2JKJA

Drae adhesin in complex with chloramphenicol succinate
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
139
structure length
139
Chain Sequence
GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
publication title A Structural Study of the Interaction between the Dr Haemagglutinin Drae and Derivatives of Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 26
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2jkjA00
2JKJA 1UT1A 2BCMA 2VERA 2IXQB 2W5PA 1UT2A 2JKLA 2JKNA 1RXLA 1USQA 1USZA
chains in the Genus database with same CATH superfamily
3EOTH 2IH1A 2P44B 2C3HA 3SHSA 1ETA1 3FN0H 1LO0H 3B6SB 1WICA 2VXTL 1A7OL 3CZNA 1GIGH 2WKLA 3KPSB 4ETQA 4DSYA 3LEVL 3TBVB 3AZUA 4WKZA 4U0RB 1BBDL 2AEPL 5KSAA 4PRHB 2YAQA 3EH1A 5D71L 2UZYA 3MYZA 4UAHA 1FLRL 5ADPH 4XHQA 2WLIA 1TTUA 2H26A 2AI0L 5FUOL 1RIHH 5GRWA 3K6IA 4G7QB 4WTQA 3T6XA 5DXWA 3UDWA 5LCVH 1YMMA 2EEFA 4F8TA 2Z7ZA 2NXZC 4S1RH 1LXMA 3HG0A 1I1AD 5DJZB 1YYCA 1MFAH 2JTDA 3HC0B 4NHCH 2EZ0C 1BSIA 1M1XA 4M7LH 4P48A 3WTTA 1AKPA 4HKBB 5L9DL 3FULA 3JVGC 3QZBA 1I85C 4IBTA 1XCXA 1P7QB 3WE6A 1UACL 2WO3B 2ZOTA 4JHAL 4D8PB 1OWWA 3JV5A 5GS3A 5D1ZA 1OVZA 5F9JA 5E8DH 4V33A 1P69B 2NXZB 3BE1L 1W6WA 3MRFA 1FE8H 3G6JE 4NKOA 3ZQXA 4JHWL 2A1WH 3UO1L 2YAPA 4UAOC 3ABMB 3ECBB 4NSKA 5EZPA 3BVDB 4EN3A 1QTYT 2A6JA 3QP3A 1A5FL 1G0XA 3K6DA 3V95A 1TIUA 2VO5A 1JZDC 2CM5A 4UQIM 5EC2A 1YNLH 5AQ0A 4ZS6C 1NCDL 2EDDA 4KJYB 1L0QA 4JAMB 3DV4A 1JUFB 1NCIA 4UAOB 5HHOB 1GCYA 4MNGA 4KZEH 5CZVL 2VERA 3EH5B 4GIAA 2FO4A 4F2ME 1IMHC 4JRLA 4JVPA 5FCSH 5F72S 1FORL 3KVPA 3GLEA 4JO2L 5C92A 5IHWA 5B1AB 1E2WA 4HJ0D 3BVVA 1QATA 1NFKA 3QC6X 3QRBA 3SY0B 2EEBA 1MWAA 5BRPA 2UUDK 3BSHA 3LIUA 2VUYA 4FKKA 3TM6A 3QA3A 5DVKA 1S6NA 3QWQB 1IM9D 4OLEA 4XC3H 2OMZA 1KY7A 4R5XA 1FN4B 1F58L 3FFCB 3HG2A 5LNGA 1IAKB 4TUOA 4EF3A 1IFHH 2RHEA 4YSOA 4JFZH 4XVTH 5ES4B 5EEUA 4G83A 5ERWB 1RUPH 3QDME 3UZEC 3N41F 4Z7NE 4POYA 2OW6A 1GOGA 1ICTA 2P1YA 3FRPG 3MFFB 4AG4H 2ITDB 4M62H 1CDBA 4P2QE 1SMDA 1A6AA 2NSQA 3KPRD 5DQJB 5EPMA 1BFVL 4JKWA 2OMUA 2WLZA 5DHDA 5C0FA 3ZT7A 3P4MB 2P5WD 3QUGA 1EDQA 2WIMA 3MRQA 1MAMH 2P7TA 2FHFA 2K4AA 1E27B 5J57B 1UOWA 3INOA 5A3IC 3EJZC 3OTTA 4HLZG 2OZ4A 5A2FA 1CTOA 4D9QE 1P4UA 1A8JH 1IGIH 4APQC 3RTQD 3DTDA 4G80B 2WANA 1GS6X 4F15C 5DK2A 5F88B 1TSHA 5FHBL 4CSZA 1A4AA 1LO3H 1T2QH 3BISA 4UB0L 4Q14A 1RIUH 3FHAA 5D8JL 5JOEA 1KN2L 3WMQA 2DIEA 2YK1L 2QR0B 3NMEA 1GHFL 1MHHB 4APQB 1INQB 2BX5A 3QG6B 5D1XC 1BVLA 1K3ZA 4F15B 1VPOL 3UJIL 4TQEL 1Y0LA 1JOIA 1S7XA 3FQTB 4B9IA 4KWUA 2D0FA 3WN5C 4E9YA 3D30A 4PJDE 3ROOB 3FU9A 2A0LD 1K5NA 5JHDE 1EVTC 4YHIB 5I1IL 5FW6A 3CCHA 3DX6A 5D1XB 3GEWB 4MJID 3H2QA 3IJ8A 3VXME 2CNZA 4XC1H 2VXVL 3N42F 5FA3B 3MJ8B 2A6DA 3BGMB 3WN5B 2JB5H 5CLXA 4V2BA 4MBRA 2AANA 2CIKA 1KT2A 2I69A 5L2KD 5EF2A 3KLQA 1RK1A 1TJXA 5D7LA 3HHMA 4MJHA 2F5BH 5FB8B 3LYRA 5DJDB 4OI7A 3QJUB 2WVUA 5F7NC 1I1FA 3HAEH 3RZWA 3EYQD 2PWHA 2I32A 2B59B 3COOA 3D87B 4CDHA 1O75A 5H2BB 1E3XA 1LTXA 2VJ8A 2Y07H 5D5MA 1I3VA 3RX9A 3GXNA 1O5DT 4WHYH 2XZAH 1GZQA 2YPLB 1XL6A 3BD3A 4S0SD 2HPTA 3D33A 3UPRA 3NIDE 2AQ3A 1MFCH 3VTMA 1P84J 2MNWA 3GBML 5I0WA 2V8MA 2XN0A 1UD3A 1U8JB 1GXEA 1Z5LA 3FB6A 3QUKA 3QQDA 1CFQB 2E7MA 2FX7H 4G7RB 1U8NB 3ULUC 3AU0A 4UT6H 2B5IC 4PJ5E 1ZD6A 1DANU 2IMNA 1ZIBA 1TNNA 3GMMA 3NJNA 4PLKC 5DJYB 2AQ2A 3FO0L 1LD9B 1I8UA 1ZHLB 4CW1A 1JGDA 3TV8A 5KVFE 3LN4A 1FI8C 3VUAA 3SCMD 3FUKA 4YHZH 5E5RB 1MCPH 3OC5A 1C5BH 2B5IB 4U31A 3QH3B 2XFXB 1HEZB 1QR1A 5EORH 4WI0B 1JXFA 1WZ1L 1PKQB 3D2UB 1G6RL 2EC9U 3FK3A 5D1ZI 3QPXH 2W9LA 4IKIA 4Z7WB 4JNXA 3TYFB 4L8BB 1JWUB 2FJUB 3VFOA 2E59A 3OKEB 1MRCH 1GYCA 3EDJA 4LARL 4CVZA 5KVDE 1KY6A 1NBZB 1FH2A 2EDYA 4HGKC 4O5LH 1F90L 1LLAA 5D96C 1OPGL 1C5DA 5GJTH 1TU2A 2G60L 2YPVA 2BFVH 3O81A 5A6LA 4YHML 3UL4A 1B4RA 4NIKB 2R1XA 2J44A 2AQRA 2EIEA 4LASL 3TIDB 5A16B 1TVHB 4XHJD 2NY0C 4H1LG 1N2RA 3G6JB 1NMCC 3FQ2A 1T5XA 5D96B 1PQZA 1YPZF 4F58H 3LRSA 4OZGA 4Y4KC 1JBJA 3POHA 3HVNA 2IDQA 4QRPD 1ZHKB 2EEAA 3WL9B 2B08A 4PRBA 3FO9A 1NBYA 3KNBA 1YNTF 2NY0B 4ETYA 2VGLM 4Z0XA 1NMCB 1RAMA 3BJLA 1TTCA 2UX7A 4WW2C 4Y4KB 4H4NA 3P2DA 1C8PA 4L1DA 3QUYC 5DD5L 4HKZB 4OLYH 2WLYA 2XYBA 2VLJE 2YAHA 3PJLA 3ULUH 4F2MB 3NK3A 1UB5A 2O61A 1RZIB 4RBPH 5I8EB 3DVNB 2TSAA 4Q97A 2XJLA 1DL7L 3DBXB 4BSVA 3ULSB 2FR4B 4WY7H 1LGVA 3OKMA 3SDCD 4GKNB 4WW2B 3LZOA 5A2IH 2DJ4A 5AUMB 1A7PL 2NTSP 1NCGA 3QUYB 4FG6C 1R47A 4K7PY 2PCXA 4PJXA 1BEYL 2A74A 3BAEH 5C2BH 4ODVL 5GGSB 2WQXA 1L3NA 4P3WA 3MN8A 1E5UI 2HLEB 4L3AA 1I75A 4PJHE 3U83A 2F7OA 5EFIA 3QDMB 5I1KH 4AITA 4EO5A 3G08A 1KXTA 1G7PA 4L3CB 2XQYA 4G71B 4DQOL 5ACZA 5MEQB 4MX7A 3P3RA 1PD6A 5AW9B 2W80C 1BOGB 1YEDB 2BMKA 1J05A 5JNYB 3SODB 3CSGA 2JI2A 2XPGA 1UXSA 2GFBA 4NGHH 4QXGL 3CFBB 1P4LA 1WA0X 4Q6IA 5EZOL 4AVHA 5IVXB 3US0A 2PP7A 4PJIF 1I1AC 1DCLA 2B77A 1IFRA 2DMCA 4NT6A 2WZ5A 3WI9A 4LF3A 4O4YH 3HUJA 2GK0A 4G6JL 3FFDB 2VZUA 3MRDA 4P0DA 4WNJA 2OCCB 1QTSA 4HW6A 1I1AB 3EJSA 3NIFE 4L8SC 4PV9A 4LSDA 2FK9A 1TTFA 3H9HA 4H0LC 1ADQA 2WWOA 3N43B 2VN3A 3K2MC 1RERA 3HTLX 4JFWA 1NGPL 2BW4A 4AZ8A 5G4OA 5BQDA 2HFGH 1D5XA 