4XOEA

Crystal structure of a fimh*dsg complex from e.coli f18 with bound heptyl alpha-d-mannopyrannoside
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
279
structure length
279
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FimH protein
publication title Catch-bond mechanism of the bacterial adhesin FimH.
pubmed doi rcsb
source organism Escherichia coli o6:k15:h31
molecule tags Cell adhesion
total genus 55
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoeA01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoeA02
1KIUB 4XO9A 4AUUA 4J3OF 3BWUF 5F2FA 4J3OG 5AALA 2UY6B 5FX3A 5JQIB 5AAPA 3JWNH 1ZE3H 3BFQG 5IQOA 4AV0A 1N12A 5LNGA 5IQMA 4X5RA 4BUQA 3MCYA 3ME0B 5IQNA 4AVKA 4AUJA 4X5QA 4AV5A 2UY7B 1N0LB 3JWNG 1TR7A 5F3FA 4XOBA 4AVHA 2W07B 2XG4B 4AVIA 5LNEA 4AVJA 3ZPDA 2JMRA 5ABZA 4XOEA 4XOAA 4X50A 4ATTA 4AV4A 3SQBB 2JTYA 1KLFB 2J2ZB 5FS5A 4CA4A 3ZL1A 2WMPB 5FWRA 4XODA 3BFWA 4X5PA 2XG5B 4AUYA 3RFZA 3ZL2A 1QUNB 2VCOA 4J3OH 4XOCA 5FLUA 4CSSA 4LOVA 1PDKB 4XO8A 4CSTA 1UWFA 5CGBA 3JWNE 5AB1A
chains in the Genus database with same CATH superfamily
1JGEB 4N6RA 3EJSA 2EE2A 2ARJB 3K2MC 2WXIA 5KBMA 1NFKA 3L4VA 2ISDA 4AK2A 4IMKC 3FCSA 4PPTA 3DXAA 1G0YR 3HKZA 3ASWA 4D9LL 1T21A 3BH8A 1DFBH 1X5LA 3GSNA 2A6JB 3K2KA 1L5GB 1MNUH 3AGWA 2VXSH 4XNYH 3RL2B 3BAJA 1X44A 4AQ8C 4JY4B 4FNUA 1XCQA 4LVEA 4LSUL 4R7DA 2NNRA 4B9KC 4JVWA 1CTMA 4QXGL 4Y4HA 1KLFA 2WQWA 1XAUA 3FFCE 5C8JB 1ZJBA 1T6WA 4HXAH 4NO0B 4O2CB 5D7JA 5KVMC 2CIKB 3ISRA 4NRXA 3NCFB 1E5BA 1UZ6E 4W93A 1NCHA 5IJBC 3KM2A 4AW4A 4ANWA 4EXPX 2PWDA 2R4RH 3OPZH 4WQOA 2SEBA 2Y25A 2B1AH 3FZUD 4FFWD 5FECA 3AGVA 3X13B 3QWOA 2OR7A 3CX5J 4L18A 3OZ9H 1DUYB 4XOBA 1WUZA 4MMZA 3WJLC 5G55A 3WNIA 4AVHA 5GIRB 1AQKL 2W07B 1T20B 2MQGA 1X4YA 4EI5C 1G1KA 2PCPB 3LRMA 5L4IA 3EO9L 3EDEA 3DWTA 4PHXA 4FFYH 1GAFL 1KXTB 4ZUVA 4WRLA 4WUUE 2X10A 2V2TB 2NCEA 3ML9A 3MUZ1 1IVLA 5F89B 3W11D 3I2CL 4KX7A 1BD2A 3TEUA 1IGTB 4FLRA 3DBXA 3QEGH 4DFIA 4N9GA 5T1DH 4XXWA 1XBDA 1WC7B 1QVOA 5F93C 5H94A 5ALCL 4U0RB 4JO5A 1KB9J 1S9WB 2QKIC 2Y4SA 4Q0XH 4B9FA 1MIEL 2VDML 3GBML 4RFNB 1KCRH 4ZPVA 4ABUA 3MNWA 3ZX1A 3MRHA 5C2BH 2B59B 2PP9A 2VDMB 3GXMA 1U8HA 4MAYB 2FJHA 4MJIB 2OYLA 1VKXB 1OEZW 1XEUA 3HN3A 4ODWA 2A9MH 4QTHB 2PP7A 3ESPA 1W72A 3UX9B 1MREL 4LZKA 4XVSH 1YEHL 2AXWA 5HYJD 1YA5A 1W2KT 4OZHA 1D9KB 3RTLA 4GXVH 4KJPC 3BGAA 2QMJA 2F6AA 3V9EA 4LARL 5JUEH 1DR9A 1TYEB 2GIXA 5TH2A 2HKAA 1SLWA 2JH2A 1ORSA 3C6SB 3B34A 3BP7B 2MHAB 3Q0HA 4DP9X 4KUZH 1RZFH 5L0QB 2F7OA 2V2XB 2KDYA 2Z93A 4PJ5D 1Y6KR 3QZMA 2F8VA 4P9HH 3REWB 3RWGB 3TJHD 5ACZA 1DJIA 1HL5A 4JZNA 4QLRA 5D8JH 4GLRH 3QAQA 5J9PB 5I1DB 3RNKA 5F9JB 