2JKJA

Drae adhesin in complex with chloramphenicol succinate
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
139
structure length
139
Chain Sequence
GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
publication title A Structural Study of the Interaction between the Dr Haemagglutinin Drae and Derivatives of Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 26
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2jkjA00
2BCMA 1RXLA 1UT2A 2JKLA 2IXQB 1USZA 1UT1A 2JKJA 1USQA 2W5PA 2JKNA 2VERA
chains in the Genus database with same CATH superfamily
5E9NA 4F9PC 3ULAB 5MERA 4NHUA 3T2NL 5E1IA 1F90H 2Z8WC 2PPCA 3G6JB 4PV1C 3APFA 2WVUA 2K8MA 2EDWA 2VDRB 3K7UA 3MLWH 4BJLA 3Q8FA 3HB3B 4JFFB 4LU5H 1XQ4A 2JLPA 4MMZB 1R0AH 2BSSA 4YBQD 1IC4H 4MD5A 3WIHA 4HH8A 3ULVE 5IB2B 2FLRT 3VG9C 1GS8A 1ZLUH 3MV11 5BXFB 3MTRA 1RPUA 2PCPA 4CN1A 2X4TA 3GSQB 2C4FU 3FMGH 4DP7X 1IM9D 4J3OG 1AMXA 4X8XA 2YAQA 4ZS6C 3ZTJH 5AFAA 2DLFH 4JPVL 1E90A 3F6IA 1XX9C 4N9GA 3H6AA 3WAKA 4HV8B 4LIQH 1M1SA 2R0KL 3F05A 2BINA 1F3DH 2MKLC 4FLOA 4Y7OC 1EQWA 1IGTB 2GK2A 5BS0B 2EICA 5DHYB 4X7EC 4KI5D 3QQ3B 4UQEA 1HXMB 2G5RA 4WWKC 4GG6E 3I3DA 1UUSA 3NIFE 4EJ1C 2O4EA 4N0CD 3PHQA 2OL3A 3FRUA 4G6KH 3O4OB 5ACLA 2ZSWB 2DYRB 4BA8A 4U1MB 3B3BA 3V55A 1INQA 4JDZB 4HWEH 1XD1A 4UQ2B 3WXVL 4Z8FL 1E8XA 2OR9L 4JO1L 3DDGA 4JO3H 4NFCA 4XP4H 5KVEH 2NY0C 3RIAF 4GUQA 4QHLB 3L13A 1UWXH 3BZ5A 1QTPA 3GIVB 1NH6A 1A6ZB 1UD5A 2WVTA 4GSDH 3H9SA 1S7UB 4L2YA 2DLIA 3PHQB 2E46A 4UNVA 1M7IA 3QUYD 3TO4C 43C9A 4ZD3H 3SBPA 3P73A 1SF3A 3HZVB 4Q58C 4QHMB 1TQVA 3GWJA 4PJHB 3NZSA 2MCAA 3ZKXC 2WZ5A 2BY3A 1J0KA 1FL5B 4K7PY 2PTVA 4PCSA 5LGJA 4MS8D 2HFFB 3LN9A 4O2FA 3RIAK 4LBEA 5FUZH 4NSKB 4D9LH 1T22A 1V55B 4UI2A 3CAFA 2YGPA 1B4JL 3LQAH 4M5SA 1BZ7B 5D8JH 1YY8A 4XNAA 1P5VA 5SWSA 2AV7B 2DMBA 1H3TA 4F3FA 1UXWB 3PWPD 3MOAH 1M7IB 1DJZA 3Q44A 2I07B 1E28A 3MLYH 1S9KC 2A4CA 4WW1B 4BCZA 4MRBA 3VG0L 4LOUC 1O5PA 4KBPA 1KTBA 3GSOB 3TBVA 2WXRA 1G7IB 1ESOA 3MGOA 5J1TC 3T3ME 2Y2YA 2VQ1A 2VR4A 1GJIA 1HQ4A 1MCBA 3EJUA 3QA3A 4JG9A 1E6JH 5H4YA 2AKRB 4GQ9L 4J3XA 1F8TL 5I0VA 1EH9A 1P5VB 3KAAA 4G8GA 4U1HB 5KBDA 4WCYH 3OF6A 1I85C 3V4PB 2C9SA 3PNRB 3UAJD 1LK2B 5HDBF 4PRPA 4TLUA 4BWUA 4L8CA 1W0WA 3UIZA 1QSFE 4H8VA 1BJ8A 1CFNA 4OFIA 4S2SA 1DBJL 2ZUSA 3INUH 1BPVA 1A9VA 2M8XA 3ILQC 4AIZB 5AW9B 3Q06A 3QPQC 4JRYA 1PNDA 4XP5L 5AOKA 3N40P 1WK0A 4M00A 3TEXA 4OZ4A 1YEWA 1FN4B 3MSPA 2JB6A 2X9WA 1K4DB 4FHJA 4QWWC 4XPTL 4JFWA 5KSBA 3WHXA 4FQHB 2DYSB 1E6OL 1CT8A 4GKLA 4Y1AA 3L5WB 2UX6A 5D7LE 3W37A 3MXVL 1F41A 3MRPB 2JKNA 3PG2A 2X4UA 1A3LL 2NXZB 2L8AA 3ZDXF 1KFAL 1EVTC 1KXTB 1MLCA 3VWJA 4X83A 3QQNA 1PZ2A 3QS2A 4QRRD 3H55A 4IGBA 1QI3A 4X8JA 4FN0A 2BXZA 2HRGA 2BCMA 1KIQB 3IKCA 3D2UA 3V9CA 5IUCA 5CF3A 2FX9H 4ONHA 4KQ4L 2YGNA 1X4YA 3AB0B 5JQHC 4APQC 5AB0A 2DMGA 4QEGA 4Z0BL 4M9PA 3SE4C 2XVLA 2YWZA 1OTSC 3QFDB 4JDEB 1RZJL 4IK6A 5KYUA 3MRLA 2FE0A 4HMCA 4FQXC 4WK2B 5BZDA 3BAEL 4K15A 2VDNL 1ED3B 1U95B 2J88H 2A73A 2H32H 4D3CL 5IR1A 3B4NA 4JG0H 4F7TA 3JV4B 1OLZA 4MFHA 1OSYA 1VAHA 5MEQA 5B4MC 3RZCD 1HHJB 2LE9A 3LV3B 3STZB 3IF1A 2AJYL 3G9AB 4PP2A 2L4OA 1JZGA 2AW2A 4XAKE 2CRMA 3B9KC 5KVDE 3IMVA 4LP5A 1NCAH 3KGRA 5E2UH 2QKIA 4MA1C 4R7VA 4F33B 1CDCA 4PRID 2E7BA 1Z9MA 4N8CL 2BSRA 3DV6A 3QDJA 2X88A 1NC4A 3D9AL 2A73B 1DDTA 4LCUB 3UABA 1E2WA 1IGIH 4FFYL 3V2AR 5HYEA 1HI6A 2BK8A 4OF6A 1WZLA 1E2VA 1DQLH 1G7HA 1N67A 3QGVA 2WJ7A 2R1XA 4QRSA 3L9BA 2UZIL 3REWA 1B4RA 3ARDD 1SJMA 4OFDA 1IE5A 3LN5A 1ACYH 1DHKA 2A6KB 3D33A 4TQ8A 3P9MA 2EZ0C 1U8HB 4E5XB 3QQDA 3X1GA 2E56A 4NP4L 1XD0A 2WN2A 3OKOB 2R23B 3ULVL 2GC7C 4KTYA 1V7MH 1G7QA 4XNBA 3IEAA 4O51B 3DTXB 1A7NH 2WQ8A 1RURH 4U1IB 4OZIF 1NBYA 1AGCB 4Y4HB 1NEZG 4G6MH 2X5PA 2FJFA 4Q9QH 3D34A 3S96A 4L29B 3GB7A 2MEJB 2UVEA 5I1GL 1BQHA 2O61B 2H6PA 3K5SA 1IVLA 1TZAA 2OPCA 1O6SB 2WINB 2YD7A 5D72L 4RGMC 3QQDB 2GKIA 2DB8A 3QJHB 1S4IA 4WUUB 1M6UA 1T5XA 4Z7UA 1YCSA 3MRDB 3KPOB 1QFWH 2MPVA 5LJYH 4XXCC 3FTXA 5EOCJ 2CR0A 2TRYA 1ZPUA 1RLBA 1OGAE 4G7YH 3MVSA 4P2OD 4J1UB 4WI2A 3O2VH 2NNCA 1SBSH 1QEXA 3FOMB 4NHCL 1R47A 3US1A 1JGVH 2QR0A 3EO1A 5FWQA 1OAZH 3IKKA 1CBJA 4ZUVA 2LOEA 2HZHA 2CPUA 4OM0L 1JL8A 2R0WH 1RZIA 1XGPB 1DQIA 1RUPL 4FL4B 3W39A 1MAKA 1OGAD 1U6AH 3IPFA 3R4DA 3PQYE 3PHOA 1R75A 3DHMA 4LVHC 4NFDA 5KVGL 4NO5B 2WNGA 4XMVA 1UD8A 3N50A 3VMOA 3GUTB 3J8F7 3MCKB 3VGEA 3NGBB 2D7OA 5I30H 4NC1E 4QNPE 3WUWA 4RFNC 3QYMA 4Y4FD 2YO3A 1YMMD 1Q9WA 5JYLA 5DUJA 2ZJSH 4KX9A 4TKWA 4OZHA 3WXWH 3ZGHA 3CZLA 2EXYD 5C0DB 3HRPA 1WPCA 2KPNA 1ZSHA 4OV5B 3WHE0 1M7UA 3BGFC 1QUPA 1QBML 1UXLA 2UX7A 3TV3H 2WB1A 2BP3A 4GLRH 5ICXB 3IFLL 1E67A 3DVGA 2W9DH 1P7BA 5A40E 4KZEL 4PBDA 4LEEA 3VD7A 2K7PA 2VZ3A 4ZMYA 1X6NA 3LNDA 5SX5K 4JM0A 1IAIH 4DO4A 2B1OA 2AI0H 5GSVA 5BJTB 3QAZC 3T4AB 4A04A 4CGTA 4X7TA 2B1HL 4GG6B 4F1ZA 3NIFB 1SLWA 4JFEA 3VFGH 5GS0D 1B0IA 2OMXB 2K78A 1S9YB 3LS4H 4WUKL 2CUHA 2IG2H 2KYIA 4PHXA 5B1JC 3CPLB 2WLKA 2GEQA 5I1AA 2MOQA 2OP4H 2A9MH 2WXFA 4PLKD 4LK4A 4YDLC 2BP8B 2GQHA 5JZ7D 1OAYL 5KVFH 4MQSB 4NAMA 2D8KA 3V4LA 3X3GH 4AEHL 3UJTH 3QG6A 1MRCL 3QJTB 4GEIA 