4XOEA

Crystal structure of a fimh*dsg complex from e.coli f18 with bound heptyl alpha-d-mannopyrannoside
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catch-bond mechanism of the bacterial adhesin FimH.
pubmed doi rcsb
source organism Escherichia coli o6:k15:h31
molecule tags Cell adhesion
molecule keywords FimH protein
total genus 55
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoeA01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoeA02
4CSTA 5F3FA 3ME0B 1KIUB 3BFWA 5FX3A 3SQBB 4XO8A 2XG4B 4XOCA 1QUNB 3BFQG 3JWNH 5AB1A 4AV4A 1KLFB 3MCYA 4AUJA 4AUYA 2JTYA 2W07B 4X50A 4ATTA 2UY7B 3ZPDA 4AVIA 4AUUA 5IQMA 2WMPB 5CGBA 3JWNE 4AV5A 5FLUA 2UY6B 4X5PA 4X5QA 1PDKB 4J3OG 3ZL1A 4CA4A 4CSSA 5FWRA 4AVKA 4AVHA 5IQOA 3ZL2A 1N0LB 5ABZA 5JQIB 5LNGA 3JWNG 5FS5A 2JMRA 4XO9A 5AALA 5F2FA 1N12A 1UWFA 4XODA 5IQNA 5LNEA 4BUQA 4XOEA 5AAPA 3RFZA 4XOAA 2J2ZB 1TR7A 4LOVA 2VCOA 4AV0A 4X5RA 4AVJA 4XOBA 4J3OH 2XG5B 4J3OF 1ZE3H 3BWUF
chains in the Genus database with same CATH superfamily
1EHAA 4EJ1C 3BPLC 2A0LD 2F53E 3EFDL 1GGCL 2UY7A 3L2NA 3RPKA 1NDMB 3U25A 2X9YA 1CFMA 1P5UA 2WO2B 4HJJH 4GRMB 2DJMA 3QUYB 5CEYB 3LNFA 4KRMB 1M7UA 1CG9A 2J21A 1UCBL 5FM5M 3QEQB 4OFKA 2VH5L 3X13A 1RFDH 2HMIC 1BJ1H 4E41E 3RJOA 1MF2L 5M95B 4YBQD 1JHTA 2H47C 5C07A 5PCYA 2VDRL 4HJGB 5D9SA 3Q05A 4HLZH 3V6FB 3EYFB 3TP4A 1NA8A 1T03L 4LSUH 1KT2B 2DKMA 4R26L 1CTMA 5F71A 5MHSD 1X5YA 4QUOA 3CQFA 2OTUA 4GAYB 1OGAD 1LO0H 1Z66A 4N6QA 4PP2A 1I3GL 2NNFA 3T0XA 2IGTA 4FERA 1FNEB 3NRFA 4BZ2H 3VFMA 2FJHB 4OCWH 1WZAA 4PJGA 4Z7WA 3OKMA 1DO6A 1ORQB 1ED3B 3WS3B 5I6XB 2MKWA 1BJ1J 5IG7B 5I75B 1KXVA 2ZX5A 4NP4L 4LIQL 4JY6B 3UROR 4CVZB 4ABUA 1RJLA 4XE0A 3KM2A 1I8MA 2KLSA 3RWFB 4ODHH 1PPIA 3T8XB 2BVUA 2IANB 2P8MA 4HFUL 2OCJA 1T7WA 4MMXA 1CGUA 4FQLL 3CQPA 1FFNA 1T2JA 3HPLA 3LS5H 4MD5A 4LVHB 3LTVA 4K5NA 4JE4B 3IM1A 4FZEH 4GXUM 3T8MA 1ZPLA 3L4CA 2V6HA 4LFHG 4Z3IA 2V9UA 2VMDA 5ANME 3CFUA 2PYFA 1B90A 2NY2C 2FT7A 4XNUL 3KL3A 5DGQA 2RHEA 7FABL 4K7PX 5D2LB 1K2DA 3P0YL 1A9BB 1JPFB 3EDKA 1ZLVH 4F57L 4ZW7A 3LVTA 1W6WA 2H0EA 4IKLA 3TTSA 1HHJB 2DWEB 1IFRA 3ZKMD 2VDNL 1OY3B 4X5PA 1CDGA 3OZLA 3C60B 3ZGIA 4J3SA 4KVNL 2IIJA 1NCBL 1EO8H 2V9RA 5CCJA 4Y2DC 1NFAA 4O02A 5E9DA 1NLBL 3L7EA 4MWFA 3E2HB 4P2RB 2W9DL 5AYQA 1NFIB 2I9TA 2QMJA 3MRKB 4OF3A 4Q8BA 1E5AA 4L8BA 2ZG1A 2JNZA 3HS9A 3LXBA 4EI0A 3AQDA 5CD3A 2A6KA 4RFEB 3IJHB 3F58H 4HHAB 1KWGA 3GSNH 2VLJB 1UH4A 1XGPA 1ZVYA 1PZCA 1A25A 1O7DC 1WTGT 5KUMA 1ZDSA 3V0WL 3O3DA 4N3UA 4DN3L 1Z1WA 3EO1B 1PD1A 2F08A 2VMEA 3POHA 1IGCH 1BHGA 1RMFL 2APSA 4HPOL 5DK0B 4Q97A 2P47B 4G6KL 1QLEB 1FRGH 4BZ1H 4M4PA 2G2PA 1CD0A 2V17L 1UGNA 3GB7A 3QORC 4XP1L 2OSLA 3QG6A 2OYPA 5DEZA 3SZ6A 4AEHH 4WENB 5LAXB 4YL4A 3SBWA 4TMPA 4R7LA 2P45B 1NIBA 2OW7A 2HLAA 3GS0A 5FYKU 2EYSA 5CKAA 4L5FE 1RQ5A 3TBBA 2PO6C 2H1XA 3ELAT 1AD9A 1YDPB 4MJIB 4B3VA 4JFYA 2EIZA 4JFFB 1A7QL 1J05A 4XP9L 1FFRA 5IB5A 1J11A 2FT6A 5I6MA 5IT2L 1HINH 3VGAC 1I7TB 3WNPA 2PYED 1YECL 3DPBA 4Q9QL 3UDWC 3ZTJG 4ADGA 2J5LC 4TNEA 1KC5L 1IAOB 3FQ4A 4YPGA 2MEJB 4HSCX 4CILA 5D7KE 3HN5A 4RRPG 2EIZB 4EO5A 5DEJA 4OJYA 4QOKB 5ENWA 1KJ2H 3L6FA 4JRXA 4E5XA 1RIHH 4K5LA 2W9DH 2CIIB 3M8OL 2YA0A 2XFGB 4QHKJ 3W9EB 2BVQA 5IJCC 4X6DE 4WHDA 3ZT6A 2UYLB 1W72L 4HSAC 3UJIL 4NQVA 3CSGA 2CA3A 3IJYB 1EZSA 1IC7H 3RVWC 4OD2B 1JOIA 2IH8A 2L7UA 3G6JF 3MBEA 2F18A 4FHJA 1TEYA 4CU6A 1NMAH 5JHLH 4HULB 1I8UA 5T3XE 1YMMD 1INDL 2ZCHH 2HT3D 1RUML 2EVFA 5L9DH 4N2IA 3TBYA 1SDDA 2QSVA 1ZVHA 3VFRA 2F61A 5HHOA 1G1OA 1IGJB 1J0JA 1LO3H 4XNYL 4L3EE 2BSBA 2D3NA 3OHMB 4PN6A 3TBVB 4S1QH 3TU6A 2YEZA 1E6OL 4WV1C 1G7LA 4F7MB 4PWKA 4U3SA 3LKNB 2QPDB 4OZGA 1R5VB 5KSUB 1C5CL 1LVEA 2F54B 2H26A 2WSPA 3VWKC 2AJXL 4IKIA 1NC2D 4G1MB 1C8PA 3P4MA 5DMYA 5HJ3A 5AKVA 3KPSE 4UTBL 2LAAA 4PRIA 5CWSA 2DQHL 4OVUA 2XA3A 4TQPA 3HRZC 2RR3A 3BKCL 1OKEA 2G75A 3DWTA 2QGCA 1TCMA 2QHRL 1QNZH 3FKUS 1BMWA 2GB2A 5D6DA 2DW5A 2AV7A 4QRPE 4EE2A 4ZMWA 1IQWL 2JB6B 2YRBA 4NO2A 3BH4A 2B4CC 1D9KA 3KYKL 4FNLH 4XCYB 4OCRL 2AQSA 4QLWA 3KYMA 3PV7A 4ODSL 4Y1TA 1OV8A 1RI8A 3TJHD 4QJ3B 1PLAA 1BV8A 3V5DA 2V2TB 3WEBA 1FZKA 1QBML 5MEPA 2FVNA 4OSUH 3IXTA 5FLVA 3L95A 3DUUB 4KUCF 5TE4L 3C12A 5I5JA 4R5XA 3VFSB 2JB5L 4KI5C 2XBDA 4PJIA 3UZQB 5IB3A 5KS9A 3QIUA 4WO4A 4PJXA 3QIWC 3SD2A 2RFXB 4KJWD 3OKMB 3STZB 1MREH 2HTLD 3SGEH 3MJGX 4MCNA 1ZA3A 1D7BA 5IESH 2WLLA 3GMMA 5JOFB 4QTHB 3HFFA 3NCCB 5G4OA 3TO2B 3O8XC 4KQ3L 5F1NB 2JV6A 2W59A 1S5HB 1TF4A 3F65A 3PGFH 3QEGL 1XL6A 3B9KB 1QRNA 3IDIA 5LQBL 2YPLB 3NFSL 2ADFL 3IFPA 1QMUA 5JPNC 1JFQH 4RRPM 1XMEB 3LNEA 2IJ0C 4GO6B 3G5ZB 3Q6FB 4IBZA 1MY7A 2NY4D 3TIDB 5F7NC 4XNXH 2NXYD 4RVBA 1Q9KB 3WO3B 4AGOA 3DYOA 1UWXH 3BSHA 1F4XH 1OAZL 1DQTA 4LF3A 5DVMA 5K33A 1URIA 5I75C 3TVMA 1GVIA 4DVBB 3GBEA 3GI9L 4TL5A 3R06B 2Q8BL 2YPVH 1EBPA 2QV2A 5JOPD 1J88A 2VT0A 3QUML 3U9WA 3WIIH 1AGDB 4PY8J 1I3RA 2WMPB 5FHBL 3VYPA 1ZLSH 3AS3A 3RBSA 1HL5A 4JQXC 1KCWA 3G04A 4GB9A 4NFBA 3VFGH 5ICZB 2WBJA 1A2YA 1BD2E 1KELH 1S9VB 2FO8A 2SODB 3OAWA 3TA3A 4B41A 5CGMA 5FYJD 2AGJL 1MFDH 3O6FA 1HCVA 1G5AA 1Y0LA 3FU9A 3C6LD 4PY7B 