4XOEA

Crystal structure of a fimh*dsg complex from e.coli f18 with bound heptyl alpha-d-mannopyrannoside
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FimH protein
publication title Catch-bond mechanism of the bacterial adhesin FimH.
pubmed doi rcsb
source organism Escherichia coli o6:k15:h31
molecule tags Cell adhesion
total genus 55
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoeA01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoeA02
1UWFA 3MCYA 4XOCA 5AAPA 2UY6B 4J3OG 5AALA 4XODA 4XO8A 5LNGA 3BWUF 4X50A 3BFWA 5IQOA 4AVJA 2XG4B 4AVIA 2WMPB 2UY7B 4X5QA 4X5RA 5FX3A 4BUQA 5FLUA 1KIUB 4AVKA 1N12A 1PDKB 5CGBA 4LOVA 5JQIB 2VCOA 1TR7A 4AUJA 4XOBA 3BFQG 2J2ZB 5LNEA 5F3FA 1ZE3H 3ZL1A 3ZL2A 3JWNH 2W07B 3ME0B 4CSSA 4X5PA 5FWRA 2JMRA 1KLFB 4ATTA 4AV5A 3ZPDA 4XOEA 4J3OH 4AUYA 5IQMA 4J3OF 4AVHA 4CSTA 2XG5B 1QUNB 4XO9A 3RFZA 5IQNA 5AB1A 3SQBB 4AV0A 1N0LB 4AUUA 3JWNE 4XOAA 4CA4A 3JWNG 2JTYA 5ABZA 5FS5A 5F2FA 4AV4A
chains in the Genus database with same CATH superfamily
3L5XH 3MCYA 3FFCB 3KCWA 3RGVB 1BDYA 4R9HA 3VSQA 3CGTA 3L5HA 1RV6X 4KROB 3WCYA 2Y7LA 1IM9B 4WUUD 5DRWA 2CRMA 1BVZA 5GGSA 4L8CB 2RIKA 1Y0LA 4S1QH 4WWKB 1E2VA 1JGEA 1J1PH 5HJGA 3T4AA 2KQNA 3RDTD 4M48L 4BD4A 4MAYA 1HAUA 1HCVA 3BIAX 3G6DL 3MJ9L 4ODSH 4ZD3L 1R46A 3SDCD 3MRNA 2N0MA 4S2SA 4UZGA 2MOGA 1OGAB 3VGEA 2ZCKL 1VB9A 1R34A 4G8FA 4L37A 2F19L 2P4AB 2DMGA 2FLRT 2XACC 4BGLA 1ORQA 3S96B 1TVBA 3HG2A 5DJZA 3NOIA 2AF2A 1KCKA 4WGKA 4AEIH 4UZSA 1PAZA 2APWA 4KNSA 4MHHI 3ATAA 4OZHA 4IBVA 1KB5B 3B1UA 5FAAA 4PJDB 1H3WM 3W56A 3VD1A 1S7XB 4MAYC 5F1NB 3ZE2F 3CAFA 3G5ZA 3D30A 3HN3A 2WXIA 1A4JB 3ARGA 5JOFB 4UYPA 4NHCL 4NX0A 1OCOB 1U8MB 3IXTB 4G8GE 2FGZA 3HE7B 3H53A 1ZV2A 5D2LB 4FYTA 4RDQG 3BEWA 3MBWA 4WJ5A 5A2KH 3LAFA 3MX0A 2E3VA 4L5FE 3QIUD 3REVA 4GRLA 3FPYA 5CLTA 1RQ5A 4NT6B 4C4UA 1WUZA 5E2TL 2GKIA 2HTLD 2JKXA 2ZXWB 3IAGC 4ICXA 3AFLA 4I0CC 3RIFF 1X5JA 2ITEA 1A64A 1T0MB 4N90E 3VWKC 1IVTA 1I3RA 2I9LB 4BXVA 2IFFL 1JSYA 3B7TA 3FO0L 4UT6H 4WEEA 5BW7A 4NQCD 2VDMH 2PYEA 1PTZA 5HYJA 1KB9J 3C5SA 5ETUB 4TQIA 3SE9H 4GRLC 4IHOA 4U1KB 5IMLB 3VI4B 5B4MC 4ZOBA 1HYSC 1E9OB 1A0QH 3TBBA 1AFVH 4FFVD 3I3DA 4IOSD 4C83A 3MRLB 2D3LA 3V5HB 1IIKA 2H32B 3KJ4C 2GFBB 3U30C 1QFUL 4JFZH 5SX5H 3VXOA 1A25A 3PGCB 3TU6A 2W38A 5A6IA 4XBPB 3GXIA 3O3AB 5GZNA 4E42B 4RLDA 2EYSB 3EBHA 5DD6B 5I1KH 4NQXA 1QP1A 5I75C 4JFOB 4G3YH 5J12B 4DF9A 3B9KD 1MFEL 3DURA 5BW7C 1VPOH 2VE6B 1H5BA 2YR3A 3GMOB 3WHXA 1OP9A 3BZFA 4BKLA 3VRJA 3I9GL 4HXAH 3SCMC 1MFEH 4JGMA 5DC9B 1QQDB 1TETH 3GSOA 1DLHA 4Y16A 3S5ZA 2XN9D 4LQFH 1TQCB 2CKBB 1N6UA 1CG9B 1RJYB 2EDNA 1IKNA 1QASA 2NOYA 2MQ0A 4MA7H 1R5VB 4BHUA 5DZOA 5GZNC 3ATEA 2Y7SA 4PLJC 4BUQA 2GSIB 1RHHA 2WAHA 4XBEL 5J0BA 2WO2B 1QR1A 1MRDL 1CGSL 1PX8A 2PPDA 3T6XA 3TFKD 3AS1A 4QOKE 3ARDD 4BCXA 1H5BC 4N0FB 2QTVA 1AGBB 1KGXA 1V7NL 3WUWB 4XB8A 2RB8A 4FCHA 4Y16C 5CNHA 4FADA 4BZ2H 3D85D 4XC1H 4U6XA 5GS1C 2ENSA 3QAQA 4FA6A 3DARA 1CB4A 1K4CB 2LW3A 4M8UA 4PJFE 5HYSB 2DQGL 2JK5A 1AANA 1IKNC 1QBBA 4R7NA 4YNYB 5D70H 3EZ8A 1UUNA 3UAJA 4Q2ZA 1K72A 3STLB 1NKRA 2Q5BA 3CNKA 3UG4A 4RFOL 1P9MC 2X89A 1OXYA 3UFIA 5EF3A 2X1PA 4Y19A 2XTSA 2R51A 4JG1H 2XWBB 5IBLC 1E27B 2BVUA 1U8NB 4BEIA 2OMWB 4Z7NE 5J5EA 4M3KB 1ETB1 1N0LA 3E7JA 4JQXC 3FF8A 2JFCA 1UTDA 5EFIB 2X4SB 5SV3A 5TQ0L 1YN6B 4KXCA 4XCEA 4ELKB 1BYOA 4ATTA 4AV5A 3BPNC 3CU1A 1E5AA 2W9DL 4OJFL 4WHCA 2DDQH 2DLFH 3CSTA 4XPTH 5EO1B 1I82A 4Y9GA 2D03H 3BEVA 5FGBC 1PKQA 1QSFB 4XNMA 5GGTH 3KL5A 4UIMB 4ZRGA 5DLLA 1P0SE 2P24B 1ET5A 1WFIA 3GRWL 1KXVA 1T80A 3EJZD 4GSXA 4M7KL 4JM2B 3WEAA 1XFPA 5DRXA 1T66D 1AACA 4ORZC 5B39G 5I8KL 3NJGA 5C0AA 5AW9B 1T5XA 3SGKC 4BKTC 2LAAA 1F11B 4BV1A 1E43A 3FTVA 3NG5A 1AHMA 3B6SA 2OPCA 3DX7B 1CZ8L 4Y2DB 3ZTCC 1YNLL 5I8OL 1IZKA 5J4MA 4EIBA 3BGMA 2FX8L 1UYWL 2XY2A 4GSDL 2CXKA 2E7MA 3MRCB 5F1IB 5IHBA 4XHJC 4GSDH 1ZA3B 1Q9OB 4HKZB 5IVXA 5IW3A 2D3VA 2O6DA 1FNFA 1NIEA 4QKTA 1LEKB 3R8QA 5JIDA 1S7TB 4NNXB 5CJ8A 2D3NA 3U9UB 4UNVA 4IGBA 3NAAL 1UWXK 2PLTA 5DCCA 3DYOA 5AAPA 3WDIA 2OYMA 4QAMB 4QJ5B 1KV7A 3MTXA 4GINA 1WO2A 4AYID 2K4WA 1DR9A 2OA9A 3SPJA 2BCMA 3V9FA 5DVOA 1KXQA 2HKFH 2HTKD 3SN6N 4F8NA 2ZUXA 4M61B 3SKUD 1HSAB 1I1YB 3DVIA 2Y6TE 1D5MA 1GVIA 2I60L 2R2EB 3MLSH 4KJYB 4N1EA 4WQOA 5H2BA 3T3PF 4OJEH 2YN5A 2OMXB 4ODWB 1WWAX 1X5XA 3FOMB 1NJ9A 2I60H 1LGVA 4RGOL 5GS2D 6TAAA 3I6SA 4U1SA 4OQ1A 1IBZA 3MCG1 4PRPA 1ZK5A 5KN5A 4RGOH 3BVUA 2DF3A 1PCXA 4GG6E 3CFJB 3LNGA 4QRTA 4U6YB 4PS4L 1AHWA 1JF1A 1SJXA 3TBTA 3K80A 3QWOA 4WTWA 1XF2A 4GQRA 3WEXB 3P40A 4GXFA 4TNWK 1COBA 4GY4A 3MROB 2EO7A 4PV8B 5AOIA 4JFWA 1NMCB 5HGDB 5E6IB 1B3IA 5D1QA 1W0YT 2EKSA 3GJEA 3SDYL 3VXUD 5LG6A 5J1AB 4ZXBC 3L81A 4MJIE 1HINH 4JY4B 5JXAL 3S3DB 2HFEB 3OJDA 2O6PA 3AG1B 3Q6GH 4I9WD 5EUOF 3WTVA 4JFPA 3KZ8A 5C07D 3ZKMC 25C8L 3SPCA 5AVXB 1GGYA 3FSWA 1FG2B 3PAYA 2V2WB 5DJAB 2XKSA 3OHXC 3W0WD 4JE0A 5F7AA 1XSIA 5D1ZB 4XVSH 1FVEA 1L4IA 1U4FA 1SN2A 3LH2L 3WUZA 2AQNA 4WTZG 4XNZB 1FZOB 4LKXA 1UKTA 3GS0A 3RY6A 3FQ4A 4YHYB 3UYOD 1XCXA 3QJZA 1E42A 1U8KB 3GZQA 3QXAA 2IMMA 3KW7A 3LNDA 4KUCF 1KELH 