8IB 4LAQL 5JOFA 3VFMA 2HVJB 4F8TA 3HUJA 4QYOB 4JRYD 4O2CB 2LQRA 1QFUH 2WUBH 2VLRB 3KDMB 1I1AA 4HUUA 2EE3A 4NO0D 3WLWD 3QUMH 1UKQA 1UFUA 3CX2A 2PTTB 43C9B 4RMWA 5HY9B 3N1GC 3VG0H 1P9MC 1O5DT 4J6RH 5DVKA 1IEBB 2R56H 4FTVB 3VFTB 5IEKA 4Y2DD 5DRXA 1EAJA 3FN0L 2B20A 4AM0A 2WIMA 4G9FD 5IGXH 4HUVA 1PD6A 1NDMA 4DKEL 4UIMB 5HHOE 2BMKB 3UO1L 5KSUB 2LVEA 3PV6B 3VXSD 3P73A 4WTZG 3Q5OA 2XKNB 3GHEL 3HE7C 5E9DB 3T0EB 3WFHA 1TTUA 3E2HB 1N2RB 4MD5B 2EDDA 2H8PB 3C9NB 3BPLB 5IB2A 4R6UA 4Y88A 3RWJA 5DD6B 5FM4A 5JXEA 1CGTA 1UJ3A 5DLMH 1X4ZA 2WP3T 1M7XA 1KCUH 3MRQA 1XCQA 5INCA 5FO8B 4YQXH 5BVJA 2FZ3A 4CMHC 2YPVL 4MLSA 2Q8AH 5F1OB 1IC7L 3D9AL 2VXVL 4NQDD 2HT2D 2VISA 1F4YH 2XFXB 1CLYH 4FQ1L 2VSCA 3VFMB 1RHFA 2IPUK 5KOVC 3ZSSA 4IDJH 4F7PB 3RWFB 3X3FH 4XPAH 4X7TB 4KDTA 4Y5YB 2XRAH 1QPPA 1A02N 3VXTA 2DAVA 12E8L 2VLLA 1AIFA 1DQLH 3I2CL 1U3YA 1YECL 5K9OA 2E7HA 4JM2B 3DOSA 4CVZA 1ZT4B 3WIHA 1ZT7A 5EU6B 1BBDH 3B5GA 3FMGH 4G6JL 2J88H 3VXNA 1A6PA 4LLDA 5EBLB 2YRZA 5HI3D 4M48L 5EB9A 1Y6MR 5EU3A 3AREA 1QRNB 5A3ID 4KTYA 5IEKB 2VH5L 2D03H 3GSUB 1N0XL 1JUFA 5A2IH 4HUVB 3P77B 4JPWL 5MERB 2R23A 5KZCB 1JF5A 1BD2E 2BDNL 1CL7I 3K0WA 2VDRH 1NANH 2J3SA 3WFHB 1FJ1A 3LKSB 3D0VB 1FN4A 2XICA 3AS1A 5I71C 5EPMA 5IB2B 4LRNH 4ZD3L 4G8FB 1S7TA 2FJHA 4HMCA 5FYJU 3UX9B 5F44A 2YC1B 3UBXI 5C0GB 1CFNA 3OGCA 1DANT 5I1LA 5DD1H 4Y4HD 1ZT1B 2C3HA 1DBBH 2BVTA 3DGGA 4S1QL 5FXCH 2HMIC 4Y5XC 3S37X 2CRIA 3VGBA 5CD5D 1ACYL 5FHAH 2AXGA 5D2LE 1P7KA 2UZIL 4MZ3A 3MFGB 3ALXA 3O2DH 3VXUB 2W65A 3CMOL 3QXWA 4JANA 2B7DT 5BQ7B 1RSFA 3DX9B 3U1SH 3LRHA 4JPKL 5EZJA 2GSIB 3BD5A 1MEXH 4W4OC 1DQTA 4R4NC 1N8ZA 5DD0L 4YHML 1SJVA 3QP3A 3UJIL 2DTSA 5K9OB 1DUZA 1BJMA 4Z8FH 2MNUA 1XIWA 3LH2L 4Y19B 3S37H 5JW4M 3KXFA 1AGBB 2WZPD 1MHHA 5CP7A 1A3LH 5LWYL 1I7UA 2C3GA 3SE3A 4YO0A 1MJ7H 4F7CA 5SWSE 5HXMA 5IW6A 1P4IH 4PY7B 1UB6A 5IBTH 1VFOA 3WO4B 2W59A 3CAFA 3ZKMC 1U8KB 4EUPH 2WLYA 5C6TL 1YN7B 2NY3B 5GSRB 1FJ1B 1JTTA 4UTBH 3QXVA 3QIWA 2IGFL 3O4LA 4HWBH 1P5UA 5EPMB 1OGAE 4GXUM 1KXQE 1ZOXA 4X4MA 3SDAC 4HW6A 2OI9B 4JLRA 5GS2D 3CD4A 3DVFA 1JMZA 4LHUA 1LO2L 4YGVA 4KRPB 3KNBA 3OGCB 4RZCB 4Q9RH 2CSPA 5DEFA 1MCNA 1EGJA 5EZLB 2GJZA 4XI5C 2EKSA 1TJIL 3MROA 3MLXL 2ADGA 5A2KH 5KAQF 5F8QC 3KYMB 1VCAA 4ZOAA 1FYTB 4KTDL 3GMQA 4G6MH 1GJIA 4DOHB 4X5XA 1MPAL 3BPCB 5IESH 1OAKH 1UZ6E 1FZOB 2MFNA 1DQJB 3L3OA 5M95B 3QO0B 3BQUA 3K8MA 3NCJH 4HF5L 5B8CC 4L9LC 4KKCD 3I50L 4RAUB 1LO3L 5CEZH 3T0VA 4YK4C 2X44D 1N8ZB 3V6OC 3F12A 1KJMB 1E6JL 3BD4A 2V2TA 3IAPA 4RGNC 3BXNA 3C8KA 1CI5A 4HV8A 1RZ8A 2FD6H 2AK4E 5HPMB 4TTDC 3M17B 4TTGA 1JPFB 5I16B 1VFBA 3TEUA 1EX0A 3X11B 3WFDH 4X99A 2IANE 4MNHA 1DLFH 5B39B 4DFIA 1V3JA 1WFOA 1RJYB 1RZ7H 2J5LC 3G5YA 2BSTA 4LDLB 2ZSVA 4GUPB 5EA0H 4WY7H 1BJ1H 4OLVL 2O5YH 1AI1H 3BZ4B 2FYYA 1J12A 2FL5A 4K8RC 2CQVA 1FNGA 1IL1A 4DGVH 3VFPA 2IQ9H 1Q0YH 4EBQH 1TTFA 2F15A 1YPZE 3O4LB 4Z9KB 2P5WE 4M03A 2AJ3B 3AMLA 2R1YA 2QKIB 1FG9C 1H15A 1XR8B 2MMXA 2LE9A 5D72L 5I15H 3DHMA 3C6LD 4ZUTB 4JO2L 4N0UA 4Z7NE 2YPLD 4YGVB 2UVEA 4U0RC 1QLRA 3D3VE 4OZGB 5FAAA 5D9SB 1VA9A 1FIEA 1QFWM 1ZVSA 3H42H 3MROB 3CXDL 1BQLH 2JF1A 5E8NA 1IZJA 3FB8B 2EDEA 2A6DB 4BSWB 4L8BB 5D7JA 4XP1H 4OQTA 3O2VH 4R7DB 3E8UL 4K9EH 5DO2D 3VH8A 3QWRA 4JY6B 2EZ0C 5FKAA 4KJYA 5HYQA 4HWNA 4U49A 2Y07L 1T1ZA 2D31B 4OV5B 3LQMA 2G5BB 3BXNB 3ZE1E 4HV8B 1XGQA 3FTGA 5KTEL 1AC6A 1I9RH 4H88H 4NRYA 3PHOA 4GRLB 1VFBB 3HHRB 5CWSA 1XGRA 4Z95L 4PJXE 2VLMD 5J3HC 