5GS0C

Crystal structure of the complex of tlr3 and bi-specific diabody
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
DIVLTQPPSVSVAPGQTARISCSGDNIGSYYVHWYQQKPGQAPVLVIYEDSERPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSSYDDPNFQVFGGGTKLTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 3
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 19
structure length 107
sequence length 107
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs0C00
3BH9A 1S7UA 3ULUF 3JWDL 3RP1A 3ARWA 4KRLB 3V6OE 3B9KA 3SCMA 2VC2H 5D72H 4LEOA 1I9IH 1A22B 1MLBB 5HSFA 1DDHA 5EOTA 4KXZH 4JN2B 3HAEG 1UADC 3EDKA 3VFMB 3ULVC 2C4XA 3EJJX 5ISZB 4LLUA 3LN5A 4OD3L 1FFOA 5TDPB 1XT5A 3HI6H 5F7YC 2APWA 1Q72H 5EH1A 3OKOA 1LDPH 1BQLH 4NIKB 5DDHA 5F96L 3PWLA 2C3WA 1G7IA 1LP9A 3AVEA 1PX4A 4WTZA 4ZUSB 4Y4KD 3HI1B 2FDBP 1BD2B 2IQ9L 4XPAL 1SJEA 3O4OB 5GRVK 1RHFA 4CN6A 1OB1B 1J8HA 3W5MA 4Y4FA 4NBXB 5DUPL 1ACYH 2FBJL 2B39A 3DIFB 2X4QA 5FV1L 3CFEA 2QQNH 4HDIB 5IIEA 3CDCA 1CD8A 1VACA 4P3DA 3ZSTA 4LAQL 3PDGA 4G8FB 2HVKA 2VZUA 2PO6B 3T2QA 2QKIA 4WNQB 4G9FB 4WHCA 3U36B 2WWMD 2BXYA 2W0FA 5EUOA 2GJZB 1FQ9C 5IW6B 4DUXA 4BFIA 3T3PF 1A7OL 1YEJL 3O4LD 3TJEH 2PYEA 4QRUB 5K9QI 2X05A 1T5XB 3AGVA 1E4KA 3QDMB 3KPMB 5EO9B 1UXWA 1AGFA 4GKSB 5J12C 3MGOB 5SWSE 1LK2A 1NGWA 2EDNA 1IEAB 1T22A 1XZ0A 1BGXL 1TXKA 3G5ZA 4OZGA 3KAAA 3GBML 4FNLL 5I1IH 4P0DA 2HTKD 4PGDA 3QH3B 4PRDB 1V3LA 2CDEA 4PJXB 4HXAH 3T8XB 1NGZB 4KZDL 5KSBF 4JZNB 1G6RH 3LKRA 1QTYT 2H2PD 4YDKL 4Z77B 4JY6B 5EU7E 5DUBA 3MRKB 4KROD 5GSRA 5T1MA 2YS4A 1EIBA 1YMME 2FX8H 5BS0D 4TNWF 3P4LA 5H35B 1PW3A 3BGAA 3WFDL 4C55A 2MSPA 3ARBB 4OUUA 2EZ0C 1NMBL 1RURL 1OTSC 1KUMA 3QG7L 2D03L 1EZVY 5KS9A 4LPCA 1C5CL 3MMEA 5C0EA 3FQRB 4KKLC 1TTUA 5K9OA 5HY9B 1FC2D 2FLBT 3O8XC 1R3KA 1TCRA 2P4AB 1J0KA 5E7FA 4U3CA 4WFFE 4M6AA 3QO1B 2WINB 4YHZH 3EDFA 4EDWL 1U8QA 4ODVL 2BNQE 5D6CA 4ZDHA 5F88A 1S9YB 2WW8A 5GRYA 3M1BB 4E41E 3CFDA 3SDXF 5CKAA 1A1MA 3C2AH 3FT2A 2HRPL 3G08A 1BOYA 3MA7A 5DRWB 1OVZA 1OD7A 4JFYB 1NKRA 1W0VB 4HGMA 2DTML 3RFZC 4F37F 2VDOH 3S6CA 4U6HA 3NCYS 3INUL 2VABB 5C70A 4CADB 2CLVB 4NN7C 1KF9B 1Q1JH 4HFWB 4X80L 3G5VB 4BFEA 3RNQA 4GJTB 3CMOL 4LRNH 4BKLB 2AK1L 2JB6A 2VTFA 4JKMA 4YHIA 3GSQA 4JHZA 5B38G 3JV6A 4QRPA 3U9UA 4XXDB 2DDQL 3D3VD 1TLKA 4PJ5A 3MUHL 5DHVH 1INEH 1JE6A 4S2SB 3R4DA 4IRSB 3MLRH 2F5BL 5DVMA 1BREA 1T04B 3X13A 4GRWF 1BZ9A 1CF8H 4LU5H 4NFCA 3O3DA 4F3FB 5JTWA 3BE1H 5C0AB 3BAEH 1E6OL 1KLGB 3P4OA 1MHHA 4OV5A 5HYSG 2FWOB 2BOCB 3IJSA 2J4WH 4FQPA 4D9LH 4MAUL 3SE9L 5ITFB 5K93A 5EBWA 1VPOH 5IJKA 1W72H 3BEWB 4D0BA 5ILTH 4JRXE 1YQVL 1Q9WB 3S3SA 5I30L 4N0RA 4MSWA 2IPTH 5CS7A 4PS4L 1FZMA 5D1QD 1NDMB 2NW2B 3NOIA 5HYIA 8FABA 5CD3A 2XA3A 2VSDA 3J7HA 1CBVH 4A2MA 3KJ6L 1D5IL 3UAJC 5JDSA 2WQ8A 2V17H 3EJYC 3DETC 5EG6C 5E8EB 4F57H 3BPLB 4HWZA 3RVXD 4JFED 4HZAA 4LLWA 4QHNB 2OTWA 3BKYL 4GXVH 5HPOA 4HJ0C 1ZXQA 5ICZB 4POZC 1SY6A 4FQXC 1LD9B 5EBLA 3O6FC 3V4PL 2VYRE 3S4SA 4YHOL 3L7EA 3RL2A 5IWLA 1KPUA 3TWCH 3ULVL 3LKSA 3TZVC 2NR6C 4HKBB 5EOCL 3H3BC 5I1KL 2DQHH 1TNNA 3RWCA 5E4IA 5GSVB 3ULUC 5T1LB 3JV4B 1CGSH 3QEUA 2ZG3A 4X5WB 1N26A 3T0ED 2WWKT 4GLRH 3FCTB 4IJ3B 1R0AH 4H25A 1OTTC 5IMKA 1S8DB 1JHTA 1OGAB 5BQ7A 4JZJB 2C26A 4XNMA 5E08H 4I77H 1DQDL 3NFNB 2Z35B 3CSBA 4U6XB 2P8MB 1ED3A 3JVGA 4WI9A 3OAZH 5E6ID 3DMMD 2W9EH 3O45A 2DQGH 4K7PY 3RDTA 4RFNB 2F74A 2HJLA 1QKZL 2V7HB 4POUB 3GSVA 1M71A 2J5LC 5CHNB 3PQYD 5GRZA 5C07E 2WSKA 5MEOB 2J8HA 3B2UC 3GBNH 1UC6A 4NZRL 5DJZB 2VLKD 3ALXA 1KELL 4HUWA 4GBXD 3RWGA 3BJ91 5EU6E 4WUKH 5CLTA 3ZYJA 3TN0C 2Z8RA 1U2HA 1UA6H 2GEEA 4OBRA 4J6RH 4MS8D 1QSED 1A6WH 3OKMA 3RVTD 1RUQL 3HKFA 4LHQB 1I8LA 1K85A 2B4CC 3JWNC 1L0QA 1A6ZA 2Z91B 4YHKH 4R7DA 5DRNB 5T33L 5ISZD 1A4JA 2OR8A 1HINH 5JORA 3BISA 5JIKA 3WEXB 5SX4I 1T2QH 3OHXB 3UZQA 5JXAL 4UT9L 1CXHA 1HKLH 3CLEH 4Z7VE 1IM9B 1G9MC 4X6BB 3TO2A 1BD2D 1FP5A 4XXCA 2DM4A 5DJ0A 3P2TA 1I3RB 5B8CB 3M07A 3V5DA 4N0UB 4XNZB 1INDH 4S1RH 4Y4KC 3VG9B 2DQCL 4ELKA 2EDJA 1OAKL 3FO2A 3LKQB 2AABL 2AI0L 1NLDL 1FL5B 4OT1H 1P4IH 1B88A 4MD4A 2DQIL 4J8RB 2FR4A 3EYVA 4R96A 5KVEH 1T7ZA 3QEQA 4CU7A 2APBA 3WL9A 3QQ4B 3Q1SL 1G9NC 4LDLB 4OFIA 5IB3B 1MCEA 4NYLB 4LCWA 2XWBB 3DI3B 4G9FD 1D5BA 4NZTL 4L3EA 1UH3A 4ZXBA 3VFGL 5E94B 5HI4D 3IGAA 3MACL 2A9NH 3KDMA 3QDMD 4AL8L 5DJYA 1KCSL 4QHLA 4DW2L 3SDDB 3IVKB 2WWMC 1FJ1B 3MV7E 4OZFH 4LSDA 4WUUA 1P4BH 1FPTL 4W70A 2APVA 3MRNA 3GSWA 3RY4A 3V8OA 4KZEL 4Q6IA 3MREB 4HS6B 3ZMRA 4YXHL 4FQCL 2C3XA 3STLA 3WIFA 3D48R 1FV1A 3GSNB 2R69L 3MJGX 5GGQH 1KLUB 2ERJB 1KPRA 3IT8D 3L5XL 1ZHLB 4JM2A 2XIDA 3DX7A 3MRPB 3P73A 1N5YL 1B4JH 3NIGF 2VZOA 3TT3L 3LHPL 1P69B 3UTTE 2HTKC 2X1WL 2AVGA 2AJUH 2IF7A 4CMMA 3Q6GH 3HB3D 5D71L 3WKMH 4C56A 3GMLA 4QRRB 5ITBH 1H15A 4HJGA 2H2PC 1ORQB 3L3OB 2AK4E 3ARBD 4HKXB 3V4UL 4RMUA 5IHUH 3UEZA 4OGYH 1J10A 2H41A 4NM8H 5JHDA 1JHKL 1XGRA 3JUYA 3D0VB 5DJ2A 3RWFA 4F9LC 4X4ZA 1QUNA 5J4MA 1MJ7H 2HH0L 2EYRA 1RJLB 5I66A 3ZYIA 1EVUA 1ZHKB 5FOJA 2B1HL 1MVFA 4JEGB 2R2BB 1H3UA 5ANMA 5F3HB 2CH8A 3U6RA 1QEWB 1Y18B 3BP4A 1GAFH 5FUCE 1P1ZA 5SX5H 3VXNA 1KB9K 1AD0B 3EYFA 