1QFUL 2WKGA 1P4BH 2P8MA 1ITBB 3DWTA 1GMEA 3BHBB 3OR7A 1E9QA 4L8SB 5HDBF 3WSQH 2AXFB 5EZIL 4KHTH 2AK1L 1NLDL 4RIRB 1XZWA 3MBED 4XPGH 4XN7A 4U1JA 4KROD 5F1NA 2IGFL 1IARB 1S7SA 4J1UB 2N59A 4QAWA 1F3DJ 1R0AH 2ZAIA 4HJ0C 5FLVA 4AKQA 5G55A 3BKJH 4FI7A 4TVSa 1YY9D 3LNHA 4K3EH 2PWFA 5DO2D 1R6VA 3WNIA 4M4RB 5C6TH 1N10A 1TKWB 1R24B 4JDTL 3BWZA 4PJGA 4Y5VA 1TPXC 2ZP9A 4MRBA 2X87A 3L4YA 4URTB 4QF1A 3K5RA 4JDVB 2JKRM 1N3NB 2H45A 4K3DH 5CEZD 3ARED 2ZKWA 1EAOA 3IU4L 1TJMA 1IM9B 3BD4A 2EYTA 4HWBA 1ZLDA 4ONFL 5MP6L 1TPXB 5I18H 1KGXA 3DO4A 1WE5A 1I7TB 3PNWA 5FHAL 3NABH 5F3BB 5KYUB 2VDMB 1WA1X 4M03A 3PAVA 4S1QL 3UBHA 2P9RA 3EO0A 1VAHA 5C0CD 1HXYA 2CRMA 2ZXEB 5EZJA 3T4YA 4OKVB 5E9AA 3DX4A 4PS7A 4OLVL 2ENQA 5AYUL 1IC0A 3LQMA 4M56A 1T4KA 3MRPB 1RURL 3KPRB 4IOIA 3FB7A 3U7AA 5EO0A 3RTQC 3PJSB 1FL6B 1BA9A 1WWAX 2PWDA 4MNHB 4TULH 3OG4B 2P5WB 2I7SA 4F9LA 1J5OH 3H4FA 4NQED 2OTUB 3LPOA 2NT0A 2Z0BA 2HLFD 4J3TA 2V7HA 1HCVA 1TJGH 2VLRE 1SXSA 3RTQB 4CC4C 2CRIA 1N64L 2J2ZA 2RTTA 5F9OH 3QJHB 4CGUB 2WJ5A 3CDGB 1RUAL 2ADJA 3JTSB 5E4IA 3H9YA 2EDLA 2R69L 1ZWIA 1W8OA 5CBAB 3BKYH 1MPAL 3GNMH 4L4VD 4DN3H 3D3VA 5DHEA 1V7MH 3PP3K 4GJTB 1XF1A 2A0LC 4JO8A 3QXAB 3RL2A 4ZUSA 5C9KA 2WO4A 4E0RB 2VDLB 2OX5B 5HSFA 3GM0A 3ME0A 1NFDF 4FLHA 1FL5B 2Q76B 5I5JA 1ETZA 4KNUA 4PJ7B 1QNIA 2HKHH 2VW7A 4MHHI 3ARDA 3VRIA 4ZK8A 3UX9B 5JORB 1FNHA 2NNCA 1A1OA 3K2UH 1RZQA 3I6GB 4MJ4A 3E1ZA 2ZOLB 4MJIB 1Q0XL 1DN2A 4APXB 4KXZH 3EYQC 3MRGA 4OSUH 1NUGA 2MPVA 3MLYL 3OQRA 4NWUL 4ZZFA 2VL5B 2VWEE 3RWFA 5F9DC 5DEJA 5GRXG 1QOKA 3WFHB 1OTSD 2K1MA 3I6KA 3JTBA 5IFHH 2ZCLL 1WRFA 3TCLA 2OSXA 2DMKA 4LE8A 2ZUVA 2ZYIA 3B1TA 5KVFH 2DICA 1CDYA 5KYWA 5MERA 4P57B 4KQ0A 1XXFC 2VLJB 1N7ML 2WZAA 4NZJA 2CKBA 2OP4L 1DVQA 1EWHA 5HYFA 2YD9A 5I0DA 4QR7A 2J55A 1OQXA 2JJTA 4W9GC 3ZL1A 4X6DA 3PWVA 2E7LC 3BUYA 4LPUA 4G7YH 4LP4A 4YDIL 2V5RA 5ESQA 4Z3HA 3I3BA 1NINA 4WVRA 3TFBA 1WGVA 2PW2B 4JM4H 5IFAL 3DETD 4LLWB 1ESOA 4PJHB 3SCMC 4XAKD 1KJ2L 2VDLH 5FKAA 1ERNA 1P5UA 1E28B 5EU4A 2NXYD 4RNRA 5GS1C 3EZ8A 3GMRA 4ZUWB 4EQ3A 5HDQH 1MCFA 2CCWA 2GC7C 4NUGH 3VXUD 2X1PA 2ZP0T 2V0AA 1OGTA 2P5EE 3RG1C 4XPHL 1LE5A 1FVCB 3O11B 3QS2A 2OZNA 2XN1A 2YXVA 2VRAA 5DWUL 3FT3B 3QJSB 1Z0MA 5GS1B 2YO3A 4R97C 2CPCA 3WIIL 3X14A 3IXAB 3QHTC 4LVHC 1UZ6F 1A7OH 3ENEA 1ZXQA 2ALWA 4ODXB 4TNGA 4O2CA 3U25A 3UZVA 1HHIA 3LEVH 3CX5K 3BX7C 3O3UN 4L4VE 1BBDH 1H8OA 2AEPH 5K9JL 5E94B 3FUFA 1UEMA 3IMTA 4H88L 5D71H 5I8KL 4UNIA 4XHJC 1FLRH 2GK2A 2NDGA 5TDPB 4R97B 4LVHB 2AI0H 5FUOH 3SIKA 4UBDD 3S0PA 3D5OF 2F68X 3DMMD 1QI3A 5TE4L 1HDMB 2QQKL 1B4LA 1VFBB 1S7VA 3CNKA 2R4SL 2Z8WC 4QRUA 5JZ7D 2HRGA 3CZJA 3PHSA 1LEIA 1P2CA 3MRMA 2ICWA 5D2LA 3K6SB 4WUUD 2VC2L 5L9DH 4HEMA 3UTTD 2X7LA 4A63A 3QHZL 4JHAH 5DD6A 2JI3A 2NNXA 1YZZA 3MV01 1JNNL 1IJNA 4F3FB 4QRPB 3ECVA 3BE1H 4JHWH 4Q74A 3UO1H 3IAGC 5G4NA 3UYPB 2IV9A 3UYRL 2FNWA 3DK2A 4LCIL 3D0VA 3FBKA 4KX9A 5SWSE 1A5FH 3GZOA 3HLAB 4POUB 4OLZL 2X53A 1CI3M 3C5SA 5C0EA 5E2UL 2JCCA 2KPNA 1NCDH 2R2HA 4F33B 5I0YA 3M1BA 4DUWA 4RZKA 5T1MA 4UOQA 1GCFA 4L4TA 3SBPA 3WKQA 5CZVH 4U1HB 2UXTA 2BVPA 2HG5B 3RIAF 1AVAA 3HG1D 1JHLL 3RWEA 4JE4B 3MJ9A 3IETB 3VD0A 1FORH 4JO2H 3C8HA 1HSAA 4DP0X 3L16A 3BUQA 1EJOL 1I8LA 1PAZA 5HJ3B 4G5AA 4JDEA 4BWWA 3QI9D 3ZDYF 5AL8A 4P4KA 4JFXA 1XGRA 4AVJA 3IEAA 1KJMB 4ZMTA 1N70A 1F58H 5D7JA 3QQ9D 1UH4A 4M5TA 4F2FA 4PWKA 1DEEA 2QKIA 4EI5D 1HILA 3WHE0 1YC7A 2A9BA 2D3NA 4IU3B 2XJKA 3VI3E 3NEOA 4DKFL 4ELMB 2HPOA 4GBXD 4FJ6A 3PABB 4GRWF 4TOYL 2YXMA 3MNZA 4GINA 5KBLA 3QUXD 2XA3A 2IPTL 1AZNA 1OCRB 3V0DA 5MEPB 3WEMA 4WJ5A 5IUCA 1BFVH 3DVGB 5CJXC 2NX5D 3DVIA 3FYEB 1PZSA 1QLFA 1SHMA 1UH2A 1EDHA 2XZZA 4NENA 4R9HA 3P73B 1C7TA 3LS5L 3IGFA 4UT9A 3IMVA 1XZ0A 3GTNA 2ZZUT 4R4BA 3MRLA 1S3KL 4YHPA 1HL5A 4S1SL 3CVIL 1WWCA 3RGVD 3RFZA 3TO2A 4Y2LA 1HI6A 5D7IB 5FHBH 5EUOA 5DJXA 3S5LA 4UB0H 1T0NA 5GZND 4QTHB 3KAAA 4KROC 4MZRA 5I1LB 1L0YA 4HJJL 1KN2H 5CGBA 4IRJA 1TJIL 1GHFH 4UQBA 4Q4IA 4M7JL 1OZUA 5F1SA 3H3KA 4MB1A 1X6LA 1DQQA 2BVQB 3GXFA 4WUUE 5DO2C 1YY9C 1VPOH 2NY6D 4NLHA 2WXQA 3AJ7A 3QUZD 4MAUL 3UJIH 5ANMA 2Q2LA 3F7PC 3RY6C 4OIFA 4KROB 2VDKH 5MEOB 3ARGD 2H0EA 1X5IA 5I1IH 1UURA 4G9FE 5FV2A 5KAQF 3IDGA 1OAYL 2VCOA 2VXVH 4X0KB 4NRYA 2H32B 2K3TA 3AREC 1G6RB 2WD0A 3CLEL 4BH8A 1WISA 5D9SB 1XGYL 1B88A 3PHOA 3WLWD 4R7DA 1Q1JH 5IQMA 3PWUB 4MMZC 4BCYA 3ORJA 2Z1PA 3S35X 3PFUA 2AEOA 2E86A 4S0TD 1DE4A 3EYSL 3AREB 4JVUA 2VIRB 4OZHA 3APNA 2MCMA 1FG2A 2VXUL 3U9UA 2HN7A 2RACA 1MLBA 4MMZB 5ETUA 1AHKA 4XP6L 5SWZE 3TH3T 2CPUA 3KLAA 2FEDD 1PLBA 2ZWLT 2YC1A 2JXMB 3AXLB 5JW5B 4OZ4A 3GBMH 4LSQL 1UKSA 4MA1C 1GZHA 3PQYD 4JN1L 4NDMB 3VTAA 2EYRA 2Q8BL 2HLFC 3V10A 1KMGA 2BSSA 4GG8B 5T1KA 1TZIB 3SE4A 4P06A 4DZ8A 5CM1A 3HI6L 3ATBA 2BNRE 5I8OL 1KLFA 1H3GA 3L7FA 4NQEB 2XVLA 1UXWB 2E9IA 3FO0H 4MA1B 3V8CA 1HAUA 1T83A 2FUTA 4EMZA 1T0OA 4QRAA 3TCTA 4BFFA 5E24E 2Y23A 3N5AA 1N5YL 3GDBA 5AYQA 2AABL 1NKGA 2ICWI 3D07A 2V5MA 2VDNL 4KK5D 4KNSA 3H7BA 1RPKA 4KTDL 3KPTA 4QO1B 4L4VB 2H32H 2AJVL 1G6RH 4HC1L 3APMA 4GMTL 1R3KB 3V0VB 5J6HB 2OXHA 1TSRA 4OFQA 4LARH 1CMOA 1MCOL 2JK5B 2A9CA 