3F7YB 1U8LB 4IBWA 2VGLM 2WLZA 5HYIA 2D31B 1ZE3C 4PJ7E 1IBGL 5KS9A 1XF4A 4OIIH 3T0EA 2J1KA 2XZAL 1FN4A 4MQXD 2ZF9A 2BP3A 3V7AG 5TJWK 1OW0C 5BS0D 3B7UX 3DPDA 1VDGA 3LV3A 1IBYA 4LSRL 1MXDA 3L7EB 4BFIA 1YNTA 5KTEH 2VDPH 4HGWB 5HGHB 2AJZB 5DD5H 4NQSA 4K9EL 3ZGIA 1K5NA 1F3DJ 2EXTA 3LS4H 2ZUWA 2WQUA 3HR5A 3UO1L 1GIGL 4JM4L 1IC0A 1NIEA 3UAJA 2L0DA 1OCWL 4W9ZA 5HYQA 5J06A 1WT5A 4MASA 3T6WA 1YEIH 3BGMB 2AQ2A 4UV4L 1EA9C 1ZSHA 2WO3B 4JNXA 3LEYH 2PUQT 4CUCA 4D94A 4QO1B 4WI8A 1WD9A 1KCSL 4JHUA 1WEJL 2DQFA 2TAAA 5DHYA 2BVUA 2P3YA 4L1BA 2MOVA 3TBTB 4DQAA 4IMKA 4MJ2A 1RLWA 2NXYC 4JM2B 3SKJH 1TJMA 2JTYA 3UOAB 4ETQB 1GCYA 4PWFA 5EUOB 4GKSB 1NFIB 4NKQB 4LDOB 2Z64C 3WFZA 4AQ8A 3L3DA 3WMPA 1S5IL 4A38A 1YNLL 2NY1B 2OZ4H 5E1AA 4WI6A 4ZO8A 3S7GA 4C56E 1BPLB 2JF1A 5E9DB 1GKOA 1HCYA 2F61A 2YPLB 3DO3A 5ETUB 2MCG1 4J8RB 1PLBA 2XQYK 2PTVA 4K71C 4OCXH 4P2RA 5DMIL 2FJFB 2OI9C 4TMPA 9PCYA 5I1AB 2QADD 5F3HB 1AYRA 2I25N 3FB8A 3OAYH 3L1GA 3BRGC 1YECL 3AQDA 1P7QA 4PJXE 2G30A 3VGAC 5CCJA 4JJHA 5KYWB 4R90L 5EOTB 3V5HA 1TT6A 3U6XS 2A1WL 3MLYH 4X6BA 4P05A 4PVMA 4HS3A 3VXNA 3NZHH 4QY8B 3WJLA 4YSPA 3P73B 4YBQC 4B27A 3B2VL 1KULA 5J13B 4EI5A 1KZYA 1XCTB 2XTJD 4F1ZA 1ET8A 3QJFA 3UMNA 2WXFA 3DK2A 1HCFX 2EEXA 4LAQL 2WKLA 5AOLA 3S35L 1RVFH 2YA2A 1WFIA 1E4XH 2HKHL 4JFDE 5L2JA 1QYGH 3RDJA 1JHTA 2I7OA 1CIDA 2V9RA 3D3VB 4GO9A 4A55A 4EJ1C 4P3CL 1YMHB 2JKIS 1WSST 4Y0GA 4EIBA 5AAPA 2QZ5A 4IMLB 3H53A 3FOLA 2FSDA 2QLYA 1HJCA 3SBPA 3U0WL 1J8HD 3MRIA 3ULUD 5D1ZC 3DGDA 2QKIA 4OCYH 1CL7H 3C60B 4YHKH 1MSPA 3ARXA 1RP8A 3BGFB 3QC5X 3QZWA 3TCXA 3LHAA 3V8CA 2OK0H 5D1XE 3TBWA 4Y5YC 5DTFA 3QRFM 1NDGB 1GZQB 4K2UH 4BM7A 1HSAA 1OTTD 1V10A 2RQ8A 2CJTA 4XNMA 3CZJA 3WKQA 1AD0A 4OKVA 3T0VA 4HJTA 4B7IA 4OJFL 4RWHA 3KPTA 3OKKA 4QOKB 5IB3B 4MB4A 4WGVB 5HHMB 2VZUA 3TX4A 1HESA 2C1OB 4YDIH 3QQ3A 3ZU8A 2WSDA 4JO8A 3MRJA 1A3RL 2ZNWA 1GYWA 3MI6A 3EJZC 2JXMB 5DJZB 3RY6C 4BFKA 2CBPA 3GGWB 1F42A 5F3FA 3T8VA 3V4VA 1U2CA 3GDBA 1SHSA 1AR1D 4TN9A 3U46B 2X9XA 5I0XA 1YMMD 1BECA 4IKKA 4P4KC 4Z3TA 4YLQT 2B4CH 4QHKJ 1MW0A 1TSHA 1KB5A 4X8JA 3FDWA 4WZ9A 3SDCB 2YPVH 3CN1A 1MPAH 1SJHB 3CQFA 4K7PY 1U58B 4MA3A 1A25A 3GTVA 4PJGE 4G42A 2YRPA 5LGHH 1PNCA 5I8OH 4LQFH 1DQLH 4NSKA 5CEZL 3FRPB 4HZAA 4UT9A 1ZAGA 5A2AA 3V0EA 3WD5L 1WGVA 1I8UA 1S9XA 1OW0A 5D70L 3FRUA 4UTBH 3LS5L 5IQLA 2J8UE 1J10A 4OZHF 2WJ5A 5DZOA 1NAMB 1PEWA 2NY4D 5CEXB 2LOEA 1FO0B 4AL8C 4PGEA 3SDXE 3F8UB 3O11A 4UUJA 3VVVA 4PJFA 3CDZB 4KZEL 4I0PD 3WE1A 5T3XH 2J7LA 4K3EH 1ZVNA 2L3BA 1ETA1 5D5MF 3GI9H 3FT1A 2ESVE 2DOCA 4RAHA 1DN0B 1ROCA 2NW2B 3IMRA 4JKWA 1VFMA 2F7PA 5ADPH 1A3LH 1VACB 4MJ6A 3ZMEA 1LYQA 3IDJA 4BK4A 4ANXA 5KANI 3ZKSD 2CD0A 