3C08H 1FFNB 4JY4A 3UBXG 2ED8A 3TO2B 4XAKD 5I1JL 3MC0A 3EYSL 5D96B 1KJ3L 1R5IB 3F5WA 1IFHH 4U2YA 1IAKA 4ORGA 3FQWA 1AXIB 1AGCA 2C26A 4ZFZB 3OAZK 1DN2A 3HNVH 3VFPB 1B0RA 3NZ8B 5F1NA 1F42A 3JV0A 2PXYB 4GAGH 4DN4H 3OB0H 1HH9B 2YBRB 4XP5H 2JELL 1CD9B 1A0QL 4GG6B 4TPRL 2NXZB 4G8GB 5EZIH 1HYSD 5GGRY 1OM3L 4PJDB 3I3BA 4KKAC 1KG0B 2XWTA 2PTUA 2RR3A 4PJEA 5D6CA 4DKAA 1E28A 3IDUA 1FP5A 4UT6L 3FL7A 1P69B 3VMNA 5JO5A 2ATKB 4HIHB 4LKXA 3AVEA 3QEUA 4OLWL 4I2XE 4QY8A 3KPMB 1BM3L 2WM0A 4NWUL 1WAAF 5IMOB 2CIIA 1JF6A 3TVMB 1JBJA 3GJFA 5HYQB 5ECJE 2MQ0A 3VCLB 4FNLH 4OD3L 4YHIB 3FB5B 5ESVA 1DQQB 1O7VA 1IEAA 3TZVA 2ARJB 5J4MA 1NBYA 1ZVHA 3L3DA 1I3VA 2BY0A 4X6DB 1MLBA 1G7PA 1NSNL 1T83A 5D2LF 5KSAC 3U0WH 1LK3H 1YEDA 2Z8SA 3WFBH 4NUJB 4XCFL 4ETQB 4OKVA 2QADC 1OQOA 3ZMRA 3H8NA 1LEKA 4Z78A 5CZVL 3WEXB 2M2DA 4HWEH 2V9QA 4YBLC 4MXQC 4E41B 4IRJC 1XCTB 1YEFL 4HFWB 5FF6B 3LN4A 4P9MH 1MNUH 5BCAA 4L3CB 3VRIB 2HJKB 2VLKA 5HI5C 5D2NB 3KHOA 1S3KH 2EYRB 2H1PL 5FYLH 2GIYA 4JFFE 1KUMA 5J9PA 4PTUA 1HKFA 2VSDA 2PR4H 1RFDH 1BFVL 4JKKA 5DQDL 4CBPA 1KC5L 5TGBB 2W0PA 4OTXL 4L9DA 1LEGA 2YZ1A 3CLEH 4G9DA 4HS3B 1MJJB 1A2YA 1G7JB 2V7NA 3E1F1 3D0LA 1A7NH 3M45A 1QFHA 4MQSB 3U7AA 4YXKL 5DJ2B 4Z7WA 5TDOA 1BX2A 1N5YH 1BGXL 2H32A 3QDGB 4S1RL 2ED9A 4KTEL 1QO3A 5BW7A 3OF6A 5DMIH 3TBVA 2DN7A 2X4RB 1A6UH 4FXGA 2FO4A 1QLFB 5JORA 4GAJH 1UWXH 4NRZB 4X0KA 3IFPB 1N59A 2YKLH 1HNFA 4WU7A 2IFGA 3L9RB 3DVGA 2GTZB 4M7ZC 3HCVB 4P46D 5L88H 2FEEL 1I4FB 2ZG3A 4GW1A 1UZ6F 1IGML 4OKVB 1R0AL 4N0FA 4F2MA 5IBLD 1MCOL 2YHGA 4EKXA 4JDZA 3EYFA 1KXTB 4PJBA 2DLHA 3IXAB 2OZ4L 4QXTB 4K3EL 1JCKA 1DBKH 2VLKB 3RGHA 3QJFA 2WINA 2NR6C 1YMMB 1TITA 4YIQA 4R0LC 4PD4K 1K8DA 4PTUB 4PRPD 3AGVA 1A4JA 5F96L 3VFRA 3DIFB 2UUDK 3H0TB 3MLRH 2P43B 1S7QA 3H9SD 3ROLB 2YD6A 3GUTB 5HGGS 1NEZA 3PL6C 5E8DH 2ZUYA 4M62H 3IGAA 4DGYL 1YYML 3ILPA 1GGYA 3FFDB 2F54E 4OCSL 1VEOA 5F1SA 4DAGL 4LRIA 5F7KC 4K8RL 5DGQA 5JQ6H 2FR4B 3QFJA 1YPZF 2GITA 5FKPA 1P2CB 3O6LL 3TWCH 3ARGC 5IB4A 1DL7H 1OTTD 4JAMB 4ZS7H 4AEIH 3P11L 2SEBB 1DLHA 4Z0BH 4Z7NF 2OJZH 4RISH 2R29L 4XBGA 3WS3B 3BKCL 5IVXB 4H5SA 4M3KB 1TMCB 2XZCL 1AHWA 4OLYL 4J3SA 2AXHA 2DMBA 3LKRA 5L7XH 5IB3A 4D0BA 3LEVH 3AS2A 4P0DA 4F7MA 1EZVY 1KYOK 2PCPB 1U93A 3HUJF 1LO4H 4TUOA 2VL4A 2HG5A 4PJ9D 1F45A 1CFVH 2VLJD 4LNRB 4XWOD 1KELL 4C4KO 5FA3A 1BAFH 5ICZA 4WNQB 2V9TA 3F7VB 3OJDB 3OPZH 1YY8B 1S7UB 1DSFH 1ZS8B 1ES0B 4QWWC 1EO8L 3GMLA 3UTQA 4DZ8B 5DUBA 5HD8D 3OR6A 1KNOB 2QEJA 3IDNA 3PE9A 2CDEA 2WINB 3QULB 3V4PL 1UXSA 2X40A 4YXLH 1F6AA 1WLHA 4EVNA 2FB4H 2R0LL 4IMKC 1IAOB 3BO8A 4RMTA 4PJXF 3MA9H 3RWGA 5EIIA 3I6LD 1QBLH 3HE7A 2NX5B 4M8QB 4NHUA 2E9IA 4XPFL 2WW8A 2FEDC 3TV3H 4ONOA 1ETZA 4P4KA 4YC2B 4PJ5A 4ELME 4XNQB 2CLZA 3B5TA 4NQTA 3QEQB 1KULA 2NY2C 4ZQKA 4XPGH 3LHPH 1RQ5A 1CU4H 3MYZA 1Q9LA 4CKVX 3HZMB 4HLZH 4NQUA 3VWKC 2M8XA 4L5FL 2DBLH 3BN9C 3EO1A 2BNQE 1FV1A 1JHTA 2DWEB 3N9GL 2B2XL 2HFTA 4FOMA 5I66B 4C55A 2AVGA 2ZCKH 5T1LA 1IC5H 3GIVA 4L29B 1I1FA 4GOSA 4NM4H 4YDKL 2HG5B 4M9OA 1DQML 5GJTL 2A1WL 4I5BB 4R9HA 4G5ZH 4LSRH 3RUGE 5IP4A 1XT5A 3MXWL 4ZS6C 3RNQA 2YS4A 5IVNA 4PRBA 3HZKA 3WLWC 5ADOH 1NGYA 2BVPB 2I27N 4UQ3B 4BUGA 5C3TA 4APQD 3H9HA 3MLZL 2X1PA 4XNXL 1EBPA 1T21A 2W92A 3P0YL 4MAUL 2P8PB 1KIRB 1YYLL 1GC1C 5L6YL 2QQNL 3HE7B 2G2RA 3QB7C 4OCRL 3UJTL 1S9YB 4OSUL 4OLZL 4Y2DC 4HC1A 2LTQC 5T33L 1UENA 3GGWA 5CSBA 5HVHB 4NJAH 5BMFL 1OP3K 2P44B 2D7TH 3QA3B 1LD9B 4ODXA 5I19H 