1TYEB 4HUVB 3LCYA 2GUYA 3BVDB 1K85A 1CF1A 3RB5A 3IYLW 4Z8FL 4O5LL 4UT6H 3TV8A 4FG4A 1GKEA 2CH8A 2PYEA 2ZG2A 3IGAA 1U4EA 2A2QT 1L6XA 4B9IA 1E5BA 2XN0A 2R7EA 4LVNC 3S3SA 4JFXA 4CSSA 1FORL 2EE3A 4NUGL 4YHZH 4F2MB 4QXTA 1IBDA 2OSXA 3CC5A 4OZHA 2IBZX 2YWYA 1E9OA 3DO4A 4P48A 5T33L 4XCEB 2G2RA 3IU3A 3HLAA 2UZYB 2VC2L 3SE4A 3KGSA 4C56A 4N0UB 43C9B 4LEBA 1U8JB 2XWRA 3RWCA 4MJ6A 1S7RA 3MA9L 2LGNA 3HMXH 4R26H 4UTAH 2ZAIA 1B0IA 1MCWM 4NPYB 4R6UA 1JNLL 1KGIA 3LN4B 5B1BB 5GRVK 3FT3A 3MV9D 4PBDA 4BKSC 2NW3A 1FG2A 3MCKB 4MSWB 1NINA 2BFVL 3IJSA 5D7SH 5BMFH 1EX0A 3FTGA 4MJ6B 3KLKA 4DKDC 1KGCE 2OQJB 1YNTB 5LCVA 2YPLD 5GIRA 2PW1A 2OJZL 4AJVA 2WNXA 1MI5E 5IVXF 5FECB 4XCEA 5JIQA 1MCSA 1U8IA 3ZIMA 2KHAA 1E9OB 1J87A 4HKJA 2OMWB 4YDVB 5DJ2B 2ITFA 4QOKD 4QXTB 5EN3A 1T80A 4X5LA 3VFUB 2K78A 3CXDH 5JPMB 3BGMA 4Z76B 3AZUA 4MNHA 5TTRA 3ZKMC 4D9LL 1T1XB 1L0QA 4BJLA 4PPTA 3UG5A 5HDOA 4QAWA 1BAGA 3X17A 5EF0A 4XTRC 3EHBB 1U8PA 4OBRA 2WXOA 5FWRA 3ES6A 1Y0LB 4PY7A 4FQHB 3DHPA 1FE8L 5PAZA 1MCRA 2K3TA 5I82A 4YHLL 5CJBA 4WTZA 4JDVA 4PMEA 1ML0A 1TVDA 2CGZA 5IB2A 3X12A 3MGTA 2XIDA 3GPSA 4NUPA 4MXQD 5JXEA 4OZIE 1IAKB 3WGUB 1MJ8L 4AENA 2HKHL 5TJWK 5IQ7L 4ODUA 3LH9A 5FPIA 1JAEA 2Z93B 1BVOA 5T3ZL 1HS6A 4NAJA 3VD3A 1OAJA 4DEPB 5C0GB 3DA0A 1JL8A 2AI0H 4PB0H 4A6YH 2DQDH 1TUPA 3OZKA 4L3CB 3D07A 1T3FB 1IC4L 3BLBA 3RTQB 2QQLH 4B9CA 2ZOWA 1TSRA 2EDQA 2R4RH 3GHEL 1F02I 1OCCB 1XXFC 3OX8A 1T1ZA 4EIZC 2MHAB 3UJJH 1DBJL 3TNMB 1OLZA 2WHVA 2VXTH 2O6DA 2DIJA 3NUKA 1JE6A 3BN9D 4XO5A 1F45A 1FZOA 1RY7B 1ZMYA 2RALA 4X7TA 3ULSB 2YN3A 2YD0A 4KXAA 4PJCF 4R84A 3QO0A 5E2TH 5I71B 1PG7L 1KENH 1R17A 3SDAC 1GJUA 1MIEH 3ULUF 1XO8A 3LRSB 4HF5L 3A6OA 4FTVB 3VXOB 2MNUA 4NWTL 1NKGA 1JWSA 5C6PB 5HP5A 3R8QA 1FGVH 1QO3A 3CVHB 4G5ZH 3QIWA 4XXDB 2YUXA 2FX8H 1QD0A 5JR1H 3F62A 1JERA 1KCRL 2BCKA 1F2XK 2WLLB 3UC2A 2OP4H 4AIXA 4M5ZL 4MJJA 4KPHL 2X44D 1YQVL 4K7PY 1RZGB 4RMUA 1G7HA 2R2BA 3E0GA 4G9DA 4KVCH 4YX2L 2ZYSA 3MLWL 4EQ3A 1KUMA 2C26A 3VVVA 1OK0A 3WL9B 1EFXD 5GGVH 3AU1B 3UZQA 5KS9B 3DUSB 1AJ7L 5E6RB 3KPPB 2HTLC 4XVTL 5I1CL 3TEZA 4X50A 3S36H 3HNSH 5E9AA 1QOKA 1UZ6F 2ZNXA 3CDCA 5CILL 5I9QB 1L6PA 1AYOA 1ZHNA 2Y07H 2WAHA 4TTDD 4JPKH 2VE6A 3P9LB 2CU9A 1WLHA 1ZHNB 4HIHA 5E4AA 3KPSB 3RDJA 1H8NA 1NCDL 3NSDA 1R0AH 1G0YR 5EG6C 4PGCB 1FGNL 1JF1A 1WIOA 2BIOA 1F3DJ 2DQMA 3GJFB 3RWDB 4F27A 5GGUA 5KAQF 3CVIL 4XCYA 1G4MA 5F9WC 5I30L 3DX1A 1AQKL 3S36X 3FQTA 2VW4A 1YEGH 4RA0C 4O2CA 2EEFA 1IAIM 3CGTA 4L3EB 1D2PA 3C08L 2TSAA 4MDIB 3T6VA 3QHTC 4YHML 2LLNA 1A6WL 2XETA 1RJZA 4HLJA 4IOSD 4PJEE 1E9QA 1XH1A 2Z31D 1NC4B 3VI4F 1FZMA 1NCIA 1E9PB 3AGWA 5MENB 4G6MH 3SPJA 4TNVK 1RULH 5IK3B 4PJAB 1RL1A 3V0VB 4YZFE 2B59B 2APFA 2CIKB 4ZUTB 3FFCB 4UZSA 3V8CA 1IV8A 1Q1PA 1T4KA 5CLZA 5HBBA 2I32A 2VXVL 4LNRA 4Q6YA 3VNZA 3OG6B 1S4IA 5FDYA 2YFNA 4PB9H 1AG0A 4UTBH 2AQPA 2YD8A 4L5FL 4PG2C 3MYJB 1PMYA 4CRPA 2DIEA 3P3TA 4MA7H 3V10A 1Z9MA 5HI3C 4FA6A 3NCJH 1J5OL 3FQRB 2IAMB 1BIIA 3MBEB 3DX2A 4Y2DD 5FFLA 1WZ1L 4R7NB 4NIYE 3HC0A 4F9LA 3IPBA 4D9LH 2H45A 1IIKA 2EXYD 2Z93A 3P4OB 4ZAKC 3ZQWA 1QTYT 1YY9C 4GXFA 5TPWH 1F13A 3EYUL 3WO4C 4ELMB 1PIFA 3MACL 2XTJC 3GZQA 3QZWG 2NNAB 4ZUUA 3NEXA 2R4SL 2WW8A 3UTTD 1J86A 2VNCA 1SLWA 5KYXB 1THCA 1RSYA 1YEHH 3IB4A 5B1JA 5JA9A 1XSJA 3ASWA 2W0LA 3FB6A 4OJAA 1YPZB 8FABA 1CFSA 3BVWA 5H37H 1EQWA 1M3IA 2DQ6A 3O3BA 1YDPA 3L3KB 4ODWA 1PZAA 5CCGE 3PPEA 3N04A 1NUNB 2C9XA 4YEFA 3QXAA 3WJMA 3BMVA 1NCAL 2ED8A 3GMOA 3FRUB 2CJ3A 4GI9A 3FTGB 3U0PA 1CE1L 1IZJA 2DMKA 3C5ZA 3IDXH 3JYCA 4U1MA 2EVGA 4PHXA 2CRYA 1CC3A 4U31A 2DYPA 1E28B 4ZXBA 4F8TA 3O6FD 3QZWB 3O6LL 1AQHA 2G5BA 2ZCZA 5B8CA 4AUJA 5KBPA 2HT4D 4HJUA 4TVUA 4YFLI 5B1AB 3MOAH 4NZDA 5HTSA 3TESA 4LT7A 3G5XB 1BZ9B 1JGDB 1KBWA 1IC7L 4I3SL 3BDYL 2JCCA 1JN6B 1KDIA 2Y36H 5ECJE 3SY0A 3TASA 3UPRB 3AITA 1XBRA 4C56E 3ASNB 2X4OA 3MLZH 1DJYA 1OP3H 1KNOA 3HE7A 3HKFA 2EDLA 4H44C 4P2OA 2XT1B 1FC2D 4G80A 3NA9L 5EIIG 4IJ3C 3L9EA 1JI1A 2IANE 1JZ6A 2P8PB 2YKKA 1PG7H 1BF8A 3QR2A 5DJDB 2W0KA 5D7JD 3OKDB 4RWYH 2A74A 4L23A 5BNXD 1KIPB 1V7NL 2E8ZA 2AJ3A 2FECI 1PZ2A 3NYKA 4XPGH 1D5XA 3HHSA 5TQ2L 1I3VA 5DK2B 5BRPA 1BQLL 2N0KA 4L48A 1JUFA 3GSVB 3PP4L 4ODBD 4WGVB 3IKCA 4PRPD 4UZUA 5IHZA 4WWKC 3I2CH 2ADFH 4LFHD 4JY4B 2LTQB 4W81A 2XXMB 4FAAB 4PD4K 3AWEA 2JTYA 1N68A 2C9VA 4GRWE 4QLRA 1Z3GL 2KZ1B 5CCKH 2R1WA 4ZJ9A 1HT6A 5CP7A 4IOFD 5MEOB 4EN3C 2E7LA 3HNVL 4HJIA 1I8LA 2J72A 1KPUB 3LZNA 2KZWA 1M1XB 1PD6A 4RDBA 2ATKB 4LLQA 1P6WA 1HSBB 4XN4A 4HLEA 2IVFC 1ODAA 2ZCLL 1HXMB 2MNJB 2AKRA 2ZF8A 3ILPB 4N68A 2XWBB 4KKZA 1KXHA 2ZP0T 4WFFD 3WTXA 2D31A 2L0DA 3WTYA 5IHLB 2M2DA 2O26U 3UDWA 2FIKB 2EUXA 5EB9A 1W0VA 2HTKC 1UD6A 3LKOB 4FXGC 4RRPA 4Z7IA 4IDJL 2WKLA 4J8RB 1BGXL 4F8PA 3LKOA 5EZJA 3QI9B 1DJSA 2PCPA 1DQQA 1UQSB 1QLFB 2RACA 3F12B 2Y25A 4NCDA 4JE0A 1HZKA 1C1EH 3BX7C 4R4NC 2MWCA 1Z9OA 1WPCA 2H0JA 1RHHB 2YA1A 1NAMH 1YMHB 3WIFB 1F6LL 5IBTL 1MIMH 3DIVA 5DZJA 3IU4H 3QDAA 1BJ8A 7FABH 1P53A 3IN0A 1UD2A 4TXVB 4IJTA 4Y2NA 1FQ9C 1HXYA 3LQZB 3Q5TA 4JO3L 1N5YL 2DLEA 4LHUG 4MS8C 2A9ML 1OPGH 4U0QB 1D6VH 2CO3A 3SJVE 4DN4H 4EIBA 3EW3B 2HFFB 