3M6DA 4DEPC 3DKHA 3K5SA 3N42B 2VDKB 1EFXB 3I9GH 4OJCA 2JJVA 1XXFC 4J4PD 2BCMA 4JGJA 4R0LC 4Q2ZB 3EGDB 3MSPA 1I9JH 4BUGA 1WS7A 1EDYA 2EDRA 4P5TC 5FV2A 3ARFC 3JWOL 3UC0H 4FXLA 4IQHA 2ZSVA 3TFKD 2ATKB 2XACC 1A4BA 4L9LB 1N26A 5DD3L 4GW5A 5MP6H 3ARVA 3WL9A 4N2DA 3ESNA 3SCMC 2QR0A 3WI9A 4MNGE 4XMPL 4JO3H 4L1HA 4LCWE 1KTDA 1X4XA 5B8CC 4EO5A 5SWSA 1X5GA 4Y8DC 4PS4L 3MOAH 2Z31B 2Q3AA 3CLEL 4S1SH 3OM3B 3U2SB 5C08E 2LVEA 5GGSB 1WCQA 3N5AA 3MJ9H 2YD3A 2IH8A 4FLSA 1OP9A 4FX5A 4L05A 4J3SA 3ECBA 4O2FB 3BP6B 1WWBX 1OF0A 1HYRC 2X9ZA 1ZLSL 1A4AA 2PWGA 5KVDH 1PKQE 2F2HA 4BE6A 3RNQB 4ABWA 4EPSA 3FMGL 4JFZL 2P8MB 2XRAL 1LE9B 3WSQH 5IVZB 4F9LC 3GSWB 3D06A 4Z1PA 2GBUA 2AQQA 2OS7A 3IETB 1NGWB 2KZWA 4JKLA 2FGZA 3ARZA 2EH7H 2A0LC 2XN9D 1CFTA 5IMMB 2V7HB 5TE6H 4DJMA 3PGFH 4A7UA 2CGYA 2EO1A 3OZLA 1F45A 1QG3A 2P80D 2VRQA 2EDTA 2CO3A 3BXNB 5DMKA 5IHWA 4WHCA 1CF8L 4G9FD 3IMTA 1IGCL 5D1ZA 4XGZB 4RMWA 5TD4A 3MRBB 1TEFA 1ICTA 2VW7A 2HVBA 1ZGLA 1LDSA 3VFTB 3VRIA 4ZYKA 4Y5YA 3WE6A 2A77H 1ETZA 2JWYA 2X09A 3BUYA 1A14H 3ZTDC 4O58H 3HUJB 4LKCA 4Y19B 5FCUH 4Y2OB 4PRPE 5CCKL 1BVZA 2WXGA 1HZLA 1PY4A 2HX8A 1UJTA 4XPFL 1P69B 2WLMA 1KMGA 3HC3L 4DN3L 2GIYA 2BERA 5E8DL 1IV8A 4E42A 4W6WB 4YX2L 4N5UA 4N2OA 4FCHA 2F15A 4JPQA 2OR8A 3RY6A 2BRRL 5LAXA 4JL1A 2YD6A 4TRPH 2AJUH 2EDBA 3ZDYF 4LFHG 3BN9D 4UDUB 3EBHA 1PY9A 3MOBL 4P4KA 1DCLA 3HI1B 5KYXA 5FA4B 4H1LB 1QLEB 5CCHE 2R0WL 4XP5L 4Y16D 1UD5A 3SJVB 4DETA 1P7HL 3O2VL 5F1SA 4UAOB 1E3FA 4K7PH 4YDJB 5DGQA 4JN2B 3O45A 1CICD 3UGUA 1XGYH 3PL6D 4DOHE 3KXFE 2ZAHA 2ZXEB 4J3VA 2FIKB 3BT2L 1A9EA 4J3UA 4R97B 3NK4A 5I1GL 1OARH 1QPPA 4DP6X 2HFEB 3VXTB 1TQUA 1ZHLB 1NCCL 1TPXC 1CCZA 2NXZD 4OZGE 2Q2LA 3SQBA 3GMMA 4N2BA 3SE3C 4I2XB 1B4RA 4X5RA 4Z18A 3SE6A 5EO9A 4YXLH 4BUQA 3KDMA 3HOGA 5ESVB 4YO0A 2F8XC 1MCDA 4H8WL 1OPGL 2XPZA 5KSUA 5E2TL 4U6XA 4ODHL 5H37H 1AHWB 4UQEA 4OVVA 3ARED 1J1XL 1NICA 1X5AA 1W91A 4KROB 4JAMA 4JB9L 5B7MA 1KYFA 4PP2A 3BN3B 4PJDA 3WFEH 2Q8BH 4WW2F 1BXXA 3D2UD 4FZEL 3DPBB 2A9NH 1I1YB 5I26A 4R84A 3M17A 2O93L 3CU1A 2EH8L 3GF8A 4AQEB 4KZDL 3DV4A 3KJ6H 3LD8B 4R0LA 2IPUK 2YZ8A 4Z7OE 5IOPA 1U91B 2OTUA 1RUQL 4YHLH 4UWQB 3GMRB 5DRNB 4WIQA 1TYRA 4P5TA 3VH8B 1CXEA 3ARFA 3CWGA 4PJFF 1M2OA 4ICWA 2FD6H 5EWIH 2J57A 2L4OA 4N2CA 4GYBA 2NY0D 1YN7A 4R7NA 4NCC2 2DWEA 1DLFL 3EJQA 3HAEA 1XFPA 4L8CB 3IJ9A 5I1KH 5E0QA 1HYSC 1C5DB 4M1GL 3FUNA 4ZD3H 1N8OE 2GBTA 3WIAA 5B8CA 3D85B 5EIIA 2AANA 4MZ2A 5CN2A 1WA1X 4JY5H 4K8RL 2DMCA 5CJ5A 2E8ZA 4M8VA 1A1MA 3B9KC 4CN1A 2YD4A 5AD0B 3U6RA 4HS6A 1KTLA 3ZDZF 2XWEA 3FB6B 2GABA 4M93C 2NOYA 3NABL 2NW3B 4JG1L 4GAYB 3S97C 3GD1C 5CJQL 1S8DA 2OJZH 1S9VB 4IU3A 1JK9A 5EFIA 5IB2A 4F9LA 2ICWB 