2JKJA

Drae adhesin in complex with chloramphenicol succinate
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
139
structure length
139
Chain Sequence
b'GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
molecule tags Cell adhesion
source organism Escherichia coli
publication title A Structural Study of the Interaction between the Dr Haemagglutinin Drae and Derivatives of Chloramphenicol
pubmed doi rcsb
total genus 26
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2jkjA00
2VERA 2JKJA 1UT2A 2W5PA 1RXLA 2BCMA 1USQA 2JKNA 2JKLA 1USZA 2IXQB 1UT1A
chains in the Genus database with same CATH superfamily
1AGEA 1MUJB 2D0FA 2YD9A 2HJLB 4JY6A 4UZSA 3H8NA 2IOOA 4M56A 3WXWL 4GQ9L 4KHTH 4UINH 4JFDE 1ZTXH 4PBVC 2PYEE 4BKSC 4U0QB 1EUUA 3A67H 1Q0XH 5DHYB 5DEZA 5E2WL 4GLRH 5AOKA 2FJFB 3QRLA 3ZZ1A 1MJJA 3DO7B 4BKLB 4PJIB 3V2AR 4ZMWA 4P2OC 2AV7B 3QDME 4ODSH 3QIUC 2IH1B 3E6HB 3FT0A 4A6YB 1N26A 2HVBA 1EVUA 3K2MC 1YJDH 2V7HA 1GGTA 3SDAB 4ERSL 4CGTA 2R8SH 3DRQA 4UV4L 3GRWA 1P9MC 3HS8A 5GGRB 4XVJL 3AC0A 1G7PA 3LCYA 4AMKH 3I02A 3JWDC 4JUSA 2NUTA 4Q9QL 1MCRA 4WWPA 1EV2E 1A6AA 3LHPL 1NMAL 1WWBX 4IEFB 3U9WA 4JQVC 3BEWA 3N40F 1UXSA 4MD0A 1B0GA 3T0DA 2BP0B 4MS8C 3ZT5A 4D0BA 4YOKA 2P44B 2DQ6A 4LLVB 4PJGB 1XF3A 4LSTH 4WTXA 4X9IA 2NY6B 1YY8B 2ZXAA 4PJXF 2H3KA 4K3HA 3HRZB 4LFHG 1I1CA 2JJWA 3W2DL 3BSZL 5EDXA 3FT1A 1RZ7L 2BY2A 5ITFB 5ESVB 4EMZA 4KKLD 1RQ5A 3CD4A 1MCOH 4NC0B 5HYEA 1XD1A 3U7YL 2VN3A 4BD4A 4WJ5A 2ORBH 4KH9A 1MI5D 1YAIA 3FRUA 1S8DA 5I74C 5D4QA 3PNWB 2IPTL 1JGLL 1AHWA 2EEFA 2F54B 5DCCA 4DTGL 3DUUB 4X6CB 4XHJC 1TYJA 4FZEH 1K9TA 5GRVK 1S9YA 3OKEB 4HAFA 1JV2B 3L3JB 3KL3A 3Q1SL 1XF4A 1N4XH 2GJZB 5CD3A 1U8JA 4HD5A 4WI0B 1G9MH 4HKZA 4PJ6A 3EBAA 5CMAA 4F1ZA 3VYNA 4I0PC 1SBSL 1YJDC 1FLRH 1KXHA 4N1HB 4XGZB 5I1LA 3GSNL 3ISYA 2Q5BA 4Y5VC 4BYHA 1YC8A 2K6ZA 3EJPA 4XP6H 4YXHH 4F37K 1NPUA 4XOAA 5HGBB 1EHNA 1HINL 2BVQB 2J25A 5HJBA 3T0EC 4CC4C 5EIIA 2NY0D 1QVOB 12E8L 4EXPX 3NRPA 5KVFE 4CW1A 1FBIH 2JXMA 1S7RA 2OCFD 3F12A 3L95B 1HHJB 4P59L 4PD4J 4QO1B 2OX5A 4EI0A 1GZHC 5FGBA 1XH3B 5D6CA 3JVGA 1E5ZA 3MLSL 3HHSA 4HKJB 3QDMA 4WFHD 5HVHC 2CLVA 4X8JB 3WIHL 1NLBH 1AE6H 3QZWB 2LOEA 4X4XB 3TEWA 4ODBD 4X7EC 4DAGH 2EJ1A 1O7DE 1NGXA 3FH7A 3IBEA 1JXDA 1FAIL 5F7BA 4KZEL 1F41A 2YAQA 4QWWC 3L2LA 4C47A 1NM9A 1EMTL 3DJ9A 5I66A 4NI6A 4PPTA 4XPHH 1NCGA 3P3YA 3B83A 5I16A 2P24B 2BDNL 3HNSH 1XHHA 3NK4A 1JVLA 2DJMA 1AD0A 1DO5A 3FONA 5CUSL 3FZUD 2DZEA 1ZVSA 2VDRB 5BS0E 3GM8A 2WM0A 2NY2C 3FQXA 2Q6WA 1GYCA 4B60A 1ULVA 3RFZC 1VACA 4ODUB 3O9WD 4IM8A 1TZOA 2Q87A 1PW3A 4ISVB 2NXYB 5IHUH 2HJFA 4FKKA 3S34H 1XIWD 4UQ2B 5EU5B 5T5NF 4HHAB 4BGLA 2KZ1B 1M7XA 4FA6A 5IB3A 3VFVB 3V52H 3ZDYF 1T0MA 1OF2B 3U2JA 4GRLD 1JZ6A 2SODB 4FEIA 3CX2A 3ARXA 3QDJD 2H3NA 4L8BB 4Q2ZB 2YBRA 3VWKB 3DECA 1S3RA 1SVBA 1RUKH 3IFOA 4Z0XA 3TEUA 2DWSA 4K3DL 3ZTNL 5IJVB 4M6MH 4BH7B 1JNHB 1DE4B 1UQSA 1K5WA 1NCAH 4PR5B 5E6YA 4X7TA 1UD2A 5LG1A 3N41F 1KYOK 3JBG7 1K4CA 4NQXB 3ES6B 4KKLC 4FE9A 4Y1AA 5HGDB 2XN9B 4S2SA 3ZN6A 4GUPA 4HQQL 2MWCA 2CE6A 5JXAL 1HCYA 1SEQH 3M1OA 1XTMA 1GGBL 2WTRB 5G4OA 3C60C 2NYYD 1JVKA 4Z7OB 4YX2H 1BZ7A 1B4TA 2FEEL 1UASA 1NIFA 3K4DA 1CPUA 2H6OA 4M48H 3VG0H 2EE9A 5JDSA 3FFCE 1W0VB 4ZSOE 1KV3A 4Z7NF 2JJUA 3M45A 1G6RA 5IW1B 2K8MA 3N1MC 3KPRA 5FUOH 4ONGH 1BF5A 1C12B 5E8NB 4LAJH 1AMYA 4JAMA 4P49A 5LBSA 3RWHB 4EUPH 2J2ZA 3SDAD 3WE1A 4AE0A 1MWAH 2MSPA 1UZ6F 3FCSB 1XL6A 3WJLA 3BQUC 3K6IA 2NZ1A 4XPGL 2BNUB 4GRLA 3K71B 1BD2B 3BAXA 4OM0H 3D0VA 1HHGB 5EU6A 5JHDB 5CJBA 3GJFA 4OCSL 5SWZA 4LLAA 4EUPB 3KPLB 3DX6A 1SDYA 4YSUA 4QRQB 4D9LL 2NZ9C 4JO4L 2O5YH 3IU3A 1ZRUA 3RA7L 4C4UA 2Q8AL 1U33A 4N20A 3NIFB 3WE6B 1VFAA 1TVBA 2OMZB 1IFHH 5DD1H 3D39A 4PYHA 2JB5H 5JUEL 3PF2A 4XOBA 4KHXL 2JKNA 3BHBB 1MQ8A 4BIKA 5D1QA 3THML 4BM7A 4XE5B 1Z9OA 2JKXA 1BWWA 4Z7QF 5T1DH 2B5IB 1IEAA 2V9TA 3W9DA 3QPXH 1BVLB 1WEJH 1LYQA 4G6KL 4JFFE 3U7WL 5J5EA 2Z92A 4OD1L 2XPGB 4Z78B 4TLUA 2DW5A 3L7FA 1RIUH 4YO0A 1MUJA 4F9PC 4NQVA 1JPST 5FYKL 4NIKB 2E75C 5J11C 5KYYA 4OI7A 5J06A 4JDTH 3F7YB 3ORJA 1LEGA 2LLNA 5IMKA 3HMXA 2FATH 5AW5B 1RZIA 3NSFA 2BOCA 4NFBA 3LIZH 1T7XA 4HCGA 3KL0A 5BJTA 4M43H 4PGCB 3UCQA 4TUJB 3W0WB 5I17A 5DVMA 4F80A 3BAJA 2APWA 1J0IA 2VABB 1BVKA 2BZCA 4KI5F 3G9AB 3LPPA 4TUKL 3F58L 4HHWA 2X6MA 1LO3L 1KUMA 1KJVB 3CC1A 2IALB 5FC9A 3RILA 1PZBA 4P2OB 1PD0A 4PJBA 1Z7JA 3ZX1A 5AUMA 4G6JH 5A7EA 3TF7C 2FIKA 4LCYB 3SDXA 1LDSA 3ARFB 3WI9A 4ZAKC 1CDYA 1A6TA 2VXTH 5F1NA 3O0LA 2CDFA 4UNUA 4GRWE 2QBWA 4ZJ9A 2DWEB 3KPNB 3NSXA 1H8SA 4L0ZA 3UYPB 5KJRL 3QFJE 4TMPA 5AOMA 4Z76A 1GZPB 2HXAA 3GRWL 1IKNC 2CHWA 4IK6A 4OQTL 1MHCA 4P5TB 3RTQA 1JGEB 3GSUB 2CXGA 4PI0A 5JHDD 1OV8A 1MJUL 3OKLA 2NY3C 4N3TA 1VF5C 4IJ3C 5FUCE 1KELH 3Q6FA 1OTUC 3LRKA 1OTUD 3S88H 4PJ5B 1G1YA 4PMEA 5AQ0A 4OF6A 1OAXL 4HGKC 3X3GH 5IK3B 3LEVH 5DMKB 4Y2LA 43CAB 2F7IA 2A0LC 1OAZH 5I18L 3TVMD 3VRJA 3OMZA 3WTYA 5FOJA 5FYKD 1R3KB 4U1LA 3CSYA 3GS0A 2HYMA 1Z9NA 4MX7B 3CZEA 3LKNB 1B88A 2IWFA 4DUWA 4DNLA 2OSLA 4H2AA 3VXPB 1KEMH 4FQ2L 4GW1B 1UM5L 3B9VA 3NJHA 1E4HA 5LWYL 3SYAA 4WRLA 3T0XA 3O2DL 3LIZA 