4P05A 5L8LB 2FSEA 1OHZA 4QRUB 1BD2A 3NH7L 2C3XA 2BVEA 3RA7H 1WZLA 1ZK5A 1G7QB 3KPQA 4PR5A 3ZE2E 2ZUYA 1E4WH 2IMNA 2WQRA 3CFCL 4U6YA 2XV2A 4N2BA 1OOWA 4NO2B 3DV4A 3MUUA 2WGNB 3MUZ1 1DJZA 1P5VB 2A74B 1I7RB 1QUPA 2EAEA 3PL6A 1P4LA 4IRJB 2HH0L 4FZ8H 3HI6L 1IGFL 3L3GB 1A66A 1RK1A 2CNZA 5F96H 1IAIH 4H88H 2F68X 4XPBL 1ZLUK 2V7HB 3L3DB 3WTSA 4GQ9H 1BIHA 1KYDA 1EFXB 5AVWB 3K81A 2MCPL 5CBAB 4G80B 4N24A 6CGTA 3QZLA 3HE7B 2WLIB 4R7DB 3K72B 4S11A 5C0DA 5IF0A 3RFZC 1UB6B 5KZCD 2CHNA 1YEKH 3FCSB 5BS0B 2V2WA 4HP5A 1KZQA 4XRCB 3LKNA 3V6ZA 1I7ZA 3JTSB 5E4EC 4U3HA 4YQXL 1YECH 1HH6A 4UM9A 3NVQA 4NSKA 1XTLA 4LKCA 2XN9D 3ILDA 2H32A 2BXZA 2WWOA 4HQQL 3WKNA 4U1HA 1GS6X 1SDDB 1B2WL 4RFOH 3NK3A 3RFRA 1WA2X 4K3EH 4LLDA 3I6LD 4Z7QB 4WW2B 2J56A 2OMYA 2FO4B 2VO5A 4DK6A 5I1JH 1F58L 4PRBB 4RSYA 5D7IF 1S5IH 3ZW3A 4OV6F 4B27A 4HD5A 3EFFA 4NQVB 4W9DC 3L3HA 2FIRT 4TF4A 2EINB 5DK3A 5GRWA 3T04D 2ORBH 5EU6E 4PYHA 3US0A 2BVQB 2J4WL 2GC4C 1A1NB 2HMID 1MCQA 1C7TA 3DETC 4WFGE 3SE8H 5DC2A 1BVKB 4HGMA 5CGBA 4PJ8D 4CDGC 1CFSB 1N0XH 1ZTMA 3CCHB 5GGRA 3KCPA 1Z0NA 4YPGB 3ZYJA 4JM2A 4MAYB 4YDLB 3WN5A 4NI6A 4D0DB 2NR6D 5EH1A 4MAYA 2P80A 1WEJH 3UC0H 4BKTC 4WI7A 5IB5B 4M5ZH 4XWGL 3CFKB 4RNRB 1BVKA 2OR9H 4P9HC 5F88A 4N20A 4XC1L 3TT3H 4FQCL 3T2OA 3GZPA 5J1AA 1RZ8B 3D39E 3CN4A 1AGCB 1TZ8A 4HIQA 3ZTEA 4X80L 4XGZA 1UKSA 1ESOA 2HG0A 5LAXA 1NGQH 1VPOL 2BP8B 3GB7B 2A73B 4QI3A 4DGIH 1CYWA 1MFBL 2IAMA 3BAKA 4O51A 5KBMA 3FQRA 1RZKC 1NEZG 3NIGF 2WXPA 4X0KB 1R6VA 5E6IC 5FO7A 5SWZE 4WW2C 2YQGA 2OYLA 3MYJA 4DKEH 3FAXA 1TTUA 1X7TA 3EO1A 4ZO9A 1EBAA 3FU7A 4MYPA 3LOWA 3QDJA 4PJCE 3QQXA 1QSEE 3MJ9L 1I8KB 2ITCB 1DE4B 3FO9B 5C0EA 5FXCH 2R27A 2NY1C 4U2ZA 3GDBA 3JTSA 2D9CA 3O9WD 2RAMA 3RI5F 4FKKA 4ZDHB 4P3CH 4XP4L 4RGNB 4KH9A 1K4DB 1RUQL 1JVOA 3LKRA 2FH8A 5C0DB 3ZL2A 4WTQA 4JKKA 3PWPD 1H6UA 4FF9A 4OZFG 3W3BA 4B9KC 4Z7NB 1F5WA 1XR8A 2O5ZL 3FUEA 5D5MF 3ECBB 1T7ZA 2BNRB 3HG0A 5HVGB 2F8VA 1R3IL 4C59B 2YUVA 1HHJA 3ARBB 4CADA 3L81A 4X8CA 3CSPA 1HYRC 5TDOB 5EEUA 1QEWB 3PDOA 3GS7A 1P5VA 4K9JA 4ZMVA 1RZKH 2Q76B 5D2LA 1JGLH 3CHOA 1QLEL 1CGYA 3KDMA 1MOEA 2DQJL 1ZOXA 5SX4I 4NKOB 2PYFB 3E38A 1F11B 4OT1H 1KJ3H 4AYBA 1T89C 2C9AA 1C08B 2J6EH 2CR0A 4AC2A 2ODHA 2EABA 4KQ4H 1BEYH 3P9LA 4OFYA 4F15C 3EYQD 5FUZH 4K15A 5F9JB 4JRFA 5I1GL 3LXUX 4ZFOB 3TF7C 3BT2H 5GS0L 5L6YH 3UTTB 2HT4C 4DWHA 2EKSB 4LSUL 5C7XL 2KS0A 2WZ5A 3KLQA 4MLSA 4K71B 4WFFE 3SGKC 4Y4KA 4F37K 3WL9A 1T5XA 1TZIA 3PCYA 3LQAC 3N85H 5DD0L 4S0HA 2HZHA 3N1PC 1KEMH 4ZS6D 5CILH 5D7JA 5IV2B 3NCYS 2WYTA 4X80H 2EIEA 1I1CA 3CZJA 4HWZB 3S36L 2OR7A 3DIFB 3FQNB 2KKQA 2JWYA 2W9LA 1NCGA 4A7UA 5K9QI 1PSKL 4FFZH 4J8RA 5C0BD 3O4LB 3RZCB 2PPCA 3JV4B 3ARPA 1B9KA 4GW5B 4YIQB 5D2LF 4OJEH 1SXNA 5LBGA 3TIEA 1Q1JH 2AK1L 1G9HA 3I6KB 1FJ1A 4PV1C 2BOLA 3KWUA 4KI1A 1E5UI 3BQUA 2B39A 5D2NB 1OD9A 5I8CA 4PJ6A 3O9WB 3P9WB 3MXWH 4TS6A 4HJ0D 4PJ5A 4GRWH 1PZDA 3TNMA 2C4FT 5CEYA 4JRYB 5AEAA 1BOYA 3S3PA 4MCZA 5IJBC 1T6VN 3SDAA 3AJ7A 2F1EA 3QCUH 2E7CA 2ROYA 4PJFF 3WFEH 1R9FA 4Q6IA 3VACA 4W68A 4P8QA 4C4KO 5E1AB 3APCA 3QYMA 3ARED 3D51A 3TZVA 4UUJB 4R7XA 4QT5B 1ZDQA 3VI3F 4IHBA 5ITFA 4HGWB 4Z7OB 2NDFA 4AENB 4NI3A 4RFOL 3VB9A 2DM4A 3RGVB 3MLYL 4CGUB 1DBMH 2JMRA 1ITBB 2HX7A 3ALWA 4QWWC 5DJZB 2Y7LA 2EE9A 5T5FA 3CH1A 3LB6C 1WISA 3ZKND 3MV9A 3QIBB 4NENB 1ZT7B 1NBQA 1R33A 4PS3A 2DV6A 4FC3E 2XG5B 1XF5A 3D9AL 3X3FL 3FCGA 2V33A 1ZLWH 5I18H 4G42B 4HBCL 4NT6A 5I6NA 3BPNB 4OIIL 1DQDL 5AOKA 3H9SA 5B39G 2SEBA 2NUTB 3OR6B 5KANI 1AIZA 3VXMA 1CU4H 2A9NL 4HU8A 5JHAA 2X9ZA 2PPAA 3E8UL 4DKFL 1O0VA 3RFZB 2D3VA 2K4WA 4KDVA 1BZ9A 2MMXA 5FOBA 3HLKA 1U3HB 3QG7H 4ZMXA 4M5YL 4GYBA 4AX3A 5LCVL 2HJLA 4KK5C 5DJ8A 2PUQT 2OXHA 1MWAB 3LPGA 1FG2B 3ZDZF 3L5HA 4LEXL 1GY1A 3KWXA 5GRUL 1JXJA 1S9YA 4AUYA 4LEEA 1L9MA 3N0PB 1WA1X 1IRAY 1XL4A 3PPSA 4P3CL 1DUYA 3QQDA 1JYWA 4J23A 3MCG1 2HJLB 2R0LL 5FYJL 1KB5L 1MJUH 1MUJA 1FFOA 2VDKB 3FRUA 4XZ4A 3EDJA 2CLRA 1KIQB 4Z7UB 1CXEA 5F7LB 2XWCA 1A5FL 4E42A 3RWIA 1MQKH 1DLHA 2J8HA 1M71B 4YSRA 3GSUA 4M1GL 3PAUA 2EP6A 1RZIA 1SJEB 1DVYA 1DBAH 1ADWA 2EXSA 4GOSA 3FNKA 5HDLA 3JTTA 1QLEH 4OGQC 3IGAB 5FGSA 1AY1L 1IGIH 3MJ6A 4BFIA 4BE6A 1BQHG 4KBPA 4R90H 2ZXQA 1SUJA 1JXDA 3F7YA 2ATPA 3KPRA 3OJDA 1ULVA 1KJ3L 1YRKA 3ARGD 5DS8B 3F04A 5EORL 5EUKB 5FKAA 3AMLA 3QZPA 4L2YA 3LHAA 3MLSH 1JPTH 2ED6A 1KBPA 2FEJA 1M9WA 3VGEA 4HGWA 1UG9A 3QUXC 3T1WA 4YZFF 4A7GA 3O3EB 4GUQA 3FFDB 4OLYH 1SQ2N 3EZJB 4WUUB 3FCTA 1ILUA 2ZYHA 4FI8A 5JIIA 3HIZA 4YE4L 3QQ3A 4S2SA 4QO1B 3RILA 2GJZB 4B9PA 2O1AA 3NCEB 5KYUA 2E6JA 1NICA 3PXJA 1AQ8A 3QNZB 3MV7E 3Q2VA 1E50A 3BSZA 5C07E 3F7RA 1ZT4B 2ARJA 4PS4H 3GBLA 2Y2TA 2ALAA 4M48H 1ZGLM 4LAJH 5F7DB 3DVIA 4EDWL 3BH9A 3ZIYA 4W4OC 5AW9B 4PJAA 3ABLB 4HXBH 4I8DA 1Z0MA 3HR5A 3LB6D 2AABH 3CPUA 4PU2A 3ZKNC 4DKEL 4ZW5A 3DDGA 4LASH 2F7IA 2UWEA 5FW7A 1BPVA 4OTXL 3DX7B 3GXIA 3G6JE 3TO2A 1E9QB 4JCLA 5HYFA 2F9BT 5EO9B 4MNQA 4MA3B 4ANWA 1UZ6E 4NQXB 2R0WH 1M7IA 1F97A 3STZA 1E43A 3QDME 4TSAL 1RZ7L 2XYCA 5IVZB 5F3FA 5KSVA 3QIUB 1BVLA 4WO4B 2MOGA 4KMTL 1PKQB 3AQYA 4MDJB 3DRQB 2ZIDA 4QHUB 4X5WA 3MCYA 5GGUB 3HAEH 2KPWA 