3QUYA 1IVLA 3MCKA 4LLQB 4KHTH 2VQ1B 4DEPB 5E5UB 2JB5L 2M2DA 4F58L 1AE6H 2BDNH 4H88L 3W39B 2R0KH 5C9JA 3DOSA 5GGTL 2R29H 3OF6A 4M48H 2GITB 1KFAL 1YEDA 4LVHB 4LLDB 3EYUH 4PJXF 5DHVA 5K9KA 2X4SB 1NBVH 5HGDB 1CLYH 5I1DA 3OB0H 1ZHNB 1FRGH 2GW5A 3HA0A 3HCVB 4NN5C 1HHGA 4HH9B 4X7TB 5J13C 2Z8SA 3L3DA 5CD5C 4P48A 5C0CE 5IHLB 4N5ED 5IV2B 4FQIH 2I9TB 1CDYA 1JGVL 4BQBA 3V2AR 3ULUL 3LKOB 2DD8H 4RNRB 3EFDL 1W72A 1CICB 1BJ1H 3WFEL 3HMXL 1HHKB 3U7AA 3WUWA 4CVXB 4UTAL 3ARRA 5D7IE 4X7CC 5KTEH 3AUVA 4IRSD 2XZCH 1RZKC 5EUKA 1JFQL 4OF0A 5IFJB 2FJGA 1MIMH 2OL3B 3DURA 2YWYA 1A6TB 2X9XA 2LTQB 4XNXL 5C0AD 3TVMA 3W11D 2YUWA 3CSPA 1WWBX 2HLAA 5IGXL 3S36X 1RFDL 2YN5A 2E27H 3V5HA 3N1QC 5TGBB 4HPYH 3MFFA 1Y0LB 1UXSA 5C6TH 3CDGB 5CBEB 2I24N 1UZ6E 1LO4L 3R8QA 1G7HB 2G75B 3MA9H 1EBAA 3H42H 2X4PB 2P5EB 1S7WB 4U7KA 4HK3J 1BFTA 1Z5LB 3GI8H 3QI9C 2EE2A 1S9KC 1JGDB 5FYKE 1D5ZB 3I6GB 4ZUVB 5D1QC 1ZA3B 1UVQB 1G7MB 1I1FB 3VXQB 4K3DL 1Q38A 4LSVH 4OBSA 4RA0C 4NBYB 1HSBB 4D9QD 3GRWH 1XF2A 5EZIL 3IXAA 3OJDA 2B4CL 3MJ9L 2Q20A 1A2YB 1WEJL 1MI5E 3X11B 2W65B 2O93L 1OWWA 2AV7A 2F19L 3QWOA 5T1LD 5GGUB 1YEGH 2X89D 4HZLB 3MRHA 5E99L 2BSSA 3BRDA 2Z31B 5AAMA 4TTGA 1QA9B 1AH1A 1M7DA 4O2FB 1FVEB 3V5KA 1G9ML 4C57C 3IJYB 3WN5A 1OGAD 3U7YL 4S1DD 1T0MB 3NZ8A 2DJ4A 1H0DA 4Y1AE 3T0EC 4W4OC 1DSFL 4ETYA 5E24E 3QIBA 2HG5B 1SJHA 1MHEB 1L7TL 5IB4A 1HHJA 2NY5H 3VI4E 2V9TA 3N85H 1BP3B 2XG4A 4MAYD 3K3QA 4YAQA 4X6FA 4PTUA 4WY7L 2ESVE 1K8IB 3UYPA 4XCYB 4B53A 5E6IC 4I4WA 3DMMC 5E8DL 5L88H 1VADB 5FF6A 1G9NL 3PL6C 4O2CB 2G60H 4N9OB 2BVQB 4F7PA 3KPRA 4KI1A 1KYOK 5CWSA 4O5LH 1MAML 1B0GA 2YBRA 2AV1B 3QO0B 5MENB 2YK1L 5HVWA 1BM3H 4LHJB 2ZP0T 2ADGB 4DVRL 4YFLF 4D2NA 2F54A 1MFNA 2QEJA 2D7TH 5GISL 5IKCA 5GIRB 1GC1C 2C1OB 3H0TB 3QEHA 4NKDB 2VSCA 4ERSH 5T1KB 3CK0L 3GIVA 3EFFB 3RVTC 2O5ZL 1U8OA 4YGAB 4N8CL 4PRPA 2R1WA 1Q0YL 3BZFB 3F7QA 4PP1D 4EUPG 4NP4H 2HVJB 4LSQH 1ES0A 4YE4H 1L0XA 4Y5XA 2V2XB 1OSPL 1NGPH 1VEOA 1DJSA 4LQ1A 4F8QA 1IM9D 3W0WE 1CDCA 3P0YH 1YMMB 4MA8L 3M8OH 2JF1A 4CJ0A 1KNOA 3WV0A 3RUGA 2EECA 3WIHL 15C8H 1QBAA 2H2SD 1BBDL 3N06B 4K8RH 5KG9A 3O4OC 3VD4A 1KG0B 3FO9A 2GJ6A 3QCVH 5FYKU 3RY6A 4D9RD 4LLAA 1T5WA 3MRRA 4PJFA 5D9SB 3QDJB 3G6JE 2VOTA 4HD9A 4OLZH 1FO0L 2CKBB 5C0DB 3SDCD 4AEIH 5HHVL 4GW5A 2R56L 2WNGA 2NY4B 4UDUB 4QHMA 1U8MB 4XPFH 2YHGA 3MLYL 2PO6C 2BNQB 3G04A 1BAFL 3V8CA 1OP5K 4N0FA 4E41B 3SDDD 3P30L 3GM8A 1RK1A 1GGCH 2XQBH 1EAPA 2YUXA 5HI4C 3C5SB 4FQLH 1BIIA 4ZFZA 1V7NH 5D2LB 4WWKB 3BT2H 5TQ0L 2ZCKH 1GZQA 1YA5A 1Q0XH 3JWOC 4ZSOB 3VGFA 3MRBB 3FQUA 4YDIL 1ZT7A 4LKCB 4K7FB 2HWZH 3FHQA 3IFPA 2ORBH 1B90A 3VA2C 3NFSH 1T7YA 5LGHL 3BDYH 4QRRD 1RZKL 3DNKA 1DBML 5HGAB 5CP7A 4K9EH 5E1AB 3DX8A 1KTLA 4FHBD 4JKPH 1R3HB 5DWUH 2I60L 4NO0B 2P47B 3L95A 4GS7B 3GMQB 3HB3C 4E42B 4BFGA 3EGSA 1BX2B 4PJGA 5DR5H 2HA1A 1FYTD 3WHXB 4D3CH 3EO9L 3MRLA 3I6LD 3ARBC 1WLHA 2ICEB 1S5IL 1CLCA 1JNHB 2E9BA 2CDFA 3C8KA 1ND0B 4RRPA 3SDAB 1OAYL 4XVTL 2V5SA 1TVDA 3OPZH 5HHOE 1FGVL 1F4XH 2Q7YA 2Y5TB 3FFDB 2WWKO 1A3QA 1WCBB 4HAGA 2IADA 2PN5A 3BVNA 1LO2H 5TQ2H 2R2CA 4XGZB 1JNNL 4QXGH 2FYYB 2Z0BA 3V7AG 1ZLVK 1YEEH 4IMLA 4JO1H 3T0VA 5I17A 1AXTH 5DS8A 2VXQL 3RX7A 4WHTA 3O3EB 3QUXD 3BEVB 3K4ZA 1QNZH 3RIFF 2A38A 3GGWA 5H37G 4PJDE 2J6EH 4D0DB 2NCMA 2BNRE 1QFWH 5IB1A 4OB5H 1CICD 1NCCL 3C87A 3N0PB 3U7WH 5FO8A 2XACC 1G7LB 1W0YT 3IFOB 1KJ2L 1FNAA 1T21B 4N5EC 4JRWA 2X70B 1LK3L 3MLWH 5ECJE 2A6IB 3EYSL 1JP5A 3FL7A 2C3VA 1QPXA 1B6DA 1J1PH 4Y5VA 4ZQKB 3OG4B 2N1KA 2YD1A 2EEBA 2GAZA 4IRSC 3ZTJG 2Y06H 4OLXH 3VXUA 3GIZH 2UYLB 4UNTA 2LU4A 2VDNH 2IMMA 4WFHE 3MXWH 4M7JH 3KPLB 3HE7A 5CCKH 1RJCA 3W11C 5ACLA 5ICYA 1HILA 5C07B 1K3IA 3CLFL 4YLQT 3GRWA 3I3BA 1TPXB 1IGJB 4MXVE 4XBPA 4G42A 2P5ED 3MCG1 1D6EB 1KCLA 3DRTB 4LIQE 3OMZA 2QQKH 3D18A 3DPBA 3MRCA 4NFBA 3QIWA 3V6FA 2BSTB 3DX6A 4I13B 1WSST 5EU6B 3L5IA 2ZG1A 4OZ4B 4O00A 1NC2B 3HAEA 4XB7A 4NM4H 2RFXB 3H7BA 1GC1L 4XB8A 1AP2A 3NAAL 3QHZL 1CK0L 1G7QA 3K2UL 2JCCE 5LBSH 3M17B 1LP9E 1HQRA 1NAKL 5J1SC 1A7NL 3MPCA 2QQLL 3FONB 5EC2B 2Z31D 3SKNA 3B9VA 1J8HE 2F58L 3QZWB 4A6YH 5J6HB 5I73B 4Z7VB 3LZFL 1ZMYA 1RMFH 1FHGA 1L6XA 2OBGA 1E4WH 4JAMB 4XCEA 5IT2H 1NEZB 4IJ3C 4OD2B 3FOMB 1T1WA 1KTKE 2RHEA 4YX2L 3WE6B 3ZO0A 5D7LB 5I1CL 3GKZA 1OAXL 4M8VA 3V6BR 3IAGC 1F58H 4GG6A 4S1DC 1BOGA 4JZJC 1A47A 2XQYG 4J3TA 4NT6A 4S1QH 5IVZA 1MOEA 4KH2A 1C1EL 5ALCL 4ZYKA 1JPSL 3BUYB 2DQTH 5EUOE 1ZGLB 3UX9B 3A6BL 1HSAB 4NC1E 3BRGC 1Q9LB 2CRIA 2PYEE 4RFNC 1F3RB 1PEZA 3LQZA 4TSBH 4UU9A 4P2RA 5AZ2H 2XQYK 5MEND 4RFOL 4GAFB 4ZUUB 1IAIL 4X9IA 3I6KA 3UJJL 1BF2A 3ARGA 3KGRA 4Y5YA 4U7SA 5J3HD 1VEPA 4OGAD 3DECA 1CFVH 3LKPA 4HMDA 2ICWI 5DJCA 2BRQA 5BV7B 1AI1H 4OQTH 5EFIA 5T1KD 3RVWD 5F7KC 3T65B 3OBAA 3JWOL 1C16A 4PTTA 4WVRA 1R5IB 1IQWL 4KK6D 2WQRA 5FYLE 4CUCA 3UBXG 5SWQB 5I1AA 5BMFL 1EFXD 3VFTA 4ZPTB 3RI5F 1OQOA 4J3SA 1JI1A 1RK0A 4L5FL 1KEMH 1M7IA 1YMMD 2VNCA 4PP1C 2PCPB 4LVOB 3CXDL 4UT6H 1IC7L 5BZWB 5KS9E 4H8WH 5E56A 2AK4B 2XN9A 5EPMB 4N1EA 3QDGA 1K4DB 4BZ2L 1MRDH 3DROA 5FCUH 1WZMA 5K9QG 4NO3B 5B8CC 3U0WH 4XNZC 3QDJD 1IGCH 1YN6B 3VG9C 3KYMB 1E28A 