4Y1AE 4L2LA 1XHHA 5JXED 5CEZH 3V0AC 3PAYA 3GJEA 1M71A 3CVCA 4PJFE 1F90H 1ZT4B 2WGNB 3I50H 2F8XC 2KUTA 3L9EA 1OPGH 3DECA 1OTSC 3P77B 1RKRA 2G60H 4LO9A 4K23H 3BQVA 4YHMH 1U4FA 5HXMA 3F6IA 4P3CL 5IMMA 3GSVB 3EUUA 4MB3A 4LASH 4HUNB 2F61A 1E90A 3VDAA 2XWTB 3L3IB 2DQUL 3MV9E 3B83A 3FQNA 1N68A 3QSKB 3HN3A 5BZDA 1W2KT 4HUCA 3Q5TA 2CLRB 2EE9A 2OMTA 1IBYA 2FWSA 4P2OD 2ZAGA 4S10A 1F4XL 3CFTA 2Z34A 3CK0H 4JZOB 3QDJD 3PWNA 1OARL 1S3RA 2X2JA 1G1OA 3TCXA 5AZEL 4GB9A 1KB5L 4FQIL 3BO8A 3S3SA 1E4JA 5A7BA 2I9LB 4J12A 1FGNL 3NQKA 3IDUA 3N0AA 1TZAA 5E8OA 3DETC 4ZX6A 5L4FA 1MQKL 4HJ1A 4KKQA 3JWDL 4HIHB 3VXRD 1MZYA 1T1WA 4HD5A 2NXYC 3F3HA 1DL7H 4JFQB 4KTYA 3N9GL 3B9KA 3FRPA 3DHJA 1KV7A 3VGEA 3EBHA 1A7PH 4U3CA 1JL8A 3BAJA 1BEYH 2VW6A 4FFYL 2YXWA 3DSNA 4ODVH 2XWZA 3PQYE 1TYRA 2V2WA 2NXYB 5CMAA 5SWQA 3UIZA 3KG5A 1DDHB 5KANG 1R3HA 3QEQD 1RUQL 4LGRB 1CFNA 1U92B 2KERA 5IR1A 1KBGL 3I9GL 4YK4C 1L4IA 2NCEA 3VXUB 3QR1A 3DX1A 1E8XA 2IPKB 2W88A 3DVFA 5DSCB 3WMSA 4Q56A 4AVIA 5CNHA 3BQUD 4M8RA 1KJVB 2QSVA 5DFWH 3KH4A 1WBYB 2LTQC 4Z3JA 4YBHA 2OMXA 4D94A 4OGXL 3KE0A 2BY3A 3L9RB 4G43B 5C6PB 4YK4B 4UBDC 4NQXB 1BQUA 3SZKC 4QXGH 5EZOH 1R3IL 2PCFA 2R2BB 1XF4B 5ISZA 5JZ7C 4C4BA 2LTQB 3FTSA 4NN5C 1X7SA 1LWRA 3BP4B 1N4XL 1SXCA 4UILL 1KNOB 4MYWB 3VWJA 4XNMB 5F8RC 4G6JH 1F86A 5L2JA 1X9QA 2CRZA 1N12A 4X6FB 1KYDA 1YUHB 3B5TA 3BZ4A 2P8LA 3P4LA 4NN5B 4LP5A 4S2SB 4WUUB 5F71A 2RR3A 2FT6A 3IT8D 1QBLH 2FEEI 1NGPH 3D0LB 3P9WB 4FI6A 4XZUB 3UTTB 4HH8A 4WRLA 5SV3A 2KL6A 3VI4E 4BUQA 5K9QG 5DK0A 1QFUH 1JXKA 2WQRA 1J9SA 1FGVL 2J73A 4AZUA 3SSGA 2JKJA 2HRHA 5JW4R 2AK1H 1NLDH 3TZVD 5IHUL 5CBEA 3DGCR 1GOHA 4GPVA 1HHJB 1QFHA 2IGFH 1BREA 4OZIB 1XGTA 2BIQA 1I8KB 3FQUA 3NCJH 3UTOA 3EDEA 3BDYL 4DO5A 2F2HA 3MHZA 1XVSA 4MJ6A 3NSXA 1OGPA 3CUPB 4JG9A 5B1KA 3RYMA 1FNEB 4Z7AA 3QI9C 3IMRA 4Z8FL 3PWLB 3HG1B 4UOZA 2FAUA 4OZFB 2IALA 2ZAHA 1FHGA 3FDWA 5E2TL 2HTLD 2P5PA 3QQ9C 4J5VA 4Z7QE 3RGBA 4LOUD 3QAQA 2IGTA 3V4PA 3QI9B 3IGKA 4PJ9A 5SWZB 3IU4H 3OVUB 4GBXC 2CUIA 4ONFH 2J8UF 4AYFB 5MP6H 3G5XA 3QUXC 5FHAH 5D7HA 1UKTA 3KPQB 1MEXH 2C4FU 3QEQE 1UT2A 3F7RA 1RK0B 4S1QH 4B0MB 1V10A 2EDXA 1SYVA 3C12A 1XCQA 2PYEE 4OLVH 2EH8L 5AYUH 4GBXB 3EFDL 2YLHA 3QIWA 2IO5A 4OBRA 2UV3A 3QUXB 1RURH 4FFWC 3QB7C 3GUTB 3RGVC 4JRYA 3RLSA 3ZL4L 2DW5A 2NX5B 4N2BA 5KSUB 2F8IA 2NYYD 4X9FA 4OW6A 3FT0A 5EBWB 5INDB 5KZCD 5FX3A 3ULVE 2X0UA 2KZWA 1J0ZA 2BOBA 4Y88A 5B3SB 3CZLA 2FSDA 3MMEA 1S78D 4E41A 4JCWA 4PJCE 2A6KA 3RGVB 1N64H 3H7LA 1PJ9A 5E8PB 3FMGL 5TH2A 4DCQB 1WF5A 5LO7A 2NY6C 1UENA 1RUAH 3UTZA 2FQGA 3QUZC 1ZY9A 2R69H 1NQBA 3TN0D 1MPAH 3L81A 4BFIB 4H1LA 2GAZB 4FNUA 1WC7B 2JF1A 2X38A 3ARGC 5IVZB 3HI1B 4WHCA 2YGQA 2XWCA 5C08D 4J2XA 1I8MB 3LNDA 4E9VA 1KJ2B 5TDNA 4FADA 2VOTA 4JG1L 4PJFB 4UM9A 5ITFA 2NY6B 3BUBA 2Y2WA 2XLLA 3QUZB 3KM2A 3M17B 3N44B 4UUJB 3CDYA 2PTUA 2DI9A 3OKNB 1D6EA 3ARGB 5JW3L 1LNUA 3WLWC 1V3JA 2FL5B 1HX0A 5JIDA 5HGAB 3MOQA 4CBPA 3RI5K 4HISA 1Q0XH 2ZUWA 5HVHC 3MRBA 4ES8A 2GIYA 2CDGB 5CWSA 3Q2LA 3HVDA 3MLYH 4NWUH 3TBVA 5LAXB 1CVSC 4PRHA 1IGYB 4HCRA 5KW9L 4LVOC 3CIQA 4RWYL 2CRYA 2X4OB 3H6AA 2KHAA 1HNFA 2QFRA 2ZCLH 4DGUA 2V37A 2IXQB 5HVHB 1COBA 1Q9KA 2BHFA 2KLRA 1BIIA 2FEDC 5FK9B 2F1EA 2FX8L 2HJLA 4F5CA 3T5WA 4QOKE 1N7MH 1AIZA 1S9XB 4GG6E 4TQIA 1U93B 2CHWA 2OP4H 2YOAA 3K4DA 3QIUD 4LVOB 1AIFA 3VM7A 1GL4B 2MQ3A 4GRLD 3IFLL 1KBKA 4F37F 2L04A 2Z92B 3EYUL 3O4LE 5FGBA 4N8CH 1J9RA 4YDIH 1S7QB 2OSLA 4PSPA 1NPUA 2FYYB 3ECBA 3LZRA 3PQYB 4JY4B 2IDCA 5IFAH 4Y9EA 1GZPB 5ELIA 1KJ2H 3VD7A 5H8DA 2X4RB 3OX8A 4XN8A 3I9PA 3DYPA 3CX2A 3HE6D 1NGZB 2BSEA 3OQ3B 4KK5C 3WKYA 4RA3A 4KJYA 3W9EB 3S3JA 2PPDA 1HIML 3U82B 1D5IL 4OCXL 5TPWL 1Y6NR 2JWYA 2R23A 4XPHH 3T0ED 2PXYA 3L1FA 3ILPB 3MYJB 4OF7A 4BDVB 5IB5B 3CG8A 5JXEC 2QMJA 5DWUH 2E9BA 4X7TB 1IEAB 5K1JA 1UD6A 4UDUA 3UBGA 3ZE0F 1S7WB 2HX7A 1DVFD 4FZ8L 1HHKB 3FPXA 2CQVA 5K9JH 3WOVA 4AXWA 5IW1B 4H88H 1FN4A 1JK8B 6PCYA 5I8KH 3AWFA 1IAKA 3IPFA 3WBDA 4QYAA 5ERWA 3VU2A 1OLZA 4CRPA 2CGZA 4K71C 4E9QA 1AMXA 4AQOA 1T1XB 2WZ6A 5TE4H 4BE5A 2KPWA 4P2OC 2WSDA 3LXAA 4QRRD 2R4SH 2OCJA 4A7GF 2ZX6A 3D85A 2YWZA 3DV6B 3RUGB 3VG9C 1XTLA 3EIFA 3DROB 4POZD 3QJOA 3T3MF 2VC2H 4X4XB 1KCLA 2ZXBA 3EYVA 4K71B 4XN4A 4XO3A 3QHZH 2XKUA 5E7FA 4RGNE 3O6FD 3CXHK 1JNNH 3LPPA 4P2OB 3IGAA 3DJSA 4DW2L 2E9GA 4PRNB 3ESVF 2D4FA 1I9RL 3L95B 3UYRH 2FIRT 3SN6N 4G80A 1IQDB 3VG9B 4LCIH 3WTVA 4J3UA 3MCLL 2QGDA 4OLZH 1E4WH 4R7VA 5E1HB 4IOSA 4IJ3C 3K0WA 2ZKYA 1PCXA 4LESA 4L9LB 1OOWA 3FNKA 3VXRB 1ZLWH 3PAZA 4KMLB 2QR0A 1IGFL 3IE4A 1JF6A 4KAQL 4XCNB 3UEQA 4B3EA 3P9MA 2EDFA 4N22A 1Z9LA 1CD1B 1JNLH 1JHLH 4XBGA 4IJ3B 1SBBA 5BRQA 3THML 4D3CL 1QYGL 1NDGA 5E9DE 1YCSA 3FH8A 3CDZA 4NJAH 4YHIA 1BWWA 4CDGC 1G43A 3DX0A 3IM1A 4Y5YA 5AB1A 3X1EA 3SBWC 3QEQB 3AQYA 4DN4L 3EO1B 1PCSA 5FA3A 2NQDA 5BS0A 2VZOA 3S88L 3GMPB 5KN5B 3BGMA 2DQCL 3WN5A 4FTDA 1UC6A 4EKJA 1N0LB 1Q9OB 1XH2A 2PYEB 3NRQA 4NIYE 3CDCA 3I9IA 2DQFB 4XNAA 2OYLA 4H25A 2HKFH 2XG5B 5FB8A 3WYRA 1TJHL 2G3MA 1TTGA 1E9OB 2I26N 4LU5L 3OMZA 4Z7UB 1UWEL 2IDFA 1XSJA 5DVOA 4HUUB 2MKLC 3LS4L 4PS4L 4WFGD 4DKFH 5C8JA 