4ETYA 1NGWA 4NUGH 2ZCLL 3O6FD 4ODTL 2FDBP 3ZDWA 3THML 4KX8A 4NKOA 3CFEA 3VE0A 1XF5B 2PWGA 4PTUB 5G5DB 1N4XH 2R0ZH 1XMEB 4GT7A 1OPGH 2ZCKL 4NM8H 5FUCC 3DO7B 3V8OA 2O6DA 3B5TA 4UQBA 5AW4B 2KQMA 1TTRA 5FHAL 3EHBD 1GZHC 3GRWH 3OJDA 5B22A 3P2TA 1OW0A 4WEMB 1XL4A 3C60C 3LZLA 2DIEA 2GUYA 3CVBA 2EXWD 4ZAKD 2YC1A 3IAGC 3WMSA 4FXKA 3KCPB 4FG4A 2XZAH 3IXTA 1E8ZA 4QLWA 2BMKA 2QVFB 1M71A 1XB8A 4CW1A 5ID0A 2DLTA 4GW1A 5DK2B 1MI5E 1XR8B 3N9GL 1QNZL 2QPUA 1ETZA 3AC0A 4E9TA 2YSSA 4PRNB 4EUPH 5CCKL 8CGTA 1SDDB 1HHHB 2GAZB 5D1ZD 2J8OA 4OAWA 2NW3A 2BOBA 5LG1A 3VFVA 3T3MB 3MLZH 3ARBD 4Z95H 1EHLH 5D2NC 2P44B 2QVIA 4PI2A 2HJKA 3CN3A 1MI5D 3EJPA 2PR4H 5BVPL 4LARH 2BMKB 3UAFA 4DEPB 4PPTA 1Q72L 5F1NB 1ZV9A 1GY2A 5D5ME 1OPOA 4PJDE 1TZIA 4HMEA 1AGEB 3L5IA 5I8KL 3ILPA 1ETZB 4YSTA 3FQTA 4PWKA 2J71A 5DJ6A 5HJBA 4ZPVA 3HW7A 1QSFB 3LXBA 3PWUA 4KXBA 2BOBB 1B90A 4M93C 1FNSL 3U6RA 1KN2H 1CGYA 1EXUA 4POZD 5T1LD 1LP9E 5KVDL 1IZJA 1S3KH 3L45A 2ICEB 5DRZA 1C8QA 1WZAA 5ANME 2XPGB 5BV7C 4JZJC 5AW5B 2Q6WB 4PD4K 5EUOF 3WE6A 5L0QC 3PWLA 3TT1H 1RK0A 3HPJB 5JHDE 3UJJH 3V52H 4KNSA 4XMKH 4U6HB 3RKDD 1FQ9C 4A6YH 3ILPB 4Z3TA 4O4YH 3Q8AA 2YFOA 3Q5YA 4KXDA 5D7LB 2ZUVA 3CDCA 3KPPA 2AJVH 4MAZA 3ARRA 1I1AD 2XN0A 3SPVB 3HZYA 4X6EB 2ESVE 4NO0B 1Q9LA 3F58H 3BDYL 1BCIA 5JHDD 4LPUA 1VEOA 4OFYD 4KQ3L 1KCBA 2XIDA 3P3TA 5I16A 2YJLA 1DN0A 1KELH 2Z1PA 4HFWA 4LSDA 4Q2ZA 1XCTB 4W9DC 1FYTA 2O5YL 2HFEB 4XCFL 3S3BB 3WEBA 5HI5C 3RNKA 1BW8A 1MW2A 2WUBL 3BPNC 3M8OL 3N1FC 4MAUL 2ESVD 3DSFH 1R3HA 5EFIA 5HSFA 5EU3A 2J4WL 5F7UA 4U2YA 3FB6B 3FQ2A 1BBJB 1J1XL 1FH2A 4JRLA 5ECGA 5TF0A 1D5XB 3COOA 3HLAA 4JJOA 1ET5A 5KBPA 2CR3A 5DK0A 3I9GL 3HBZA 4Q2ZB 4LDCA 3BUPA 2YXFA 4G7RB 4FC3E 1TDQA 5AKVA 4V11A 1HILB 5HP5A 4RISL 4WI6A 5EFIB 5B3JF 1DBKL 3DETD 2BM3A 2H4EA 5I2IB 2UUDH 5MEPB 1OARL 3OKDA 2L7UA 3IJHA 3WFHB 5ITBL 1DBBH 2C1PA 5BUPA 5GRZA 1SRDA 3QUZA 2J1ZA 1CLZH 1YJDC 1BZ8A 2VNCA 3ARDB 4U0QB 1Z7JA 3RWGA 3P40A 4OJYA 3L9RB 2Y7SA 1PCXA 3TJEH 5BMFL 1WICA 1CDJA 2EIBA 4Y1SA 3K6FA 5C0IA 2BHZA 1YA5A 3RFZA 1UQSA 5GIRA 3BPLC 5JW4N 3QIBC 1AZBA 1VGKA 4BFJA 3EDJA 4G8IB 4ILDA 1L5GB 5DWUH 2Y9RT 4QCIB 3AQYA 1D2PA 2CLRB 5KYXB 3OHMB 1I4FB 2V4LA 3RPIA 3IRCA 2A6JB 4XVUD 3S2AA 3B5GA 3RUGE 3UG4A 1DSYA 4WEBL 1RIVL 3I9AA 3LRHA 3LDBC 2ZX7A 4HS6B 3VNZA 5C8JA 3NYKA 5I1EH 1OB1A 4MAYA 2VISB 2X28A 2PP9A 4KY2A 4M62L 4YQXH 2VW7A 3BZFB 1CF8H 4JG5A 5AUMB 1VGKB 4L1LA 5J7CC 4TTDD 3IJ9A 4HAGA 5D2LE 3E3QE 5AW2B 5D7JD 3QYCA 4A7GF 4B9IA 3HC4H 3TL5A 5I0DA 1T1YA 4PWGA 1NCCH 3OPZH 1KUMA 2VC2H 1A1NB 2AERT 2CO3A 3KPTA 3KYAA 4HQQH 4PEEA 3RZWA 1X5XA 4YJZL 4F1SA 5J5EA 2DI8A 3ARPA 3MBEC 4RGOL 2BW4A 3K2UH 2JNZA 3Q6FA 4XOAA 4LFHG 4PJEA 3PQYA 1HEHC 3FUMA 2VDKH 5IHUL 4LBAA 4LRIC 4A7QA 1E9PB 1K8DB 3JWDH 3GGWB 2JJSA 5J1AA 1EGJA 1OGAB 3VD4A 4OGAD 1H5BC 1LXMA 1U91B 3MLUH 5T8IA 3KNBA 5T1MA 3F62A 1UM6L 1DO5A 2ZXGA 1A3RH 4OLWL 4HIHB 1N3NB 3CZNA 1BVNP 3G04B 3SKNA 4L8BB 5DDHB 2BWIA 3RI5F 3D6GA 3QBTB 1GIGH 4FZ8H 4LNRB 2NY6D 2AMUA 2DQGL 2Z7WA 1CVRA 4JDTL 4Y4FB 1WGOA 2A9CA 3PQYB 3X14B 2HFGL 5FFGA 3X11B 2MJWA 5EPMB 5IB1A 3RDTC 5F3FA 1FL6B 4K94L 3IAPA 2OMYB 3VB9A 5T1DH 2R4RL 4LCYA 1AI1H 3PAUA 4J27A 3KNBB 1E27B 4YHZH 2NUTB 2N0KA 5KN5B 5EHFA 4N0YL 2X2IA 3ZKND 3RI5K 4PJBA 2DQHL 3BP4B 4YXLL 1K8IA 2COQA 5K1NA 2NZ1A 3F6LA 1ZHNA 4IKIA 4XP6H 3C2SA 4XH2A 4NQVA 4QY8B 4OIAA 1HOCB 2BZDA 4QXTA 3UMTA 4PMEA 2V2XB 4EI5D 1KEGH 1LDPL 1PYWA 3UBFA 1A3ZA 4IBTA 1MN4A 2IH3A 3H42L 1J0YA 4RZKA 2HJFB 3QHFL 4UANA 3OVUB 3WN5C 4RCAA 1NL0L 2VSDA 1KGJA 3MRFA 1CG9B 3SE9L 2JCCF 5KANI 4JFUA 2BP0A 5LQBL 3D18B 4XH2B 3BKCH 3AT0A 1S9WB 4FD0A 1TETH 3GHEL 3O6FB 1PYWB 1MCFA 4J3SA 3TYFB 5AW6B 5IW6B 3P4NB 1WD9A 1ADWA 1T0NA 1TJGL 1EAJA 1UH3A 5DZPA 5KBMA 4FFZH 1TF4A 1MCQA 2W94A 4IRZL 4G82A 4HJJL 2GUOB 4JQXC 5ESAB 5TDNA 4B9KC 3KJ6H 3EHBB 5AVXB 4L3FA 3I6KB 3U4BL 1RLWA 4HP5A 1JF6A 1UGKA 1GTFA 4JFOB 1QRNA 3VRIA 3MODH 3A67L 2QQNL 4ZAKB 1YPZF 1ZTXE 2OX5B 2NSXA 5IKCA 1KIPA 2OKMA 5IOPB 3O41A 3KPNA 5CGYD 3UTTE 4G80B 2VR7A 1IBFA 4XNQB 4WK4B 2QV4A 3SQBB 3FAXA 4ZFGL 4LCIH 1J5DA 3E2HC 3T0AA 4J39A 5DSCA 4PB0L 5ACMA 2ZUQC 4OCWH 5BO1L 5IP4A 1RZKH 2DQIH 5GS0H 3NSDA 2JKJA 5D7IA 3DUSB 2BVUA 4FS0A 3ARBB 3UTTD 3CZSA 1AVAA 5IMLA 1CFQA 4J4PD 1NWPA 1MI5B 1ZOXA 2B9BA 2JLLA 4IRZA 3T1WA 2OJ1A 3WKNA 4BCYA 1ADQL 2CDFA 1N0LB 3RL2A 2GI0A 1BAFH 2XX1A 4KVPA 1A9BA 1PSKL 1A7OL 2A83A 4WWNA 3TO2A 3WY3A 4AQ1B 5IIEA 2WXNA 4W9FC 2W88A 2L0DA 4MSWA 4PV8B 3HI1A 3IJEA 5I66B 1TTFA 1BQLH 4PS4L 1R5WB 3PIQB 1HNYA 2Z35B 1HHGA 5T1LB 3IYLW 2DH3A 2EDOA 5D5MB 4PJDB 1RKRA 1OSPL 2EC9U 2X9XA 4HIIB 4O00A 4PJFF 2V3FA 1U2HA 3L4XA 1E8WA 1FIGH 4QYAA 3N2JA 5IIEB 3LPOA 5DZJA 1E3FA 1LP9B 1OGSA 2WTRB 1YY9C 2CKNA 3AAZB 3SDDA 3TM6A 3CX2A 4Z78A 2CCWA 1T04B 5ANMB 5E4OA 3UYPA 2VDQH 3CWGA 1INEH 4G6FB 4DAGH 4ANXA 4GBXA 2X6VA 3HZMA 3C9NB 1QLEL 4NRZB 5JHDB 1HTYA 3OHXC 2BVYA 2W07B 2ZKHL 3JTBA 4LCCC 1ADQA 2AJXL 2NY3B 2X70B 4ZW5A 2XDHA 3MRIB 4UQ3A 1AD0B 1O75A 2ENQA 2CPCA 5D96B 4U3SA 5TGBA 3DVNA 2ESVB 1BYOA 5HDBE 3SDDB 3NA9H 3WKMH 1EHXA 1JXKA 1AD9A 4CU6A 1UJ3B 4ZNEA 4FYSA 3QNXB 4F8QA 