2H2SC 1W8OA 1LHZA 4OJFH 1LEIA 1IFHL 2Y5EA 2NY4D 5GGVH 3G9AB 2YSSB 5IW3A 4NQEA 5F9JA 4U1MA 1A14H 1RU9H 4Y4HA 3CFJA 2BNQD 5AZEH 3N1GC 1JK8B 1SEBA 1YMHA 2NZIA 4LPUA 4Z78A 5BXFA 4K94H 1XF5B 4HX1B 4NUGH 4S0SD 5EO0B 2C4FU 4M62L 4JB9H 3WXVL 2IFGA 4Z5RA 3FQNA 2P5WB 4WWKD 5ID0B 3UDWC 2WP3T 3SDDC 5DSCB 1J1OL 3O41B 4NQSA 4X8XA 1K3ZA 3ROLB 1XH3A 3G6DH 3AMLA 1MF2L 5TJWK 4QRPE 4XPBH 5C0CB 5FA3B 4CN1A 5B38A 4ZAKB 1CGXA 3QFJA 4JFOA 5D7JB 4P5KA 3CXHJ 5JW4M 2KH2B 5CEZD 4OCRL 4LFHD 1K6QH 1E6JH 4G3YH 1H3VA 4G6ML 1UB5A 4KY1L 1HXMA 3VMPA 5DURB 5D7IB 3IDMB 2ERJC 4U0QB 1WT5C 2DWDB 4GAYB 4R3SA 4RZCB 3OZ9H 3OR6B 5KVGH 5IEKB 4G5ZL 5IHZA 2SEBA 5HVHB 2M8XA 4D0CB 4HIJA 1L4IA 4P9HC 1QFOA 4N0CD 1L7IH 4XMLH 5ESAB 43CAB 4NHCL 4ZO6A 5IHBA 3QHTC 1MRFH 5JW5A 4Y2DA 1T1ZA 1OARH 2EDQA 2IALB 4BH7A 3HMWH 5ACZB 1XR9A 1T3FB 3SDAD 2OR7A 3SE4A 4OAWB 1KCRH 3QJFB 5H94A 1DQML 2NTSP 3HR5B 3D25B 3VWJB 5J6GA 3MRFB 3MRIA 4LSSH 1J5OH 4GUPA 1JRHL 1VEMA 5D2LF 4XH2A 1CT8B 1WZLA 4GRLA 2EKSA 3TLRA 2XNAA 1I1AA 3S5LB 1RVFH 3BP7A 5DFTA 3BD5A 2Q6WA 3BPNB 2IPKB 5E8NB 5C0FB 5I1LA 3A67L 4DEPC 4GW4A 3D2UA 4WV1B 1T4KB 1MI5B 3UPRB 5F7NC 1HZHL 2A1WL 4LVHC 4M6OH 3B6SA 4Y0GA 1F42A 3ILPB 3O4LA 3SDYL 4M6NH 5KBNC 5DLMH 2PXYB 4DGYL 3QEGH 4LCYB 4PJIB 4U6YB 4UNVA 4HCRA 1X5LA 4NZDA 1QLRB 3DGGA 4IDJL 4UINH 3FB6A 1IT9L 1PD6A 1DVFB 5F7MC 1PVHA 4Y1AB 1CICC 3HHRB 4KKCD 2OJZH 4OCMC 4YHPA 4AQOA 1JMZA 1QP1A 3R06B 3V4VH 2GUOA 5GGRA 1OM3L 3TBYB 5ESVB 2LTQC 1XGPA 3BMVA 3CX5J 5CKGA 2BSRB 2ESVB 4OLVH 5DD0L 5FO9B 3L3IB 5C07D 4AH2B 1ERNA 3MLVH 5FIEA 5CGMA 1T03L 2HJFB 5JOFB 1UM5H 2XFXA 5DD1L 5DYOB 5A3ID 1A0QL 1G84A 1YYMH 3NTCH 4RQQB 4M6ML 5SWZE 4ZFOB 5INCA 4PJAE 5FKAA 1ZT1A 4X7SH 1QBML 4MA7H 4QGYA 2EXWD 2GFBB 4HK0A 3W2DH 2XTLA 5FHBL 4A6YA 5JDJA 1F2XK 1NC2D 1EJ6A 1ZGLM 4FZEL 4PBXA 2VXVH 1GGIL 3RBGA 3QRGL 4Z0XB 4KVCL 3V6OC 2FECL 2VDKH 1DFBH 3K0WA 1JHLL 1UM4H 1U8NA 4KTYA 3OKNA 1FNGA 3AS0A 4NQVA 3CJJA 4QHUA 2LFGA 4R0LA 3WFBH 2NW3B 3T0AA 3W0WB 2VXUL 1J05B 4PYHA 3BQUB 1IEBB 4MQXD 3VFOA 4XBEH 3TBTB 2Z31C 3O9WB 3VU2A 4EUPH 1TIUA 1CTNA 2CMRH 5FOBA 5D7LD 5HGHB 2DF3A 3D5OF 1FFRA 4K3EL 4IRJD 4M1GH 1N3NA 3T08A 2V5MA 5KN5A 4LCWE 1WFNA 2AXHA 3RWHB 1ZTXH 2XZAH 4JANB 3X3GH 4L3EE 3F7PC 4LFHG 5CZVH 1JPTL 4F7TB 2YPLE 4U3HA 3K8MA 1JCKA 1VENA 3KPOB 1OP5H 2VLJA 1NJ9A 1KCUH 1RZFH 5GRUH 4RIRB 3CSGA 4ZOEA 5IOPB 3VFSA 2X42A 3QJHB 3SGJA 4I3SL 2BMKB 4I2XA 5LGJB 3OJMB 4IIQB 2WUCL 1F11A 3L9RA 2Q3ZA 4L8DA 1F4WH 4FQQB 4QNPF 1G1CA 4UIKH 4Y19B 5J3HC 1OAZH 1TJHH 2BNUB 4QRQA 2ZSVB 2FO4A 1T89A 3PWNA 4OZIA 2H26B 3PUCA 4QRTB 4Z7VF 4FXKA 4XPTL 3B2VH 4Q7DA 2ATPB 2CK2A 3E0GA 2CJUH 5DJ8A 4MDIB 2LV4A 4C56E 3VW3H 3OGOE 3RVWC 4HXBH 5BO1H 3MBXH 1N59B 2JK5A 3GSNL 3SPVB 2IG2L 4U6VL 4ZUWB 1GGTA 1DQJB 4KK6C 2VO5A 3MNZA 1DBKL 1QRNA 4KXZI 4NRXB 5JHDE 2AK4D 4N5UA 3O3UN 4KQ4L 3ARTA 3BHBB 2NPLX 3VH8A 4P9HL 1MNUL 4JR9L 1UKTA 3UTZB 5JW3H 1UWEH 4G80A 4NNPL 4EBQL 5HDBE 4NWUH 2C3HA 4N8VA 1EJOL 4HS3A 1ZEAH 3VXSA 4B50A 3E6HB 3I75A 1S7QA 4X4XA 2D7OA 2WANA 2AEPL 4PJBB 3F12B 5J7CC 1I8MA 2NY4C 2R4SL 3VFUB 4YXLH 2ED7A 4BH8B 2I07B 4Q97A 4U2ZA 1IGTB 1ZLVH 1GZPA 2WIIA 3TT1H 3VI3E 4EVNB 2V9RA 2HFFB 2P5WD 3MLSH 3PQYA 3PGFH 4P2CG 1RJYA 2C7UB 4F9PC 5E9DA 3KLSA 1EHLL 5C0CD 4TSCH 1GPOL 1YEJH 4ZAKD 3KLDA 4R26L 4WWKC 1UJTA 1N8ZB 4NGHH 5D7JD 3WO4B 2BNRB 4GBXA 4NJAH 2ICWB 1ORSB 3HG1E 4KJQD 4L4VA 3WDHA 2VDRH 4NQXB 2A83B 1U8JB 3CSYB 5DURD 3D9AH 5GS1B 1QSEA 1OT1A 3P11H 5H37H 4UOJA 1NFIA 2XWTA 3ARDD 1JZ2A 4FG6D 4IRZL 5CSBA 4YPGB 5JUEL 3U4BH 4FNLH 4AM0A 4YWGL 3JTTB 1AQDB 1FCGA 1XCTA 2EXYD 1XIWA 2VZ1A 2OL3L 4GS7C 1MPAH 1T6VN 3GJFB 4P3CH 4CKVX 3UO1H 5IVNA 3H9SA 2AJ3B 4MNGE 4N0CC 4HUXB 3GKWH 4FP8H 1DUZA 4F8TA 4YC2B 2VWEE 5HVGB 2B8OT 2QR0A 3BYTA 1J9CT 4XC1H 3VWJD 3BH9B 1S7UB 4MDJA 4G7VL 3SDAC 1ULVA 1RURH 1D6VH 3VGAB 1BFOA 5FYKD 3B9KB 3SCMB 1ADQL 3QG7H 4LEOB 4RFEA 2FIKA 1DDHB 5C9KA 3QWRD 5EOTB 2BK8A 3KLHD 4H0IA 2J88H 3KPQA 1N64L 2XG5A 4LLUB 4M61A 4JO2L 6FABH 3LN5B 3IKCA 5C08E 5JQ6H 1FFOB 5JNYA 5D1XA 1JVKA 5DQDH 3TIEA 4P59L 4CRPA 3OKOB 5DDHB 1MJUL 1IGFH 4X6CE 3PWLB 1G7IB 1LP9B 5I2IA 5D7IF 5LWYH 2ZNWA 4G6FB 5GQBA 2PXYD 4V1DE 1SJEB 3BKJH 5C0ND 5JIIA 1CLZL 1J8HB 1RULL 4Y4FB 2J12B 2F9BT 2HRPH 1MCDA 3CVHH 8CGTA 1DVFD 2X4QB 1OOAA 3CFEB 5IIEB 4BK4A 4BA8A 5F7DA 5I8OL 3L1OL 4RWYL 1VACB 4ZO8A 4P3DB 3TESA 3P9MA 2HVKB 1EVTC 3PHOA 5IEHA 2QKIB 4MA1B 5IUSA 4PP2A 3CMOH 1FNSH 4JRYE 4KKCC 4JJHA 4R4BA 1UCBL 3KPRE 4Z7WE 2JELH 2W0FB 3IU3A 5EUOB 4CAGA 4BFIB 5MHSD 2PYEB 2F5BH 1A3LL 5FO7A 2Q8BH 1YN7A 3DBXA 1P84J 2F54E 1ROWA 2XZZA 4PYGA 2XY1A 1TPXC 3LRHA 3HI5L 1UXWB 1AGFB 4I0PA 3KXFA 4ZTPL 1FBIL 1LK2B 1J18A 1NGWB 1T22B 3TH3T 1XZ0B 3G5ZB 4OZGB 5A3IC 1YQVH 2XY2A 2QSVA 4MCZA 4PG2A 3L3HA 4UQ2A 1CVSC 3CPLB 4PGDB 3AREA 2CDEB 3GZKA 1Q9KA 1I3GH 5AEAA 4PRPE 4PS4H 2YUVA 5I19L 3NACL 4PJIF 1RZJC 3ZDYE 4M5ZH 4WGWB 1UEYA 4EUPA 2EDFA 3BP5A 4KWUA 5DUBB 5GSRB 3SGKA 5EBGA 5T1MB 1FC1A 1UYWH 1TZGL 2JJWA 1HIML 3U83A 2GK2A 3RUGE 1CR9H 4OCSH 4OUUB 3BQUD 4XVJH 3GHEH 2HKHH 4R9HA 3GMRA 2NZ9D 1E4JA 2X5PA 3GBLA 2GJ6E 4LBEA 5KS9B 3ECBA 4Z7NF 3MMEB 3RWIA 