4XO3A 4K73A 4XNQB 1AXSA 1BCIA 1DBKL 1SY6L 4JDZB 2Y36L 4AIEA 1P7QD 1ND0B 7PAZA 5J4MA 1ZS8B 4G8IA 5HD8C 5I8EB 4PJFA 2VE6B 1P4BH 4TSCL 1BXAA 1S5IL 5JORB 1QBAA 1Q38A 1KTJA 4EKJA 4Q6KA 2VDMB 1E0OB 2VCOA 3O2DL 2HLFD 1CR9L 1P84J 2YC1A 5DA0B 5C8JA 4Q89A 4CN1A 2Z4QB 2NT0A 4E9RA 1NAMA 1ONQA 4LMQI 4UWQB 2PTUA 1GXEA 3H3BC 1PLGH 4M5TA 1G9EA 5CJQL 1DANT 2JFCA 3HZYA 4Q58C 1WK0A 3F58L 4JO1L 3TBTB 5GSVB 3K5SA 3F7VA 1J5HA 2Z4TA 1TEFA 1HCFX 4W9JC 4YSCA 1BZQK 4YK4B 4KX9A 1AXTH 5FF6A 5CJ8A 3ULVF 3N40P 4UNIA 3T3PF 4NHUB 1CYGA 1K6QL 4N8VA 3WFCL 1ACXA 2D8KA 4EI6A 4ZD3H 5FUCE 4J3WA 5HHPA 5E8OB 2IWEA 3Q8FA 1GRWA 2R1XA 3BAIA 1IBFA 4PJ9D 5C0ND 3TCLB 3QDGD 4B53A 5A2CA 4CC4C 2WYZA 4FEMA 4F2EA 3DSFH 4MJ2A 4P04A 2WXNA 2D3JA 5F70A 3ROLA 3VD1A 3HI6H 3RB7A 3DVNB 3LS4H 1N8ZB 3VCLB 1LYQA 2B4CH 3EG9A 3H2QA 4QJ5B 4KZDH 2J12B 3K6NA 1E6JL 3JWOC 4WI0B 3SKJL 5I0XA 1EGJA 1R4XA 3U7YL 4KDTA 3N41B 4JN1L 4MQXD 1FNFA 2BERA 3TO4C 4OGYH 1CLVA 1U8HA 2FWLB 4H5SA 4U49A 5D7IB 5A3IC 3RDTD 4DAGL 1Q72H 4NXSA 3MHZA 4K94C 2QQNH 4C83A 3HE7C 2I24N 1TQWA 4ATTA 3KVQA 1E3FA 1YEWA 4DSYA 1BYNA 3WFZA 3W9EA 1TYRA 1JXGA 5IB2B 2CIIA 4PI2A 1J1OL 2B9AA 1RPQA 3MDJA 3FTSA 5CEXB 3DROA 1E7UA 1N12A 5DZNA 4I3RH 4YWGL 2A74C 1FH2A 2AXFA 4WTZG 4N4YB 3RL2B 1G9NC 3WN5B 4CMMB 1Z2KA 5CN1A 2X3BA 4OJCA 4DOHB 1OE3A 5EOCL 1WFUA 5GS2H 1HAWA 3OAZK 3WHXB 1MW0A 4OLWH 5BZDB 3AB0C 1NC2A 1J0ZA 1S9WB 1BVNT 3GMPA 4MAUH 4NKQB 3CPLA 4IYKA 3EUUA 3Q43A 4U3CA 3TA3D 2XZQL 4PLJD 4QRTB 4RIRA 3VXME 3CLFL 1NFKA 2HKFH 1TLMA 3AREB 4JRLA 2RTTA 1PLCA 2Y72A 1YO4A 3DJSA 1F4YH 4UOW0 1UACH 3LRGA 5HYQB 2XPYA 3K2KA 3CTTA 1NWPA 3L9YA 1MCCA 4QF1B 4YXKL 3B3BA 3AM8C 1AJ7H 2CHZA 3TO4B 4NQEE 1LE5A 5ES4B 5DFAA 3MLUL 3VD9A 2XOTA 3MRRB 1HOCB 1JD9A 3H9SD 4APQB 1VENA 3B8SA 1U8QA 5EOCJ 1ET5A 1TTGA 4P2RA 4DK5A 1NMBL 2DDQH 4J6RL 5KTEH 1UM6H 4PTUA 3D2UA 3RP1A 5CBAA 1OGPA 1QUNA 3QJHA 2DYRB 1BFVL 1MAJA 2VDNB 5E6IB 4A2GA 4BDVB 2ZJSH 1BLNA 5IMKA 1LLAA 2E6PA 4UI2A 4XP6L 2QPEB 3EOAB 1DBKH 1JPFA 4NFCA 4H2AA 3S4SB 4DPBX 2WANA 4HWBA 4YGVB 4XB3A 3KBPA 1KCLA 4UDUB 3VDBA 2D0GA 4WWKA 5AWNL 2OKMA 5G4MA 1RJYA 4M9OA 1SNRA 1BP3B 2E86A 2YAPA 4NC1E 4TRPH 4L1TA 5L4JA 3IFOA 3IMBA 2FSEB 3UXFA 4KZCA 3EJZD 1TZHB 3RNKB 5IWLA 1FNLA 2W5PA 2VJ0A 4PS4L 4ZQKB 1TETH 4HX1B 4KJYB 3NK4A 4PJAF 1CFNA 2F53D 3D0LA 1AQMA 4ETQA 2YGVA 3LKPA 3UJJL 5JIPA 2E75C 3MLYH 4LF3B 4NHCH 1COBA 3OKLB 2YZ8A 2NY7L 3FU0A 2AJUH 3SYQA 3HR6A 3TL5A 5T5NF 1JPEA 3NP4A 3JVGA 5LHDA 4PJGB 1B4JL 3MV7A 3TPUB 3E3QC 1ZLWK 4OQTA 4APXA 4GUOA 2BFGA 2Z35B 4M6MH 4HIIB 1FCCA 4M02A 5JPNB 2LW3A 3JVFC 1HC1A 4GAYA 1VSCA 5MEQA 1SXZA 2UV3A 4PJBE 2R69A 5JUEH 4IRZH 5EU3B 4M7LH 3BMWA 2EIJB 3GSQA 1IMHC 1WFOA 3G7TA 2XN9A 4ADJA 5C07B 2GIMA 3MV7B 4GP4B 3QUXA 2X05A 5MEND 4ZPVA 1DANU 4CNIA 4XOEA 4ODTH 4GSQA 3ZSSA 3X13B 3DJ9A 3T6XA 5EEZA 5DSCA 4ZD3L 4EF3A 1G7IB 4FFVD 4S0TD 1MKFA 2DLHA 2AZAA 3NJJA 4ZOCA 5EV7A 3EADA 4AWJC 5CP7B 1H5BA 3VFSA 2Y06L 4WUUE 1A6WH 3WKML 1XSKA 4S10A 4OCNC 3UADA 4KROB 4DNLA 1YEJH 2WXHA 3IXTB 4KGLA 3HBPA 3V5DB 1AI1L 3S96A 4OFYD 5FYJH 3IKCB 2VC2H 3GUTA 5B7FA 4R9HA 3KYMB 2IQ9H 4L4VB 4F8LA 4UDUA 1UB5A 1T2QH 3PGCA 4ORZC 1MCOH 2J6EA 4LEXH 1OP5H 4PTTB 4QKXB 4A2DA 3S4SA 3WXVH 3B9KD 4KKNA 5J57B 4R5VA 4TNFA 1EA9C 3OKYA 4QHMA 2O6PA 2O4EA 3AB0B 1IC0A 2QT6A 4H20H 1RERA 1LJMA 1BLNB 4G6FD 5IVNA 5D6CB 2A5UA 1J1PL 4EIGB 1OT2A 3Q2LA 4P2OB 5A3ID 4YSPA 3JZYA 2CRZA 4Z7UE 5HJ3B 1CFVH 1W0WB 1HNGA 2O5YH 3P4MB 2COVD 1LE9A 4PJ8B 1EAQA 2JJTA 1A7BA 3C6SA 2H26B 3AAZA 4JO5A 4BCYA 2WLKA 5K9KA 1X5XA 4M6ML 5GGVY 3IGFA 5AVTB 5IBUB 3IFNH 5DO8A 4ESKA 4F7MA 2YEZB 3PWUA 1LO2L 4TM9A 1S46A 1KBKA 3LNIA 2FAUA 3AG1B 4JZOA 4KTGA 1D5BB 5IHUL 4I48A 2FYVA 1UT9A 2VITA 4NAQA 3SOBL 3U2IA 1O9WA 2F8XC 5HGAB 5EU6D 3ULVE 1CGVA 1JZ8A 3QRLA 1RZPA 2DWYA 5F6HI 4AEIL 1YYLL 5DUBA 2FJUB 3F6IA 1A3RL 1MI5A 2XLLA 1MCJA 2VZUA 3JWNG 3KBEA 4AM0B 4JFHE 3DXAD 1UXSB 3GKZA 2EZ0D 3L5WA 3AT8A 4LBAA 3UZEA 2OAAA 4DQOH 3IKKA 5A6LA 4U6HA 4BFGA 1VPOH 2DLFH 5AYUL 3HBQA 5I30H 3JBG7 5AQ0A 3QWNA 3MRHA 3HS0A 4NBYB 2WBXA 4E9QA 3ARFA 4XVTH 3SGDI 1G0XA 4YHNB 3WBDA 2Q86A 5EFIA 3ATBA 1A9VA 1XIWB 3REVA 2OXGB 1IAOA 1UXLA 2Q8AH 4LPXA 3G3LA 2MH4A 3T2NH 2AXFB 2LFEA 1UZGA 1E3XA 4Y16A 5CP3A 2P5EE 5CLYA 1H3UA 4XP6H 4CVWA 1P6FA 3B6SB 3K2MC 1CVSC 1UWGL 3KL0A 3OMIB 4H4NA 4H40A 3QPQD 4ZUUB 1A47A 2JCCF 4DP1X 1QX1A 2YOAA 4ELMA 4UQBA 1GIGH 2EYSB 3QAZB 4NZTH 1OP4A 5IGXH 1NGPL 2W1NA 3GNMH 3IFNL 4WI6A 5DRXB 1FCGA 2PWHA 3C8DA 3KDPB 3RWGA 3UO8B 3MLXL 3OWRA 3HS8A 1KCRH 2OSLB 3QG6B 3S9DB 1D6EB 2QSCL 3ZSTA 5KBKA 3TYGH 2QSQA 3IRCA 3MJWA 3SKNB 5CSGA 4Y4KD 4KROC 3UBXI 1UTDA 1G1CA 3GBNH 3BDBA 2OTPA 3VXQA 3T0ED 3N5AA 5ISZE 4DHLA 5T3XL 3ZUNC 3ZY7A 4KTDL 4Z3JA 3ZT5A 4K9EL 5DC0A 5EU7E 4JAMA 4P99A 5TF1H 2CK0L 2MCAA 4J7RA 1BZDA 3IJHA 1GGBH 1BEXA 3FOLA 4HHAA 2QEJA 3QNXB 4I4WB 4NN5B 4KQ4L 3S37L 2B59A 3QDHA 2F19H 5A7BA 2CBPA 2R8SL 5JMOC 2Y1AA 4AEIH 3GK8H 2DQHH 2YKLL 4WZ9A 3N42F 4K7FA 2DB8A 2X42A 4IIQA 4K23L 2QKIA 3F7VB 4HIJB 5D4HA 5KVDE 3X1FA 3B2PA 1A22B 1OGTB 1C5CH 2DI8A 1Q0YL 2OS7A 4KI5D 3U7WL 4O2CB 3WTUA 2BSEA 2QV4A 2VKXA 1BBJA 12E8L 5C2BH 