4JAMB 2AQQA 2FIKA 2E59A 1DJIA 2XV6B 4YSDA 2A77L 2M83A 2VDOL 4PS7A 5MP6H 2PXYC 5C0JB 1TTUA 3EJYC 3F7VA 5JW3H 2FSDA 2VMFA 2VZTA 4AW4A 1LD9B 2FZ3B 3TJHD 1PD6A 4MTMA 3QWQB 4L3CB 2XA8H 4CU7A 5BZXA 3CXHK 1GZPB 4BH8B 1MCNA 43CAB 2OJZH 2BNRE 4O58H 4U1GB 1GKOA 3OKLB 1SJVA 5F1SA 3ZDXE 5HXMA 2VLLB 2C1OB 1WP6A 2FECI 3U2IA 2GHWB 1UCBL 1FVDB 5LWYL 1KCUH 1RHFA 3WGVB 4L23A 3VFWB 4DQAA 1HCFX 1Q8MA 1Q94A 4R90H 5CCHE 3TZVD 5JHLL 4H0GA 2Y7NA 3K6IA 1X44A 1L9QA 4QTHA 1D3CA 1I9JH 2PWDA 4PLJC 5EUKA 1D7BA 4RBPK 2IGLA 1CTMA 5ICYA 2E5EA 2O6PA 4W9IC 4DGIH 3M1BB 1JZFA 4ZFFA 4M8UA 2JI3A 2XWTA 1QA9A 4HJIA 4E9SA 2DQEL 3Q3GB 3NQKA 5EBWB 2ZD0A 1HESA 1RIHL 4YHYB 3KS0H 1ZLWK 4NGHL 3MRBB 5C2BL 4OCRH 3RUGB 1ET7A 1DLFH 3ME0B 5HGDB 5DO8A 4RWHA 5ICYB 2MQ3A 4AKQA 2A99A 4KKLC 4JJHA 1V3MA 3LEVL 2IQAA 2EVFA 2H8PA 4L8DB 4OSUL 4X9FA 5D1QA 4F15B 2GFBA 3FFCE 1A7QL 5JHLA 5D2LB 3RB7A 4JK0D 1QSVA 4LSVL 1JZ4A 1TCRB 5D1XE 3S37X 1IC7L 4R0LC 4R4FL 2OBGA 1B6DA 3VYOA 2XZQH 3LB6D 5I9QC 4HJGA 3BC9A 3NFSL 3FPYA 1ZLDA 5J13C 2FYYA 4HJ0D 3EIFA 2R4SL 3T5WA 3FFCD 3LTVA 4NPJA 5FF6B 4HPYH 2SEBB 3BUTA 3UTSA 5ESVB 1CXKA 4Y9GA 5HD8C 4TNFA 5D1XD 2NY6B 2P24B 3BUDA 4H5SA 1GYWA 4XMLH 1ORSB 1G1KA 2IADA 4P2YA 5DJZB 2E7LC 2HRPH 3CH1B 2ZSVB 4M6OL 4KDVA 4Y5YB 5EZJB 3UO1L 4OM1H 1G6RL 3VSVA 4OZIE 4MB3A 4KK5C 2KPWA 1TJHH 3S35X 7FABH 2BERA 3IGAB 1R3KB 3V5KB 1AGDA 3O0LA 2B59B 3OKKA 5ABDE 1RU9H 1OVZA 1OKEA 3QH3B 1KYOJ 1ZS8B 3R1GL 5CEXA 3WTUA 1AIFA 1VERA 4DGVL 4K8RL 2CHDA 1DFBH 4GKNA 5GS3A 1YG9A 1EZSA 4HIXH 1CGSH 2W80C 5A2AA 3FOLA 4X8CA 3FJTA 4P2QD 4LVNC 4EI5B 4XOBA 4FFWD 4W9CC 2WBWB 4ZOAA 1GH7A 4P49A 5C08E 2FR4B 4FQJL 1WCBB 4JHBA 5TFSL 1GGCH 1Q0XL 4K9EC 4MGXA 2VLKA 2YLHA 4GKNB 2ZPKH 2OSLA 4DK5A 3DOIA 1YEFL 3RBGA 3BT0A 1MEXH 1MHHA 3W57A 2VRAA 4AGLA 3T2LA 4R26H 1AZCA 4AJ0A 1ZT4A 4NENA 1G6RA 2D9QB 3OM3B 2EXTA 1GZQA 3SKOB 1ZIAA 1IUZA 5AAWC 3VI3A 4ICWA 4XE5B 5EN3A 1N0XL 4ZSOE 4P57A 4X5WB 3BMWA 3DX2A 1XGRA 4PBVC 4U6YA 5LG6A 2YSTA 2Z31A 5KG9B 3NCYP 2J43A 1BIIA 5F8RC 3WL9B 1L6ZA 2PW1A 3H53A 4M7KH 2ZCHH 3FQWB 4A7UA 1C5CL 3VXSD 4AYMC 4OU3A 1G1OA 4IK7A 4X6DF 5DMGC 5C6PB 2X1XR 3NEEA 4P3DA 2F7QA 2CKBH 2VN7A 3FNKA 4KHTH 4PJAA 3LHAA 5DZLA 3WKQA 1BJMA 2GBVA 3CVIL 3HHMA 1MLBA 2Z31B 9PCYA 1BIIB 1DVZA 1MHCA 4HXAL 4I85A 1NCBH 4NZTH 3GZKA 1JTPA 2PW1B 4YDVA 1MAJA 2HVBA 1TZHA 3RJQB 1C08A 1YNKL 1ACZA 3TWCL 5LBGA 3RGVA 4MJIA 1UZ8A 1G5AA 1JGUL 3QJVB 5ALCH 2ADJA 4YDMA 5BQDA 4Z3HA 3F7QA 3HI6L 4NWTH 4I4WB 4RNRB 2YEVB 3UTTB 5LCVH 4QMEA 2YRBA 5F88B 2CIIA 5FO8A 3DX6A 4MYWB 5E99H 1MRDH 1MIEH 4UIKL 1QKZH 4QOKE 2J44A 2DIAA 4OF5A 2IPTH 4HKJB 1EUTA 1BJ1H 2GBUA 3O8XA 2ZT9C 1T20A 3QEHA 2OK0H 1OCWL 1G9MH 4Y5XB 4O2CA 1XH3B 3GXPA 4CBZA 1B6UA 3LZQA 4Q89A 2NNRA 1WO2A 4IOFD 3L3DB 1KBKA 1MREL 5AKTA 4M3JA 1DL7L 3QWRA 2DWTA 4J3OH 1EEYA 1S9VB 3L3JA 4FLSA 3X12B 1VCAA 4DKDC 3K0YA 4QOKD 1BFVH 1H6TA 2VN5A 4KO6A 5C0FA 4UAHA 5FDYA 4JY6B 3DX8B 3HG1E 4PG2C 3IRPX 1HYSC 3TBYA 5FGBC 5CLXA 3FU6A 4CADB 3UC0H 2IBBA 3NAAH 3SDCD 2OTWB 3KBEA 1N2RB 3BN9C 1FC1A 5HHXL 2GJZB 1J8HE 4U05A 5E9DE 5FX3A 3CFDB 4UV4L 3SBRA 5KYYA 4OZGF 5F7MC 3D50A 1IJ9A 1JPGA 1AS6A 1X9UA 4ZFQA 1QFPA 4G6AD 2W9EL 4I3RL 1ZTXH 4ZUUA 4HU2A 3TBSB 4EMZA 3KPRE 5FHBL 1E9QB 2AEIT 3DX1A 4GKZA 1T6WA 3NH7L 4GAAA 5T1KD 1J8HD 2BY2A 4GT0A 4PJ9D 5F9JA 1E4XI 2YR3A 4U1KA 4OCYH 1URIA 4RWYH 3O2DH 1PDKA 1AGBA 1D5IH 1A4CA 1OM3L 3QULA 1FDLH 1KY6A 2D0GA 1F90L 1B88A 3C5ZA 2F8VA 5KYYB 2DOCA 3BEWB 3KPRD 3MLWL 2GPZA 2YK1L 3UZEC 4LU5L 1EEZB 3KH4A 2E75C 3IRZA 2KZBA 1R0AL 2UY7B 1V3LA 1G94A 5IJKA 5HDBB 1Z3RA 3GJFA 1GCFA 1P1ZB 3UJIL 2LTQC 4PWFA 1PG7X 5EZIL 2X2JA 2DQCH 2ZXBA 5AZ2L 3NSJA 5AOJA 4A2GA 3UXFA 1MWOA 3FMGL 4I3SH 1D9KC 3C5ZB 4F20A 3S5ZA 2FB4H 3C8KA 1BLIA 2BY0A 4GRWE 4NUJB 2NNAB 2DM7A 3MLVL 2W65B 1UM5H 5EUOE 3MLXL 1NBQA 2IMNA 4LOVA 2Y7QA 4E68A 3DRQB 3TVMA 2AQRA 4GI9A 1KB5L 1N7ML 2WXLA 1I8LA 5H8DA 2J56A 4TVUA 3RWHA 4BD4A 4BUQA 1LNUB 2EDHA 4CMHB 1NPUA 1WLHA 3BPCB 4X80L 2BNRB 1G7JB 1HZLA 4MS6A 3ZDXB 4G6KL 3FT4A 3BXNB 1R5IB 4HFUH 2NY7H 4HJUA 1EIBA 4UINL 1KTLB 2CMRL 3SO3B 3ATFA 3BD4A 4HWEL 4OFQA 1KGUA 3IE9A 4ZX4A 5JLZA 2WTOA 1OTUD 4W9HC 5L6YH 2IFFL 2R0LH 4FQ1L 3SGKC 3JWOL 2K6WA 5MENE 1TSHA 2VXUH 1TQWA 4DKEL 2CLVA 1IGCH 3A47A 3MR9A 4JO2H 3P2BA 5HI4D 2XICA 4YN3A 2N1KA 2C5DC 1BECA 3ZQ9A 5I8OH 2Y0SA 1I3RB 1GYUA 2YUVA 4GMSH 2ICES 4PYGA 4F7MA 1YEDA 1JTOA 5EO0B 4LLQA 3W9DB 1RV6X 2EYTA 2VUYA 4KRPD 1SPDA 1DE4B 4I88A 5HDOA 2G75A 2NSMA 3I6LE 2AP2A 3S37L 2A74A 3E9UA 1AYOA 1D6VH 3MNDA 2O30A 3C5SB 1UA6H 1DR9A 1WAPA 1RK1A 3HE6A 4WO4D 5E2TH 4ODUB 2WMPA 2Z8RA 3MOAL 5EU7C 2C9XA 5IG7B 5CEYA 2APWA 3FFCB 1ZRUA 3CXFA 2ZP0T 5EC2A 1RUAH 3JXAA 5HHPB 2I5YL 3RPBA 3CBKB 3WTVA 4F7MB 1JUFB 4N22A 3I6LD 4JVUA 1PZSA 4LLYB 1USZA 3KYOB 5D1XB 1KB5B 3I2CH 1E4KA 2C7UB 2G5BB 7PCYA 5CO1A 1IL1B 1MCPL 3LZFH 4P04A 4MD0B 4NQEE 4NNYA 4C83B 5FYJE 2A1WH 3GO1H 1FG2B 1IAMA 2FWUA 4M5YH 3S35L 4TSAH 1JGLH 4U33A 5I15L 2WMPB 1UVQA 2GHZA 4M7ZC 3GEWB 3EO0A 1MJUH 1X7QB 3PE9A 3CNKA 1EV2E 3F64A 3NQIA 2YEZB 4GO9A 4APXB 3MYZA 5ELIA 2E86A 5C0BE 5FYJD 4YXHL 1OAQH 3INUL 2W9LA 5E00A 2NY4C 