4JCLA 3H9HB 1JGDA 5GRJH 3K8MA 4JJOA 4LU5L 2PO6B 1E27A 4O00A 2DN7A 3LNDA 3K80A 3TXAA 1JGUH 2V0AA 3KLDA 5F6HJ 2VLJE 3BSZL 3QUYC 3PWPA 1UZ8A 1DQJB 4JHWL 2IANA 5D7LE 4HSCX 1HXMA 3DETD 4K3DH 4P2OC 1H3PL 3WIHL 2OMWA 5DEFA 2WYZA 2C1PB 2J4WL 4C58B 4RNRB 1FVDB 1OKEA 3T2NH 3S5LA 3W0WB 4D3CL 1X3DA 2F8IA 1KGYE 3L9RB 3NZ8A 5FGCE 4YSAA 4E5XB 5E8EA 3BDXA 3WIFA 5JDSA 3CFKA 1XGRB 5FYKH 2J43A 4ZXBD 2NQ3A 3QGVA 4UIMA 5F96H 3LPFA 5C0AB 1FNLA 4JFEA 3PWVB 5TQ2H 1T1XA 3GB7B 3MV8D 2CDEA 3B83A 4FTVE 4RGMC 3OQ3B 1T03H 1KACB 1JSYA 4RBPK 1OGPA 2HFGH 3Q5YA 4U1LA 4ADJA 4AIXA 5FYLL 1IKNC 3I3BA 3K71B 4YHML 2J6EL 3AS3A 3WS6C 3OD3A 1BQSA 5EU7E 4LDLB 1GYCA 4OCMC 3PG2A 2EC8A 2XJLA 3K2UL 1L6PA 4RX4D 1TIUA 2EDOA 2VR7A 3A4DA 3C9NA 1HI6A 5IIEB 3IU3B 1KIQB 4W1TA 1FH5H 1DSFH 5L2KA 1GS7A 1TZIB 2F7IA 4NZUH 1PZ5A 2FIRT 3C2AL 5F44A 1ZANH 1Z9NA 1UM6L 4JFYB 2MPAL 2HTLD 2WKOF 4QNPE 2NY6D 3TWCH 3MX0B 1HHGB 1OY3B 1FWXA 4NENB 3WJMB 1FFOB 3LKOB 4PFEA 4RMUA 5JHDD 3SE3A 3RVUC 4GKOA 4J1UB 3SQRA 1KENH 5EO1A 4MJJA 2WLHA 2J55A 4U6TA 1GPOL 4J3XA 3LJ3A 3MODL 3QZOA 1HHKB 5J6HB 5E2JA 2OP4H 3FHEA 2G75A 5IROC 4C55A 2G0KA 4AZUA 4ZQKB 2C4XA 4NIYE 4LVHB 1QNZH 4ODXA 5DRZA 4XOCA 3LN4A 1R5IA 2GSIA 4BEIA 3D51A 4Y9FA 1CD0A 4JPIA 1TTCA 2WLJA 4N22A 3TN0D 1AZCA 1SYVB 2OMUA 2UWEA 1KELL 4YHZH 3NCMA 3FHQA 2XETA 5CGBA 4YR6B 3L4ZA 4DESA 1FFRA 4G80B 3UTQA 4Z8FL 1D7FA 5I16A 3VFGL 3UPCA 4AZ8A 3T3PE 1RL1A 3OKLB 1OZUA 3BT0A 3MV9B 2OAAA 3O2DA 1PG7X 3DYPA 1JZEA 3OKNA 3SDAB 1LL1A 1ZA3B 1QI3A 4ZX3A 3BIAX 2OQJB 5C0CB 3TYGL 2QPUA 3L4WA 1EO5A 1IJNA 1UWGL 3DGCR 5I71C 5D2LE 4K94L 3RVWD 3GQFA 4U1JB 4PJIE 2DLIA 3QB7C 2EECA 3B9KA 3QWRA 1BAFH 1NIFA 5LXGL 2DMHA 4X99B 5LWYH 4XP6H 4YWGH 4H7VA 4PW9A 4N0UE 5DJ6A 4H44C 1CLYH 3QUMA 3BRDA 5M94B 1I1RA 2NUTB 3ZRFC 1UH3A 1THAA 1SOXA 3NPSC 4XC3L 4RAVA 5KSAB 2LV4A 2A4CA 1DL7H 2XV0A 3T2QA 5TE7L 1BF8A 3PIQB 1ED3B 4UB0L 5CEYA 3IDNA 3BWAA 4NZJA 2OBGA 4TXVB 3GHEL 5CLTA 5FFOA 3ZDWA 3AQZA 4X5XB 1I3VA 4P23C 5E2UL 5I8CB 3QDMB 2PR4L 4PVBA 3F6LA 4M8QA 2EDXA 1M71A 3FCGA 3UPRB 2PMZA 3QUYA 3C6LB 4FYSA 3PFUA 4X6FA 1I9IH 3VG9C 4PBWD 3HHRB 2Y0SA 2ADIB 3PF2A 3PJSB 4HJ0D 4DWHA 1Q1JL 3ZZLA 4PLJD 4P2OA 3FUHA 4N4YB 2R2EB 5DEJA 4AE0A 4S10A 4HF5H 4UU9B 3HZKB 3S8FB 4POZC 5GGQL 4NNYA 4QR7A 1LD9B 3WU1A 4M6AA 3PP4H 5D1QB 5E70A 2VLLB 4W9LC 1FLTX 3CMOH 3LRSB 5I5MA 4F7EB 5ITBH 1R5VA 3I75B 3L4UA 4ZFGH 3HLAA 4FQ2H 3V4LA 5JIDA 4TNVF 1XL4A 1MJ8H 4M6NH 3BLKA 4LEXL 5FF6A 4OUUB 1JRHL 4KMTL 5DVOA 2BCKB 4OCWL 1IE5A 4IRSD 4WEEA 1ZHKA 4BWWA 1S7RB 4PJ7A 1SEQH 2BVPB 2AK1L 3HI5L 3NP3A 5FUZL 5KBLA 4E41B 2NY2D 5A7EA 5KBDA 4V1DE 1CBJA 3BLBA 2EYTB 3EH3B 3ELQA 1IKNA 5PCYA 3WY4A 3STZA 1V27A 3WS6A 5I6KA 