5GS0C

Crystal structure of the complex of tlr3 and bi-specific diabody
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
DIVLTQPPSVSVAPGQTARISCSGDNIGSYYVHWYQQKPGQAPVLVIYEDSERPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSSYDDPNFQVFGGGTKLTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 3
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 19
structure length 107
sequence length 107
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs0C00
2ZUVA 3MRDA 1X4ZA 4MNHB 1IILE 2G5RA 2VIRA 1AKJD 1U36A 2R8SL 4RGNE 3LRHA 5F8RC 5IK3A 2RFXB 3HRZB 5JLZA 4FN0A 1R3JB 1G1YA 1E28B 2AABH 3ULUF 4S11A 3E6FB 3NIGF 4MCZB 3V4UH 5JQHC 2O93L 1YEKL 5DFVC 2HT4D 5C0CE 3EOAB 1GL4B 4MS8C 1R3IH 2FJFB 1D5IL 1WT5C 4O2EA 1PAMA 2H1PH 1FNEB 3MCKB 2HN7B 4NHUA 3QQ4A 4A6YA 5IMLA 3C8HA 3C08L 1LD9A 3V9FA 1D6VL 3HNSL 1S7XA 4U6VH 4WFGD 1XAUA 5F7LB 2VWEE 2XKNB 3I02B 4HJ0C 1YEIH 2IFFH 5FK9B 3ROLB 4DKEH 5ITFA 1F6FB 4KUZH 4GXVL 2G75A 4PRPB 3E3QE 1MUJB 4F7CB 4PRHE 2W9DH 4XPTH 4QHUA 5SX4H 1EO7A 4FTVB 5GGUA 2BVPA 4L4TE 4G6MH 4X7DC 5T3ZH 2DQGL 3DOSA 5I8OH 4IIQA 3KPQB 1QSFE 5GSRA 1I3UA 5DJ6B 3ZKNC 1HDMA 1AQKL 4IJ3B 4YC2C 1TQBB 4U2ZA 5I17A 3QDMB 3MCG1 4DK6A 5ALBH 2Q1EA 4WFHE 2F53E 3PXJA 2OI9B 3IDIA 5I16A 1FC2D 3EBAA 2YN3A 4NFDA 2NW3A 3OBAA 4H20L 3WFDH 2BSTB 5KS9E 3TBSA 1QBAA 2VDOH 2PXYA 4UIMB 1QHOA 1IEBB 3FB6A 3MJ9L 5BRZA 3OWEA 5TDPB 2BDNH 3U4AA 1I1AC 1UXWA 1LDPL 4JPKL 1VSCA 4APQB 2LE9A 4O51B 3KPMB 4C4KO 3PNWB 1GSMA 1YPZF 1B6DA 4HZLB 3ULUE 5D7LE 1PEZA 3O6ML 4E41D 3MRMA 5TQ2H 3P11L 1L7IL 1Z6JT 5D1ZC 2VXVH 4MB5A 4RMVA 1JZ6A 5E8NB 4D0CB 3S34H 3U0TA 3BKJH 1BZ7A 4S1SL 3L9RB 5EBMA 4HD9A 1AD9B 5HHVL 9CGTA 2WW8A 3BJ91 3B6SA 3H7LA 3BISA 4JZOB 2X4RA 4IBLT 5L6YH 3RGVA 1A6UL 2HRPH 4PLJC 5FXCH 1R3LA 1N6QH 1Q1JL 2VLKE 4IRZL 3ZTNH 2IANA 3F7YA 5DK0B 2GJZA 2X7LB 2XN9D 1CDCA 1MCIA 1SMOA 1BIHA 3L95B 4B7IA 1NFDB 2JIXD 1DLFH 2YPKA 2OTUB 1DBMH 1OTTC 4W4OA 3FRPG 4UAOB 2QSVA 1D9KC 2AK1H 3QUZA 4QXUL 1ZLWK 1KJ3H 1ZHLA 4N68A 2NX5E 1R6VA 1T04B 4N8PA 1AO7D 1K5NB 4NOFA 3WXVH 1MJUH 4QGYA 3KPRA 4EN3D 1KJVA 4I0KA 2DOCA 5B3JF 3ES6B 5C0IA 3CZFA 5L2JA 1OT2A 4MD5A 2E3VA 4UU9B 3V6ZB 3V6FB 2AEPH 5SWZA 1J05A 3L5WB 5IB3A 1I4FA 1A6ZB 1HIMH 1QUNA 5F7YC 2OSLB 1EAPB 1LO3H 5T5NG 3MLTA 4QGTA 1BP3B 5TJWK 3W39B 1J0IA 1YPZE 4OB5L 5DS8B 2IQAA 1P4BH 1UWEH 3IFOB 4OCMC 2L0DA 1MHEA 3D1MC 5D1XA 4PJ9B 1MCWW 5LCVH 1IAIL 3QRFM 1P4IH 3UBXA 2ARJB 5DRNB 3GB7B 2NTSP 2VXSH 1M6OA 4NQEB 4OUUB 4MAYC 3NZHH 4N9GA 4EVNA 1IM9A 1KIPA 3MRGB 5CJQL 3RAJH 5IKCA 3DO3A 3VFOB 4K7PH 4Y0GA 1NAML 1DANT 1GGUA 5F7DB 4XMKL 2FHBA 3CK0H 5KJRH 5GGQH 2C3HA 4FXGA 1A3RH 4JFED 5F9OH 1T1ZA 5I1JL 2NY4B 2V2XA 3OR6B 4LQ1A 4XP4H 1AJ7H 2YEZA 1A6AB 3BD5A 1KCRL 2HFEB 4KDWA 3Q5TA 4Z7QF 4CNIB 4P9HC 1YN7A 4ZUVB 3KYKL 1NGPH 4EUPG 3GSUB 3L3IA 1U6AL 1IQDA 5D9SB 1ROWA 1QKZH 5B3JE 1NCCL 2F5AL 3MNZB 4H8WH 1KF9B 1NGZB 3Q3GB 5EWIH 2WQRA 3WKMH 1NGQH 3HG1D 4L1HA 1WV7T 3U7WH 3BKYL 5ITBH 2C3VA 3T4AA 4KC3B 4XPHL 1GPOH 4KKLD 4WO4A 3TN0B 4JB9L 3RWIB 2CDFA 4E42B 2AXFB 1CDJA 3L3KB 4MJ5B 3BZEB 3RNKB 4O02H 1WSST 5E4IA 1C08A 5JW4N 3MRPB 5HHME 3QIBD 5HDOA 1UXSA 4X4XA 2E9WA 3MRIA 2VLRA 2BY1A 3ALPA 2ICWJ 5CZXD 3NCFB 3D25B 3WLWD 1L7TH 2NR6D 5CLTA 3LAFA 3O4LD 3FQTA 3VH8B 4MLSA 4MQXC 1TVHB 4XH2B 2V7HB 4FP8L 5FA3A 2OP4H 1JPFB 4WHYH 3CSBA 5IVNA 4MA7L 5C08D 2CJUH 2VC2L 2ZSWB 3I6KB 4XBGA 4U1HB 3LKRA 2C9AA 4U1NA 2KKQA 3U4EB 1KXTB 3UJIH 1I75A 1JZ5A 5JNYB 4Y16B 1N59A 1EK3A 3ULVH 5DJ0A 3NACL 5F9AC 3EFFB 2IAMC 2NXZB 1ZGLP 4X80L 2BERA 4FQXD 1D5MA 3QG6B 2E7BA 2BNQB 4R3SA 5DMIL 1E6JH 4FRWA 4Z7QE 3HI5H 1DUYB 3D3VD 4OV5B 4NQDB 2IG2L 1NGYA 4TOYL 4NQCB 1BQLH 4PJEF 4YUEL 1NC4B 4OCWL 3L3DB 2NYYC 2PW1B 1EO8H 3KPNA 1EAJA 5KTEL 1KIQB 4MAUH 3MGAA 4WV1C 1G9MH 4LLMB 4HAFA 1RVFH 3LSOB 4PRDB 2AJZA 2IMMA 3QEQB 4GRWE 2GSIB 4H1LA 2D7QA 4LCCC 5ANMA 2UYLA 5EBWA 2HKHH 5DEFA 4J8RB 4G80A 5J57B 2BSRB 3FN0L 3HAEH 5FUCE 1OT1A 4J7RA 3RIFK 4P46B 1ACYH 1Q0XL 2ZWLT 3HTLX 3HB3D 2XFXB 2VXQL 5BS0B 5CCKL 1IAOA 1ES0A 5JHDB 5E2UL 1PSKL 2R0KL 4DGVH 3KXFD 4PRBB 5ISZE 4MDJB 2XWTA 2ATPA 4ELKA 3NFSH 1FZOB 1CXLA 2J8OA 4QOKD 4ELMF 3ESUF 3TIEA 3EYSL 4WI3A 4NQUA 5IT2L 5BO1L 3PP4H 1D6EA 4JRYE 2EYSB 1J7VR 2JJWA 4NUGL 2A74A 4LGRB 4PUBH 3BKML 4X8XA 4J3VA 4NN7B 1JHKH 3CXHJ 4QNPF 3W5MA 3RVWC 1FZJA 4LAJH 5T1LD 2P45B 1IL1A 2DQIH 3CFBB 2NY5H 4I3SH 4M4PA 1AGDA 2ENYA 4I0PA 1CDGA 4HUUA 1DEEA 4LIQH 3UJJL 3VU2A 1TZHB 3OKOB 3MACH 4NQTA 1KBGL 4JDTH 4DN3L 1JWSB 1RUQH 4C56D 4ODHL 1JMXA 5A16B 4U7MA 1TQBC 1AGBB 3HFML 4KH2A 4ZUUB 4OCLC 4G8IA 4XNUL 1A0QH 3GM0A 5GS3A 5CAYB 4Q2ZA 4BFGA 5IQ7H 3LS5L 1NAMB 2OI9C 4PGJA 5E4EB 4LCUA 2CR6A 3AM8A 4CBPA 5C07B 5HYSG 4E5XB 1WFTA 4YDIL 3W39A 5C6PB 4I3RL 4J3OC 5SWSD 3UBXI 4UBDD 5HBBA 4MA1B 2YMXL 4APQC 2RR3A 2QADD 1U9KA 1RZJH 1S9WB 5FYKL 4GRLA 3ZKMD 4OLUH 4JGMA 2V5TA 1F02I 3O3DA 5BZWB 4RIRB 1UA6H 3B9KA 4OUUA 3RWCB 2EDQA 1SJXA 2ORBH 3U2SB 4QYOA 2DMBA 5CMAA 1F4WL 3S4SG 3TGXA 4ELME 3BESR 5A40E 4M1GL 4JDZA 2ZKHH 4NC0B 3IDJB 1A5FL 5HYQA 4XHJD 4TNWK 2C1OB 4FZ8H 4OQTH 5IFAL 3BE1H 4NKIL 4DZ8B 1YEFL 1JZ2A 3SJVA 4LGSB 3QPXL 3O2VL 