1BAWA 1VGKB 4I87A 2DM7A 4TVPD 5GS0C 2VQ1B 4YNYA 1R3LA 3FO2B 2R56L 4M43H 2R23B 4TKWA 4WSJA 1R19A 3FRPA 2LLLA 3KW8A 2DWDB 3BEWB 4WKZA 1PGRB 3RJDA 4ZYKA 3MNZA 3QHFL 4AYID 3ESNA 4N85A 5DF0A 4NQDB 1N6QH 4FHKA 3S34H 3TT1L 3ETTA 3DUSA 4A7VA 4CN6A 1I9JH 2PPEA 5DQ9A 2UZIL 3DSNB 4O58L 3VWJD 3FB7B 4ALAC 3UAJC 2DQTH 1QSZA 4Z7WB 4GSDL 5KWYC 1NAML 4XO9A 3V0DA 3WTTA 2J71A 4P23A 3HG1E 3PJLA 3T2PA 5BRZA 3BSZH 4JHVA 1FN4A 3B9VA 3GBNL 1QO3B 4J4PC 4GEIA 2IAMC 2KMWA 5CIPH 1K6QH 2NY4B 4Q4IA 2XBTA 3QJZA 2X0WA 4PJCB 5IQLA 4HPYH 4NN6C 3BH9B 1EEYA 2IGLA 3F05A 2XV0A 4GIPD 5SWZB 4ICWA 5L2JB 5ABZA 3ZTJH 3SBWC 4PGZA 2F74A 2Y5QA 4LL1A 1U2HA 1MCNA 5JUEL 3MRQB 5F8QC 1AZVA 5D6DC 1I8IA 1VFBA 2FGZA 4AE1A 3CLEL 4HUCA 1OSYA 3WAJA 2GJZA 4BK5A 3TNNA 1L7IL 2EE6A 2WWKT 3U0WL 2EH8H 3OKKA 3ULAB 3CD4A 2FJFB 5LBSL 1S7XA 2X4TA 3K6IA 4CSPA 2JI2A 4U1NA 1MI5D 1M7XA 2YPKA 4WUUA 3RX5A 4LLYA 4AEHL 1M05B 1HE8A 1RSFA 3QUKA 5E8EB 1GYCA 4J6RH 3K2UH 1NEZA 4LVNB 1CK0L 1KGUA 2JJVA 3VGDA 5HSFA 4NPJA 2Y5EA 5DCCA 5SWQA 1U3HC 4XMPL 5SWSB 2JKNA 1JWMB 1IAKA 3SGDH 2NY1D 4LP4A 3X12B 2GT9A 5AWNH 4LPUA 2VIRB 5MHSE 1ZEAH 1WWBX 4WW2F 4G1EB 4PJDA 3H2PA 2A9CA 2YXWA 1OAKL 3PWVA 1TTRA 5EOTA 1HAUA 1MNUH 3V0WH 1MHCA 4AQEA 1F58H 3ATDA 1J0KA 1HFUA 2GHWB 5HPOA 5KBDA 3A6CL 4ZZKA 1FNGA 3DVGA 4M8UA 2K45A 2ENYA 1HI6B 1USZA 3F6LA 4P5TD 3BZEA 2YEQA 3IMVA 1RCYA 4GG8A 2ZOKA 4MX7A 1WFTA 4AV5A 1NL0L 1SJEA 3H56A 4KZEL 1NKRA 4HQQH 3P4NA 1DP0A 3HE7D 5KTEL 4HKJB 4FQIH 2WD0A 1M9SA 1G9NL 3L4ZA 4OZFH 2F58L 4E42B 4ENED 4BUQA 3DXAB 1JPST 2MOVA 1JZ2A 3VGBA 3FXIC 5FK9B 2O5ZH 4GAGL 6TAAA 4WV1A 4HUXA 3REWB 3NSXA 3UEZA 4CSZA 1ROWA 3MCKA 4MSWA 5FYLL 2XVGA 3P30L 4R4BA 3BO8B 2YN5A 4QRRB 2PYEE 4WWNA 2OXHB 3N9GH 4NERA 4X98B 3WHE1 4Y16B 1I9RL 3BKML 4QHLB 3ESOA 4ZQTA 4MNGA 4WSGA 4MXQC 3KR3L 4K2UL 1UYWL 3CLFH 3C8KA 1R3JA 2YSSB 2EH8L 5JA8B 3UAJD 1VFAA 4U1KB 4MRBA 3D18A 4Y19A 3V0IA 4N5EC 1S7TA 4JANA 4RZCA 2JQZA 5GPRA 4B9FA 1NCTA 5T3ZD 1SXCA 2XRAL 1J1XL 1NGQL 2DWXA 2CGYA 4YFLF 3SJVD 1SXSA 4F37F 1CCZA 1H15A 1HSAA 2K6YA 5HDRA 1ZT7A 1SBBA 3D39D 2Q7YB 1VKXB 1KTDA 3NTCL 2X4RA 2PWEA 3V5KB 3GSWB 3ZE2B 4G43B 2J25A 1E3ZA 4J6IA 1I1AB 2IPTH 4XC1H 2AS5M 2HPOA 5DUBB 2I9LB 1WBXA 1HZHH 5A1AA 3ATAA 1MXDA 3AACA 4BGDA 1Z5YD 2P24A 1A6ZA 2ZAHA 1UJ3C 1JRHH 5E0QA 3LEVH 4U0RB 1XH2A 4G8GB 3FQXB 2F7RA 4QRRE 3V5HA 5DZOA 3O0RL 3NP3A 1UZ8B 1I3RB 2WMPA 4XMLL 3E8VA 1DJIA 3J07A 4KJQC 5E5MB 5HI4C 1DSYA 5HHVH 2DM3A 5K93A 1QSFD 3HI1B 2BNUA 4RA3A 1NTDA 1YEDA 1ID2A 4KY1L 2VRKA 2ZOOA 1IGTB 3FTWA 1NLDL 4LSTH 3P77B 3TVMB 1MRCL 5EIIA 2AJXH 2YK1L 1FG9C 5CN3A 3CDZA 4M1DL 3EUDA 5GS1B 3VSQA 3MODL 3SPIA 1TPXB 2HFEA 4LRNH 3ULVD 4PREB 4OZHF 5J3HC 5DHVB 4LSDA 1C12B 3I6LE 2F58H 2ICEC 4EN3A 1SLVA 4NO0B 1QRNB 4UOJA 5ETUA 1A3QA 4EUPG 8CGTA 4RGND 3VWKB 3UGXA 1CFQA 1RU9H 1WZKA 4FG2A 4MHHG 5F1NA 1X4XA 5J11C 3DIFA 5C3LD 4Z7NF 12E8H 1DVFC 3HBGA 5E94A 2N4IA 3O11A 4KX8A 5A2BA 5ELIA 2ICCA 4HD9A 3Q13A 3HUJB 3RX7A 3FW6A 5SWSE 2G5RA 4TNGA 2BK8A 3D3VA 1OZUA 3LN9A 3R7RA 4X42A 2RFXA 5HYSG 4L8SB 2CHDA 2XQYA 3NA9H 3VXSA 4UIKH 3VSTA 4Y4KB 1JPGA 3HC3H 3JV0A 1UUNA 2CE6A 4FQ2L 1ET8A 5LNDA 4FRWA 1G7IA 4IRSA 1IGMH 4XN2A 5K1JA 4JZJC 4PWHA 3BE1H 4HIXH 2WUBL 5FA4A 3GXUB 3DUUA 2X4SA 4KK6D 2YFOA 3L4WA 4X6CE 2CRIA 2IADB 1R0AL 4LARL 1NIAA 2OPCA 3MNVA 4AMXA 3QPXH 4IMLA 3GSQB 1PQZB 1OAKH 4P2OC 3RVUD 3ZHLA 4FG0A 1MCEA 3FCBA 4PJ9C 5C0NC 4ODXB 1FYTD 2R2EB 2PCFB 3OSKA 1S78D 3RWJA 1LWRA 2FQGA 5FW8A 2YD6A 2N7BA 4BRVA 2V37A 3W0WD 5L2KE 2JB6A 4APXB 3V0EA 1O6VA 2EDXA 2GAZA 2WP3T 1TZOA 5ERWB 5TDOA 2VW6A 5F6IB 5K9OB 5HVFB 1RUAH 2QSCH 2C9RA 2XJLA 5DVLA 1GKOA 3ECBA 2W91A 2FATL 3P2TA 4PIRF 2XYBA 4NZTL 1WHPA 3D85A 3EGXB 1UT2A 4LDCA 3UCQA 3BHBA 4GSRA 5E6ZA 1XB3A 1YJDC 3K5RA 3LXCA 2PTTB 4DO4A 3B9DA 3GJFH 1H8SA 4OLYL 4LASL 4ZQKA 4QXVA 4ZDHA 4FP8H 1L3WA 2CLVB 1RLBA 2HLEB 5FYJE 1QBBA 2NQDA 4KTEL 1AY1H 4UOZA 1OGAB 2LV4A 3QUXD 4TULH 4K94H 2WJ5A 4XC3H 4X6BB 2IGFH 2ZUWA 4OLWL 3NJIA 3FBQA 1MFEH 3HG1A 1GCYA 1SM3H 1Y1DA 3JWDL 2B15A 1DBJH 1EGJL 1N5AA 2R0ZL 5DJXB 3TBWA 3UYRH 3ALXA 1AZUA 4PHZA 4QNPF 3S88H 3VYOA 3KNBA 4JHAL 5I1GH 1MF2H 4OD2A 1UKTA 3WEMA 4IGBA 2ERJB 4LHJB 4JY5L 1XZWA 4NRYA 1FL5A 1FIEA 2X88A 1HN1A 4XMVA 4HETA 1I1FB 1VACA 1J10A 1KDJA 1HYSD 4TLTA 5EULV 1NFDF 2GK2A 5J3HD 4ODHL 3ZE2F 1U8QB 2VDLH 1ILSA 2FQDA 4ZO8A 2HPTA 1IBHA 1SOQA 4QOKA 4HWBH 5G4NA 4F7TB 4YHYC 1I9RH 3D12B 3SOBH 5IEKA 5A2IH 2R0LH 2RMNA 2HRGA 1IKNA 3P3RA 4AK2A 4EZJA 4L9LA 1IC5L 4X6FB 5F9DC 2VN5A 3PWLB 4PG2A 5E2JA 2VLRD 4G6ML 4BXSV 1NCCL 2VABB 4AGPA 4PJHF 3W5MA 4Y7MA 3B9EA 1LEGB 1R24B 4IKJA 4JMXA 2X4NA 4M5YH 3RRQA 3SGJA 3GGWA 1CLCA 2Q3AA 5ISZB 5EUOE 4UF7C 3L3HB 1VHPA 3CG8A 3A6CH 1WWWX 2Y7SA 3WAKA 3SDCA 3TBSA 3NZ8B 4JFOA 3QUHA 4WI9A 1ZHLA 1NL0H 2CO4A 1D5IH 1DBAL 2YLKA 3FQUA 5DTFA 3ZDZB 3B2UC 5FAAA 2VABA 3B56A 4PRID 1HIML 2Y2YA 2W95A 4OQTH 2LT9A 5C0FA 3B2MA 2VDQH 3CSFA 5TQ0L 2GEEA 4PJAE 5BUAA 5T8IA 4PJ7F 2HVJB 2EDBA 2GK0B 3BGFC 2PR4H 1L3NA 4A2HA 4N2HA 4HUNB 3C6EA 1A65A 2ZKYA 2ZUUA 3P0VH 4WJ5A 4GG6F 3IDNB 2BVOB 1OTUD 1QPKA 3IVKB 2FGWL 4L8SC 3AMKA 2D3LA 4KJQD 4LRIC 1HKFA 2WLIA 