4OZIB 2LU7A 2H6UA 3IPEA 1QPPA 4IHOA 5H94A 1WITA 2QJDA 4JREC 4X7FC 4WSKA 3NN8B 2P28B 2WOBA 3NT0A 3R4RA 4UZGA 1KPUA 2FJHB 3LH8A 4GFXA 2H3NB 5C0BD 5E1QA 5TJWK 4JFXB 5TQ2L 4L4TE 1NA8A 4DP8X 2G2NA 3M1OA 1I1FA 4LLMA 4QRPA 2NT1A 3EFFA 2O6CA 2YIHA 4D8PA 3LKNB 5C08B 3TXAA 3VFNA 1JTTA 5H94B 5J56B 2FT8A 4P5KA 4FYQA 4M5TA 4GQQA 3I84A 3T0XA 2J20A 4XCCL 3ISWA 1HEZA 4L4TD 1U93A 2HG0A 2VXQL 1YEJH 1RJLB 2FX9L 3WHE1 3X1NA 4UTAH 3D08A 2F61A 2MH4A 3A4AA 2EO9A 3KHQA 3ROOA 1REIA 4PHZA 3V6OA 5HVWA 1XGZA 2H41A 3U83A 4OGQC 4W9ZA 2WBXA 2K1MA 2HVJB 4MXWH 1BA9A 4M29A 3ATAA 1ZHLA 4I87A 3FT1A 2YUWA 2B0SH 5JPNA 4PRDA 2Q86A 3F04A 4ZSOB 3RWIB 2XWCA 1Z9SA 4GIOA 4KTDH 3P3RA 4I1NB 4HGWA 2J88L 5GGTH 4NOFA 2DIJA 2LABA 3RRQA 3TFKD 4IDLA 1H0DB 5C0RH 1JHTA 2QDWA 1KT2A 3JV0A 2AEPL 4JG0L 4ES8A 2ZZUT 1FAIH 4ZX3A 3P4MA 5I18H 1BOGA 3L7FA 4TM9A 3KJ4C 5FR3A 1DBMH 1TYJA 4YR6A 4HS8H 3HNSL 3TBWA 3X1BA 1UD4A 3SYAA 5BCAA 1UHVA 1IV8A 2P5ED 5EZOL 3RWCB 2A6DA 1QYGH 3D69B 4CUCA 2YA0A 2JKWA 4E42B 3UBGA 4NI6A 3GMOB 3JT0A 1D5MA 3MRMB 5F9OL 5LKNA 1JHTB 3SZ6A 2K0RA 5L2KA 2HLFD 3L3HA 3MLSH 4FHBD 2E4FA 2WXMA 3QJFA 4NC0B 2JCCE 4PGBB 1BSIA 4OF8A 2AGJH 3C12A 5FLUA 2HTLC 2R7EB 5I5JA 4PJ7F 5J1SC 1N5YH 2C3VA 4B9PA 5KSAA 5HPMB 1XF4A 3HNVH 5DS8B 4Z76A 4QOKB 4XZUB 4ZDHA 2H32A 3GXMA 4RGNC 4ES9A 4JFZL 4AE0A 1OIOA 4N2KA 2L04A 4OF0A 5IW1A 4N68A 2EE0A 4JRWA 3KWUA 3GBNL 5DEFA 3SDCB 4J6IA 4JR9L 1DQDH 5A2LH 3VWJC 5D7HA 4UDUA 2VJXA 3NACH 1B9KA 4IGBC 4LHUB 5DU7A 2EVGA 2Q8BL 1YPZE 3WLBA 4JGMA 1NBZA 2FATL 3H56A 1GL4B 4FGMA 4BWTA 3HG1B 2ICWA 3A3YB 3WLWD 1CVSC 5F1IB 3SDAD 3QCVH 5DJYB 4ZDHB 3U25A 1KWKA 4KUCD 3QWNA 2Y06L 1R17A 4MJJA 5C0AD 3DBXB 4ZUSA 3FCSA 1JVLA 1J8HB 2CBQA 1ZV2A 5E9DB 4LRNL 5FFOA 4G7YL 4PP1D 4FG2A 2KERA 3GT6A 3REVB 4R5XA 3BZDA 5IY5B 3FB7B 3VFTB 4BINA 4OJCA 1NMCC 5CJOH 5A1AA 8PAZA 2FEJA 1NBZB 5FB8A 4P3CH 3OAYH 4Z7VF 3KPRB 4TUJB 1C5DB 4QRTB 3NBNA 3M17A 1B2WL 4W70A 3LXAA 4WO0A 1JGEA 4LXFA 3BH8B 4KGLA 1PG7L 3TA4D 1SQ2N 2WNXA 5B8CB 4XCNB 2RH0A 3A4DA 5E95B 2QKIC 3GSVA 1CLCA 5F8QC 5JUEH 3NP4A 4QT5A 3LNFA 3MJ8A 4NX0A 3QFGA 4RFOL 5EUOA 4L3EE 4Y9CA 5AEAA 2Y24A 5ISZD 2ZJSL 2R29L 3RTQA 2F54E 3EDEA 3QVAA 2GK0A 1CICA 4Q8BA 2RMNA 3M17B 4XPGH 4XT1C 4PJFE 4WEEA 3V5DA 6FABH 3PJNA 1H19A 5AWNH 5GGSB 3RA7H 5JXED 1TMQA 2WLLA 1NAKH 5IQMA 2OMWB 4P9MH 3E6FA 4HX1B 2W9DL 1RZJC 4L3ED 5KSVB 2WQVA 1A6AA 3MNMA 2FJSA 4F92B 1BP3B 1DUZA 2F54D 4GRWB 5F7EH 4I2XA 4GOSA 5C86A 3FUKA 4NXSA 5DYFA 5GJSH 5JMRA 2X4NB 3BGMA 2E7CA 3T8MA 1XIWD 5I73C 5MENA 4NDMB 2EO7A 3MJ9L 1NQBA 2D4DA 3S3CB 4S1QH 1IEAA 3VFGL 4P4KB 3BN3B 2CO4A 4LPVA 3VXOB 3TPUB 2VB5A 2OZNA 3Q6GL 4OLVL 3MV9E 1CQYA 2YN5A 3D87B 4EZMA 4ZXBA 1E9OB 3HI5H 4Y2OB 4CNIA 1U92B 1ZAGA 5E1AA 3BGMB 2R29A 3VFUA 4ZJ9A 1AXIB 3E38A 4NUGL 1XF3A 2P9RA 4QRUB 1JNHA 3MV9D 3U36B 2CH8A 2GTQA 2QLVB 1WHPA 4NM8L 5CGBA 2FYVA 2J2ZB 4HCGA 1S78D 4YHIB 4XBPA 4XHJD 2DWEB 1E4JA 5CM1A 3Q2LA 2PWFA 4ZXBB 1YN7B 4MZRA 3IPBA 3GIZH 3R7QA 1YN6A 3WENA 1BZ9A 2LVEA 4JMXA 2EC8A 4WO4B 4DGYL 5DJCA 5IMMB 3ZL4H 2FNBA 4KRNA 5CFAA 3O6LH 4N85A 1UB5B 4YGAB 1R9FA 1I82A 1P7HL 3PLYA 1S7TA 2BW5A 2V2WA 3N85H 2NOYA 1AQMA 1JNHB 4NQEA 4MWFA 5EO1A 4V1DA 5A3IC 4GRWH 2E6QA 3JYBA 4CMMA 4M6AA 5IBLD 2GBTA 1LO5A 1CO1A 3V7MA 3CD4A 1G4MA 4UT7L 1MHEA 3ETBF 1J86A 1T03H 5C1MB 4KROB 1T89A 2HVKA 3IU4L 4NYLB 3P0YL 2IMMA 3CQPA 4IRJD 2AV1B 4YE0A 5FFLA 1IBZA 3L5JA 4FQLH 5I17B 2AJZA 2BS8A 5K69A 2C4XA 4Z95L 1PIFA 1CD1A 2O6FA 3EH5B 1HDMB 2DWDA 5DD6B 4NQEB 3WIAA 3QJOA 5IQ9B 1A22B 1IM9A 3AJ7A 3IDMB 1U8IA 1KBGL 3RWEB 4IEFB 4UT9L 4ORGB 2FEEL 4BXSV 1MQKH 3DUUA 1L7IL 4AM0A 3N40F 3SPCA 4FKKA 4MNQA 5JOFA 2Y3NA 4MX7B 4K5PA 5ILTH 1AAJA 2Z34A 5C0BB 2DAVA 4I8DA 1FA4A 3OLIA 1ZGLP 4WU7A 2UZXB 4D7PA 5JIHA 1U42A 5DFVD 4EIGB 5HGGS 2OXHA 1NKOA 3ATEA 1ID5I 4G9FA 1G7PB 4MZ2A 3V52L 3Q9QA 4A6YL 3T04D 1JDAA 1KN4H 4EUPA 2F1BA 4XBGA 1NCHA 4OV6F 4XXDA 3T8XA 1S7QA 1JK8A 2AXGA 2Q3AA 5L88L 2AJVL 1DZ0A 4L4TB 4G7SB 4G1MA 4OZFG 2YBRB 1A1MB 3UG3A 4DVRH 1OCZB 3CDYA 2FWOB 3EFOB 3AABA 1NBVL 3QUYA 1DVFA 2BO0A 4UT9A 4HIJA 3I6GB 1OW0C 1K6QL 4YC2C 3FSWA 1X4XA 4CA4A 4XBGB 5TPWL 2XWBA 4PRBA 4E9YA 4PR5A 3DMMD 4FXKC 1RZFL 4TSBH 2X41A 2HN7B 4IM8A 3DHPA 3BWAB 4U2ZA 4MMYA 32C2B 4FJYA 3VH8G 3PAZA 4ZO8A 1YYMH 2WXPA 1EFXD 3G5WA 2VSKB 1DVFB 4N0UE 4AGNA 5GGQH 3D5OF 1NGYB 3AG1B 4A6YA 1FF5A 4YHMH 1KOAA 1HHKA 1UB6B 1I9IH 4YDIH 1QNIA 5EIQA 3VXME 5DJ8B 2UY6A 2WZ0A 5DQDH 5CEZL 4LGRB 1B3JA 3BQUA 5JW4Q 3VXRD 3MRHB 5J6GB 5CBAA 1L9OA 1OQXA 4PI0A 5AVUB 4ZYKB 1S7XA 2Y6TE 3DJ9A 5T3ZE 1D2OA 1CLZL 2VDML 2XQYG 1QATA 3CBRA 4HZLA 3S8GB 3VXMD 2YPVH 3QRFM 3GSUB 3O4LE 1EJ6A 1WFIA 5GRJH 3UAJA 4TNWF 4K71C 4ZMLA 2X3BA 2XJKA 4JLRB 4WHDA 4F2EA 5ITFA 4DO5A 2Q7YB 4ELMA 1FRGH 2CWRA 2A6IA 4I0PA 5F7AA 4KJPC 2OTPA 5D7EA 3DHUA 3RWFA 5T3ZD 1DTUA 4AWJC 4ENED 4L1HA 2EEAA 2R1WB 1SMDA 4LQFL 4EQ2A 2JCCB 1P4UA 4X42A 3IFPB 4XPFL 3U2JA 4EZJA 3O4LD 4G9DA 2IAMA 2YJQA 4QXGH 2BWQA 3EJQA 5CN1A 1U8KB 4GH7B 4HZLB 2HT2D 1ZMYA 2KDYA 1QMUA 1I8UA 4X6DE 3U1PA 3ZHFA 3LMJH 3ECVA 2YN3A 4AQEB 3IM1A 2FNWA 4B9JA 3FUJA 4HU8A 4TNWK 5I1EL 4YQXL 5I6NA 3SDAB 1EDHA 