1BZQK 2XA8L 5E5MB 2FGWL 5E0QA 5GS0H 1RJZA 4WHYG 4OFDA 2Y36H 4GW5B 1KPVB 4CMHB 4LHJB 4ZPTB 1OY3B 3CFEA 5EUOB 3ZE2E 3WFCH 4YHNB 1IAII 3Q0HA 2IBGA 1Q9LB 2A9NH 2P8MB 3FFCE 4GKSB 3QXTA 1YNTA 4OFPA 3CFKA 4UOW0 1FVEA 4O02H 2DTMH 1VADA 1JNLH 1BVLB 4FS0A 1OSPH 5E2TL 4K7FA 4JFYB 2I5YH 4XPTL 1AGFA 2HT2C 4JFXA 2D7QA 3C5SB 4JN1H 1QNZL 4Z0XB 4QHMB 1T66D 4R4FH 1EHLL 3FJTA 4LGSB 1OAZH 4F7EB 4U1JB 1R3KA 4LQFH 2E7LC 4HIXH 2ESVA 1LP9A 1C7TA 4ZODA 1GIGH 2BNRE 5IVZA 1WZ1H 5D8JH 3LV3A 2ZOKA 1C16A 4O2EB 3LQAH 2AJYL 4X5WA 5I76A 5IBUB 1JN6A 3DUUA 1A14H 4OI8A 1HHIA 3P0VH 4XBPB 1WVZA 2N56A 3HMXL 2HTKD 4MA1C 4UT9L 4RBPK 5KSVB 2V2WA 4LBEB 3WIHH 2A2QT 4MNGE 1J8KA 3DURB 1Q38A 2CUIA 4RRPA 3U9UA 3GSVA 3HLAA 4OT1L 2X9WA 4JHWH 4W68A 5I71B 3ZKND 4DEPC 1LK2A 3SDAA 5IT2L 3MLVH 3T0WA 3V4UL 3L7FA 4NSKA 3BKJL 1JGLH 1GHFH 4Y8AA 5D7IA 3O8XC 4Y5XB 2EH8L 1T6WA 5C0AB 5LGJA 1C1EH 1SBSL 5IW1B 5CFHA 4G7YH 5FHBL 1BFOA 4QRRB 4NQEE 4Y4HC 4EN3C 2Y25A 4L9LA 3HC4H 1MUJA 4QXGH 3ESUF 5TE7L 3H9ZA 5F7FA 3ZTNH 2NMSA 2ZWLT 5C07A 2GEEA 1MI5A 2IH3B 1PQZB 3LB6D 4HIIA 1FH5H 3O9WB 5T5FH 4AH2A 3RL1A 1QQDB 3EZ8A 2VR5A 2VXTL 2GK0B 3O6KL 1JFQH 1T22B 2YA0A 1D5BB 3RZWA 1JWSB 3ZDXE 3ULUH 5I76B 2OR9L 5E5RB 2ZUQC 4NNPH 3BVNB 3R0NA 4P57A 4GH7B 4I77L 4UI2A 3SDXE 4HFUL 2V2WB 5H35A 3K80A 3JUZA 5DJYB 4Z7OE 2BCKA 4S1SL 2J8UB 4X9GA 4F9PA 4HKBB 1SHMA 4MJ2A 5JXAL 1P7HL 3KPRE 5J11B 1X7QB 3WIFA 2F53A 1OARH 5DWUL 3TO4D 2HWZL 3RHWF 4MB4A 2X89A 5J1TC 1IGIH 1XR9A 4TSBL 1IM9B 3BESR 2A6IB 4CADA 1MCEA 4JRXD 4ZAKD 4NYLA 4WI8A 4JFED 3VXRA 3VDBA 2OL3B 5DHYA 4FHBD 5K93A 1KEGH 3UC0L 5C3LD 5IMKB 2I07B 2EDXA 1FFRA 4Q6YA 2PYED 3MV9A 2H6PA 5B8CB 1KCLA 4U1MA 3JTSA 5T1DL 4DVRL 4PLJC 1DR9A 1PY9A 1EGJH 4RGNB 5C07B 3N85H 2BJMH 4HIIB 3GMMB 4HUXB 4NWTL 5I17A 5CZKA 3TF7C 1V7MH 3FOMB 3K2MC 3RIFK 2VKWA 3BH8A 1CTNA 4DKFL 5DJ0A 1MFBH 1D6VL 2O26U 3B9KD 2J5LB 2Q20A 5J6GB 5FGBC 5C0IB 5ICYB 4E42B 4LOUD 2O5XH 3W5MA 3EHBD 2BCKB 2LVCA 4HD9A 4G6KH 4IBLT 2R4RH 2KBGA 3MLYL 3RUGF 4MQTB 5I8EA 1FORL 3S8WA 1JIBA 5DJDB 1EZVX 5IMLA 4YBQD 2QR0A 5BRZE 1XR9B 4NO5B 4WWKC 3MRMA 3MJ7B 3QDME 4PS4L 4U0RB 3VXMD 3O3EA 5CEXA 3GSQA 4FP8H 2CRMA 4LSQL 5J6HB 3EOAA 3TIDA 3RU8H 3ZZ1A 2NW2A 4PJEF 1VPOH 1GC1L 1H3VA 1EDQA 4LF3B 3H3PH 1INQB 4PGDB 2DLIA 4XNUH 1I7RA 4M7LT 1J1XH 3BI9X 4LAQH 2X6MA 3U7YL 4A2MA 2AEWA 2ED7A 1P84K 4JZNB 3QDJD 4BH7A 2P47B 4CU8A 4PV8A 2OJEA 2Y6SD 5HHVH 5MENB 3ZE2F 4OQTH 5K9JL 4PRIB 5E2UL 5I8OL 3MJ9A 1T2JA 2DWDA 2GJ6B 1FRGL 3EYOA 3PWPD 5E4EC 5F89A 1GGBL 4FZEL 2GW5A 5BZDB 4YAQB 3GKWL 5I1IL 2KL6A 3EJZD 5IHUL 2UZYB 3UCRA 1MIEH 4DKEH 4R7NA 5DI8B 3UO1H 2VAAA 5IKCA 3BN3B 2HLAA 1X5XA 4C57C 3CUPA 2EECA 4UB0L 3NH7H 1RK0B 3MRMB 5ISZB 1WF5A 4OBRA 3EDJA 5A16B 1Q1JH 5EC2A 3CFDA 1G7MA 3VA2C 4NQCA 1QBAA 5JHDD 5KW9L 5I1AB 3I3EA 2FECI 3NCYP 4BUHA 3MCLL 3DUHA 1YEJL 4G8EB 2VDPL 2V5RA 3CVIL 4FQ1H 1QSEB 3FRUB 3HNSL 4X6EB 5E24E 4RMSA 3TP4A 3IAGC 3WNLA 1NAML 2Y7QA 4CVWA 1PZUB 4PBVC 3CDGA 1QLEL 2XNAA 12E8H 3FO9B 3UTTB 1A8JH 3HMXA 5KSAB 4PG9A 1G7IB 4N9OB 5BXFA 4GQ9L 4G6JH 4CW1A 3GJFH 2W07A 3QRGH 2VH5H 4IRJB 2X4NA 5DMGC 1N0XH 5FCUL 1A6TA 1E4XI 1NGZA 1QTYT 4IIQC 3W0WD 1YUHB 2BOCB 1Q8MA 1N7ML 4DZBA 2BY3A 2AABL 3HG1D 3MA7A 2BDNH 4R0LA 1ZHKA 1I3GH 2JB6A 4UDTB 1BBJB 3RGVA 1XF2B 4JY5L 2X7LB 1K85A 2OX5A 5F1IA 4ZD3H 3NCEB 2Z31D 3L7EB 4P23D 3MXVL 2UWEB 4LLVB 5HYJE 5HHMB 1JNHA 5CJBA 1X5IA 2FJFB 1KTDA 4S1QH 3BW9B 5TE6L 2UZXB 1H3XA 4OZFA 4R3SB 5GJSL 5DA0B 