1Q90A 4JVWA 1XMEB 5TTRA 4CAGA 4MQXD 3KYMA 2IPTH 2VR5A 5H2BA 5JW4N 4CSPA 5IQ7L 4PJEF 3OXRB 4ZMXA 2YPLA 3L4ZA 5GISL 2HVBA 2LAGB 2IH8A 2UYLA 5I1EH 4XXDA 4B41A 4HLJA 3TIEB 1QSFD 3VWKC 3BPLC 4KRNA 1S3KH 1FCGA 1WDAA 4IIQC 3EYFB 4S1SH 3CVIH 4D7BA 3LKSA 4OZFG 5IW3A 3MLSL 1U95B 4PVMA 5D70L 4PWIA 1U8NA 2EYSB 4PJBF 5EO1B 2X2HA 3TZVC 3CXDL 4JFFA 4MA3B 4UTBA 3PGDA 1RZFL 1OIOA 3BPLB 3VWKB 4HJJH 1LE9B 4GP4B 2DQGH 3APFA 3DJTA 3H1ZA 1A3LL 3P0VH 4IIQB 4FLRA 5MENA 5DJYA 4M7JH 5IMLB 3D18B 1ZHLA 4IBUA 1A14L 4JQXA 3RWIA 4MAUH 2PR4L 3TZVB 2FT8A 1F18A 4RMWA 3EJJX 1IGCL 3KS0J 4FYRA 2Q86B 5FO7B 2IFGA 2CO7A 4TXVB 3HNTL 4WI0A 4QY8B 3DJRA 4FI8A 4K5PA 3QGVA 4PN6A 5DYOB 2VDNB 3DC0A 1SJEA 4YOKA 1OAYH 4AEIL 2DWDA 2MPAL 4Z7WA 4LOUC 3TYFA 4L8BA 5KJRL 3CLEH 4LRNL 3OKEA 3CHQA 4HALA 1XGYH 5CJOL 2F1BA 4LL1A 5F7EL 1QP1A 4D9RE 1T0PB 3N1FC 1T3FB 1V55B 1TT6A 1HSBA 5EEVA 1K85A 5AVWB 3EYSH 4A2GA 3G04B 5IM7B 1X7QB 3BP7B 4S11A 1T5WB 3RX5A 3GJFH 4PW3A 3WY4A 1F41A 1U91A 3GSOB 1EZVX 5EOTB 5ABAA 4HOZA 3TIDA 1D7FA 2VXUH 3O4LB 3F5WA 4G8FA 2QADD 3G6JA 2BCMA 1G6VK 4XP6H 2V33A 2X3AA 4XPTL 2NYYC 3OKYA 3WL9A 1AOZA 4JN1H 3KW7A 1S78C 2NDFA 3Q05A 3SGKC 1N0XL 3RNKB 4WFED 5FR3A 3JWDC 3TV3L 3WFBH 4OB5L 4NP4L 1RJCA 3V5HA 2Y1VA 4BK5A 3HI6H 4RSVA 1KB5B 5KZCB 4JDZA 4HKZA 5I8OH 3TN0C 2BVTA 2X4SB 3GO1L 3LVEA 4F2MA 2N3JA 2WINB 43CAA 2AAAA 5IKCA 1MHCB 3ARBA 2EKSB 5I8EA 1JZ5A 3ULSA 2FR4A 4YIQA 3MV8D 2ZXCA 4FNTA 4TMPA 2AABH 4K94L 2VDNH 4F7PB 5I6KA 3QUYA 4AWJC 4KTDH 3TN0B 4KDWA 3IE9A 5GGSA 5IJVB 4HC1H 1UATA 3H55A 2FBRA 5C08B 3IYLW 4GMTH 3AY4A 2OFQA 4XN5A 4MZ2A 2DM2A 3H85A 5C07E 3QDMA 2Y5TB 4PUBL 5J6GB 1MCOH 1XD0A 4JJHA 1A64A 4GXUM 4Z7VB 3CFQA 5DC4B 3O3DB 3KLDA 3HG3A 3B9AA 3RA7L 4L3CA 4ANXA 1OAXH 4P2QA 2IH9A 3TJHD 4Q9RL 2D9QB 5DTFB 3R06A 3QEHB 5JNYA 4P3CH 2E7DA 1JF5A 4YPJA 2DQUH 5HY9B 4JQIA 4KKRA 5HYJE 3W9DB 1HJBC 1QEWA 2BZCA 1HAWA 3QIUC 3DTXA 4FS0A 2IG2L 3LNEA 5C0BD 1VB9A 3REWA 4EAEA 4JO1L 1D5MB 4GRLC 2VSKB 2XWJA 2WQWA 1WS8A 1F4XH 4DT2A 4HK3J 3EFOA 1OARH 1Q9LA 1E40A 1BBJA 1YY8B 2DI8A 1KB5H 4FQIH 1G7LA 1MN4A 1C08B 1ZTXL 3QIUB 3V6ZA 3QQ4A 3KD4A 5IOPB 1EQWA 1FGNH 3KEHA 5FM5O 4GRLB 3Q6GH 3VSVA 3Q3GB 4XZ4A 4AQZA 3CHPA 1MQKH 4GT7A 1JZ2A 3K81A 4JFYA 2HX9A 3VCLA 3NA4A 4DUVA 1J18A 4PJDA 3N9GH 5I1DA 3K7UA 1F13A 2VABB 3BIAX 4L8SA 3BAYA 5JHDA 2X6CA 2AXFA 1A6PA 4BUHA 3RJDA 4G5ZL 5DRWB 3VXMA 2GJ6E 5J11B 1EZLA 1Q94B 2GSIA 3MJ7B 4FFYH 5GIRB 4E9TA 5FYLL 1QHQA 2WXRA 2DAVA 4IU2B 3VFNB 3F7LA 3WFEL 4PVNA 2XN9D 4MS8D 2YD5A 4RESB 3VD2A 2XV3A 2LHAA 2DJUA 1RUQH 4EIUA 1U8PB 1KBGH 3I9GH 2FO1A 5LGJB 2Z9TA 4RLDA 1TKWA 1DVFC 1R24A 1UVQB 4JB9L 4DNLA 2ZUQB 1KENL 2LU3A 3VG0L 5LXVA 3VFRA 2XSKA 3HR5A 3P3UA 2B8OT 1BZ9B 3WN6A 1L0XA 3SKNB 4OGXH 4NO0A 2ZCZA 4NQCE 5DVPA 5J1SC 2E9JA 1DVFB 2WM0A 3HZKB 1V3KA 4CNIA 1R3IH 1EIBA 3CWGA 4LIQL 4PRIE 1I7TA 5F3BA 5KYUA 2PPEA 5DU7A 1N4XH 4POZC 4UILH 3KGRA 1EEZB 2FH8A 3D6GA 1KLGB 1PEZA 3O6FC 3QWRA 4PSRA 3VFPB 4PJ5A 2VMEA 4U7KA 5D7SL 5LGKA 3LHAA 1WD9A 4QRRB 4MVBC 5IUSA 3OGCB 2A99A 2P8PA 3KPRA 3LNGA 4M61B 1ID2A 5F7KC 3GGWA 1QRND 4MNHA 4TQ8A 5M7QA 2CZNA 4H0GA 2J1YA 5HGHB 3NCEB 3O6FB 3A4EA 4AJWA 4KNTA 1XAKA 3EF4A 1UADC 4OF5A 1FGVH 4P5TA 3OKLB 1FNAA 3RTQA 4OI9A 5AOJA 5E51A 5IHUH 2K0RA 3QJHA 5AW0B 1WTLA 5LHDA 1NCTA 1JHTB 2H5UA 4LPYA 4GW5A 1MLCB 2XA8L 3BDYH 3TEZA 5JPNA 4PY8J 5A2CA 3QXAA 4U2YA 4BV1A 2Z35B 2BC4B 4CC4A 4E0RA 1J8KA 4OJCA 2EIKB 2OX5A 5BZZA 4PGEA 4IKKA 1FL5A 1UFGA 4Y9CA 5JPMA 3H9ZA 1NUNB 1KWGA 2CCVA 2AVGA 1CGUA 3NZSA 5E2TH 1T2XA 4LNRB 2CO2A 5CP3H 3VGGA 1ZDSA 2BNUB 2YA0A 4IK6A 2ZOLA 4MJIA 1JYXA 1H3XA 4JPSA 3OKDB 4NQTA 5E1IA 2ICCA 4Q6KA 3GZQA 4PW9A 4MQXC 3RVVD 2PTTB 2FLRT 2W65B 3QQXA 5CILL 3WFHA 3G5WA 5C0JA 1IJ9A 3J2PA 5I71C 3RL1B 2BP5M 3CPLA 4MCZB 4DGIL 1WWBX 1MQ8A 3HMXL 3WTWA 2EH8H 4RGOH 1DJWA 4I87A 4KOCA 2FWUA 1TLMA 2VN5A 4OUUB 4ZFOL 2VLJA 3DUUB 4TVUA 3ZL4H 1BQSA 4OIIL 4V2CB 5I71B 2C1PB 4LLDA 3G5ZB 1G9NL 4W6WB 3CLWA 1SXAA 4FXKA 3Q8CA 3CVHL 3LRLA 3WKMH 4KRMB 4ZW8A 1B6UA 1U3JA 1CGVA 3F6JA 5AYTA 3SKOA 5C97A 3KYNB 3FMGH 2PW2A 3N50A 1DUYB 2WLHA 1X9RA 3FOLA 5FFOA 4GY4A 4PJHA 4EDWL 4N2EA 3FB8B 5DZPA 3LRMA 1I4FA 3MTRA 1DQJB 4JZJA 3WNLA 3ZMEA 2CLVB 3RP1A 4FN0A 4RAHA 1DBJL 1LK2A 4JG1H 4ANVA 5FYLD 1TNMA 1QFPA 4K7PL 3HJEA 4GQPH 1MWOA 5BRZD 1FVCA 5KBPA 5J3HD 3O11A 3MV7D 4U1MB 5ID0B 3E6HA 1P9MA 4A2MA 2WB1A 4LLMA 1O9VA 4BSWB 3GB7B 4WJG3 5CCKL 3DOIA 3RWHA 4TNEA 4TSBL 2AS5M 1X5FA 2GJRA 4YPGB 3H54A 2DL2A 4LBAA 2PABA 2EO1A 1KGCD 3QW9A 5HJGA 4JFHE 1XF2B 1MDAA 5JO5B 1EEYB 1JTOA 5KW9H 4JFOA 1URLA 4RWYH 2QADC 3II2A 5D4HA 1T1YB 1YHPA 4LCCC 2NUPB 1CDCA 2Y6SD 4OQTL 1JWMA 4P3DB 4PJIE 5A2BA 3V79C 1HDMA 1MFMA 3ZKXC 2FX8H 2EACA 4WENB 5E1GA 1VFBA 3LVTA 1FZKA 1URIA 2WXMA 3U0WL 2QADB 1BF2A 2IADA 1YN7A 2YPKA 2VITB 5E9NA 1HVXA 4LCCB 3IFLH 3K6SA 3U4KA 2UX6A 1PBYA 5K9OB 1FIEA 1J11A 1TQCC 4CMHC 1U2HA 5E0FA 3EYUH 3DRQA 3ZKXB 4WK4B 4XXCC 3OV6A 4YHOL 5EEZA 1JRHI 1YA5A 1T21A 2JJSA 3N91A 1TUPA 3ZR6A 5GGSY 2DQDL 1T0MA 4PCTA 5BQ7A 2GSMB 5HDBE 3HB3D 4TQHA 4CMHB 4KXZI 1AH1A 2QLVB 4PWEA 2BLFA 4AY0A 1HWHB 1W8NA 3ALXA 2IAAC 3CGTA 1FFPB 