5IQ9A 4KK8D 1W0WB 3VJ6B 2D31B 4QNPE 4ZNCD 1ZGLA 1HNFA 3PWPD 3QUXA 3WNKA 3ARQA 1R0AH 2XA3A 2HG5B 1KENL 1Y6MR 1HINL 1KIRB 3CC5A 4YH6A 3V0VA 4LPUA 2DTMH 3WN5B 4P59H 2OK0L 2FLRT 5DD6A 1KSRA 1MCEA 5CGYD 4UAOC 3IDMB 1FNAA 4Q6IB 4AMKL 1D7FA 5ABDE 2CDEB 4N0YH 4WU7B 1G7PB 5I8KH 4ZO9A 5CD3B 4HS3B 1CD1A 1H3WM 4FFYH 4GAYB 1R5WA 1T4KA 1Y6KR 5EB9A 3C60B 2FD6L 3OJMB 2XOTA 4BA8A 3AY4C 1AFVH 4P2OB 2V5MA 4OT1H 1YMMD 5FUOH 4OGYH 5IOPA 1WF5A 1XCTA 1W8NA 4IS6B 3GI8L 3KLSA 5E1AB 1GGIL 5FEBA 5I1HH 2C1PA 3ZT7A 1A7NL 3E0GA 4PJIB 3VFRB 4OLEA 4LK4A 5KANI 4JPIB 1KCLA 1TNMA 3OAZH 4X99A 4LEXL 2UUDK 1H0DA 2RB8A 4HBCL 3W2DH 2CGRH 4PJ9C 4TSBL 4JY5L 4UTBH 1JBJA 1F3DH 5DQ9B 3O2WL 1HXMB 5EO1B 3TYFA 3HR5A 4OZFH 2V6HA 4Q0XH 3WO3B 4Q74A 3O3AA 1IGCL 3CXHK 4YPJA 3V5DB 2VYRE 1RSFA 2PETA 3CU1A 4M7JL 3OGCA 2CUHA 4X6DB 3RBGA 4ZDHA 1CI5A 1KNOB 3P0VH 2ZUSA 1TETL 3H9HA 2GFBB 4P3DB 4F7EA 4XNMA 1QRNA 3GSWA 1KG0B 5GRUH 1NMBH 2UWEA 1INQB 2DLFH 4NZTL 4PTUB 1UVQB 3F62A 4JJ5A 3BPCA 3VFMA 2NY4C 3C5SB 3OJ2C 5I1AA 1EEZB 5FM4A 3X17A 4YZFF 3VXUA 1FRGH 3O6KL 1U91A 2AQ2A 2D7NA 3TYGL 2OL3B 4HPYH 4P5KA 4HXBH 2GY5A 3NA9L 4XX1G 2NY3B 3O3BA 3AC0A 3EHBC 4HUXA 4R2GC 5IV2B 5DDHA 2VLMD 3DV6A 1HSBB 3FONB 1RD6A 4LHQB 4Q97A 2WINB 3MLVH 3HE6A 5DSCB 1TZIA 1J8KA 3JV4A 1SMAA 3SDDA 3RIFF 4HDIA 2EIZA 5HYJB 5E08H 4HJJL 4NKOA 3SGJC 1WTGT 1FDLH 2Q7YA 5I1LA 5E2WH 4JDVB 4Z7NF 1WVZA 5CJ8A 4M1CD 1EFXB 3ALWA 4OQTA 5FKPA 4JLRA 3TA3B 4OM0L 2I9LA 4UINL 4KJWD 3D39A 2C7UA 4G42B 5IVOA 2AK4B 3TN0C 4MDIA 3X3FL 4F7TB 3MV7E 5J9PB 4CDHA 4HK0B 4OV6F 3G5XA 1HHKB 1G6RL 1GRWA 4D3CL 3EGSB 5IUSA 2G60H 2VSDA 1U8NB 5FF6A 4JEGB 4L8DB 2YPVL 5MEQB 4ONHB 3LN9A 4JKLA 3HI1B 4TULH 3W82A 1NGWB 1OD7A 4WUKL 5KG9B 3DURA 4JKMA 4KZEH 3HZKA 3S97C 2R9HC 3PWLA 5B39B 1ZA6B 3F7VB 1JK8B 1ZVSB 4NO2B 3G5VB 2XQYG 4QRRA 3VWJD 1FIGH 4OCXH 4BQCA 4Y16C 2DQHH 3IETA 1KLFA 1OGAA 4HLZH 4LVEA 4AZ8A 2VJXA 2NXZC 1YEJL 3PWNA 4M8VA 4WY7L 1H3PH 4YZFE 1ITCA 1FYTD 1X5XA 4M9PA 4OLVL 4M93B 4JR9H 4KRPB 4ZS7H 3Q6GL 3D0VA 5D7IA 2Z0BA 5JQ6H 3QFJA 4XBEH 3U6RB 5JR1L 1IC7H 3B3IA 2I5YL 4P49A 2ATKB 4MS8D 2D4DA 4ZUTB 4OZFA 4Z7NE 3GSNB 1IVLA 1K9TA 4UV7H 5EFIB 1LDSA 4L3ED 1NLDL 4D9RE 5D70L 2HJKB 4PRAA 4PJCF 3QNXB 2XQBL 1OAUL 5FA4B 2EC9U 4HJ0D 1CZ8H 3CFJA 4P46C 4Q9CA 5EU7C 3GK8H 3W0WA 1P53A 4Z7OF 4ZUWB 4YX2H 4W70A 4B50A 1OW0C 5E2TL 2B7DT 3QIUA 3G9AB 4WNQB 3IYLW 3BMWA 1WC7B 4MJIE 3EOBB 4NQVA 1H5BB 1RUML 4JFQB 3L7EB 2FX8H 1HQ4B 2EXWC 3O41B 5EA0H 1FLTX 4NT6A 1IBGL 5DHXB 4WHCA 1JGDA 3MC0A 1IGIH 1Q9WB 3RTQB 3HMXL 1JV5A 4G6KH 4WGWB 2PYEA 1ZANH 3TBVA 2IPTH 1MCWM 4RMSA 1OPGL 1QBBA 3MLXH 2H26B 3BN9C 1HHGA 2D03L 4KDTA 1DQMH 3KYNB 1WAAA 2JF1A 5F89B 3GEWB 3EO0B 1CE1H 5DT1H 1QVOB 5DUPH 5D71H 1FORL 1I8IB 2R29H 3MOBH 4BH8B 1A1MB 1WBYA 1EGJA 3QUKA 3S36H 3P30L 5FYLD 2FYYA 1MI5E 3WL9B 2L4OA 5D1ZD 1RULH 2XZZA 3MFGB 1IAIM 4TQEH 1Q9LB 3O45B 1J1XH 1YECH 1ORQB 2XICA 5AAWA 5DRZA 1U58A 1ZT1B 5E4EC 3AS3A 4M62L 4Z76A 4YHZL 1RZFH 3RGHA 3TT1L 3BSZH 4PJCE 4YPGA 1A9EB 5D7JA 3ULUL 4R96A 3NFNA 3P9MB 3K3QA 4MA1C 4U6HA 3QHTC 4Z7OE 3O0RL 5E6IA 3QNYB 3LKPB 4V2CB 1P84J 2MHAA 2Z92A 1NUNB 2D9QB 1I7TA 3PWUB 5HYSB 4YXLH 4ODUB 5T33L 1XIWA 3WKNA 1CD9B 3WFEH 5TE6H 1U8JB 1DQJA 1MFCL 1T6WA 4I2XA 5FM8A 4QRQA 1S9XB 3FT3B 1KG0A 1JRHH 3ZE2F 2DM7A 4GAJL 4WEUD 2W65A 1N6VA 1MHPH 2BVUA 3QCTL 3MZTA 2CK0H 4N0FB 5IROC 3S96A 2M1KA 2PO6A 3S4SB 1BQUA 1JFQH 3DTXB 4Z7WA 4WFGE 2WBJA 4BH7A 3G08B 1TTFA 3FO2A 3W11D 2JK5B 2IADB 3WN5C 4X9BA 4F57H 3ARFD 3K2UL 5TDOB 4DN4L 3CVHH 4Q6IC 1MF2H 1UM6H 3SKOB 5BRZD 3QO1B 4HPOH 3QISA 3BXNA 2KH2B 3MGOB 3MLYH 3X3GH 2H32H 1XF2A 5CILL 5L2KE 1VDGA 3C60C 1FZMB 2JLLA 4EUPA 1I1FA 2X2YA 3VFTA 5E03A 5K9KB 4P2OC 1DE4A 1CICC 1KB5H 3UX9B 4NRYB 3KWWB 4MWFB 1CFNB 1TCRA 3DIFA 3VXQA 4Z5RB 2VAAA 3MUY1 1HSAB 3MUGA 1ZS8A 1FAIL 4X7EC 4MSWB 2ZCKL 4JFFA 1G7IA 1SVZA 1D5XA 1P9MC 5IEHA 1M05B 1T21B 5DZOA 3DVGB 2P8MA 1N26A 4X5WA 4EDWL 3P3YA 5CEYB 3FTGA 5J11B 2FATH 1D5ZA 1TENA 4E41E 1FIEA 1T1XB 2BOBA 4PJHB 3ZE2E 1XGUA 5D5MF 1X4YA 4Y4KA 3L3HB 2IQ9H 4P9MH 3V5HA 1B0GA 4RGOL 4MD0B 4X8JB 3DI2B 1F58H 5I1IL 1CT8B 4OI9A 1S7VA 2BCKB 4P5TB 4YJZL 3UEZA 5BZDA 3OKEA 1MCOH 2PW2B 2WUBH 5I76B 3N1QC 5C0CB 4ZPVA 5GS2H 4ERSH 1J1PH 1NBYB 2DQFA 5IFJB 2ADIA 3QPQD 2R23B 3IU4H 1ADQA 4D94A 4EI6B 1XZ0B 3MFFA 1WITA 4A2LA 1IM3A 3NZ8A 4GAGH 1HCVA 4KKCD 5AYUL 2GUOB 4XC1H 2XN9E 4LSQH 4X98B 4R0LA 4PLOB 4P57A 4XZUA 3BP4B 2NPLX 4U1IB 1U8HA 2QQKL 4B0MM 4NZRH 4JFXB 3EYOA 4DW2H 1T7WA 1F3JA 5HVGB 3OX8A 1NSNH 2J3SA 1AO7E 1T0NA 4QWWC 4HIJB 3I3EA 2G9HA 4PY8I 5DLMH 2JJSC 3LB6C 1U41A 4WHTB 3MA9L 3TA3C 5JXAL 3BGMB 1CE6B 3JV6A 3FQWB 1ZA3A 1UCTA 4LEOB 2KDGA 2HFGH 1QSFB 5C0BA 4KPHL 5IHZB 1XGQA 1QNZL 4OF6A 4JAMB 2F8OA 3ILPA 2F53B 4PG9A 1XH3A 3U48A 3QWQB 1CU4L 3F12A 25C8L 3JV0A 2H2PC 2B8OT 5KN5B 3LEYL 5KS9B 4G8GB 1X6NA 43CAB 3CVHA 1R3HB 1G7QB 3BIKB 3L3OA 5EUOF 1F6AB 4L8SB 1OSPL 3TEUA 4OSUH 1CFQA 3GJFH 3MR9B 3JWDH 4NKQB 3RWJB 2GSGA 1OF2B 5MERA 2NY7L 3DUUB 3GKWL 2VKXA 4OLZL 5DVMA 4TUKH 4JO2H 1KB5A 4QRPE 1F4YL 1G0YR 2FX7L 1K8IB 3RUGA 4RAHA 3T2NH 2SEBA 2E7HA 4GLRH 3G6JE 1TVDA 3V5KB 