3N40F 1DJSA 2G0LA 4MLIA 3GK8L 4GNKB 2QQKL 5KG9A 4XPTH 4F20A 3VD4A 2K8MA 3BIKA 1OF2A 2VO8A 3CVBA 1F18A 3DUUA 4NZTL 5DURD 4ZX5A 3JZYA 4HT1L 1BW8A 2HJKA 1GJWA 3K6FA 4WCYH 5GGSY 5BV7C 1UM5H 3VD1A 1QD0A 4YHOL 3MUY1 5FKAA 1BOYA 3MNDA 4LPTA 5B21A 4E9QA 1OHQA 1MCOH 2VRAA 2WLIB 4S0TD 3S37X 1TZGH 4QRPB 2NY3C 4K0OA 2EXWC 1L9PA 1MI5E 1OD9A 3NRFA 1F1AA 3DRQA 4F58H 3AM8C 3SPHA 1BP3B 3MBXH 2P5WE 1FC1A 1R4XA 2CGRL 4MXWH 5K9OB 4TUJB 3FT9A 2VDQH 1JMZA 1OD7A 2YQGA 4DZ8A 4ODSL 5IROA 3BZ4A 5D7SH 1ONQA 3QDJE 4M7LT 4XMLL 2B3RA 4PWKA 1A6WL 4KQ3H 4TS6A 3FT4B 3KYOA 4WTWA 1BVNP 1TQWA 4ZTOH 5IVXF 2PTTB 2EXSA 4RDQF 5E5UB 4WWKC 4JN1L 5EOCL 4CBPA 4P5KB 4I0PC 4LHUA 5HPMA 2Y2YA 4LGSB 3N1GC 3S6CA 1N0LB 4QXUH 1A8ZA 2P52A 4WFFE 3SGDH 5J3HC 1KEMH 2R0ZL 3T71A 3O9WB 3WY3A 2DKMA 4PJXA 1QA9B 2KZKA 2DQGH 3H42H 1RU9L 1DVZA 3BKJL 4TVUA 2OCJA 1J7VR 2IDCA 3F01A 3LVTA 2DD8L 3SY0B 1HQRB 2R7EA 1HNYA 2I27N 2W38A 3H3BC 1RZJH 1TTBA 4PB0L 3QI9B 2ZYRA 4AIZB 4GMSL 4F7CB 4LSVL 2DEYX 4DP5X 4OLXL 4DKAA 4HJJH 4B9IA 4NRYB 4CC0A 3PWNB 1XB3A 4G9DB 1U4EA 3WXVL 5JXED 1W0YT 5KSBA 4FP8L 1UOVA 2RHEA 3RWIA 4BFBD 2VXQL 3TO2A 3HMWL 5CBAA 1DJYA 1XIWC 4AQAB 2XY2A 3LPOA 5DS8A 5T1MB 2J88H 2Y23A 3WFHA 1WBYB 2AZAA 3TFKC 2YD7A 4DQOH 1E8XA 3LKQA 1KN4H 3QC6X 3N3EA 1UZ6F 1WISA 5F0JB 2FWLB 3LNIA 1C8QA 4JVUA 3WKML 4OCRH 1IAII 5L6YL 2XWXA 4MJHA 1NKGA 4GFXA 1FGVL 3R18A 5IKCA 4PJHE 3QQXA 1E7VA 3CFTA 3HIZA 1YEDA 3MBED 2E27L 4KFZC 4PREA 4YDNA 4OQTL 3O3AA 3N41B 5GHWH 2RTTA 1OB1A 1FZKA 4AI7A 3G08A 4P23A 1AYOA 3UBXB 1NAMH 4HWZA 4BZ1H 3NAAL 3KLKA 2DQTL 4LIQH 1FO0H 1MEXL 3ME0A 3RVVC 2XQYG 4PY7B 1PSKL 1QBAA 1T04A 2HLEB 3B1TA 1L4IA 3D12B 4LPVA 4OUOA 5D4QA 1NANH 3HFMH 2BOLA 3EO0A 3BPLB 3BQVA 4TLKA 5FFGA 5FO2A 5AG8A 1CI5A 4OLUL 1GSKA 1IC7H 2XV2A 1XF5B 4L1LA 5I1LB 4L8BB 5EZPA 2IMNA 1NGXB 1JXFA 2GBVA 2VSDA 4TVPD 5KVEL 1EO7A 1UFGA 3FQXB 3E1F1 4H1LG 1GZHC 2DWDA 1Z9MA 2VDKH 4PGBA 3QYCA 5EU3B 2CU9A 1I7RA 4Z7WE 4MNQD 4M56A 3L3JA 3A3YB 1A6TA 1CU4L 5DLML 4N2GA 6PAZA 4HPYH 3OKMA 2BP8B 1NLBH 1AMYA 1RURH 3D33A 1B4LA 1B0GB 1JHKH 3FSVA 1RERA 2YEQA 3QCTH 3BH9A 3B37A 1FNGA 4HIEA 1P1ZA 2J8UA 4LHJB 2B77A 4P3DB 4ZPTA 1KGUA 3U9PH 3E6HB 4DVBA 4HFWB 1DBJH 3OHXC 1MUJA 2J3SA 4QRBA 4NO2B 1QRNE 1K9TA 4ZG1A 1E8WA 3HVNA 1IFHH 1EGJL 4G72B 3VO0A 1HHJB 2R23B 1DZ0A 3F00A 3HBZA 3QDGA 4XAKD 3SB3A 1QSEB 1RZ8B 3UJJH 5FUCE 4JRXE 2C9PA 4P5MA 3SKMB 2WIIB 4PJ7F 1AZVA 2P49B 5DD1H 2APWA 3DIVA 2YAPA 3AM8A 4OT1L 3MQIA 5DT1H 3US1A 3RVTD 2VISA 2BNQD 2WIMA 1W0VA 4GQ9L 1MCWM 1OALA 5G5DA 5CBEA 4J7RA 2PWFA 1DVFC 2HJLB 1KNOA 4XODA 4ELMA 4P46B 2P43B 3VH8G 4R7VA 3L95A 4QI3A 1JP5A 3DBSA 1IGJA 3OR6B 4NPKA 4AEHL 4XWGH 4OD3H 4MDJA 4AQZA 4TPRL 