1MJ8L 4I0PB 2AXHA 1CF8L 3RWFB 5KS9A 2JJUA 1E5UI 1E5YA 4U1SA 4A2HA 3ETSA 2B4CC 5DGQA 5HGAA 5C0AB 5T33H 1W0VB 5DZAA 4QRRA 1XZWA 3BPOB 3G08B 2IAMB 3RJOA 2X6CA 3ABKB 3FQRA 1YPZB 1SOKA 1X9QA 1XF2A 1D6EB 3EOYG 3EXLA 3F5WB 1SN2A 5HHQA 2CR6A 1K3ZA 5DT1L 2GBAA 4EI6B 2F8XC 1E42A 3V6ZB 3G6DH 5DQ9B 3WBDA 1TXKA 1WA0X 3O3BB 2VDKL 1ID2A 2CGRH 3B7YA 5B7MA 2FGWL 2VM4A 5D9SB 5AYTA 3ZHKA 4U1SB 4YWGL 3MRJB 3TNNA 1NMAL 3QZBA 3CFIC 4GXVL 3FN9A 2VDMB 2BS9A 4FQCH 4NO2A 4D0CB 2QSCL 3ZMEA 1EAPA 1XCQA 3MXWH 3NSFA 3W0WA 5IOKA 1Y0LA 3LNIA 3GM0A 1ZE3H 3DJTA 3K6SB 1GIGL 3MRGA 1JZ6A 1QAWA 2YKLH 3RZCA 2ZCZA 4PJFA 1MELA 2JJTC 3U46A 4KY1H 4WWKD 3U9UA 3FUDA 4JBSA 4UDTB 3KHOA 4NZRL 3LEXA 3QUZC 2QQQA 5J0BA 2JQAA 3CFKB 1JZHA 4A66A 3GK8H 4MHHI 1GGUA 3MO1A 3G5XB 2Q10A 3PL6A 4NZUL 4GUPA 4OIBA 2PPEA 1PCSA 3IE4A 1M7DB 4L3EB 1TJMA 2F54B 1KBPA 2FEDC 3UBXA 1N59A 3RFZC 4OZGE 2EEDA 1IQDB 4PJFB 1CBVL 1P2CB 3ALXA 4N2DA 1F45A 3D07A 1XIWB 4EN3A 4YBLC 1KEGL 1NGQH 1DQQB 1U8PA 1YMHA 5IB4A 4ELKA 1I1CA 4JVPA 1OP5H 2QZQA 3TO4D 5C70A 2WQWA 3BIAX 5DRXA 3U1QA 3D4ZA 1JNJA 4HWBL 1NFIA 4G7QB 1R1CA 1X5IA 4OF3A 3IJ7A 5L9DL 3L4YA 1HSAA 4MLSA 1NAML 4MAYC 1N59B 3ARGA 4LF3A 1IFHH 3QZWA 5I19H 5EOTB 1FFPA 3ZPDA 3CC5A 4K2UH 4WJG3 5E8NA 3O2WH 3KLSA 4M8QB 2VITB 3F84A 2LAGB 4P23A 3MV9B 3ZT7A 4GAGH 4I5BA 5HHME 3NK3A 4QJ5B 4JCWA 3GJEA 3V8CA 4LEXH 4BK8A 3TH3T 2O1AA 3IJSB 4MJ5A 5IVZB 4LOUD 3KR3H 2NRDA 3FTYA 4BFEA 3E8UH 1QFWI 5MI0C 3SY0A 5L7XH 3MODL 3WS6C 4WFEE 3SDXF 2OJEB 5EEXA 5HHMD 2VN3A 4P59L 1VZGA 4I0CC 2JJSC 1AC0A 4MMXA 3P3YA 4P2OA 5DJ0B 5KBKA 3LKSB 5I1DA 3FONB 5DUBA 5LXVA 4N24A 4W93A 1KTDA 3WD5H 3V0GA 4I5BB 5B38G 3WNJA 1COBA 3CK0L 4HWBA 4PGDB 4ZT1A 4LLDA 4GRMB 4HK3N 2FX8H 3GJEB 4MDIA 2IALB 2XVKA 4KXCA 4WJKB 1FPTH 3MRQA 4EBQH 2CDGB 1NAMA 3QXAA 4LCIL 1I7UA 1A2YA 3T8VA 2YS4A 1KPRA 5HDLA 4PW9A 3UZVA 1F3DJ 1JD7A 3ILQD 5AZEH 1OAUH 2E27H 3QPQD 2QQLL 1J87A 2MCMA 4HUXA 5I6OA 4QWWD 3US9A 1M1XA 4N6RA 5DJ2A 4FFZA 1FZMB 2CCLA 3GTVA 2R2CA 1X6LA 1YMMA 1OAKH 5A43C 1F42A 1YLBB 1FNEB 1K2DA 3P1VA 2PTUA 5LNGA 4RMBA 3M46A 4BZ2H 1HH9A 1TG8A 1BQLL 2BS71 1MCLA 2X6BA 4JHAH 4NN7C 4Z7QF 4GLRI 5DYOA 1KENH 1Z2KA 1JF1A 4ZRGA 3QK0A 4N6RB 2GSIB 2NMSA 4KMTL 4F2MA 1QQDB 2J1KA 2VDPB 3J27A 5IHBA 1JWSA 3WIIL 3WOVA 1FWXA 2XFGB 4Y2DA 3LKPA 4KDTA 3QZOA 3UIYA 4B3EA 1XR9B 4BSWA 4I18C 2Z1KA 4MASA 1IAII 1TZGH 4APQD 3ROLA 2P49B 3IDYB 1WC7B 5F3BA 1IBGH 3KPMA 4XXWA 3FRPA 1RSFA 3MYJA 3GMPB 1BZDA 4K94C 4FOMA 2K3HA 4DAGL 1TPXB 4FQXD 3SKJL 1GYCA 3Q1SH 3KEDA 1ZK5A 3F12A 5AL0A 2CXKA 2NY5H 2FL5A 1JWUB 2XRAL 5E4EC 5J6HA 1IAKB 3S6CA 3L08A 5EN2B 4ZO7A 5BZWA 3FUFA 4XBMA 3FT3B 4MNGA 3DPDA 4ZQKB 3RVVC 3MA9H 4BZ1H 4YK4C 3I75B 2PPAA 3DMMB 3MJ7A 3NA9L 3WKML 2AK1L 3ZBMA 4AW7A 5AG9A 5IESH 4DUVA 4UM9D 1PPIA 4CVZA 2BHUA 1OEZW 4M61B 4B9YA 3GBEA 2G60H 2FL5B 1RZGA 2WCPA 3MV8D 1EFXB 2V5SA 1HAUA 1SHWA 4KXAA 5CJQH 3TLRA 5JW3L 1OT4A 4E41E 1LLAA 2YD9A 3EYUL 4NQTA 2UXTA 3G6AB 3CMGA 3CCHA 2X4PA 5IM7A 1NIBA 2XA8L 5H4ZA 1A1OB 5IROA 3VXRB 5IFJA 3BVTA 4UBDC 3T65A 4XPBH 4KKQA 5KYNA 2VDPH 3K74B 5F44A 4M02A 2PMZA 1T1ZA 4N0UB 1QFUH 2AK4E 3LRLA 4DEUA 5ES4B 3QEQE 3NCWA 4GW4B 1RJYA 2J3SA 3W11D 4DHLA 2HRLA 3VXMB 5D1ZA 4G7VH 5A16B 2BPBA 3GI8H 4NRYA 1W72L 1XGTB 3FT0A 4OCXH 3L16A 5AYQA 2ODIA 1OCCB 4OQ1A 3IDXH 4K5NA 2DQUH 3ATBA 3QUML 4X6CE 5M94B 1PGRB 1ZY9A 1M2VA 3ES6B 5D6CB 3B2VH 4G8FA 4IW4C 2AK4D 4NQXB 4U31A 5FA4B 1USQA 1OTTC 4WF7A 4KV5F 1HZHH 3O4LB 4KK8C 2W81C 4K9JA 2P48B 4YGVB 1AGFA 3GXIA 1I53A 4ONFH 3FHEA 2D31B 5ID1A 2VLME 3SQOH 3KYKH 1UD3A 2OSYA 3L3GA 4KTGA 4IJTA 3JUZA 5E8PA 2ZOLA 1CLYH 1ZT1B 3VWKD 1H3PL 1NCWL 3L95B 4NM4L 1M3IA 5CIPH 4JM4L 2AANA 1P4BH 3CSGA 2QGEA 1KZQA 1DVYA 1IU1A 3M86A 4GBXC 3VXQB 5IJDC 4HF5H 2KBGA 3N42B 2BZ7A 2VLMD 1BAGA 3EGSA 2YEQA 3FQUA 4X6DB 4LMQE 3OKEA 3S3PA 4ZMTA 2XLLA 3SGJA 3KDPB 3MI6A 4TS6A 1XSKA 1DVXA 3F6JA 3L3GB 4PGEB 1I1AA 4LSTL 3OB8A 2WXJA 4KTEL 2ZOLB 3VG9B 1MDAA 5HHVH 2XWEA 3C6LC 2NY1D 1YEIH 3CHXA 4EZKA 2EDDA 2KLTA 2UWEF 2VRKA 4KAQH 1C12A 4OFYA 3QPXH 4N2LA 4JDVB 3QIUA 3BW9A 4OLUL 2FX7L 3OKEB 4P05A 3TT3H 4AGMA 4A55A 3BO8A 4BSJA 4XMZA 2Q9OA 4JB9L 4PJ7E 1IQWH 2ICWJ 5DJXA 1BDYA 1JVKA 1W72B 2CBTA 1FGNH 5T3ZH 4ZQTA 2WYZA 3QDME 2P7TA 2WXHA 3DVIA 3GXFA 3QUMB 2APBA 1U8JA 3VXPB 5FO9B 1M05A 1NDTA 4XMLL 3UMNA 1AC6A 4Z0XB 4WWKB 4M1GH 1CFTA 4JFPB 3ECUA 3FU0A 1KG0B 1ZLVH 3I02B 4OM1L 1D5RA 3KWVA 4Y16A 4AYGA 4PWIA 5KJ4A 3ZTEA 1CFVL 2ZICA 3A24A 3FT2B 4I13B 4JN2A 2BFGA 3U2SB 5BW7C 1CXHA 1T4KB 3FU7A 3SDYL 2AEQH 2NY0B 4JPIA 2XG5A 1IILE 1PEWA 3OKMA 4HDIA 4PG9A 5K9KA 1NCIA 4HIXL 3DPBA 3M6DA 1FVCA 3W3BA 3G5VB 4JKLA 1CGUA 3JTSB 5DHVB 1JN6B 1MVUA 1ZVSB 1BFOB 1UXSA 5FUCE 4EF3A 2VZ1A 4MKTA 4H88H 3RVUC 3V0WH 3MGTA 4AMKH 3JYCA 3TO4B 1S7RA 2BSEA 4P9HC 2HPTA 2AJUH 1PD1A 4HBCH 1FJ1B 3ZKXB 5D4HA 5ENWB 4OZGB 2ZWNA 1GGCL 2G4EA 2YFNA 4X8GA 1S8DA 1A8JH 2ZPKL 4IU3B 3ARQA 2PPFA 4Z7VE 3H4FA 5K39A 2V7NB 1UATA 5CR1A 3TP4A 1OOAA 3ZZSA 2ZWKA 5K1VA 4HPOH 1PS3A 2P80D 3C60D 2OMTA 1JWMB 1H8LA 2ENSA 1JPTL 1H8SA 4OQTL 4CJ1A 5SWZD 5MEOB 4W6WB 4XP1H 2RQEA 5D1QC 4LSSH 4XNUL 1VSCA 1GMIA 4KKCC 2VH5H 