4XCFL 1S7VA 5IQNA 5DA4A 4UT6H 2O5XH 3AB0C 2YPVA 4OCNC 4RRPM 4OFQA 1JRHI 5D7EA 3R8BB 1JK9A 3WNOA 3VYPA 1BQSA 1MJ7H 1AZCA 2PF6A 3OC8A 5BO1L 2VM4A 2CU9A 3GBNH 4ATTA 2IWGA 4AIXA 3LVTA 3L4ZA 3WG7B 5EZJA 5SX5K 1TSHA 3ZSTA 1KN4H 2LU4A 5FECB 3QIUD 4H8WL 3VSUA 4HPHA 3MV8A 1OAQH 5J4MA 2ZAHA 1RLWA 3LJ3A 4LL1A 4M6NL 1ZA3A 1C5BH 4XNMA 2GY7B 5DT1H 2B2XL 5EOTA 3P9WB 4XPAL 3QUMB 1OPGL 4LF3B 4P5TD 4XAKE 5FS5A 4AQAA 4F3FA 3A6OA 2VZTA 1FO0H 3H85A 1TVHA 2D03L 2ICES 4RZKA 4OD3H 4DH2A 3S5LA 1G0DA 4X99A 3IRZA 4RIRB 3TJHD 4KY1L 4X80L 4XN1A 5J6HB 3HE7D 3HE6A 4JPKL 1ZSDB 4LGSB 4EQ3A 3MX0B 1S2EA 1QTSA 3W11C 5C0RH 1ACCA 3ZKMD 2GTWA 3QNYB 1IVLA 2WKLA 1RVFL 4A7TA 2QSQA 2FYYB 5DZOA 4C83B 4WIQA 1AO7D 3AGVA 4X83A 1KGWA 2O6CA 2CKNA 4O2FB 1JHTB 5D4IA 5EIQA 3QPQD 5C0FB 1F5WA 4QCIA 3MCLL 4JPQA 4OZGA 4XZ4A 3D33A 3QI9A 3OZ9L 4BHUA 3APFA 3RIFF 1FZKA 4TN9A 3W0WD 5L2KB 1ORSA 2X12A 3H3KA 5DTFA 2HX7A 5DK2B 4DW2L 1HZLA 3L81A 5EN3A 4K5PA 4ABUA 5C0IB 4A2EA 1T1YA 4WI6A 3T3ME 3AQDA 1M1SA 4BK4A 1RURH 1ODUA 4DP9X 4LRNH 4XXWC 3TPUA 3VH8A 5IW6B 3US0A 4NUPA 3QO0A 1DE4A 1JNHA 2BVEA 1F3JA 3I9AA 1M1XB 4OAWA 1NCDL 5I19L 5IM7B 4JPVL 2R29A 2H6UA 2HFGL 1FYTA 1GGCL 3ASOB 3BDYL 5F1SA 2VN6A 3IDXH 2YPLA 4JBSA 2XXFA 5DLLA 5C0CE 5B3JF 4AGMA 2WO4A 3QUGA 4FHBD 2Z8WC 2FL5B 3FQWB 1ZA6A 1FORL 2NNRA 3QIBC 3HUJA 4QMEA 3TF4A 4KO7A 2A74A 2VLKB 1UYWH 4OLXH 5F0JB 2NUPB 4H44C 1T7WA 5E8EB 4JHWH 2ZZUT 3VRLF 1BQ5A 4M5TA 4U49A 2VWEC 4IKKA 4PJ8C 1OEZW 4H8VA 3BUDA 3ZRCC 3FAXA 2DTMH 3S4SA 2XNAB 4J2QA 1QEXA 5CZVH 4Q97A 1I3RA 2ZJSH 3BYYA 4HMDA 2F7PA 1JV5A 2C8NA 2QSCH 4O2EA 1NCOA 4RRPA 4TVPL 2B77A 3GSOA 5DI8A 3N1GC 4EIZC 3AADB 2F18A 4KK5C 3MGAA 2XYBA 2YD5A 1DQQB 1KLUA 1QKZH 1LK3H 4OIIH 2Y2YA 3VJ6B 1BZOA 5SWSE 2F54D 4G42B 2F5AH 2YUZA 2NX5E 3GLZA 4BUQA 1TTRA 4MXQC 4DEPC 1RUAH 5C8JA 2CUIA 1ERNA 3QWNA 4Y4HB 3V0JA 3M46A 3IDGB 1FNLA 3RVWC 2DV6A 4M9PA 4WHYG 3KLHD 5EIVA 1A25A 5HI5D 4HS6A 1GTNA 1ZDSA 1I9IH 3DHJA 1YMHB 3G6AB 4P2QB 5DO8A 5EF1A 3DURA 3MLVH 4ZMYA 1MNUH 5I0DA 2MMXA 2OXGB 4CMHB 3DYOA 4H1LA 5GGUB 5ES4B 1RUPL 4O2CA 3MV7E 4OFYD 1E5AA 1K3IA 4F5CE 1P84K 2AJXL 2UY7A 3QEGL 4N8CH 1ZHBA 4UU9B 4DGIH 4LL4A 2EKSA 3EHBD 5CEZH 4G6FD 1QFUL 2BSEA 1IC7L 3ULVD 1TQWA 2J4WL 4GO6B 3UZQA 2R0ZH 3Q2CA 2NYKA 4LLMA 4KZDL 2K4WA 1YO4A 4AIEA 3VWJD 2VSDA 2X05A 4Y5VB 4BK8A 2YXVA 3BISA 1DJWA 1U3HA 4PJEB 1MRDH 2AJUL 5INCA 4PB0L 4U05A 3SBQA 3CFDB 1E6JH 2E27L 5I8EA 3PWLA 3L3OB 5B8CB 2E46A 3A4FA 5T1MB 2CKBA 2M26A 1P5UB 3HNTL 3ENEA 2DLGA 5D1ZC 1SHWA 5BXFB 4L0PB 1JTTA 3SDYH 2XXMB 1JN6B 2PYFA 3D39E 3K2IA 3WS6A 2I60L 4JS7A 5LO7A 5T3ZH 3GHPA 1QTPA 3FPXA 1ZKAA 2APVA 3FRPB 4TLSA 1E43A 4N1CA 4OF3A 3V4VA 1XGPB 3PQYA 4NB7A 1RIVH 2VABA 3QI9C 1TETH 1FL5B 4NQDE 4PJEE 3S35L 4MDIA 3DIFA 3IJEA 3P2DA 2XKSA 5FKAA 4HJ0D 5K9OB 1BPLB 2BSRA 2YJQA 3HS0B 4N2EA 4PBWD 1CK0L 1KTLA 4WNJA 3MRRA 4JE0A 2ILLA 4KJWC 1YEGL 4ZFZA 4CILA 5TK4A 3T04D 5BPPA 1USZA 2NNAA 4OF8A 2I69A 2L0DA 2Y06H 4FNTA 1KYOJ 3HE7A 1J5HA 4W9LC 4Y4KA 4M7KH 5BRZB 1WBZA 4J4PA 4PLJC 1XMEB 4OLUH 1OQXA 3ATAA 4OI9A 2P5WA 1HCVA 1ACZA 4FX5A 2WUBH 4YIQA 3HI5L 4YBLC 3CFJA 5HVWA 4R7NB 3TV3H 2WXGA 1ZVHA 2OL3H 2BIMA 2R0WH 1MSPA 2YRLA 3NFSH 4AK1A 1T2JA 1I9RL 1FF5A 3O8XC 3FRUB 1A6VH 3U4EA 4CKVX 4H8UA 3SBWC 4GKZA 4EZJA 3RZCB 4JFEA 3UAEA 3V95A 2RALA 2RIKA 4PJHE 3ATBA 3BP4B 5HPMB 3D0LB 3CDGA 4MXWH 4NKMB 5LGHL 2CKBL 3JYCA 1LTXA 4D9RE 3R1GH 4JHVA 1K5NA 1SF5A 4WUUB 2NCEA 1JXKA 2JJSA 1G9NH 3UJTH 1I1AB 2F5BH 4IKIA 4XVSH 2GUOA 3QFJD 4YHOL 1EXHA 1PZ2A 3W5NA 1N0LA 1TFHA 2HRPL 2YQ3A 4AZ8B 4JK0D 1CTOA 4QIRA 3BQUD 3GPSA 1JHKH 3QG6B 1JD9A 5EORH 5CJ5A 4F7TA 3KLAA 5D5ME 2EH8H 1HWGB 1SM3L 1FIGH 3MOBL 4KC3B 4I5BA 2W60B 3BZEA 3JVGC 3V4PH 2RFXA 4LU5L 3E8UH 1L9PA 2A38A 4KKNA 1QI5A 1Q1PA 2FJUB 4IIZA 2XA8L 3O6LH 4O9HL 2BS71 3NJIA 1IM3D 3QAZB 1MPAL 3HAEH 3V5HB 3NABL 1XEDA 3L7EA 3EYUL 3QIWB 1J1PL 5L0QB 1G7MB 5GISH 1U2YA 1AI1L 1FVCA 1VGKB 5AZUA 5EOTB 3KWTA 2K4AA 3F65A 4CJ1A 1OM3L 3BGFB 1IVTA 1VAHA 4LZKA 5HVHB 1YUHA 5JPMA 1BYPA 2XTJE 5FKPA 3VFUB 2F1AA 2BHFA 3NSCA 1XR8B 4RCAA 1AD0B 2A6DA 4RIRA 3STLA 2ATAA 2KS0A 4PJ8B 1ZVSB 5J57B 3GSWB 1E4XL 1DVUA 2WXFA 3GHBH 6PCYA 4HEMA 3HG2A 2ARJB 1V7ML 4WWID 3P0GB 3HC0B 3HMWL 1WA0X 4LCVA 4N28A 4G8FB 5BZDB 1V7NL 1U8PA 2JJTC 1V8HA 2N59A 3NGBC 4JFEE 4N5EC 1U8QB 4O2FA 5DR5H 3G3LA 2EECA 5C0FA 3KBEA 4TSCH 3P4NA 1H3GA 2H8PB 4UV7L 4UIKH 4TSBL 1GJUA 3VE0B 2BIHA 5K33A 4BK5A 4X6FB 2ZG3A 1WHPA 3KYMB 3QA3A 5IJKC 3H9HA 2WNGA 4GIPD 5GZNC 3A47A 4WKZA 2BM3A 4WAFA 3HC3H 1NCIA 5L4IA 2CR3A 4JZNB 1TMQA 5IJVA 3DV4B 1BVOA 4JG5A 4I8DA 3MBED 4Z7WB 3T6QC 3J7HA 5HHVL 1HWHB 3TPUB 2Z1PA 4ACTA 4FS0A 5EU7E 1W91A 3L4VA 4PUBH 3ULVE 5C0BA 3H42H 4UT9L 2ZX6A 2FAUA 2NXYD 4EF3A 1T1WA 1WS7A 1X5GA 2HX9A 2JIXB 4XNXL 4Y4KD 3L13A 5T5FL 1TVDA 1NBQA 2BHYA 3SDDB 1R33A 3GMRA 5TQ2L 4DO6A 3WYRA 4L9DA 1EXUA 4ONOA 3UTZB 1KCRH 3CZSA 5JIIA 1J88A 1FG2A 3N42F 3OKNA 2IAAC 4HJ1A 4FQCH 1DBAH 4LGRB 2FLMA 3AMLA 1GY2A 5C6TH 3ARWA 3AU0A 3GIZL 4H20L 1FNGA 1YCSA 1U30A 3FTXA 2CGRL 4IU3A 3WJJC 4YC2C 4AUYA 3EYQC 4G1MB 3QIBB 1MFEH 4NRZA 4PEEA 3CSBA 3NSYA 5IQOA 3HBPA 3Q7JA 1QFWL 