3PPEA 5DJ0B 4F33A 1AHMA 4HV8B 1AS8A 1BQRA 1HIMH 3ZE1B 1D5IH 4OCXH 5GS2D 2JCWA 5TPWH 1KELL 4HUVB 2IANE 4LEOB 4XB3A 3S98A 1MWAL 2HG5A 1JPTL 1XH3A 3ZGHA 1ZTXE 3QUMA 3IETA 1P7KB 1IU1A 1LQBC 2PPCA 4GS7C 4E9LA 2Y5EA 1FF5A 4B0MM 4AMXA 4DEPC 3KM1A 3TJHC 1QA9B 1J1PL 5BPPA 9PCYA 4FZ8H 3TASA 2VQ4A 3L5XL 5MHSD 1OEZW 1XB6A 4GS7B 3U0TB 4I5BB 4U4BA 3FT1A 1ZOXA 2LLLA 3FSVA 5F7FA 4DEPB 1NFAA 5J1AB 5DZNA 1KXQE 3SE8L 3L5WB 4MMXA 3VXSE 4AC4A 3SPVA 4KI5D 2FWOB 4K5OA 2D73A 3SDXF 1MVYA 5MEPA 2MSPA 4J3SA 4JHBA 3DVGA 5EUKB 2FB4H 3IJHB 5D6DC 4GQRA 3G6DL 1IT9L 2VLRA 3LKRB 1MCCA 4LK4A 1SFHA 1QAWA 4JJ5B 2F53D 2DD8L 3LD8C 2I07B 4JZNB 4JW3A 1A9BB 4DW2H 5GHWL 4R7LA 5F0JB 3EDKA 1I9RH 5D4IA 5GGTA 1MCQA 3CD4A 5JHBA 3SE9L 3EXLA 1TDQA 2ROYA 2AKRB 2J1KA 3LD8B 3BRGC 3A4FA 1KG0B 4QTHA 3KVQA 4KDTA 1AD0B 1IEBA 1B2WL 1IGFH 2Z91A 1MJ7L 3V7AE 4MS8C 4A2DA 1ND0A 4XP4L 1G1YA 4KO7A 4ZUTA 2EIZB 2RQEA 4IRSA 3UTQA 3CXHJ 3D52A 4DERA 3EJCA 4GYBA 4D3CH 1QYGH 4UV7L 3WJJC 4LL9A 3MRKB 4PWJA 2O4EA 1QNZL 1NFDE 3ZTEA 3RY5A 3QDGE 2SEBA 3SD2A 1YQVL 3QULA 3TYGH 3KPPA 2XN9B 4L4JA 4M6NL 1UM6L 3T6ZA 4DN4H 5KSAD 3S88H 4X0KA 4HU2A 3N04A 5JMRA 1KIRB 4P5KA 3WNMA 4N6RB 3RY6A 2J25A 3SZ6A 4QUOA 3UBFA 2YQ2A 1YPZB 4W9CC 3NIGF 4U1IB 1TJHH 3PWUA 4ENED 5GRUL 3RVUD 3QISA 4LU5H 1I9EA 3KPNB 1UWEH 2CA4A 3H9SD 4PJ6A 4PGCB 4R0LC 3LS4H 4PS4H 1ZLWK 3V6OC 3ZDWA 2Y24A 4TSAL 2XXGA 4UYQA 3F7QA 3BCDA 3P0GB 3Q48A 1PNCA 3VXPA 3RIFF 1X9UA 4AEHL 1X7TA 5E4AA 1HHHB 3KLLA 3SJVE 5IQ7H 2CDFB 3GMNB 2C3VB 35C8L 4MMZA 3V4VL 2EP6A 3FJTA 5GISH 3S4SB 2C9UA 2RA1A 4R0LB 4HUMB 2WMPA 3PGCB 3S9DB 5CCJA 4V1DE 4BCXA 1M2OA 4EN3D 1NM9A 3FYIB 3MLSH 5HHPB 5DMGD 3HPLB 1ES0B 4OIBA 1Z3RA 1B0GB 2DMHA 3V5DB 2Y7QB 1TZIA 1A1NB 5E5UB 5TF1L 1RZFH 2WCPA 3CFJB 3BEWB 5DURD 1NGYA 1E2ZA 2I25N 4NQEA 5HYIA 2UWEB 4QRFA 4K94C 4FQXA 1A14H 4G6AD 3VYNA 3D4ZA 5DUPL 1JVOA 2ZG1A 3B9VA 3SGDH 4XCFL 1MFDL 2BS9A 4ELKA 5KANI 5I0XA 1EMTL 2DLEA 2PR4H 5DC2A 4O51B 4O2FB 1YC8A 1AQMA 1IGCH 3HMWL 5AKVA 2H0JA 4TKWA 2FLMA 2V9QA 1REIA 3HNTH 2G30A 4L4VA 2DIAA 1CGXA 2LFEA 5DS8B 3GHEL 1OANA 4GW1B 3D0AA 5JLZB 4FNQA 4AEIH 1JCKA 3V0VA 2MPAH 5LGHH 5KJRH 2QELA 4LRNH 2LOEA 2YPVL 1UZ6E 5CJOH 4YDVB 5F7EH 3ZDXB 1I1YB 4OFIA 1DVZA 3V0WL 4XO4A 5FYJD 4U49A 4FA7B 2NQCA 4KY2A 2EVFA 1NWOA 1M4KA 3RVVC 1ZT4A 4CSSA 3TTSA 1QW8A 2C3XA 4YR6B 4UOW0 5BZXA 5I0VA 3HHSB 4TRPH 4QNPF 5DJAB 1Q9WA 2EUVA 5BV7L 2AQQA 4M1GL 4FFTA 2XWTA 2HJKB 1X5HA 4DZBB 1KTJA 2ITCA 2NYZA 4JLRA 2CLRA 3BPOC 4FP8L 4XPTH 4WU5A 1EO5A 4LMQE 3OB0K 4MSWB 5HDBB 4JZOA 4G6FD 5K9QI 3LN5B 2BOCB 4H8VA 1HT6A 1JGUL 1YVLA 1N0XH 1HL8A 3HBPA 3NCWA 4X5RA 3KBHE 3VXQA 3MRJA 3TV3H 5EC1A 5FOBB 1MJ8L 2N7BA 2Q5BA 3FT2A 4NRXB 3BPOB 3NCMA 1XGPB 3HOGA 4KRPD 4R90L 4ATTA 1K8DA 5DRZB 4MJJA 1UQSA 3GO1H 3PV6B 4WTWA 4WI6A 3DX9B 2V2XA 4N25A 1P6FA 4JFQA 2APXA 3GS7A 2VH5L 3CBRA 4HVBA 2DQEL 2E4FA 3TJEL 3W1ZA 3DIFB 2J8OA 1TEGA 1B9KA 3L3GA 4K94H 1GMIA 1IGJB 4N2GA 4RA0C 3BVXA 3NP3A 3C8KB 3HFML 2CJUL 4ZOBA 5J3HC 1M9WA 1AKJA 3UJJL 4QXUL 5LAPA 2WK2A 4NJ9L 1CT8B 3EGXB 2E7CA 4LSTH 2VRQA 1XIWD 3QIBD 3H0TA 4QYOB 1IBHA 1U92A 5FO8A 3BKCL 2X12A 1P6WA 3VXUA 2HTKD 1NGQH 1EZVY 2IPKA 2H41A 1CICA 3VI3A 3ZDYE 5BRZB 4J8RA 2BP3A 3RA7H 4P99A 1WBYA 3MV7B 1U8OB 4YDNA 3DGDA 3VB8A 3GRWL 5GGUB 4Q9RH 4FKEA 2X4PA 4PG2A 2GEEA 3L9RA 2Y6SC 3LHPL 3K3QA 3F01A 5IHHA 4ONHA 3LPWA 4G1EB 4IEFA 2R2BA 4O02A 4GRWE 1JYWA 3O2DL 2WW8A 4FKHA 4XMKL 2IG2H 3V6BR 4NEHB 4ZO9A 4JO1H 1FBIL 3BP4A 4M5ZL 4TVPL 5FUZL 4L1HA 5L4JA 1KNOA 4PLJD 4JS7A 2IDTA 1ADQL 2F08A 4L18A 5EU3B 3BH8B 2VM9A 3PWPE 3FU7B 4X6FA 2DQJL 5AW6B 1I3GL 3OBAA 2PUQT 4GAGL 4WUUA 4IRZL 4EZLA 2VR6A 1J87A 3RWGB 2E3VA 3HB3C 4WWNA 2R0KL 1I82A 2YJLA 5HPMB 1Z9SB 3GSUB 4L23A 1XSOA 2KBGA 4R7XA 1Z5YD 2ZUXA 3QQNA 1IC4H 3RZCD 2AW2A 4N9GB 1T22A 1MI5E 1ONQA 3FTYA 4G5ZH 4G9FA 3G5VB 5AAWC 4GRMB 5DUML 1JV5B 3HZ3A 4P5SA 2GCYB 5FYLH 3HBZA 3LPFA 5BXFA 4G7SB 3W5NA 3WFEH 4F7CA 3IKCB 4UU9B 2VRKA 4OM1L 3CUPA 5B21A 3E9UA 5K5YA 3RPKA 2D7TL 3PWLA 4JB9H 1H0DB 4PTTB 4NERA 1KENH 4OZFA 2H6PA 3LDBC 2BSDA 1MHEA 1D5BB 1JFHA 1Z32X 3A6OA 1Z2KA 4MDIB 3BXNA 3F83A 3LKPB 3MCKB 4MFHA 1AE6L 3DHUA 3MNVB 3MNWA 1CS6A 3DXAE 3H2WA 1O7VA 4M1DL 1TR7A 5SWZA 4J4PA 5K1VA 4KI5C 1II4E 4I48A 4L37B 2FZ3A 3QJFB 3LDBB 4YE4L 4LIQH 4N0FA 4NUQA 2E9WA 3QVAA 1RK0A 1TZGL 3ZE2B 2JQAA 2YAOA 2H47C 3JYCA 4GBXA 4H2AA 3NJFA 5D7SH 4AQ1A 3D1MC 1X9LA 4LPTA 2BNRA 1BQKA 2R1WB 3QUXA 1G9NC 2MCAA 3BRDA 3IDYC 4Q6YA 1CF1A 3UC0H 2H3XC 3NN8B 4MCNA 4A66A 3ZBMA 4GO6B 4W6XB 5KSUA 4X80L 3GLAA 5J13C 3RB7A 4GH7B 3B7RL 4ZFOB 2F53B 5KBKA 2MFNA 4DVBA 4CU7A 3F7YB 4HAFA 1R3LA 2F6AA 4PV8B 4WU7A 3AAZA 3IDYB 2AMGA 5I1HH 2GUOA 3CVHB 4FYTA 3CFCL 2QZ5A 4M02A 2D3JA 3ZHDA 1OT2A 5J13B 3FO1B 4N90E 3AW5A 4X9BA 4XNXH 3T1FA 3TBWA 5GS2H 2XA8H 1AYOA 4BFIA 2WO2B 4KXDA 4P23D 3TF4A 2GAZA 1WC7A 4YHLL 3HI1A 1XQ4A 4Y1AA 1HC1A 1I8MA 2DL9A 5C6WH 4C4UA 3X1GA 2UZIL 2AEIT 4PJFA 5E6SB 1DFBL 5J0BA 2G0LA 1NOFA 4TUJB 1KCWA 4XNUL 3IJSA 4M6ML 5KSAC 2J5WA 1L7IL 4JHUA 2PR9A 4UUJA 1AGBA 3S4SG 4ZTEA 2IH1B 4PWFA 3ARGA 2FJFB 5T3ZE 3ZMNA 2OR9L 4BD4A 1TITA 3MV9A 1W0WA 3UDWC 4ENEC 