2Y1YA 4DWHA 4U0RC 5D7JA 4L4VE 1MHPH 3MROA 5D2NE 4XZ4A 3VFMA 1ILUA 4G43A 5HHMB 2OYLA 2PR9A 2ILLA 3A4EA 4KHTL 1J9CT 3ARYA 4AK1A 2ZUUA 1UKTA 3B5HA 5CP3H 5FAAA 2YMOA 3U4KA 4B9GA 2P3YA 1ZHBB 3NRPA 4MLIA 4UZUA 3UBXI 2OMZB 1BG1A 4S1SL 1TZOA 2JSFA 2LHAA 3B34A 3NFNA 4NNXA 4NZTL 5DHVH 5LAXA 3VFPB 4C56E 4JL2A 4G8AC 3QUKA 4WI8A 1B3IA 1T6VN 1V10A 1MAMH 2XSKA 2XXCB 2Z6FA 5ALCL 4YHKH 4ZMVA 3CUPA 3L1EA 3WFZA 4NWTL 1NLDH 1OL0A 4HG4K 3JWNC 5LCVL 3IWVA 1K4CB 5AAPA 1WJ3A 1JNNL 5E99L 4WU5A 4OQTA 1MRDL 4C56D 1PU0A 1QKZL 3LH2L 4MA7L 2BIMA 4M4RB 2EDJA 1RFDL 3MUHL 4W6YB 2F5BH 2MFNA 1G0DA 5LAXB 5ETUA 4LSRH 3U9WA 1BWWA 1X9LA 4BM7A 5BRZE 1AQDB 4JZNB 2D4FA 4J8RB 1JNLH 1OY3B 4RZCA 4MCYA 5IEHA 7TAAA 2APTA 2CKBA 1BM3L 4JKMA 5DQJA 5C7ZA 4YFLI 1BFVL 3ABGA 3V6FB 4XN1A 2MTPA 3G5YA 5BRZD 5M95B 4ZTPL 2W0KA 5EU6A 6TAAA 5GGVL 3RWJB 2VL5A 4APQB 4N1EA 1E7VA 3ZRFC 1J88A 2VDLH 3SJVA 5L4JA 3DGGB 2CHNA 1WFUA 2CHXA 2WVSA 4UOW1 5LO7A 3TWYA 5FO7B 3FQNB 5FUOL 3RIFF 2B39A 1DCLA 5HI5D 5LCVA 4FQXB 3LS5H 4O5LH 3X3FH 5DQJB 4DPAX 4Z77A 2N56A 5JQIB 1PLAA 2YWYA 3VMPA 5HHOA 2EE3A 4HK0B 1UD6A 1H9DA 2CBMA 1ZA3A 2EDRA 3JVGA 5IMOB 2OMUB 2BNQE 3OD3A 5GGUA 4OCYL 1X7SA 2VL5B 5TDPA 5EZPA 3B9KB 1VFAA 4L3AA 4PFEA 1RIUH 1FDLL 3CN1A 4ZODA 4MA1B 2XN2A 1HH6A 3AU0A 3BYTA 4UM9B 3OLEA 4HOWA 3RIFK 3O6MH 1OE3A 1DCEA 4ETQA 2DYPD 4E41A 1FBIH 3MV8B 1AS7A 1CGTA 1GHFL 2F19H 3CQQA 5EU5A 5AVWB 5AW0B 2XWXA 4Y2NA 4JM2F 1SEQH 3S34H 1AJ7H 4XB8A 3OB0H 3ZO0A 2DQCL 3RGVC 3ZE2F 3T0VA 4OBRA 1K72A 1SVBA 1PQZA 4RAHA 4AM0Q 4XB3A 3QB7C 4I3SL 1V3KA 1E5BA 4M8VA 4BHUA 2JJVA 1RCYA 4G6JH 1WWWX 4X50A 5I5MA 1UM5L 1HJCA 3QIBD 4MNHB 5E56A 4E41B 5IBUG 1IC1A 1BVLA 3BD5A 1WA2X 3O8XC 4EDWH 3QI9A 3C87A 2A9NL 3FFDA 2YD8A 2XOTA 3UL4A 4UB0L 2ZWLT 4XO9A 2JTDA 3V0VA 4KDWA 1BF2A 1LE5A 4XPAH 4AV5A 5ERWA 2AK4B 3KH3A 3GSNH 4X99A 3QEQB 4TUKL 5DO2C 1HFUA 2VQ4A 4LL4A 5G4OA 4PS3A 3NJMA 4PJCA 5KUKA 1O7DC 1JK9B 4RGMB 3ORJA 2WNKA 4ZX6A 4J2QA 3CLEH 1O9ZA 2PYFB 5FPIA 2YAFA 4MDRA 4X6CB 2CIKA 4IOIA 1W8NA 3IXAB 4FTVA 5L6YL 4LCWD 2CO7B 2Y07H 1IGML 4BRJA 5E0QA 3V0VB 1MNUH 1XMWA 2NY2C 4YMPA 1VKXB 1IGCL 4X99B 3BP5B 1G0YR 1HX0A 3VW3L 1G7MA 4Q4EA 5CBEB 4FAAB 3MBED 2XG4A 4K5OA 4X9YA 5E2VL 2YMXL 3WJMB 4O9HH 4O2EA 1IM3D 3HC2A 4AIXA 1RZ7H 4GMSL 4YSQA 3QZLA 5C07E 2CO2A 4DNLA 4F8PA 4IOIB 5G4MA 4X5LA 4XVSH 5BPPA 4LVHB 4NN6C 3HFFA 5CD5D 3PABB 5CP7B 3O9WD 2GCYB 2R9HC 2GT9B 1MFCL 4N86A 2HKAA 1UA6L 4MB5A 3PV7A 5E2TL 4F8TA 2N1TE 2HLEB 5JTWA 4DN3L 3ECQA 3JV6A 3N1MC 4RFNB 5CILL 5C07D 5D1ZI 2IPUK 5FKPB 5T3XH 3VGDA 1QR1B 4W4OA 4ZOBA 5JO5B 1NM4A 1JPSL 1RUAL 2YD0A 5DEJA 1AR1C 3RDTD 5IJKC 3ECWA 1SHSA 2DBLL 3I2CL 4LLVA 4FA7B 5JPMA 1Z9NA 2F5AH 1YO4A 3BGFB 5A6LA 3LZFL 3KLQA 2BRRH 2TSBA 4MD4B 1N10A 1A6PA 2VW6A 3ARTA 4YSRA 2HT3C 4LVOC 4FCHA 2GSGA 2VYRE 3WSQH 1T66C 3GO1L 1HXKA 4M5YL 1Q9OA 3V4UH 4TSAL 3EOAB 4PJ7B 1I7TB 1VGEL 4FDWA 4ODXA 1MJUL 3HFML 3II2A 3TIEB 2VQUA 4KZDH 3CHQA 4R3SB 3QDMB 5KSUA 3WIFA 5IFAL 4ONGL 2FTAA 2PO6A 2R83A 3TVMC 3QAZB 1EHAA 1VJSA 4HWZB 1I8LC 2F53E 4S1RL 1EEQA 1LHZA 2WBJA 4QXVA 1GSKA 1Z5LB 3M45A 5KSBF 1DQMH 2QADC 1XWVA 4C55A 1QBBA 4H25B 3LIZL 4RAUB 4YDLB 3I85A 1XFPA 2EYRA 3K6OA 1CLOL 2F53D 3TZVA 2CO6B 2QGCA 3QXUA 2XXFA 3BIKB 1FFNA 4PIRF 5SV4A 2G9HB 1CI5A 3ZN6A 5GS1A 5BV7L 3FUIA 3CDZB 1RVFH 1QLFA 4KZCA 4MJ6A 4OGYL 4MJ2A 3L4VA 1MFBH 1MCOH 5B1BB 4ZUTA 4XP9L 4TRPH 3S97C 2YRLA 1A65A 4HAFA 4DQOL 3HMXH 4RSYA 4EQ3A 4XMWA 3C60B 3KBFA 3PHSA 3D0VA 3CV5A 2HKFL 5HYJD 1NICA 1XSIA 4UTAL 1X4ZA 2D7NA 1BPLB 2H2PC 4GW5B 4Z7VB 5LGHH 1AKPA 1V05A 3OJMB 2VLRE 3RVTD 1FZJA 4DUXA 3BOVA 6PAZA 5AVYB 2A74C 3CXHJ 4TVPE 4GINA 3HC0A 2OM5A 3HE6C 3SGDH 3LIZA 4R2GD 3VJ6B 4JRFA 3UYOD 4XGZB 1ZIBA 2DICA 1UWGH 2VLRD 2FGZA 3EUUA 4LLUA 4TSCH 1Q1PA 3BSHA 1OGTB 1F86A 3ELAT 3GKWH 3KPSE 4JKKA 1T5KA 4NNPH 1TQBC 5C0RL 1A02N 4L4VB 1QG3A 1MIMH 1FAIL 1E4KC 5DJAB 1R5VB 4LASL 3MTXA 5D2NB 3N6YA 3TNMA 3VI4A 4JZJA 2B20A 1Z3GH 1T80A 2H0PA 2YA2A 4HGKC 1MXDA 3FO1A 5IB5B 5C6WH 2ITDA 3QO1A 4JANA 4NPYB 3O3DA 2IQ9H 1CYGA 1SM3H 3L1OH 4U1LB 4Y9EA 4Y88A 3X17A 3VGHA 3ZTCC 4A67A 4Y4KD 4BZYA 3GNMH 4LLUB 4R6UA 4C56B 1IEBA 4M93B 1V27A 4UTAA 5A2BA 4PJGA 1X5MA 1A14L 4DKFH 2ZE0A 1OWRM 3N0AA 2P5WE 3V4VB 4DERA 3IETB 1H3VA 1QSED 5BV7B 1LO3H 4JZJB 1XH0A 5D7KE 1SYVA 4XVTH 5F96H 5L0QB 4JE4B 4WW2F 3QO1B 4DN4L 1NCDH 1K85A 2O5XH 1LE9B 4RA3A 1F11B 1P7KA 5GGTA 3EUDA 2DY2A 1TEGA 1SMAA 2B2XH 1L9TA 1AOZA 4FXTA 5GRUH 3BUIA 4XB7A 1JXFA 3QQ9D 5BRZB 4DP5X 5D7KD 2YD5A 5EORH 2XTLA 1MFEH 2LR4A 1BVKA 1YEHH 1DQDL 3AS0A 4P2QA 4AYSA 4L5FE 4LOEA 4RDQG 1KJ2H 4ICXA 4X4ME 4A7VA 3IDJA 2FBJL 3BGAA 1I8IB 4Z7UF 2JK5A 1MF2H 1OD9A 2OMVA 3KM1A 4OCSH 1F97A 3RYMA 3L3KB 4K3DH 4AZ8B 3VQ1C 3HKFA 3BQVA 3BPNB 1MG3C 3HNTH 3MUUA 2NLJB 1A7RL 2FBOJ 3HZ3A 4KNTA 4LOFA 1X7TA 2NTSP 4I77H 3V6OC 1GCYA 1SXCA 2BNUB 2V6HA 1HN1A 1WTGT 2E6PA 3B2DC 1BD2A 1IE4A 3MNVB 1MRFH 1HU8A 3AGVA 1BQHG 4BRVA 2PXYD 1WDAA 5JPNC 1EJFA 3QIWD 5EC1B 4P2AA 1C5BL 3MU3A 4OR1A 3VA6A 5IVXE 2F8OA 5FW6A 3S5LA 4Q56A 1HHIB 1UD2A 5DD5H 3S36X 4AH2B 2EIMB 3QXDA 4M7JH 2BNQB 1N18A 2XUWA 3GMNA 4ATWA 4F8OA 1CI3M 1TOXA 