2EEBA 1ACYH 3DTXB 4N8VG 2VWEC 3IKKA 5C0CA 2IEPA 1NFDB 3QZWA 2UZIH 3ARGA 5I1KL 3CMOH 2P5EE 5ESQB 1IT9L 3MOBH 1CBVL 2XIDA 5EULV 3WBDA 3MV7A 4ODTH 4JPKH 1I1YA 3V6ZB 1Z6JT 3V9FA 4EIGB 5AG9A 1ND0A 5DD0H 4KROD 4YHMH 2G75B 4KFZC 4S0SD 3S3SA 2D7NA 4NO2A 3UJIH 5ENWA 1CGXA 4PREB 4ISVB 1MCSA 1A64A 3ARXA 2H32H 4HS8L 1FYHB 1DN0A 3RTQA 1I7ZB 4JO1H 5BS0D 4ZTOL 2IAMA 3B4NA 3D39D 5IJKC 3E0GA 5LWYH 4QRTB 1JRHI 4MAYA 1H8OA 4P2CG 2ZSWA 4P46C 3UTSE 3CSYB 2NYYD 5KVFL 1GGIH 1PYWB 3WV0A 4I48A 4WVRA 3LKPB 5IBLC 1UQSB 4R0LB 1ZHKB 3LEYL 5C6TH 5IIEA 2NY1C 1NLBL 4JGUA 5C08D 2H2PD 3FAXA 3ECBB 4WUUB 2IGFH 5F1IB 1FFOB 1UM4H 3CVHB 3GMRB 5BJTA 1NFKA 1ODAA 3PL6B 1IC1A 3RVUD 4AIXA 1WCBB 3SDCD 3VMPA 4S1DD 2E9WA 4ZNCD 1TJIH 1Z3GL 3MLXH 4WDIA 1EO7A 3X13A 5CEZD 4P4RB 1T4KB 2UY7A 1MPAH 4PGEA 3FO2A 5TQ0L 2R4SH 2Y1VA 3ES6B 4CNIA 3VWKA 3BEWA 1V3MA 4XP6H 3I50H 1LO3H 3O3AA 5C6PB 3VG9C 2DRUA 1E6JH 3E6HA 2PYFB 3MRHA 5C0BA 3VGHA 1OTTC 4KJQD 1CVSC 2A83A 2ITCB 3KR3L 3N06B 2NCMA 1O0VA 3GIZL 3MRKA 2VL5A 4J3XA 5DQJB 4JKLA 4YHZL 4HG4J 2EKJA 2FHCA 4FQIH 4QRSB 4N0YL 3DBXB 1J9CT 3S9DB 1SYVA 4PJ7B 5JDSB 4WFEE 2E8YA 4OLVH 2VZSA 1MFNA 4PJ9C 3MJ6A 1KT2A 1M71B 3VDCA 4NZJA 4XWOC 1T1YA 4YXHL 2EYSA 4Y4KC 4U1GB 5HD8C 1H8NA 2V7HA 2VN7A 3OMZA 1OWWA 1HHHB 5D72H 3OKEB 4PY8I 3S4SA 3SKMA 1QSFE 3HS0B 4XVUD 1EO5A 3MRDB 5C09B 4I3RL 4HKXA 3QG6B 2ATPA 1S9VA 1EFXA 5JPNA 3CXDH 4JO3L 3BWAB 5FUOH 3PHQA 5ADPL 4JJ5B 2NXYD 1OD9A 4PJHE 3WL9B 1EEZA 2DQDL 2C7UB 3VWKB 3BEWB 3SY0B 1NC2A 5D70H 2Y07H 3O3AB 4QRPE 4XB8A 4ZUSB 4JFHD 3U2SA 5CJXC 1HXMA 3SKUD 4TSCH 5ID1A 4EI5D 3MRHB 5KTEH 1S9KC 3RDTD 1BP3B 1VSCA 3NFPB 3G5VA 4Z95H 3KLAA 2HH0L 4XH2A 5I1JH 4U0QB 4JRYB 5CAYB 1R24A 2E6JA 4Y8DC 2NLJB 1K9TA 1KJ3H 5E6IA 5HDLA 2FH6A 5I1CL 5FV1L 4NO0B 2Y72A 4U6XB 1IGCL 5K59F 1W0WA 4P48A 5HJ3A 4K94H 5D1ZD 5SV3A 1IVLA 3FRPG 3RP1A 5HHPA 3PABB 1YDPA 4RX4D 4K2UL 4MSWA 2V7HB 1A0QH 1HIML 3WNOA 1TJHL 4Y2DB 4APQC 1X5GA 2LTQB 2P7TB 1OM3H 4G9FB 4FQJL 4LLWB 4W4NA 4OZHE 4Y16D 2P8LA 1NAMA 1HINL 3MREA 3VXSB 4MD4A 4UT6H 4PJ8A 5H2BA 1E6OH 4D9QE 1MQKL 4DQOL 3AY4A 1DDHB 4OLWH 1JYNA 3O8XA 4P9HC 3WUWB 1BM3H 1G6VK 4D0CA 4OCLC 5JZ7D 3WJJC 3UJJL 4XP9H 1IRAY 3D85D 1U8JA 2JCCB 2BHUA 1NH6A 1C8PA 1KB5A 3ARWA 2DJUA 1V3KA 2X1OA 4WCYH 4OD3H 2ICCA 1QFOA 4EN3A 1DBAL 5D71L 1CE6B 2EDFA 4ODWB 3BP7B 4Z7VB 3IRPX 1UEMA 1JWUA 1WZKA 1WGOA 3MMEA 4NQDB 1R6VA 4FFYL 5HHXL 3CJJA 1NMCB 1BZ7B 4FTVE 3M8OH 1NSNH 5ELIA 3IKCA 3SKOB 4WHCA 2QV2A 4AIZB 4HKZB 1F6FB 1U3ZA 4PJGB 3DNKA 4QF1B 4Y1AD 2ZZUT 2G9HB 3IDIB 5FYLD 4D8PB 2YZ8A 3BGMB 3T1WA 2XWJA 4JFDA 2YD7A 5MHSD 3T0EE 1YEFH 4YGAB 5E9DE 1A6VL 4HWUA 2ADJA 2EDKA 2ZPKL 5D1QD 1T66C 2A38A 1EXUA 2R1XB 4HKJA 4HGKC 2XZAL 2H1PH 1LHZA 5HHPB 3X14A 1KYOJ 4MA1B 3LIZL 1F6LL 1BFVH 5KANI 5FGCB 3REWB 3BDXA 2HFEA 1BOYA 1PZ5A 4OTXH 4WV1A 4HK3J 3UYRL 3QFDA 4GG8A 2R2BB 1SYSB 5FYKE 2HTKC 4EZMA 3VFWA 3V5KA 4JE4B 5IROA 4YXKH 4PRHA 1BGXH 1HDMA 3ZKNC 2WV3A 4KTEH 5DSCB 2ZUUA 3DO3A 4DVBB 3OKMB 4POYA 3BZEB 2W9LA 1I8MB 5GPRA 1TVDA 2VQ1A 3QNZA 4Y4HB 1WSST 5EU6E 1O7SA 5HSFA 1QEWB 1MFEH 1ZHNA 1K5NB 3FB7B 3MMEB 3BKYL 1QRNE 1GVIA 4XVJL 4P3DA 2A0LC 1R0AH 2MJWA 1MCOH 5IK3B 5TPWH 1FZMB 2YPKA 2CDGA 3AXLA 3UAJD 5JPMA 1BZ9A 3CGTA 3OAUL 1LNUB 1J0KA 2GCYB 4RIRA 3LB6C 4HK3N 5FGBA 1LO5A 2ZUQB 4U6TA 3TNMA 2YD9A 3I02A 3GSNL 4BKLB 4NQVB 4OCYL 1QFWI 2VR4A 5F96H 1DE4B 5SWZD 5DZLA 3MUZ1 1K6QL 2QQKH 2FWOB 1CS6A 3FONB 4M7LL 5DHVA 4JB9L 4TUJA 3KYAA 3DXAA 