3OMAB 1IKNA 1WO2A 1ZLVH 5E03A 2WQUA 3Q8FA 5FC9A 1L9PA 3GSQA 4WKZB 4X9IA 2VZTA 1PZ5B 5KSAB 4HFUL 2Q7AA 4X7CC 2UZYB 1H8LA 3K6NA 4TQPA 3TL5A 2Q20A 3IJ9A 4B60A 3P2BA 1KBWA 1JGVL 2K4WA 4Y8DC 4S0HA 2CKBL 2X4OA 4DP6X 4AJ0A 4F57H 1ZAGA 4DGIH 3H9SB 4JN2B 3BIBX 3HMXH 1DN0B 1GGIL 1NIEA 2P26A 2EVIA 3FONA 4PREB 1KPRB 2K3HA 4XR8C 1M1XB 2WUCH 1S9XA 1UZ8B 4BQCA 3RKDD 3ZTNL 4OIIH 7PCYA 4GLRI 3WE6B 3LKQA 5DMGC 4G59C 1G9NH 2YMXL 1NLBL 5F9JB 2WWMD 5EU5A 1W91A 3CVHH 1EHAA 2Q3AA 4HQQL 3T6VA 3VGDA 5DGRA 4LLVA 4MLSA 1K8IA 4NKOB 1J8RA 5IBUG 4DF9A 2OA9A 3KDPB 1S7QA 3LRGA 3N06B 2A6JB 4N1CA 3RIKA 3PQYA 4JY4A 4UQAA 4LFHD 1JPFA 1KEGL 3OC8A 4G6AC 4X9YA 2EDOA 1NAML 2HAZA 1UTDA 3O2WL 1G9ML 3LNFA 3SDYL 5F7DB 2E4TA 1FDLL 2VQ1A 2VSDA 3ZDYB 4MNGB 3K71A 1DYZA 1DBJH 5JW4M 2FO4B 2WWKO 3OLDA 4NUMA 2E27L 4K7PH 2R56L 1MFNA 5CFAA 3IPEA 3ILPA 3MYJA 1C1EL 4G6ML 5IB5A 1ZA6A 5FYKL 1A9VA 4JFEE 4ODHL 4FHJA 2VDRL 3L3DA 4GRWB 4OVUA 5AW2B 4TSBH 4TNVF 5CCKH 2CO4A 1S7WA 2OMZB 3LZNA 2P28B 3II1A 4JCMA 1AFVL 4TUOB 2AQTA 5IW1A 4QHUA 1JK8A 2CBTA 1QEXA 5SX4I 3MA9L 1AD9B 4RMSA 1N8ZA 3VMPA 5IB1B 3U46B 1A6AB 2XNAA 5EU6E 4XPAL 1QPKA 5EPMB 3VI4A 1VADA 2OMUB 3X12B 2H3NB 1SLUA 5C0FB 5E4EC 2RB8A 3U0WH 3RUGA 3MRQB 2H2PD 3KLSA 1VA9A 5LB1A 3KL3A 1BF5A 1O9ZA 3RVWD 2VUKA 4N0CD 1BAFL 4P2OA 2DDQL 4XE5B 4PRNA 5JYLA 3WTUA 2JLLA 4G6FB 4I89A 5DK2B 5E4EB 4YUEH 3FTXA 3HCVA 1IQDA 4PLNC 1JG9A 2DQDH 4KTEL 6TAAA 5F7WC 4BGLA 3D3VD 2ATPA 5CFHA 4MB5A 3MJ9L 2E5EA 4LOFA 4L9LA 4TVPE 1BVLB 1VRSA 2P80D 2ID5A 1JZ6A 2NSMA 4AEFA 1Y0LB 1S7XB 1MWAH 3ARDD 1XIWC 1CD1A 2X1OA 3QIBC 1JPTH 4HT1L 3SOBL 2BXZA 3EDFA 3FOMA 1FVDA 2IBGA 3FCGA 3CCHB 4RFNC 3DX6B 2QGBA 4JHVA 2YKLL 4K7FB 3AMLA 5EF0A 2GIMA 1KGUA 2A6DB 5DD1L 2HT4D 3K74B 4HKJA 3QEQA 4AKOA 1XIWB 2B9BA 3QIBB 4HIXL 5FYJH 2CIKB 1KT2B 1KYUA 3L5XH 4Z0BL 3V7AG 1X4ZA 1RK1B 1MNUL 3TBSB 4HIPA 4AGMA 4RFNB 1N0LA 1CFSA 1Q9OA 2PYEA 4AE0A 5M95B 2DQFA 3GI9L 2AEWA 5E4OA 2J8UE 1I1FB 3Q0HA 4LCWE 3SE8H 3SBWA 1PD1A 4Z7UA 4BA0A 3FN3A 4C56E 4ILDA 4PLJC 4UT9L 3CH1A 1RIVL 1A47A 1MRFL 2Y7MA 4BJLA 1FC2D 5D5MB 3IMSA 1OHZA 2GJZA 4AEEA 1JZ3A 1GZQB 3BSZA 5PAZA 1UM4L 3WJLC 4NAQA 4KY1L 3OXRA 3UPRB 1NMAL 1IT9H 3G6DH 4PJCA 4LAQL 4BKLA 3I6SA 2DD8H 5HVFB 4AOFA 1TCMA 4NCDA 1WFNA 3MRCA 5GHWH 1Z5LB 4GXVL 3VJ6B 4J2QA 1J9QA 3WU1A 3QUKB 1YEGL 3V4VB 3FTZA 4NX0A 5I76A 3RPBA 3IDMA 3SE9H 1U95A 2WP3O 2FNBA 3RZCC 5EO1A 4KQ4L 4JKPL 2VUOA 4MA3A 3UG3A 2WHVA 1CBJA 3JSSA 1B2WH 1JGDB 4IIQA 4I0CC 1MJ7H 1XF3B 3L9BA 4HCGA 1OK0A 5T8IA 4FDWA 4P2CG 3IN2A 3C5ZC 3RZCB 3N0PB 4UV7H 3NAAL 3L2LA 1QNZH 5IIEB 1IE4A 4YEFA 1YQVH 1GGBH 2Q86A 4NC1E 5GSVA 3P02A 1EFXB 4CSTA 1ZEAL 3K8LA 2QVFB 4L05A 5DYOA 4M6NH 4FMVA 2XY1A 3C75A 1UM6H 4JEGB 1F3DH 2BP0A 2ZNXA 2FEEL 1A4JB 2FRGP 3L08A 5FYKD 3C5ZB 3WXVL 2KQNA 2COVD 5C1MB 2EAEA 2FJGB 1AQDB 4X6DF 1KFGA 3PREA 4IS6A 1AI1L 3FUJA 1H19A 5HYQA 4UDTA 5ILTL 1T3FA 1C5DB 4NZTL 4QOKA 4N5UA 5GRUH 5BV7C 5KVEE 1OB0A 2GSGA 2HVJA 1U30A 4OGYL 2R1XB 4TSAH 1KXVA 2VAAB 4FF9A 3KYOB 2WVVA 1G7QA 3GSOA 5IG7B 4PJAB 4AEHH 1N2RB 3W3BA 1HZLA 4XGZA 1OKEA 3O4LA 2F5AL 2CJSA 2WXPA 1H9VA 1PQZB 5C70A 1OD7A 4DHLA 2X41A 3DYMA 3KPMA 4NS0A 5BV7B 3TWCL 2WNGA 3V4VH 5M94B 5T1JA 4RISL 3CHSA 5JOPE 5I73C 2Z31D 5DZVA 1PZUB 1NBYB 3KNBB 1OK8A 5B39G 3WS3B 2QHRL 3U6RB 5JDSA 2DIJA 3RNKA 1KYFA 3QPKA 2FUQA 2A74C 3FUMA 1PLAA 5I73B 5E6YA 3ZPDA 1UB5B 1KB5A 4L4TD 2AJ3A 3CE1A 3ZHLA 1AO7E 2A5UA 3GXTA 3T9WA 4BSVB 2WINA 4P23C 4PRDA 4KHXL 1T20A 2YARA 5DUPH 3SGKA 3HRPA 2Y6TE 1MFDH 4XCFH 3W5MA 1EMTH 4PJXB 2A74B 5ACLA 4F7PA 1DJHA 1HE7A 2B15A 3WKPA 1ZLSH 1PFCA 1K4DA 4KV5F 5IJVA 2CDEA 4P23B 3MJ6A 5F7MC 3QRLA 2KZ1B 1SY6A 2HSIA 1G5AA 3W0WE 5D7JD 1DQDL 2YPVH 4Q6IC 1KXTB 5AD0B 2E56A 1G7PB 3ZE0E 2O5XL 2YZ1A 3UADA 3V0WH 1PF3A 3O3DA 1JGIA 5ACZB 4MX7B 1G87A 1L9OA 1J05B 2DWSA 4N85A 2WXKA 1RJZB 2ZSWA 1YYML 4Y89A 5DTFA 5JHLL 1NANI 1U8HB 2GFBB 5BV7H 4Q6IB 3CDFA 2NTFA 4W6YB 4BE6A 5DVLA 4QGTA 3A6BL 1D5ZA 2AQSA 2JCCF 4M1GH 1M7UA 1O9WA 3S5YA 3HPJB 5HY9A 1NSNL 2FQEA 4NT6B 4UMGA 4BH7A 1A6UL 4MDRA 3RKDC 4LF3B 3NESA 3HUJB 3IFOA 3K0YA 1L9SA 1WCBB 3IGLA 2J3SA 5LBSA 2WWMC 3T3ME 3MRDB 3GT6A 3LIZL 5IHLB 3UH8A 2NW3B 1YY8A 4RGMC 4NC2B 1JGUH 3H9HB 5HHME 1ZSHA 1X6NA 1C08A 2R1YA 4S1DD 1MJ8H 5IOPA 1M3JA 4AZ8B 4GRLA 4R90H 3VD3A 1ZK9A 1ZLEA 4JL1A 1D5XB 2C4XA 3II3A 4ONGL 3K2IA 1E9QB 1CLVA 5E9DA 2WQAA 4RGMB 5DFTA 3GXDA 2VH5H 1T03L 2DQEH 1XSIA 2VABA 3OZKA 4U1JB 3TJEH 3MZGB 1KTDB 4X4ME 2C7UB 4OGZA 5FIEA 4FABL 1E3ZA 4HAKA 2HKAA 3CTTA 4Y5VC 3HFMH 2CJUH 5DRWA 1M05A 5GIRA 1Q94A 4OR1A 4R96B 4BM7A 4KKPA 2R83A 4QXUH 4U3HA 3UJJH 5CGMA 3L5JA 4YXKL 4NJ9H 4IU2A 3LPGA 4H8WL 1DJSA 2DLFL 4Z78A 3A47A 1VDGA 4FNLL 5F6HI 4X5QA 2J8UB 3Q2VA 2OAAA 4C4KT 2J1ZA 4Y5VB 1UVQA 3IN0A 3LSOA 4WTZG 2XC8A 4M8VA 2A9NL 2V9RA 3ABGA 4DQAA 1YEKL 4QF1B 5DJ2B 2CGYA 5TD4A 3V55A 1RLBA 3VD5A 1VCAA 3GRWH 3LOWA 1AMYA 3SD5A 2RH0A 3N55A 5K33A 3LHPH 1NCWL 2Y06L 5F6HJ 3WEAA 3HZKA 4DWHA 4HIIA 4C83B 1E8YA 3PNWB 4WWID 5GGVL 4DUXA 3LH8A 3EO9L 4PY7A 4J3OF 1HWWA 1JMXA 2O6FA 4XMKH 3EO0B 5KAQG 1HXYB 1LL1A 2K6ZA 5EZJB 1FBIH 2F7QA 4M5ZH 5FUZH 2H2PC 4F9LC 