1TSRA 4OD2A 3VXSA 2BVQA 4AQAA 4E2OA 1NJ9B 1CK0L 1KIUB 1AH1A 3TEZA 1IT9L 3HS8A 3TTSA 3MJGX 1BBDH 1AY1L 3MRKA 2LU3A 2MIZA 3OMNB 3OX8A 1AXSA 3CFJA 4OZHF 3V95A 1KYOK 4NO3A 4Z7QE 4GJTB 4QLRA 4KJYB 1RHHB 2MQCA 4H26A 5HHNB 1SZNA 5I75C 1YC8A 3NABH 3BPLB 4FMVA 3QIBB 4HKBB 4KGJA 1UWEL 1NUDA 2V9QA 3NJGA 3T6WA 3OMZA 4OJFH 6FABL 4PLJD 2ATPA 5AWNL 3RA7L 2BVQB 1J9SA 3LKRA 1U41A 3NJHA 3ZZ1A 3L2LA 1I8MB 2FJGB 4BSVA 4R83A 5E8DH 3B2PA 4GXFA 4LHQB 4HC1H 3EXJA 1DJYA 3QWOA 3O3AB 2WYHA 1CXEA 5KSAC 5F7EL 1NIFA 1AXSB 3LDBB 3CFJB 2WK2A 1KEML 3C6EA 4FCAA 4JZOA 4KX7A 2G3MA 5GJSL 4HEPA 3MUGB 1O7VA 1VACA 3BVNA 3FQYA 2Q87A 1AACA 2EKSA 4XWOC 1JPFB 1HWWA 2D0FA 4PGJA 2LLLA 3LKRB 1NFDA 3PCYA 1SHMA 4QKTA 2KC0A 4S1QL 5E4IA 3K3QA 2DQMA 1R3LA 3TJPA 1ICTA 1NMBH 4CVXA 5TTRA 1TQSA 1UC6A 3HI5L 1I1RA 3MOBH 4ZUWB 5I0XA 1BX2B 1WG3A 2VMEA 3MBEB 4DGWC 1UT1A 3QCUH 4GSRA 4XVOA 3RGBA 4GAYB 4PJXF 3CIQA 4Q9CA 3IVKB 2Z7YA 1YEKL 4BUGA 4KHXH 1IBBA 2DD8H 2E7HA 4N2HA 1H5BB 4L8SA 1WHOA 3UO8B 1CPUA 4ZOEA 1A25A 1XB3A 3FO0H 4UIMA 4BHUI 4DVBA 5C9JB 2YD6A 1AZUA 2IXQB 2L7QA 2OS7A 5HD8D 3NDYE 3S98A 5T1KA 5C07B 1UGNA 3O6LL 3RVWC 2Q8AL 4OZFH 4BQCA 3U7WL 3N85L 3RDTB 3T3PF 2NX5A 3WS3B 4ISVA 5DFAA 2R2BB 3BLBA 3ZR6A 1F0LA 4KK5D 4BH7B 1S7WB 2MWCA 1DYZA 2XN9A 3D8MA 3MX0A 2W60A 3QO0B 3POHA 4FQQB 1Q9KA 4H13C 3FTSA 1SMOA 3TCLA 2EUWA 2H47C 3N04A 3CC1A 3HAEB 4KV5E 5FKAA 4R7NA 3RTQC 1HL5A 3WY4A 1CICC 3L5XH 1ASPA 5DFTA 3UTQB 4FQLL 3NUKA 1FCCA 2JIXD 3BZEA 4TVPL 4FQ2L 2EVJA 2DIBA 3CMOH 4LLWB 1U9KA 3QUXA 4OGXH 2H5UA 4QI3A 3TEYA 4FABH 2C9VA 3PGCA 5BRPA 5FM4A 3WN5B 4B0MM 3QCTH 2ALWA 5CNHA 2WVVB 3S2CA 5FKAB 1EVUA 2YOAA 1LO4L 3BUBA 4KUZL 4AT6B 2EDLA 5ILTL 1XGYL 2F53B 3AREA 2XKSA 2B1AH 3VXNA 3WEMA 4AYFA 1I1YB 1FV1A 3LHPL 4UT6L 5HBBA 1TVBA 2LFEA 1QLRA 2WJ5A 3VD2A 1A3QA 2CXGA 2MKWA 1M6OB 2UWEE 4TL5A 3WJLA 5I1LA 2EYSA 4XMXA 4F8NA 3EKCA 4OLZL 3CU1A 3T9WA 1EFQA 4RMSA 2WXIA 4UZSA 2HP4A 1A4KB 2DQTL 4ODWA 2ITCB 2B8OT 1TEFA 4NKIH 2PWHA 3FL7A 1HE8A 4B5EA 5CZXC 2P4AB 5C0NC 1NGZA 2WLMA 3C2AH 4IOSA 4YHOH 1GGYA 3V5HB 4LAQL 4ODSH 4YSAA 4H1LB 4N2CA 4B60A 1NOFA 5EA0H 1HXYA 2R56H 3FCTA 3FS9A 2ROXA 1MCHA 5AB2A 1KTKE 4N8UA 1HIMH 3I50H 3E2HB 4MCMA 2ZUQB 3TTYA 4EKJA 1FGVH 4JW3A 2VLRB 4TSBL 3DO4A 1ZSDB 4N0FA 1ND0A 1MCJA 3EDFA 5M7QA 1F6AB 3K80A 4L5FL 4UMGA 4U6VH 2X1OA 3CFCH 1E40A 4HZAA 1TU2B 2ADGB 2DI9A 1FH5H 5B7EA 4AUUA 4BE6A 1QSZA 3WFCH 2Z64C 5ICZB 1T89C 2AJSL 4DPBX 4YHML 1HXYB 4YDIL 3SE8H 1I9IL 4YBQC 3OL2A 3KPSB 1YNTA 4PIBA 4P99A 5D4IA 5DQDL 4DW2H 2JKTM 4N8VB 1IEHA 1NEPA 4LP4A 4S1DC 4V2BA 2P5WA 2HLAB 1A6VL 1B2YA 1ND0B 2XI9A 3MLRL 3C5JA 5DD0H 1HINL 1I8AA 4U1NA 4XN2A 4HALA 5EIIB 4CU8A 3T6ZA 3W9EB 4JPKH 4A2LA 3PFUA 3H7BA 3P9LB 5D71L 5AVTB 4J8QA 4KRLB 4DH2A 3H9HA 4KJWD 3IN0A 1E7UA 2QSVA 5EOCL 3BN9D 4IU2A 4PB9H 1WH0A 2P5WB 4KI5C 1ZA6A 1YUHA 3I9IA 2V17L 2OR8A 4P46A 3SDXA 3E6HB 4WGVB 2LLNA 4WTZA 4X4MA 3MCYA 4LEOB 3T4YA 2UV3A 5SWQB 5IV2A 2ATAA 3C6SB 2F58H 3OHXB 2MNJB 2BY1A 4K7FB 1DDHA 4R96B 1OD7A 4LCCB 3WEAA 3SIKA 1F02I 5IHZB 4FXGA 3NVQA 4HKXA 5IQ7L 4QHUA 2DJMA 2PLTA 4MCZA 4FF9A 3VX1A 2XV2A 4KKNA 4XVJL 5AD0B 3OWRA 1IC5H 2EH8L 5FIEA 3WFDH 2Y3AA 2DDQL 5T33L 1S5HB 4BELD 1IARB 2G2RA 2H26B 2IH9A 4NT6B 1F4YH 4MB4A 4OB5L 4XOCA 4ADGA 3QUYC 3VACA 1AQKL 4YE4L 1IJNA 2MPAH 2PXYB 2WLNA 3DVFA 4XR8C 5HVHC 4PJEF 3QFJA 2VE6B 1KGCE 4C4KT 1FE8L 5C0GB 4UOJA 3KGSA 3S36L 1SY6H 2KS0A 4MCZB 4F7KA 2IH1A 3VGFA 5IUSA 3RG1C 1XGQB 2G3XA 3AQDA 3BP6B 3SKMB 3CPUA 2F7OA 1D9KD 3BHBB 3H3PL 5FYLD 4PREB 1UKQA 2F68X 4QXUL 1RZ8B 4EOWH 3WTSA 4Z1PA 1U8CA 1KGCD 1ZD6A 2YPLE 5H37A 3MXWL 3AS1A 5JW5B 5IVXB 1R33A 2JTYA 5T1JA 1CWVA 2F74B 1T21B 3UZQB 5DI8B 4LESA 5A7BA 5CFHA 3HE7D 2O5ZH 1Z1WA 3VCLB 3BQUC 2V2TA 3MV7E 4QRQA 1BJ1J 4KY1L 1YEGH 3C09C 2ZAIA 4YSEA 3IJYA 3K4DA 2CDEA 3ZO9A 3BT2L 1NBCA 4X6FB 4Z5RB 5LB1A 5I5IA 4GKSA 4ZPTA 5PAZA 3GK8L 1BFTA 1FG9C 5AB1A 3WNKA 2JFCA 4JFQB 3DXAE 4PJBF 4AYDC 1XCXA 4E9LA 4Z7QB 4BE5A 3UAJC 3MV7D 3IDNA 3SOBH 3BDXA 2WYIA 1A7PL 2V2TB 3HMWL 3PDDA 5PCYA 1FFOA 3QS3A 3IJYB 3ZUNC 2DRUA 1IGYB 1NGQL 3DXAD 4YDJB 3F7YB 2C9PA 2VABA 5T5NG 2QTEA 3HZKA 4GKSB 1CD9B 2V7HB 2ADFH 4XCYB 3MNZA 5BQ7A 1OP4A 5EZLA 4CGUB 35C8H 5EU7E 4X0NA 2ZXAA 3VSUA 3IDNB 1F3JA 3PP3K 4Z3JA 1QTYT 3CN4A 1F18A 5A6MA 3H8NA 1JGDA 4MBRA 2VJ8A 1F6FB 3BAKA 3O2WL 3ILDA 4R0LB 5I6LA 2WNWA 3HR5B 4H8PA 5DC9B 2XWJB 3GBMH 5DMIH 1N6QL 5I9QB 1PLGH 3T6VA 1Y6KR 2DF3A 2WLIB 5J13B 3KVDD 4UUJA 1AHWA 3ZE2E 1AKJA 1BXAA 4MQ7A 4M48H 2LLGA 2VN6A 4YDKH 1P9MA 3Q2NA 3CFTA 2X05A 3WE1A 1YAZA 1TTAA 2DQFA 3KLKA 4WKXA 2EDXA 5GPRA 1H9VA 5DVNA 2DLGA 1QZNA 3ESMA 3GI9H 4L37B 3QARA 5GGRA 2BSTA 2HMIC 1GS6X 1WFOA 1P6AB 1YECL 1F4HA 2OW6A 3S4SA 3HC3H 5AYUH 1UXMA 2FX8L 3L3IA 4WTQA 5JDSA 3TIDB 5KJRH 4DKTA 4BCXA 1E5ZA 3QPKA 1Y18B 5KW9L 2J6WA 1RUML 4OLYH 3RZCC 4AK2A 2V8LA 3ULSA 5D7IF 3RWDA 5EULV 2NY4D 4K3GA 5DCCA 1OAUL 2E27L 2BLFA 1Z9LA 4XCEA 1N9PA 4L0YA 4LVNB 3DX9A 5IK3B 3H9SE 4WIQA 3PL6C 5AAWA 3OXSA 5EF3A 5E6IA 2IWEA 4QUOA 4LCVA 4XC3H 4TUUA 2ZOWA 3O45A 5K59F 3ULSB 5KAQG 1R3JB 3N43B 4ZS7L 2GTWB 1DJHA 2XKNB 3MRNB 1HCYA 3IT8D 5JXEA 2BOLA 