4F2MB 2HH0H 1VPOL 1WZ1L 2X9WA 3ZTJG 4G6FB 3N0PB 4WW2F 4M93C 4KRPC 2FX9H 4X6CF 2P24A 4J3UA 3DX8A 3FB7A 1B9ZA 5KAQF 5KVGL 4LASL 1PFCA 2VLKB 2QL1A 1F11A 3CX5J 1XGPA 4HIEB 4LIQE 3ARRA 1UWXH 5ERWB 2X4TA 3UAJC 1AD0B 4JFDB 3RVTD 1GGTA 3QA3B 4GO6B 3OKLA 4JRXA 5DC4B 5AZ2H 5IHBA 2E8ZA 1GIGH 4K94H 4PBVC 3HG1E 4AQOA 1ULVA 1MVUB 2MQ0A 2NX5B 3UTTE 4QT5B 3QAZC 4HLJA 4PJ7A 1FNSL 3EYUL 4PRPD 4P9HH 1FFOB 2PYFB 3SPVA 3V0WH 4M7KL 2D7OA 4CL7A 5JW5A 5BV7B 1DLHA 1EXUA 1VGEH 5AD0B 3FB5A 3LEXB 5L8KB 4HH8A 1H8SA 3DHMA 4N1HB 2Q3ZA 3OAUH 3WIIL 1KLUB 5D96B 4X9FA 3LS4L 4HT1L 4YXKH 2O5ZH 43C9B 4XXDB 2DLGA 5T1KA 4TSAL 3BMVA 5CBAB 2ZG3A 5DMJB 5JPNB 2P5EB 3G08A 3RTQC 3O4LE 2K7QA 1L9NA 4AL8H 5CZVH 1LEIB 4L4JA 1EX0A 1MPAH 2RCSL 1DEDA 3HMWH 5C08E 3ZO0A 3AGVA 4I48A 1W72H 1YN6A 4L3CA 5IB4B 3TO4A 5TFSL 4N5UA 5BOZG 2ZPKL 3ZHKA 2QLVB 1T1WA 4RFOL 2AV7A 3HA0A 2BOCB 2X42A 2Z31B 1KTRL 2VITB 2ZCLH 3U0WH 1CDBA 4X6CE 3D3VE 4J4PA 1QO3A 4Y8AA 2Q86A 2XZCL 1ND0A 1MY7A 1YQ2A 3WD5H 4K3DH 2AJSL 4NQSA 2ZG1A 1CLYH 2EDBA 2DI7A 3C5ZB 3ECBA 1JHTA 4PPTA 5EIIA 1K4CA 3OB0K 3QXWA 4NNPL 3AFLA 4JFPB 1FG9C 4NJ9H 3VFWB 1FLRH 3VRLF 1CK0L 1JCKA 2QKIA 4GMSL 4NGHH 3BHBB 4WHYG 4JFOA 1JPGA 4I0CC 5IVZA 4HGKC 3UTQB 5IJVA 1AY1H 4Q6YA 5HGHA 4XVSH 2N7AA 3SDCB 3QQNA 4OZHB 3QXUA 3W9DA 3IU3B 1NCTA 3IVKB 4M48H 5T1MB 5L88H 2AXGB 5CEYA 1N0XH 4IMKA 3GHBH 1LP9F 4UUJB 1NUGA 3PGCA 1ZVHA 3NFPB 3OKMB 4G6JL 3LKSB 1QYGL 1DN0A 1MEXL 3S36X 1BEYH 3JV5A 4N8CL 5GHWL 5FO9B 3ARBB 4M5ZL 1FZKA 1V7NH 1WWAX 4O4YL 1RZGA 4YBHA 4IM8A 4LKCB 2EDNA 4PJDF 4QOKE 1WBXB 3SDYL 3IDGB 1L6XA 1J5OL 1GZQB 2I9TB 3BDYL 4AH2A 4X4ZA 2FEEL 5HGGS 4JREB 4X7FC 5DRXA 5GRJH 2DTSA 4JO3L 5I30H 5IMMB 1CVRA 2R2HB 3M17A 3HZYA 5FECB 4QHNB 4NDMB 1C5DB 4PB9L 3RDTA 1BLNA 4FQHB 5EBGA 1VFAA 1NDMA 5KSAA 1JL8A 1U3ZA 4AG4L 1JRHI 3K8KA 15C8L 4HIHB 3ARXA 5C0FA 5DQJB 2R4RL 4HWBL 4PJ9D 2C4FT 1OL0A 3E8UL 3PDGA 3QXAB 5FCUH 1DBAH 1ZT4B 3IDXL 2CSPA 4WI8A 3H7BB 3AXLA 4PREA 4X6EB 6FABL 4DOHB 2P42B 2FO4B 3DX6B 3H9SE 4C56E 3QEUA 3AMLA 3B9KD 4NQED 4OGXL 4TPRL 4XWOC 5DJXA 4JHWL 1B4JH 4YDLC 2FGWH 3NPSB 2A6JA 4KHXL 3SOBL 1U42A 2E9BA 4IRSA 4N0UB 2F9BT 5K9QG 4PTTA 4D9LH 3SDXF 3NCJL 1QLRA 5DZLA 5SWSE 3SJVD 4FXLA 4GMTH 2ADFH 3QUYB 4GRWB 3ZDXF 4M6OL 5HI3C 5HHXH 1DVFB 4ZQKB 4TRPL 4U1MA 1DBBL 1FVCB 1YEHL 5J11C 1JI1A 4YHIA 2H6PB 5LGKA 3TNMA 4QRTA 2WANA 1DSFL 1MCHA 4I18B 4BELD 4MCYB 4PJDE 3H3PH 4N0CC 4OD3L 4CW1A 3P9WB 4ZFGL 5FGRA 3RA7H 3HE7B 2MNUA 3DXAA 3L7FB 3L3GB 4FXKB 3MXVH 4P5TC 4K3GA 5DD0H 2LU3A 1KCUH 2CIKB 2CXGA 4JG0H 2R0LL 2Y7QB 2BNUA 4FZEL 5C0JA 1K85A 2Y1VA 5FGBC 3MX0A 2D7TL 4DGIH 2W9LA 3V95A 3AS0A 5HGBB 1RUPH 3DRTA 3FB8A 5B38G 3PWPE 1YNKL 5CJXC 3QRGH 2DAVA 4XPGL 3TN0D 4D9QD 3THML 1F90H 5I66A 5BJTA 1NMCB 3AU1B 4Y19A 2GKIA 3QDGE 5IR1B 3LZFL 1OAQL 4LRNH 1IGFH 2VDQL 4MMXC 4CVZB 1LO0L 2DQUH 5A2LH 1CR9L 3IGAA 5TGBB 2DIBA 2G2RA 1AP2A 2BX5A 5E5UB 3MLRH 4E0RB 2H2SD 4RISH 1OP3K 1S3KL 1ZLVH 2XA8H 3SE8H 3DI3B 4PJBA 3E3QC 1BOGA 5FFLA 4KI1A 3U82B 4R4BA 1AQDB 3L5XH 4ZUSA 4Z7UE 3RWHA 3MRBA 1NFKA 1YMME 1JHLL 1SEQH 4ODVH 1Q8MA 3SDXE 4ETQA 5I1DB 3BEWA 5C9JB 4TSCH 1X3DA 2BXYA 4XCNA 4HWZA 2NXZD 2NTFA 2Y5EA 5CHNA 3AROA 3ZDXE 3I9GL 2BNQD 3TV3L 4QF1A 1NLBL 2EYTB 4HZAA 3H6JA 1WIPA 4HBQA 3VFVB 4LRIA 4OAWB 3LMJH 3V4UL 4IMLA 4LLWB 4X6BA 4NQCD 1Q38A 1M7IB 4F7MA 4IHOB 2DD8H 4UOW1 5FHAL 1INEH 5TE4L 1R3IL 5EBLB 4FABH 2FB4H 4L8SC 3NABH 5HPMA 5F7WC 1N5AB 3IF1B 2AKRB 2YD7A 2AERT 4R9HA 4XGZB 5DVOA 4LCWA 1L0QA 2KL6A 3ULUC 2AW2A 1S7RB 1OTSC 5F3HB 1IGYA 3MXWH 1PX4A 1P7QA 2B20A 2N56A 4S1DD 3KJ6H 3SDDD 5JOPD 5DURB 3NAAL 2IPKA 4FQJH 2A9ML 3D69B 5EOTB 3RVVC 4KY1H 4Q9QL 4F3FA 2VDKH 2W0PA 3KPOA 2P5WA 4YDVB 4LHUG 2P8PB 3VRIA 3VXME 1IFHH 4LSPH 1A47A 5F1IB 3D39D 1HEZA 5T3XH 4FA8A 5DQDL 2OS7A 1YQVH 2VLME 2ITDA 5INCB 5E99L 1OCWL 1ZSDA 5GXBB 3JUYA 2NY6B 3X12A 3I3BA 3ZT5A 5EIQA 7FABH 3DBXB 3ZYOA 4OLYL 4RFEB 2X4PB 5HHNA 4KTDL 2R8SH 3REWA 5JORB 1NKRA 2DIJA 1QSEA 2WZPD 1DJSA 5C09A 1FV1A 2DDQL 4PJFF 2XACC 1A3QA 1GVIA 4HKBB 1YEKH 3BN9D 2KQMA 3EYVB 4TTDD 4ZPTB 4YFEA 3VDBA 4HWUA 4QRRD 5C0GA 1A4KA 1P4LA 1D5IH 5EZLB 5BV7C 3BZDA 1P7KA 2AV1B 4PJGE 3HUJA 1OGAD 3DWTA 3QI9A 2WLZA 4Z7VA 3HNSH 1CGUA 2AJVL 5D96C 5IB1B 4HUVB 3TBWA 1RJYB 3LOWA 3U7AA 2VLJA 5F72S 4LFHG 2DN7A 3A6CL 4GXVH 1NBZB 3BH8B 4GUPB 4XVUC 2GCYA 3RJQB 5GGRB 3X13A 1JNJA 5J0BA 4ODWA 3TM6A 4XCEB 1BD2B 2YPLA 4UQ2B 2DYPB 2R2BA 5TH2A 3MBEB 5EU6A 5J13B 2DQGH 4HKXB 3E6HA 2AVGA 5FB8A 1TXKA 3TPUB 1ZV5A 4WJ5B 1AQKH 2Z31C 3J7HA 1FYTE 1NJ9A 2ZUUA 4CN6A 1DBML 4S2SB 5E8OA 4PJAF 1W0VA 4G8EB 4NN6B 4Y2OA 5BVPL 4QY8B 3W0WD 5KBNC 3N85L 5F3BB 1QA9A 3RPIB 4H20H 4JQIL 4LVHB 3C5ZC 5J12B 3C6LA 4OZ4B 3ARTA 5CEXB 2VKWA 2L7JA 1BOYA 5IJKC 3MJ9H 3BDBA 5IBLC 3SEPA 3IDUA 3PXHA 4ZOCA 1LDPH 4JPKH 3MRJA 1U93B 2WP3O 1W8OA 4I4WB 4FG6D 3RU8L 1T5WB 5IIEA 5HVWA 2VDNL 1PJ9A 4L3EE 5C2BL 3T65A 4LKXB 4PJFE 1V8HA 3SDCC 3O6MH 2JTDA 2ZOKB 4JFZH 3WUZA 3PGFL 2V2WA 1PW3A 2EDEA 3P11H 5A2FA 4L8CA 5CWSA 1KEGL 1RFDL 2LTQB 4KK5C 1VA9A 3U9UA 3KLDA 3ARBC 3DO7B 4S1SH 2YHGA 1U3HB 1OSZB 5HHVH 4GBXA 1TJGL 3GMPB 2X9XA 5CGMA 1JZ3A 4NO0A 