5I0ZA 2Z8VC 5C0EB 5I16A 4PJFE 2A6JA 4YJZL 1WQVT 5D1ZD 5K9OB 1RAMA 4MQXC 4P49A 3QPXL 3QXAA 4ODSL 1R3KB 1TCRB 3DYMA 3N1PC 2AJXL 2WP3O 4UILH 5EZJA 3EIFA 4GLRI 1RJZA 5E95B 1AD9A 3GMPA 3CD4A 5EWIL 2ADJA 5EORH 1U8QB 2R0LL 3BZDA 4ZDHB 1J0ZA 5D6CB 2OZ4H 5F88B 4KI5E 1HNGA 3CFDB 1MFDL 4FQHA 1A1MB 4H5SA 2CKBL 4ALAH 1AFVL 2AKRA 3FT2B 3G08B 3GHBL 3MA7B 1YQ2A 1UM6L 1RI8A 3RWEA 4U6HB 1KTDA 1IGIL 4Y19D 4PGZA 3RNQB 2UZIL 3T2PA 5IB2A 2JB6B 2R2EA 4YHIB 3GSQB 5L6YH 5IVXA 3JV6B 4QRPB 4FFVD 3U9UB 3BGMA 2YD3A 4OLUH 3ULVE 4PJ5B 2YEZA 2Q8AH 5BV7C 3TNMA 5CINL 4UBDD 3X13B 1BZ9B 1OW0C 2GSGA 4GG8A 5TPWH 3O3DB 2VITA 4MNQA 3BDBA 3P4OB 5DVNA 1MHHB 1RIHL 4OV5B 1D7FA 5KJRH 1ZA6A 3MUZ1 5EBWB 4ZG1A 4PRHE 2D7PA 2ZNXA 3AC0A 4D0BB 3HNVH 4LGRB 5FGSA 4LVOC 1FE8L 4X99A 4TUKH 4MSWB 7CGTA 5DMGD 1FZMB 2B0SH 4XCFL 1IC4H 4IMKA 5JXAH 8FABB 4BZ1L 4MQSB 4UT9H 1TETH 3KYNA 5CD3B 3MV8A 4KMTL 1VESA 5TE4L 5JDSB 4HWZB 2R0WH 4LLWB 1MWAH 3DSFL 4APQA 1UWGH 2OTWB 4FABH 4ZD3L 4JY5H 5HHPA 4ONGL 5EZLA 2AABH 2AI0H 4I5BA 1JPGA 2AXFA 4MAYA 3LDBB 4FZ8L 5EBLB 3S4SB 3L7EB 3RL2B 2E7LC 1I4FA 1KPUB 2QTEA 3LKSB 1MCHA 3P77A 5CIPH 1UWXK 5IESL 2YXFA 4P23A 4PR5A 3FAXA 4GSDH 3RWCB 1WFTA 2NMSA 3QEUB 2DLIA 3IS1X 4ZTOH 4DN4L 4KMLB 5IP4A 2XT1B 3UZVB 4JO3L 4H25B 4NOFA 1LO3L 2BNRD 2R1XA 5GZOD 5IMKB 1JHTB 5FK9A 3V0WL 2QV2A 3DXAA 1KCSH 4XNMB 5AD0A 3S96A 3AS2A 4ZAKC 4Y8DC 3IU4L 1ED3B 5D7JC 5F9WB 5KVFL 3W9DA 4I3RL 4BSJA 4KJQC 3O45B 2Y6SD 4IS6A 4XP6L 2B2XH 4U1IA 4LRIA 4FQCH 3RDTB 2F74B 4DKEL 5F9DC 2HJLB 1XGTA 3BKCL 1NGYA 2BXZA 2DQDH 3NA9L 3GSVB 1M71B 2ZCLL 3PWPA 4FG6C 4WFHD 5HVHC 3S37H 2KZWA 4PJBF 2Z4QA 4QTHA 4WU5A 3VD7A 2EXYC 5LGKA 2R9HD 1R3JA 3U4AA 4HUWB 1H3PL 3RWGB 2C9AA 4RGNE 4PJ7A 2EEDA 4H20L 1UKSA 3V4UH 1T66D 1IM3A 3B9KD 3SCMD 3VRLE 3OKMB 4YGVA 4MQ7B 4HK3N 4UQ3A 3O6ML 5T3ZH 1P7QA 4PUBL 4OLEA 3VWJC 1F97A 4KHXL 1A6ZB 3BKML 3Q5TA 1OPGL 3V0AC 2IWGA 4R7DB 3SDCA 1AJ7H 5EIIB 1A4JB 1WIOA 3CVHA 5JORB 1CD1A 3E8UL 2FATH 4HFUL 1RZJL 3KLHC 1UKQA 2PW2A 2WAHA 3BPNC 1F5WA 2IBZY 5CJBA 5HTSA 5GS2D 1LEGA 4G6FD 3TO2B 5DUML 4ZOAA 4WV1C 4HJJL 2XKSA 4M9OA 3UXFA 5DJ0B 4Y4FD 2FEEI 3V5DB 1TCMA 5HHME 4ELKB 1WITA 2YA0A 1KFAH 1Z3GL 1IL1A 1MCFA 1LNUA 2PXYC 3FO2B 5GGSY 4XNYH 5C0NC 4MD4B 4HS8H 3NVQA 1BJ8A 2FR4B 3WS6A 3EYVB 4R96B 2V5TA 3QEQB 3WL9B 3O2VH 3TIDA 2HYMA 2XKNB 1DVFC 3OWEA 4PGBB 4HQQH 3C08L 4LCWB 4JG0L 4MB4A 1D5BB 2YMXL 4NKQB 4L3EB 5F7EL 1YNKL 2YC1A 2QHRH 4U2YA 4ZXBB 1QQDA 4P2RE 1DLFH 4QTIL 2W9DH 5IMLA 3IGAB 2PYED 1OF2A 2VLRA 4KPHL 3D87B 4OSUL 3KDMB 3C9NA 3AU1A 3CC5A 5DJYB 4QHLB 3ZSSA 1U92A 3CZJA 4KRNA 4WUUB 3MRNB 3GSWB 1AO7A 1JGUH 4R2GB 1FYTA 1EHNA 2YRPA 4Q6IB 1N6QH 3OV6A 1JYWA 4Z9KB 1MRCL 1A3RL 3UC0L 2DTSA 4OGXL 5FDYA 5GZND 3STLB 3WIFB 2AW2A 1FV1B 2EDYA 1LP9F 4RISL 1WBXA 1Z9OA 3RX8A 4AIOA 5F1IA 1KPRB 4EN3A 4RMTA 4JM2B 3IYLW 3DX7B 3P73B 2DS4A 5L2JA 2IBGA 1IRAY 3CUPA 3UBXA 5F1SA 3AM8A 3WD5H 1MIEH 2MQ3A 1P4LA 4CMMB 3SOBL 4C56B 5BV7L 2P8PA 3GMLB 1H15B 4HJGB 1DN0A 1TITA 3LH2H 2XN9E 4IBLT 1J0IA 2YD7A 2FZ3A 2I25N 2OZ4A 3T3ME 5JHDB 1XGRB 3QUXA 1DBJH 5DJ2B 3TCXA 5A16A 1AXSA 3RWFB 5LXGH 3DVGA 4HUMB 3BQUC 5EUOF 3GM0A 1G0DA 2FJFA 2EYRB 5CILH 5DD3L 3IFLH 5I66B 3HPLA 2NZ9C 3O9WC 1MY7A 3NA4A 4HG4J 2NY1B 1TJGL 5ANMB 4NQEE 3S37X 5EOQH 4DVBA 4EI5A 5FECA 3U6RB 3BP4B 4NNYA 5IR1A 1P1ZB 5DC4B 4M5YL 1EZVX 3VXNB 4K7PH 2F8OA 3EYFB 3QUYB 3MCKB 1RY7B 1KXQE 1NLBL 1RZ7L 3PE9A 4DGVH 4OZGF 3CDFA 4HWEL 1FGNL 3H3PH 5DTFA 5C9JB 3X17A 4JQXA 5TFSH 1YEDB 2JJSA 5K9KB 2W0KA 2DICA 5I1DB 4RSVA 1WIPA 4JPIA 4ONHA 4V2BA 5A2KH 1HHGB 5JR1H 2DLHA 3L3DB 1Z0NA 4LHUA 1B9ZA 4OLYL 2EH8H 2VLMD 3MR9A 4IIQC 4M1CD 4LGSB 3QXUA 1W72B 5TF1H 2VH5L 4QRPD 5KANG 3WUWB 2AP2A 3T3PE 4PJ5D 4XP5L 2WM0A 4XVSL 3H6JA 3DGCR 5KS9F 5EUKB 1MFAL 1A9BA 2FJGB 4FFVC 3DURB 1NAMH 4OCXH 4XBGA 3ZZ1A 2R4RH 3SEPA 5F6IB 4G6JH 3TVMB 5GISH 2J7LA 4FQ1H 5J1TC 5BW7C 2HLAB 3GSUA 1ZLSL 4B7LA 3IFNH 2AJYH 4UBDC 4NWTL 1B2WH 2IGFL 4ODUA 5I8KL 3MFFB 1MWAA 1UXSB 5GJTH 1ZV5A 1MFBL 5KSBE 1OSPH 4JPKH 1QZ1A 5CIPA 3PHQA 4M7KH 4MA8H 3AY4C 2A6DA 3VFRA 4NNXA 4XC3H 1RUAL 5DMGC 5M94B 1CYGA 3WNNA 4ZNCD 2DKUA 1NCWH 2ITDA 4MLIA 4KTEH 5L7XL 4PLKD 3VXOA 3SQBA 2K1MA 1M4KA 3GO1H 1XF2B 1OTUD 3IXAB 3OJDB 1IKFH 3KJ4C 2APXA 1K2DA 5I1GH 3MCLH 2H3NA 2EH7H 4FMKA 4NZUL 5FYKL 4YBHA 1YECL 2AV7B 3O4LE 2WBWB 4FQ2L 3QWOB 3MRHB 4ZFGH 2BSSB 5E03A 4OQ1A 3MLYH 3QISA 4TVPH 1LE9A 3RJQB 1LO0H 1M7DB 1GGBL 3V5KB 4JHWL 1MFCL 2YPVH 5I0DA 2AJZA 2MPAH 4MWFA 3WN5B 5DJAA 3SDXE 3NZ8B 1HK6A 4E9LA 3WO4C 5AG9A 3TV3H 1FIGH 3QIBB 3TH4T 4U1GB 3FTGA 1SJHB 5GZOC 4JFPA 4K3JH 5IB4B 1HHJB 3WJJA 2XXMB 4PJ9A 1CGYA 3RDTD 4YAQB 4HBCL 2R8SL 4RBPK 5GS1C 4X6FB 4PTUB 1JNLH 1QRKA 1OD9A 4I4WB 5I1HL 3U79A 5FF6B 3PP4L 2Y6SC 4MMXC 4F7PB 1EFXA 3KPRB 1PG7H 1U3JA 4UV4H 5CWSB 1JZ5A 2G5BA 1U6AH 1RUML 4Y7MA 1B0GB 2IPUG 2ARJA 2YBRB 3LN9A 5CEYA 4K7PX 4GRWE 2XPGA 1K5NA 4G6AD 2F54B 1F4YL 4X5XA 3NCJH 1GHFH 5M7QA 3P9WB 5BVPH 4YC2C 5IKCB 1KEGH 3FQWB 1MJ8H 1W8NA 3B3IA 5FHAL 3EO9H 3QEHB 2IPUK 1T66C 3VGAC 3B9KC 5BRZA 3GIVB 3L6FB 5TE7L 3SCMC 3ARYA 4M8QA 3GMOA 4U3XA 4Z7OE 4ZFOL 1T1XA 3HNTH 2EE9A 5MERA 