3TOPA 1UXWB 4JMXA 3BSZH 2X53A 2XT1B 3VA6A 3CZFA 2OTWA 1JHLH 2IG2H 4GMSL 1UEMA 2BOBB 3HBZA 4LF3B 2DWEB 5E51A 4PJGA 2NT1A 4OF8A 2BNUA 3MV9B 1TO4A 3TYFB 4JFFB 5FIEA 3RY6C 3H0TB 1SVCP 4BFJA 1A65A 1WFJA 5CU5A 4RAUB 4FRWA 4HGKC 4X6BA 5KOVC 3ZDYB 1YEGH 5EIQA 3U6XA 4JO4H 1PG7L 1F4YL 4NKDA 4KX9A 3QS2A 5IOKA 2FSEB 1N64L 1TPXB 5AZ2L 5C7XL 4K2UL 4NQDA 3MNMA 1JWUA 3HMWH 1N64H 2UWEB 3GJFK 1MNNA 2AEPH 2ZIDA 3G6AA 1NQBA 2IADA 3HNTL 2GPZA 4Z0XB 5C0RH 2XTJE 1G7PB 4HS8H 2M26A 2OYKA 2HA1A 2AERT 1OF2A 4D0DA 3VXNB 1M7UA 3TO4D 4G8IA 4ELMB 5CBEB 4E5XG 1ZHLB 3CFIC 4P05A 4AGOA 4YX2H 2EE3A 3QXDB 2I85A 5AKSA 4J6RL 4PJ5E 4W9CC 5CGBA 3QEUA 4WY7L 1W9XA 2BP8A 1FYTA 2BOLA 3VD0A 4XPHH 2ZQKA 2WW8A 5JHDA 2D2CC 4R4ND 2BDNL 2PUQT 1HZHL 2L0DA 4KRMB 4HDIB 4M5SA 5FW8A 4JG5A 2B08A 2Y1AA 3JVGA 4UQ3B 1KZQA 2ZKHH 4HMEA 5DQDH 5EBLA 1TTRA 3B9AA 2RH0A 5JZ7C 4RSVA 2EH7H 1M2VA 4OLWH 2ZXEB 2NXZD 4FF9A 1P5VA 4R5XA 4M7ZC 3NN8A 2Q86B 4ZMTA 1G7LB 2XA8L 3N9GH 2WLYA 1T7YA 3UO1L 1NC4B 1DBJL 1I8IB 1ADQL 3IRZA 1FORL 5D8JL 4XNDA 2WINA 2B5IC 4QHUA 5T33L 3FT2A 4FQCH 5JUEH 3M8OH 5MEQA 3RE0A 5EEZA 2I07B 1UJ3C 4FFZL 4TSBL 3TN0A 1OAUL 2PP7A 4MD5B 4NN6B 3TBSB 1AVAA 3DV6B 5DJYA 3JVGC 4NZJA 4KWUA 5E56A 3V79C 4WI0B 5DMKB 2A0LC 3GBDA 3ZYJA 1OAUH 5LHDA 2ZKWA 4QO1B 1IZJA 4YSCA 4UIKH 3HBPA 1XR9A 5GRZA 4A68A 4NWUH 3X17A 2BS9A 3PHSA 4FABL 1U8CB 3SDAB 2GJZB 3MRGB 5CCHE 4NPYA 1J11A 2NCEA 2CDGB 3TT3L 5DS8A 3UTQA 5LDUA 2FT8A 3B2UC 2Z7ZA 3BKJH 4M4RA 1JF6A 1OAXL 1QLFA 1L9TA 2EP6A 5C0JA 1U2YA 5C0GA 4UUJA 5LNDA 1WYJA 4O4YL 1UB6B 4LEOB 4KZ0A 4EQ3A 4C59B 3BZEA 4Y1AB 1YN7A 2Z91A 4F7PA 2A77L 2ZCHL 4JZJC 1NGZB 2Q9OA 4UM8A 1U21A 1VRSA 4DZ8A 4D94A 4IEFA 4WU5B 1MCWM 1XF3B 1G9NL 2R23B 1OTUD 3LKPB 4OTXH 5HGHB 2AKRA 1QSEA 2G30A 2V6HA 5TE7L 3MLZL 2B1OA 3HI5L 3E8UL 2PPEA 1X4YA 2VDRH 2XJKA 3QIBB 1KG0A 1KGUA 3CLEH 3INOA 4UF7C 3DSNA 1PY9A 3WY4A 2X38A 2YQGA 4N8PA 4JVWA 1BEYL 1MHEB 2DQDH 1I8UA 4AW7A 3O8XC 1D7DA 4M62H 5E6YA 4TRPH 4XPAH 3WMQA 1A7OH 4PJIE 5EU5B 2P5ED 3G08B 5IF0A 5L9DH 2XY1A 1TENA 4JJOA 1DQTA 3QPKA 5A16B 4J4PD 3UP1A 5DXWA 4G11A 5FB8A 1PMYA 1SFHA 4PUBH 5DZAA 2EO1A 1C08A 1A7QH 1Z66A 3D2UD 3L13A 4M5YH 3ABMB 2OS7A 3X1BA 2AEQL 4AGPA 3RWCB 4JX0A 5J8OA 4L23A 1N0XL 4L1TA 4GW4B 1BIIA 5FKPA 5LNEA 3F62A 3LN4A 4UI2A 3KWUA 3O3EA 3S6CA 3ZZ1A 3WLBB 3O4LD 4XNQA 3EKCA 4LEEA 2VDQB 3QB7C 3NRFA 4W93A 3EJYD 1NPJA 4KPHH 3FQXA 3GLAA 2NY0C 3NIGF 1QRNE 3L3OB 1W80A 5FF6A 2R4RH 4YJZL 4RGNE 2DB8A 4XNXL 1K5WA 1ZANH 3OAYK 2A1WH 1ZJBA 2UZYA 3U30B 3VQMA 5DZNA 4D0CB 2AHIA 4F8TA 4WAFA 2C9PA 3HMXH 3LKNB 4ZS7L 5IFAL 1UB5B 4LSTL 1SN0A 4F7TB 5I75B 5TK4A 3EGXA 1HDMA 1IBDA 5AB1A 1RLWA 5B8CA 3QFDB 3C60A 3LMJL 1NFDB 1CD9B 4O02B 4GAGH 1AYOA 2GJ6D 1ND0A 4N1HB 3A6BH 3ZZSA 3GKWL 1P6AB 4RFNB 4XI5D 1YUHA 3P2BA 3VSTA 3WLWD 2XPYA 2NW3A 4QXUH 1A8ZA 2WKOF 4ORGB 1KFGA 3Q44A 2JWYA 1AKPA 4S1DD 3AM8A 3CCHA 5EU6B 4KDTA 4PJXF 4PM1A 2F1AA 1LEGA 4W6XB 3BH8B 1G7QB 2YRBA 2XWZA 1ETA1 4TF4A 5I1EH 3U7AA 2VLME 1BX2A 4GKZB 2Y7NA 5EOCL 1OCZB 5TE4L 4B96A 5B8CC 4IRJD 5C0BA 1CWVA 3TIEB 5MERA 1TSRA 1TYJA 1MIMH 4QXTA 4W9LC 5IB5A 4PEEA 4D0BA 5KYXA 4JFDB 4DVRH 1NL0H 1TJHL 4B3EA 2ORBL 5E00B 5T5FH 4R8WL 5GS1B 1D2PA 3NZHH 4L4TB 5D7IB 3BT2L 3CVHB 2VQTA 3QEQE 4G7YL 4H1LA 4X7EC 2ZG3A 5ES4B 1U6AL 4QF1B 4PS8A 3AUVA 3T2QA 3HLAA 1EGJL 1P7BA 2DTML 3RZCD 2CHXA 1KTJA 4XXWA 1AG0A 2F68X 1A4CA 5E2JA 4JRXB 1Z9SB 4LLUB 3RFZC 1FNAA 1YUKB 4OLZH 2G4GA 5IIEB 4LGSB 1E28B 2AABL 4J6IA 5D7JD 3LH9A 2CLVB 5F6HJ 3K6NA 5SWSD 1HEZA 3LB6D 4XWGL 2AABH 2B2XH 4JM4H 3BPNB 1HQ4B 1HOCB 2XBZA 4PRHB 4XWGH 5FECB 4LSRL 4OH2A 1THAA 2WXLA 1WEJL 1ZT4B 3HJEA 4H88L 1O9WA 2OL3A 3P9LB 4A55A 2BP0B 2R59A 3QUML 1WC7A 3F58H 3HB3D 4OFKA 4AENA 1VFMA 1ZHNB 4PHZA 2ADJB 4NUJA 2G9HA 1DQJB 1LHZA 5E9AA 2VN6A 4ZNCD 3OF6D 2IOMA 1N67A 4M7JL 4N28A 3TJHD 1NZRA 1Z2KA 5AZUA 3A23A 4DN3L 2AI0H 2LHAA 5MHSE 2E27L 2GG1A 4OZIF 4LSPH 4XPFL 1NFIB 4FQIH 3LV3A 4U1HB 3Q8EA 3O3DA 3PV6A 4YPGA 3N41F 2CNZA 4L18A 4FHBD 1NCBL 4CSTA 5GXBB 2WBJA 3P30H 5BS0B 2Z92A 5EOQL 5FFOA 4F8LA 1R5WB 3CSYA 5D7LA 1CGYA 1INQA 3MV7B 1YRKA 2AV7A 3UIYA 3B2DC 3FB6A 1WV7T 4ZW8A 4KRPB 3T77A 4HPHA 1DBBH 4MNQD 3ABGA 2VLRD 5EZPA 1BZ9A 3K7UA 1SDYA 4ZFOA 5BPPA 4WU7B 5LAXB 4NQEB 4NO5B 3Q01A 3PWVB 3VGFA 1JPFB 3NTCH 2WBJC 1OF0A 1I3VA 2VZ3A 4L8BA 3PP3K 4H8UA 4NYLA 4HOXA 3TVMC 5CD3A 2ZOOA 4XBMA 4MGXA 3VI3E 4GSUA 1U3HD 2AQ1A 1WBXB 3O9WC 3FQUA 1NCWL 4TQ8A 1SLUA 5DJ6B 3ZT7A 4LSDA 3RU8L 3ZT5A 3ARQA 3FDWA 4L4VB 4M6OL 1G84A 1EUUA 3O0RL 2FX9L 2VL5A 4M6OH 3DHJA 1ZJAA 4OFVA 2G4EA 2PP9A 5CZXC 2YKKA 4G1MA 3C6LB 4GSRA 4L4JA 2LVCA 4K7FA 1MH5A 3UTTD 1HHGA 3MOQA 3ZSTA 5JXED 2P26A 4X99B 4P3DA 2XNAB 4W9DC 4YQXL 1EA9C 4ZXBB 3QO1B 1BG1A 5IB2A 1SYVA 3RUGA 3NRPA 1KXTB 1IAII 1PPIA 3RIAK 4BM7A 3Q5TA 2R2HB 2D7OA 5H37A 4NLAA 5MEPB 4WKXA 1FLRH 4YHNA 4CAGA 3HEIB 4WUUA 3FO2B 3OHXB 5KOMC 1AGEA 3FUKA 1MWOA 1DQLH 3OGCB 1P1VA 3FQRB 1BFVH 2CO1A 4I77L 4OCWL 1OM3H 2J6EA 1TTBA 3RDTA 3UZQA 5HHPA 5F3HA 4M43H 4K07A 4IOFD 3UTZB 3U25A 4YBQD 5DS2A 4G8GB 5HVHC 3SDCA 4A2FA 1XF4B 1FGVH 1E2WA 2J8UE 4K8RC 3O6MH 4KXBA 1PAMA 3N3EA 5I9QC 4MQ7A 5AWNL 