3BN3B 5GS1A 1HOCA 4ZSOB 4CU7A 3C5JB 3TVMA 1A6UH 3EYFB 4LGPB 2P43B 1Q1JH 3IJYB 3B8YA 4IRZH 4PV8B 3PABA 3N1GC 2E9IA 1C7SA 3BD3A 3VWKB 1KEML 4JREC 4Y4FA 5GRZA 4XC3L 1AGEB 1XCQA 5SWQA 1J12A 2KUTA 5GS0C 4IDLA 4MVBC 3CK0L 4QXUH 1A3RL 3QT2A 3QFDB 4K23L 5IM7A 3BT2L 12E8L 4AENB 4CMHB 5JXEA 5D7JD 4P4RA 4BK4A 2P48B 2P7TA 4PJAE 4G7YL 4R4ND 5EU5A 3MLZL 3LKNA 4Z18A 1AGFA 3DGGA 1A7QL 4WVRA 4F9PC 4FFWC 5IVXF 3BPOB 5FYLE 1J0YA 1XGRA 1S8DA 1XF4B 3ARGA 4Z77B 5F9DC 3H0TB 2EE2A 2I60H 4IRJB 3NPSC 3MV8A 3WKML 4OB5H 4POZD 1RHHB 1BBJB 4H25A 4KGLA 1IAIH 4U1SA 1X5HA 5IWLA 4Y1AA 4LLYA 2ESVA 2XKUA 3QUYC 3FFCA 1JPST 4S1QH 4LCIL 1DVFC 2Y6SD 4O02L 4WI7A 3ZLQC 3AS1A 3HS0B 1E4XL 4RAUA 2NY3D 1QZ1A 3PIQB 5CJQH 3UDWC 1DUZA 1QQDA 4K8RC 3QJFB 4I18C 4RQQA 4K07A 4GKSA 4LBEA 4Z0XA 2E6JA 1I8MB 1L7TL 1NAMH 4JG1H 3T8XA 3RHWF 1S9YA 1LK3L 4Y2DA 2Q76A 5HYJD 3A6BL 3HE7C 1KPRB 5I1JH 2CLVB 2ICES 1P69B 3FO1B 2J8UB 1EFXD 1C12B 4PYGA 2VMFA 2A6DB 2BFVL 1KCRH 2HRLA 4LLUB 3WS3B 5HI5C 1KXVC 3MOAL 4MJIB 2H9GB 4L29A 3KYKH 4O2FB 1OHQA 3NOIA 4ETYA 2XWJB 3MV9A 2ZSVB 3PDOB 4JZNA 1GGBL 5E70A 1U6AH 2C3WA 3CDCA 2NY1D 1E6JL 3CH1B 3WDIA 2HVJA 1NCCH 2F5AH 1KULA 2FBJL 3Q48A 3RL1A 1XGYH 1T22B 1U95B 1BQSA 1KCSL 2H2PD 5BRZE 5IVXE 1F97A 1PKOA 3G5YB 1Z9SA 3BKYH 1Q9KA 3MO1A 1I7RA 1RZ8B 3B2UD 3N06B 4XPHH 2C26A 1HQRB 1FO0L 3OKNA 3V2AR 3OL2A 1Z9LA 4I3GA 4LCYB 3UCRA 1KTLB 1IGML 3MNVB 5F7FA 4GG6B 2Z4QB 4Z78B 2X4UA 3VD3A 4NCC2 1XR9B 3S35L 4JHZA 5GGTA 1XF3B 4UNUA 3C09B 3SCMA 4FP8H 4HMCA 5DI8B 4PJCB 4MA7H 4WUUB 5KSBF 1MOEA 4Y88A 5M95B 4U6YB 3MLPA 3NACH 3FQNA 4CN1A 1L6ZA 1YNTB 2VN4A 4X80H 3IJSA 1JWMB 3LN4A 1AKJB 3UAJD 2X70A 1LO2L 1KACB 5DMIH 4PGBA 4NPYA 2DWDB 3MRNB 1X5IA 2EC8A 3NN8B 4EEEA 3LRSA 5IGXL 2IG2H 1MCPL 4TOYH 1Q72L 4PY7A 5ID0B 3MJ7A 3U36A 2NY5L 4I3SL 4OCWH 5KTEH 1LEKA 3CNKA 4QHMB 2BNRA 4LIQL 3KPPB 4PJ8A 1F4XL 2E7MA 5C0BD 2DM2A 2P8LB 1UGNA 4JDTL 2RQ8A 4O9HL 5HYIA 1NFIA 3ZZ1A 2FHFA 4OCRL 3OG6B 4YHPA 3UYPA 3FN0H 3T0EB 2NY6C 1UFUA 4U1LA 3IFPA 1ZHBB 1MQKL 4J12A 1S7SB 4JHAH 5CCKH 2VXQH 1R24A 5DYOB 2CIIB 1F2QA 1HYRC 3V6BR 5IW1B 5E2UH 3KYMB 1PSKH 2R0KH 3CDGA 4H5SA 5MI0B 5EPMB 1CIDA 1UADC 3OR7A 2OL3H 5DHYB 1FN4A 1RZJL 4HJGA 3EYSH 4OLUL 5IT2H 1MJJB 1T2XA 3TC9A 2NZ9C 3SE3A 1A9BA 5F44A 3LKQA 4NUGH 5KSBE 2JCCA 1IE5A 3BKMH 3ROOB 3NMEA 1QTYT 5I2IA 4P2YA 5DJDA 1JYVA 4XVJL 3D2UB 5DJ8A 1MAKA 2B39A 3RWDA 5ILTL 3DROA 3LN5B 3D0LA 3MGTB 2HTLC 1YYML 3UJJH 5D2LB 4OUOA 4JN2A 3GFUA 1R0AL 3MBEC 4XB8A 3MUHL 1KBGH 4Y89A 1H3VA 5J13C 1I1CA 4HC1L 4MZ2A 3KJ4B 4ODHH 1V3LA 3MQIA 3EDEA 4HHAB 3HFMH 5DHVB 1AGCB 1OARL 3LS5H 4WCYL 3BRGC 4ZD3L 1JGEB 5ESAB 2XY2A 4LVHC 4YDIH 5J12C 1EEUA 4LARL 1N6UA 4I3RH 1Y18B 3Q2CA 1EEQA 1JNNL 1B0RB 2GYSA 1OP5H 3S37L 1QPPA 4U1GB 3BP5B 4OKDA 4UQ3A 3OQ3B 2JIXB 4OIIL 4X5XA 3WIFA 4OZIA 3HLAA 5DGRA 4WU5B 2K1MA 3PJSA 1J0ZA 3Q6FB 1F4WH 2IBZX 4JQXA 3QH3B 3DVNA 3QUMA 1EHLL 1MQ8A 4M1GH 5M7QA 1WBZB 1A5FH 1TTUA 4OF0A 4PRPE 2LTQC 4AQ1B 3HZVB 3FZUC 5IFAH 4NKIH 1U3HC 3KAAA 1YEFH 4L8BA 1G1CA 5KSUB 3QPXH 3O2VH 3O6FA 1ZK9A 5J6GB 4XCCL 3RWFB 3FO1A 4CVXA 4JZJA 2GW5A 5J8OA 4YNYA 3GSNH 1FO0B 3QBTB 2F19L 4P48A 3WJLA 1CCZA 2X4NA 3GSRB 4PRNB 1MWAL 1KENH 4MJ2A 4TNVF 1HINH 2VL5A 3QDME 3TIDB 3VWKC 1S7QB 3FO9B 5GIRB 3WXWL 4EDXB 1IC1A 4Y5YA 4AMKH 1MAML 4R97B 4YHOL 2W60A 1IT9L 3MRLB 1ZTXL 3RVUC 3W9EB 5T5FL 5IF0A 4OZGB 5JO5B 2DI9A 5I1KL 3TPKA 1T7XA 4CMHC 5ANME 5B38A 4DFHA 2FD6H 3OAZK 3RBSA 1QEWA 3PQYA 3O11B 3B8SA 5C86A 1CFSB 1CGVA 3LD8C 2VZUA 1DTUA 1Y6NR 2EE3A 3GI8H 4HF5L 5AWNH 4HEME 3BPOC 1GGIH 3CSYB 3DETD 3G6JB 1A7NH 2X4SB 5D6DC 1KN4L 4JFEB 5EDXA 3V8CA 3CMOL 4V1DA 4IRJC 1JGLL 1PKQA 4LEXH 1UYWL 4P5TD 1XR9A 4HBCH 3LV3B 2A73A 1HH6A 3PHOB 5A2IH 4TSBH 4YFDB 4JY5H 1A1OB 4Z9KB 4OLWH 4FQQB 5J89A 3JTSA 2AEWA 3VGGA 3DMMA 2MWCA 4RRPG 3BAEL 5C8JA 5BQ7B 2GTWA 1IGCH 3FQRA 1DFBL 3QDJA 2V7NA 4K7FB 5FO7B 4LDEB 5FKAA 4XTRD 2VDML 3MRHA 1TETH 3C8KA 3RDTD 5C6WH 4JHBA 4P5MB 4G9FA 4HAGA 5E0QA 5MENB 3G9VA 4J2XA 1Q94B 4YGAB 1Q9OB 5I1GL 3AS2A 5TDNB 4LVNC 3IJHA 1IAII 1P1ZB 2IBGA 2B4CL 3O6KH 3QJHB 2J8HA 2LVEA 4ODXA 1ZOXA 3NA9H 3QIBB 4PGCB 1U8QB 3O6LL 3D87B 3VE0A 3IAPA 3IXAB 5FDYA 3QDAA 3D18A 1Z5LA 1VEOA 1OGTB 2FR4B 4QHLA 4EI5A 4HCRL 4HJJH 1KJ2L 3STLB 3OKDB 2D3VA 2GAZA 4LHUA 4PR5A 5SX5K 1EERB 1X5JA 2GJ6A 1NEZB 3KDMB 3WHE0 3DX7A 4K9EL 4QCIA 4G8GD 4OM0H 1JUFA 1X5LA 2E6PA 4TYUA 4UINH 4BKLA 5EZIL 4FQXB 3MRFB 2YUZA 1FGNL 3X3FH 4NQEE 1N2RA 5DD3L 1VFBA 4FQLL 1S7TB 1HI6A 2YOCA 4D3CH 3EZJB 1SEBA 6CGTA 5HGAB 1JYNA 5DJYA 2YPVH 3RQ3A 4WUKH 5J1TC 5FYJD 3R06B 4NBXB 3BEVB 3SJVE 5BXFA 3C09C 4G6FD 2YZ8A 5HDLA 5F7EL 1TFHA 1YZZA 5ICYB 5I15H 5L8JB 3VXRA 3PUCA 5L7XL 3SY0A 2F54A 5LJYH 1A6PA 1I8LC 4IOFC 1T7VA 5LQBH 2MFNA 3FCTA 1YEJH 4WY7H 1FFNB 4NFBA 1IEAB 3O3EA 3VA6A 4JFDD 3GMMA 5E8EB 4UT7L 5F9JA 1BJMA 2CKBB 3KXFB 1YY8B 4OLVH 4KMLB 4M6NL 1UB6A 2CDGB 1NCNA 2HT4C 2P1YA 3CFKA 3Q6GH 4QOKB 2A6KA 4WFFD 3JWNC 1UQSB 5FUZL 1R5VA 3PHQB 2I5YH 4Y7MA 4D9QE 2VABB 1S7WB 3DJ9A 4K71B 1QBLL 4UT6H 4M4RA 2ZJSH 1NLDH 2EO1A 5D70H 4CMMA 2YD2A 1U3YA 1G7MB 3T0EC 2Y9RT 5K9QI 1FCGA 1OAUH 3BUTA 4TQEL 3BZ4A 