4JCWA 1W72B 3TX4A 1DEEB 4AYFA 2J73A 2WQAA 3W56A 5D7KD 4XN7A 4KOCA 1HWHB 2XZAH 2PF6A 3RZCC 4DF9A 4I77H 3C60A 3HHMA 1E2WA 1TQSA 1RLWA 5DMGD 1RVFL 4KPHH 4IBWA 4XN9A 3AG4B 2IWKA 2C7FA 1N19A 4XMZA 1A9BA 3M17B 5HHNB 5GGVL 3P2DA 4RZKA 1N3NB 3I3EA 3G6DH 3AGVA 1Q8MA 1DBML 2E9GA 2XTSA 3QQ9D 3KPQB 3EO0A 3OPUA 2J4WH 4U6TA 4A38A 1FAKT 1MLBA 3QQ4A 4HUWB 3RIFK 5HGGS 5J6HB 3L13A 2H6OA 1AKJA 4I5BB 3V4VA 4PLOB 4R0LB 1OCRB 3ETBJ 4LQ1A 2VAAB 3CIAA 1YUHA 4JRWA 4KHXH 4R3SB 4CVXA 2Z6FA 1UHVA 1MCIA 4NKIL 3RWFA 4CC1A 1NBVH 3RDTC 2P49B 2VQUA 3MVSA 4X5QA 2AABL 1SFHA 3NABH 5C0BE 3TF4A 2FX7H 3GXMA 3HTLX 4NM4L 3VFWB 3CLWA 5B39A 4YXHH 4ZG1A 1OVZA 5IROC 3ZYOA 2P46B 5I16A 3QXUA 3H85A 5H8DA 5I9QC 2WXFA 3HZYB 3VXUD 4L18A 2IH3B 3EFOB 3MLPA 4BKLB 2HUHA 4U05A 1BXVA 2E76C 4FTVE 1NAMB 5EEWA 3HZVB 4BFEA 4LSPH 4ERSL 3L5JA 3VXTB 1A21A 2IDTA 3I3DA 4LU5H 5DJCA 4RQQA 4UIMB 4BXVA 1EXHA 2IC2A 5DUML 5DRWA 1J5IA 1TCRA 5IW6B 3QWOA 3CZFB 1NM9A 3VSVA 3I75B 2APBA 4OM1H 3LIZA 3R0NA 3GXTA 1JI2A 3WFBL 1WC7A 4G6FB 4LLQB 2ZJSL 3ECVA 1X4YA 3QEQA 3Q1SH 4JZNB 3W81A 1AKPA 2XWDA 2VXQH 4P2QD 2DLIA 4RESB 5BVJB 5IKCA 5TK4A 1A3LH 3I9IA 3K8KA 2Z92B 3RI5K 4YLQT 4YHMH 1T0NB 3U9PH 3P3SA 2X87A 3NT0A 1A7NL 3C60C 1FLRL 4X4ME 5CIPA 4MA3A 4M8QB 4OZIB 3LQAL 5L2KD 5ESAB 3VO0A 2EEBA 1T0OA 1ZVNA 1W15A 1G7PB 5A6IA 2B1AH 3K8LA 4OJFH 3D4ZA 5C7XH 1D5XB 3HHSB 3ZBMA 1CGXA 1KN2L 3NIFF 4LKXB 4XN8A 1OAXH 3LPOA 5F97E 4GT7A 3CDYA 1A5FH 4ONOA 4PJBB 5C0CA 4JJ5B 4TULL 4ZW8A 3MBXH 4D7BA 3MV8D 4E9WA 2BMKB 2BOCA 1FNSL 5ID1A 2H41A 4K71C 3MKGA 2HX9A 1GA2A 1ZT4A 3DC0A 3ZTNL 4X4KA 3EJYC 2K6WA 3M46A 1EO7A 4M7LL 3TJEH 1OOAA 1N8OE 4M8VA 2CUHA 2FTAA 2JI1A 3BZFB 3QUMA 4P9HL 3ZDXF 3BISA 3QCTH 4R4FL 4YR6B 3T3PE 1OB1A 3BC9A 3MBED 1J8HA 1ZJBA 2DPKA 4P0DA 3T2NL 3RNQB 3DETD 1YMMA 4GLRI 3O3EA 1JHLH 4H1LH 4LCIH 3ZR6A 4F91B 3VFVA 1L9NA 4NYLB 3MX0B 3PNRB 3Q01A 4O00A 3W0WA 1WBXB 4Y89A 4WHYG 4OCSL 3IDUA 2VJXA 4J2QA 4R96B 3S97C 2N59A 4XP4H 3Q3GA 4WW1A 1IM3B 4FYTA 4IRSC 1CQKA 2RCSL 2WBKA 3WLBB 8PAZA 5GISH 5I17B 2PXYC 4E9LA 2HLFC 2P42B 4I0KA 4UQ2A 3UX9B 2JKTM 3DOSA 4EUPB 2NUPA 4N90D 3RDTB 3WJMB 1F18A 3ZE0B 3EYSL 3K6OA 3ME0A 1QNIA 1B2WH 2EDMA 2GBTA 3D18B 3DURA 4Y19B 4ZPTB 4HIEB 3EYVB 3H3PH 4MQ7B 5J11B 3ARQA 2A9AA 2WY3B 3PL6C 3SQRA 1DLHB 3KL5A 1XAUA 4XNXL 3T0EA 2K8MA 1N59A 4HV8A 4WGWB 4U33A 4H8WL 2IV9A 5CN2A 2EYRB 1NGZA 4NJ9H 5KYXA 3QCUL 1EWHA 1XB6A 1J9SA 2AC0A 4L9LC 5DU7A 4Y9CA 1GZHC 3PS6A 2C9SA 4NQEB 2Y6SC 3RZWA 4CJ1A 2VDLB 4R2GB 4KMQA 1LQSR 3NSJA 1DJXA 1X6NA 3TH2T 3SQBA 3BKYH 2W80C 3PWNA 3RUGA 4XPBH 4NUJA 3U2SA 5GSRB 1RVFH 5KG9B 1DQVA 1Y6MR 5I76B 1DQJA 5DD1L 4U1GC 3MOQA 4JCMA 3ZQXA 1ODUA 2XWJB 1OB1B 4IGBC 4YSDA 3LYRA 4P4KD 2QFRA 3QIUD 3FPXA 4WO4D 3VXMB 1MCOL 3ULUE 1OT4A 2BY2A 4HCIA 1O6TA 4DUXA 3BIKA 4NO3B 5E56A 4N2OA 2NY0C 1N2RA 3IXAA 2VAJA 4NT6B 2L7JA 3PHSA 2YPLE 2BMKA 2YQ3A 5GZND 1T4KB 4WHTA 2BRQA 1PZ3A 1RD6A 2IG2H 2VB5A 3V7AG 3ZE1F 4XMTA 5GS0D 1YEJL 3EGDB 3RUGE 1KYUA 1UENA 2QHLA 5EZLB 4Z1PA 2H1PH 5KOMC 3NFNB 4AQAA 3NCBB 4KKPA 4RX4D 4XT1C 4PWIA 5D1XC 1MIML 2W8CA 3ZDXE 4DO5A 3MRPA 4FTVD 3M1OA 1NCWL 2PMZA 3FSVA 5EOCH 4YUEH 4DGYL 3W57A 4YJZL 1VZHA 3GSNL 1Y07A 2OCCB 2A99A 3GHBH 2AAVA 4JO3H 2VZ1A 4FN0A 3KLAA 1L6ZA 1B3JA 2FJFA 2MQ0A 2X70A 5DEGA 1UWYA 4ZUWB 1TO5A 2BS8A 4ODSH 1AQDA 2C7UA 2XXCB 1R34A 2WXLA 4FXLA 5JMRA 3TCTA 3MRGA 1OL0A 4NO5B 2DRUA 4BCXA 3NA4A 3ABZA 4PRHB 1ORSA 4U4IA 3WE1A 3GJFA 3ZRSA 1IC1A 3KPOA 3NIFE 5SWZA 2AVFA 1XR9A 3HVNA 3WEXA 4G82A 3AXIA 1MJ7H 1MWAL 2J2ZB 4J4PD 1XGQA 4CMHC 4ZFFA 3E7JA 4EEEA 5IW6A 1UKQA 4KO9A 4WEBL 4QAMB 2NY7H 2D7TH 5I15L 1LO3L 5KEZA 3BZ5A 4XPHL 2JKLA 3C5SA 1AZRA 3CDGA 2A0LC 1AMXA 5HY9A 4RISL 5TFSH 5BRZB 3QIBC 4P23B 5KSBE 5HHOD 3WFDL 1KTBA 5GGTH 4FFTA 3I9GH 4AIZA 4BKLA 1XEDA 1Q0EA 1B0RA 1YNLL 4X8XA 1NGYA 5DQJA 2CDEB 4YHIA 5C1MB 2OMTA 3O0RH 3AADB 1WICA 4PJ7A 1CLOH 1JWSB 1QI5A 1QW8A 4WWPA 5DMGC 4ZODA 5KW9H 5IBTH 1KPVB 3UBXB 1AACA 1QA9B 1S6NA 3BEWA 4WKZB 1K4CA 4R2GC 2OX5A 4I5BA 3FU6A 2A3TA 4I1PA 2B1OA 4FYQA 4Q9QH 1ETZA 5C71A 1N26A 1C08A 4IOIB 5C07D 1M2OA 1FVEB 3FL7A 4QWWD 2CBOA 3CXHK 5I1IL 4LZKA 3CJJA 1ZEAL 2WSDA 3SE3A 1T1ZB 2NMSA 2IWFA 2YJQA 5LWYL 1ZGLP 1LO5B 5DD5H 4N6RA 3OKOB 1KCBA 3KPMA 1BFVH 1EJ6A 3CSYA 4OW6A 1A6PA 4XAKD 5BQ7A 5JQIB 3VFOB 2H8PA 5C0GA 2XC8A 1KXQE 2F7OA 3WMPA 5D7LD 3QDMB 1F86A 5IFAH 2HSIA 1QQDB 4FQXB 3W11C 4QOKE 5G55A 2C1OB 5J5EA 1WCBA 4UT9A 1N0LA 1LNUB 3CFBA 4LCWE 5DZ9A 3FUDA 5EWIH 2CM6A 1ZSDA 2DF3A 4DCQB 3IEAA 3QWQB 1C5BL 3RVXD 3G6JB 1MFCL 2HVKA 1EMTL 4FQHA 1KIRB 1DLFH 3F8UB 5IFHH 1G6RH 4TUKL 1V7MH 2GBAA 2O6CA 4JFFE 1S7WA 1U8CB 4MJIE 4FMKA 2CNYA 1EVTC 2DMGA 3BP6B 3WJLC 4UDTA 1KJVB 4OCRH 5IB1A 2JK5B 4JQVA 3VQLA 3T77A 1P7QB 4KH2A 3FQ1A 3MRIA 1TJHL 2VQTA 2W92A 3O3AA 4MGXA 1KMGA 2DEXX 3DHMA 3WO4B 1ZHLB 2XWJA 3MV01 1BYOA 2A73A 2VXSH 4MA1C 1MDAA 4NEHB 5IOPB 3MRBB 4FYSA 1YNTA 3UAEA 5BVPH 5DRXA 4QRQA 3WNNA 1ZPUA 4AY0A 5KW9L 2CBTA 3OC5A 3U48A 2F5BH 3IJSB 3KGUA 3UABA 3KD4A 1J8RA 5TDPA 4URKA 1PVHA 4NRZB 4Y4HD 5F88B 3IFLL 3NDZE 5AAWC 4WO0A 3LIZL 4E9YA 3C60D 2IBZY 4GAJH 1IFHL 4X7SL 1JK8A 3BUDA 4N0FB 