2ICEC 2BJML 4IRJC 4HWBL 3WLBB 3ZE1F 1F4XL 1KB5B 4KHTL 4G9FA 1WDAA 1OK0A 1BX2A 5CP7A 4HISA 2HVJB 2ZXCA 2AK4A 3D50A 5KSAD 2JWYA 4OZFA 1TZHB 4BCYA 3CPLA 3IFLH 4XI5D 3CFQA 4FQLL 8FABA 1RZJL 1Z32X 3H1ZA 1OALA 2AEIT 2LU3A 2PW1B 3UO8B 3VX1A 2TAAA 1U3HD 1IAIL 3LKRA 5FHAL 3EOYG 1IT9H 4MDRA 3VD5A 3QUZA 4Q74A 5DDHB 3ARGC 3V5KA 2E7BA 3AREC 3GBLA 2YAHA 3PFQA 4X6DA 4CU6A 4TLKA 1UADC 4ERSH 4UAOB 5DJDB 3O3EA 4AYEC 1SN2A 3FFDB 3MV7A 4ZFGH 5H37G 3VXUA 1UJ3A 4YHYC 3MFGB 3KYKH 4AMKL 2XY1A 2GY5A 3WHE1 2HT4C 3MBWA 4CDGC 1H8OA 4XCCL 1NMAH 1A4BA 2QDVA 3MRIA 1HI6A 4YBHA 1PJWA 3SOBH 3VCLB 4X5QA 4Y1AD 3IKCA 5EIIG 3GHEL 1XGZA 1JXGA 4W9GC 4NQVB 4WGWB 1EAPB 5DFAA 1PPIA 4FG0A 2EXTA 2EDJA 2Q76A 2VUOA 1OY3B 2F8VA 3V4VH 5EOQH 1QBAA 3FT4B 3JUYA 5AW4B 2ZWYA 2XG4B 4L9LC 1ET7A 1UOWA 2OMYA 4X7DC 4FQHA 4Y1SA 2XYCA 4UQ2A 4B9GA 2BINA 2ORBL 2ARWA 2GJ6E 1S7XB 5CJOL 1KB9J 3MUHL 3OTTA 1OB0A 4QGTA 3QH3B 3LZQA 2PCPA 1CFMA 1I8KB 2JELH 4ZAKD 3S2CA 4BE5A 3WUWG 1LP9F 1ZHLA 4PP1C 3V4VB 1N4XL 3SHSA 1WP6A 4ZDHA 5CD5C 1PFCA 2GVYA 2WXNA 3BSGA 2W0LA 2AABH 5FO9A 5KW9H 3PS6A 5DUML 3A0OA 4X5LA 1JD7A 3L08A 1NBZB 1P6FA 3E38A 4FQXD 3U6XA 1FGVL 1XCTA 2PN5A 4FQ1H 4P57B 5A2CA 3VFGL 3FYIB 2KL6A 3V6OE 1E6OL 1YA5A 5ESQB 4V1DE 4N0YH 4H0LC 3PIQB 3EXJA 4G7VL 2F1BA 3JV4A 4ONFL 3ZU8A 3DRTB 1EEUA 3CFKB 1NCHA 4A7QA 1HX0A 4G80B 4OIAA 5JOFB 2YD2A 5EU6D 2DH2A 5GRWA 2W9DH 1UH4A 3VTMA 4UNVA 5CBAB 3HZYB 5AAPA 1Z3GH 2G60H 3BZ5A 4Y4HD 5I1IH 4L9LB 3QP3A 3BT2L 3WIHH 2HT2D 4XBGA 1P1ZA 1AMXA 3FUDA 4Y5YC 5FGBC 2GJ6B 3FB5A 1QO3A 1AXSB 3QARA 5D9SB 4LSVH 4TULL 4N2CA 2P5EB 1KLFA 3QQXA 3WHXB 1NCUA 3RIKA 1WBXA 5HJ3A 4AGQA 5LAPA 3QORB 3HOGA 2FQDA 4ZX5A 2EEAA 2EICA 3UYRL 3QZPA 2RGSA 5J56B 3ZDYE 5FLVA 2VLJA 4F2MB 1CBVH 1OAUH 4ANKA 1FN4B 1AGCA 4OKDA 1C1EH 4B0MM 2CRMA 4PJXB 1WG3A 2J1XA 3ARDD 5K1JA 4QD2E 2WQVA 2WNKA 4TXVB 5J89A 4BFNA 3ULUL 2P49B 3B2UC 3EBHA 4H4NA 4HT1H 3U0TB 1PG7L 3VD0A 3G04A 4PJ7E 4ODHH 4AEHH 2CIIB 1FFNB 3LRMA 1NWOA 2J1KA 1WIUA 4L18A 3BRGC 5F21B 3P54A 3PHSA 3SKJL 4AYFA 4FQIH 4YHZL 5CWSA 3R7RA 2OSXA 3RP1A 5CZRA 3S3CB 4NWTH 1UWGH 4ZMAT 2B9BA 2FIRT 2FUQA 1M71A 1R3LB 1WH0A 3F84A 4XMZA 5D70L 4ICWA 4GSRA 4XN5A 2H0PA 4LPWA 2PR9A 5MERA 4PBXA 3OR7B 5D7IE 5E8DL 3QQ9C 3QZNA 3BPOC 4KK8C 1F6LL 3MMEB 5AVUB 3O3AA 4HS8H 4MA1C 3RFZA 2P48B 3ZHKA 4EZMA 2WLHA 1BVZA 1CICD 3C5JA 1KXTA 3V6ZA 3DO4A 4WJG3 3V0DA 5DJCA 1F6AA 3NMEA 2X88A 2Y1AA 4KFZC 4WFGD 4PTTB 2AI0L 2TSBA 4MJIA 4ZW8A 3IN2A 4CSSA 3FQXB 2Q6WB 3CFUA 5E6IB 3LRSA 5T8IA 3VWJC 3GB7B 3AFLA 5JXAH 1GIGH 3EAKA 3IAQA 3BVDB 4XH2A 1AXIB 5DJZB 1K3ZA 4LEXL 4PW3A 3SQRA 3VFTA 2MPVA 3VGBA 1BAFL 2MKWA 3ABGA 4K0OA 4YX2L 2X2JA 5HDQL 2YKKA 3L17A 1DQDL 2R29L 1FZMA 5IB3B 2OULB 2WWMC 3MLWL 2WWMD 4OZGB 4Y4KC 1BLNB 4GAAA 1BFOB 4M8VA 3TO4D 4P2OA 2FBOJ 3MJ9H 1NEZB 2H8PA 4BDVA 1OARH 3IFPA 5EO0A 1HE7A 1KBWA 5DYOA 4PG9B 4AQEB 5BW7C 3IETB 3SPIA 2EABA 4FXLA 1EWHA 2EVHA 3HG4A 1NIDA 3PXLA 4XX1E 5BZWA 4WKZB 2R51A 1UQSB 2NNCA 3BAEL 1NDGA 2XWEA 3K5SA 4K5LA 4ZYKA 4CC0A 1QOKA 4JZNA 1JPGB 1PX4A 3O2DA 4KROC 4Z7QE 1NAKL 3BAWA 4QXGL 4HMCA 1S7SA 4N4YB 4OZFH 5MP6L 1KOAA 4NZTH 2VERA 5ALCH 2YXMA 2Q8BL 5I5MA 1SY6H 3JWNE 5E0FA 3ERXA 1DL7H 2WTRA 2CO4A 3ZL4L 5EFIA 3CDFA 4MMZA 4XP1L 3QNXA 2FL5A 4HSCX 1WCBA 1KJ3H 3JV6B 3JV5A 1BZ7B 4KRPD 4GXUM 1AGDA 4JN1L 4M6OL 4R26L 4XBPB 3S3DB 1CFNB 5C09A 1T66C 4AT6B 3LKSB 3EJQA 1QSEE 2FT7A 2YPVH 1QSZA 2VDPH 1JPTL 4JRYB 5A16B 5FB8A 3MRHB 3G6JA 1A9VA 5T1DL 1R19A 3K6NA 3L1FA 2Z35A 3F6LA 4JO1L 4XPTH 4LSRL 2X4PA 4RA3A 4NRZB 3GZKA 4GW1A 1IMHC 3U7WH 1OXYA 2BP8B 4GIOA 5EIIB 2FEDD 2KLRA 5HGGS 1EDQA 1OAYH 3GLAA 5FCUH 5AW7B 1K2DB 3ZE1E 2DQCH 1TTGA 3WD5L 2NXZB 4GG6E 1TYEB 2WWKT 5C97A 1N2RB 3O41B 1HZHL 3N40P 5SWZB 1JGDB 5I73C 3J27A 4R8WL 3LX9A 4X2UA 2FATL 1X5JA 4EI5C 3ZGHA 2FO8A 3P73A 4GRWF 3R19A 3EJUA 4Z77A 2C3WA 4M43L 32C2A 3SKOB 2CUHA 3VG9B 1IC4H 4NO3A 1JNNH 3RUGF 2UZXA 2D7OA 1U8OA 4WLCA 2XOTA 5JPNC 2IPUK 2QFRA 1RUQH 4U6TA 2OBGA 3AWGA 3BHBA 4OFDA 4JKPH 3QEQB 5B1JC 5AYUH 3TURA 4H2CA 5K59E 2DLIA 2QQQA 4NNPL 4MS8D 3ATEA 2PXYA 1U6AH 3NRFA 4WEBL 2XWJA 2XC8A 1T6WA 2UVEA 4QHLB 3MV9A 5E4OA 4J1UA 5FK9B 3T8XA 3KYOA 4U3SB 1GJIA 3C8DA 5EUOA 4QTIH 5J3HD 3CN1A 4GS7C 4LMQI 4Q6KA 2CUMA 3OXSA 3ZE2F 3MODH 4YSEA 1L0PA 1EZSA 1QABA 4WI4A 4BWUA 2FX7H 2B1HL 3FHEA 3OZKA 4QPEA 5CKGA 5I8EB 1A7PL 5FR3A 2I27N 4ACPA 2YUWA 5BS0B 3FUFA 5EZPA 3INOA 5ICZB 1A9EA 1W6LA 1X7TA 2DWYA 1YNTA 5EWIH 4P9MH 3BESR 5F7HA 5KSAA 2XV3A 4FFTA 3RWEA 4FLQA 3T08A 4LASL 3SDAA 1HXYA 1MLCA 3NA4A 1BBDH 4OF0A 4U7SA 4X5WB 5F7MC 2JLPA 2YBRB 1BM7A 2H2SD 3CWGA 4L37A 2VB5A 4ELMA 5IVXE 2XN1A 4MDIB 4PJGF 3HI6L 4YAQB 3NJMA 3MV01 5HI5C 3U83A 1XCXA 1P4LA 4LHUA 2VLRB 2WXKA 1F1GA 5MENA 1V55B 3TN0C 3V4PA 4FLSA 4I3GA 4AKQA 1B0GB 1WYJA 3JZ7A 3H3PH 5E8OB 1GRWA 4GUPB 4YHKH 2DWEA 1T5KA 3BJ91 2UXVA 4DHLA 1RU9L 3SE9H 5IHLB 4BKTC 5BRZA 4UBDC 1RFDH 1F18A 3R18A 4IOFC 4DESA 1D5BB 1KCUH 2G3XA 5E94B 3P11H 2Y5TA 3N41B 3Q44A 1X9RA 3OKLB 4P4KC 2G9HB 2NY7L 3SIKA 2DJ4A 1XEUA 2DEYX 1T66D 1G43A 1WUZA 3MYJA 4ZTPL 1MJ7L 3QJSB 4HJIA 2EH7L 3QEHB 1A7OL 4G1EA 4NO5B 3OVUB 2FBJL 2IANE 4BFOA 