5E6ID 2AV7A 4PW4A 4WWKA 4ORZC 2VCOA 1QR1B 4Q56A 4KKQA 5KEZA 5FW6A 3QR1A 3DIFB 1M57B 1P4IL 3O41A 3THML 3LH8A 1MDAA 2OZNA 4LCWA 5TE6L 4YIQA 5IFJA 3MYJB 4QGYA 5C3TA 4EIGB 1CGXA 3NRPA 1IARB 4M7KL 4B9ZA 1YEEH 5C08A 2EIZB 3DROA 1PZDA 3L9EA 1UXSB 2IVFC 3ZZ1A 4JG0L 5EZIH 5F1IB 3D4YA 4HK0B 5EU6B 1HSBA 1F6AA 2ZP9A 1OOAA 3ARDB 1PKQA 4M48L 1CGVA 2ZOKB 3RI5K 4PCSA 2HPOA 2X4QA 4LVNB 2C26A 3MXWL 1XIWA 4ZMLA 1HINH 1QI5A 3ALWA 3B9EA 1QLEH 2XT1B 3GPSA 4BZ2L 4MX7A 5IZ7A 4R5XA 4IRJB 2W5PA 2XI9A 1YC7A 3EG9A 3FPYA 3G5VA 1T4KB 3CFEB 2HJFA 3EFOB 1JGVH 4PP1D 4FLHA 4GW1B 3EF7A 4PJXF 2ZIDA 4M7ZC 1UGNA 4OH2A 1D5MB 1Y18B 5A2CA 1EHLH 3MLRL 1Z5YD 2X1XR 1CFSB 5B7EA 4HEPG 1JF1B 4NKOB 4HW6A 5IEHB 2BWDA 1AGEB 2F0CA 4A7GA 4Z78A 3OBAA 1LDPL 2MQ3A 3QULA 3CFJB 2VH5H 2XV3A 4KRNA 3HW7A 1M56B 5TGBB 3U79A 1I8MB 2FEEL 1IL1A 1JZGA 4OF3A 3WHXB 4E5XG 4XMUA 4S0HA 1JN6B 2Y7LA 2IFGA 2C9VA 3RX5A 1V3KA 3E9TA 2PW2A 2J6WA 3WS3B 2F5BH 1T89C 4NWTH 4ODUB 5DFVD 4PHZA 5DYOB 3SZ6A 1C1EL 1A64A 3OQRA 4XPHH 3VFWA 3P2TA 4XN4A 3ULSB 3LDBC 4FE9A 2H2PC 4XOEA 5K1VA 1L9TA 3MCKA 1KYAA 4GSQA 3M8OH 3MJ8B 3CHXA 1BJMA 1GZHA 4JFPB 4OM0L 3FOMA 3EYSL 3W3BA 15C8L 5T3XE 1Z9SA 1T7XA 3WG7B 3ZQWA 3MMEB 3OLDA 4PYGA 3VXMA 1ORQB 4NRZB 1KGCD 1VAHA 4HKXA 5ERWB 8PAZA 4M7JH 4H26B 5GJTH 3FTGA 1SZNA 4CMHB 1Y0LA 1PS3A 3H9SB 3KXFA 4P8QA 4NI6A 5AVUB 1ZV2A 2Y3NA 1MFAL 3V6FA 1RJYA 4KI5D 1A7BA 4KXBA 5E2VH 5B39A 2JELH 2FR4A 1MLBB 2BOCA 1DHKA 3QXDB 4WTQA 4WNSA 1WLHA 1KTJA 2F54D 5KOVC 4Q9RH 3OHXA 1RUAH 4XWOD 2JJUA 3FQYA 4KKPA 3RZCD 3POHA 1VPOH 5B1AB 4B41A 2IH3A 3VFPB 1GGUA 5K9KB 1J5HA 3WKYA 1SN0A 3P9LB 4X83A 5IMOA 4H8VA 4PJGF 1N5AA 2WBJD 4HCRA 3IXTB 4KKAC 5ISZA 1UD6A 2D0FA 2Z91A 3IJ7A 1NBVH 3AG4B 4TF4A 3GWJA 5TE4L 4P59H 2XFXA 1R3HB 2J8UF 3WLBB 5FHAH 2ZCLL 5JQIB 3NCJL 4X5WA 3U4EA 1NAKH 3OKEA 2ZKXA 3HZYA 5JOPD 2VDRL 1DVFA 3HG1E 1W9XA 3SE9L 1XWVA 3UZQB 1LO5B 4NN5B 3V55A 3SDXF 3GPEA 3KBEA 4FA8A 4IKNA 5KVDE 4OGXL 1D5IL 1IO4C 4A67A 3MGOA 2CR6A 4FG6D 5CMAA 5SWQB 4IDJL 2GAZB 1UVQB 3PWJB 3U1SL 3UTPE 1IC5L 4FI8A 1KN2L 4OGAC 5KVGH 4XH2A 1BLNB 1P1VA 3UTZA 5C0JB 2G2RA 1RIUL 5A16A 1UQSB 1XD1A 4NQCE 1MFDL 1N0XL 3D30A 5C7ZA 3FFCD 3JUYA 4RFEA 5AL0A 4YQXL 2F7QA 3SGJC 4KKCD 1GGCH 3NPZB 5LNDA 5CU5A 2OMVB 4JFHD 3VRLE 4LLQA 4I18A 1BQ5A 3QUHA 3TN0C 3UIZA 4TL4A 4U31A 3FFDA 1MCQA 4LK4A 4NAMA 4D7PA 2A4EA 4JHZA 1E0OB 4L3EB 4TQEL 2NYZA 1LO0H 2Y2TA 5DD6A 2XA8H 1RAMA 1KB3A 1Z3RA 1J5CA 4QRRE 1XSIA 3DUSA 3LOWA 3HNTL 1ZT1A 1CDGA 2LTQC 2I9LB 4HS8H 1PJ9A 4PRIB 5C07A 3UJIH 1RV6X 2ITEA 2VLJA 2W9LA 3FTZA 3UYPB 1QWUA 4ZW8A 3OAZK 2C3VB 4QWWC 4AYDC 1AGDA 1A1OA 4JFFE 4WUUD 1LO3H 3KPQB 2IPUG 3A47A 1U30A 4J6RH 5J1AA 4E9WA 4NNXA 4BFFA 