1ZLVH 4V33A 2VMFA 1TJXA 1C16A 3W9EB 4N2OA 3AAZA 3RNKA 3MBEB 1JFQL 3LN9A 1NDGB 4Z7UF 1JK9B 2XV6B 3KPMA 3WU1A 4ZFFA 3HI6L 1IGIL 4BK4A 4WDIB 1OL0A 2Y5EA 3IWUA 4ZX6A 1N2RA 5IROD 3HI6H 4N22A 3VQ2C 3RWDB 2KMWA 3SDCC 2O5XH 1BJ1J 2FUQA 4RWHA 1HHJA 4RGNC 5FA4A 2ROYA 1UZ6E 3PHOA 3U1QA 3QIUA 2YBRB 1JRHL 1YECH 4DIXA 2N1KA 2OSYA 2Z4QA 4K3HA 3KPRD 1UVQA 1XGYL 2NY4D 1UHVA 1F6AA 2A9CA 1DVFC 1LQSR 1S7VB 1RZQA 4KJPC 3W0WE 1I7UA 3GNMH 3ILQD 5IJVA 1IFRA 3TCTA 3VFNB 2WKLA 1DSYA 2DKSA 4LLQB 3SPVA 4LDLB 4FQXB 4ODTL 1MLBA 5KYYA 5J13C 4U1IA 4LDOB 2JB5L 3HPLB 3HRZA 4FTVE 1PIGA 2IPUK 1S9WA 3PJLA 4NQCA 5G4OA 4HWZA 1KIPA 1BOGB 3QIUC 3KDMB 5JORB 4R97C 3WKML 1RJLB 2VDMB 4IOSA 5L7XL 3ARWA 4WWOA 2UVFA 4F92B 3MLYL 1B4JH 2NSMA 1KT2B 2BJMH 2VYRE 2XZQL 3GEWB 5BNXD 2XFXA 2YGQA 1E6JL 3TGXA 3KXFD 5I1CL 4QOKB 1I7TA 4LHUD 4NZUL 1SEBA 1I9EA 3GXNA 3NCMA 3EO1A 2ICEA 2OTUA 4B9CA 3B9KA 5D2NE 3VJ6A 3HRZC 1ETZB 1CMOA 3L08A 2IAMD 5KG9B 3IDXL 2IF7A 3L16A 4OF7A 5H94B 3MCKA 4G1EA 2XRAH 4MSWB 2XN9A 1BVLB 3IDXH 1C5BL 1ORSA 2E56A 4PJFB 1AAJA 4HETA 3MLTB 1F02I 3VD2A 5IMKA 3U1PA 4QD2E 2WLLB 3ZUNC 4UAOB 2E7BA 4AM0A 4X4YB 1DQKA 3BIBX 3KPNB 1VFAA 4GT0A 2BIHA 4KK6C 4RDBA 2CCLA 3T6WA 4P5KA 5IW6B 4WK4B 2JJVA 3ARDA 3UADA 2E9IA 4DPAX 1X9LA 3BUYA 3FRUB 4MRBA 2D73A 2GHWB 2PTTB 1JVKA 5CD5D 1BZOA 4JUSA 3I3EA 3LRSB 4JCWA 3QHZL 4FFYL 4KHTH 1FVCA 3BAKA 3BH9A 3D85A 4NGHL 2A6JB 2YC1A 1EHXA 3TPUA 2EJ1A 1BQSA 2BMKA 2DKUA 1IQDA 4A04A 2OI9B 1A7RH 2HFFB 3SE6A 1EFXD 2GIMA 1LDPL 3GSWA 1Z5YD 3FXIC 5EZIH 2F54E 4U7SA 1XGTA 4JZJB 1EQWA 2IQ9H 2Z3FA 3OJMB 2BVOA 3ZOAA 2EDYA 1UGNA 1E6OL 3K3QA 2LLGA 3OLEA 5CP7A 4X9BA 4AE0A 2IOIA 4EZJA 1CFNA 1P1ZB 3L5JA 4E41B 2AMUA 3APCA 2CDFB 1LO2L 4Z7QF 5DTFA 3ETSA 3V4UH 1NMBL 1XCWA 4GI9A 3CXHJ 4MD4A 4QHKI 2CJ3A 5D7EA 5F7MC 3RURA 4HH8A 3LKRA 5IT2H 3GIVA 1J5HA 3BYYA 5CFAA 4POYA 1DVYA 5C0DA 3TEZA 1FIGH 7CGTA 3GRBA 3QEGH 5K9OA 4NZTL 4OCXH 4NENA 2BXZA 3SDXF 1ONQB 4MVBD 5ALCL 3PCYA 1EEYA 3O2DH 4NZTH 4AE1A 2YMXL 2RCSL 2OZ4A 3T4YA 2QDWA 1JPTH 2PWGA 2Y4SA 4H20H 2IC2A 1JV2B 3EZJB 3VFMA 4CN4A 1GIGH 1A8JH 2J5LC 1K8DA 4IS6A 3SYPA 1TVDA 1CK0L 3MV01 1J5DA 2EILB 3CFEA 4PCKA 4W9KC 4AJYV 1JF5A 3OKLA 2ERJC 4TULH 2VXQA 3Q2VA 1SMAA 3VO0A 1FO0H 3KH4A 3VW3H 1HL8A 1RK1B 4GG6B 1YHPA 2KLTA 4CVZA 3A22A 4MWFA 5J57B 1WT5C 3ARED 3QXUA 1J18A 5IHZB 5DJDB 2AVGA 2IDQA 4YL9A 4FQ1L 3S5LB 1T66C 4LIQH 3QZOA 2AQSA 3CFCL 3HG1E 1Q1JH 5ANMA 2OR9L 4KJWD 3UIZA 4UBDC 4YXHH 3OC5A 4YDIL 3VRLF 1G4RA 4FG6D 3QZWG 4MA3A 3WNOA 2NY0B 2VCOA 4G43B 4XVUD 3NJNA 3BI9X 3CLFL 1KB3A 4BCYA 3DRQA 5LCVH 4ES9A 3O2WL 4MJIB 4A6YA 2W0KA 4QNPE 4XMZA 1IAMA 3LEVH 4MHHG 1EAPA 3HUJA 4HCIA 3HNSL 4AX3A 3VXSE 1ZAGA 3FT3B 4OF5A 4CMHB 1SBBA 1CYGA 1YEJH 3BAJA 5DC4B 1TMQA 2BXYA 2PCXA 2W88A 4LEXL 3QJFB 3RWFA 3NJMA 5ACMA 5HI5C 3CV5A 5FGCE 4F2EA 1NCNA 3EYQC 4J5VA 2YIHA 4OD3L 5EC1B 2WUCH 3VXTB 5DQ9B 5KZCD 1MVFA 1CJYA 1RFDL 4OU3A 3EUDA 4LIQE 4AYBA 5AW4B 3VXUA 2XETA 3U4BH 2ADGA 3BXNA 3TA3D 2ENJA 2EYRA 4QLRA 3DPBB 1DBKL 3CZEA 3KWVA 5C86A 3SY0B 3H9SE 3TFBA 4JNXA 5IB4A 4HT1H 5E5UB 2D4FA 5C07A 4YEFA 1CPUA 3BUPA 3LOWA 4UAHA 2AEWA 5E1AA 1JVOA 1JS4A 3O4LE 3BP7A 4JRYE 3WGVB 1KIQB 3G5VB 3VD9A 3DMMD 4LOEA 4RZCB 3W0WA 3S35L 4R4BA 5G4NA 5KS9F 1MFNA 3DGGA 1T03L 4GQPH 3W11C 1JZ2A 2VISA 4R7VA 4URKA 4UNTA 2MQGA 4Z78B 3BO8B 3BP6B 4X2UA 5JIPA 1CL7I 2ICWI 1T6VN 2H3KA 5MENE 4WNSA 2FAUA 2GBVA 4U3HA 5IR1A 4WNQB 3ESVF 5I1AB 3VDBA 2P8PA 3VG0L 2ZNXA 1PQZA 4YGAB 3EDKA 4JPIB 3KVQA 4QRPE 3VG0H 4XXDA 1H3UA 2XTJB 3K6DA 3KGTA 4MDIB 4JO2H 1KCLA 4Z0BH 5I1DA 1MCCA 2B4CL 3MU3A 2F58H 2WVSA 3MR9A 3U2SA 4PJDF 1OPOA 2J1KA 4HS3B 2JJSA 4E9WA 1E3XA 4PJ5B 1Z3GH 4Y2OB 4GS7B 3MXWL 2C3VA 1C9SA 1Z0NA 5DGQA 5E94B 4W4OA 4MMZA 3MXWH 5E0QA 1ZEAL 2R0WL 1ANUA 2V9UA 5D2LF 4DKFL 4WI2A 2FIKB 2EE6A 1ODUA 2JH2A 4LOVA 4GFXA 5TFSH 4K5NA 4OAWA 1YEFL 5C09D 1AYRA 5KBKA 2XQ0A 4NQSB 4RAHA 4IDLA 2EZ0C 1GGUA 2D7NA 2H0JA 2V17L 2GTZB 3ZX1A 4G5AA 3ZTNL 5JTWA 1S6NA 1RPKA 5DEGB 3QORD 4N0UE 4Z18A 5CEZL 3R06A 2VLKD 3JWOL 4RETB 4H13C 3SKNA 3TO4A 1UH4A 3CZNA 4J27A 4JPQA 4X6CA 1OSEA 5CP3H 1BCIA 2EVGA 2VDPH 2WBXA 3S7GA 4XRCA 3T0AA 4OCSL 43C9B 2IJ0C 4MCYA 4OUOA 2AXJA 3CK0H 5HYQA 2OMVA 2ZOKA 1I1AB 2WM0A 4XP9L 3VI4F 4DN4H 4HULB 1PVHA 2VXVL 3QDHA 3N43B 3F5WA 1O5PA 4UANA 5GSRA 5I74C 2IH9A 2XG5B 1S4IA 1IAKA 3RL1B 3GMPB 3LEYH 4HIJB 3TO4C 3HAEA 5E7FA 3Q5YA 2Q0ZX 3CVBA 3TVMB 2CMRL 4M9OA 1XO8A 1TCMA 3QFJE 4JGNA 4I5BB 4OW6A 1KLGA 2H45A 2NDFA 3JTSB 1U8PA 2JQMA 4LL4A 1NKOA 3DX0A 4NJAH 4DP1X 2YPVH 3BD5A 5ITBH 1SPDA 4LSVH 2MKWA 3DSFL 4DH2A 1AR2A 2YD5A 4Y9BA 1I7ZB 1OTTD 4R4NC 5B3NA 3MJ8A 1GA2A 4ISVA 2X6BA 4FXLA 4Q58C 1MPAL 1NBYB 3P77A 2Y06L 4P9HH 3KBPA 1CDJA 5C08E 1NGPL 4HUWB 1E4XI 4Z8FL 4GO8A 3HJ0A 5KWYC 1BBJA 3NCWA 1FFOB 3H4FA 4Z8FH 5FS5A 1OM9A 2VC2L 1ZKAA 3I9PA 4QPEA 3QRGL 1EVTC 4HZAA 2X4PA 1WAAF 5C8JB 1YPZE 3CC5B 4X7SL 5AVTB 3ROLA 2AQ3A 5JHMA 2ZYHA 1BD2E 1MQKH 3LRHA 5F9WC 1WS8A 5FEBA 5FM5M 1AGCA 5IQOA 2FJHA 2OMZB 1D3CA 4BA0A 1MCDA 4Z5RB 3ULUF 3CN1A 3ZUCA 4TUOB 5E23A 1FG9C 2EACA 4YHKH 5IEHA 1IFHH 4ZPVA 4J8RB 3X3FL 4PJIB 5HVHB 4J39A 3C6SB 1LO3L 1L7IH 