3P4OB 1TIUA 3MRQB 4LP5A 1YECL 3OF6D 4F7PB 5IMOB 3CLFL 1OTUC 2J4WL 5DJCA 3PL6A 4O5LL 1RZFL 3P73B 1R5IB 4XVUD 2O61A 4XPFL 3EIFA 5EU4B 3U0PA 1FL6B 5E2TH 5MI0C 1T7ZA 5H2BB 1N0LA 3LY6A 1BGXL 3CFDB 4L9LB 3ZKXB 3LDBB 3VI3F 3QP3A 2CRIA 4NQXB 2OXHA 3MSPA 4JY4B 4XP6L 2A0LD 2BNQE 5I8CB 1IBGH 1EHNA 4EKXA 3WHXB 5A3ID 4ZNEA 1ORSA 4PJXA 3HMXH 3BQUA 3GSQA 4GW4A 2P5WD 3BD4A 4NQCE 4NRZA 4GS7B 5GGRY 1G7HB 4K2UL 1I8KA 2EYRA 1OPGH 2PTTA 2D03H 3OXSB 1MCFA 5KZCD 4BUHA 4PBWD 3KLHD 3MLSL 5CP7A 1GAFL 2R69L 1FORH 5ESVB 2MCG1 3UTSB 5DWUL 1T2JA 1IKNA 1G6RA 2Z91B 1PZ5B 3F7PC 2A2QT 4OTXL 3P30H 5EC1A 1LNUB 5DVNA 3KJ4C 4PJ5A 3NCYS 2GT9B 3CZJA 3ULSA 1JE6A 1ERNA 3MYJB 3SKMA 1RUKL 2XTJB 3ISWA 4J1UB 5C0ND 4DFIA 4MB3A 4KK5D 1MF2L 8FABB 5JHDE 5LXGH 3D39E 2C4FU 3H42L 4EBQH 4M62H 1NEUA 4YHZH 3TT1H 4KROB 4MXWL 3VXSA 1K6QH 5JIIA 2E7CA 2N7BA 5TE7L 2NZIA 2A77L 3ULUH 3QR2A 3HCVB 3EO1B 3ZYJA 2D9CA 5F7HA 5FDWB 5DJZB 4U1GC 1C5CL 4MJ6B 5ACMA 3N1MC 1D5BA 3O0RH 2MPAL 1GC1C 5DUML 1KPUB 1MHCA 2YD6A 1FNHA 1YDPA 2BXZA 5E6ZA 3RZCB 5C9KA 3BFOA 3LH2H 5T33H 5LBSH 3ZSSA 4P2RB 5GS0D 4LOUD 4WI9A 2O26U 5ICZB 1LE9A 3QO0B 4TUOB 1MFCH 2HFTA 3ORJA 3MLUL 1JNHA 4EN3C 3MJ8A 1JN6A 4GAJH 4QRRE 4Z7UB 3HC0B 3D85A 3QCTH 4FFVD 2DQEL 2W1NA 1OGAE 5EU3B 3U1SH 3WJJC 4N1CA 4FFWD 1EEYA 2IQ9L 1SJHA 1NL0L 1BVZA 5IG7B 3WLBB 1CGWA 5I18L 3BO8A 4GQ9L 1XGTA 3T08A 1DQLL 3JWOL 3K2UH 5D7IE 2VLLB 1E27A 3BPLB 1KCKA 3C6LD 4D0DA 5C0EB 3GJEA 1RHFA 4ERSL 4R97C 4U2YA 4OCNC 2XG4A 1ZWIA 5DK2B 5BMFL 4PYHA 1U8MB 5EORL 4X0KB 5DJAB 5CILH 4PJIF 3QUYD 5FYLL 4XC1L 1U8KA 4JM2A 3GMOA 2OR9L 5GGSB 2FEDC 3EJZD 4LPTA 4JVPA 3VFNB 3WEXA 5J1SC 1LE5A 1FPTL 4K8RD 1F4AA 1F45A 5J6HA 3W0WE 2VQTA 3VXPA 3I6LD 1NSNL 4YEEA 5D6CB 4PRHA 1FAIH 2AJYH 3M1BA 2ZCKH 3LQMA 4I5BB 5T5NF 1FC1A 4GBXD 4O58L 4RAVB 4X6DF 4L4TA 3QSKB 4O2CB 1FVDA 2EXYC 3TVMD 1S5IL 3G5ZA 3MRRA 4NUJB 4EDWH 1QR1B 3UBXG 4YE4L 4MLIA 1N3NA 1Z3GL 2Q87A 1OP9A 1FVEA 4R26L 4DCQB 4Y4FD 3AREB 4D0BB 2ADGB 5EULV 4RGOH 2WNGA 3RWGB 2AJ3B 4O00A 3GMLA 4JGJA 4QTHB 5I1IH 4XVTL 2CLZB 3B5GA 5JXED 1CLCA 2XG5A 3FHQA 1B2WL 4M61B 3SKJL 5I8EA 4U6XB 4OFYA 4YBQC 2F58L 2VDRL 2LQRA 2QBWA 1BBDL 5D7LA 1L4IA 4PJGB 3DV4B 3VFGL 3ZHDA 4U05A 5AYUH 3QIBC 4MNGA 5BVJA 1ED3B 2P44B 3RI5K 4BQBA 2VNCA 3VXTB 4ZG1A 5E1HB 3ARGD 4HV8B 2R2EA 1BX2B 2MSPA 2CLRA 3VXOA 5I74B 3WLWC 5B8CA 4PJIE 1I7ZB 2NR6C 3UROR 2R1YB 5HY9A 2CUMA 1AXSA 4PD4K 3PHSA 2FX9L 2YC1A 3LKOA 3KS0H 2F8XC 3MA9H 5JXAH 2HJLB 4HGWB 1WCBB 3RL2B 3WUWG 2HVKB 3QULA 1BFTA 3T1FA 1A02N 4FQXC 1AHWA 2X1XR 4KPHH 1T7YA 2R1XA 1QNZH 2UV3A 2YUWA 4ZAKB 4GJTB 4RWYL 4X6DE 3PP3H 4Y5XB 1GIGL 3DUSA 1CU4H 25C8H 5DK3A 4Y2DD 3TBYB 4U1JB 5DURD 3SO3B 5I8CA 3ARVA 4KVCL 5KANG 3LEYH 2HKFL 3RWEB 4JO1L 3GUTA 1RMFL 1SJEA 4U7KA 4U0QB 3V0WL 4OD1L 1OSPH 4Z7WE 1JF5A 3MV9D 4ZXBB 1FFRA 1SYSB 2NY7H 1KT2B 3SKNA 3LPWA 1HHHB 3K74B 3GKWH 4EJ1C 4OLZH 2IALA 1ZHNB 2V5SA 3OPZL 4C4KT 4AIZA 1QD0A 2BVOA 2FX7H 4B41A 3X14A 1YPZA 3AB0B 5IB2B 3HB3C 4OJFL 1NDGA 3R0NA 4OIBA 5HYJE 3RY6C 1UWXK 1VPOH 1WZ1H 5H94A 3QXDA 1WCQA 4C55A 5E5MA 3RKPA 1CGYA 4GRWH 3QNZB 1JGUL 1YJDL 3O9WB 3U46B 5EN2B 3MRCB 2V17L 3GMQB 4KQ3L 2R0WL 4GKNA 1BMGA 1FGVL 5KVGH 4LASH 2AK4E 1BZ9B 2D2OA 1ZHKA 2XNAB 3TO2A 2W92A 1BVKA 4P4KA 1K4DB 4F33A 4XCYB 1UWGL 4K71C 5GJTL 2FECL 1G9NL 3VFSA 1RIUL 2JB5H 3PG2A 1EPFA 3FOLB 3WHE1 3VRJB 2GITA 4FHBD 1DQQB 5F6HI 1CIUA 3KNBB 3BH9A 2X4QA 1CTNA 1JI2A 1FNSH 3EYUH 5ICZA 1PG7X 1FLRL 3O3UN 4XB7A 4M7KH 4XWGL 3MRDB 4ZFZA 1BD2D 3PDDA 4V2BA 1O0VA 3AAZA 4M48L 1UB5A 2DYPD 2VIRB 5L88L 1FG2A 3MBED 3ZKXC 3LDBC 3WIIH 3LS4H 3INUH 4HT1H 4G8FA 2V2TA 5IK3B 5JLZB 4PP1D 4RSVA 4R4FH 4WEBL 3FOMA 2RCSH 3VFUA 1INDL 3JVGA 4P23A 4XP1L 4O2EB 4HS8H 3TWCL 4GS7C 2BNRD 5JMRA 4UBDC 2KZWA 4OI7A 4NHUB 3QQ4B 5TFSH 4ZOEA 2RGSA 3V4PL 4A6YB 5IMLB 2ZPKH 1U92A 1LD9B 2DM3A 2MJWA 1S7XB 2OR8A 2FSEA 2VRAA 2E7LA 5D4QA 1A6VL 1IGTA 3ZKMC 3DPBA 4RFOH 1MAJA 3C2AL 4WEMB 5ITFB 3E1F1 1I7UA 1YC7A 3ZL4L 3OSKA 1NCBL 1NQBA 5IBTH 2G75B 4NJAH 2EIEA 4P0DA 2ZOLA 2AJSH 1QLEH 3TFKD 1CTOA 4XHJC 4QHUB 2NY0B 5F1OB 2J5LB 2LFGA 4R7NA 1UCBL 1OQOA 3FZUD 5F88A 5GGUB 2BVPB 3P0GB 3HKFA 1U3HD 2EEAA 2XKSA 3BP7A 4IIQB 1E0OB 3O4OB 4RWHA 4WI2A 1DBJL 4KROC 3OXRA 5GSRB 3S9DB 1CK0H 1HDMB 4GMSH 3WV0A 3T77A 4U31A 5I17B 2FBOJ 1GCFA 1TVBA 2B4CC 4RA0C 2AJUL 3IDIB 5I16B 3BW9A 1X5ZA 2NW3B 4ODSL 3WIHH 2VZTA 3VWKD 5CGYC 3RZCC 5DA4A 3TBSB 2PXYB 1MEXH 3FB6B 5EC2A 5BRZB 4N8CH 4M5ZH 3BDXA 1UXWB 4QKXB 3GBLA 1NCUA 2C3GA 2XY1A 5ALCL 3RVUD 4O4YH 4NP4L 1PYWA 3ARDA 4PGDA 2IGFH 4NKMA 1ZLWH 2Y06L 1VFOA 3SDYH 5CSZA 4M61A 3MRMB 4P2QA 1MLCA 3UP1A 1J5OH 1I9IL 2IPUK 2NY2B 3BDYH 3U7YH 3DVFA 3MMEA 1UENA 3RI5F 4BFIA 1DDHA 3H3PL 3VA2C 3KVQA 4JO3H 3U0TB 3HAEG 1BZ7B 2Z35A 2BK8A 5EBMB 4IEFB 4PG2A 3SHSA 4XXCC 4YAQA 4S0SD 3QQ9D 4PB9H 2Y36H 1HYSD 5ISZA 1PBYA 2ICCA 2JJTA 2Z8RA 4P3CL 2WV3A 1XFPA 3B6SB 5TF0A 3BPLC 4AG4H 1ZT7A 5A1AA 3W5NA 3IDNA 3DECA 2X4RB 1HXYA 2HFFA 4J3SA 3RGVB 15C8H 1R3LB 2BSSA 4G43A 2R4RH 4HWBH 1B6UA 2IANB 3F7YB 3E8UH 2GJZB 3IDXH 4JRYA 2YPKB 4BSWA 4YO0A 6FABH 4B53A 3QUZB 4OGXH 5DUBA 3K80A 1B3JA 2HWZL 3GMNA 1IGFL 