3LOWA 5DRNB 1FO0H 3FTGA 1BF5A 1TFPA 3JWDC 4EN3C 3S88H 1V8HA 3H9SD 1FIEA 4E0RB 4NQSA 2ZOKA 4X5RA 1DQJB 2Y1VA 1KENL 3Q2VA 1LM8V 3PWVA 4FG0A 4B9CA 2ENPA 3QJUB 5SWSE 5E4AA 4NUMA 4PY7B 2G2PA 2PP7A 1JFQL 4YVNA 5LBSL 1SNRA 1NDGA 2VZUA 3ARGC 4JJ5A 3ZE0F 2CUMA 3HHSA 4OT1H 1ULVA 3CLFL 5F6IC 2DN7A 2WLJA 4JFHE 4PJ6A 5LDUA 4M7LL 3GS0A 5SWSD 3NA4A 4BKSC 2VW4A 4P23C 2N7SA 5F0PB 4PJ5A 3KDMB 3Q1SL 1B0RA 2UWEB 3LPWA 4G8GE 5FA3A 1A6WL 4PRAA 3B3IB 4YZWA 4JFHD 4PRPE 5HI3C 4NKQB 1EJOL 1FLRL 1X5LA 4GRLA 1KULA 1U8MA 3K72A 4BZ2A 1ET8A 5DUPL 4AGOA 3ZLQC 5DD1H 4MMXC 5HGHB 4IDJL 4P2OC 1GJUA 1DUYA 1W2KT 5KTEH 1N64L 3DX7B 4XO3A 15C8H 4JRYE 5B1AB 3OF6D 1QEWB 2G60L 3ALPA 4JY4A 4M6NH 4PRPD 1NDMB 3IU3A 4YIQB 5DRWA 5KSBE 2ETWA 5LNEA 4KH2A 5CKAA 5I76A 3PP4H 5IJVB 2AZAA 4I9XA 5LBSA 5JMOC 4JEGB 1N26A 4Y1AE 4RGNE 3GLEA 3BSZL 3PXJA 3B7UX 1KCSL 4N3TA 3PWJA 4F7EA 4RDBA 1MPAH 4JRYD 2GJRA 3UGEA 3KLAB 3PHAA 4XPBL 3MACH 3OAZH 1S7SA 5B3SB 5EV7A 1CN4A 4PVMA 3QC5X 2DWSA 5C7XH 1FL3B 1KLGA 2B77A 5TQ0H 1A9EA 1LEGA 2BIHA 2UZYB 3HCVB 5HDQH 4F7CB 3D4YA 4IRJA 3AROA 5K9OA 3OKNB 1Z66A 2AQSA 2ZG2A 2E4TA 2Q76B 1TTBA 4FEMA 1ZTMA 4NKMA 1L7TH 4BZ1A 4XMPL 2OSWA 1KWGA 5FM5O 3VWJD 1FORH 5G55A 1YDPA 3PWJB 1BEYH 3DYMA 5I8CB 2VIRA 1EUUA 3FU9A 4IGBD 3FN0L 3CVHH 1XCWA 3AZUA 3DA0A 3UPAA 4D0DA 3II3A 5F0LB 4NXKA 3DROA 2C4FT 2WD0A 3IFOB 1XZ0B 2RD0A 3D2UD 1TIUA 4XPHL 5DA0B 4Y2DC 4KDTC 1CQKA 3U9PL 3I74A 5H35A 3U0WH 3MFFA 3D3VA 4DP6X 1QO3B 4BWWA 1CLYL 4XXWC 4EXKA 3ULUH 3DURB 1ZCRA 4GG8A 5IEKA 3V10A 1CE1H 5TE7L 2GITB 1SDYA 5J06A 3VQ2C 2G30A 3DIFB 2BCKB 5G2NA 2FO4B 3DROB 4K23L 1OAXH 1F4XH 3MUJA 2ZKMX 3DSNB 3WJJA 4HSCX 4G3YL 3GXNA 3QDJE 5H35B 3MFFB 4KO7A 1YAIA 5TDOB 3H4HA 1TKWA 1VENA 2LTQB 3IDGA 3INOA 5HHVL 5K9JL 4WI0B 1XEDA 1KCWA 1WZ1H 4PTTA 3EYOA 2P46B 2XIIA 3RBSA 1LTXA 2ARWA 1D9KB 3AWEA 3QDJD 5E8EA 3HUJA 2UYLA 1NC4D 2NTFA 2VERN 2JKRM 5E23A 2IGFH 3BE1H 1MCDA 1IQWL 3BIBX 1HS6A 4JFYA 5B39B 4WNJA 3ETBJ 4PV9A 4BEIA 4QRBA 3ECBA 2AQ1A 2YD4A 3MCLH 4AENA 5CIPA 1KIRA 1U3HA 5IROC 4M1GL 3BZ4A 1N6VA 1OP3K 4JFVA 3BP7A 1XGUB 2Y25A 2YPLB 1QOKA 2CBPA 4KI1A 5AOLA 1B0WA 4U4BA 4WUUD 4EDXA 5D1ZC 3VFOB 2KL6A 3VSTA 3GSXB 4AL8H 4JQVA 4FZEH 3MV7B 3EYVB 1TQCC 3EOBB 4Z7UE 3CXDL 1H15B 4XO4A 1T0MB 1VRSA 4PJIA 3LSOA 3R06B 1SOQA 3PWNA 3D85A 3OGCA 1Q0YL 2ZXCA 2VAAB 4H20L 12E8L 3P77B 5EBLA 4C59B 1U4EA 4ERSL 3JWNG 4OFVA 4N5EC 2OL3L 3U4EA 5I5RA 3U0PA 3DXAB 4H88L 4KJQC 3MRCA 1CE6B 1HWGB 3T1FA 3GHBH 2YRZA 5L4IA 4HBCL 1Z32X 2DTMH 4HHAB 1CFSA 4Z7WF 3FXIC 1C8PA 1MWAH 2EINB 3RE0A 3OR6B 4I48A 2EO1A 2PCYA 1DEEA 5AW8B 5FYLH 4ZFZB 3WE6B 3ZSSA 4JM2A 5FCUL 5MERB 5E7FA 2BOCA 2F18A 4NHUB 3VI3F 3L4ZA 1MCWM 1VADA 3NEXA 3RKDC 4ADIA 1I9RL 3FC8A 1HAWA 1AZRA 3ULVD 1QHPA 3SGJC 5FO2A 4QHKI 3RAJH 1IMHC 3EFDL 4XP1L 1GPOL 4Z3IA 2BSSB 4LSSL 1I1AC 4MD5B 4OZHE 4AG4L 4AVIA 4G5ZH 1FNFA 1RULH 5IBUB 1FHGA 2H6OA 1JZ3A 2E9IA 5A3ID 1MHPL 1DEEB 1QPXA 2PCPB 4PJAF 5D4QA 1JHLH 4J6RH 2X4TB 3BEVA 5GRVK 1BVZA 4UV7H 1I3GH 4NZJA 3ZE2B 3QIUC 3WFEH 2QV2A 3VXUA 4M7ZB 2NUPA 1SOSA 1WD8A 2P8LA 2X4RA 4N9GB 3TH4T 3L9YA 2P45B 4WGWB 1ODAA 2CK0H 3MLPA 4HAKA 4AXWA 2BVPA 3WV0A 2Y69B 4XNYL 3EOTH 3GKZA 1MAML 2VDRH 4LKXA 5KVGE 4JFEE 2NY4B 4IS6A 1P5UA 2OCCB 4BQBA 4ENZA 4YHKL 4HIQA 4NQCA 4K5MA 2OL3B 3FRUB 1NLDL 4Y16C 3O3EA 2X1WL 3QDAA 2YD1A 3DIDA 3JT2A 4WI7A 5CUSL 4JREB 5INDA 1AANA 2BP5M 1GW6A 2NUPB 3ILEA 3D4GA 4N5UA 1INQB 1ROCA 1HCVA 1IKOP 3AUWB 2F5BL 4AUYA 3GF8A 4JFED 4LSRL 4QD2E 2F9BT 2WV3A 4YUEL 2Y6SC 2ADIA 3TA3A 1CU4H 3H9SB 5AVZB 3AXLA 4HJ1A 1XAKA 5JDJA 2AJ3A 4RAVA 43C9B 3T77A 2R39A 1J48A 1M53A 3P73B 4YHPA 3WIHH 2J8UF 3EJJX 3PPEA 3HS9A 4L18A 2EDTA 3WTTA 2XBZA 5LGJB 3KMDA 2GYSA 4O2FB 4K07A 1OALA 5EOQL 4LBEB 1B4TA 1FP5A 1NCGA 1PJWA 2BDNL 4IKNA 1AS8A 1O9VA 4MZ3A 1T22B 3VD9A 4MCNA 4XRCA 5SWSB 1A21A 1YY8B 3BKJL 5DMKA 4F3FB 4IMLA 1IFGA 3T3PE 2AJ3B 2R8SH 4RAVB 1E28B 5FEBA 3QQ4A 1OWWA 3HG4A 2CJTA 1WUNT 1DBAH 4ZMOA 4FQIH 3TBVB 4TTDC 3KW8A 3OSKA 4OLXH 3MGOB 5D7JC 1HE7A 3VU1A 2VQ1B 2G0LA 3KJ4B 5I6PA 3AG3B 1HQ4B 3QA3B 3FQ1A 3E7JA 4J12A 2YAOA 3B2XA 3DOSA 3K1DA 4J3WA 1JV2A 2VWEC 2AXJA 2XVBA 4DZBA 5CHNA 3QR1A 4G8GB 1QSFD 2ZYHA 3O6ML 3K46A 3SODB 2M1KA 2WIIA 3B6SA 4PRPB 4L8CB 1FAKT 1NEUA 1W0WB 5JIPA 1HSBA 4MJHA 4KK6C 1PZ5A 4BUHA 5F70A 4OF7A 1SEQL 2QHRL 2OI9C 1AJ7L 1CFNB 2CD0A 4LKCA 4S2SB 3LN4A 4Y9FA 4OGAC 4RMVA 1MFAL 4IBYA 3FCGA 4RRPM 4Y19A 1UOKA 3B8SA 1L0XA 4HISA 4JRYB 1I7ZA 1BG9A 1S9XA 4JPVH 1ES0A 4U3XA 1UASA 5LXGL 4OZ4B 2JB6B 5KSBB 5D7LD 1A6TA 3WHXB 4ZFOL 1SHXA 3QQXA 4Z7OF 4KJPD 1CT8B 1NCJA 3L17A 5IGXL 3EO9L 4Y1AB 4RGNB 1MW1A 3GJFK 4NO0D 4EDWL 3SGEH 3P02A 3OPUA 2X4UB 1ZT7A 1A0QH 4WGKA 2DL2A 4IIQA 1U33A 4FI8A 3MLTA 3KGUA 3HBPA 4IMKA 4XPAL 1MLCB 2CE6A 4DCQA 3VWJB 3GSNL 3V4PH 1FNLA 4HBQA 4IGBB 4PCTA 4MB1A 2X4OA 3BLKA 4X8JB 2CLZA 3VRJA 3WXVH 2OR9H 1V7NL 1RJCA 1FYTE 2ATKA 1T0PB 2VM9A 4UQDA 2JXMA 4DO6A 3AS3A 3IKCB 3ARFA 3D2UB 1FNGA 3CLEL 1EJ8A 1T3FA 4ONHB 1G1CA 3BUQA 3PJSA 2Y07L 1KDIA 3BH9A 4WI5A 4DCQB 3WNIA 4B6ZA 2G9KA 2X0WA 1FYTD 5KYUB 3BSGA 3MRLB 3QJQB 1NMCB 1ACCA 2FRGP 2VR8A 1CDYA 3QYNA 3HLKA 4YFDB<