3ME0A 4HUCA 5HY9A 4KFZC 3S36H 1QRKA 3HFFA 3V6FA 3BE1L 3P0GB 4NC2B 5DHEA 4EIUA 4Q9BA 2CXGA 3L9RA 3I02B 4YHPB 2JB6B 4KQ3L 4Z3FA 2JI3A 3CIQA 1QNZL 3T2LA 1U91A 3QEHB 4NQVB 5EEVA 4XVJH 1FNLA 3DLQR 4PP2A 1A3LL 1BAFH 2PP8A 2VDRB 3H8NA 3GXUB 2R9HD 3EFDL 3LNIA 1SJHB 5E5RB 2ZOLB 3UAFA 4PGEB 3ARBD 4GG8B 1NEPA 2YPKB 4X9YA 4MB3A 1RURH 3MLXH 4H44C 1XAUA 4NJ9H 1TUPA 2ITCB 1NBZA 1QRNB 1OTUC 1H6UA 4L29A 4OBRA 1OSZA 1WVZA 2A83A 3N85H 4UB0H 4WO4B 5BRZD 3RPBA 2P5EA 3P3UA 4F9LC 4ZTPH 3ZE0F 5DFVD 3ZMNA 1EX0A 1UH2A 1YYML 1I8MB 3SGDH 5LGHL 3D1MC 3D2UA 1IC4L 1P7QD 2HVKA 3FTWA 3G5YB 3MLWL 1GZQA 2FATH 2L7QA 1X9RA 4GUOA 1DVFB 5B39B 1IC4H 2P42B 1RY7B 4OM0L 3ZHDA 4WI5A 1U41A 2A9BA 2Q76B 3PDGA 4L5FL 4BCZA 3WXVL 2EDJA 4L8SA 3RVXD 4AYDC 3T8XB 1N5YL 4MRCA 4F7CA 3EG9A 3WXVH 5J13B 1VACA 4H8QA 3PGDB 2CGZA 3HFML 2AFNA 3S2CA 3H85A 1QPKA 5FYKH 4QR7A 4PRAB 4J4PC 1JPSL 2P9RA 4TSCL 3KL3A 3A47A 4IBQA 1EDYA 1CDYA 5DYFA 5GGVY 2PCPA 2MJWA 1H3VA 4P2RE 3INUL 1NEZA 1AY1H 5T1MA 1MAJA 2CUMA 5AD0B 4AQ8A 4KDVA 3AY4A 3FHAA 5JHLH 3INUH 1OAKH 1KIUA 5HHOD 4Z7VA 1Q94B 4B5EA 1S9XA 3GMQA 3EJYC 3FUEA 1XGQB 5D93C 5CSGA 3ASNB 4OM1H 4Z7AA 1JK8A 4B41A 2NXYD 1IKFH 4KVCL 4CJ1A 2GJ6A 4ZYKB 2VDOL 3N1QC 4LAQH 5B7MA 4LXFA 2QMJA 1DJYA 1TTGA 4DKEL 1HCFX 1KNOB 3K0WA 1FH5L 2JCCF 3S3BB 5FYKE 2YA2A 4CC0A 2WQVA 2HUHA 1U42A 5AW0B 2BC4B 1QTSA 2CK0H 3MZTA 4AQEB 2LTQB 4MXWH 4G6AD 2XYCA 4JZNA 2NX5E 3DX8B 4AYGA 2JIXB 3IAPA 3NJXA 4IRJA 5E5LA 1RZJH 4PJBE 2JKNA 3QT2A 1FJ1B 2BNRD 3IKCA 5T3ZD 3CPUA 4H25A 2P48B 4X98A 1MI5E 3Q8CA 4XXCA 4YUEH 3OPZL 2R69H 2YXWA 5E4OA 1QFOA 3FAXA 4XI5C 2ADIB 2F7RA 4JO1L 2J8HA 3EIFA 4DP0X 3V0JA 1T1XA 4CGUB 1CLOL 3ZHFA 3MA7A 4R4FH 2VR3A 1GAFH 4GXVL 5IBTL 1X9QA 4BH7B 3RZCA 5D71L 5FYJD 1NCJA 1RD6A 2YMOA 4P04A 5IBTH 3ELAT 4DZBB 4GUQA 2P8MA 2CCVA 5HGBB 4IRJC 4PTTB 3TBWA 4X6EA 2ZG2A 5D7JA 3EGSA 1GW6A 1XB6A 2Y69B 4TYUA 3G6JB 1LO5A 1YDPA 5SWSA 4XXCC 1QTYT 4UQDA 4HBCH 5FOBA 4CN1A 1MNUH 1UG9A 4CW1B 4PMFA 4HEME 3D08A 3IEAA 3EJRA 4ZMQA 2E6PA 1B3JA 3M7OA 2CCWA 3MFGB 1C12B 3BN9D 5F0PB 3ZDYF 4PJAB 3ROOB 1LYQA 1DE4A 1U9KA 2DLGA 4BH8A 5IVOA 1HI6B 4QGYA 2DYPB 4QRBA 3OF6A 1MJJB 5L8LB 5CINL 3ARFD 3FHEA 3KBFA 1MHHB 2UWEF 3LB6C 2YJQA 5CINH 4F5CE 3ARTA 2EDEA 3A4DA 2EUWA 5I1IL 3NIFF 3C2AH 3KLDA 2XCMC 2KERA 1A5FL 2ERJB 3VI3B 3TLRA 1PZ5A 1N18A 3VFTB 4XC3H 4ELMF 1A5FH 1ZA6A 2YD6A 4EN3C 4OUUB 2K6ZA 2XQBL 5I71B 3BYTA 3PPSA 2WVVA 1HVXA 4GKSB 5JLZA 5LQBH 4FHJA 4ENZA 3AXHA 3FSVA 3IPBA 1H15B 3BUBA 3DK0A 4MNQA 3RDJA 3V4PH 1OGPA 3PFQA 3TJHC 1NDTA 2VLRA 4KKBC 2HRPH 4HFUL 5E9DD 5I19L 5I18L 2F9BT 4BSJA 3K5RA 2CG9X 3MRRB 2W5PA 4E5XB 2AJZA 2EKJA 5FM8A 4AMWA 2COQA 3VXRD 3X3GH 1WIPA 5BQ7B 4EI6B 2P8LB 3J2PA 4F3FA 3ZVVA 4HWBA 2VAAB 1F97A 4FLHA 4UM9B 4WW2C 5BZWB 1U3HA 1UENA 4DW2L 2E76C 4BFBD 1N6QL 3L2LA 3L7FB 3VFRA 1L0XA 1KB9K 2HT4D 3DTXB 3LH8A 4HIXL 4UU9A 1SEQL 3AACA 3GSUB 3MMEA 3FTYA 5EZJA 3L3JB 3T65A 2CSPA 3GSVA 4PG2C 4AGMA 1PD0A 3ILPB 4WW1A 2EUXA 5DO2D 4E9QA 1J0YA 1CFTB 3UTTA 3CE1A 1AIFA 3V6ZA 5JXEA 1IGYA 3RVWD 3BVNB 3GSXB 2OMUB 2J8UB 2UV3A 4YE4L 5T3XL 3N6YA 5DJ2A 3V52H 4P9HC 5HVFB 1KPUB 1U3HC 4YE4H 4ZPTB 1R33A 2D4DA 3BRDA 2VKXA 5IHWA 2ZTBA 2NY5C 4JFUA 3ZE2E 3PABB 2R7EA 4X8JA 4JANA 4AT6B 5DMYA 4B7IA 5DT1H 3QULB 1IGMH 2UZPA 4OF0A 1DCEA 2DWSA 5KJ7E 2NLJB 3CIAA 3UZEA 5B3JF 3IWVA 3SSGA 4HP5A 2AV1A 3WMSA 1D7CA 1R5IB 3MACL 4KV5F 1K2DB 1LNUB 3L7EA 4HPOH 1DHKA 4XCFL 1MWAA 4DPCX 4Q8BA 3LD8C 4FMVA 2VIRA 4XN8A 3FN3A 3M7FB 1DZBA 1A6UL 5I1JH 4EDXB 4EKJA 1IGFL 2PPAA 3EYVA 1SQ2N 2HG5B 4DP2X 1BVKA 3CSGA 1TJGL 2ZWKA 3U0PB 4Y5YC 2XWTA 1W6LA 4QHPA 2VR9A 5CIPA 1TJGH 3UZEC 2A2QT 1UASA 3LHPL 4L3CB 3VM7A 1ZVHA 3OKNA 5F6HI 3SE3A 2ARJQ 2NY3B 2ZKYA 3T0VA 4RQQB 3SE8L 3WYRA 4J23A 5IROA 3X13B 4IOFC 3FTZA 4YBQC 3QPQD 4KUZL 3SE8H 3B43A 1CURA 3BP5B 4FTVB 1MVUA 2VB5A 3L3KA 5IG7B 1KYOJ 2WLMA 1UWFA 5I17A 5DJXA 4GOSA 1NIBA 5BJTB 4DWHA 3OWRA 3UJJH 3FFDB 5HDQH 4RCAA 3KPRA 4XMXA 1YNTF 4PJ9C 1CVRA 1ZS8B 1YEIH 4DP8X 1YEHH 1C1EH 3Q6FB 3GLEA 4GRMB 4NIKB 3D8MA 4HX1B 1FPTH 3B3BA 3F7YB 3KYNA 3V5DA 2CR0A 3KNBB 2A9MH 4X5RA 5AW6B 1SHSA 2OTPA 3GB7B 3HZVB 4KGLA 1CTMA 5D2NB 2YSSA 1I9IL 1U8IA 4IIQA 2W07A 3HS0C 1T5WA 1MCKA 4Y5XA 4F33B 1YJDH 2QVKA 5I6KA 4NM4L 2VN7A 4UINL 4QI3A 5F7NC 3RWJA 1IGCH 5K5YA 4HQQL 1UT9A 2DD8H 5J89A 4MJ6A 4Z6AT 3P3YA 5HJ3A 4HQQH 4M5ZL 1P5UA 2ZUSA 1SQMA 2G60H 5GHWH 3ZU8A 4Y89A 1TZGH 3QO0B 3SOBH 3DROB 1N70A 5I74B 2WTOA 5FUOL 3KXFA 1ZSDB 4LHUA 1RVFL 3G04A 1C8PA 4F2MB 2NR6C 2FZ3B 5DUPL 3B1TA 1JGDB 1Q9WB 1DEEA 5IQ9A 2IAMA 4PJ8D 1KDIA 4AQ1C 2IQAA 1NFDF 4WJKB 4HK0B 2WQXA 5FYLH 2IMNA 4J3BA 5HYFA 2R8SH 5AVWB 4PGDB 2GI0A 3RA7H 1NCDL 4FEIA 3D39E 4PREA 3NJJA 1F4AA 5L2JB 3KJ6H 3QG7L 1IAOB 2FJSA 5E5MA 4NNPL 3H6JA 2OL3L 1QBMH 4G6MH 3DYPA 1MFDL 1NUGA 2IPKB 5HHNA 1JZ7A 2WQRA 4D9QD 4XCYB 3IDNB 3IFPA 4HV8A 4D9RE 3QRFM 4MNGE 3O3BA 3T3MB 1MFDH 2P5WE 1JZFA 3DDFA 4QXGH 5DK2B 2VLJE 3RVVD 2Y9RT 5DD0L 2GTWA 2Z1KA 1GTNA 1RUPH 5FYKU 1QFWL 1ILSA 5IMMA 1RZJC 2DM2A 1HKFA 1R3KB 4XB7A 1R0AL 4UTAA 3BLBA 4K7PX 4EVNB 5I15H 2Q3AA 1EFXA 5D7IF 1S5HB 3OPUA 4M00A 4XE5B 1E8WA 1VGEL 2HB0A 3QHFH 