1EEZA 4XBMA 1SF3A 1ADQH 4PJEE 5H37G 1HESA 4X8GA 1U3YA 2FQFA 2XVKA 3FB5A 1JZEA 1JCVA 4IOIB 3FB7B 4UQ2A 3FQWA 5I1CH 4JRXD 3VVVA 1CG9B 5HJDA 5T1KD 3I75A 5C71A 2QHLA 2DQJH 1I3GH 4RMBA 2OJZL 4GAGH 2KI6A 3FUHA 2WXNA 4OJDH 3N1PC 4PW4A 5HGHA 3TBYA 1GSMA 2R0KH 3O6FA 1X3DA 4PJBE 5DLML 4FERA 3X1NA 1NEUA 2P3YA 2A73A 5DJCA 1S9VA 1KIQA 3QZMA 3GYRA 1BLIA 5MI0C 3TBTA 3D3VB 5DUMH 3DRTA 1MLCA 3L54A 3BI9X 3GINA 1BQ5A 3ME0B 4DP7X 1CO1A 4OM1H 1NFIB 2BC4A 1KPVA 2NNRA 5JTWA 3KXFD 1HHGB 3JWNC 4R4ND 2HT4C 2WV3A 2D7TH 4KH9A 2R7EB 3VRIB 1VJSA 3QFGA 5MI0B 4FMFA 3NGBB 1A1OB 4HWBH 3OPZH 5FUCC 5E56A 4LNRA 2X6AA 3EYOB 4MQSB 1NEPA 1QO3A 1UXLA 1GGCL 1RJLB 1AE6H 1YEJH 2BNUA 3GHPA 4N1EA 2C3GA 4ZUVA 1INEL 2EVJA 3MRGB 1KTRL 1S5HB 3DA0A 4M1DH 3RWFB 3L6FA 5DZ9A 2K7PA 3TPUB 3IGUA 3OJDA 4YE4H 4GNKB 3EJUA 5KSVB 2PTTA 5AAMA 1DVSA 3ZHFA 2JJTC 3TCLB 4JBSA 1TZGH 3RL1A 4U6XB 2FHCA 5J6SA 4HGMA 1BXVA 5DO8A 4L0YA 5KYWB 4ZAKA 4ZS7L 3AGWA 2W07A 3BUPA 4LGSB 4MKTA 1JE6A 2CKBB 2WOYA 4W9FC 1MH5A 4DFHA 3EH2A 4IIZA 1USQA 5FWQA 2P43B 5IQ9A 1KYOJ 4FEIA 4UNTA 4HDIA 4UI2A 3PWVB 4X80H 2HRLA 3BUYB 1P5UC 1FPTL 2UUDH 4N68A 3NEXA 4NWTL 5ESQB 2YD1A 3RX8A 4JFPB 1D7CA 3ERXA 1SQMA 3CFCH 3KYNA 1JDDA 1DUYA 3EDDA 4ZXBA 1WVZA 1P5UB 3FB8A 3NK4A 1EHXA 5C07A 4LPWA 4XPFL 1DQJA 1RHFA 4JRXE 4PHZA 3GMRB 1HOCB 2CLVA 4YHLH 1XX9C 2D3LA 1NAMB 2X1XR 3ZZLA 2NW2A 3KHOA 3REVB 1OGTB 1DFBH 3V7MA 4AMWA 5DRNB 4L29B 4HWEL 1LE5B 4XNUH 3OMNB 2YGPA 4M6MH 4BXVA 1L7IH 5AOZA 4XOBA 4CADB 1L5GA 3ILDA 3BT2H 3JWNH 4U1MA 4A7SA 1TMCB 1E9PA 5E6UB 1CDGA 1XWVA 3S35L 3X14B 1A6ZA 1MCDA 4F2EA 5ID0A 1T7WA 1M2VB 2OR9H 2X4UA 4HCRL 2ALAA 4BSWA 3GB7A 3UZVB 2DH3A 1BZEA 5HYJA 1BQHB 1W80A 2NNAB 3MC0A 1GW0A 4YPGA 2Z6FA 5FGCB 4HFUH 3D51A 5ISZD 2HG0A 2HB0A 1XGQA 2YEVB 2VDRB 2B16A 3T3MB 1MCBA 4N3TA 3QO0B 1XF2A 1EEYA 1JGVH 4AJVA 1U3HA 3LV3A 3X3GL 3T8MA 2CKBH 3Q01A 2NUPA 2QSTA 4P3DA 2DQIL 1GGIH 1S7VB 4MQ7B 4AYDC 4QRUB 1P0SE 3QG7L 1LEIB 1X5XA 3WTYA 2Z31C 4ATWA 1P2CB 5HYSB 3MRMB 5D2LB 2VR9A 4LPVA 1YN6A 4HPHA 3PY9A 2X7LB 3ZTNH 1A6WL 4NFCA 5DD6B 4RFEA 4LCCA 1T6BX 2YMXH 1ED3B 1NLBH 4XP5L 4HQQH 4U7MA 15C8L 3WFDL 5I9QC 1WZLA 2Z31B 2GJ6A 2PO6C 5ABDE 3D0VB 1UA3A 1G84A 3CZFA 2CO6A 1WG3A 1KEGH 1HINL 4NQUA 5C0EB 4LOEA 3WO4C 1NAMH 2ZUSA 3L48A 3O2WH 5F7AA 1G9MH 2OL3L 2QVIA 4HAGA 1I8LC 1HQ4A 3M1BB 5CN1A 3SDYH 5I9QB 1RZ7L 3FQ1A 4L4TB 4W9EC 1FDLH 2PO6B 1CLZH 4N1HB 3J7HA 2BVPB 1OO2A 1WBXB 2ZXDA 3D9AL 2JIXD 3PJNA 4LEBA 3WO4B 2E27H 4WW1B 3X1BA 4FNRA 2R56H 2VO8A 5D7JC 1MJJA 1C1EH 4NQCA 1P7KA 1MXDA 4G6MH 3QUHA 4HXAL 5FYKH 4ODHH 2PW1A 1HCYA 2AJXL 4PJ9D 5D93C 2VDRH 4PRIA 4ZO8A 4M4PA 1QA9A 4ZNEE 4GKZA 1P84K 5D7JB 4WKXA 1AFVH 2F0CA 1DEEB 4WLCA 3U0TA 4I5BA 4KXCA 2X6MA 1YEFL 3S8FB 1HILB 3MR9B 5CF3A 3D4CA 5I28A 5D93B 5AW8B 1MAJA 4OV5A 3L5WA 3Q2WA 2F58L 3QIWD 1UJTA 2XZQL 3RHWF 2DKSA 3MNZB 5E5MB 4OJYA 4LFHG 4PP1D 3AS1A 4DEWA 2V4LA 5IT2L 4JRYD 4XPAH 3RFZC 2AJYL 3BUTA 1BD2E 3IRCA 4PMEA 4PJBB 5HDRA 1QLFB 3MGAA 4NENB 3O3AA 3DI2B 5EUKA 4MXWL 4LSSL 3ZYJA 1MG2C 2FQDA 3UMTA 4AQAA 1XZ0B 1U8MA 3IAPA 4XCEA 3MRLB 3MX0A 3BYYA 3MCYA 2XOTA 3VE0B 3SGJA 5LWYL 1HXKA 4E41D 2DDQH 3P40A 1A9BA 1EEQA 3RFZB 2XDHA 3TO2B 1NCCL 1HI6B 4BWUA 3V0EA 3QCUL 1QACA 4GI8A 5EUOB 5A7EA 5JHAA 4KTGA 4KTEH 3S5LB 1T0NB 3FT9A 1U3NA 3VSUA 3KR3L 4Y2OA 1AJ7L 2AKRA 4WK2B 4E5XG 2IPUG 3T3PB 3MJ9H 3WENA 1KG0A 2CD0A 2YKKA 2G9KA 4UM9D 3DOSB 1KXHA 5EG6C 3OJ2C 3TOPA 2IEPA 5IOKA 1FVEA 2JB6B 1H3PL 4HT1H 3SOBH 3ZHNA 2PCPB 2BRRL 2GHWB 3SYCA 4XX1E 3T2NL 3OAZH 3RIAK 5SX5K 3SBQA 2YKLH 3IDGB 4M7KH 4AIOA 2Z7WA 1MIEL 1S8DA 5A40E 5DD1H 4BH8B 2E8ZA 4HIXH 5B1JC 4DGYL 4EIZC 4PRHD 2J1WA 4Z0BH 1MJUL 2VZSA 1W72A 2X4TA 4W1TA 4WFHE 4R7DB 1KIRA 1MNUH 3CC1A 1OV8A 3D39E 3CSTA 3MBWB 1QWNA 4XMPL 2ADGB 2AV7B 2GB2A 1YPZA 2HVKA 3GI9H 3ZDZE 4U1IA 1A65A 5I0ZA 1AGCB 1IAIL 3P69A 4MS6A 4CN1A 4YFEA 1IBZA 3PGFL 3D48R 3PDOA 1YNTA 3RPIB 4UT9H 1RIVH 2FATL 1MRFH 2HN7B 3MGTB 1MLBB 2F74B 2HFFA 4ES9A 2XI9A 5EMYA 3HS9A 3SE4C 1UM4H 3AQDA 2CDFA 3GMNA 3KLAB 3ZSSA 1NMAH 2BINA 1JPEA 1H8NA 4LAQH 2YC1B 1SXBA 2AJZA 3S4SA 4OZ4B 4R0LA 5AWNL 3V6OA 3SDDA 1J0IA 3PGCA 2BSCA 1NCBL 1T83C 2EYRB 3PAUA 1G5GA 1NBQA 1FZJA 4JRXB 5T1KB 5LG1A 5HHPA 1DBBL 2PWGA 5DGQA 3UAJC 2BSED 3V5DA 4KQ4H 1KLFB 4JKPH 5JIKA 4ZO6A 4JMNA 3VA6A 4ADJA 4OI8A 3CSPA 4UF7C 4Y7MA 3BEWA 3ECQA 1NDTA 5LDSA 2MQCA 3JBG7 2WWNA 2PXYD 5DEFB 1QSEE 4OF8A 1AY1L 3NAAH 4O51A 4R4NC 5LQBL 3BN9D 4PFEA 4XH2B 1GS7A 2XKSA 4TLTA 3GIVB 4A38A 1ZEAH 3QC5X 3BYTA 1RFDL 1N67A 2OXHB 1EZSA 4RAUB 3K91A 5DS8A 5I6NA 4FTVE 3P3TA 2P45B 3WXVH 3KXFB 1AZCA 3GJEB 4PJIA 4YDVA 1M71B 1K2DA 1I1YA 2XVBA 1XO8A 3WGVB 1AI1H 4NO5A 1U8LA 4B9PA 5ILTH 1OF0A 2WBJA 4NZTH 1BEXA 4PRPE 1ZLUH 3LKOA 1PY0A 1NCNA 4OGYH 2CIIA 4G8IB 4YR6A 2ESVE 2FLBT 3D85D 3UAEA 1DVTA 2X70A 4EXPX 5BZDB 2F5AH 3TC9A 4N0UE 4D0BA 2GUYA 1MY5A 1CPUA 3TWCH 2WLLA 3WNKA 3TA3A 5IVOA 2C9QA 4RISH 3U7YL 3NFSL 3NJGA 3PWNB 3NP4A 4TYUA 1YAZA 1GY1A 2WBXA 5C3IA 3BO8B 2QHRH 1RULL 3H3BC 1G7HB 3IWUA 4Z7OB 4KK9D 4IOSD 4N2KA 2Y69B 3HHRB 1HZHL 1XGPA 1T1WB 2IANA 5AVZB 3L3HA 1BQHG 1NA8A 1MVFA 2R2EA 3PV6A 4X7FC 3DX9A 