4XMLH 2OMWB 1A6PA 1RZJC 2AK4D 2XWRA 4XO3A 1OCOB 4AV5A 5DFTA 1CVRA 5JIHA 4E5XB 4MX7A 2WBWB 4XGZA 3WO4B 4NKMA 3WHE0 4TYUA 1WBXB 5HJ3B 3L5WB 3MRLB 1T0NB 3RWCA 2LV4A 1IBGL 3FK3A 1ZLEA 1D7CA 4YH6A 1EEQA 5E8PB 3RHWF 5ACLA 1D7BA 5IB1B 2YD4A 1FUNA 3BWZA 5I76A 4ODWA 3U6XS 3FUHA 2O61B 1CI5A 4PJ9D 2XZAH 3GKWH 4GI6A 5D2LB 2PTVA 4R2GB 4WCYH 1RVFH 2D9QB 3GK8H 1QQDB 1UZ8A 2CHNA 1CQKA 2QPEB 4MCZA 3V9EA 2CXKA 1UXWA 3IGAB 2H26A 3D39B 2D73A 4WFED 1FFNA 3D51A 5IJCC 1YYCA 3P30L 2QSTA 4V1DB 5F1IB 3UO1L 4DIXA 3RNKB 4FCHA 2VZUA 4EOWH 4G43B 3LH2H 1YEWA 1JGUH 3AAZB 3MCLH 4S0TD 1AIFA 1INDL 3B8YA 1LP9B 3KM2A 1E3XA 1KSRA 1JWUB 1UKTA 4PRBB 1VENA 4PRNB 4X6BA 4OTXL 2WQAA 4JL2A 3U9PL 3MJ7B 4H13C 4UNIA 4XNMB 3ARED 5GSVA 3DHUA 1L9TA 4HS3B 1S7TB 3AT0A 3RWGA 3G6DL 5EC1B 2MQCA 4Y2DC 2X9YA 2ATPB 5IEHB 4FEMA 2AW2A 2B7DT 1I53A 2CG9X 3LQAC 3K8LA 3GXUB 2AVGA 1X5FA 4C8XA 1MFCL 5JIKA 1BSIA 2HFGH 4QHUA 1FLTX 2BOCB 1BLIA 4OB5H 4TQEL 1JN6A 5C70A 1XR9B 1R0AL 3PGFL 2IH3A 2KMWA 1FORH 4OBSA 1GH7A 1LEKA 1QSEB 3KS0J 4HPOH 2Z7UA 3FT9A 3S5ZA 4PJIF 5EN2A 5F9DC 1Q0YL 1GAFL 3D2UB 4YDLC 5KG9B 5FWQA 3SDAC 2F9BT 3PDDA 4X5PA 3H53A 1U8QA 4PJ7B 2ALAA 3QG7L 1AC0A 2J6EL 4CN6A 5CZVL 4DP0X 4PJBB 1XGQB 4YFEA 4GXFA 3NOIA 1G1KA 1YECH 3ARFA 3B7YA 5KUMA 3G5YA 3PJLA 3OMAB 2EDYA 4LVEA 2JKTM 2K9UA 4OIIL 4Q0XL 2ZP0T 1KIRA 3QFDA 4L5FL 1T5WA 4H1LH 2VZSA 4ODTH 1VEPA 4MQTB 4HUCA 3VH8B 4JPWL 3OM3B 4MB4A 4POZD 4CSZA 2J8UE 3PL6B 3PGCA 4N2KA 3GSUA 2ZUYA 4NEHB 4J3BA 3SY0A 1Y07A 1Q4NX 2EEBA 2Z31A 4M7LT 1TG8A 2XQBL 1ZHKA 2IMNA 4LLUA 4KJQD 4WHYH 3VD2A 5D2LF 1VGEH 5F9JB 2AERT 1J1XH 4AE1A 4ELME 4LP5A 2OL3B 1NL0L 1UZ6E 2H2PD 4GH7B 1LK2A 3F62A 3L5HA 2WQ8A 3HFFA 1RUPH 1SYSB 3NA9L 3QZBA 3QK0A 3TT3L 2GJZA 2I07A 3MJ8A 4IS6B 5H2BA 4N8CL 4H88H 1EFXB 5C0GA 3MOAL 5CMAB 2NY2B 2WY3B 4JY5L 5EOCH 3SQBB 4N2IA 3L1OH 4PJDB 4XHQA 3ULAB 1QFUH 1MCFA 2P7TB 2OZ4L 2QVMA 4A2MA 2P8MA 2J2ZB 4N2LA 5A16A 3OSKA 5FB8B 2A6JB 1HNYA 2IFFH 4YDVB 5HGBA 5LDSA 3FCSA 5M95B 3QDGD 5GRZA 2GUOB 3LZOA 1P4IL 3N44B 2BP8A 4XVUC 3JTTB 5D8JH 2IGFL 2QPSA 1HQ4B 5CEYA 3D07A 4F2EA 4ZFFB 1N3NA 1V54B 3CSTA 3I84A 1GPOL 3O4OB 5C0EA 3IMSA 2Z8SA 3IE9A 3QORC 3D2TA 4YHIB 2D9CA 1GC1C 3M8OL 1XAKA 3LRLA 3G6AA 2GI7A 1QW9A 4YHML 5AW1B 3EYSH 2VYRE 4PJFF 2ZWLT 4FLRA 5C0CD 2GSIA 4XNYH 1I8IA 4AM0A 4JUTA 2LE9A 1TLKA 1SJXA 1RIVL 3KPQB 4JFZL 2GFBA 2WVVA 2XQYA 5C0ND 3O3EB 1DVFA 3VM5A 4E0RA 2DQIL 3CVBA 4JRXE 3T6WA 4BXVA 1TTBA 4AYMC 1Y1DA 3FTGB 1BQHA 3QNZB 5KOMC 1OSEA 1ZK5A 5T5FA 2X4QB 4LB8A 3EBIA 3ZHDA 5EA0H 1X7QB 1HTYA 2Y06L 4M4RB 1QZ1A 3WS3A 3N1QC 4P2RE 4O02L 5KVMC 2WSKA 3IFNH 3IJ9A 5MEPB 3K91A 5HHPB 3VVWA 4N6RA 2Y9RT 4ZXBC 4LARL 2HWZL 2K70A 4P05A 4HCFA 1XDTT 4QHKI 1KBGH 4F27A 2WUBL 2NCMA 3RVTC 1ZV9A 1G9NC 4JN2A 5EU5A 2QR0A 2XG4A 3VFMA 4LLDB 5K5YA 3BN9D 4M6AA 4KXBA 1U8PB 4ELDA 3RDTC 3CVHA 1I9RH 3WO4C 2OM5A 4M62L 1J8HB 1NUNB 1MEXL 2R1YA 5D7JC 1Y0LA 2WLIB 4L4VA 4R5XA 1UZGA 1GOFA 2FX8H 4FFVD 4FXGC 3CX5K 2PCPB 4KI5D 1QUNA 4M8QA 3QDAA 4HUWA 2VH5H 2ZUUA 1ES0A 4V2CB 3AM8A 4AL8L 1L5GA 4QLRA 2HUHA 2KPWA 5F6IC 2CHXA 1J9RA 4Z3IA 2NY1C 25C8H 4PJAA 3WSQL 2X4UB 5D1ZD 1TJHH 3MO1A 3S88L 3L9RA 2F58H 4F24A 4ZW7A 4AL8C 2D7QA 2C4FT 4ZS6C 4LHUB 2WGXA 1I85A 5TGBA 3X2QB 2YAEA 4C56D 5I1HL 5JHLH 2A1WL 3T0AA 2EDMA 5JPMC 4Y4KB 1Q8MA 2HAZA 5IVZB 3LV3A 5LQBH 4QXTB 5D7KD 4P57A 4YHOH 3VH8G 2FEJA 2GI0A 3HKZA 1CLZL 4PGJA 4TV3A 2P3YA 2GHZA 4X5XA 3D7PA 1UWYA 4KDVA 3TNMA 3CFCL 3W82A 1IM9B 1SM3H 3B5HA 1MAKA 3KJ4C 4YE4L 3MOQA 3D30A 4TVSa 1TTUA 4PJFB 2D7TL 1WT5A 1TEGA 2AQSA 2XNAA 3KD4A 4TUUA 5K9QI 5KBLA 4AYGA 5FFOA 1BEYH 4X4KA 5D6DA 2MCMA 1T03L 4Y5YA 3JWDL 4MJ6B 1MPAH 4POUB 4UM8A 2ZUVA 5E4IA 4XODA 1JHLL 3NABH 3RX7A 4BZ1A 3TZVD 1HILA 2EQDA 2OMBA 3R8QA 5SX4H 2Z91A 5L7XH 1AI1H 4MJIE 3FYEB 2EYTB 4JANB 3C60B 1B6DA 4H0GA 4ODSL 3VFSA 1UD5A 1JNJA 2E74C 4KTEL 4EUPA 1IL1B 1T1ZB 1ZLWH 2D4DA 4M00A 5CEZD 3HLAA 4DF9A 1J11A 4YMPA 4GG6B 1K6QL 1OGAD 3GSQB 1TVBB 2OMZA 4GSUA 3QCUL 5JW3L 1OLZA 1IM9D 2MOGA 4N2NA 3SKMB 4FXKA 3DSNB 4L1BA 3T0WA 4QXUH 4DEWA 2DI9A 3RGVC 5IB4B 2ICWI 4HZAA 2RTTA 3FTYA 3G7TA 1XSOA 3JTSA 3GI8H 1KEGL 4TSCL 5DUPH 1O6SB 1R3LA 2Z34A 1ZA3B 4KJPD 4L1DA 1AGEB 1TZAA 2K3HA 3FQNA 4MRBA 1U3YA 4NQTA 4PRHA 1JWMB 2DMCA 3BRDA 3OR7A 1JVOA 1HOCB 3EUDA 43C9B 4Z78A 3TFKD 1CXFA 1I9EA 3I74A 2EXSA 3B5GA 4I0PA 4ZUUB 2ZP8A 3CFBA 5LUMA 3D1MC 4XN2A 2UUDH 3SGDI 3HC3L 4FLOA 4WV1C 4J4PC 2R69H 1AGBB 3K80A 2DB8A 2IAMA 3NP4A 5KANG 5M94B 3DETC 3IF1B 1ORQB 5AD0A 4DTGH 1NOFA 3AWEA 2R7EA 3FULA 3GSWA 4PUBL 5JIDA 1IC5L 2J8HA 4YFDB 4OCYL 4OLWL 2OMYB 5E6IA 4KUCF 3ZDZE 1DZ0A 3Q1SH 3R0NA 5T33H 4LSUH 4MA8L 4JO5A 4JFVA 2AVFA 2WK2A 1NBYA 4DVBB 5F3HA 4GSDH 1SBSH 1UT1A 1HHKA 1KCRL 2OXHA 3EO9L 5I1AA 2CAKA 2WLKA 1I85C 3BD5A 3D2UA 5TFSH 5KG9A 3LPFA 4LCYA 3SDXB 1M05B 4X6CE 2OMUA 2WAQA 4RFNB 1TENA 1A6TB 4N0CD 1KENH 5F1NB 1BWMA 4MZIA 1R5IA 2NNAB 4DP4X 1CDUA 3COOA 1WBYB 1DN0B 2WINB 1LLAA 3V6BR 1CI3M 2L7EA 4OUUB 1W9XA 2WCPA 4P5TA 1F3JB 1F4XH 3FUNA 4Z7WA 2X41A 2K9FB 3HB3B 2Z3FA 1S7WB 4DAGL 2ZYHA 5JOFA 5JA8B 5DRZB 4JY4A 3T0BA 2MFNA 3T6ZA 1RZJH 3PUUA 4XX5A 1MHHA 2CQVA 