4BSWB 3R0MA 4RGMC 2C3WA 2VXTH 3IJSA 4JL2A 3WNKA 1ZHKA 2YPLD 3UYPA 4H8PA 2BSTB 2VR8A 1CE6A 4YDVA 1PU0A 5CD5C 2EXWD 5FHAH 1KN4L 1BYNA 1VKXB 3F84A 4ZFOL 4MYPA 4P4KC 5E0FA 5DJ8B 4CC1A 3A4FA 5L6YL 3KLHD 3UYRL 1F90H 4XVTL 4YR6A 1U93A 1KOAA 1MRCH 4IKIA 4OLYL 1DBML 2J8OA 2JNZA 1MG2C 1S8DB 2FBJH 2X4RB 4OLYH 4ZUSB 1DBMH 2H0EA 2AITA 4JS7A 4X5QA 5F72S 4WUKH 3HG1B 1UD8A 3IFNH 1SJEA 5IW1A 3K8MA 3T3PE 4ODHH 1ZWIA 3O41A 4F58L 5ICYB 1PZCA 3DOSA 4FQHA 3VGAB 2XU9A 3MUGB 4FQJH 3BSHA 4DQOL 2EUVA 2K9FB 2W65A 1F5WA 1L5GA 5IVZB 2MPAH 2YS4A 3V95A 5DVNA 4FXKB 3LKQB 4OV5B 3HE6C 4EDWH 1K3IA 4KZEH 4P46B 5J11C 4NZRL 3MRMB 1NGWB 3MV11 2WXHA 3BESR 3QBTB 1FDLL 1QEWB 3UTSE 1ZVNA 4NWTL 4NZRH 3RJDA 3VXSB 4XH2B 5D7HA 5EBMB 1I7RB 1YEKH 1NLDH 4GP4B 4K8RL 4NWTH 4MTMA 4P2QD 3AG2B 2JKLA 3AREA 3F7VB 1FO0B 2J4WH 5JPNA 5FGCB 3RNQA 1ACYL 1R3LB 1KCRL 4DESA 1ZOXA 4LCWD 2HJKA 3MOAH 4O51B 5C3IA 1AXIB 4XPBH 5EUOE 5I73C 1T7ZA 4PR5B 4Y4HC 3TM6A 1OIOA 1WBZA 1JCKA 1SOKA 4LCYB 5DJ0A 3HNVL 1AZVA 3L54A 2J6EL 2G75B 3H9SB 1DJIA 3FNKA 4JREC 2J6WA 2P5PA 2ZD0A 3OR6B 1GPOL 1M7DA 1R24A 2VUKA 3KPLA 2HLAA 4HC1H 1HH9A 1SHMA 1A2YB 2ZX6A 3U48A 5KVDH 5DRZA 5ENWB 3FFOA 1BJ8A 2FIRT 4FZ8L 4F37K 3H3PL 1J87A 2PPFA 3GLDA 4KK8D 3ZDXE 4KJWC 3BISA 1BPLB 5D93B 4OCLC 3OMIB 4S2SB 6FABL 4IKNA 4JY5H 3SGEH 4OVUA 3WFEH 1DDHB 1N59B 3IDMA 3SQBB 3CFTA 1CDHA 4RFEB 2OK0L 4JN2A 1NBVH 4G8FB 3CFKA 3FB5B 2VKWA 4G9FD 5C0IB 2Y1YA 4JFVA 3R7QA 2X4QB 3TA3A 4XP1H 1TVBB 5TGBA 3VU1A 5AAWC 1LO0L 3VFPA 4YBLC 1RK7A 4OZHB 4DJMA 4OD1L 1KGCD 5H4ZA 1ZGLB 1GS8A 3V4VH 2ZX5A 4BINA 4QRPB 1IC5H 1A6VH 3RHWK 3MJGX 1KCVH 1XCTB 3DMMA 5KVDE 2XXCB 1MAMH 2PW2A 2LU5A 2WTRB 4M7LL 4HZLB 3FS9A 5FDYA 3N2JA 1IT9L 1RERA 3T2NL 5EORH 5C0CD 2OSLB 3HHSB 4HSCX 4NO0B 1RI8A 2WNXA 5KBMA 1SM3L 2CGRH 3S0PA 4ZO8A 3BPLB 5FK9B 1J5OL 4IU3A 1X44A 4EO5A 1YYCA 3FU7A 3O4OC 1E4KA 4F1SA 3GHEH 3BAEH 4FGMA 4JO3L 4U1MB 5L2KB 1T4KB 2X44D 3DXAD 3FB7A 4NP4H 4W9GC 4Y4FD 3DMMC 2WCSA 1OSPH 4Z3TA 1IGTB 1DQDH 5HHMD 3N44B 2RHEA 4N0UB 4U1JA 2B3IA 5E8PA 1D2OA 2BERA 5DHYA 4JQIA 1X7QB 2Z9TA 5T8IA 3PL6D 5SWQA 2VDLH 4JPKL 4PGBB 4ZSOA 3ULVD 2Z7UA 4MQSB 3WO4C 3NP4A 3CC1A 5D1XD 2D0HA 3C5ZD 1IM3D 3NFNB 4AMKL 1DVTA 2DQJL 2AJVH 4Q89A 2VN5A 3DX2A 3UDWA 3Q48A 4FXGA 4NQXB 4NO2A 4PW4A 4TVPD 3ZE1F 5C09A 3GMNB 1EO8L 3QDGE 4YSEA 1XZWA 2UXTA 4HISA 4IMKA 1PJWA 3H42H 3L9YA 3WDJA 2VGLM 2BNRE 3EADA 5F8QC 5CEXA 1XV8A 3GSOB 3J8F7 3QORA 5DK0B 5L8KB 5D7SH 2WK2A 2VLKA 3CZSA 3QFJB 2SEBB 3HG4A 3ZR6A 1JN6A 4DTGL 4HAFA 4EN3B 1KJ3L 2GBTA 1A6PA 3UAEA 2J57A 4R84A 1WTLA 2H26B 3VB8A 5L4MA 2VDPB 1YJDC 1GYAA 1J1XL 4XAKE 2FO4B 2FO8A 4XNBA 3JV0A 4GQZA 1JGVL 1NCIA 1M7IB 1S7RB 2X70A 3WL9A 4ABQA 4ZMNA 3GXPA 1I3UA 2P49B 3DX3A 4R96A 3KYKL 2CGYA 3QA3A 5C08B 5KBNC 1AD9B 3QORC 2Z31C 4YHMH 4WCYL 3UZQB 2DI7A 3ECUA 5G4MA 1Q38A 2JK5B 4N68A 4W6YB 3V10A 4CMMA 3SY6A 4WW2B 5E1IA 4R90L 1HHKA 2QVTA 1GC1C 1BD2B 2IGFH 2YK1H 3I6KA 1Z1WA 4O2CB 3MRIA 4I0KA 1IC7H 2CIKA 4MYWB 2BHUA 3CDGA 2BINA 3DHMA 2QHRL 3UZVA 5AVUB 1QLRA 2E8YA 2QGBA 3PS6A 4FA8A 5LXGH 2Q3ZA 4Z3GA 2WGNB 4YL4A 5I30L 3U4EA 3C9NB 4JPVH 3RIFK 3RY5A 4P57A 5TDPA 3BEVB 5EV7A 1R3IH 2OZ4L 4L3AA 3ZBMA 4P23D 1T1ZA 4L3ED 1U2HA 2OZ4H 4N2IA 4ATWA 5ACZB 2WYTA 4U6VH 4JFEB 4JVUA 2JLLA 1A6WH 3QIWD 5DUBA 4P0DA 3VU2A 1CICC 1W0WB 3MNWA 1OTTC 2VC2B 3SQOL 2VXQL 3QJOA 1J5CA 1ZTMA 2WQUA 3B6SB 3GBNL 3PYCA 3ZKXB 1D9KD 2NY1D 1Z5LA 1OPGH 2CJUL 4ZFGL 3CSFA 3BGMB 5EC2A 2W9EL 4IRZA 4ZFGH 2P7TB 3ILDA 3KLAB 4YAQA 5KVEL 1RZFL 4L48A 2NZIA 5E24E 5EEUA 1OLLA 2FH8A 1XQ4A 4LPXA 3FQTB 4HIEA 1NCUA 3FFCD 1OO2A 1RZFH 3RGVD 3FQYA 4HUNB 4AI7A 1EJ6A 4JG0L 2AXHA 5I0WA 3OB0H 3RX9A 4IGBB 4E68A 1JHKL 3GSRB 1KLFB 5DHXB 4A6YL 3H2QA 1AO7E 3QUXD 3ULSB 4HEPA 5FLVA 3NIGE 3RVUC 5K9KA 1K6QL 4WWKD 1VLXA 3TEWA 2C1PB 5EWIH 4L9LA 1AMYA 2BY2A 1D5MB 3ARBA 4GQ9H 5GJSH 5MEOB 3QG6A 5H2BB 2R1WB 1NJ9B 1OCWL 2XPZA 1JGIA 2BFVH 3NACL 4HCRA 4YGVB 5BRZA 4DEUA 2OV0A 5GRJL 3MKKA 4WTXA 3CBKB 3TJEL 2H2PD 1QKZH 4KKZA 5BZXA 5E08H 1MY7A 1SXCA 3TBTB 4N9OB 2FWOB 1T0NB 2C8NA 4P2RB 5BUGA 4NKIL 1XF2B 2BOCB 1IAIH 1P7QA 3IJ9A 4GEIA 4XOAA 4XP5L 3D2TA 4PJ9B 4QRRE 4WI9A 2CE6A 4KKPA 3K2UL 1GGTA 2WQWA 4G71B 1G5AA 4QYOA 2OJ1A 3QUZC 5D1QB 1E3ZA 3GJEB 5CBAA 4L9LC 2JXMB 4P5TC 3TV3L 5IHUL 5KVGL 4X4KA 5FUZL 3SE4A 2Y1VA 3MREB 5F88A 5TDNA 1BQKA 5F89A 4HHWA 4MCZA 5T1DH 5I6OA 3HE7D 2DL9A 4PB0L 4JFPB 4HHAA 4OKDA 5DFVC 4TSAH 1KBKA 1FL3B 1X6NA 2C1OB 3MRPA 5E1QA 5LNGA 2DQUL 4LU5H 2CJSA 2ZZUT 5BV7H 4OI9A 4HW6A 5FV1L 7TAAA 3ETBF 2IFGA 2YFOA 3V6OE 5FA3A 1VSCA 4NERA 3UBXI 5DD5H 3S37X 4BK8A 2E75C 2D7MA 4S1RH 5HHOA 1XZ0A 3QZWB 2JKRM 2QV2A 2NX5B 2XPGA 1AE6H 4TNVK 4U7KA 2FD6L 2V9QA 1DTUA 4XN4A 3RVXC 3SE4C 4JFQB 1DQVA 3ALXA 1PSKL 4P5RA 3L2NA 4P3CH 3M1CA 3QXAB 2Y5TA 3P0YL 1MI5B 3FK3A 1SHXA 4U4IA 3PDOA 8CGTA 1KTCA 5I5JA 3WEMA 4X42A 4I1PA 1C7TA 2NZ9C 3JYBA 3AT0A 2QPFA 5A2FA 2ENQA 3CZFB 2ADYA 4FZEL 2VDOB 1UCTA 3LKOA 1V3KA 1YCSA 2ZSVA 4I48A 4OF6A 1RZGA 3D6GA 5BCAA 1GGBL 4KQ4L 4G59C 5EO0B 4AZ8A 1OALA 2YAQA 5E8EA 1BECA 2WP3T 2NXYC 1JWSA 2Y7QA 2J72A 3D4CA 3DJZA 4F8PA 2H1PH 4FNLL 1EJOL 5TDOA 3IDJB 5JHAA 