4PPTA 1RUQL 3FT3A 3NCBB 1FC2D 4WWKA 5H94B 1EEYB 3VXUE 4OCSH 4C83A 5T3ZE 4DAGH 4K8RH 3TO4C 3V5HB 3QNYA 3O6LH 1OB1B 4CUCA 5F7LB 3P11H 3BRFA 2XY1A 4XCEA 2XY2A 4H25A 3RBSA 1A1MB 1EA9C 2R29H 2XN9A 3BKCH 2CUHA 4Y19E 2XZCH 3B83A 4YHKL 5INDA 4IHOA 4DK3A 3MPCA 1CQYA 1K4CA 3NOIA 1ZLUK 3P9MA 4I0PD 4P3DB 1F4WL 3NFNA 1MCWM 2DKMA 1F4XH 4PJHF 2JJSC 4OFYA 2OSLB 3C60A 2ZCHL 5GXBB 1KELH 5EOQH 4NQSB 4MA7L 5SX4H 2VABB 1BZ9B 2YR3A 2KPNA 3BPNC 1EO8H 3GSRB 4X6FB 5TF1L 5T3XH 4FQQA 5LCVH 3AS3A 3WE6A 3MCKB 3V4PH 3EUUA 4ZDHB 2AK4D 3KLHC 2VZUA 4P2QA 2R0LH 3I02B 3O11B 3ZKSD 5AYUL 1P4BH 3QUZC 4D3CL 2FJGB 1S7XA 2RB8A 2YD4A 1CZ8L 5ERWA 4LLMB 2FNBA 3VW3H 3OAZH 2AQ2A 3REVA 3TC9A 1FYTE 1I7TB 4KXZI 4LOUC 4OI9A 4DOHE 1EK3A 1T3FA 3EHBC 4ZNEA 5E7BA 5JIPA 2H26A 4C83B 3TH2T 1DUYB 4FQHB 5E99L 4PGCB 8FABB 1YJDC 4NFBA 4YBQC 1GPOL 2R69L 1FZJB 4OLUH 3C6LB 1R3HB 5FUZL 4KK9D 2YPLB 1ORQA 3W9EB 1J1PH 2HFFA 4X98B 4IMLA 4L5FH 4GRWF 3RZCA 4JZOB 3C5JB 4K7PY 1CDHA 2CD0A 2E7CA 3TBSB 2B2XH 4LCUB 5EFIA 3S7GA 1BQHG 5LGHL 3LQZB 2V5SA 1AH1A 3IB4A 5FUCE 5DK0B 3BH9A 3N0PB 1XF4B 3BIKA 4OBSA 4YDKH 4P9HL 2NY0C 1DQMH 2VNCA 5GJTH 4LEOB 2A1WH 1I1AD 3VGGA 2W60A 3K4AA 2DM2A 4EI6B 3HFML 1UYWH 3QI9C 5KN5B 5J8OA 4QHKJ 1XGUB 2Y6SC 4P5MB 5HGAA 4IEFB 4HJJL 4X6CA 2VITB 1MRCL 3MLZH 4LU5L 4XNXH 4KK8D 1F4AA 4MAUH 4IIQA 3L3GA 4R26L 2A6KA 1YYLH 3S3PA 5DEGA 4OZGE 5F70A 1Q72L 2DL9A 2XTJD 2I26N 3UJTH 5GS0D 3K8KA 3OJMB 3LVEA 3P4NB 4OSUH 5B38B 5CBAB 4OLZH 1CDGA 4G8IB 1IGJB 1ZHLB 5BMFH 3EJZC 1A4KB 5T5NG 3VE0B 5CLTA 4GRMB 1KFAH 4YFLF 5KS9B 2XA8H 3G6JB 2H26B 2FGWH 4PRAA 4FMFA 5I8KL 3A6CH 1M05A 5JXED 3QPQD 3MFFA 1NCBL 3QCTL 4KHXL 3FQNA 1V8HA 1RUML 4CMMA 4RMUA 1J1OL 4P2RA 1X44A 3MODL 1DQDL 3ARBD 4EUPG 1C5CL 2XKSA 1MCKA 5DZNA 3JXAA 1AXTL 2LV4A 3ZT7A 2LABA 3CFBA 5E2TH 1GOHA 5I18L 1MCPL 4XPTH 3EJYC 5I9QB 1BF8A 1QUNA 1KGCE 1QNZH 4GRWH 2B1HL 1T0MA 3EYQD 1EHLH 2X4QA 2ZOLA 4HH9B 4PV9A 5EIVA 3SGDH 1S5HB 3Q48A 2E9JA 4PG2C 3K81A 4FMKA 2BVYA 4JM2F 1JV5B 1J05A 4M02A 1MRDH 2CO6B 1RHHB 2HT3D 5J56B 2YWYA 2AV1B 5IJKA 2VJXA 1KPUA 2FX9L 1FFPB 4NCC1 2AJYH 4GG6E 3OR7A 2EXWC 4G8GE 1IGYA 3O3BA 3ARED 4PJDE 1FNEA 3HMXH 1FFQA 4UT9H 1ZXQA 5TFSH 5JLZA 1TTGA 4K3DH 4ZOCA 4PJCE 1I8IA 2O5ZH 3E3QE 3RI5F 3IU3B 4OT1H 1QBML 4QEGA 5IF0A 5DJXA 1MREL 3L3KA 1FAKT 2G5RA 5GGTL 1YMHA 4J1UB 4BQCA 5LQBL 4PJFB 4NKOA 1J8HA 3VFNA 2UUDH 3V4UH 4U1KA 5CGTA 2MWCA 3BKJH 3V0VB 1AQDA 4DKDC 4JFFD 4FXKB 2EH8H 2XA3A 4Q97A 1NAKH 4HUMB 4P23C 1AKJD 2C3VB 4X6DE 5FHBH 4XCNB 3PWUA 1OGTA 4QHNA 2QQLL 4ODUB 4PYHA 3QCVL 1RY7B 1SM3L 3ROOB 4FQPA 5TE7H 2YK1L 4OZFH 4E41E 2ZOLB 4NNXA 2DYPA 4U1LB 3ULUD 1NBZB 3AFLA 5D2NE 1NBQA 4MCYB 4X4YA 3U36A 3B9DA 1YY9D 1XIWD 1PJ9A 3ALWA 5AWNL 2VXTH 3S96A 3O6KH 5MEPA 4HJGB 5D7KD 3KXFD 4XX1G 1T03H 5DMYA 5FO7B 4P46B 5EBWB 2HLFC 2OR9H 3MLPA 43CAB 1JVKA 4I77H 3RIAF 2VZ3A 4HFUH 3WKMH 5F6IC 1IMHC 4KUZL 3HE6A 4HIJA 4Y4KA 2CMRL 1LEIB 2HWZH 5DJXB 1KCKA 3GSOB 4J23A 2X4SA 2ICWI 3L3KB 3ZHKA 1OP9A 3THMH 2NYYC 3QDGE 1Z2KA 4PR5A 4TSBH 3VFNB 4O58L 3QIWD 1P4LA 1AQDB 2APTA 4PRPB 1GGUA 4B41A 4PB0L 4GLRI 3SBWC 1FZKA 4LHUD 5DJCA 4JRWA 3D69B 4KK5D 1PG7L 3H9SB 3UC0H 1U8HA 3DX6B 3DX7A 1CL7L 1FVCB 5E8EB 3Q3GB 3KYKH 1MFAL 3TYGL 5HHQA 3L1OL 3SDCC 5J0BA 1OGTB 3QWOA 3PP4L 1T6VN 1MFCL 4S1DC 3U79A 3IFNL 3UYPA 5T1DH 5CJXA 4DVRH 3VG9B 1G9MC 4TOYH 4WTZA 1Z5LA 3WN5B 5F6HI 2PUQT 3BQUD 4LCWA 3SGJC 4BSVA 3MLUL 1WBZA 3GSNB 3PGFL 5DRZB 4Y89A 3U4EB 3QBTB 