2FBRA 4WY7L 5FYLH 1GS8A 2KQMA 2VLKA 2VDPB 1N10A 1A5FH 2A6KA 2QEJA 2YGNA 3FCTA 1T0PB 1WCBB 2M83A 4Q56A 5AZEL 5B7EA 2GCYA 4BFIA 4E9LA 1LK2B 1PCXA 2GJ6A 1AXSA 3GMNB 3Q8FA 4NSKA 3D0LA 2O4EA 1INEH 3CFNA 4HZLA 3LKQA 4EKJA 3GXFA 1EEZA 4MD4B 1IBBA 3HLKA 3I3BA 3OKKA 1SGKA 1OPOA 3UEQA 5GS0D 5F7AA 4PRDA 3Q43A 3AT9A 4OQ1A 2WC7A 1KCVL 1S7VB 3H7LA 3E0GA 3Q8CA 1B2YA 2F0CA 3ILEA 4PJBE 4A2HA 3MRDB 4YHLL 1K72A 1N59A 5GS0L 1JI2A 3L95A 5ACMA 1F4WH 1IFRA 3OGCB 4QYOB 4UQDA 5BVJB 3AREB 1G7IB 1AFVL 3V52L 1QRNA 1QHQA 4A1RA 3V4VL 2VMJA 2GSGA 3C6LC 3FO9B 4UWQB 5C0EB 4F1SA 2OCCB 4LSDA 4G9DA 1DQKA 1I1FA 3CG8A 5D7LE 3WEBA 3MRFB 3NJKA 3MRCA 2AFNA 4FG6D 5DRNA 1B6UA 3W38A 3NZHL 4MWFB 2HPTA 5A2BA 4ZX3A 4GLRI 4PTUB 4PLKD 4JO2L 3NIDF 4JFWA 3FB7B 3FFDA 2A4EA 2VISB 4JG9A 5EULV 5B1JA 2YRZA 4HPYH 3QYCA 4Q6IB 3OB0K 2NY4B 2F6AA 2D3LA 3ML8A 4OU3A 3VVVA 2MHAB 4GMTL 4PJCF 2OV0A 4HKBA 4JFFA 4MJ5B 5LBGA 4I2XE 2CLZA 2WXRA 4H5SA 5A2FA 5JLZA 1HZKA 1QSVA 3C5SA 3DJZA 5DC0A 1IAOA 1P4UA 1T3FB 4E42A 4EI5A 3W9EB 3FO2B 2WZ6A 3K8MA 4NERA 4EI6B 1QHPA 4O00A 1XVSA 3PWLB 3PFUA 4GB9A 1BQRA 3T65A 2BK8A 2YKLH 1YY9D 5FUOL 5HHME 5BZDA 5CINH 2ICEA 2W9DL 2XT1B 3O3DB 3CSFA 4ZNCD 5KN5A 1L7TL 1MWAL 1HSBB 1U8LA 1J18A 3QIWD 4PWHA 1CLOL 3D3VA 1MCNA 1QLEB 3WJJA 4B50A 1BFVH 3KYMA 3PPSA 3LB6C 4LLYB 4PJDF 4AX3A 5B38B 1B4JH 3BUTA 3GNML 4AQEA 1LWRA 3LQZA 1QUNB 4M8QB 4F33B 4XMUA 4RNRA 5H94A 2FHBA 5DU7A 5DA0B 1DQLH 4TF4A 3QCVH 2DWDB 4YVUA 3UYRH 3T4AB 3B9KD 4GAGL 1D5XA 3MACH 2IDTA 2Q8AH 4BQ8A 1OCRB 2G3MA 3OLGA 1QLEH 3KPSB 1KXVA 3V6FB 2YPLB 4CBZA 3LDBB 1RZGB 2KLSA 4IRJB 4KTGA 3KPRE 3FS9A 4S1RH 2ADIB 3KDMB 4F7PA 1ZA6B 1FRGH 3C5ZC 4Z23A 5KYXA 1SXBA 4HIEA 5KYUA 1AR2A 1TMCB 2UYLB 4W9FC 4D3CH 1KGIA 1JP5A 1BIIA 2OMVB 3HMXH 1FIEA 1YNTF 4G8IB 1HU8A 2OA9A 5FGCE 2NSMA 2G9HA 1WEJL 2CO3A 2YSTA 3ZE0F 5AVVB 2V7NA 3SKJH 1J5DA 3C09B 1X4YA 1JV5B 3U4EB 4OD1H 2CJTA 3K1DA 4QUOA 3S2AA 1J9CT 3VYOA 1UWGL 2BFVL 4F7MB 1C08B 4G1EB 3WN5B 2JKIS 3QIBA 3G08B 5TQ0H 3Q9QA 3BFWA 2DJSA 3KWXA 4ODVL 2CJ3A 5E2UH 3HI1B 3CDGB 3QT2A 5F7DB 2V33A 1AGFA 3STZB 3VD3A 2ZOOA 1FCCA 1GYWA 1X9LA 1ACXA 1UKSA 4HS8L 4DPBX 3GSNB 1Y1UA 5I15L 4Y4HA 3RIFK 4H8WC 3LXAA 4JANA 2VRKA 5E08L 4IKJA 4PB9H 4Y4FB 3QDGA 1U93B 5BO0D 5FFLA 4J2XA 2DS4A 3KPRD 5LJYH 3NSJA 4LSQL 4XNZB 2AJVL 4D8PB 3F58H 4HIHA 4AIZA 3C75A 4F58H 4FQQB 1NGWA 5LBSL 3U0TA 5ID1A 2OKMA 2VCOA 2YQGA 1HQRA 3BAIA 1AAJA 3ULSB 1ZLUK 1FE8L 1G84A 1AY1L 3WDHA 1QX1A 1ZHBB 2NT0A 4NO0B 2ADFH 3GJFH 1P0SE 1ZLVH 5IB2B 3UGEA 1JWSB 5C0AD 2G75B 5AOJA 1L7IH 4F91B 4XVTL 2DM2A 2WLZA 1Q0EA 1GHFH 2WQWA 1UFGA 3FQUB 3M1CA 4YWGL 35C8L 1RY7B 3MJ9L 5SWZD 3TIDA 5ABZA 5IHHA 3RWIB 4PRNA 4X6BB 1S9VB 3ULVH 3NCBB 2FTAA 1CFBA 4OKVA 2NY6C 3MV9B 4QAMB 5GJTL 3RGVD 5CAYB 2PW2A 3RVUC 1BXAA 3BAYA 1Q9WB 4K5OA 1RJCA 1I7RA 2IDCA 3S96B 3BAEH 4IBVA 4ZO8A 2A6DB 2KZKA 4I7ZC 2PPEA 4WU7B 3HIZA 3OPZH 4MJIB 1DBBH 2HVKB 1J5IA 3FQTA 4DN4H 4QXGH 2A9BA 3QJHB 5I18H 2F8XC 2A9MH 5CGYD 2Q8BH 2Y5QA 2VZ1A 1SY6L 2ZKMX 6FABH 1U8CA 4ZUVA 3VFRB 3C2AH 2NOYA 3HRPA 4HEPG 3C6SA 4R4BA 4XAWH 5SWSD 4X7FC 2HKFL 4HJUA 1NDMB 2GW5A 1KEML 2VO8A 3L5IA 5KS9A 1UWXH 5E24E 2PYED 4ZPTB 3C5ZD 1GW0A 4DGVH 1MRFH 2HKHH 2UY6B 2V8LA 3O2DH 3A6BH 3TVMB 4P2YA 1AS6A 1XGQA 3EO1A 1P4LB 4UT6L 3QHTC 4APXA 2OYLA 3FQYA 4B7IA 1U91A 2EDBA 4P3CH 4FQXB 3K72A 2E5EA 3PWNA 2Y7QB 4QTFA 4GMSH 4IU2A 4JZJA 5FA4B 5CS7A 1Z3RA 1ZGLB 2Z8RA 2Y36L 4Z5RB 3DV6A 5IW3A 3CIQA 1GJWA 4F9PA 3NEOA 5CU9A 3QZMA 5D96C 1NAML 4YIQB 5BO1H 2DQCL 2GITA 3Q6FB 5K9JL 3OKYA 2CO1A 1MCIA 1OTSD 1OTSC 2F8OA 1WZ1H 1OAQL 1KXQE 4XMVA 4BJLA 5AKRA 1F4HA 2AKRB 2R2BB 3EGDB 3SDDA 2A73A 1G7HB 2Z7ZA 3K7UA 3CN0A 1TZ8A 4ZFOA 3TESA 1EXUB 3GKZA 3CVIH 3RIAF 1LO2L 1RJZA 2DAVA 1OAJA 3II2A 3KEHA 4HP5A 2HT2C 3BVXA 4ZXBA 1ZJAA 4N0UA 4JKPL 3KCPB 5AYUL 1DJHA 4CN4A 1H6EA 3NACL 4Z7NE 2OK0L 4N25A 1A1MA 3WIIL 1N0LB 5BMFL 2AJZA 2OP4L 1FGNH 1OK8A 3B1TA 4KDTA 3OXRA 1IX2A 3B7RL 3SKNA 4PH8A 4EZLA 3RB7A 4HA1A 2O5ZH 4NGHH 5C0BD 4CVWA 1U41A 2DEWX 1JGDA 4GKSB 2D3JA 2YD7A 7FABH 4I9WD 5KVDH 5DRXA 1JZJA 1MOEA 1SOXA 2A9DA 2VAAA 2YARA 1NTDA 3F04A 3JSSA 3DIDA 1RURL 2V3FA 1AIFB 3QQ4B 4M4PA 4BSVB 4F20A 4WSJA 5LGJB 3EFOA 4MA1B 4MNQA 1PNCA 3WY3A 2P26A 1MCHA 4M1CD 7PAZA 4ALAC 3ARBB 2CDEA 5FW6A 3SDXF 3WGVB 1E5YA 1J05B 4JPVH 1IGFL 3HI6H 1WVZA 5I2IA 1VEOA 1GGCH 3BDYH 5TK2A 4EVNB 2XZCL 2XG5A 4JDVB 5FAAA 5J6HA 2AQ2A 3STLB 5DD6B 3X17A 1DQIA 2R2EB 5FLUA 1A1NA 1UYWL 2NX5A 1BMGA 2UWEA 4JHWL 5I6XB 5D72L 3ELAT 2J8UB 5JZ7C 4R90L 3PJNA 1RU9H 1BEXA 4X9GA 1FVEA 4HXBL 3FO2A 3IDUA 3NK3A 2C9SA 2NDGA 4KV5E 3UAJA 4ANWA 1SRDA 3IRCA 5L88L 2XTSA 3MSPA 4FG4A 4RGOL 3IMRA 2HB0A 1QKZL 2DQHH 4DCQA 1S78C 5IQMA 1F97A 1S78D 4OV6F 2G5BB 2A7BA 3B5TA 4CKQA 3STBA 2FT8A 3O6MH 1XF5A 2XVLA 1BMZA 3D3VB 1X5XA 1H8NA 2GTZA 4PVMA 3C09C 4BFBD 5HYFA 3E2HB 3ZHLA 2V17L 1JGVH 3JZYA 1EZLA 3WFDH 3EXLA 1MAMH 5CCKL 4U1IB 5DJYA 1IC0A 2DBLL 1Q9LA 4J3UA 2X4TB 2QHRL 4NN6C 4PP2A 3TOPA 2EXWD 4RETB 2NY1D 4S11A 2XWTB 1MFDH 4Y2DA 1OZUA 3MLVL 2GBAA 4N0CC 3TLRA 3PY9A 3MV9D 2I5YL 2X1OA 1B4RA 3O3UN 5ESQA 1HHHA 2ZF9A 4H8QA 2KYIA 2WBKA 4JREC 3IJHB 3RVWD 