4LARL 4FQJL 4X7FC 4PRPB 2R1WB 1I8IA 1VFMA 1QVOA 5E4EB 1FGVH 3QCUL 1ES0B 3TH2T 4EJ1C 4Y5XB 1T2XA 4KUZL 5JW4N 1KNOB 1JNNH 3S35H 3VWKA 3T2NL 3RUGB 3WIIH 5KOMC 5I15L 1VSCA 5FYJH 1SJXA 4WI2A 5KG9B 3FO9B 2GJ6B 4U1LA 4WCYH 4Y4FC 4GMSL 1T5WB 3MRRB 1J87A 4PJFB 3OX8A 5CJOL 2VDLL 3QEQD 1T80A 2QQQA 3F58L 5IK3B 1TQCB 1QFWI 4GW5B 3VD3A 2PYFA 4LCWD 3GJEA 1UH4A 2N4IA 3IJHA 3N9GH 2D31A 3NH7L 4QHMB 2A77L 2DRUA 5F9OH 4ZXBD 1CDIA 4X4YA 5HJ3A 1NCBH 1XAUA 3G04B 4MA1C 4Q0XL 4YQXL 5E2JA 1LK3H 4EOWH 2CIIA 1ZSDA 32C2A 4N0FB 2E7HA 4YK4B 3DLQR 4I2XE 2DYPA 5IBLD 1CFSA 1RK1B 1A7RL 5HHNA 4WUUD 1EAPB 4NC1C 5DJXA 3MLXL 4JHBA 1BIIB 1BZ7A 4R2GD 1E4KC 4ZFZB 4HIXH 5KSAA 1KJ3L 2YPKA 1GZQB 3HS0A 5JA9A 3FFCA 4B5EA 1S78D 4KAQL 3FQUB 1ZT7B 3ME0A 1RUPH 4JM2D 1QLEL 3IFPB 5GZNC 2J3SA 1MCRA 3AFLA 4AYFA 4DAGL 5J8OA 1U91A 1A5FH 4C56D 2BZDA 1EBPA 4QYOA 1VCAA 2BY1A 1QRNE 5CP7B 1EUUA 1YJDC 3DX8B 1KTLB 2Z9TA 2BJMH 3LQAH 4TPRL 3L95B 3P0VL 2Z93A 3F7VA 1CGWA 5HBBA 3EGSB 5TH2A 4PJGB 4PGEA 2FIRT 3NABL 4GQ9L 3MRLB 4JY4A 1N2RA 2Y07H 1WTLA 1PAMA 2CDFB 5DRZA 1HHIA 2HFGL 3C8KB 1J1XH 1MHPL 1FFNA 1WAAA 3VXSE 2NY1D 1KENH 1EMTH 1E27A 4PGCA 2Q7YB 2F58H 1PG7X 4I9WE 1CWVA 4JHAL 2IADB 3BVNB 1VFOA 4OLWH 1PKOA 3QIUD 1OP9A 3QUYD 2VXSL 1FCCA 1VGKA 4IDLA 4XP4L 4AZ8A 1JZ7A 2QSQA 4I3GA 2OJEA 4Q9CA 3LEVL 1A9EA 2CQVA 1KV3A 4IMLB 4ONOA 5I17B 1M7XA 1JZ4A 3PQYE 1DBBH 2VDQL 3G6AA 5DS8B 4WHTB 4JM2F 2NLJA 1C1EH 5EC1A 3GGWB 1UWXH 3LMJL 3V95A 3WKNA 1NAMA 2MQ0A 1BIHA 1CZ8H 2Z92A 3D85A 3WNMA 1LWRA 5EZOL 5IB1B 3BWUC 4R7NA 1A7PL 5FO8B 5L9DH 1JNJA 1X6NA 3QXWA 5KVDL 1QSEE 4KMQA 3P4MA 3O6LL 4O9HL 2CK0L 4OUOA 4W6XB 3S35X 2C3VB 3K2MC 5C0RH 4Y5VB 1JF1A 2HFTA 5ISZE 1UH2A 4GKNA 2GAZB 1AGCA 2W60A 3VXUB 3DO3A 2IC2A 5HDQH 4UT7H 3FB7A 4KJPD 5HDBF 1U8HA 3HE7B 5HGBA 5ICYB 1HILB 3S34H 5IJKC 1BEYL 1C5BH 1DEEA 2BY2A 4Z76A 4XBPB 4G42B 1KN2L 1N6VA 1EGJH 3P3YA 4L5FH 3SJVA 3ZKXB 1KN4L 3D18B 3QIWB 2BVOA 3V6FB 4RGNB 3DX6B 1OAUH 4UDTA 2AEQL 3CFCL 3R8BB 5CJ5A 1YEFH 3OR7A 3HAEB 3P0GB 4IRJA 4QOKA 2HKFH 3H7BB 3U0PA 2DOCA 3C5ZA 1AP2B 5F72S 2FX9H 2CIKA 3D69A 5DEGA 25C8L 1HHHA 4G9FE 3RIAK 3L5JA 1G7QB 4PLKC 5E2WL 2FB4L 2E6JA 1HQRB 5FFLA 3LDBC 1MQKH 3QDME 1KBGH 5IWLC 3HLAA 3SKNB 1GJIA 2VDPL 1NCDL 3TA3D 4CBPA 4JGJA 1F6AA 3DWTA 1T2JA 2NXZB 3E3QE 1X7QA 1KIUA 4FRWA 4PLOB 4XCEB 4WGVB 1FORH 3C8DA 1RSFA 2HJKA 1T1WB 3QIBD 3WXVH 4H0HB 5FM5M 4GG6B 1BOGB 3BZEA 4NT6B 4QF1A 2VIRA 5IVZB 1FL3A 5GJSL 4MQTB 5BCAA 5F9WC 4ZYKB 3JVGC 3O11A 5C3TA 3RDTC 3KPRD 5J1AA 5M95B 2R15A 4NCDA 4BUGA 5H2BA 1MCOH 3LQZB 1CDGA 4UU9B 4K23L 4P2RB 1UG9A 3ZDZE 4HT1H 4OTXH 3I6KB 3ARGB 3KXFE 4Y5YB 2F54D 4UV7H 4G5ZH 3B5GA 1TJIH 1CIUA 3C2SA 3LKPB 4Y88A 1I9RH 1KJMA 4HBQA 5AYQA 4JZOA 5DJCB 1OQXA 3L3GA 3QULA 2VKWA 3LVEA 4G6AC 4JFQB 3R1GH 4CU6A 5EFIB 2BP3A 1EA9C 1MREL 1RUKL 3HTLX 1C16B 3LEXA 1CTOA 4FFYH 2G2RA 4PTTB 1I8LC 5DK2A 1A7QH 1YC8A 4JM4H 4PRPD 1AQKL 4MJ2A 1AKJA 4NCC2 3H7LA 3VFTB 5ELIA 2N56A 1AGEA 1RK0B 1M7IB 3OKKA 1I7RA 3TZVB 1JRHH 1GH7A 3BX7C 1WZKA 5CBAA 3SE8L 2Y4SA 1UB6A 1YJDL 1N4XL 5EU5A 2XN9B 3OQ3B 3QDGB 1KACB 2DLEA 4HW6A 5FYLL 3RAJH 4XX1G 3DROB 1BFVH 4XXCC 2ZUTA 2GJ6D 1CLOH 3HZVA 4UOW0 1UFUA 1DR9A 1A6UH 1E28B 5F1NA 1DE4A 4FFZH 1GOHA 5J11B 1FNEB 1T0NA 2ID5A 3I50L 5KSUA 4FXLA 4WI5A 4X6DA 1LEIB 4XPGL 3WUWG 1UACL 2I27N 2RQ8A 1NSNL 4NQEB 5F9JB 4U1MB 2YA2A 5C0AE 2YD9A 4HEPG 4IDJH 3CFJB 4Y4HB 4RMVA 3X3FL 1INQA 1IT9H 4KI5D 4JKLA 3LQMA 3GK8H 5HHXL 3ROOA 2FGWH 4MZ2A 2J5LB 1SEBB 1YMHB 3ARDA 4Z8FH 5E6ZA 4Z78B 5BXFB 4RAHA 2VR4A 4ZXBC 3UYRL 4ETQA 1PYWA 1SEQL 3ARUA 3ZE2E 4P57A 2HN7A 1MY5A 4WEBL 43C9A 4Z5RB 3FQNB 2OXGA 4OM1L 5T3XH 4JQIL 4LPWA 4JPVL 3ZDYF 2RCSL 2DMCA 3FZUD 3MLTA 3P9LA 4NQSB 5HI3D 1XH3B 5C7XL 5IVXE 4R2GC 4XWGL 5IQ9A 1DQQA 2A73A 4Q6IC 2CLZA 5B38B 1IAOA 4OFKA 3QFJB 4JFOB 4DFIA 4P5KB 4PB0H 3RUGF 2RIKA 4XCCL 1S78C 1EV2E 1UB5B 1HXMB 1IGML 1NUFA 4MNQE 4K3GA 4M6MH 4D9QE 2DMBA 4JM2C 1WK0A 2FH8A 3WHE0 5HDOA 4DQOL 4R3SB 1PZ5A 5ADOL 3ULSA 3KR3L 4PJFF 2ZJSH 1URLA 2SEBB 3MJ8A 2XA8L 3IDGA 1XGQA 3QQ9D 3TNNA 4POYA 2UVFA 2BC4A 1DL7H 4HIJB 3VGEA 4HSQA 4S0TD 5JW5B 4Y2DB 1T1ZB 2IAND 5IQ7H 1WBZA 3FMGH 4BH7B 1EDQA 1AY1L 5HYFA 3EOBA 3SKOA 4KI5F 2A6KA 1FFQA 3MV8E 5DT1H 1OGAE 3HPJA 1JGEA 5H94B 3GI9L 5JMRA 4WEUD 1X6LA 2YKLL 3EO1A 3BSZH 5J6GB 3QP3A 3MRIB 1CE1L 3V7AE 2NY1C 4GUPB 3WFCL 4KDWA 3LEYH 4XH2B 1JJUA 4NO2A 5LAXA 4GRLB 1X5KA 3B9AA 2EKSB 2XNAB 4NJ9L 3EOAA 3BP7B 2Q6WB 3QUYC 2O5YH 4JFFA 4O02L 1FH5L 5I1LB 3BESR 4GW4B 2E6QA 3D2UB 1N7ML 1QLFB 5BJTA 5L2KD 1MCWW 3KYKL 5IVOA 3LS5L 3B6SB 3O4LB 4WI8A 3EUUA 3ZKND 1SY6L 4GRMA 1JPTH 4HIIA 4ODWA 1T7WA 1G9EA 1V3JA 3DXAE 4LSTL 4U1SA 4NQDA 4PJHA 3DGGB 5ETUA 3FB6B 2OXHA 4PJGF 4I3SH 5TDOA 1A64A 1IEAA 2J1KA 2WUCH 4H26A 4ZO9A 1EGJA 4YHPB 3FRUA 1FAIL 1S7TA 3KWWA 4XMKH 3VXUD 5DRXA 2GUOB 3NCMA 5I74B 2YZ1A 2DIBA 5GGRB 2OR9H 4RBPH 1QHOA 3IDYC 4HHAA 5F6IC 4J7RA 1XGPB 1ZKAA 3TVMC 3OXRA 1XGYH 4G6KH 3HE7D 3MXVH 4ZPVA 3CXHK 4KROB 4XPTH 3QT2A 5GXBB 1A8JH 3SE3A 2YUZA 5J9PA 2AS5M 4CNIA 4EQ3A 4KJPC 2XFXB 4PJ7E 3GSNH 4QRSA 2IG2H 4P5MA 2VC2L 3QIWD 5D72L 1I9IL 2X44D 5T5NG 1DBKH 5INCB 