2AJXL 2YAFA 5F9JA 5I76A 4DGUA 2ZJSH 3BDYL 4LLVB 2WC7A 3PJNA 4UTCA 1E9PA 2B77A 2BCKA 1AZCA 4YDJB 3G6AB 3QZMA 1WZLA 2HVBA 1YEEH 3UG3A 5E6RB 3DGCR 4BKSC 2BSRB 3OXRB 1EAJA 4APQC 5G2NA 2ZCLL 1E9QB 3P69A 2AJ3A 2ZUTA 3MXVH 3UROR 2CLZB 1PZ2A 2CQVA 3E0GA 4RSYA 4QCIB 2AAVA 3HVNA 3T8MA 1HHIA 2YWYA 4Z7IA 4EAEA 3NP3A 1FYTB 1JXJA 2Q6WB 3SKOA 5K9JL 3BQUC 3MGAA 2CUIA 2V7NB 5JHDB 3F7PC 2BSCA 3ULUD 3N40F 1FZKA 2GQHA 5K9JH 4TLTA 5TPWL 1MVYA 1FIEA 4H4NA 2X7LB 3IPFA 2J73A 1D5ZA 2VM9A 4RBPH 1QEXA 1R19A 2LU3A 2WXKA 2XVKA 3L3GB 5CN1A 4E9XA 3US0A 3T6ZA 2VDNL 1AP2A 1BGXL 3CXFA 5K9QI 1BMZA 2LAGB 1G9EA 5GRUH 2R1YB 4OJCA 5EBLB 1Q0YL 3U9PL 4DP6X 3QC6X 4PN6A 2F8OA 3ARFA 2Z35B 3MRKB 2C4XA 1P5VB 4JO8A 3T0XA 1KBWA 1QLEL 2EYTB 3NN8B 4IQHA 3TF4A 3NFSH 2HSIA 3HE6B 2X6UA 3G5XB 3VXQB 3I9AA 5J11B 1LLAA 3FU8A 2WINB 2MCPH 4PJEF 1MAKA 3FT2B 3DX9A 3HIZA 3GGWA 1QSFD 4RDQF 4GIAA 3EGDA 2ZAGA 3WN5B 1JZJA 3VFSA 1LP9F 1BLNB 2GSGB 4NN5C 3TN0B 3U82B 3BKML 4QXWA 4QLWA 4XCNA 5FO9B 1WITA 1QWNA 4JM2D 3Q05A 2X4OA 3FQWB 3L1EA 1YLBB 1J8RA 3E8VA 4L1DA 4Y2LA 2VRKA 4K94H 2WLZA 2ZXAA 3C6EA 2DBLH 5E9DA 1J86A 4IRSC 4PG9A 4XAWL 4Y2DD 4Y4HB 2O4EA 2D7TH 3L48A 5DI8B 3V0AC 3BPCA 5SWZA 3CH8A 3VXRA 1RZIB 3DETC 1RU9L 2SODB 2FK9A 1CLYH 2O5YH 1I8KA 3O11A 3PHQB 5B3SB 5KSAC 3GTVA 4QHMB 4WI8A 2VZTA 5CN2A 4UUJB 4C54A 1UKQA 4ICWA 3ZE2B 1LEIB 4YEEA 2G3NA 5GRXG 3SO3B 2Z91B 5I2IB 3MHZA 4XMPL 2B1HL 3OKKA 1T22A 1NBCA 3SPIA 5E4EB 1OE2A 1DJWA 1AXTL 1PLAA 2JI2A 4IEFB 5CHNA 4LB8A 3B5TA 2ZWSA 3VFOA 3QNYB 1AXTH 2EIEA 1SYSA 4YLCA 4IBWA 1QSEB 1KSRA 4X0NA 4Q6IA 2CD0A 5GIRA 1OVZA 4I18A 1L0PA 2FB4H 1IGJB 4NQQA 2EXTA 4WGWB 5BZZA 5D4HA 3OVUB 4UILL 4HOZA 2ZAIA 1JDDA 1LO4H 2HT4C 1T6WA 2Q7YA 3BVXA 3KLSA 3VTTA 4ERSL 4XMLL 1TSHA 4KRNA 5CMAB 3QQ4A 4W9IC 3II1A 3E80A 3LPFA 4XMLH 1TTFA 3V55A 4YFLF 2HPOA 3TT1L 1AGDA 4XE0A 5IF0B 5DO2C 1CFBA 2KZKA 4I85A 1E90A 1LQBC 1KACB 3KM1A 4DKDC 2WKOA 4XT1C 2DQIL 3KPOA 2HFGL 4K3EL 4PJXA 4B0MM 4P06A 4GP8B 3OQRA 4PJIF 4FAAB 3LZNA 4LVOC 4HWEL 3NBNA 1YQVH 2D31A 3O3EB 5E2VH 5IM7A 1QYGL 1KCUH 3CSPA 4FNSA 3ISYA 5JW4Q 4IBUA 4YLQT 1H3XA 2XI9A 3QQXA 5IMOB 5D1ZD 4N2FA 3WKYA 3LEXB 3DNKA 3CWGA 3PXHA 3GMLB 1J9SA 2L3BA 4IU2B 2UZXB 4MZ3A 4OQTA 4Y7OC 4N8VA 4R0LB 5JDSA 1NM4A 5CILH 2OCJA 3WUWG 4POZC 3FH5A 3D87B 3P73A 2AQQA 3TYGL 1ZT7B 1YMME 2DJSA 2RQ8A 3QJUB 3U83A 32C2A 1USZA 2E8ZA 2WSDA 1UADC 4ONHB 2CBPA 3B8YA 4OKVA 5D9SA 3BKCH 3CXHK 2KPNA 4XP6L 1KGCE 4F93B 2VN3A 2RALA 3ZK0A 1JYWA 5ADPH 1HEHC 1HILA 2FX7L 2CUAA 5EOTB 3C60B 3FCTB 4TPRH 3X14B 3C2SA 4XTRD 2HRGA 3CPLB 2QQNH 2Y0SA 3JYCA 3MV9D 3OMAB 3IN2A 4JFFD 1QBAA 1HNFA 3AQYA 2ZOUA 4B9FA 1RIVL 2MSPA 1ZE3H 2R4SL 1FNEB 1V7MH 4ODXA 1CR9H 3RFRA 3KPSE 5I26A 2OSWA 2DM3A 4M1GH 4N5ED 2J88H 3W38A 2ED6A 3UJIH 4NHUB 3BZ4A 5F7EL 1AOZA 2QR0A 3D39B 1CL7H 2FLMA 4IOIB 2JMRA 2RTTA 4OZIA 3LYRA 5MERB 4K23L 5CS7A 2KL6A 2V9TA 4D0BB 3RAJL 4EBQH 1BHGA 1FYHB 4U6HA 5BV7C 3GSNH 3NVQA 4IBLT 2VH5H 2VLJB 4HGWA 4UYQA 2E46A 1U8QB 5A2BA 1M6OA 1Y18B 1FAIH 2OJEB 5I66B 3NZ8B 5EEWA 5T1LB 3CZJA 4PJ8A 1KTDB 4YPJA 4C8XA 3UPRB 3ZHKA 4HYTB 5JPMC 3DBXA 4OB5L 5HPMB 4NBXB 3H54A 3F6IA 3QZLA 1OARL 2WLIB 2EE0A 3GFUA 4Z7QE 1D5BB 1F4WL 5D5MA 4UT9A 4N9GA 1G7HB 4XNUH 2OQJA 1RCYA 2W0FB 4KI5D 1NUDA 2HLEB 1V3LA 3AMLA 3F83A 1FL5B 1FFTB 4GAJL 4ZODA 5FUCE 1LD9B 5I5IA 4QIRA 1MUJA 3I2CH 3JTTB 1JI2A 3DTUB 3MO1A 2WLJA 2QSVA 3SDXE 4PJ8C 3QCTL 1WLHA 4WENB 5D72H 1NGYA 3MRFA 2HP4A 3NCCB 4UDUB 1JPGB 1FGNL 3FONA 1GZHA 4YXKL 4YHIA 3A0OA 2AS5M 3DRTB 5INDB 1E8XA 4BWWA 3CBJB 2IPTL 3RWHA 1EZVY 1AR1C 1M1SA 4W9EC 2GW5A 2UVEA 2WZAA 1LK2A 1I9JL 1O6SA 3CFQA 2JELH 5TF1H 3T3PB 3LS4L 5F7FA 3LV3B 1A9VA 5FKAA 5LDSA 5B1AB 3HCVA 5ERWA 3SPHA 5IQ7H 4QWWD 2YPLA 1B0RA 5HGGS 1BFOB 3SDAD 2Z92B 2VDKH 2O5ZH 1DO6A 3FB8A 4XN5A 1GXEA 4TQPA 1CE1L 5LBSH 3CSYB 3I85A 4LCIL 1IUZA 1WZ1H 3APMA 2AV7B 1A7PH 1NGXA 1N4XL 3GK8L 1H9VA 3AU1A 3G6JF 3UTSB 4HJGA 3WTSA 4D9LL 1CF8H 2F5BH 3VRLE 4MDJA 4BFGA 5KEZA 4HWBL 1UM5L 2K9UA 5AW1B 4OZFG 2RMNA 4PGCB 3LQMA 1WICA 4GKNA 5JOPD 1N9PA 3I50H 5KTEL 1RPUA 1BBDL 2NY5L 4N2MA 3SODB 1TQSA 4PJAF 2A74A 3NJVA 4L8BB 5EUOB 5CD3B 4Y9EA 2GCYA 5ESVB 2KS0A 3MJWA 2J5WA 2EXWC 1XMEB 1BZ7A 1RUQH 2OW7A 3CUPA 1OP5H 3RGHA 1BOYA 1E4XH 4LCCB 4PB9H 4Z7UA 1FNHA 3IJHA 4X6FB 1P4LA 1E40A 2VL5B 4JDVA 1KLUB 1DSFL 1PGRB 3POCA 3VI3F 2CBTA 2QQQA 4G1MB 1OP3K 1WE5A 2YJLA 3DIVA 4K7FB 4P2QA 2YLKA 3ZDXB 2M8XA 4QTIL 1TZ8A 2YEVB 4AH2A 3X1EA 1ADWA 2X2IA 1AZUA 5F1KC 3W2DL 4PVMA 4LCWA 2LQRA 3RUGB 4W9FC 4IBSA 3EF7A 3O6LL 1KEGL 3ESOA 4RMWA 4JFXA 1KJVB 4K94C 1H0DA 3VWJC 1MJ8L 1RUKH 4J3UA 3T0BA 2NT0A 5C6TH 4YHNB 3PWPD 4I0PC 1G6RH 4H26B 4WUUB 1L6ZA 3X1NA 2Z93B 5M95B 1AGEB 2L7JA 2BVPB 4UTBH 5KS9E 1MWAL 4U3SB 4KITB 1BF8A 5FO8A 1Z6JT 3F65A 3AGVA 1DUZA 1WD8A 3RDTB 3BPOB 1D6VL 3VWKD 4LBAA 2WAQA 4OIIH 3IVKB 4XR8C 1AQ8A 3MTRA 5DR5H 4ZTOL 1EDQA 3LIZA 2NY6B 5J3HC 4MQ7B 2E86A 4ZX5A 4N6RB 4B27A 4KAQL 1OGAE 2GUOA 3AAZB 3V7MA 4A2HA 3RNKB 4A2LA 4G9FA 5I1LA 3FRPA 5B4MD 1HYSD 4YHOL 1FC2D 3DYMA 3GBMH 4OFDA 4OLXH 3TNMA 4R7DA 3VFUA 4ALAC 1GGCH 3V0EA 4ZFFB 2J8UF 4KQ0A 3N1MC 4UOW0 1FE8L 3EDDA 