1YJDL 4JCLA 4JG1L 3IFLH 3EO9H 5AG8A 2EE9A 4CJ0A 3G6DL 1YMME 3GB7A 4ZO8A 1EHAA 4PJIA 4DKFH 4K3JH 3MRCA 3QJHA 4PP2B 1E27A 1MWAL 4Z76B 2GTWA 2O93L 2OP4L 2EEAA 4M7KL 1CN4A 3KYOA 3QAZC 4PJ9B 1X5KA 5ABDE 1NL0L 2VLJB 3DO7B 2BXYA 1BOGA 1XF3A 3C5ZA 5JOPD 4WJ5A 1OL0A 3MLYH 2EYTB 4XXDA 1HKLH 5DHXB 1U2HA 5FDWA 1QFPA 5FO9B 4UIKL 4APQA 1NGQL 1MJUL 1FL5B 1F3JA 2ITDB 2J4WL 1P4LB 2YD8A 3OKLB 1HILA 4HQQH 4MQXD 4NCDA 2R56L 3ARTA 1OP5K 2BC4A 1B4RA 3WLBA 4L4TA 2FBJL 4LSQH 1M7IB 5IVXE 2E3VA 5E2VL 1G6RA 4M43L 1ZWIB 2OXHA 4F58H 1GC1H 1HEZB 3WJJA 4MQ7B 5FCSH 4K9EC 1CDJA 1ADQL 1I9EA 3QHTC 5D7JD 3V52H 4LSTH 5IJVA 5DRNA 3SGKC 5TDNB 3BX7C 1Z5LB 3QWRD 3K4ZA 3VFSA 5SX5K 4HK0B 3MV11 1KCUL 3JV6B 4LVHB 5K9JH 1HQ4A 5E2UH 4D94A 2Q8AL 2OR7A 3ULVF 3KWWB 3MRCB 4KI1A 2PN5A 2NNAA 1F4YL 2Z8RA 2FIKB 1FRGH 4U6YB 4FZEH 4C56A 4OIAA 4PGZA 1FNFA 3QUXA 1RZIA 3RDTC 2NX5E 3KPPA 5I1IH 3GKWH 1MH5B 2Z4QA 4IDJL 3X3FL 3D18A 5EU4A 4XPAL 2XRAL 4LK4A 4XP4L 4DWHA 3T1FA 1B9ZA 1DQLL 1C5BH 3N1PC 3PWVA 4F8QA 1MVFA 3QEQE 2MPAL 1AGDA 4I9WE 4KWUA 1GRWA 1BBDL 3PQYA 5E8PA 4JQVC 4M6OL 2J88L 4RBPH 4APQB 3QUYA 1HILB 1N64L 5BV7H 4GG6F 3VDAA 4PJDF 2D03L 3IF1A 3STZA 4N1EA 5KW9H 5ALBL 4PJCF 1T1WB 3OL2A 3SPVA 4LHQB 1FVDB 5DRWB 3MCLH 1YEJH 3NIDE 5F71A 3O6FC 5FK9B 3CVIH 3HNSH 1KCRL 4JFZL 4LRNL 3VWJA 1NAMH 3WIIL 3LKNA 4JGMA 1WQVT 5IMMB 1KTLB 3CH1A 3SJVA 4U6HB 5JZ7C 5GGSY 1ZE3C 1EJ6A 1CDYA 1U8PB 1JPGB 4M93C 4MWFB 1DBBL 3OKDB 3TZVD 4GQ9H 5IM7A 4X6DF 4F33A 1ULVA 1HHGA 1KB5H 2W91A 5FYKU 5DVLA 5L2JB 4QTHA 5JDJA 1HHJB 5FCUH 2MHAA 2W38A 5IV2A 4OJFL 3FB6A 1N7MH 3ULVH 4Q58C 1BPVA 3MV8A 5B4MD 5JA8B 1WWAX 5K9QI 4I4WA 1I3RB 4F37F 4UTAH 1IC4H 4YNYA 5C0ND 5GRUL 2ZUVA 1CGYA 3RWDB 2IFFL 4JY5H 1XF5A 2VDQL 4F3FB 3ZDYE 5D1QC 5C0JB 1E4JA 3A0OA 4TNVK 5EUOE 1X5LA 3MXVH 4H1LA 3MGOB 3T3ME 4XWGH 1AR2A 3DVNB 5J12C 1N6VA 3IF1B 3D2UA 1JL8A 1AD0B 2Z0BA 3RY5A 1MJ7L 5TDPA 2WWKO 4KHTH 5GJSH 4UDUB 3TO4A 1UH4A 2VDOL 1W72B 3OKOA 1EVTC 4QRQA 4PGJA 2KDGA 3IT8D 5I1KH 4OUUA 2EDOA 4QXUH 1NKRA 2Z93A 1IT9H 3RY4A 1Y18A 4HWBL 4NZDA 3EOTH 3AAZB 5I30H 1XGPA 2NW3B 4MDJB 3GMNB 3OF6D 3MRGA 4MJ6B 4U1SB 1PX3A 4POZD 1JWMA 3ET9F 1CGWA 3ARPA 3BYYA 4I0KA 4Q9RL 4TQEL 1LQSR 4HS8H 4LCCB 1P5VA 1K8IB 4F33B 4N1CA 3QUKA 3GK8L 4HUWB 4ZTOH 5CIPA 3QYCA 2MCPL 1C12A 5ANMA 5BO1L 3CZFA 5J1SC 4MJ5B 4QHUA 4XHQA 3NCJL 4HLZG 2Z8WC 3MYJA 1G9ML 3TBWA 2Y5TA 4PJAA 3FT4A 4TVPE 2BVQB 4JFOA 5IFJA 1B90A 3G04A 4QCIA 4HCRL 3G6AB 2FD6L 3G5ZA 5CHNA 3V4VL 1PGRB 3OKKA 4LPWA 3CDYA 3QUZA 3EYUL 1BFSA 1ZTXL 3MNVA 3S35L 1RUKL 2HN7A 4JDVB 2BVEA 5C0AE 3IFOA 4H1LB 5DFTA 1BLNB 2BSED 4V2BA 5I75C 4UV7H 3Q5TA 3QXDA 3BKML 5EA0L 1DEEA 4QRRE 3UBXA 3RBGA 4A2LA 1T89A 3TO4B 4A6YL 2A73A 4WHTA 4TVSa 2C1OA 4EEEA 2Z93B 4EBQL 2HJLB 3IDXL 4WFFE 4PTTA 5DHVH 5KSBB 1FPTH 1XGPB 4JRXB 3QFJD 4ZAKB 3SEPA 3VXMA 2XOTA 4N5UA 1KEML 5J06A 3EIFA 4JFEB 5HYIA 2NZIA 3U7WL 3L3JA 1CWVA 5HI4D 1A1NA 2PYEB 3GIZH 2WQ8A 1VKXA 3KJ4B 4PGBB 4YHZH 5BZWA 2X4UA 3SDYL 1JF1B 3UZVB 1WT5A 4U1NB 4K9EL 3QI9A 2J8UE 3QDJA 3BPNB 5CILH 4I0PC 3G5XA 3GJEB 5D5MA 1N5AA 3RQ3A 1FCGA 4O9HL 3FT4B 1DEDA 1NJ9B 5IG7B 5C92A 5I2IA 4JN2B 1EAPA 4R90L 3BP4A 4YXHH 1EMTH 2UYLA 5JHLL 1I9RL 3RL2B 2CKBL 4ZFFA 3B9KB 4LVOB 3IDMA 4L8SC 1QA9A 5HGDA 1ADQA 1TNNA 3PWJB 2IQAA 3QXDB 4I3RH 3W9DA 1CGUA 3WDIA 1RK1B 4FQXA 4YHYC 3IU4L 2BOBA 4KQ4L 4P4KD 1I8LC 2JKXA 4JO3H 4DGIL 3EJJX 4PJ5D 5AD0A 4GBXA 3V6OE 5ADPH 5I74B 3HNVL 3KPQB 1MHCB 3DUSB 4OD2A 2C3XA 