5IOPB 2X9XA 1HFUA 3GUFA 2Y22A 5HVFB 4EKXA 3UPRB 3GKWL 4U1MB 3VI3B 4TTDD 2DQFB 4JFQB 4QY8B 1IC7H 3LQAH 5CHNA 2W9LA 4XC3H 4G7RB 2C9RA 1ZLUH 3F7PC 2IADA 4NFDA 4FL4B 3NDYE 3NJGA 1FJ1B 4ENED 4K2UH 2FVNA 3FQ4A 4KK9D 1JGUL 2FQEA 4NC2B 4NKIH 4PJ5D 4NKQB 4EAEA 4WHDA 1KLUB 1J0ZA 1L9OA 1ZLSL 1MRDL 4QT5A 4PB0H 5MHSE 2XPYA 1PS3A 3NT0A 4LRIA 4YDVA 2E27H 1MLBB 1RP8A 4B3VA 1M6OA 4XMTA 5HVGB 4Y8AA 4NQQA 1RERA 5CKAA 2UZYA 3KYNB 5D2LE 1ZLDA 4MAUL 5JXEC 2A5UA 5C7XL 5BZZA 5EEXA 4M5SA 3T0EA 5IMOA 1TZHA 3BDXA 5ADOL 1QG3A 5T3ZL 2ZONA 4NKOA 1I8UA 1S3KL 1XGRB 5BUPA 3RL1A 2EDOA 2ZXWB 5DD3L 3DK0A 2R4SL 5E6UB 3LKPA 4N2OA 4OLEA 5TPWH 5BV7B 1E9QA 2WMPB 1HVXA 1VA9A 4O2CB 4JG0L 1BQUA 1FSKB 2ESVE 4AIZB 3MYZA 2H1LM 3KPSE 4OZIB 1RZQA 4E5XG 1SJHA 1UXWB 2UZXB 2WZ0A 3RHWK 1GL4B 1H3PH 1A0QL 1J1OL 3VFNB 3NCFB 4K71B 4G5ZH 3KNBB 4PV8B 5EEZA 5JHBA 1TJXA 4KI5E 3VMOA 4TS6A 5BV7H 1WAAF 3UTSE 3QXAB 4ZXBD 5KBMA 3GIVA 3GINA 4PS4L 3VCLA 2BNQE 1W80A 3MPCA 3D34A 3DXAA 1FI8C 3EW3B 4BWTA 4Q0XH 4I0PB 4ZUUA 3EUUA 4LO9A 2ZG1A 2PW2B 2R0WL 4GFTB 1ZJBA 5C9KA 3DMMA 2F08A 4E9XA 4R5TA 3ZL1A 3N85L 1N18A 1ORQA 5AD0B 4PCSA 5ETUB 4K8RH 4QHUB 4AQ8C 5D5MF 2BWQA 3QJQB 2QHLA 3TS8A 3KAAA 3VXOB 1J1XL 4L4TB 2AQRA 4WI3A 5KSUA 4YPGA 3VXTA 1SJVA 5DURB 2BSSA 1NL0H 2XTJB 1Y0LB 1J87A 3QB7C 1LL1A 5IREA 1Q1JH 3NA9H 4J28A 4N26A 4FFZL 1PFOA 5I1CL 2YD3A 4OM1H 1K8IB 3CZLA 4YL4A 1MIEH 5EZLA 2JCWA 3MLXL 4FP8H 5EOCL 3VXRD 1R3HB 4I9WE 2UY6A 4L4VE 5DHXB 5CCJA 5DZLA 4KOBA 4AUJA 3LHAA 4TM9A 2VDKH 3TN0A 4FLHA 3SODB 2MTAA 3HVNA 3CHRA 1FIGL 1NFKA 4W9JC 3INUH 4ADIA 3ZBMA 2ZSWA 3MRPB 2UXFA 4NUJA 4UIMB 1DQMH 4NBYB 1MG2C 5HGHA 4ZYKB 1NA8A 3HUJF 2SEBB 1AZRA 2OTWB 4W4OC 1BAWA 1S5IH 4LCCC 4KKPA 5CCGE 2VIRB 4X4YB 3D85A 3FO1B 2HLFC 2GITB 2AGJH 3X1NA 3O45B 5KSVB 4JFDB 5ESVA 4DEPB 1TQTA 3SB3A 3V55A 3NFPB 4S1QH 3GSXA 4R96B 4E41E 2VERN 3GXIA 4XRCB 1YEDB 3UBHA 3WMQA 4XP4H 3H3BC 4N8VB 4HOZA 5KVGL 2A73B 1S9WA 2QADC 1OB1B 2YSSB 2LGNA 2WZPD 1D5IL 2I07B 2WZ5A 3MJ8B 3VGGA 2K78A 2BNRD 3SGDH 4LVNB 4JFZH 4Y8DC 5GGSY 5GJSH 1Q94A 2FK9A 2BO0A 4I3SH 4PY8I 2FD6L 3LMJH 3JV0A 3QRBA 2FZ3B 2DQIH 3GHBL 5HDRA 4N0UE 2GJPA 4XB8A 4XVJH 5IFJA 4P99A 3RWJA 1UJ3C 3VI4B 4AJ0A 5T1LA 3D9AL 2DYPA 3HMWH 2ZX7A 4HK3N 1A02N 5E8PA 4HBCH 3DO3A 1IL1A 1T1ZA 2RMNA 1EJ8A 4JPSA 2Q7NA 4NP4L 5IB5B 4O02H 4L29B 3B6SB 4ODWB 4C4KO 4KUZH 5E1IA 8PAZA 1DJZA 1U2CA 4NO2B 3OGOE 2A4ZA 4L1TA 5IZ7A 2VL5B 2ADJA 2L8AA 5JA9A 3EOBB 1ZDQA 4UV7H 2H41A 1KBGL 4LDEB 1A3LH 3PV6B 2BVPB 4LSTL 5DJ2B 2EDNA 5DWPA 2YLKA 2JF1A 3GBDA 1J9QA 4U6YB 5TD4A 3US1A 1UENA 3V0HA 4PLNC 3UTQB 2CLVB 2WGNB 4X8JA 1P84J 1UJTA 5CSZA 5K9KB 1BZ9B 2DBJA 1CD0A 1NGXB 1J5CA 4QRRB 4TSAL 4NRXB 5D1QC 4JLRB 3RDTA 2BOLA 2UWEF 2J1YA 2WVVB 2OJEA 2AK1L 2ZX5A 4KKRA 3JWNG 1EJFA 3PP4H 4GUQA 1JCVA 3ECBB 25C8L 2A0LD 3FTGA 1TJHL 3MZTA 1B3IA 3ISWA 2IAMB 3GS4A 4QAWA 4YDJA 2H0JA 5CSGA 1HSAB 1P6WA 1WITA 1RULH 5TQ2H 4WUUE 3QEQE 1J8HE 4KRLB 5LQBL 2IOIA 2YD0A 1BCIA 5MEPA 4FQCL 1HNFA 1DBAL 1YMMD 4NT6B 4NS0A 3RVVC 3OJDB 1GSMA 4MQXD 4XXDB 4HWEL 2JH2A 4EI6A 3QRGL 5I1EL 4YQXH 3WFCH 4WQOA 4YHPA 5HY9A 2VR5A 2VZVA 2VXQH 1IAKB 2B5IC 3TBSA 4HIPA 2ATKB 3QWRA 2VLLB 5EF0A 1HCFX 4LPUA 4NRYB 5JIPA 5CGMA 1B3JA 2EDHA 5GQBA 5L9DL 5DVNA 4RFEB 4JPIB 3TBVA 1OP3H 3UYOD 4AM0Q 4DCQB 1QLFB 2DYRB 3S37L 2Q0ZX 1O6VA 3G5YB 4F7CB 1NLBL 4AVJA 4W93A 2LAAA 2MNWA 5GGQH 1X6LA 3DV4A 5DC2A 3CHSA 1L0XA 3EYQD 2C1OA 3QIBD 4FQLH 4G7YL 4TPRL 4UDUB 3RGVA 5L7XL 4H0IA 4PJBF 3IS1X 1T80A 4PJEF 1F1AA 2EVIA 3GRGA 2ADGB 5HHNA 1PKQE 3LZLA 3PWUA 4NQEA 4QF1A 4DK3A 4Y5XC 1SVCP 3K1KC 3II3A 4ZMLA 2VDLH 4WHCA 4QXTA 5DD5H 1RZGA 4JY4B 1OO2A 3SYPA 2XN9A 2APXA 3LD8C 3HN3A 4NJ9H 4RDBA 2GK0A 4U0RC 3FU8A 4KUCD 1NAMA 4N2DA 1FFQA 3JV6A 1MHHB 3D48R 2ZSVB 4DZ8B 1GS7A 1ZK9A 4AGPA 5EDSA 5KEZA 1K6QH 4GAYB 2ZG2A 4H25B 3FCTB 5JW3H 2QGBA 5IFAH 3ARFC 5GGVY 4FYTA 4BZ2L 4AYSA 3QEHA 1E28B 1WFMA 2BS9A 2PWDA 1IQWH 2IADB 4NO5A 4UOW0 1N68A 4U1KB 4G1MA 1KDJA 2XVGA 4PJDA 2VSCA 1KEGH 1ASPA 3VFPA 5KOVC 4LNRB 2XTJD 3GHEH 1IV8A 3T4YA 1E0OB 4ZQTA 1KIQA 1XL4A 2OLDA 4MXVE 3OV6A 5M7QA 1HYSC 1UWFA 5CZKA 3PWJA 4ODXB 1ADQL 3RBSA 1QFOA 3MRLA 4J3SA 1M6OB 3F8UB 4Z3TA 3F5WB 3D25B 3QDMD 1ZY9A 3BUYA 1ZE3C 3CPLB 2C9XA 2UZYB 3KYNA 3WKQA 1M57B 2V2XA 5CJOH 3B2XA 3ESNA 1KCSH 3FUMA 3VFWA 1HHGA 5EU6B 5JHDA 3DVNB 3FSZA 3GJFB 4OCLC 4QJ5B 2GSGB 3NH7H 3I3EA 2EUVA 4NZ8A 1NCWH 3ZLQC 2BCKB 1OHQA 3FU0A 4M3KB 5GGRY 2WLNA 5DGQA 1ILUA 2ENYA 1WSST 4G8GB 3VUAA 1HQRB 1ZV5A 4OQTA 1ZIAA 1PQZB 1DVTA 3AQZA 1FC1A 4E9WA 1MELA 4PTUA 1DVFB 1OLLA 2WB1A 1IZJA 4PJDE 4DETA 2ZX9A 3LZRA 2VC2L 4HUXB 1I4FB 4IRZH 4MA7H 1H5BB 3EGSB 3KPMA 1DUYA 1JXFA 2ZPKL 1FGVH 3Q8EA 2O6EA 3QZLA 2OCJA 4LVHB 2F74B 3BKML 5JXEA 4AY0A 5JMOC 2RCSH 4F57L 3O6KL 1YC7A 1HOCA 4RX4D 5FV1L 4OKVB 2CO2A 1OGTB 4APQA 2P80A 2DDQH 3I6GA 1ZWIB 3ETBJ 4IW4C 4LPCA 4JRXB 2QADB 4WGVB 3BEVA 5A6MA 3TYFA 3VXNB 2N0MA 5FYKU 3HR5B 4LIQL 3APDA 1Q9KA 5AW8B 2DY2A 4AQZA 4WNQA 1SXCA 2HVKA 5ESAA 2Y2WA 3MUUA 1ZVNA 3OG4B 4CVXB 3RTQC 4LSVL 3MBEB 3REVA 5C71A 3QJHA 2ESVD 2AV7A 4WY7H 1SUJA 3BQUB 4X5WA 1A5FL 5HDBF 4M5ZL 5KSBA 1MDAA 2QL1A 3ME0A 