5FKAB 4RGND 1ZT1B 4YEEA 4ZODA 4D9RE 3VRJA 4HK0B 5D1ZA 4A6YB 5E2VH 2VWEC 2WIMA 3KPPA 4U31A 1QHPA 3HI6L 4OZFG 1A02N 1Q72L 5DEFA 1LDPL 1BQLL 4NNPH 4EBQH 1A6PA 3BUTA 4Q9RH 1U8NB 3OKNB 4OZHA 4JQVA 4FTVA 4UB0L 1FNGB 4NQVB 5FA4A 4QHUB 2I5YL 5C0GA 3FT3A 4K71B 4R0LB 4WW2A 1MEXH 3VFOB 5K59E 2R4SH 1RIVH 3CU1A 1UZ8A 1N0XH 5DD5L 3WXWH 1EUTA 1A6VH 1WGOA 4ODHH 5FOBB 4NBZB 3WN5C 4PREA 1U9KA 2DQUH 5JIHA 1N3NB 5KN5B 3TM6A 3MUGA 4MJ6A 3QIBC 4U1GC 3T4YA 3TJEL 1CDBA 2ED9A 1YDPA 1R3IH 2IQAA 4QRRE 3D0LA 2VLRE 1U8PA 5F89A 2DI9A 3IETA 4GFTB 2KZ1B 1WBYB 4P2RD 3NFPA 1U41A 3VRLF 2VLJB 1NJ9B 1J0YA 3RWDA 3DV6A 5DZNA 3ARGD 3VFSB 1AO7E 1WC7A 5I8CA 2EIZA 4I2XB 1FYTE 4ONFH 3C6SA 3HNSH 1C12A 5GS0H 2FD6H 5I1IL 1F11B 3L9RB 5SV3A 4L8DB 2EDRA 4WI6A 4HXAL 3VA6A 4F2MA 2Q87A 3JV0A 3TO4A 4ZOBA 2OM5A 3CU7A 4QRQB 4OZIB 2FO4B 3PWNB 1EO8H 4AIZA 3O2DH 4FXKB 4K8RD 2ADIA 1J0HA 3F65A 4HGWA 2MKWA 5DJ8B 3MNVA 3MBEA 3VFNA 1CFQA 1EEUA 1YUHA 2GKIA 5C8JA 2JK5B 1YYLH 1MJJA 4DKFH 1FDLH 4GAJH 1RHHA 4GG6F 3MNZB 1ADQH 5E4EC 1QRNB 4WJ5A 1OAQL 4Y5XC 1MFEH 3QDGD 4H0GA 3MODH 9CGTA 1EXUA 4L9DA 3VH8B 4LK4A 3OXSA 3TJHD 4P59H 4F7MA 5L0QB 4X5WA 4G80B 1WTGT 4NQTA 3B8YA 4YHZL 5J56B 4HS3B 4WO4A 3RY6C 1ETZA 3VXSB 3I75B 3HC4L 4NQED 1S7QB 4X4XB 4C4KT 1TQCC 2E9WA 3C2AL 3G9VA 1I8MB 2ZUXA 3REVA 3VFWA 1LDSA 5D4QA 2ZOKA 2V7HA 1GZPB 3L1OH 2WIIB 2VDOL 3F6IA 4KI5C 5MI0B 4YK4C 4BFBD 3FO1A 3PQYB 1CG9A 1SMAA 5DJ6A 1KXVC 4LRNL 1RJYB 2X40A 1UCBH 2Z8WC 3DVIA 4J1UA 5E9DB 1PKQE 2PTTA 3T0XA 4DGIH 3QFJD 2JJTA 3MLRL 4GBXB 1CF8L 2EYSA 4LU5L 5HI3C 2E7MA 4FA8A 4L4VB 1X5HA 3BE1L 1CI5A 3VJ6A 3PF2A 3F7YA 1I1YA 1QSEB 3PHSA 5FGBA 2CUHA 4AEHH 2VN4A 4TULH 3KLAA 3T3MF 4D9LL 2DWEA 2X4OA 4IOSD 1X4XA 4LVEA 1JI2A 1W72L 1NFIB 2XWTB 3VXMA 5ALBH 4AM0B 1EFQA 3MC0A 1KT2A 1WZ1H 2ZKHH 4I18A 2IPTL 1XCTB 4Y2DD 1XIWB 3NACH 2CD0A 3QQ9C 4S10A 4W6YB 3RKPA 1JF6A 3H9SB 1CBVL 4UMGA 1GIGH 3QNXA 1DUZB 2V17L 2QR0B 4F57L 1M05A 3K81A 4MDJB 1WICA 4GXVL 1BFOB 4RFEB 2XRAL 3UBXI 1AGBA 2FIKB 4GRLD 3TWCL 1I1AD 4P4KA 2F8VA 4M61B 4ODSH 5B22A 3IKCB 1KJVA 4WHDA 3UTPD 2AJXH 5JNYB 2DQHL 5D1XB 3D2UD 3TIEB 3OKYA 1D9KA 1U0QA 1R5WA 3RGVA 2C3GA 2VXTH 1R0AL 5I2IB 3FB5A 5MENE 2AJVH 1P9MA 1C5DA 4UTBH 1MFDH 4I77L 3G5YA 5EDXA 1CGTA 3ZKNC 3GHBH 1F02I 1VGEL 3TFKD 2AGJL 1HE7A 3HRPA 5LG1A 3BN3B 3NBNA 5CGYD 5F7DB 3LRGA 2BVPB 3UTQA 3T0WA 1JZ8A 2LVCA 5I9QB 3P9MB 3PHOB 2VL4A 3MRGB 5IEHB 2Y7QB 3NN8A 5I1JL 3GBNL 5MP6H 4OFYA 4PP2B 4Y5VC 4R4BB 4NSKA 1CVRA 4NRYA 1TZIA 3IU3B 3QQ3A 3SBWA 4ESKA 2NTFA 3QNZA 4HF5H 4J2XA 3WNOA 5JW4R 5FO7B 1TDQA 4WUKL 1ZVSA 3ZKQD 3HE7C 1YN7B 3DBXB 1UA6L 3MOAL 2BVYA 4J6RL 3UTSA 1V7MH 1T0PB 4OIIH 1A6WL 2DM7A 3NIFE 4I0PB 3L3JA 3KXFB 4KKAC 3LCYA 1PLGL 4IOIA 3QDJE 5EN2A 4N0YH 4YHKL 3ZKXC 3S7GA 1CS6A 1XMWA 4MCZB 1QFUH 3L3HB 3QIWC 4UQ2B 1HINL 3ZL4H 5BRZE 4BSVA 3AREB 4RGNC 1HH9A 1OT2A 1Q9KB 3GNMH 3E6FA 1F8TH 1DP0A 1G0YR 4LCIH 1T2QL 3U46B 2UWEA 4NQUA 1QEWA 4EUPB 1UCTA 3BP5B 3CLEL 5SV4A 3DO7A 3QXDA 4TRPL 2F53A 4KV5F 1INDL 4S1RL 3DSFH 4ZD3H 3S97C 4OT1L 3S36L 1P4IL 2NY5C 5HGDA 3GMRB 5D2LE 4LBEB 4U33A 4YHYB 3WDIA 5F44A 3ECBB 1ZANH 3RWIB 5I16B 2JIXA 5KVEL 1PSKL 2A6JB 3VXPA 4YO0A 4PD4K 2WK2A 2NXZC 1JUFA 2P7TA 3QXAB 4ZSOE 4HEME 5EZJB 5CEZE 2EO1A 2V7NB 3HC3L 1RJZB 2NX5A 1AD9B 3GMPB 4NKMA 1Q9OA 4ZUTA 2ADJB 3MJ7A 1JV5A 2A9NL 4HIEA 3QPQD 2C5DC 5E7BA 2ZPKH 5BZDA 4FQHB 4HUNB 4H5SB 2XKUA 4PRIA 4LSUH 2VLJD 3GDBA 2AKRB 3IU4H 5CJXA 3O2DA 1CQYA 1NBYA 4I3RH 4PLJD 4LPVA 2H8PA 3HE6A 2J2ZA 3G5XA 3RWEB 1ACZA 3IDXH 4Z7OF 3QBTB 5GGQL 3CDGA 3ARGC 3MV01 1KTDB 4Y5YC 5JOPD 1PEWA 1VERA 5EB9A 1PX3A 1B4JL 3SKUD 3B4NA 4QHKI 2R2EB 5T5FH 2AERT 5IVXB 3BGMB 1T83A 2X2YA 3Q6GL 5I76A 3PWVA 2YEZB 4WIQA 1P84K 5ITBL 4ORZC 3TNMB 5FUZH 2GSGB 4GG8B 1UJ3A 4D8PA 2VITB 4MJIA 4IHOA 4K8RC 5IHUL 3VDCA 4MNQB 4OGYL 3T1FA 1QRND 1NBZA 4RCAA 2B5IB 2IH1A 4G8GA 1ZA6B 4JFXA 1FVDA 3NCBB 2VUYA 3UROR 3BKMH 1HH6A 1MJ7L 2X7LA 4OCYH 1S5HA 2DLFL 4LF3A 4X99B 1KIRA 2LU3A 2QL1A 4L3CA 5B39G 1GAFL 4AJ0A 1LO5A 1NMAH 1C08A 3KYNB 4MNHA 1K8DA 4AENA 1FLRH 3IJYA 3VXSD 3TJHC 3MV8B 5DUMH 2FRGP 4I9WD 5J11C 2BDNL 3IKKA 3ALWA 2R0KL 1NUDA 1KC5H 4APQB 2R29L 1IZKA 2FEEL 4M48L 3EYUL 1Z3GH 5HHPB 5EZLB 1JPGB 1CLYL 5I1EH 1BWWA 1FRGL 2AXFB 4MAYB 2MTPA 4AMKH 4Y4HC 4OZIF 1I4FB 3DV4A 3P77B 5ADPH 1PBYA 3OKEA 4HKZA 4FQIL 3C08H 2BHUA 4P23B 4PR5B 4AEEA 3MLPA 1CFNA 2DD8L 1F6FB 4NRZA 5E9DD 1YNKH 2F15A 4WI3A 2YZ8A 4QTIH 5KTEL 2XZCL 3NIDF 2R1XB 2ADGA 1VKXA 4OSUH 4K9EC 5FK9B 3HFMH 5E8OA 4L4VD 4PY8I 2DQJH 3DXAB 1W0WA 4BYHA 5AD0B 3FT4A 3S96B 3PV7A 3W9DB 1IAIM 5SWSA 3IAPA 2E27L 4IS6B 3UC0H 4U1IB 4E0RA 3MYJB 5C6TL 2JJVA 1XGTB 2YXMA 1NGYB 4QNPE 1A21A 1NFKA 1MH5A 3WFHA 1XIWD 2NQCA 1NC4A 3PWPB 3MA9L 4XZUA 4YHLH 3H42L 1E4XH 3TP4A 2Z4QB 3H9SD 4QTHB 1I8KA 5HD8D 3GI8L 1DEDA 4WU5B 3F5WA 4JLRA 4Y2DC 2H45A 3BN9D 1R3JB 5BV7H 2ZUVA 4PJ7B 2WBJA 5FM8A 5IB5A 5E00A 5D7LE 1IM3B 3SE4C 4TVPE 3GRWL 4YGVB 1S9VA 2YD5A 4UQ3B 4KRPB 1PG7W 4I0CC 1P7QB 4CW1A 3SDCB 5D5MA 5D93B 5C09A 5KAQG 5D1XD 3ABZA 3CVHB 1KSRA 4NKIH 5A2FA 1CD1B 1J7VR 2CDGA 1YEGL 4GRLC 2DIJA 1TJGH 1BMGA 1I1AC 2OYPA 2PW2B 4Z7QE 