1JNNH 2DWDA 4ZAKA 1UURA 5IJBC 2F5AL 5FFLA 4PJDE 2YRPA 4KK8C 4FFTA 2I69A 1AGFB 2DZEA 1FFPA 2J20A 2F5AH 2F15A 3LXCA 3WFBL 1GRWA 3CU7A 1HQRA 3VA2C 2I5YL 4O2FA 1K85A 1W91A 4ABUA 4HH9A 3V4VB 3MA9H 1HHJB 2IDSA 1J8KA 3GZOA 3SCMD 3RGBA 1P4BL 5D2LE 1WUNT 1N6VA 3EBAA 3OTTA 5C0CA 2MKLC 2NY2C 4LLWA 2W92A 3BFQG 3S4SG 3TP4A 5DSCA 4BK5C 5CWSA 4PD4J 4X5XB 1MCBA 1S9YA 2F0CA 5GRVK 1F6AB 4CADA 3FULA 4CKVX 1S9KC 2J2ZB 2VMEA 4QRQA 4YDLC 3WTTA 2Q8BL 4NXKA 3WIIL 4PLJD 4APQB 2DTSA 1Z3RA 4HXBH 1RAMA 4OT1H 1H19A 1LWHA 5GS0H 3B4NA 1UQSA 3DXAA 3ML9A 1DVSA 3QDGB 1MLBB 1MCLA 2AK1L 2W0PA 3D9AL 4Y4FA 4M7LT 3DHUA 2EDQA 2AJYL 2AQTA 3NJHA 4JFDD 2QZ5A 2BY0A 3P4LA 4HWZB 3GIZL 5DUML 1X4ZA 2QHLA 3PL6A 4LDCA 5AAMA 3RTQC 4L4TD 3THML 1AI1H 4OCYL 5D1XA 2VDLB 3O45B 5EBWB 1BQ5A 1UM4L 4B9GA 1XBRA 3MCLL 3V0WH 3C5ZA 5CKGA 1IM3A 5L88L 3KLQA 1TQTA 4WV1A 4LCVA 4B95C 4JRXD 3DO7A 3JWNC 1I7TB 1Q9LB 5IBLD 4BBWA 3E1F1 5I6LA 1T83C 2ICEB 4Y4FC 1MFAH 4YC2B 3VJ6B 2VR4A 3CH1A 2G5BA 4JQVA 1AXSB 4L8DB 3PQYB 1KN2H 3D25A 4JB9L 2VUYA 5CEYA 3MCKB 2OAAA 3TCXA 1VEPA 4PRHD 1ORSB 5I16A 2TAAA 4GMTL 1UFUA 2WMPA 1S5IL 2PABA 1OGTA 4CVXA 1BQHG 2Q87A 4HOWA 2XIIA 4PIBA 2EICA 3I6GA 1T20B 4K55A 2V0AA 4MA1B 2EE2A 1EUTA 1W8NA 1FN4B 4JDTL 3NPSC 1AQMA 2WHVA 4LCUA 3U0WL 2HT2C 3IDIB 5DEFB 1HK6A 1JTTA 3W82A 3UABA 4JHUA 4UTAL 2V4LA 1AKJB 4JQVC 1NSNL 4G42A 1WAAE 2W91A 2EEXA 1Q1PA 4EKXA 1MCOH 2CLRB 4JCLA 4LGRB 5GGUA 5FUCC 3F04A 2CIIB 2YC1B 3FSZA 3O6FC 4YO0B 3TPUB 4P4RB 1IQDB 4PW9A 4H8VA 5KSAB 5KYWB 4IDJH 1QVOA 5BS0D 1AJ7H 2HX7A 3DOIA 2AJSL 3UC0L 3C12A 2JKJA 4I2XE 2ZG1A 4UQ9A 3GSWB 2P52A 3MV7D 2Z1PA 4PRIE 5GGVH 1XGTB 1N8OE 1Q90A 3OAWA 4KRPD 1HXYB 3T2PA 3EFOB 1CIUA 2WUBH 4Y4KC 2UUDH 4ODVH 2XYBA 2CR3A 4WFEE 3SBWC 1Q72H 2KT6A 1CQKA 4NQED 2DBJA 1W0VA 4MD4B 3EH1A 3GMMB 2JLPA 3QXVA 4LLDB 1A14H 1PLGH 2QT6A 1J05A 3FJTA 3KCPB 4JHAH 3AC0A 4OGYL 3MUZ1 1YZZA 3ARZA 3T3MF 3PWLB 1HIMH 3US9A 4MJ5B 4P23A 3K71A 1BQLL 4J3VA 4L3EA 4L4VD 5I6XC 3QIWA 2HJLB 1EEYB 2WIMA 1AO7B 1NCAL 3BGFC 5KSUB 1FFNB 5K1JA 4RMUA 5KYNA 3P11H 1NCAH 2MTAA 3VFMB 3ZE0E 1D9KA 3VH8G 1WWWX 2DIJA 1IJNA 4I1NB 5AB2A 3QPXH 4AVHA 3CFEB 3P3RA 4N8CL 4ZXBD 3OKLB 5IEKA 4JAMB 3PIQA 3TV8A 5LN8A 3L4CA 4N8CH 5I6MA 2XZCH 4N8UA 4IMLB 4KMTH 2X3AA 3FFCA 4LVOB 5DWUL 3RGVA 3MV8E 1V55B 3VFVB 4WSGA 3QIWC 5E2WH 2AJUL 4PJCF 1SJMA 4LOFA 2M2DA 5EPMB 1G6VK 1U3JA 4QRRB 1B4TA 3EH5B 4F9PC 3QUXA 2GK0B 3N04A 1D9KC 4WWKA 1KGIA 1H6FA 1CBVH 1HN1A 3BT0A 3EOYG 5JHBA 3D51A 1XIWC 3HC0B 2YA1A 5DEZA 4A6YB 2EDMA 3HR5B 4G8GD 1DBAL 1M56B 4YXLH 2IWFA 1YY8B 3P9MB 4OZFH 1IQWH 4PY8I 1JRHI 3WS6C 3BVVA 3RGVC 1JPEA 1E0OB 5LLIC 3WOVA 4YHLL 12E8L 3RVTC 3MBED 4TQEH 3JUZA 4DFHA 4KROC 4MX7B 5I1GL 2E9BA 4XX1E 1KEML 3RKDC 4A7GF 4WWKC 1J0ZA 4NKOB 1KB5A 2VABB 2Y3NA 1ZMYA 4N90D 4P9ML 4AVIA 1S7XA 2YD8A 4XCCH 5F1NA 4XP4H 3FU0A 2A3TA 2ATPA 4Z77B 2QKIA 5ILTH 2JCCE 4X0KA 2ETWA 2CAKA 1A4JA 2X88A 4JLRB 3WMPA 1JNLL 5JOFA 4XMKL 1U8MA 3X1FA 2UXVA 2HX9A 3O6KL 5I1HH 1MJ7L 2OSXA 3RB5A 4KNQA 4YSAA 1X5KA 2QQLL 4MNHB 5F96L 4X4MA 1EXUB 4NT6A 4KTGA 4PY7A 3CN4A 2A7BA 1MHPH 1CDIA 3WNNA 4R4BB 1AS6A 4PJ7E 5BV7B 1HOEA 3DGGB 4NM8L 4YSDA 4M1CC 4UV7L 1NAKH 4NDMA 3AS2A 4FQXD 5JO5B 4AWJC 1J1OH 5E8NA 4D8PB 5C71A 3CVDA 1DN0A 1NUFA 1QFHA 3HE7C 3KLKA 4KO9A 4X7TB 7FABL 3ILEA 1N10A 2VW4A 2PKDA 5ETUA 5JPMB 3K91A 4TLKA 5IMLA 4JQIL 3L17A 3VI4A 3MRBB 1PQZB 3NSFA 2VITB 3MRLA 2H32A 3GO1L 2FLBT 3GHBH 4XNAA 3N41B 5JW3L 1H3PL 1P7KB 4XBPA 4OZHF 4E42A 3B5HA 2OX5A 2GITA 2QVFB 5DD6A 1CGVA 4QOKD 5GGSY 4JFOA 2WANA 5JZ7D 1U2CA 3RRQA 1AH1A 4D3CL 3GMOA 2VE6A 2G3XA 3L4XA 3SD5A 2CPUA 3ZDYE 3VFWB 4MMZB 1L9MA 5ALBL 5KVFH 2HH0H 2O30A 1QQDA 1EANA 2A6DB 5E9NA 1YAIA 3BLKA 1S3KH 3VRIB 1Z5HA 1X4XA 1CG9A 1RJYA 3ECVA 2AC0A 2O61A 2UWEE 3L1OL 4EZMA 2HFTA 5CSZA 3QAZC 4M8VA 3NIFE 2B0SL 1A4KA 1AQDB 1AOHA 2A0LD 2GSIA 1GC1L 3FCSA 3EOBB 5EZLB 5F9DC 2WOBA 4N2KA 5J12C 3PUCA 3S97C 1UZGA 1Y6NR 3FCGA 3T09A 2EECA 3PREA 1AGBA 1WGOA 1G4MA 3B2UD 3GTTA 1EXHA 1HS6A 4LNRB 5IB3A 3PP4H 3N44F 4MCYB 3WNIA 1TQCC 2K7PA 4TNWF 2ESVE 1F2XK 3HHRB 5HYSA 4YNYA 2ZKXA 3NCJL 5KVFE 4U1LA 1J9QA 3L1FA 3OR7A 3F5WB 2ZXGA 1VFBB 5GSRB 2OW6A 3P4MB 2XWBA 1VA9A 1E27A 2JQAA 1F58H 1U8NA 1XXFC 1IBHA 2OMWA 1KTRL 3D0VA 4E41D 2AGJH 1CXIA 2LVEA 2X4SA 1CGWA 5EFIA 3WIHH 1DYZA 3DX6B 4XWOC 4O5LL 1RMFH 2OXHB 3EH2A 1VERA 3ULUC 1T2QH 1X5LA 2FYYB 2FR4A 1QSFA 4Z7OB 4UIMA 1XSOA 5BVPL 3P77B 3OZ9L 5C0FB 1F1AA 5AG8A 4JM2A 3PAUA 1G1CA 1IEAB 3O8XD 5GPRA 3R1GL 4DP9X 2GEQA 3QCVL 4PVNA 3DX7A 2MQ3A 4Y2DA 3UH8A 4FP8L 3KR3H 2AEIT 3ROLB 3PDDA 1KYUA 2NY7L 3PJSB 4G70B 4IRZL 3MRCA 4JFYB 3CVIL 1T1WB 5F1IA 4CNIA 3AT9A 1VZGA 4ZFZA 3WAJA 2FJHB 2NY7H 4M8QB 4ZMLA 4I88A 4FNUA 3K6SA 5DJCB 4HKZA 3RWEB 2FWUA 4P8QA 1DL7L 2Z0BA 4WW2F 2DQEH 1LEKA 4KV5E 3C5JB 3LQAH 4Y1AE 4CILA 1S7TA 4NNXA 3U9UA 5IEHB 5MI0B 3Q8FA 4DP4X 2C3XA 4NSKA 3RX5A 4B9KC 2NY0D 1WZKA 3LPWA 3V6FB 3R8BB 4DK5A 2YAPA 2XQYA 4U05A 3A4AA 2PXYC 4M61A 4MJID 1I1YA 2R2EA 1F42A 3IDUA 2C9SA 1WJ3A 4KJYA 1U91B 3WENA 5AW3B 2OMXA 4ODWA 1EHLL 3FOMA 2IALB 3NH7H 3NK4A 4HCRL 1J9CT 1EHLH 2J7LA 3CZGA 5BOPA 5C0DB 2F74B 1JXGA 