2X5PA 4GAGL 3VXMB 2YUZA 4WW2C 1ZHBB 4XP5L 1MWAB 1ZLWK 2RAMA 2EIZB 2ENYA 4M7JL 4Q6IA 2CDFA 1F58H 2R0ZH 4KZEL 3K4DA 3NZHL 4Z7UB 4KK9C 2X4OA 4Q2ZA 5HVFB 3QQ4B 3QUMB 3TNNB 3P4MA 3MLTA 1SEQL 3NIDF 1G1CA 5T1LD 3IXTA 2X4UB 1FO0L 4HMEA 4XVSH 3P9WB 4HIEB 3OJ2C 1I85C 2LAGB 3L6FB 3QDJB 4EDXA 4UQ2A 1ED3A 2AEPL 4OCNC 3SE8H 2VIRB 2IADB 3K46A 4HDIB 3PWLA 4LDEB 4WIQA 5KG9A 4AK1A 4LCYA 4XAWL 1HZHL 4N90D 3BGFB 1R5VB 2WBJC 1B0WA 3DV6A 1BVKA 3PWPB 3U0WL 1CT8A 3T2NH 5HGDB 4ZUVA 1HIMH 5HBBA 1MJ8L 4LIQE 1TJHH 3DWTA 5MEQB 3L3IA 4KK8C 1S78D 4X6BB 3BPOC 3QHFL 1S7RA 4HWEL 3W9DB 1A6WL 2ICEB 2I60L 1WC7A 4YDLB 3HZYB 1MQKH 4DQOH 5CP3A 2XTJC 4KVNL 1MHEA 5LKNA 1S3KL 4CAGA 4YHPA 5I1GL 1C5DA 4NKDA 3UJJH 2GFBB 1NGXB 1DBML 5EUOF 5MENE 5TH2B 3TJEH 3DROA 4PRIE 4YPGA 3T65B 2OR8A 4MDIA 1DBAH 2Q1EA 4CU6A 5JHDB 5JXEC 1FL6B 1UJ3C 2X41A 1KIQA 2GJ6E 3PWNB 1CFSA 1T0NA 4FFYH 5HHXH 2X4OB 2ORBL 3UXFA 3ARBC 3GMPA 2Z91A 2AJZA 3TBYB 1Q94A 4U1HB 1G0XA 1Q9OB 5EO9A 3GZKA 4N9GA 1NDGB 4WUKL 2NTSP 5DMIL 1LMKA 1A6VH 1MCLA 5J1AA 1FGVH 4NIKB 2ESVD 2ZPKH 3RNKB 3EYQC 1SJEA 3FCTB 4LCYB 4IOIB 4OCMC 5JMOC 3RWEA 4MX7B 3INUH 3IVKA 3LIZH 5FYJE 2W0FB 5ISZE 4PLKD 1LDPH 2DQFB 4Y5VB 5L88L 2HT3C 1CT8B 4F80A 1SJHA 4U1IB 5DJ8A 5HYSA 1IGTA 2EIDA 1OSZA 1ZA6A 2MKWA 2PETA 5CSZB 4KJWD 3UYRH 4LSSL 3W0WB 5DJZB 4RMVA 1IM3B 3WS6C 4V1DA 3HG1B 5C9JB 1QSEE 1WCQA 4X7SH 5C08A 3SDAD 3SBWA 3UTPD 2KUTA 2WIIA 1V05A 3J7HA 3RKPA 5IHZA 2Z31B 4P23B 1PEZA 2CK0H 3UTTE 1BFTA 4XI5D 4WO4A 4NN6C 4I0CC 4DN3L 3U9PL 4QOKA 4WI3A 1NFIB 4ZMAT 3RPKA 5JIIA 3TIEB 3BKYH 5DT1L 1H3UA 3SKJL 4HWZA 2HJFA 3HB3C 4ODSL 1SY6L 5CUSL 4HCRA 3T4AB 5I0ZA 4K71C 3P4OA 4KPHH 2BSRA 4MNQA 1MI5D 4AEIL 1HNGA 2B0SH 3EO0A 5JW5A 4KROB 5E8OB 4Z0BL 2KQNA 3OAUH 5A2JH 5DK2B 4K55A 4PJIF 4NKMA 1R3JB 2F8OA 5FOJA 1S9WA 4ZO7A 4NKIH 4JPIB 2F19L 2UWEE 3GSNH 4IRZH 4A6YA 4OCYH 1NCCL 5L7XL 1XIWC 1ZLSL 4EUPB 5HHME 1D5MB 2FCBA 5BS0B 1OHQA 5HYSB 3D39B 1CFVL 4P59L 5F3HB 4K8RD 4OZ4A 4JB9H 4WENB 3EZJB 3GEWB 4YHLL 5C7XH 1NFDE 1RUQH 5IB1A 2F53D 3UTSD 2H9GA 3HTLX 3VH8G 5LG1A 2F8XC 2F74A 5F21B 5FM5O 5C08B 2X89D 1N0LA 3L5WA 2XI9A 4RGMC 4YXLL 4O2FB 4U4BA 1G7QA 4ODHH 1MCDA 3MA9L 4BZYA 5TJWK 3VXRD 3VFOA 3QIWC 4XZUB 1OTUD 1MCFA 5F9WC 3OKNB 4ONHB 4U7MA 3VXOB 4J3WA 3SDCB 2CJUH 1IKNA 4YHKH 4L4VA 3TV3L 5HGHA 3MLSH 1A6AA 1KN4L 3SGKA 4R4BB 4JR9L 4OAWA 3MV9D 2EZ0D 3W39B 2EDRA 3RWHA 1F4WH 1J7VR 2A74B 5T3XD 2OCFD 1S7VB 2CKBA 2ZCHH 5TE4L 3LHPL 1HCFX 2LAAA 1SVZA 5DURD 1OF2A 3IDGB 1CU4L 1EUTA 3BMVA 3QDHA 3FOLB 4KU1A 3BQUC 4WUUE 1TJGH 2GUOB 1P7QA 3EYVB 5DJAA 2Y06L 3QAZB 3T2OA 4YUEH 1IE5A 5E94B 5C8JB 1T20A 3NCMA 4ZSOB 4D3CH 3N1QC 5CMAA 4NM4L 3ZYOA 1BIHA 1CZ8H 3FQUA 3MGTB 2GY7B 1SVCP 5JW4R 4LSRL 3D1MC 1YEEL 1F3RB 2YEZA 2I9LA 1NGPH 4QRUB 5ADOL 2Q7NA 3RPIB 2HT4D 1JGVL 1LE9A 2PW1B 3DRTA 5MEOB 3DECA 5SWQB 1JZ8A 4UU9A 5GQBA 1GPOH 5E00B 5FUZH 3AROA 1FO0A 3P4LA 3RAJL 2XPGB 2VAJA 3PDOA 3O6FA 3RX8A 3SDDD 3FT2B 3BRGC 5ITFA 4AT6A 3GDBA 3K8LA 5HHOA 3UEZA 3RHWK 3PIQA 4NJAL 5EN2B 4NRXB 4MJ4A 4OAWB 5LGHH 1CXEA 3O41A 1I8KB 4PJ7E 3FO1B 3M07A 2NXYB 5F9JA 2G60L 3R4DA 3GRWL 4P9HH 3ZYIA 2Y36L 3H7BB 2AJSL 3IDJA 2Z8VC 1ONQA 1U95A 3RWIA 4HULB 4EI5B 3FQRA 3MCG1 3MR9B 2N1KA 1A9EA 1ORSA 1YEHL 3LN5A 3RDTB 4HJJH 5DDHA 5CLWA 1A6ZA 2QADD 5F9OL 2DTML 4LU5H 1U91A 2EDTA 1JNLL 1H0DB 5DF0A 1OSPL 1D6EA 4Z5RB 4OCWL 2BY2A 1U8OA 4R26H 3V5DB 3H9YA 4E0RA 5FA4A 3KPOB 4MXQD 5F3BA 2DF3A 1KLFA 5C09E 3SQOL 3RA7H 