1DANT 3IDIA 1EEZA 5GRVL 1U93A 4M5YH 1LEGB 5DHYA 1NLBH 1CGVA 1G6RA 3T4AA 1NGXA 3HUJA 4EDXA 1IL1B 1LNUB 4C83A 4L4TA 3H9HA 1TVBA 3TIDB 3FQXA 3TFKC 5FDWA 2VN7A 2G60L 4OIAA 3C6LD 2V2TA 5CGYC 4JO4H 2FNBA 2YC1B 5IF0A 5I74C 3BOVA 1QQDB 3ELAT 1KIPA 5IMLB 3V52H 1OF2B 2VLRB 3LAFA 3THMH 1PJ9A 3C9NB 3AU1B 3CC5B 1KIQA 5JQHC 4KROC 4NUJA 4X7EC 1LMKA 1U92B 2D7TL 4NO5A 3FB8A 1AO7B 3SGDH 4I0PD 3KXFD 1FYTB 1M6OA 3BPOB 3DVNA 3MROA 4JRXA 2EO9A 3VH8G 3C09B 2DQEH 4WW1B 2KL6A 3ARED 1WBXB 5FYJE 4N8VG 5F1IB 4NP4L 4EN3B 4LSQL 4YE4L 5L2JB 1NGPL 2AJSH 3CUPB 3UBXB 3P0YL 1Z2KA 1P4LB 4L3AA 3M8OL 2BCKA 3QIUA 4QY8A 1RUAH 2P8PB 3ZTNL 4C4KO 1AR1D 4YPJA 1DN0B 4M93B 3ZKMD 15C8L 4K8RL 5EU4A 2VZVA 3MSPA 4RGOH 1FNLA 2P5WE 2FZ3B 5C2BH 3QCVL 1HNFA 5DVOA 1IE5A 3UJTH 3QUXB 4K71C 4R0LC 5A16B 1AXSB 4OLZL 4F7CA 3DVGB 4PRNA 4AEIL 2FJFB 4ZO7A 1YECH 5J89A 3HPLB 4LAJH 2CUIA 2HFEA 4R8WH 4XPFL 2A9MH 3MNWA 1L9NA 4EI5B 3ZDZF 4DVBB 5FECB 1A1NB 4NNYB 4M7ZB 5IR1B 2E6PA 2ZWLT 3EYOA 1LE5A 4DFHA 1GGCL 5MEQA 3H2WA 4KJYA 2XQBL 3CMGA 5CJQH 4FQLL 5DTFB 1V7NL 3QPQC 4N1HB 5FUOH 2VL5A 2QADB 3BT2L 2ZCKL 4JPIB 3S9DB 4ONHB 1Q0XL 1HDMA 4MCYA 4U1JA 3SGJC 3ISWA 4LHUB 3QUKA 4PLJC 2CGRH 3MR9B 2HWZL 1IBGH 2GTWA 3Q3GA 1PKQB 4LLMA 3NFSL 2CLRA 3VCLA 3VE0A 4WRLA 4H8WC 1T89C 1A9BB 4JKPL 4FS0A 4RAVA 1BECA 4MNQD 4XBGB 3O2WH 3KPNA 5DR5L 3GSUB 4D3CL 3DUSA 3RVXC 2X9YA 5JW4Q 4Q58C 3VFPB 3AAZA 4ODUB 4BQ6A 2GJJA 1MWAB 2VZSA 4ZS7H 3IDUA 2Y36H 3OPZL 4GOSA 4PJIE 1XF3A 3TA3A 3X14A 1LO2L 2DMKA 3MV8D 5TQ2L 5CIPB 3PHQB 1MVUA 2A6DB 5L0QC 3VFRB 2FSEA 4NNXB 5FYJU 4K94C 4QXGL 5AWNH 2VAAA 3IS0X 3KYAA 3ESVF 2ITDB 2MWCA 4APQD 1CL7H 4LL9A 1YEEL 3ZE2F 2WV3A 3VXOB 4G8EA 4JO1L 1AXTL 4Z7NE 4IM8A 4Z7UA 1K2DB 5IVXF 2H3NB 4HG4K 4IOFD 5MHSE 4P23D 4LDEB 1D5MA 1QFWL 4XT1C 3B5TA 1EK3A 1V5JA 3HN3A 3RKDD 4WWID 4NKOA 4HWBH 3LS4H 5MI0C 4NQDE 5DXWA 1LE9B 4PJHE 4KKNA 4OKVA 4MXWH 3MLWL 2AJZB 4MWFB 5DJAB 3DXAD 3MV7A 3U9PL 1J1PL 4JCMA 3MLXH 2Y06L 4OLXL 5FGRA 3GIZL 3FTGB 1SVZA 4GBXC 4U0RB 3VD5A 4JFPB 1IILE 4OV6F 3B9DA 2VDNL 4HCRL 2X1QA 5E6YA 3MXWL 4PJ9B 2KQMA 1D5XA 2DBJA 4MS8C 3N1FC 5D6DA 5CCKL 2PR4H 5E2UL 1YEKH 1SQ2N 1FZJB 1OHQA 3BD3A 2ZUQB 1ZGLP 3PWPD 1QLEH 3UTTA 1EFXB 3EDJA 3CX2A 2QQKL 5DMYA 2ARJB 1QBLH 1XIWC 4PV8A 4AQ1B 5CEYB 3L5HA 1JGLH 2XPGB 1K5NB 4XAWH 1S7XA 5LQBL 5HD8C 4X5XB 3P0VH 4NM4L 3BN9C 3MO1A 4QCIA 4KRPD 3L7FA 1ITCA 4HWNA 1P7QD 3B3IB 3NABH 4LNVA 1ZLWK 2W59A 4OZFA 4JJ5A 4X0KA 5LBSL 1KOAA 1X5JA 1OLZA 5BRZB 3IXTA 4M8QB 3GMOB 4OZHE 1T1XB 5MERB 4ELMA 4OI9A 4WDIA 1S7SA 1I8IB 4CVZA 1QVOB 4XTRD 4A6YL 2BFVH 2BRRH 4JG1H 4PB9H 1F3DH 4JFHD 5D1XC 1MHCA 1RMFL 1JZ6A 1E4WL 2VXSH 1HWHB 5IT2L 3VDBA 3VWKB 1IEHA 3T2OA 1F58L 4HUKB 4Y19E 1T6WA 4S1QL 5DSCA 4RMQA 4U1LB 1FZOB 1JL8A 2IBZX 2DQTL 3E3QC 4X8JA 2IH3A 1VFBA 5I75B 2EE6A 1MCPH 5EU3A 1YY9D 2PYFB 3GJEB 3DI2B 3IJHB 2D31B 4O58H 2Y72A 4PJ7F 4HPOH 4TSBL 2AQ2A 4QHKJ 1I3UA 5AZ2L 3TBWA 5I9QC 2E5EA 4X4YB 5HJ3B 5KZCD 5KVDH 1NKOA 2VLRD 2DWDA 1DBAH 2CIIB 1ZSDB 2WZPD 32C2B 2GHWB 4WTXA 5JMOC 3CGTA 2DYPB 1CFSB 1CXFA 4C58B 1CFVL 4LASL 1RZ8A 5HHNB 1KB5H 5DJXB 1G7PA 1AO7D 1BZ7B 2XOTA 2EDOA 1GGUA 1AI1L 3MLZH 2IANA 4LQFL 5KSAB 2HT2D 2A74A 2YPKB 4XWOD 3HS0B 3RHWK 3RNKA 4I0PC 4KU1A 2P46B 4EN3D 4OD1H 3O0RH 2BHYA 5I71B 1I9JH 1KN2H 4PG2C 4PJBE 2VE6A 5DK0A 1KEML 3AREC 1I85A 4TNVF 1U91B 5K59F 2C1PA 4UT6L 4X9FA 1HOCA 4QYOB 2LAGB 4H8WL 4RMSA 3SGKC 5AUMA 3HZKA 5D8JL 3MGTA 3V0VA 5FCUL 5MEPA 2Z93B 3SKMA 2AEIT 5IJVB 5TH2B 3U0WL 1AR1C 3KS0J 3NZHH 1IGCL 4LIQH 3ZKMC 4BJLA 3WLBA 2F5AL 4JY4B 3QCTH 4EI6A 5L2KA 1N2RB 2BVEA 3BP6A 5DRZB 3U1SH 4YHYC 1FFNB 5D70H 1FG2A 5GGVL 2D7QA 4MJ4A 5T3XE 4L8SA 1E27B 4PGCB 4LCCA 4EI5D 1RU9L 5CEXA 1X5GA 5AZEL 3PV6A 3QFDA 4Y1AA 3OTTA 4JN1H 4H1LH 1VGKB 1CU4L 4J3OC 4K94L 4YBLB 4PY8J 4NUGL 3UPAA 4JB9L 2OJEB 5AYUL 1A9EB 5F6HI 3RL1A 3KG5A 3HZYA 2DAVA 2QADD 3CIQA 3G6AB 1VDGA 5DD6A 1MCBA 2NLJB 5GJSH 5EC1B 1HYRC 3G6DL 1WISA 4XPBL 1NAMB 1QFHA 4LHUD 2Z92B 3D85B 3BXNA 3MLUL 4YEFA 4XP1L 1K6QL 1E6JL 3DUHA 4G3YL 3REWA 5IM7A 4R7NB 4KVNH 4K23H 4M1DL 2P42B 5IMMA 3ZDXF 3BH8A 3P4MB 4GW1A 5DGQA 2OMNA 1T7XA 4DN3H 1JF1B 4GKNB 3K8KA 1AGCB 1QBBA 1YPZA 2W60B 4GKZA 5GGSA 1MRFL 3W9EA 3FB7B 1OARL 4MGXA 4CDHA 3HMWL 1U8HB 4QXTA 1JPFA 2B5IC 5HGBB 5F7HA 3IB4A 2PTVA 1KCRL 1DEEB 1YZZA 4Z76B 3CNKA 3WUZA 1IQDA 4PRBA 4QT5A 3QHFH 3U30B 4LSSL 5F9AC 3SJVB 3O8XD 5IW1A 2CSPA 1X5ZA 2BVOB 1QD0A 4UDTB 4IMKC 4P2OA 3C5JA 5HYJA 1RVFL 4HWBA 3QNYA 2H1PL 3TBSA 4RX4D 2CRMA 3OR7B 5FYLH 4IRJB 5JHLH 4QOKB 3U0PB 4HUUB 3C5ZB 4XCNA 2CIKB 3D69B 5DEGB 3G6JA 3EO0A 1HHHB 1I1RA 4APQC 1IC5H 4M6OL 5T1DH 4J4PA 1X5FA 3UCRA 4L9LA 5EA0L 4MAYC 5DLML 1UACH 1DQTA 3QEGL 5D2NA 1X4ZA 1ZLUK 3PXHA 3HLAB 5TE6H 4UINL 1EAJA 3X12A 1F6AB 4P23C 2EIBA 3PGCA 1X7QB 2XZQL 1BQHG 4WFGE 2OJZL 4OZGE 4P46A 2HJKB 4MA3A 3V4VL 2N7BA 2MCPH 3BZEB 1IKNA 5ESQA 4QF1B 4JQIH 2VIRB 4PJ9D 4JPVH 1FL3B 4OLVL 5EO1A 3IF1A 5F1KC 5C7XH 3O11B 2HRLA 3LY6A 4MDIA 3MLVL 3D39D 4CL7A 4LRIC 5T3ZD 4ODXA 3GSOA 4FN0A 5J1AB 5KOVC 2MJWA 3LD8B 2EYTA 5H2BB 4LPXA 4QLRA 2BHZA 1IGMH 2IAMA 1YYML 3MOBH 3UTSE 4HIHA 4WFED 4UUJA 5KVMC 