3WUWB 4IOFD 4K5NA 3TTSA 2BSCA 1KFAH 5E1GA 2X6VA 4UB0L 4AZUA 4AWJC 4HZ1A 4PJAB 4NP9A 1K8IA 3ULUE 2JB5L 3HPJA 1E7VA 4RGMC 2BVUA 1T83C 2OR8A 2FIKB 3QUXC 3ZIMA 3D39D 1RD6A 3VSVA 1RI8A 1FC2D 4I48A 3P2BA 1A1OB 3TIEA 1CG9B 5ENWA 4LKXA 5I8OL 2B59B 2XV0A 2LTQC 3ZVVA 4A39A 1JZ4A 4K5MA 3EFDH 3U1PA 4CNIB 1MHCB 2O6PA 3UBFA 1FZOA 1CDBA 2BW5A 3JXAA 2D4FA 2GBTA 1LD9A 2I7SA 1MKFA 1F3RB 3QR0A 2EXYC 4J8QA 3N9GL 4L3AA 5E8DH 3FN0L 3JTBA 1L0QA 1R5VA 1HH6B 4R7DA 5E99H 2VR4A 3ESVF 5JOPE 4R3SB 5EPMA 4BSWB 2PCFB 4IMLB 4E9VA 3BZFB 5F88B 5F8RC 2D3VA 1RJZB 2IH8A 1D5RA 1M7UA 3NZHH 4OLYH 2HMIC 3GMNA 3HKFA 1QRKA 1U8IA 4DGYL 4JO2H 1T7VA 2Q7AA 3FJTA 3GZPA 3UAAA 4N9GB 4HKZB 4OI8A 1R3KA 1IGJB 4U1LB 5CFAA 4NPJA 4OZ4A 5C3IA 3PDGA 4RSYA 3TM6A 2KHAA 2W92A 4AXWA 2EKJA 5IFJB 4W9HC 4U6VL 3L6FB 2AJYL 4F37F 3MRDA 5HDQH 1OGAA 2EO7A 2R29H 1PLGL 2HA1A 3WEMA 4CW1B 5E23A 4GG6A 4NNXA 3SDCD 3RKDD 3BPLC 4JFPA 5E6ID 5ANHA 3SD5A 4E9TA 3H6JA 1JYXA 4NQUA 5KJRH 4OCXL 4NYLA 4U1NA 4J5VA 1I1AD 2VN5A 4ORGA 4PGEA 2JCCF 3B3IB 5CINL 4G9DB 4JFED 4OQTH 4TTGA 4MXQD 1JWSA 4ZMVA 3MBXH 1LP9A 4DWHA 2JKLA 4WF7A 4R5VA 3U0WL 4FNRA 3B9EA 2EEDA 1A6UH 3D09A 3QEUA 3V10A 1C7SA 3MV8B 1RHHA 3A4EA 4JGJA 1JDDA 2CMRH 1HL4A 3CU7A 2ATPA 3QQ3A 5I26A 2J6EA 1F6AB 4NZTL 5ABAA 3EJTA 3CK0L 4XCEB 2VN7A 4J4PD 4PTTA 3LRGA 4GBXA 4UYPA 3VB9A 4M7ZC 2FJFA 1J9SA 1SXNA 3I9GH 5D7SH 1CICC 2J20A 1FPTH 2QPFA 2R7EB 3WTWA 1ETZA 3BCDA 1G7QA 1KBBA 2OJZL 3D4GA 4OCRH 3ALWA 2A74C 4Z3FA 1E5BA 1I1YA 1FRGL 1HE8A 1PZ5A 4FFYA 3ZMEA 1DYZA 2NW3A 1J12A 2PWEA 1FZMB 5FDYA 1QFPA 4PJ8D 1QAWA 4YGAB 2L4OA 3HMXL 4C83A 3VFOA 4U0RB 3LN4B 5ICXA 4BZYA 2AF2A 3BZ4B 2EC9T 4JO1H 4XPTL 2J56A 5IQLA 3EYFA 3O6FA 4F8PA 5IHZA 3I02B 4NM4H 2BFVH 4JFDD 4M29A 2X3CA 3MRKA 5FCUL 2W59A 5TQ0L 1MW2A 2UX6A 4MMYB 5IBUB 3UH8A 3AT8A 1N0XH 5C0IA 1P5UC 5E2UL 1T1YB 3NN8A 2WVSA 3ZO9A 4D9QD 3A23A 1RK1B 2P8LB 2PTUA 2R0KH 3BW9B 4UUJA 2B2XH 4UTAH 3T4AA 1EO8H 5JQIB 4LCWD 4GEIA 1SFDA 2E59A 2WTOA 3OWRA 5ISZD 1DVXA 5E08H 4OD3L 3MA9L 4AH2A 2WKOA 2NXZD 1XGYH 4MMZB 5CN3A 4P2OD 1L9SA 2HRLA 2AJVH 2OL3A 3PP3H 3RPKA 2CUAA 3DXAE 1AGDB 4XBPA 3TA3B 5C0NC 4WFGE 1SYSA 3DUUA 4JPKH 3F64A 5C0RL 4Y9EA 4UDTB 1ZT1A 4JR9L 1SEBA 4MDJB 2ADFL 4L4TD 3TCLA 2ZOKA 5JW4R 3L4YA 2WOBA 1QBLL 2XN2A 1E28A 1GHFL 1H15A 4YDKH 2EVFA 3BIKB 4G59C 4BFJA 3QS2A 4TRPH 1AQDB 2N1TE 5I1DB 2IXQA 3DDFA 2ESVA 2NY4C 2Z91B 2XZZA 1MREH 4L8CA 3JWOL 5DQJA 3Q6GH 3ARBC 4PWKA 4YVNA 1R4XA 3H7BB 4L4VD 2CD0A 4WU5A 5EWIL 3BUYB 4NM8L 5G55A 5IQ9A 1U0QA 4XCYA 5DUBB 1AZVA 5HYJB 1YQVL 2VLME 5I19H 5E03A 3DX4A 5D1XE 1D5ZB 3MKGA 1Z1WA 4JDEB 3SKMA 3P9LA 2WBJC 1KT2B 1TQUA 5GSRA 4A2LA 4G6AD 1SQMA 4YDIL 2GFBB 3U30C 5CN1A 5IROD 1SDAB 4E0RB 1EEYB 1X5MA 1MH5B 3QDJE 1VKXA 3OKDB 4GW4A 3FQNB 1HEJC 5MEQB 2XZQH 1T6VN 3V0WH 1PEWA 2DTML 2CO6B 3KYOB 2F74A 1PYWB 2EE6A 4JRWA 3FU9A 4U3SA 2FH8A 2ZUXA 4K55A 1F11B 4P3CL 2QSCL 3WMPA 4FJZA 4JY6B 4JM0A 5HYJD 1FH2A 4N68A 3EOTH 4TQHA 3WJMA 3CZFA 3EDFA 3Q1EA 4XVUD 2EH7H 2AEWA 1CFQB 2F5AL 2V2TB 1GZQA 5HBBA 2OS7A 4LOFA 3KG5A 1A7QH 5J9PA 1DN2A 2WNXA 1YYML 3N0AA 3BJLA 3ZKSD 4KO9A 4WNQB 2Q9OA 3MLPA 1ETB1 2NY5H 3IGUA 3O0RL 4TUJA 3W0WA 5I17B 4L3EE 1NDTA 4YSPA 3CFMA 1GA2A 5I1AB 1ED3B 3P3TA 1OCWH 2NXYC 2VDKB 5JORA 2BZDA 1NM4A 1F8TL 1NGZA 5T3XE 4QRUB 3W57A 9PCYA 4RFOL 2DTSA 3L9RB 4L1SA 2JI3A 3HN5A 4M8RA 5TGBB 2Y6TE 4DQOH 3D4CA 2NR6C 2B14A 4X7TB 5A40E 2GTQA 3NACH 3UJJL 2B0SH 2C1PA 2NX5D 4FXGA 3SBPA 4OUUA 3GFUA 5EB9A 4AQ1B 4TKWA 2G2RB 3KW8A 4KZDH 4NC1E 3ARPA 1F56A 1WJ3A 3KPSD 3L3IB 3ZQWA 2BIIA 1E3ZA 3UO1H 3H0TA 2SEBA 1S7WA 2ZUSA 2OMVA 3LZNA 1EPFA 3GSVB 3WN5C 5BUGA 4NGHL 4L3CA 4LCWB 5ISZB 1BXVA 1CN4A 2VDNH 4JFSA 4NQCA 3OHMB 2X2UA 5C07D 1E4JA 5KVDL 7FABL 2Y7MA 1S7UA 2XWZA 3FF7A 4KMTH 2K6YA 1MI5B 4J7RA 3E6FA 1FNEB 3J07A 4PJXE 1A14H 2CR0A 3QCTL 3QORD 4NUMA 5B39A 4QHKJ 2GCYB 1J48A 1RZKL 1S9WB 3QDJA 5F88A 1QTYT 1CGVA 2WQXA 3M7OA 1U8HA 2EYSA 5H4YA 2IFGA 3ARFD 3BP4A 4UILL 1MFMA 2VDNB 3GSNA 4Q4IA 4AQOA 1YYLL 4EN2A 3GTNA 5CLTA 5AAMA 2WLJA 5T1JA 4PRDB 5AVWB 1R0AH 5I82A 1OGPA 4N24A 3HC2A 1DVSA 4JREB 1A1MB 1U93A 2XY2A 3ILQD 5DZ9A 3EJCA 1H19A 1OT2A 3LEYH 1WZLA 2X4SA 4QRFA 4D7PA 5C9JB 4FQQA 3NPZB 1Q0YH 3U4KA 2JXMB 2PO6D 4HH9A 2L7JA 1KY7A 2YPKA 1VSCA 1S4IA 5IMLA 3NIGF 3H2QA 4UM9D 3P02A 2VR6A 4UT6A 3JTSB 3QDMB 3MRFA 1MFAL 3QUZD 2JKSA 5DS8B 4X9BA 4KTDL 3OKMA 2VAAB 1JWUA 3TV3L 2ITFA 1M3IA 3FMGL 4FZ8H 5EZJB 4UTBA 3DKHA 4K94C 3TBWB 4L05A 4AJVA 4RMWA 2GAZA 1BVLA 4Z7UB 1GKEA 4MSWA 3ARGA 2VW6A 1NSNL 5FF6A 2V17H 2E86A 4PGBA 3ECBA 4KKCD 4YC2B 3IYLW 2DBLH 2YEQA 1UWEL 3DMMB 4W4OA 3OAWA 5KYYB 5LGHH 4ZZKA 4H8PA 5DD0L 2C4XA 1CYXA 5IMKB 1TITA 4UM9A 2JCCE 3MUGB 2WZAA 1F58H 2BVOA 1TQBC 2APSA 3UJTL 4G71B 3EYVB 3MOAH 4GINA 2EIJB 3GO1H 4LLQB 3WBDA 3ULUF 5KSUB 4K9EH 1EAJA 3TO2A 3SPJA 2HRPH 3TBTB 1RIHH 2EXWC 2ATKA 2ODHA 4XC3L 1JHKL 1JHTA 5EORL 1YNLH 4P2RB 1MIMH 2F54E 3ZTJH 1TQCC 4K3JH 4KKZA 3V4PL 1L4IA 3BCFA 5D8JL 2GTZB 2WSDA 2IGFH 3QFDB 1QYGL 1DN0A 2WKOF 4NZUL 5IBLC 3WXWH 4MMYA 4D0DA 1BBJB 5C0JB 3WU1A 1CJYA 3SO5A 1GPOH 3CN4A 4QOKE 3KPNA 4KDTC 4I18A 3REWA 2E9GA 3HRZA 1E5UI 5DJAB 