4ORGA 3ISWA 4XPTH 2LR4A 2ZX8A 3K2UL 4P5TA 43C9A 2ZUTA 2CHXA 1T5WA 5I1EL 4P2RE 4JM2B 3T0EB 4A6YL 1NCUA 5KOVC 3HEIB 1UURA 5FO8B 3F64A 3JWDC 1KLUA 2YARA 1JZHA 5HJBA 1SN5A 1A1NA 4ODVL 1VACB 4Z0BH 3D3VD 5AZEH 2X89A 3DX6A 2YEVB 1U9KA 2R2CA 4ECNA 3DHUA 3CVHH 4NC0B 3S35H 1UXSA 2ED7A 2I60H 4P07A 4MA7L 4WW1B 2OMYB 3HUJF 2GTZA 4OKVB 3PUUA 3IJ9A 2VXUL 3MNDA 4H1LG 3HZMA 4X2UA 2Y7MA 3IU4L 2OZ4H 1EZLA 3IBOA 5C08A 3INUH 3CBRA 5CINL 3BAEH 4HYTB 4QTIL 4AZUA 3MX0A 1T04B 2VITB 5DZPA 5F7EH 3UP1A 3K3QA 3VXUA 1OGAA 1NFDE 2BHFA 2AQNA 1N64L 1GHFL 3Q9PA 5AL8A 5TPWL 2BSRA 1KSRA 2WVVA 3ZE1E 2NY5L 5EEVA 1GGBL 4N2FA 4LCUA 5D4JA 1I3UA 4HW6A 1BF2A 3MRNA 3ZU8A 4EQ2A 1BQHA 3LEYL 3MACH 5DHMC 3FH8A 5MP6L 3AQXA 2VZTA 3NJVA 2GI7A 1P7KA 3GEFA 3QR0A 3GO1H 5J56B 2F19L 3K0WA 4HKZA 4I0PC 1CTOA 5D6CA 3WJJC 2NX5E 4LL9A 1NPNA 3NN8A 5F6IC 3WY1A 3V6BR 2IDUA 4PSRA 1U3ZA 1T5KA 4IRJA 1AQKH 3MLRH 2JIXA 4R0LC 3GLAA 4JVUA 1BVNP 2YPLA 1N4XH 1JSYA 4PTTA 1FFTB 4QR7A 1XGYL 2J8UB 4FXKC 4XAWH 2Z91A 2AAAA 2VWEC 2FX9L 1GJWA 4ZUVB 1BMGA 3CUPB 3O45A 1ES0B 4OGXH 4OF0A 4UQ3A 1LWHA 3H53A 3OGCA 3E9UA 4E41B 1QLRB 2EDEA 2NRDA 3UAAA 4QD2E 5CIPB 1EDQA 3MCLH 3MNVB 5G5DA 3N06B 4JFPA 4B9JA 2NOYA 1NIFA 1S7SA 3BVVA 4ES8A 3HG1D 4QRSA 1SEBA 3EDFA 5CNHA 4KNSA 2Z31B 3QEUB 1RIVH 1XBDA 4ISVB 5C2UB 2F53B 1TMCB 4O2EB 5E9DD 3VXRE 3T3MF 5I0DA 1WV7T 4I85A 1JHKL 2DS4A 4ABVA 2IMMA 4H8WH 2GUOA 4JRYE 4WK0B 2BHZA 3I75A 3RTQC 4UINH 3U36B 4LAQL 1VCBC 5JXEC 3ILQC 3D09A 2GTWA 1PJWA 3PGDB 4KU1A 4GFTB 3X1BA 3QUYC 3CK0H 3LSOB 5EZJB 2DJSA 1ES0A 3TZVD 5IZ7A 1NBZA 4ZUVA 3VXTA 1IVLA 4HA1A 3GMLA 1E8YA 1FGNH 5FFOA 4AXWB 1MVYA 3OMAB 1FV1B 3CFJB 1HTYA 3BEVB 5EZPA 3MOBH 1TXKA 4ZS7L 2BSCA 1J0YA 2G75B 2RCSH 3OAUH 2D03L 4DGVH 3MLXH 4JKLA 5F9WB 3U0WH 4UNUA 2P4AB 3OZ9L 3DVFA 2XPGB 3V0FA 1KPUA 3UBHA 3MXVH 3QS3A 5AKTA 5LGKA 4LLMA 3T6ZA 4A2MA 1XD0A 2ZX7A 3UYPB 2B0SL 5T5FL 4NIKB 3IMRA 4FLOA 4M7JH 5FCUH 4PB0L 5HDBE 4D9RE 3VXMD 1T83C 4W9HC 4KJPD 4M4RB 2XXGA 1OZTG 2EEXA 3BVNB 1VF5C 1OM3L 3CQQA 1LP9E 1UZ8A 2UVFA 2QR0B 2W88A 4NC1C 1LEKA 1YNTF 1MRDH 2R1YB 5DK2A 2ZUSA 1QFWH 3VFRB 3GQFA 1U8MB 4YGVA 4K3GA 2K7PA 1UGKA 1SMAA 3BN3B 5CZKA 1T2QL 5F8RC 4UNVA 1FPTL 1LK2A 1NIEA 4CMHB 1KTDB 5TE4H 2IBGA 2XZZA 1M6UA 2Q7NA 5DUPH 4ILDA 2ZE0A 4NBZB 3IJYA 3QWRD 5J9PA 4BDVA 5J13C 3TS8A 1QUNB 3TTYA 1H3VA 3MGOB 2PWGA 4Y19D 2Q2EB 5FDWB 4AYFB 3I9PA 2AEQH 2FJSA 3FDWA 1HHHB 3IVKA 2BNRE 4IS6A 5JOPE 2IQAA 5F1IB 2B77A 4WJ5B 1R3JB 2YSSA 3S2CA 3BP7B 5EO0B 1BSIA 5DHEA 4HEME 5ADPL 1IJ9A 5FB8B 3DPBB 1PX4A 2AI0L 5ICUA 4BH8B 1A4KB 4J3OD 5D70L 2GITB 4N0FA 4ORGB 2G5BB 4XPHH 4JFFA 1GC1H 4JFYB 2W9EH 5EA0H 2GSGA 4U1LA 1QSEB 3L8QA 4IOSA 4Z0BL 3T4YA 4JMNA 2LTQC 1DUZA 3ZKXC 4PRDA 4YLCA 2HJKA 2XN2A 4GI8A 4JFOB 1BFOB 1J1PH 3N50A 3IGUA 3S35L 3HN3A 3JQOB 3H3KA 3QXAB 3Q8AA 2WXIA 1D5MA 3T2QA 1TU2A 1E4KA 4GKLA 3VX1A 3ZMEA 1LEGA 1R24A 3BWSA 4HT1H 3AS1A 5JHLA 2ZTBA 5MERB 2ZWSA 3C9NB 4YFEA 1NZRA 3T77B 3RGBA 4GG8B 4CN4A 2Z7ZA 1OLLA 3QE5A 2DN7A 4UDTB 1E4WL 3MREB 2AJYL 3T09A 1EAPB 4GRWF 2IOIA 3C08H 2QKIC 1XIWD 4JKNA 5CEZH 4PJ9B 1CL7H 2EJ1A 4J3UA 1AHKA 1PG7W 3ORJA 5IEKB 5I6XC 3O8XA 2VW7A 3PWVB 4QTFA 3B34A 3ZVVA 3QNFA 2WVTA 2APXA 1U93B 4AG4L 2GHZA 1OT1A 3L7EB 3N1FC 4G6JL 1I1FA 5SWQB 1QFWM 2XZCH 2NZ9C 1AYRA 2DWTA 5LUMA 2VXQA 2QQQA 3AY4C 2CWRA 3FUNA 1M05A 5E8EA 5FW6A 4B9ZA 5G2NA 4KTEH 1KC5H 1UD8A 4LHUD 1GMEA 2FQEA 4EDXB 3VDCA 3GSXB 1LO5A 4O2FA 3TNNB 4CL7A 2C3VB 4HS3A 3C2AH 5LGJA 1L9SA 2XIIA 1A7QH 3ERXA 1GYAA 1I9EA 1KTLA 2YUWA 1ZVSB 4X6BA 5T1LB 4WF7A 4XR8C 1FDLL 3GS4A 5I74C 4EKXA 4FG6D 5FYKD 3D0VA 2DYSB 5FA3B 1GPOH 4M03A 1KB9J 1RP9A 1MEXL 5LQBH 4GKNA 4ALAL 1FFNB 3HPLB 4MD5B 5DRZB 3RY5A 1WSST 4MZ3A 2BIPA 4MJ5A 4ELKA 3OKNA 3HC4H 5L4IA 4IEFB 4NKDA 2ZYRA 3Q48A 4N25A 4HSQA 4PYGA 4AC4A 4NJ9L 1B0GA 3OM3B 5BS0E 1VADA 1DJWA 1H5BC 1UXMA 4LSQH 4Q14A 2AEOA 2XVBA 1ORQA 4G72B 3MLUH 1NGYB 4YDKL 3QJXA 3VW3L 4O4YH 2FWOA 3T0WA 3NJXA 5EBLA 1U3JA 1CIUA 2EDYA 2QGDA 4IK7A 3FB7A 4YXKH 4AXWA 1U91B 5MP6H 4JZJA 1M2VA 2VDOL 1QKZH 2NXYB 2ARJQ 3CIQA 3RPIB 2ZKHL 5HDBB 3RWDA 1GJIA 1UACL 4NQDA 3RIAF 4TUJA 5BZWB 3UZEC 4NQQA 2ILLA 4CVUA 2NY5H 2Z3FA 4IMLB 4NBXB 2A6IB 4BINA 1A8ZA 3F7KA 3II2A 1NCNA 3FRPB 3G6AA 1HDMB 5C92A 3ZZSA 3DUHA 1OQOA 4CBPA 1Z9NA 1JHKH 1SDYA 2WN2A 2YIHA 4TLSA 3VGFA 3RLSA 3EH2A 1X5KA 1AXSB 4J1UA 4XWOD 5AD0A 4EN2A 3K6SB 4OGXL 3BAYA 2VZ3A 4LCIL 1MVUA 2IDFA 4D8PB 1INQB 4XNUH 2HRPH 4PV8A 5KZCB 3GHPA 1FIGH 2MRYA 4ELMF 2EIDA 3WI9A 5AG8A 2DQEL 3M07A 4G9DB 4KKAC 4H88L 1YYCA 3VU2A 3WGVB 1N6VA 5DEGB 1XSOA 2VDPH 2ZXWB 3HUJA 3QDMD 4PUBL 4XMKL 1TVBA 4JL1A 1D6VL 4GIOA 4ODVH 3SSGA 1O9ZA 1Z9SA 1JPSH 1G7JB 1BVZA 2PW2B 3IMUA 3WHE0 3OHXA 4K7FB 4PJIF 3QWRA 3BJ91 1CFQB 3ULVC 4CC0A 2EEDA 3DV6B 4QIRA 4HVBA 4LOVA 1OXYA 1MPAL 2A38A 4AYEC 4EN3B 2BO0A 4S1QL 1MW2A 2OULB 3KYKH 4FNLL 3SEPA 2RIKA 3PP3K 1XQ4A 3PJSA 4DO6A 4JHAH 2Z0BA 2HFEB 4L3AA 1PTZA 2BFVH 4IIZA 1EGJH 5AW8B 5CR8A 5HHVL 1RZFL 3UYRL 5EPMA 5BMFL 3DGGA 5EIIB 1XMWA 1KBGL 5K9JL 2KYIA 1X5ZA 3RHWK 2WLJA 3INUL 1SYSA 3MZTA 1DO5A 2B4CL 4PBXA 1IGTA 5KVDL 3VI4E 1HEHC 2GG1A 4FXGA 2A6JB 2RQEA 4OLEA 