1ZHLB 4JHWH 1Q0YL 5HSFA 4KHXH 3SOBH 5CZKA 4AT6A 5HGDA 3KPRB 1KOAA 4JO4L 1KLGA 5MEPA 1KJVB 2EDDA 4HUWA 4NIKB 5C0IB 5SV4A 3CZFB 2R0ZL 3B83A 3NCJH 5FHBL 4PJHF 5L2JB 1FSKB 3NTCL 3L6FA 1RZ7H 5SWZB 4M6OH 1J05B 4PJEA 5IB3B 1I4FB 4F9LC 5GZOC 5E8PA 1ZLSL 4ODVL 4UV4H 5J7CC 1WIUA 4TSCL 1DBBH 4MXQC 4UI2A 3MLTB 4DVBA 3MRKA 3KPLA 3LIZL 1DSFH 3BWUC 5F9WB 2IQAB 3AREC 3HR6A 2WWKT 1MHEB 3QHFL 5D1XB 3S88H 1WEJL 4OD3H 4ZFGH 4I13B 3HPJA 5C6TL 3RP1A 1KELH 2ED9A 3ZKSD 3UBXB 3OJDA 2R0LH 4KJYA 3STZA 1A1NA 4BSJA 2DD8L 4KJWC 1INEL 1M6OB 4FZEH 5E9DA 1J86A 2FB4L 2KQNA 4N9GB 4EVNB 1IM9B 3PQYD 3R4DA 1KIPB 2ZUWA 1YNKH 1RJLA 4AK1A 2EEBA 1RZKL 4XPGH 5IKCB 2ARJQ 4KJPD 3THMH 3NH7L 3O2DL 4ELMA 4XPAL 1OB1A 1BQHG 3KJ6L 4WHDA 3LZFH 4FXGB 1T1ZB 4HXAL 1OAQH 2VDQH 4V1DD 1LO0H 2V2XB 2HT2C 4OKVA 1CR9H 5I74C 5CSGA 3BRDA 2YEZB 4Z8FL 2ERJB 4W6YB 3ARWA 1DZBA 1S3KH 5HJ3A 4Z0BH 1YN7B 1TPXB 2CRYA 1I85A 1T5XA 3HC3H 2GK0A 2YSSA 3L3IB 2FIRT 1IQDB 5DEGA 4WUUD 2Z8VC 3EOYG 5JDJA 3UTPE 1JHLH 4HKZA 3QZWG 1KYOK 4FMKA 5DMGD 3QEHA 5KS9F 4PJHE 2LAGB 4LDLB 1L0XA 5HDQL 1F00I 4F37K 3EZ8A 4ZAKC 4FQCH 5KAQG 3I9GH 1RY7B 3TV3H 4F8TA 4G9FD 4Y5XC 1NLBH 2VXTL 1RK1A 2C3VB 1I1YA 1JMZA 3T4AB 1X5KA 5C0AA 4WO4B 2CDFB 3DUHA 3SGEI 5HHQA 5IB5A 4KTEL 4OFPA 4YXHL 1C1EL 5FHAH 5TE4H 1QRKA 4HWBA 2BHZA 1C08B 1I3GL 4XAKD 1UXSB 4X4XB 5H35A 5FYKD 1B0WA 3MRIB 2VLRB 4ZXBC 2E8YA 4FQ1L 1TLKA 2O5YH 2Z8SA 4PGZA 3WFCL 2GY7B 3CDFA 3FQTB 1BWWA 5FA3B 2IH3A 3T0ED 3CPLA 3LHPL 3NAAH 2A9MH 3AB0C 4M7LT 4LHUD 4XBGB 4Q9QH 1EVUA 3LKRB 4U1NB 1OTUD 1TJHL 4XX1E 4JFYA 1N59B 5DJ0B 1BIIA 1HCFX 4ZO8A 5DQDH 1IAKA 3IFNL 3O9WC 1D5MB 4R3SB 3RIAF 5E99H 1OCWH 5HHOA 4OZFG 5K9OA 4DTGL 2VH5L 1NGYB 2BMKA 4GAFB 3WNOA 1UH2A 4OLYH 2PR4L 4LSRL 4KTDH 3KPNB 1N4XL 3N50A 3ARZA 4LVOB 4G8GE 2AJZB 5ACZA 2DDQH 2BVQA 3D2UD 3JWOC 4H1LB 5ANMB 4CADA 5C70A 4ORZC 1U8LA 2UYLB 5EBWB 5DEFB 3GSXA 4G80B 1A64A 4L4VA 4AIOA 1FP5A 2DICA 3ARPA 2IEPA 4JFZL 4LPCA 4H0HB 4ONFL 3QEGH 1IAOB 2AJVH 4LFHD 1ES0B 2JB6A 4KTYA 4XNQA 5DJ2A 2I07A 1A3LL 5FYJE 4JE4B 2X6MA 2G5BA 2XWTB 3DYOA 3A6CH 1LO5A 2ATPB 1LHZA 3QIWA 2H45A 2Q6WA 4ELKB 4K3EL 1RU9L 3TIEB 4FNLL 2APFA 1D6EB 3WCYA 3MV7A 1LILA 1AE6L 3SE9H 2A74B 3F6IA 3P9LA 3Q5YA 2PCPA 1C5BL 4YR6B 2DQDL 3RZWA 4JFDE 1HK6A 1UJ3C 4ZS6C 1FZJB 3U30B 1IL1B 4LF3A 3VXNA 1GZPA 5DVKA 1AGDB 4WI4A 5BVPH 3PL6D 1CGTA 4I0PB 3N85H 3BIBX 2NY0C 3IS1X 4HUUB 4JQIH 1DEEB 4OZHF 4X4YA 4WFFE 1HZHL 2J5LC 3GSVA 1FJ1A 1KC5L 4IIQC 3O4OC 5KVEL 4GW1A 1NH6A 3RU8H 5F1NA 2DMKA 2VDNH 3WFZA 4AM0A 3Q1SL 2XWBA 4G8IB 3W11C 3T2OA 5C2BH 2MTPA 4Q2ZB 4HLZG 3PGFH 4LCUB 2I60L 2YXMA 3ARFC 3BQUD 2P5EE 1KEGH 3UPRA 1RFDH 1U2HA 4XBPA 5I1EL 2PXYC 2X4OA 5JDSA 1CG9A 4C83A 4LPWA 4OI8A 3MCLL 1TJGH 4GRLB 4RDQG 3O3DB 4XP5L 4ZTOL 4S1QL 3WDHA 3QDHA 3B9KB 5J4MA 1OLLA 4QYOB 5CMAB 5EO9A 5ELIA 2NY2C 2FEDD 3WO4C 1K8DA 4JDZB 1KEMH 4PJ5D 5HYQB 4XC3H 4QXGL 1XF5A 4JG1L 4QXTA 5EOQL 1CYGA 3RX8A 2P5WE 1GGCL 5I6XB 1BM3L 4M6AA 3SJVB 5IQ9B 2VZ1A 2FO1A 4K23H 4WW1A 3GMRA 1N8ZA 3BT2H 12E8H 1ZGLB 4LNRA 3PV7A 3RGVC 3QUXB 4G7YH 3CUPA 2UUDH 5D1QA 3T2PA 2EXYD 3MLZH 3V0VB 3CC5B 2F74A 1ZKAA 3DSFH 1A7QH 1EJ6A 32C2A 4OZHE 2FEEI 3BWAA 4W4OC 4LAQH 5DD6B 3SE4A 3QUZC 1CN4A 2PF6A 4F37F 4F8QA 1T6VN 2K9UA 1QACA 1XGYL 1MFEL 4GRWF 4NRXA 1CD1B 1BECA 3GSOA 1JTTA 1R5WB 1T4KB 2XZAL 3IRPX 4Q7DA 3H3KA 4LMQE 5MEND 2MOVA 5C1MB 3QPQC 3MA7A 5IESL 3WUWA 1GHFL 1FSKC 3JTTA 4MA3A 1XCTB 5IOPB 1EO5A 4KHTL 1FNGA 4KKCC 4YBQD 3TZVA 4OF3A 4GKZA 1G7JA 4Z7VE 1YJDC 4LCIH 2C1PB 4N8VA 1KIUA 1E4XH 1MH5A 1MI5A 1QFHA 1MCDA 3QYCA 4WWKA 5E95B 2VN7A 4X99B 5DHVH 1J8HA 3UYOD 4RNRA 5F9WC 1H0DB 1Y0LA 2WIIA 4YHNA 4WTZG 2WQ8A 2ICWA 1CBVL 1G9NC 5D1XC 1WJ3A 3UJTL 2FL5A 3GO1L 4XMLL 1PVHA 1VADA 3HNTH 3KHQA 1LK3H 3A6BH 4ZFOA 4MNQA 3TYFB 3HR5B 4PFEA 3T0WA 3O3AB 5C0DA 3V7AG 2BFVH 3WS6C 2M8XA 3OGCB 3EW3B 3MOAH 1XR8A 3AUVA 4JM2D 5FOBA 4JFHD 4ZDHB 3OV6A 3H9HB 4DOHE 4BFEA 1GGBH 2QSCL 1QRNB 4XNMB 3GSWB 4F7EB 1VENA 2UWEB 3NIFF 4JJ5B 5JOFA 3FAXA 1CL7L 4KKNA 3WDJA 2FBJH 1A6TA 2DKMA 3EJYD 3BPCB 4PRHD 3VFMB 5I1AB 4N0UE 1KCSH 1A6WL 5KSVA 3VXUB 3O8XA 1U91B 2C4XA 3ZDYF 4P5KB 3O3BB 4HUXB 4L4TD 1TPXC 5DDHB 3SDAA 3DV6B 4MMZC 2ZUYA 4OCYL 1FO0H 2EKSA 1NGXA 5CGTA 3HE6B 1JYWA 1TZIB 3ZDZF 3JV4B 1F5WA 3RKDD 3SDDB 2WWKO 4HDIB 2EIZB 1IGMH 4NKOB 2Q7YB 5I1LB 5EO0A 5AUMA 3GNML 4CDGC 4UTAL 4JHAL 1CQKA 1ETZA 4JLRB 4ODTL 5FKPB 1RV6X 3S35H 2I9LB 4JCLA 4LQFL 4POUB 3S5LG 3D39B 2YD9A 2C7UB 3X11A 3ZE0F 3B9VA 1H3UA 4WO4C 4MDIB 2OL3L 5L2KA 2VR5A 2VE6A 1JYXA 1A2YA 3G5XB 3V8OA 5LAXA 4BQ6A 3MTRA 5E00A 3UO1H 5FF6B 3CD4A 2PUQT 2X9YA 4QRUA 3RVTC 1UM5L 4ENED 4PP2A 3DURB 2OTWA 1LO2H 2PKDA 4EOWH 1CLOL 4W6WB 3HZKB 4YR6A 3VI4F 3PWLB 4YGVA 1JZ7A 5IGXH 1JWUA 1MCPH 1A21A 4LSSL 5ETUA 1Q72H 3T0DA 1H8OA 4NM8L 4WGVB 1EJOL 3NIFE 4QRRB 1BAFL 4YHLL 3IETB 2Z8WC 1OGAB 4E41A 1F4XH 3PWNB 4UZGA 2FRGP 4P3WA 4O9HH 2B0SL 1M4KA 3ZDYE 4OCRH 4IJ3C 4C59B 3U4BL 4EQ3A 1MFAH 2UZYB 1BF8A 1SYVA 2YBRA 1MQKH 1N5YL 3D0VB 5D7IB 1AR2A 3QFJB 2HJFA 3ZDZE 3T4YA 3B3IB 4LLQA 4NWTL 1T80A 4DKAA 4GKOA 5FV1L 4LVOC 5GSVA 1HH9A 4OZFB 5SX4I 4OFVA 5L0QB 1T0MA 4W6XB 