4KRMB 1Q72H 2HTLC 2IWGA 5IB5B 4PYGA 1EHXA 1OAZL 3ARYA 4H26B 4LQFL 3I6GB 2AV7A 1CXKA 3GMOB 5IUSA 2YEZB 5D1QA 1U8QB 2IG2L 4R97C 5D1ZB 2APXA 2DQCL 3L5JA 4NC1C 4MMZC 1LE9B 3O6ML 5D8JL 5HDQH 4DFHA 3B3IB 5I8CB 3MOAL 5E7FA 3VFUB 5HGBB 1NCBH 3QCTH 1A14L 5F7DB 3R1GL 4KHXH 1L7TH 2EE6A 1RUMH 1J1OH 4BFGA 4BFIA 1XGTA 4ERSH 4CU7A 1DQDH 1MQ8A 2DMCA 4NQCD 3QNXB 1PKQB 3LKOB 3OX8A 4Y16B 1OPGL 3SCMA 3GBNL 1AXTH 2VXQL 1OAQH 3PIQB 1BD2A 2MOVA 1MCPH 4JRYE 5HYEA 4TRPH 1JPTL 3PNWB 2K1MA 4UAOC 5DD5L 3D85B 2B1HH 5FEBA 1L7IH 3OGOE 5FB8B 1ZA3A 3SO3C 3Q6FA 3HI6H 1R3LB 2P24B 3EDFA 4X80L 3RVXD 2JJUA 4NN7C 2AJXH 4XCYA 2FX9H 1KJVA 3ARDA 4HX1B 3MUGA 3TZVC 4QXGL 3T77A 5D2LA 4G9FE 5IQ9A 5F3BB 5E08H 3GJFK 2OTWA 2PW2B 4Y1AB 1T83C 2V2XA 3VXSE 4LLYA 1G7HA 2DLFL 1U8LA 1QBMH 4RNRA 1UB5B 2NR6D 4E9LA 3ARFA 1MREH 3CFJA 5D1QB 5LQBH 1CDCA 1T2XA 4LKCB 3RGVD 5B4MC 2JCCE 1JFQL 3ARSA 1HSBB 1BECA 1CFTA 5KOMC 1UKSA 2UWEF 5FGRA 5C0NC 1Q9KA 5F7YC 1SY6A 2V5MA 4Z7VE 4JDTL 4NQDE 5DQ9B 3T4YA 3ZYJA 2X70A 5SWSA 4B0MM 3EGSA 4OZIB 4H1LH 5C0CD 1WBXB 2QQLH 1U8NB 2EE2A 3ARGD 4X9IA 1A7BA 3OKYA 1CIDA 3HC0A 4PJGE 3RX7A 1SM3H 1IGIL 5HHNA 5GIRA 5EU5B 3H3BC 3MV7D 2YSSB 1OGAA 4RAHA 5EOTB 3OHXB 2LU3A 2B8OT 2X4TA 1M6OA 2Q76B 2FECL 1R5WA 1ZLUH 2IPKB 5E2WL 5BW7C 3WNMA 5AWNH 3WHE0 1AQKH 4KI5F 3I3DA 1LE5A 5FGCE 4LQ1A 3RTQD 1JZ3A 1QKZH 3T77B 2VZTA 1U9KA 1PG7X 2R1WA 2IAMD 4GAFB 3VXPA 4MAYD 3VMOA 4QWWD 1T04A 2ZJSL 5D5MF 3S34H 3RVVD 3HC3L 5CEYB 2CMRH 5EH1A 1UH2A 2VKXA 4YEEA 5AUMA 2IPUG 1G84A 4HXAH 3DRQB 4NNYA 5CIPH 4ZUWA 3LRSA 3F58L 2J12B 1KXVC 3IJHB 3PGCA 2AK4A 4O58H 1TVBB 3CFCH 3LSOA 4PB0H 5SWZB 4LDOB 2IANA 4GAYA 1I8LA 2O5XL 4JQXC 3T4YB 1CL7H 4WU5A 3TYGH 3CC5A 1CD1A 2GQHA 3L1OH 4HBCH 2NY2D 4Q74A 3PP4H 1MFCH 3UTZA 5J13C 2RCSL 4UOW1 1K2DA 5T3ZD 5F88B 3HR5A 3TPKA 3TLRA 1YPZA 2WWMD 2P5WA 3MLUH 4FP8L 2WBWB 1YJDH 4PRDB 2H3NA 2X4TB 3MX0A 3RU8L 1MCQA 4JG1H 1TXKA 2C4FU 5IBUG 5C0BD 3CPLB 2ZG1A 1VPOL 4J3OC 3D3VA 2YMXL 3H3PL 5I1DB 1XH3A 3TN0A 5C2UB 4CVXB 1RMFH 4X8JA 2XG5A 3QDAA 4HUNB 2OP4H 4I0PB 4XTRC 2GT9B 5E4IA 2O61B 4M7KH 1AHWC 4PJ7F 1QR1A 1NMAH 3WNKA 2FX8H 3JTTB 5E1AB 1FSKC 3VXPB 1NL0H 4N0RA 2ADIA 4ZS6D 1C08A 5GGUA 2FX7L 3ZL4L 3ARUA 3VRJA 3TCLB 3KPSE 5HHVL 4X4XA 2WBJA 4OQTL 3FQTA 5AUMB 4L8SB 2AKRB 5GGSA 4QHLB 3ZT5A 5DR5H 1A7PL 4UIKH 2R8SL 2AK4B 1NGQH 1MJUH 1UH3A 3TFKD 2J4WH 1A9BA 1ZGLP 3B6SA 1JRHL 4PJXA 2E9BA 5D93C 3DYMA 1B88A 1GZQB 2FBJH 5EBMB 1KLGA 4S2SA 4M43H 5E2VH 1MIEL 3GRWA 1ZGLA 2XXCB 4OM0H 1JGDB 2Q6WA 1SEBB 3DMMD 4LEXH 1EFXD 1ADQH 5JNYA 1K4DA 3MLWL 4WW2B 1TCRA 4GS7C 4IS6A 1AGEA 5F7EL 3MGAA 3NH7L 4P4KC 3FZUD 4ZYKA 4P2YA 1U58A 1VFAB 1NC2D 5C0FA 1Q1JL 2AXFA 3ARBA 2I25N 1D5XB 1YEKL 5ALCH 4XCCL 1HOCA 4OLEA 1OAUL 1G7LA 1XH3B 4GXVL 2BSSA 1J11A 3SGEI 1FLTX 4XNZC 5JOFB 4I2XA 3HUJB 4N8VA 5E6ID 4HUUB 1I1AB 3VRJB 4XP4H 3OZ9L 4X7EC 4LSDA 4K94C 4X4XB 4EQ3A 3U6RA 1BVZA 2MPAH 5GZND 4LP5A 4B50A 1FBIH 5ACMA 5GISL 3KAAA 4M6OH 2NTFA 3SO5A 5C0EA 1L0QA 3BPOB 1N64H 2YPLE 3WS6A 1CD8A 3QO1A 3QRGL 3WJLA 4M9PA 1MCJA 2IF7A 3O4OC 5DRXB 2B39A 4HT1L 4AM0B 3EOBA 5ALBH 2XTJB 3KYNA 1BIIA 4NO3A 1NDMB 5EC1A 4TSAL 3P73B 1S78C 1GGCL 4PJ8D 1I3GL 2Y23A 3O8XD 3WO3B 2ERJB 1KCRH 1YEGL 2EC8A 4JFZH 2JCCF 3RWJB 2V17L 4JFFA 3WIIH 1UJ3B 3BEVA 2A6JA 3MRQB 1YN6A 5CP3H 3PV7A 1XCQB 2VQTA 5INCB 2WUCH 2D7OA 4EN3D 3ARBB 1AKJA 2FZ3B 5BVJB 3MBXH 1HOCB 2QSCH 2VLME 4AQOA 1AY1L 2VISB 3ULVD 3QHZL 4XAKE 2YD3A 3CK0L 4PJGF 3AUVA 2JIXA