3AMKA 3CFJA 2WXJA 1JGLL 1LILA 1CC3A 4ZMVA 2DQTH 4JN1H 1NBZB 3N5AA 1DQML 1OSZB 2A83B 3FMGH 4JJ5A 4PV8A 4XN9A 5LUMA 5CZVL 4O9HH 5HGDA 2YKLL 3JSSA 1MJUL 1S2EA 1YY9D 5K33A 1IE5A 2O6CA 3HS8A 3QDJE 3NA4A 2NY2B 3KEHA 1KFAH 1U3ZA 1OKEA 3MN8A 4LVHB 5J1AA 1YMMB 4JY4A 2HFEA 1AZZC 1NDMB 3V0VB 1P4UA 2OP4H 3UBXG 3ZW3A 1JZ4A 4YDLB 3DVGB 2F53E 2WJ7A 4Q9CA 5IVXF 1P2CA 1FG2A 2V2WA 2P44B 2ZF8A 4F7CB 2HRLA 5DJAA 5FWQA 2B3RA 3SJVA 5C9JB 2DMBA 1NMCC 5E6IC 5KW9H 1MCWW 2N01B 5CLXA 2WXOA 4CC4A 2PWFA 1FZOA 3RTQB 3TA4D 1SBSH 1UACH 3DECA 1MLCA 2PCPB 4KO7A 3IU3B 3KPSB 4RMTA 5GGRA 2R29H 1HCZA 5T1MB 4EQ2A 1U8KA 4TLSA 1RIUL 3BOVA 2YD4A 2BSDA 3HC4H 4RX4D 4MMYB 1UXWA 4N3TA 5IUCA 4OY9A 1L3NA 4KHXL 15C8H 4B3VA 2XV0A 4BZ1A 1EBPA 4NUGL 1SXAA 1GKEA 4JY6B 3ISWA 2F7OA 1EIBA 2XTJD 2UZIH 5D1ZC 4AYMC 3E9TA 4KY1L 2BOBA 4AYFB 1BJMA 2DWEA 1V10A 1II4E 3FUDA 2AXFB 1E4WL 1SVBA 1TJIL 2WXGA 5ADOL 5D6DA 1FRGL 2VJ8A 4KVPA 8PAZA 5IKCB 1G7JA 3MV9A 1Z9PA 3CSBA 2X4NB 3TYFA 4JFFA 3TBCA 3H0TA 4PJ5D 2AK4E 5L0QB 5AYUH 1HSBB 3O2VL 4LRNL 1FVDA 2DN7A 1KC5L 2X6AA 4I3GA 4Q9RL 5E4AA 5EU6E 1CLVA 2FSEA 1P4IH 3BUIA 3A67L 5T3ZL 1Q9KB 1KPVB 2ED9A 3NPSB 1ZDQA 4OLVH 3BD3A 4C56E 2UWEA 4J3XA 5TE6H 1RZ7H 3RYMA 4H8WL 1NCCH 5D7KD 1WCBB 2XOTA 3ABKB 4Z0XA 2ICWB 4BYHA 3ZYZA 1A9EA 4JFDE 2VMJA 3VXNA 2DWXA 3O6FB 3AS0A 3BDXA 5FYJL 5CBEA 4ELMA 2WZ5A 1W72A 3GSNB 4OJYA 2EEAA 3IKKA 4GQQA 1QI5A 3SDXB 1T1XB 3QXDA 4JKNA 4OIFA 1JWMB 4RVBA 1WS7A 3QNXA 2NCMA 1MELA 2J43A 4FJYA 5K9QG 4Q0XL 3C08H 4O2EB 5FM4A 3WJJA 4Y4KB 4YVNA 4FFWC 1I1AD 4JRXE 4M93C 3K72B 4QHLB 2ZAHA 3QH3B 2APFA 4KXZH 4LSSL 4HDIA 5D7JB 3CQPA 2HUEA 3EGSB 4JJHA 4QXVA 1JNHA 1LO5B 2W80C 4RNRB 5BUAA 4LSSH 4UQ3A 1WCQA 2ATKB 3HKFA 4M6NH 4NOBA 3M07A 1TJMA 2Q7NA 2XVLA 2B1AL 2HJFB 3TVMD 3JQOB 1QMUA 1IC0A 3QJHA 1GGIH 4HALA 3RI5F 3O9WD 4K9EC 3U0TB 1OV8A 2A38A 2Q86A 1HYRC 3HB3B 4PLKC 1XCQA 1NANI 5TD4A 1J8HE 1TOXA 2BSBA 1I8IA 3K1KC 3PNRB 2DEXX 3WJJC 4KJQC 3BGFB 3OAZK 1RZKL 4I3RH 3ML8A 1F1DA 1WIUA 3WHE1 1UATA 2XQYK 4ZW6A 3IJYB 2I07A 1IJ9A 1RZKH 5CZXD 2VL4A 4MD5A 2ZSWB 3TBSA 5KVMC 3DV6A 1LVEA 2WYZA 4KTDH 2N4IA 2XN1A 4ZMXA 7PAZA 5DMKA 4Z95H 3U9WA 4QO1A 2FYVA 2I9TB 2QPSA 4X4XA 1U8CA 3SDAA 2GJZA 5AZEH 2CDGA 1ZA6B 3HHMA 4PWKA 4AGQA 1TDQA 4X5PA 1OSYA 1HXMB 2WVVB 2R0ZL 2PR9A 4OV6F 5DF0A 3HRPA 5JYLA 1MDAA 3A6CL 4PRNA 4DGYL 1VGKB 1A6ZB 2DH3A 4HUKB 3PAVA 2QDVA 4P59H 2VLRB 1I1CA 3IS0X 4NN6C 4FI8A 1UB6A 5LGJA 2CDEA 1ECZA 1P53A 3FUJA 4NRYA 1XIWB 1BFSA 2NW2A 5B1CA 1FNSL 1WISA 4NZDA 3SDAC 2ARJB 1T7VA 4WU5A 1XF3A 2R23A 1GCYA 4ONFH 3LKPA 4HJUA 4HUVA 5HGHA 3C09C 1JIBA 3VFRB 1KGYE 4AL8L 5E2UL 2NTFB 3CN2A 4L4VE 5C2BL 5EZJB 2WB7A 1A3RL 3T65B 5KS9B 4LVNC 5DDHB 4M9PA 2A73B 2VLLB 5GZOC 4UV4L 1CN4A 1AIFB 1MHEA 3CHPA 1MCSA 4KVNL 4M48H 1NC2D 3C87A 5HDBF 1FNGB 1QRND 3G6DH 3MJ9H 1RUAL 4ZD3H 3QUYC 3B2VL 4RGND 5EU5A 2PW1B 3G08A 4J3OG 3K4ZA 3ZQ9A 1RUAH 3KGRA 4Q6YA 1ETJA 5A16A 3MZGB 3BFOA 5DD1L 2ZCKH 3PWPA 1DFBL 3QIBC 1AZBA 2F19H 4HUMB 2ZT9C 2OXGA 5B1KA 1DVFD 3DJRA 3EBGA 1J12A 4GW4A 1XT5A 4KJPD 3NCXA 1G6RB 1M9SA 2L7UA 4LPYA 2AV1B 3WLBA 1GKOA 1INDL 2QFRA 3VWKA 1KPRA 3OKEB 3D34A 5AENA 2PTUA 5CCGE 2WCPA 4MMXB 2EIMB 1U33A 3LQAC 1NIFA 1RHFA 2VIRB 1LTXA 4DUVA 1X5FA 4NHCH 4UCFA 3FTXA 4GH7B 3DJSA 5GSVB 2WVUA 2P45B 3BVTA 5MP6L 3GM8A 4LLYB 4M1DL 2PR4L 1BVKB 4OQTL 1JERA 3NSYA 2XWJB 2W60B 5E8OB 4XN7A 5EIIG 1NAMA 4GJTB 1VJSA 2BZDA 4D0CA 5E2TH 3M88A 1AS7A 2VXUL 3NA9L 3EJTA 3K5SA 3QNZB 4RRPM 4TNGA 4Z23A 3EYUL 3LKNA 2VLMD 4A1RA 3K6OA 4F7TA 4FKHA 3EYUH 2Y72A 4ZQKB 2HXAA 4LL1A 4ADIA 3QFDA 4LHJB 3VXPA 1NFDA 4O02A 2F1BA 2IFFH 3L3OC 5CLYA 3FO0H 3SCMA 5I17B 1SZNA 3QEQD 3BDBA 1XDTT 2YQ3A 3ZE1E 2WXPA 1I9RL 4PGJA 4JG9A 3CHSA 3SGJC 3QAZB 2H7WA 2YHGA 4KZCA 4RRPA 1QFUH 3BH8A 1G7QA 3NIDE 4I9XA 4MFHA 3V5DB 5FPIA 2D7QA 5AOJA 3QC5X 4KK6D 4GKZA 3OAUL 2JIXD 4WWID 3HBGA 4IIQB 1PJ9A 4PCYA 3TIEA 1PEWA 3IFLL 4JFDA 5HI3C 3RWJB 3I9GH 1EPFA 3DV4B 3IFLH 1BAGA 2WXNA 4RFNC 5GS1A 5FXCH 2VR5A 4L4TA 4QHNA 5D7IA 3CVHA 3VDCA 1A3ZA 4QF1A 1A1NA 4XNYL 1QR4A 1BMWA 1SMDA 2CU9A 5IUSA 1I31A 4MJJA 1P9MA 1S78C 4JRXA 4LHUB 1Z9SA 4LLUA 4XBEH 2E7CA 4X9IA 5MHSD 1MRDH 5IIEA 5BO0D 5I24A 1CGSH 4JQXA 4LPCA 1MFCL 4V1DE 3VXMB 2IQAB 2GT9A 4LARL 4UT9L 1V7NH 3SKJL 3ARYA 3JV6B 1GW0A 2OZNA 1HQ4A 3IGFA 1HOCA 4NKMB 5GRVL 4PRHA 2P43B 5FECA 3DGDA 4I2XB 5TQ2L 5FGBA 4X9GA 1ZT4A 1CXHA 2Y36L 1Y7VA 5E5MB 5JR1L 1FHGA 2DQGH 2UY7B 2BWIA 3P9LA 4PRIB 4DVBB 3TTSA 5AVRB 4TOYL 4TTDC 5BQDA 2JKSA 4DNLA 3FU3A 1M05B 3VQ1C 4NUQA 2ADJA 5BVJB 4FLQA 1T21B 5FCUL 2QV4A 2Y07L 4RFOH 3SGKA 4OCRL 4ZUTB 4HAKA 1ZS2A 4FHKA 4GRWH 1DJHA 3GJFA 5GRWA 1NFIA 4NEHB 1FLTX 5TQ0H 4BQBA 2GIXA 4Q7DA 2VUOA 2E74C 3DUHA 4X6DE 2VSDA 2W9DH 1XL6A 1YVLA 4LRIC 4OJFH 1S7QB 4F24A 5BS0A 1EFXB 1VADA 1R5WA 1MF2L 1UCBL 1DP0A 4G6KL 5I8CB 4KRLB 3MV7A 2HLFC 4WIQA 1E2ZA 2BW5A 4N6QA 4R26L 5E99L 1YG9A 3GRWH 1ZHKB 5EH1A 2ZYIA 4M7KH 3LNEA 3MRJB 4UBDD 4Z76B 3ZE0B 1E5UI 5I8KH 1KJ2A 4UOJA 2OYLA 2A9DA 3Q2WA 5GISL 5JNYB 4E41E 3VACA 4NQEA 1CZ8H 4NO5A 4DPRA 5JW4M 2PXYB 1NKGA 1YNLH 1ZXQA 4TM9A 5I8OH 3PWVA 4W70A 4YR6B 1HE8A 1JPFA 2FX8H 5E6ZA 5J6HB