1HWHB 1GGYA 2WBKA 2XN9A 1A7OL 3T0XA 3FO0H 4PRAB 3FT2A 3ZE0E 2VXUL 4DUVA 3CFJB 3VCLA 5DEZA 3F5WA 4L3AA 1KFAL 3UTSD 3W0WB 1F42A 1AO7A 1ZLUK 3TH2T 3CCHA 3SN6N 1VKXA 1ADQL 3PGDA 3QIUB 4XVJH 2M2DA 2XTJD 3TF7C 5ILTH 3I75A 2PN5A 4NQVB 3MV9E 2CRZA 3VI4E 4KROD 3GSNL 1YYMH 2GQHA 3MNWA 4NT6B 3DHJA 4P4KD 1JGDB 2EDWA 2NCMA 1JV5B 5F7NC 1B88A 2PYEB 3HAEA 4HC1H 4H8WC 4RBPK 3TBVB 1CDIA 5CBEA 1Z2KA 3RZCD 5D5MA 1P2CA 4LU5L 3LPGA 4Y5VA 1HHGB 1OARH 5ESQA 3U30C 4P2RD 4WCYH 4ZD3H 4I0PC 2HLAA 4U3HA 3K4AA 3GI9L 4LARH 3CFEA 1RIVL 2RIKA 3KYOA 1JNNH 3C87A 4JKWA 3V79C 3SGKA 3TNNA 1WBYB 3S37H 4F58L 4QHKJ 3QUKB 4QRPA 4XRCA 2FYYB 3WNNA 3RPKA 4OIIH 5AWNL 5ICXA 1RZKC 4I8DA 1UT9A 3EAKA 5DRZB 1U58B 2ICWI 3NGBB 2CKBH 3AM8C 5TF1L 4Z76B 4JQVA 1FL3A 1EHLH 3M45A 1JP5A 4YPGB 1YEGL 5D7JB 4H26B 4P23D 1EVTC 4R96B 3NFNB 5D2NA 5HVHB 1J18A 4U6HB 3FMGL 5ADOL 4OLWL 5E6IB 2OQJA 1UM4L 1BD2E 3G04A 4GRLC 4XCCH 5TPWL 1MLBA 2MHAB 2Z92B 1I7TB 3P77A 3B9KC 2F19H 1LK2A 2VISA 4DGYL 1XIWB 5L8LB 1N7ML 1HNGA 3ZKQD 1MWAH 1DQJB 1WLHA 3HG1A 4I2XB 3IKCA 2WBWB 4QRQB 5FGSA 3TBTA 3UTTA 4M5YL 1OAZH 2ADJA 3R1GL 3R8BB 3WXWH 2X09A 2W65B 5I6XC 4R8WL 1MAMH 2BNRE 5ECJE 4YHOH 2DB8A 4CRPA 2FJGA 1IT9H 1G9MC 1ZTXH 5GISL 5T5FH 3S96B 2PO6B 5I1KH 1QFPA 5DC9B 4Z7WB 5DMKA 2W38A 2WBJB 4BK5A 3QUXC 4WI5A 4BH7B 3FO2B 1UKSA 5GZOD 5EUOA 1OWWA 3WFHA 2L7UA 1UG9A 2XV6B 1BQHA 3F7QA 4MXQD 1VGKA 1ZGLM 4HF5H 1T89A 5I73B 3CVIL 3O4LA 3ARED 1KN4H 3CMOH 5C08A 3BXNB 2NLJA 3RJDA 1JGLH 1XF2B 1UYWH 3KLAA 5C71A 3P0YL 4EUPB 1I1FB 2OXGA 3VFTB 2ZCHL 3P4NA 1DE4B 1VACA 4P2QD 3QZWA 4ZSOE 3WNMA 1TCRB 2NY1B 3DIFB 4WW2A 3VXQB 2VAAB 3BAEH 4X6CA 3D3VA 1DFBH 3BIAX 3MUGB 1ZS8B 3IXTA 3NA4A 2J8UF 1K2DA 4JFFB 2VDMH 1G7IB 5LGHL 1LVEA 2ITCA 1D5XB 1AXTL 5D72L 2HT2D 2H2SC 5ISZD 2WWMD 1HE7A 5IEHB 5CUSH 2JJVA 2VERN 2P8MB 4X5WB 5IBUG 5I1GH 5I15L 2E6QA 1E4KA 3GIZL 3FTGB 1D5ZB 2BOBB 2B4CH 3MLWL 5D8JH 1XGUB 5MEOA 4FQ2L 4NKDA 3FQUA 1LEGA 4Y4KB 8CGTA 3V5HB 1B0GB 2DJSA 5KVFL 5LQBL 3O6LH 4UOJA 1I3RA 4GXUM 4NOBA 4Y4HA 1S7VB 2VQ1A 3GGWA 5BZDB 2YRZA 3OKEB 4WTWA 2AQ1A 1QG3A 4ZAKD 1UJTA 1H3TA 1PG7L 2YD1A 3MROA 4HCRH 4ZPVB 1KJ2H 2DQFB 4Q9BA 2ADIB 2WAHA 1T3FA 3MFFB 4K9EH 4PS4L 1IM3B 3NZ8B 4GG6F 5IFHL 4R0LB 1EZVY 1ZXQA 5JHLL 2EDLA 3BUYA 5EZIH 4P57B 4XZUB 1DCLA 2BC4A 4UT6L 1FGNH 5JTWA 1U8HB 3HE6C 5HD8D 2ZJSL 5DD3H 4ZXBD 4KK6C 5HYEA 3EYOB 2EDYA 1F3JB 4FQLH 5E94A 4S1DC 3OX8B 3SDDC 1MWAA 1T0NB 3G6AA 4LSDA 2P4AB 4N5ED 4HFWA 5T1LA 3F8UB 2VB5A 3CU7A 2G9HB 1IGJA 4TNWF 5JIHA 3OB8A 2F5BL 3JV6B 1ZA3B 3IFLL 2H8PA 3T09A 1NBQA 5E9DD 5F7EH 2F8VA 5HHPA 3MUJA 2APBA 2J8UE 5C0BB 4NSKA 2IPUG 4W81A 2OYPA 3S98A 2YK1L 4M6ML 5DD5L 2FJHA 1S7UA 1XGQB 5L7XH 3H9SA 4DZBA 4C56A 3O9WD 3ILPB 4PG9B 1XH3B 1T83A 3K46A 4NM4H 5DF0A 1FNLA 1XEDA 3F12B 2MCPL 1MRCL 3A0OA 3A6OA 3K8MA 1T1YA 4HIIA 5DC0A 3CVHB 1FH5L 1CXIA 2W0FA 4NN7C 3JZ7A 3L3OB 3BI9X 4UT7H 5SWSA 1RQ5A 1LP9A 1YEDA 2ICEA 1GOFA 4M6NH 1CFQB 3MOQA 2RAMA 2GSGB 5MERB 3S35X 4TTDC 3PQYE 5FUZH 1KB5B 4HK3J 2VAJA 1MCBA 4GRMA 3RUGB 1QBLH 2SEBB 4KKBC 4PJDA 3REVA 5IW3A 2FWOA 4GG6E 1TCMA 4PGEA 1MNUL 4V1DE 4X4ME 3P2TA 3OKKA 4MYWB 4MXVF 4YHKL 4N90D 4NO3A 2P24B 5C0AD 3CLFH 5LXGL 2Q8AL 1X7QA 2J4WH 3DX8B 3FB7B 2Y5TA 1HILA 4EBQL 4X7TA 4O5LH 4RGMB 1F11B 4XPFH 2BVEA 1XGPB 1K6QL 4H26A 4WUUE 4U3CA 3PWPA 4DVRH 3CGTA 5HYFA 5L0QC 2X4TB 1BGXH 1KJMA 3RNQA 2A6IA 3OKLB 1DL7L 4LLVA 3QDGA 4JRXB 5K59F 4M8QA 4B5EA 4XP6H 5FYJL 2CR3A 3LH2L 4JY6A 1TZGL 4G9FE 5LBSL 4PJ7B 4NNYA 4S10A 4ZS6D 4LDOB 3UPCA 5FM5O 4HCRA 3SPVB 5DFWH 1KJ2A 5D2LF 4GW5A 5JW5B 1DLHB 1RJCA 1EXUB 2NY0D 3QIUC 4K2UH 2XYCA 3FB5B 1WK0A 1YMMA 1J88A 4XAKE 5MHSD 1KXQE 3OB0H 5FYKE 4FG6C 3SDXA 3UYRL 3U1SL 3ZMRA 5HHOD 3MREA 3MLSH 5T1KB 1GAFH 2R69H 3NCEB 3VG0L 1MJ7H 4R6UA 4D8PA 5LVEA 1PQZA 5DWUH 3T0EE 3H3BC 4HS6A 2WIMA 2GJJA 4OTXH 2VOTA 4I48B 1YN6B 4L3CB 3TO4B 1RUKH 5CEZD 5INDA 2PXYD 1PEWA 1GOGA 4KDTC 5GRWA 3H42H 5BV7L 1T1WB 2AV7B 3LQZA 4MQ7A 4MXWH 3VGAB 3PWVA 4MXVE 1U8PA 2LV4A 5TE7H 4L4VD 2A77H 1S5HA 1QFUL 1QO3B 2Q86B 1C5CH 5LGJA 1ND0B 4NQSB 3Q5OA 2NY2D 1M71A 4WENB 2MPAH 5DUMH 2YA0A 2WSKA 1JHTB 3ECBB 5EIIB 1K4CB 4L5FL 5ENWA 1JPSL 4NZUL 1YY9C 5DTFA 3NGBC 4UNTA 2AJYL 3VXMA 2DL9A 5K59E 2NQCA 2QKIB 5D7JC 1K3ZA 3MLUH 5IJVB 4JFOB 1JPGB 5IVZB 3UTZA 1JNLL 3SGDH 5HGHB 4R4NC 3I6GA 5J3HC 5EIVA 3W9DB 5HVHC 3RGVD 4TVPD 5E6IC 5MP6L 2VZSA 2DQEH 2IAND 5D2LE 2I27N 2EO9A 3PGCB 1RIHL 3S37X 1DN0B 1XIWC 3KPSA 1G6VK 1NL0H 4WTZA 4OZGF 1BFOA 4LPYA 2PTUA 3QUZD 1FZKB 2Z93A 1NUDA 4GQ9H 5I18H 1RZGB 4POZC 1DQLH 3JWOH 4ORGA 2X05A 1WZKA 1T03L 5E2JA 2IH1A 3KPRD 3V6OE 3VFPB 3T1WA 4AH2B 5BMFH 1V3JA 5EORH 5LWYL 3ET9F 5DRXB 2R1WA 2Y6SC 3G6JF 2WBJC 4ZYKA 5SWZD 5FYLH 2NY3C 2B1AH 4JM4L 3BZFA 3M17B 3HZYB 4G9DA 2OR9H 3SBWA 3RDTB 1NMAL 1BLNB 3FRUA 2VL4A 1TTGA 1VFAB 1NDMB 5KSAB 4Q9RL 1I3VA 1FPTH 5I73C 2XPGA 1CFTA 4U3XA 5CD5C 2QQNH 1JTPA 2H3NA 5D1XD 5C0FB 5FO8A 1KN2L 4M3JA 5EZJA 3BRFA 3VWJA 3PV6A 3AXLB 4PREB 2BRQA 4O58H 2W07A 3QEUB 5T3ZD 2OJEA 4Z6AT 1S5IH 3PWJA 4ISVA 1IJ9A 1IM9D 4YE4H 5DJXB 1FYTA 2A6JB 1Z3GH 2IBZY 2NY1C 3PF2A 4PRIA 4R26H 5GS0L 2GTZA 3GZKA 1OVZA 