4DTGH 2X1PA 4QXUH 4AT6A 4X7SL 4DKAA 5IBTH 3KR3H 3W2DL 5KANI 1TNMA 1KJMB 2VXVL 5E2TL 3L3GB 3QULB 1H3WM 2VDKL 1DFBL 4LEXH 5A2JH 2E9IA 5KW9H 2EDHA 5BRZD 1MSPA 2UWEE 3WO3B 3LEXB 2LQRA 1P7KA 2G2RB 3RA7H 4KRPC 5DK2B 5HHOA 1QSFD 4L29A 6CGTA 2JLLA 5DC9B 4NFDA 1AKJB 3CVIH 3SDCC 3WFBL 4ODTH 5D93C 1AGEB 2OS7A 3OKKB 1R3LA 1I7RB 4XBEL 1VFAB 2OLDA 2OQJA 4XTRC 4P5TA 3VWKD 2VDMH 5CBAB 1SYSA 3O6KH 4TVSa 1UB6B 4HUVA 4DCQA 2CMRL 5JO5A 1I7ZA 3OG6B 1HCVA 1DQLL 4M1GL 2PW1A 2VLME 3HZVB 3CH8A 1ZTXL 2XZAL 3EJZD 4LHUG 4D94A 2QBWA 3X3GL 5C0IA 4UAOB 4PJDA 5F1NB 1DE4B 1SBBA 2X41A 1KB5A 1T0NB 4PJ5E 5CZVL 5KSUB 4X6DB 1ZS8A 3WS6C 2ZUYA 4JVWA 4LSTH 2R1YA 2A83A 4ORGA 1KCUL 1RZFL 5GRUL 1INQB 3NIFF 1YY9C 4WENB 4AG4H 1SM3L 3ROOB 1NGQL 3E2HB 3ILQD 4R90L 4UIMA 4XAKD 3ARDB 2DYPD 2YRLA 5L8KB 4ETQB 1PYWB 1F4WL 4YNYA 4P57B 2HN7B 4UIKL 1AGDA 3A6CH 4UZGA 3AB0B 43C9B 4OIBA 5KSAD 1OAZL 2O61A 3I9GH 1TJHL 2K9UA 4O4YH 3L5WA 3P9LB 3FFCD 3MLTB 4MZ3A 4GAGL 3TYGL 2CJUL 1DQQB 2A73B 5IQ9B 2CLZB 3BPOC 3OGCA 1IAOB 2V2WA 2ZCHL 4KGLA 3C09C 2HT2C 4KC3B 5BO1L 3MBXL 1OCWH 4XWOC 3SKJH 1EEYA 4MJIE 1QR1A 2J6EA 4EN3C 1YEIH 3UJIH 4G8GE 2VB5A 1PZ5B 3ULSB 3AM8C 3TPUA 2Q1EA 3MJ8B 2FO1A 3IDGB 4LLYA 1XGQB 3TNNB 2A0LD 2P49B 2BC4B 2R0ZL 3VGDA 4GXUM 2YD8A 2H32H 4M93C 4YDVA 4H1LA 5JW3L 1UWEL 4M3KB 2JCCA 1WBZB 4NWUL 3V9FA 5K9JH 4KTDL 4UB0H 3OKLA 1ZEAL 3EOBB 4LSPH 5B39A 3IDJA 3QUXC 3SKOB 2A6KB 2I5YH 3HPJB 1JGEB 4L1HA 4O2EA 5F8RC 5JIPA 3EO1B 3SGEH 4XNQA 5DMKA 3QB7C 4YXLL 4XVUD 4WI7A 4KRMB 3FN9A 5DD5H 4NO2B 5LAXB 4EI5C 1OP3K 3TT1L 4M7ZC 3RZCA 4LP5A 3DRQA 3EOAB 1U8KA 3MLSL 3O3AA 3PGFL 1QPPA 4JFFB 3MZTA 2ED8A 4YR6A 5BJTB 4GMTH 4JQXC 4TSCL 3RTQA 3MTRA 3U2SA 4YHMH 3D85D 2JJSC 2YR3A 4NGHL 2QADC 4G9DA 4NJAL 4GRMB 5ID1A 4HIIB 4Q2ZA 1DTUA 5D7SH 4ODWB 1V3MA 2VDRL 1FN4A 1S3KH 4U1SB 4NQDB 4PJHB 3D9AL 5I8EA 5ETUB 1F90H 3P11L 1WWWX 2VZ3A 5BOPA 3WSQH 5TDOB 5J06A 4H26B 3U4BL 3BGFB 3FRUB 1S7TB 3CPLA 1XR8A 3KWWB 5IFAH 2FHCA 2WUBH 5DRXB 1PGRB 2EKJA 1WAAF 4CU8A 1GGYA 4JDVA 4HC1L 5ERWA 4HHAB 1BBJA 1AIFA 1OGTA 1SHMA 2P24A 1MPAL 3OXRB 4P3CL 2GY5A 4Z95H 3UO1L 4ZPVB 4F33A 1MCQA 1O7SA 4OI7A 5J9PB 3EOTH 3GKWL 4FP8L 4CNIB 4K2UH 4R4FH 4XC1L 4QRSB 3SJVD 1D6VL 3MUY1 4P5MB 4EZMA 4EKXA 4XP9L 3VFVA 3TYFA 1EERB 1OAQH 2B20A 3VRJB 35C8H 2ZOLA 2K3TA 4U49A 3MV11 3QEQE 5D1ZB 4TVPD 2J88L 3SN6N 6FABL 4X4MA 5I18H 3GEWB 5D5ME 5C09E 5JQ6L 3KPPB 4QOKD 1ZLWH 1FFPA 3SO3B 3C5ZD 5DQDL 4XI5D 4PJCA 1HQ4A 5DEFB 1IGFL 4J12A 4B41A 5LWYL 4OZHB 3RY5A 4FTVB 4TUJA 4CVWA 5FA4B 3HC4H 3QDHA 3MJ6A 2HP4A 4U4BA 3BKJL 5C0GB 3FT3B 4OQTA 4YUEH 1O5DT 3LPWA 1RIUH 4WUUE 3HZMA 2OK0H 4WW2B 2X4UA 2DIAA 3CVHL 5CD5D 3BFOA 1UT9A 5KSVA 5CSZA 1PFCA 3CCHA 3HUJE 3QUMH 1KPVA 4L4TE 1UZ8B 4Z0BH 5F7FA 4EXKA 3FN0H 3V6ZA 4PREB 3ZHKA 4OGAC 2KPNA 1FNSL 1BLNA 3B83A 3MUGB 4MJ6B 4LPTA 2JELL 4NQCA 3VG0H 4U0RC 1BVLA 3T4YB 4G7YH 3WJJC 1YEHH 2PTUA 1YDPB 2IQAB 4PJ9C 3D0LB 2Q8BL 1LEKA 1U8PB 3K80A 5F89B 5DMIL 3JWDH 3IETB 4XPHL 4Y16A 2H6PA 3BDXA 1Q8MA 2ZUQC 3P4NA 2D0FA 3NFPB 3W82A 1JMXA 4LKXA 3RWDB 4ZS6D 3DV6B 4KJWD 1WC7B 5I8CB 1JWSA 2EIZB 1ONQA 3C6SB 5TDNA 1C12B 1G7JA 2DQFB 4OD3H 3QI9D 1I3GL 4F2MB 2ZUSA 5DQ9A 3TO4B 5ANME 3RRQA 4M5ZL 4Z7QF 5F96H 3U4EA 4WHYG 4AIZB 1R24A 1UYWL 4WEMB 5FYJD 2ADIB 2DLGA 3VFNB 4HGWB 2IQ9H 4XPAH 3MNVB 3MBEB 1CFQB 1AKJD 5AG8A 1TQBB 1YUHB 5IBUB 3KJ4B 5C8JB 1CR9L 4OCSL 5DUPH 3WYRA 1MJJB 2FBJH 1ZVYA 4XVJL 4R4ND 3GHEL 2HKHL 1SVCP 1RHHB 2N7AA 4PG9A 2XRAH 4WJ5B 2MHAA 5E70A 4XX1E 3T09A 4LAQH 3NPSB 1EXUB 5F6HJ 4UILL 3OXSB 3VWKC 4L8BA 4TNWK 4F7EA 3VD9A 4F7MB 1XF4A 1A7OH 5EORL 4HV8A 5JPNA 4TOYL 4WO4B 1JTPA 5C92A 2OZ4L 1EO7A 1ETZB 1SJVA 1B6UA 3EJZC 1WWCA 4N9GA 4ALAL 4XRCA 5I75C 3LV3A 1VGEH 2AGJH 1K4CB 4P3WA 3VXRA 3PL6D 3REVB 2E9JA 3VFWB 1I3VA 1BGXH 2EEAA 2DJUA 2ZOKB 3GBMH 3DX9A 3OB8A 1GSMA 3ILQC 3FO1B 4KZDH 1CG9B 2NY2B 5DJ6B 5I1JH 4OM0L 1VB9A 5A2LH 1F13A 4YDKH 1ZK9A 1MCNA 5L6YL 1A1OB 4J1UB 2D4FA 4OLUL 1FZKA 2PTTB 2Q8AL 2WBKA 5KSAC 4KDTA 3LN4A 1Y6NR 2UY7A 2H32A 3MV9A 2EYSB 3N50A 5GHWL 5TPWL 4BSWA 5F97E 3MOAH 3WFDH 1H5BA 3VJ6B 1NMBH 4MD5A 4F37K 5SWZA 3F7YB 4MQ7A 1I1YB 4PJAA 2D03H 5KJRL 1J88A 3KLAB 3MZGB 2DWEB 1C5CH 2X4OB 5I71C 4OI8A 1PLGH 3VXMB 3HNVL 4JFZL 5EIIA 1KT2B 4X6DF 1FVCA 2RBLA 4I18B 4TUKL 4DOHE 5CLWA 2ZSWA 2B0SL 2OTUA 5C3LD 1IC4L 1B0RA 3ARFA 2A0LC 4DUVA 4EDWH 1TETL 2VRAA 3M45A 4ODVH 1YNTA 2CRYA 2EDBA 4PLNC 2KKQA 3QNXB 3NMEA 3I84A 4TRPH 1M05B 1U3HA 2R0WL 1MWAL 1UWGL 4FABL 1H8SA 4MD0A 2VQUA 4JY5L 3S36H 1BVKA 5HI5D 3MFGB 1AGBB 5CFHA 2OSLA 2V5YA 2DTMH 1NCAL 1PSKH 4P4KB 4EXPX 4Z7UE 2XKNA 5DQJA 2ICWJ 3INUH 4PGBA 1FIEA 2PO6D 5F7LB 4JFFD 4FOMA 4X80H 1KJVB 4XVUC 3C6LA 4YBLC 5CMAA 3ZE0E 4GSDL 5HHQA 5FB8A 2AK1H 3HC3H 1D9KB 3HC0A 1R5WB 3RGVB 4ZTOL 3QG6A 4GT7A 2DDQH 1UGNA 4CGTA 3FB5B 3ZT5A 2HTLD 1ZLUH 2YPLA 1C5DB 2M26A 1JBJA 3P40A 4NQDD 3KPTA 1Z9LA 3G5YB 1E6OH 4AEFA 3STZA 1U95A 4MAUH 3SE9H 4BQ8A 3ZT6A 2B2XL 4YDJA 3O3BA 4N90E 3UTQB 2DQDL 5I30H 1CCZA 2EXWC 4I1NB 3NN8B 3S37L 3LKRB 4NSKB 4NN6B 4NRYB 1TZIB 5IG7A 3EW3B 3LPGA 3QQ3B 4AIXA 1PQZA 3KJ6H 1D5IH 2NTFB 3QNZB 1ZVSB 1KLFA 3BKYH 3UTSB