2FCBA 1O6VA 2CKBL 1JTOA 1KCUL 1U8PB 2CCWA 4HUKB 3B7YA 4EAEA 3FT0A 3H9YA 2CKBB 4BDVA 4BBWA 3JBG7 4PJBF 1VFBB 2GTZA 3SO3C 1BCIA 4Z7VF 4GG6B 1C5CH 1I7UA 4M5YL 5DJYB 4JHBA 1SY6H 3FNKA 5C6WH 1UB5A 2KDGA 5HGAA 2ORBH 3I9AA 2XC8A 1T89A 4RGOH 2HRPH 3JUZA 3JTBA 3MRKA 2BWQA 5GS0L 1U41A 1G7JB 3MC0A 1KCKA 4QYOA 5HP5A 1G5GA 4KTDH 3DO4A 2BNRB 1ZLDA 2YWYA 3V0VB 2BM3A 5D4HA 1X5HA 2FWOA 1DE4B 2CPCA 4L0YA 1K4CB 3FS9A 1IAKA 1G7PB 1T0PB 3QFJA 3EF4A 3PNWA 3P9WB 2ZZUT 1ZTXH 1ESOA 3RPBA 5FYJU 3QQDB 4FMKA 2AK4B 1QBML 5JQ6L 5F7FA 2R69H 3SGEI 3FU9A 1E3ZA 5DUPH 3S9DB 3QO0B 2JCCB 2OMZB 2XZQL 3F65A 1SJVA 5C3IA 1DVTA 1OAQL 3E8UH 5HD8D 1MJUH 3UEQA 2F5AH 3EDKA 5D7IE 2AXGA 3ABLB 3V6BR 1KEGH 2FVNA 5CSBA 2PYEB 5GZOC 2VLKB 5F6IC 4R7LA 1BPVA 3KYNA 4KQ4L 4FNQA 1EQWA 1USZA 4WU7A 5HGBA 1O6SA 3AACA 2MNWA 3FTSA 3HC4L 4MMYA 1U3NA 4Q58C 2Y7SA 4G6FD 2IWGA 5GQBA 1A6VL 3BKML 2WUBL 4LLDB 2K3TA 2Z8RA 4XCEA 1CE6B 4UIKH 3F7PC 3HEIB 3QXTA 2GTWA 1WHPA 4AYFB 5HDQL 2COQA 4JKPH 3FQNA 3IU4L 3RJOA 2LE9A 3FJTA 4KJQC 2MCAA 3EO1A 3IS0X 5BO1H 3B8SA 5ID1A 3DHJA 1A7PH 3HRZB 5G4MA 3L3HA 3LKSA 2FX8L 2B08A 2WUCH 4P99A 5EA0L 4EDWL 1Q8MA 1J12A 4A37A 1KJVB 4ANKA 3RWFA 2BIMA 4FABL 3VXPA 2NUPA 4OZGF 1S6NA 2ZCHL 4KC3B 2BVTA 3IDIA 4JDVA 4W9CC 5C7XL 2W88A 3ARBB 4FCAA 4D0DA 2FBJH 1HOCB 2P48B 3JSSA 3OJMB 3PJLA 5F72S 3L5XL 2XVLA 5FDYA 3H2PA 1UA6L 4HIJB 1P5VA 4PJ9D 3OKDA 4HK3N 4MA8L 4XHJD 3AXLA 3HA0A 5D2LA 5AKTA 1KY7A 2Z92B 4C56D 1F4YL 3IFNH 1WRFA 5CJ8A 4JJ5A 1P7BA 1SHWA 2Z0UA 3BW9B 3QPXH 2J1ZA 2EIDA 1CN4A 3EYUL 2AS5M 3TIDB 3SGJA 1KCVL 3DARA 1UWFA 2VXVH 5EEUA 4MD4A 2VMJA 3BEWA 3CFDA 4Z7OF 3BOVA 3KPMA 3VXUA 2ZT9C 3QNFA 3ARQA 4X8XA 3JV4A 1T80A 3OR7A 4M8RA 4KTEH 1J5IA 1M9WA 1TETL 1YQVL 3MROA 3QVAA 4HA1A 5DC0A 3QFDA 4NQDE 3ZSSA 1X5XA 1R75A 1U4FA 1KIUB 4XO9A 4DGYH 4HOWA 3W39B 2MJWA 5CWSA 5FYKE 5CGYD 4FFZH 1P4BH 3APDA 2CMRH 1SXNA 2KS0A 3BUPA 2G2PA 1HVXA 1QSFE 1NBCA 2OL3L 2NXYB 3GI8L 4FF9A 4A6YH 2VERA 2VR3A 3B3IB 3KCPA 3BESR 3X14B 4UT7L 3ZT7A 2QGBA 1JTTA 5JXEC 4Z7UA 1SDYA 5DK0B 4KK9D 2FHBA 4JFDD 5GRUH 2C7UB 3D69A 4W6YB 1UOKA 2AABL 4WGWB 4ZZKA 3GUTB 4G7YH 3ULVH 4G3YH 5A40E 4HIIA 1OAUL 4K71B 5J11C 4WI3A 4ABVA 3Q6GH 1PMYA 5EIVA 1IM3D 3BYTA 1JDAA 4HVBA 5D1XD 1ZK5A 5D93C 1OAJA 8FABB 4MXVF 4N85A 4PJ8C 1ES0B 2C7FA 1OQOA 3IFLH 4LLAA 4LXFA 6TAAA 4G6KL 1U8MA 3EFFB 4NM4L 4W4NA 1NBYB 1RUKL 2WXJA 3EOAB 4MSWA 3EGXB 4XPAH 2NRDA 2FB4H 2W91A 3SBQA 1TZAA 4D9QE 1D9KD 1KLUA 3R1GL 4ENZA 2WINB 4IKJA 1P7KB 3PABB 4NO3B 5INDB 2F74A 3P40A 5IF0B 4F80A 2WGXA 1YUHA 5IM7A 4ZFFB 4XPGH 1XGQA 4JFTA 2QVFB 4PTUA 5EC2A 5HJGA 3QIWC 2J1WA 5E4AA 1AXTH 2PN5A 2HKFH 4MBOA 2IBBA 4RBPH 3U0TB 3GO1H 1FCGA 5DHDA 5IQ7L 