4IRSB 2ZG2A 4TUJA 4PTTB 1SVCP 4DUXA 1QLRB 4LNVA 4XVTH 4BUGA 3S5LA 2NW2A 4JANA 3VH8G 3HHRB 1HKFA 2QSTA 1SHMA 3B2UC 2DI8A 1WT5A 5EUKA 4OZGE 1B2WH 4ZO6A 3SKJH 1BJ1J 4U1MB 5D1QD 2H32A 4MD4A 2CO7B 2F58H 2VDRH 4IOIA 4YHIB 5GZND 1OP3H 4L3EA 3TNMB 4QRTB 1BBDH 4PJFA 5F6IB 3VFGH 1LMKA 4RMRA 4Y4KC 2BRRH 4PJ5E 4H0IA 4CW1B 1RJZA 2MMXA 3DXAB 1CFBA 3C9NA 5IBUB 3DX9A 4JFEE 3TJHD 1KUMA 2BNUB 5C0JB 5JW3L 3VG9B 1AH1A 3BVNA 4GSDL 1QOKA 3QWOA 3DRTB 3FB8B 2QR0A 5FIEA 4YDJA 4YK4B 4WO4D 4X5LA 4HFUL 5I66B 5BJTB 1U8IA 3QG7L 2FZ3A 2IMNA 4R0LC 4Y19B 1JF6A 1BWMA 1J1OL 4K8RL 1AR1C 3STBA 1CLZH 2VLRD 3IGAB 2G2RB 1UZ8A 2JB5L 4UDUA 1AP2B 1J8HD 5CIPH 4RWYH 3IS0X 5E8DH 4PJBB 1QSZA 1HKLL 1C7TA 2QTEA 1C8PA 1BOGB 3VD7A 5MENE 4KVCH 4MNQD 4R4BB 4ZUSB 1I1AA 2HKFH 4JO1H 3RWHB 3MRBB 4PJAA 1RMFH 1V7MH 4OD1H 4AEEA 1C16A 2VDPL 4ETQB 3BEWB 5JIKA 3P4MA 1NC2A 3VMOA 3MV11 4XCNB 1XMWA 4HWZB 2NTFB 5CHNB 2WP3T 1RK0A 1YMHA 2FDBP 2XIDA 5IP4A 1AC0A 3OPZH 4QF1B 5D1ZA 1H5BC 3INUL 4HG4J 5JW4Q 2VO5A 4BYHA 2NNAA 4DAGL 1JF1A 4IMLB 4R4FL 4X6BB 4OJFH 3B9AA 4F7MB 3O8XD 4AEFA 4HS8L 5HPMB 4LLDA 3SDAD 1JGUH 4LCWB 1YJDH 2R39A 1X4XA 2DKSA 4JFHE 2V17H 1IGYB 4KQ3H 1G7LA 1P7QB 2R0WH 1FGVH 5HXMA 4HX1A 1CQYA 3IAQA 4YIQA 1H15A 1A4JA 1UJ3A 2BJML 4OFIA 2IPKB 1UWGH 1D9KA 5GJTH 5IBTL 4NJAL 1G9NH 4EIZC 4RZCA 1WZMA 1F8TH 1RIUH 4F3FB 3KPOB 2P5WB 1QLEL 3VRIB 1JGVL 3NCYP 4OD2A 1S9VA 1HEZB 3VD9A 5L2KD 4JPWL 5KZCB 2ITDB 1ZSDB 4RGMC 4WDIA 3GJFA 1YYLL 3X12B 4J3XA 4XWGH 4X6FA 4BZ2L 4MQTB 5H37H 5HHNB 3VMPA 3WE6A 3L5HA 4PV9A 3ARFA 4RX4A 4XP9L 2EDOA 3REWB 1W0YT 3WIHL 1QSEB 5C09B 1FV1B 5ID1A 5IHUL 4QXWA 5IVXA 4WEBH 3KXFE 3MZGB 5C0GB 1INDH 1A4KB 1P4LB 4I0PD 5GGVL 4XP1H 1FHGA 3KPTA 3TWCH 2IGFL 1MVFA 1P7KB 1MFBL 1SJVA 2EIDA 3NIGE 3HUJB 4MAYA 1FFPA 3V4PH 3QI9B 4MNGE 4Z7VB 1CGXA 3VFPA 1A6VH 3U7YL 3TBWB 3FT4A 3SQBA 4ZFFA 3C2AH 2VLJB 2GEEA 4JN1L 3H9YA 1DANU 3ZL4H 5CLWA 1NCBH 5CIPA 3S8WA 4R7DA 1I9EA 1R3KA 2GCYB 4B7LA 2Y36L 2YS4A 4IDJL 3X13B 3QQ3A 5IW6A 4AJ0A 2HMID 4ODWB 1H3XA 3TO4C 4GG8A 2A83A 4YHML 4NYLA 5IEKA 2YPLB 1UCBH 4N0RA 2R2BB 3HZMA 5TH2B 5J1AA 4GT7A 5EU6B 1KTDA 3E6HB 4FFZL 5C92A 1DBJH 5FB8B 3VGAC 2FIKA 3ULVD 4YFLI 4GRLD 3BP6A 1NJ9B 3IRZA 1QLFA 1MCLA 2ZUQB 4NO5A 3TCLA 4J4PC 5E8OB 1KPVA 3FFDA 2VR9A 5GGTL 1W0VB 2AJUH 1F3RB 2OJZL 1QA9B 4ODSH 1LO4L 3C6LB 1DQDL 4Z7UF 2DRUA 4BSVA 1A14L 4ZTPL 1HHJA 2DWEA 3MRJB 1W72A 4WFED 1S9KC 5ALCH 1RURL 4NP4H 5IIEB 1RZ7L 3JWDC 4BZ1L 4GFTB 4HG4K 2YUXA 3T65B 2Y06H 5JPMA 1VESA 3OAYH 4UV4L 3QUXD 4QRSA 2V2WB 3ILQD 1I9IH 5L9DL 4IMKC 2OZ4L 4L8CB 2IFGA 5CWSB 5HPOA 3FQXA 3UTSE 1FL5A 3DETC 1H3GA 1PLGL 3S88L 2DLIA 3U9UB 1ONQA 5JUEL 4GBXB 1KELL 2XTJE 1MFNA 4H1LH 4NO0B 4P3CH 5GS1B 1HOCB 3WS6A 4M3KB 4N9OB 2AEQH 1BVLA 3SGDI 3TVMB 1MCNA 3L1OL 1M7XA 2AXHA 2IAMA 4HKJA 1M7DA 4MX7A 3PABB 3K7UA 1CXKA 2HLFD 4QRPD 4Y4FB 1XCQB 4NNXA 5SWQB 5KSBA 4XTRC 2HWZH 4K94C 4G3YL 5IMKA 3RDTC 1Q0YH 5KSAC 5IM7B 2J12B 4U1KA 4P2RE 1ZEAL 2AXJA 3G6DL 4P4RB 3C6SA 4JO4H 1VB9A 2P7TB 3BJLA 4R2GB 1U8OA 4WV1A 4Z0BL 5EU5B 2QQLH 3GIVA 3LKNB 2R0ZH 5FHBH 1X9QA 3HPLA 1AGFB 3DGGB 1UKQA 3HC3L 1G0XA 4LCCA 4W4NA 4CU6A 1HHIA 5ADPL 3NTCH 3KR3L 1AIFA 1MRFL 1XGRB 3L3JA 4FQIL 1S8DB 1ZLSH 3ARGB 2AAVA 2QHRL 4MNHA 4KGJA 3MV8B 3LIZH 4FQCL 1QRND 4ESKA 3UTTD 3BX7C 3FHAA 4IRSC 4EIGB 3QHFH 4L1DA 1V5JA 2RFXA 3HRZA 1WEJH 1R3JA 4H25B 3CXDL 1E28A 3E6FA 4U1SB 3L5JA 4PJGF 4MCZA 5C6TH 4DKFH 4Y1AB 4LLYB 2ESVB 4YDKH 3FFCB 3EOAA 3VXUD 2YD5A 1I9RL 1DQTA 4RMQA 3K2MC 2FJFA 4ONOA 5B39G 1ITBB 4PLKC 1AC6A 3MCKA 1FNEA 4RAUB 2HN7A 3I85A 2AS5M 4RMTA 1CVSC 1OQXA 1DUZB 1QQDB 1RZKH 4RQQB 4S1RL 2O5YL 4GKSB 4LBEB 1A8JH 3NH7H 5F6IC 4Z0XB 3HE6D 4LSVL 1L0YA 3O2DH 2XKNA 3I02A 4KK6D 4JVUA 3T8XB 1NCWL 4XPAH 1SQ2N 5FK9A 3ROLA 4WI6A 1S9YB 4Y2DB 4HSQA 2Q76B 4HXAH 3UXFA 4PRPA 1DN2A 1ZMYA 1BREA 1MCKA 2A9NL 1MUJA 4WIQA 4F7CA 4Z8FH 2QSQA 2EZ0C 5BW7C 3I50L 3VG9C 4YFLF 1WWWX 4L29B 5I9QB 3EO9L 3MV9B 4KVNL 1SY6L 4FTVA 4JZNB 4YK4C 1JJUA 1T2QL 4X7SH 1UKTA 2Y23A 3KPQA 1ZVYA 2HVJB 5DJ6A 3QUML 3ESVF 3QDMA 2H41A 3RL1B 1A7BA 2FH6A 2XRAL 2YKLL 1N64H 5HDQH 4A2MA 1MCSA 4GLRI 3MO1B 1Q9KB 2BP3A 2VXTH 1I7RB 2BSTA 4ZODA 3BPNB 2BY3A 1MHHB 4RA3A 4AIXA 4UIMA 1IEBA 5TDPA 3OKNB 3F58H 4P2QE 4APQA 4KTEH 3B2VL 4YXHH 1C1EH 4O51A 3RX7A 3KPMA 3PNWA 1I3GH 4HZLA 1J0KA 2CD0A 2APTA 2VSCA 1B90A 2X4UB 3MJ6A 3WSQL 4Y4HD 1FBIL 4FQ1H 4KKBD 3QEGL 3WFCH 3UZQA 3ARYA 4AYFA 5AG8A 3SCMB 3K0WA 5E8NA 4D0CA 4LRIC 4OF8A 3LHPH 4OQ1A 3D48R 3L9RA 4NC2B 1AD9A 2XXMB 3QFJD 3RY5A 1TJHH 4JZOA 3FQNB 1BZQK 3SE9L 3IJSB 4EXKA 4DWHA 3IFNH 3LN4B 2X70B 3OGOE 5DK0A 5FCSH 4PGBB 2X7LA 3GBML 5KOVC 4NPYB 2A0LC 3L95A 4DTGH 1NFDA 2VH5H 2OTUA 5A3IC 3LRSB 1FNFA 4PY7B 2FGZA 3MJ7B 2PR4H 4LSRH 3U36B 5A2KH 1IRAY 3QB7C 1T04A 1N4XH 1LEKB 1K5NA 2BNRB 4TTGA 4PJ8B 4P2CG 4UIKL 3AY4A 3QIUD 3ES6A 4PJEE 1WISA 1NFIB 1BFSA 4UU9A 3KHOA 3H9SD 2DQJH 4YHPB 3V6ZA 3V6FA 3KLHC 3RY4A 3L5WA 4U1LB 3IFPB 1A6ZA 1IMHC 2OSLA 1CFVL 3O2DA 2FECI 3S7GA 1R24B 4ONFH 1EAPA 2FHCA 2PYED 2X44D 5C3TA 2EIBA 1T20B 5DS8A 1U0QA 1A3LH 5C0NC 3IFOA 3CDGB 4H5SB 4OGZA 4GH7B 3OR7B 1GXEA 4PJ9A 1LQSR 4K3EH