3FB8A 2J8UE 4GRWB 1JZIA 1KIUB 2VJ8A 3TFKC 1UH2A 3KPTA 1KYAA 3FFOA 1T04A 3O4OB 4R97C 4P5KB 3WFCH 2HT2C 3OAYK 1X5FA 3QZBA 4NZUL 4DP5X 3LY6A 4KXCA 5GHWL 3TPKA 3FZUD 5C86A 4GEJA 4KV5E 2NX5B 4KKQA 1M42A 2Z0UA 5ADOL 3U1SL 5JXED 3ILQD 1B0WA 3BCFA 5FGBA 2X4RB 4WUUD 2BSSA 4F7KA 3SKOB 2Q7YA 3ARDA 1XV8A 3QFDB 4R97B 3VD2A 1QRKA 2VDQB 1OAYH 3ARGA 4FJZA 1FL6B 4ZTEA 4EMZA 1KFGA 1IBYA 5KVMC 1T21A 4X5RA 5C3IA 3DGDA 3SE8L 3HAEG 1BOGA 1FRGL 1RUKH 1UWEH 3ZE1B 4KO5A 5I0YA 2XACC 3ARFB 1IGCL 1F41A 2JLPA 3GLEA 4HIEA 3U1QA 3NZSA 4HZAA 4MVBC 1KLUB 4AH2B 4FQ2H 1M71A 2KZBA 4HCRA 3MYZA 3QJFB 5CF3A 3QUMH 1FSKC 3WIIL 2YD5A 4RMRA 1RZ7H 2NUPB 5CZXC 4B0MB 4RETB 4KROD 3LD8C 3I2CL 4UU9B 1UOLA 5J0BA 5I1AA 3SD5A 1I75A 2Q5BA 3CZUB 3FH5A 3MRDA 3U6XA 5EO1A 4W4OA 4FFWD 3CN0A 3B9AA 1HINL 3FT3B 1UT1A 2HVBA 5CGTA 3LN4A 4KDWA 1RK0B 3VSUA 5LN4A 3A0OA 1GOGA 4WI4A 4YQXH 3QZNA 4RX4A 3VFVB 3RWCB 1QPPA 1LEIA 5HGDB 3VTAA 2KLTA 4AQZA 2G2RB 2MNWA 1YC7A 3K1KC 1D5ZA 2XWXA 1HEJC 1YJDL 3LKSB 1B6DA 1KGCD 1M6OA 4MQTB 4XNDA 3MRIB 5D1ZB 1URLA 1TOXA 4GAAA 4FNUA 4FTDA 5KYYA 5EEYA 3II3A 4ZMNA 3MLZL 3S3DB 4ZXBC 1YNLH 1BX2A 2I27N 4KK8D 1HWWA 3NH7H 1LO4L 1TYJA 4PBVC 4CW1A 3IGKA 1IQDA 1B4RA 2XG4B 3QB7C 5HYJA 2R59A 2YQ2A 3CWGA 4I77L 1T1WA 5FYLD 2A9MH 2FHFA 2X4QA 5L7XL 2FGWH 4O9HH 4LE8A 4LQFL 2DIAA 2AEPL 3G04B 3QCTL 4R4FH 3SN6N 5I1CH 2PW2A 3W39B 1F4HA 2BOBB 3D87B 4F7PA 2YPKB 4I13B 4P4RB 1OQXA 3OXRB 4N8VG 2BDNL 1EDYA 3OKOA 1J9CT 2XQBL 2X9WA 2A9BA 1YEEL 2MPAL 4XCFH 15C8H 4PV8B 1BZ7A 1EAJA 3FSAA 1INQA 2BSDA 1H5BB 3BW9A 3CU7A 3WENA 2CALA 3FUIA 1IQWH 2BIIA 4OFIA 4PG9A 4L8CA 4H8HA 4FMFA 1XHHA 2CUMA 3GBML 1QNZL 3THMH 1IEBB 4LCWB 2WQUA 4P23C 5DZAA 4RBPH 1HDMA 2VUOA 1YN6A 2RA1A 1MCWW 2YAFA 4N2LA 4OF5A 1AGEA 3VU1A 4TQHA 2Q20A 3IS0X 2ESVA 2FUQA 2UY6A 1ZHBA 4M29A 5DJCB 3FFCE 5GGQH 3RAJH 4NN5C 1I9JL 4PQXA 5AB1A 1HILB 3BPOB 5TE7H 1H0DA 5I24A 1VEPA 4XB8A 1GY2A 3AY2A 2X28A 1A3LL 4QTHA 4KKLD 5JW5B 4XWOC 2IG2L 2Z35A 3VFTB 3H9ZA 1U8KA 5MENE 2EUWA 5GJTL 5JO5B 4PUBH 1NGXA 5BCAA 5J89A 4YH6A 2EC8A 4L05A 5DHYB 4OR1A 4K8RL 2VDLL 1AHWB 4HDIB 1DN0B 4PLKC 1FIGL 4HJJL 1QFPA 5HY9B 4XNZC 3WYRA 2P7TA 3CDGB 4L9DA 2WLMA 5EU5A 3TFBA 4ZI8A 4JFQA 3UO1L 1JNNH 2YJLA 3EOBA 3WE6B 4YSAA 3OKNB 5D1ZD 1BZ8A 1CFNB 3D0LB 1FP5A 4ZTOH 4ZYKB 2VR3A 3PWPA 3C09B 1PG7X 5F9JA 5DRZA 4FA7B 2ADGA 1MJ7L 4GKNB 5LLIC 5MEPB 3MMEB 1Q0YH 5J6HA 1NSNH 3IFOB 2VSDA 3ZTCC 2BWDA 5EBGA 4MLIA 4AW7A 1UA6H 1UUSA 5D93C 4FG6C 4MYWB 1L9OA 2E27L 4DFHA 4OLUL 4OKDA 4QRAA 4JKPL 4PMFA 3QNYA 5BRZE 2C7UB 4LDEB 4CGTA 1AQDB 2X1XR 4P5MA 2GW5A 4F3FA 2B20A 3UTQB 4NP9A 3ARBA 3QI9D 3L1OH 4EI5D 1IIIA 5D2NC 2FH6A 2DLTA 5JIKA 1MVFA 4OD1L 3HE6A 3J27A 5FYKE 4PTUB 2FATH 3TN0B 5FGBC 2BVYA 1W72A 4HJSA 1B88A 1CDUA 4RMQA 2BJML 3UERA 4D9RD 3HHRB 3OQRA 1RURH 4MB1A 1S3KH 3JV5A 2QVIA 1HHKB 3WMSA 4IW4C 1CB4A 4WHTB 1KGYE 2R39A 2ITCA 4DGWC 2HVJA 5DZLA 5ADOH 2CQVA 3FU7B 2H0PA 4XNMB 3CFDA 5ESVB 2OI9C 4QXWA 3UZVA 3EF7A 2NTFB 3SKNA 1JHLL 1U6AL 2P5EA 3RVVC 1N9PA 3QBTB 1TU2B 1FNAA 3VRIB 1QPXA 3PABB 5A16A 4O5LH 4UT6L 1O5DT 2EDNA 3PHQA 4NUJB 3RUGB 4HKXA 3SQBB 4X6DA 2UYLA 1YUKB 1XCXA 5F3BB 1FC1A 2WN3A 4HKBA 4BQ9A 5CZXD 5E8DH 2NNCA 1CFBA 4LLVB 5KVGL 1DVUA 3OMNB 5BZDA 4B9GA 5H35A 1X5IA 3KMDA 1MIEL 1AOHA 4C58B 1A7RL 5C7ZA 1X3DA 3PWLA 4PW3A 1PFOA 3HZ3A 1KEML 3D50A 3NPSB 2DQTL 1QVOB 2NY6B 4F58H 5HYEA 1NQBA 2Y7QB 3P0YH 2P52A 1OAXL 2Q86B 2BIHA 4UCFA 2ETWA 4Y5VB 4GQZA 1XCQA 3NMEA 5SX4H 1NWOA 2BSTA 1H3PL 1GL4B 2VYRE 3LKQB 5K1VA 2IXQA 4HT1L 2DQJH 2ZWYA 2W0FB 4OZGE 3FPYA 4P59L 2LU7A 4YBLB 4HHWA 4NQCD 3DOSB 4ANXA 5ISZD 1GGUA 2QADC 5BW7A 3I9AA 1SRDA 3D0AA 1J5OH 5I6LA 4WQOA 2OJEB 5D1ZC 5TGBA 5T3ZH 1MI5B 2AQTA 1OP5K 1CWVA 5DK0A 3L4TA 2VSKB 1KJ2B 4NZRL 5IIEB 4N2DA 5J6GB 3SHSA 1JP5A 2VQ4A 5D1QA 2PXYA 5D5MB 3SDCD 1L5GB 3EG9B 4FJ6A 1LEKB 2QR0A 1N8ZA 2ZONA 1I31A 2VN3A 4Y19E 4L29B 1U3NA 4X4ZA 2A6KB 4RFEA 2Y0SA 3DIDA 3VFPB 3ZE0E 2VSMB 4Y1AE 3QUZB 5I8OH 4OUUA 3DBXB 1Z3RA 3U46A 3FCSA 5BS0A 2PTTA 1KLGA 4XAKE 5KN5A 3HVDA 4GQQA 3S48A 2DY2A 3BHBB 1IJNA 1N67A 5AB2A 5HHPB 2DJUA 3FN0H 5DEFA 2ZD0A 4JDTH 1IBBA 3DX8A 1P7BA 2Z31C 3TN0C 4F2ME 3O2VL 2B3IA 4OLZL 3VJ6A 2Q1EA 3BP5B 3QXDB 1F42A 5K9OA 1FZJA 3ZO0A 2EO7A 3U9PL 3BEVA 4TNWF 1K2DB 4ZNCD 3C5JB 1IM3D 3BQUC 2Z64C 1XGRB 5IGXL 4B60A 4MAYC 1K8IA 1XF1A 4YDLC 1WHOA 4P23D 1G6RB 4ZK8A 3RU8L 2B8OT 2Z4QA 1UB5B 4N8UA 3H0TB 4X6DF 1JJUA 2XN9E 5IHHA 4JFHD 2Z1KA 1G1YA 3APMA 3GSNB 3B2VL 1BD2B 3L48A 4L1SA 4IBTA 4LSSL 4RAUB 2H6UA 4HH9B 5D1ZI 5D93B 4XI5D 2YRLA 1ETB1 3N2JA 4LGPB 5CGYC 5AZ2H 4AK1A 2IADA 2P3YA 4PJFB 3WY3A 4ZZFA 5GZNA 1FL3A 1PL3A 2GQHA 2VOTA 4XH2A 2P8MB 4P5RA 1WA0X 2A83B 5JW3L 2VM9A 4FL4B 3ISYA 1PEWA 1QP1A 3JV6B 5IEHA 4MD0B 3ZDYB 1BAFH 4HC1H 5GS2D 1BVLB 1K5NA 1U8NA 2WBJC 5IVZA 4CDHA 1SEBB 3UTSD 1P4IL 1RHHA 1VFOA 3C75A 4BA8A 4U1JA 1ECYA 2DLFL 2ZPKL 1HK6A 4DGVL 4PJ5E 4BYHA 2UXVA 3CZFA 3NACH 1GCFA 4V1DD 3KHOA 1TCRB 4UAOB 3VFMB 2VR5A 3O11B 4NS0A 2ZAGA 1QWHA 2DEYX 4UB0L 4OIBA 3V0JA 2NZ1A 3CN2A 4AI7A 2FBJH 1EXUA 2FX7L 5FOJA 1OSPH 3T3ME 3HZVA 4L4VD 3HR5B 3GSRA 5FHAH 4OM0H 5D71L 4M3HA 1E5CA 3V6FA 4KHXL