3FRPB 4BRVA 2EDWA 5TK2A 3DIFA 3I6LE 1A21A 3BLPX 3ZMRA 3DSNB 3NCCB 4YL9A 4E36A 4H8WC 2F19L 4ZMPA 5GGRA 5FEBA 1TMQA 1R3HB 3FUNA 2JE8A 1CFNB 4I0PA 5BS0D 3AS2A 5IR1B 1BECA 3EGXA 5HYSG 1Q1PA 4JPIA 2Q2EB 2G2RB 2LU7A 1DQDH 2TRHA 1KXQA 1YJDL 3QO1A 4NOBA 2O5XH 3M7FB 3VXSA 4DTGH 2OMXB 5DK3A 2O1AA 2VLMD 4ZMQA 1DBML 1I7RB 4JQIL 3WFCL 1VGKA 1NWPA 3IU3B 5GGUA 1YYMH 3O6ML 4GUCA 5JHLH 1Z9PA 4MAYA 1NUFA 4KJQD 5ISZB 3A6BH 1CXHA 4G1EA 1NIAA 2YRPA 4Y7OC 1OW0C 3L8QA 3PP3H 2OTPA 5CEXB 5I82A 2MOGA 3SDXE 5D2NE 5B1CA 5IGXL 4JRFA 4CMMB 3BZ5A 2X6BA 1HQRA 1QTPA 4K9EL 4EVNA 5L2JB 2ZOOA 2EDMA 3LIZH 2O5YL 1CC3A 4I13B 4O58L 5EU3A 4YHYC 5F97E 2MEJB 2P8LB 4YHKL 5EN2B 3FU7A 4XRCB 4JFFD 3DNKA 1BMZA 4BRJA 3W82A 5J8OA 5MEND 4Z6AT 3MLWL 3WHXA 4DESA 5DK0B 4W9LC 3RWGA 2BCKA 1DJYA 4PPTA 1IAOB 1OZTG 4ONGH 1GJUA 3CQPA 2ZYHA 4I0KA 4H40A 4YHYB 2A3TA 2I5YL 1Z9SA 1NFDA 1UHVA 4P49A 3QDGA 2ZUYA 4X5LA 5HPMA 2X2UA 1T03H 2EH7L 1HH6A 3UG5A 5CBEB 4YQXL 2WLMA 3KGSA 5FO9B 3HR6A 4FABH 2A6IA 1XGTB 3FQUB 2D03L 4JKLA 4PLKD 4GRMA 1N5AB 4HLZH 2GCYA 2PETA 4KMQA 4MJ6B 4NHUA 4YXKH 3AFLA 4PYHA 2G4EA 2OMYA 3TFKC 2DLFH 4UU9A 2A9MH 4FNLH 1F3JA 4PJ9C 1AHWA 1EAQA 2NR6C 2J57A 1OF2B 2JIXB 4ELDA 2IALB 5EWIL 4KKAD 4PTTA 5EULV 2A9NH 2NY2D 3SKJL 1OGSA 3D09A 1YEKH 2WXHA 3IWVA 3QHFH 4RMRA 2CR3A 3BMWA 3LKPA 1A66A 2ZOWA 2C9XA 3MCKA 4AL8L 4UOJA 2KLSA 4PJ9B 3KYAA 3NIGE 3SJVA 4FX5A 1NCWH 2EDEA 4H0IA 4R4FL 3SPHA 3QIWC 2Y06H 2XU9A 4KK8D 3NACL 2LABA 2X3CA 3P4NA 4PP1C 5LN8A 5GGVH 3ZY7A 1L9NA 4ORGA 5C7ZA 3BZFB 4RQQB 1YAIA 3S36X 3GSNA 4HEPG 4Z23A 2A38A 4QTIL 5T1DL 4DOHE 1J0HA 4LLQA 3QIWB 2XQYK 3ILQD 1OSZA 4UM8B 3ULUF 1JXGA 4FC3E 1LHZA 4LHQB 3K8KA 5F0PB 3ZJAA 3TO4A 4UV4L 4ALAL 2OJZH 3NN8A 1XBDA 4H5SA 2BOBB 5EEWA 3P30L 3QZWB 4Z7WF 3ARBD 5DLMH 1H6UA 4E41B 4RWHA 3F7YA 1ET8A 4X8JA 3VFMA 1SUHA 1W6LA 4GIOA 4PV8A 5TH2B 5KVDL 4YGVA 3CVHA 3UTZB 4M6OL 1U8IA 4PQXA 4X8CA 4TL4A 2IQ9L 2E6JA 4HJSA 2N7SA 1FYTD 3FO1A 1CXEA 1G7IB 2UZPA 4FTVB 3Q9QA 2X10A 5CIPA 4LCVA 2X6UA 4OF3A 2IBZY 4FQLL 3ULAB 5ITFB 3QDMD 4XNBA 4L1SA 4QXVA 5DMJB 1O0VA 1YMME 2MOVA 4PRPB 3RB5A 3V4PH 1SM3L 1QD0A 2IFFH 3N2JA 4P2QD 5B39A 3OZ9L 1FRGL 1Q72H 4N2MA 1BG1A 5GPRA 1T5KA 5FDWA 2FJFA 1GGCH 3MRBB 1INEH 3MUUA 4ABVA 1T7YA 5CWSB 3CSYA 3WY3A 1EXHA 4R84A 1PZ5A 3DURA 3OB8A 4DP1X 3MRNB 2JKLA 4GUOA 2AEQL 4D9QD 1OTTD 4WHDA 4QNPE 1RZKL 4PU2A 4XVSL 3ZQ9A 2APWA 1TQUA 2X9WA 3QNXB 1Q9KB 4NN7C 3VW3H 4AYSA 4WJKB 1BIIB 2IDUA 2IBBA 1JZ7A 2HJLB 5FGBC 3H9SA 3MRHA 4JN2A 4YSUA 4WW2F 1DN0A 1E4HA 1AANA 1CE6B 2YHGA 3GKZA 4JGJA 4ZS7H 4PREA 1FZMA 1KPRA 2VERN 1AIFB 5A6IA 1UZ8A 4OQTA 4AE1A 3QK0A 2IPUK 3ZZQA 1EAPA 2CK0L 3FTGB 4KRLB 4NN7B 5DRXA 3JTTA 4YX2L 4WSKA 1BOYA 3QXWA 3J27A 4NWTH 2OSLB 1A6VH 2D7QA 5JHDD 4YNYA 2AXHA 3AG1B 3FUIA 1DR9A 2NY7H 4FD0A 4H1LH 4Q0XH 3RNQA 5C9JA 1BJ1H 4N8PA 4XOCA 3VXMD 3FPYA 1AGFA 1D5RA 3SBRA 4YAQA 2PXYC 3OX8B 1OE2A 5I16B 4M9PA 2EUXA 3BN9C 4XPFH 5F7DA 2DQMA 3ZSTA 1V27A 1I8IB 5IVXF 2OL3B 2R23B 2ZG3A 2HH0L 4LKCA 4Q9QL 2PXYB 2Z4TA 2FGZA 4QKTA 4YXLL 1G9HA 3CVDA 3FU5A 3ASWA 4ZUUB 1FL3A 4MCYA 3S35H 1YDPB 3OKKA 4NO0D 1VGEL 4UDUB 3GSXA 4HCRH 3KS0H 3M8OL 4HZLB 3NCXA 3FTWA 1H3UA 2WN3A 1FYTE 2IAMA 3DO7B 4AXWB 1UGKA 5EIVA 4LSRL 1Z9MA 3N43F 1F3RB 2C8NA 4NAMA 1MRDL 5F7BA 3L9YA 4X8XA 1IZJA 1AD9A 3X3GH 4FQ1L 3PWPA 3GXPA 1ZCRA 2JELL 4M3HA 1ASPA 2Z8SA 3QWRD 4W70A 5AVVB 5IB1A 3U46A 4PJ5D 1BFTA 2DQIH 3FUEA 5HTSA 3ZXAC 3QG7H 2Y2YA 3D85B 5H94B 3X12A 2H3NA 1YEWA 1QFWM 3EYVB 4KK9C 4PS3A 1A6WH 2LVCA 2Y7NA 1E6JL 4WEBL 4WTZA 3IGAB 4Y1TA 5KS9F 1KCBA 5FV1L 15C8H 1DVXA 1MI5A 4P5TD 3L1EA 2CMRL 3WFDH 4NBZB 1G1KA 5F8QC 5GZOD 4XNQA 1OSEA 5EU7E 4CGTA 2BIIA 2BSBA 5GGRY 4F37K 2B0SL 1WJ3A 4KK6D 2QPEB 5INCA 4MB4A 4W9HC 1HINH 2VDQB 2D0HA 3PHQA 1MDTA 1SDYA 1MCKA 4JY5L 4PBWD 4EIGB 1XGZA 5D7LE 1OAJA 3UPCA 1RZ7H 2DB8A 2OV0A 3QUML 1USZA 4U1LA 1CFVL 3WNJA 3OJVC 4Y5YC 1TXKA 3UCRA 3P9MB 1LDPL 2GY5A 3D9AH 4XBGB 3B2MA 5H37A 1NDGB 2BO0A 3T09A 2EXYD 3DXAA 3NIGB 2CGRL 3CDZB 5LBVA 3HC3L 3VYPA 3DIVA 4HXAH 3CQFA 3I84A 5IY5B 2G5BB 4Y5YB 3CJJA 2Z4QA 2QTEA 2AJXH 2OK0L 4K7FA 1SJVA 5BS0B 5L88L 2ICEC 4KGJA 1E8WA 1XIWA 3QIBA 3FQ4A 5EA0L 4DOHB 1OM9A 4ZX5A 2K7QA 2ZOKB 4KJQC 3TBSA 4H25B 4MZ3A 5FFLA 5EBGA 1A7NL 5HPOA 1YEFH 2G3NA 1HKLL 1NKOA 5CZXD 5F0MB 3N40P 2DY2A 3U30C 3VDCA 4XX1G 5C8JB 4O9HL 4ZX4A 3HBGA 1CD0A 2P47B 2ICEB 2F58H 4YDKL 1AOHA 2XZQH 3MRIA 1JGEA 3ARSA 3ECUA 2VXSL 2R0LL 2VLJD 3KYMB 1ZSDB 2YAFA 3SQOL 4BK4A 5DC9B 5A2LH 4OIAA 1HH9B 5GGTL 1CXIA 4MXWH 4LSSH 3U30B 1A1MB 2UYLB 1RJYA 4XXDB 4GEIA 4L8DB 1C12B 5C86A 2UXFA 2PNDA 5LWYH 4HIEB 3NZHL 4NI3A 4H8QA 3LKSB 3TH2T 3VJ6A 4PJ7F 1NCCH 1MCEA 3V4VA 4JQXC 3ARVA 3QCUH 2QDWA 1TFPA 1EDYA 4YDMA 5E00A 4JFFB 3WJLA 3KR3H 4EUPG 1AJ7H 2OTWA 3PGDB 3PUUA 4M9OA 2B39A 3WUWG 3ATAA 4J39A 5AB9A 4X5PA 5C0AE 5MENB 5FKPB 1FIGL 3HW7A 3OSVA 1E65A 2PCYA 1QVOB 2PKDA 4OLWL 1FNSL 1PG7X 3RWIB 5HYEA 1XF3A 3NH7L 1E7VA 2O6EA 4HUWB 1SQ2N 2J88L 5DFVC 1MW0A 3WTSA 3DHPA 3ZRFC 2EINB 3RZCA 3BAKA 1ODAA 3Q2NA 2X28A 3CFKB 1EO8L 4YH6A 4B97A 1PZ3A 2BRRH 2CO7B 4NQDD 5DVNA 5IIEA 1R4XA 2A4ZA 4KKAC 4RETB 2NY2C 3T2NH<