3ZE0E 3DLQR 1F0LA 1E8XA 3HBQA 4XC1L 5GISL 5ITFA 2F53D 4WEUD 3RWDA 5DK0A 5ID0B 1GY1A 5HD8D 4IRJA 2DWTA 3UTPE 4B6ZA 1WGVA 4YXKH 2W1NA 4LP8A 4A2DA 3AABA 1PIGA 3TGXA 3NIGB 4LOUC 3U9UA 4N86A 1RXLA 1ECZA 3ELQA 3MLZL 4JG0H 4A04A 4UV4H 3EH2A 1OB1A 4BQCA 1QA9B 1TO5A 3NJJA 3WEXB 2BX5A 1EK3A 3DROA 3SPVB 2DL9A 2V7NB 4RGNE 5I0WA 2I32A 5ICYA 3VRIA 1T83A 1N8ZA 2LU5A 5KZCD 2QT6A 3C6LD 3LHPH 5F9OL 1MF2H 3TTYA 1FNGB 5L8KB 2W38A 4UMSA 3ZXAC 2C26A 3P3SA 1Y7VA 5F7WC 5DHVB 1PGRB 4W4NA 1A3QA 5CJ8A 3QIUB 4FTVA 5A2IH 1CD1A 4Y4HC 1WICA 2FGWH 4KX8A 4OIFA 2C3GA 2VDRH 3SDDD 4UQEA 4W9CC 4YPJA 3SKNB 3VMNA 1A4JA 5F7YC 3MHZA 3CN2A 3U7YH 1SOQA 3N85H 2NYZA 3ZE2E 5E95B 1EIBA 1IGCH 2FX8L 4HJ0C 4HS6B 5D71L 3HHSB 4HKJA 4WKXA 3EFFA 1JGLH 2EUXA 1CF1A 2ICWJ 5L6YH 5ICUA 1PLAA 1IEBB 3VI3F 2BCKA 3C6LB 1KIPB 2P4AB 4X8GA 2X89A 3ULSA 2A6IB 5B3NA 5AKTA 4JQXA 4QR7A 4OFIA 2WO2B 3AY2A 4NO0A 5DJ0B 2P42B 4YLQT 5TE6H 3P9LB 5T5FH 1FCGA 3S97C 3E7JA 3SDCC 2VISA 4YEEA 1VCAA 3F6IA 4JG1H 5K59F 2F7QA 1BV8A 4QJ4B 1NCNA 4H1LG 1FLRL 1MWAA 3C5ZA 2OSYA 4RGNB 1H3TA 4J27A 2P24A 4KKQA 3S98A 5KYWA 2QPDB 3MLXH 4FP8L 1A3RH 3S5LB 4OF7A 3DBSA 2ERJB 2CJUL 1BVNP 4KVNL 4NZFA 4C56E 2ZOLB 2Q86A 3LNGA 3Q01A 1T3FA 1TJIH 4GQZA 1DSFL 4E42B 1F11A 4EI5B 5GZOD 3T2QA 1IBZA 3N91A 3QZOA 4ABVA 1WQVT 4OGAC 5I30H 4XBEH 5MI0B 4L4JA 4NT6A 1FDLH 3VO0A 2NR6D 4Y9FA 5FO7A 2HSIA 4E9QA 1IJNA 3C8KB 1NLDH 3DX7A 1INQB 5E1AB 3MV8D 2J6WA 3V4UL 1J8HA 2WQRA 3NFNA 4WK0B 1HSBA 4PMFA 1FNHA 4S1QL 3QUYD 3N04A 1IGIL 3L9BA 5TDNA 1FAIH 2JNZA 5AVXB 3FRPA 4UMGA 2BIOA 4U3CA 5D93C 1EMTH 2ZCKL 5KS9B 4YNYA 3CXHJ 1I31A 5FHAH 3ZZLA 1U8KA 5EC2A 1CGSH 2P5WD 5KSBE 4IIQA 1F45A 5EZLB 3NAAL 3PJSA 4X9YA 1NGZB 3EH3B 2YK1H 5C0AA 3RGVB 5KAQG 4ZDHB 4PM1A 1XBRA 2AQTA 4KI5C 2V0AA 2HTLC 2WSPA 4QNPF 2M2DA 4PWEA 4YXLH 4CU8A 3KYKL 1CDJA 4Y1AB 1FL3A 1HAUA 3PWPA 1U3HC 3K74B 1F6FB 2ERJC 4WVRA 1T04A 5HGHB 1CYWA 4NP4H 4X98A 2VIRA 4K7FA 3JV4B 4CNIA 5E5UB 2H9GB 1JZ2A 3SJVE 5GS3A 2V5YA 4MZ3A 3ETTA 1DBJL 3HG1B 1CD9B 3L4CA 4LGPB 2V5RA 3H9SE 4HEPA 3UTTD 4F8OA 1UGKA 1KTDB 1CICA 2XQYG 4HC1L 2NY6D 4U4BA 4XT1C 3PYCA 4Z7UE 1FNEA 4DERA 1OAKH 5J8OA 1SXZA 3CFTA 1D3CA 1JPFB 3FB5B 1TZIB 1VFMA 3II1A 3P9MA 2EYTA 2YA2A 3NCWA 2EDRA 2JELL 3UAJD 2EE3A 5EBWB 4GRLC 2JLLA 4MA8H 4LEEA 4AXWB 1EBAA 3LPOA 1UCTA 4GSDL 1SJMA 4LOEA 5KVEE 5DUMH 2LTQB 2NY4D 4MASA 3MCG1 2RD0A 4CMHC 1TNMA 2EP6A 4KQ3H 2Y4SA 5ERWB 1CDGA 3WFCL 4YQXL 5ABDE 2BVPA 5DJ2A 5A2LH 1QR1B 2Q2LA 2E9WA 5FM5O 2Y3AA 4RISH 5GS1B 3GM0A 5CILL 3A4DA 2GJ6D 4ONGL 2AZUA 4TNFA 5BOPA 3NCJH 5HHQB 15C8H 3TIDB 1BAGA 3ZKNC 2Z31C 2XPZA 3MA7A 3MRGA 3GJEB 3RVVD 4A6YL 3CZGA 3BT2H 1E4WL 4XPGH 3UTTA 3U7AA 2XG5B 2W94A 5IR1A 4KU1A 4OM0L 2RQEA 3IF1A 3I6GB 4JFUA 5FKPB 3F3HA 4PGBB 3VFUA 2W65B 5FYLL 3F7YA 3RJOA 2VQ1B 1WPCA 4A67A 4DSYA 1XR8A 2G3NA 1F2QA 3GBML 5AZEH 1SNRA 3VNYA 2DYSB 2P1YA 1TKWA 3GZQA 3RA7H 2W0FB 1E4XI 5D1QD 4NJ9L 1WWCA 1OAUL 2NXZC 5L8JB 4KKBD 1RJLA 2JCCA 2VE6A 2OXHB 5T3ZD 1IFHL 2HJFB 5DD1L 3VNZA 1M7IA 4B0MB 1FFPA 3K8KA 2DLTA 4HHAA 3ULUH 1KJVA 5IFAL 2N1KA 5I9QC 3QHZH 5D1ZI 3DBXB 1KCVH 5K9OA 4UZGA 1IQWL 2HJKA 6TAAA 2BSRB 1XXDC 4A63A 4YGVB 1TQBB 3VGAB 3NCYP 5I6NA 5GS0H 4UTBH 2XKNA 3MDJA 4F7CA 4NWTL 2R1WA 3IFOB 4YLCA 2HN7B 4Q52A 1RIUL 3IETA 4ES8A 4PJGA 5F72S 3AG2B 1YY8A 4GJTB 4TL5A 5FYKH 1ZMYA 3TIEB 4KVCL 4PN6A 4WV1A 4KH2A 2BC4B 2C9PA 4OJFL 3KPOA 1KPUA 3KVPA 3MZGB 3KLSA 4DP6X 4MQSB 4I85A 3SD2A 1VPOL 4NJAH 5D96B 3KPPB 1OP5H 3HBZA 2CDGB 4V11A 5L0QC 1F42A 4NC1C 3LIZL 5HYJE 4J3OH 3GSXB 3O6FD 4JZJC 3N06B 1KJMB 4FNSA 1G9HA 1KPVB 2AI0H 2DD8H 3BI9X 4Y16A 3MXVL 5DFVC 5DMKA 2G2NA 2Q1EA 4X6EA 2ZWNA 3SDCA 3QYNA 5KAQF 1JZEA 4ZW6A 3SE8H 4DKDC 3K4ZA 2YD8A 1IQDA 2C5DC 2RHEA 3KPRB 3SPVA 1J5OH 1YNKH 3TCLB 2VC2H 2V5SA 3MV8E 1KN2H 5GS2D 1AZNA 5F0MB 3OJMB 3BKMH 1CL7L 5I9QB 4U4IA 3RWJB 2ITDA 4AC2A 1M9SA 4S0HA 2BY3A 1HOEA 4N6QA 4GBXD 1UFUA 2O26U 2PMZA 1NANI 5HDBE 3DTXB 4DGUA 2AEPH 3GRWH 1OARL 4JQIA 2WIIA 3IJ8A 1I3GH 2EE0A 2P8PA 1MQKL 1QRNB 3B2VL 3PAUA 3UTSD 4FKHA 3CE1A 4R7XA 5E56A 2I24N 2KLTA 1KXVC 5I6LA 4ILDA 2X0WA 1MFBL 3DOSA 1ZS8A 3BFOA 3EIFA 4ENZA 1WF5A 3L16A 3HS9A 5HYQB 5D6DC 2OAAA 1ZTMA 1XH2A 2H32A 3GNMH 3DUSB 4ZOEA 2OMXB 4Z7QB 2PWGA 3LEVL 3ROLA 2BVTA 4G8EA 3ZKQD 1SJHB 2KI6A 4RFNC 5K9KA 5LN4A 5ALCL 4NO3B 4M5ZH 3HB3D 4Q6IA 1DL7L 3VD4A 4JLRA 5CSBA 3MV7B 5MHSD 3TH2T 1O75A 4XO9A 5L2JA 3VW3L 3D05A 1H9VA 4OZIE 3ARUA 3QXAA 2H1XA 4QKXB 4PCKA 5GIRB 1KC5H 4J3XA 4CGUB 1MY5A 3IB4A 5EBGA 3BQVA 3T4AC 3EYOA 3DHMA 1J8RA 3L7FB 4Z1PA 1ZLWK 1QLRB 1IKFH 1SHXA 2XACC 4D3CL 2QQLH 4J1UB 1GSKA 2O5XL 4W6XB 4ZTOH 1TZGH 5EUOB 4LESA 2WV3A 4WTZA 4MZRA 3OJDA 4FFVC 3L2NA 5ALBH 1D7FA 2FYYA 4P4KD 4F7KA 3DK2A 1PZ5B 1D2PA 3EFDL 5ETUA 2F53A 4Y7MA 4X4ZA 3V79C 4P23B 3O3DA 4ZD3H 2QADD 5EBMA 4BXSV 1E8YA 4AMWA 4IJ3B 5FIEA 1DUZB 3NIFF 3MBEA 3REVB 1CURA 1ZCRA 4LAQL 3BZ4A 4ABWA 2WUCH 1BVKB 3V0AC 4UQ3B 5DT1L 5I15H 5BNXD 1OPGH 3ZDZF 4OLYL 3FSAA 4H7VA 1NPJA 4AEIH 3V9CA 4LCUA 4IMKC 4PB9L 1SMDA 4AV4A 2VL4A 3ILPA 2ED6A 4JGUA 1ZIBA 4KMLB 2R4RH 2XWTA 4DZBA 3H55A 1K4CB 2GIMA 2YXWA 5SWSB 5KZCB 2ZXEB 2HLAB 3F2LA 4U6VH 2E