1MAML 3GHBH 3MTXA 2YLHA 1DQDL 1MVUB 4RGNE 3HR6A 3NZUA 2JV6A 1DDHB 1CDJA 4XXDB 3FO1A 1KBBA 3MLTB 2AGJL 3M1BA 5AL8A 5TDPA 1F8TH 4PRAB 3WMSA 3Q2WA 4Z3JA 3VFMB 4FLQA 2NNAB 1KGWA 4PGCA 1U8NB 4AEIH 3D1MC 4AENB 4PJCB 3LIZA 1EO8L 4LLVA 4XCCL 4NO5B 3QZNA 3N1QC 3NH7H 5I76A 4M3KB 3OMNB 5JIQA 1MI5A 2GT9A 5GZOA 1EAPB 1UTDA 3P0VL 4U1KA 4MJIE 3QJHA 1I9EA 1UXWA 4ODVH 2P5WA 4E2OA 1A6UL 2XBZA 1TCRA 4NC0B 4OZIE 3KYAA 2GQHA 3QG7L 3WY2A 4JANB 5DJ2A 4PJAA 1S7VA 2VR6A 4ZS6C 2J56A 1WBZB 4LOVA 4LT7A 4QD2E 5FUOL 1JF6A 4APQC 3NJJA 3LRKA 3TVMC 2R29L 2HP4A 1ZD6A 2HTKD 5LBSL 2I85A 4L4VB 2H3NB 4O5LL 4A2GA 1FRGH 2JKXA 3VXSB 3B7TA 1Z32X 3QQ4A 5FLVA 2IQAA 3ZE2B 5AOJA 3DYOA 1QZ1A 3REVA 4QNPF 1N8ZB 3I9PA 3P4NA 1BQHB 5ALBH 3QIUC 1P5UB 4HC1H 4DFHA 2CA4A 2DAVA 1DLHB 5CAYB 1J0JA 2P5PA 1U8CB 4ZMOA 1U33A 1FVCB 2B20A 2IC2A 3CZFB 4JFUA 3PAVA 4ZFOL 2NYYC 2AW2A 1MWAL 4O02A 3FO2A 2HA1A 4ZFOB 5T5NF 4F24A 3BFOA 3AG3B 3GDCA 1XQ4A 2IV8A 5IMLA 1I8IB 2G3MA 1YEKL 4PJEE 5IHZA 3LQAH 1P6WA 1BFVL 3VDBA 4FG0A 5MEOB 1RHHA 4DVRL 2ITDA 4D9RE 1QX1A 5HYEA 1VHPA 3KPSE 2WZAA 4WNQA 3KEHA 3RDTC 4F15C 1KIRA 43C9B 5HYSA 1WE5A 2HT4C 2YKLL 1XH3B 5E9NA 3S2CA 3NYKA 4Z6AT 4B9YA 1ROWA 3RAJL 1PEZA 2VUKA 2Q86A 1SBBA 5BRZA 3RVXC 3T3PF 2MKWA 3KPRD 4PJHA 5DUML 3PWLB 4PIRF 4UMGA 3RE0A 3D52A 4NUPA 5ACLA 1DUZB 1NC2D 2B3IA 2E47A 2EDKA 5F9OH 2NY5C 1NDTA 3UACA 1D5ZA 2HVJA 2F08A 2FQEA 3QYNA 1B4JH 4QKTA 2J71A 3STLB 2QHLA 5EEYA 1PG7L 3CVIH 2CUIA 2HYMA 2LR4A 1XSOA 1YEJH 5DDHA 5EUOE 1NOAA 3FB7B 5D2LF 3TBBA 3QH3A 3L7FA 4Q97A 4RSVA 4PJIF 2Y5TA 5E9DE 2YPLE 5DO2D 4B3EA 4ODBD 5IMKB 3MLVL 1E9OA 1LEGB 3D3VD 5SX5K 2YD5A 2BDNL 3GSOB 3EOTH 5CNHA 3NFPB 1H19A 3BHBA 2CDGA 3MUHL 2R2BA 4KTYA 3SCMB 2FJUB 1J05A 3T6QC 2ZD0A 3GSQB 4M1DH 2HZHA 4URKA 1A7OH 1T5XB 1WAEA 4C54A 3O4LE 4YVUA 2ETWA 2OMNA 4QXTB 4Z7WA 2C5DC 1ZA6B 3G5XB 2CE6A 4PJ8A 2UZXA 1XT5A 5AUMA 4G8FA 4QOKD 7TAAA 2VZTA 2ICEC 4ZO7A 1F4XH 2D3JA 4NAJA 2ZAIA 4KO5A 1KSRA 3CHOA 1TO5A 2V5SA 3ES6A 1E65A 2GITA 1R3LB 3QIWA 1J1OL 3OGCB 3L3OB 4B6ZA 2XXCB 3GM0A 2AXFB 3V8OA 2OMXB 3A6CL 4HK3J 4XXCC 4GFTB 3VE0A 3LXAA 3QQ9D 3OF6D 1HWGB 3QJZA 1Q94B 2DW5A 1BXAA 3LH2H 1BJ1J 1A1NB 4LLYB 2D3LA 1SXAA 2RAMA 1NDMA 4NZFA 4HXBL 5CZVH 1I4FA 5BVJA 1OAKH 2G4GA 1OCZB 4JRXA 4OLWH 2VQ1B 1JPGA 4WJG3 3IAGC 4ZAKC 5CFHA 1ODAA 3VWKB 2IAAC 3FB5A 4ALAH 2CK0L 3CLFH 4ABQA 2DYPB 1V7NL 1XSJA 2X0UA 2NZ9D 2QHRH 3OMIB 5HHME 1MQKH 3IJ8A 4Z76B 3ZE0E 3L54A 3BKCL 5F88A 2QSCH 3TBSB 3GFUA 2QGEA 3HNSL 3ARTA 4KI5C 4XBPB 4DTGL 4APQA 2AEWA 2P26A 4DEUA 3TVMA 2Y22A 4YPGB 4A7SA 2XA3A 1THCA 1N64L 1AKJB 2APFA 1Z5HA 1A4KA 1HL9A 3L2MA 4HKJB 3CDFA 1MIML 5HDWA 3VGBA 1OHZA 3VI3A 3CFQA 4X9GA 3WFCL 5F9WC 5KUKA 4LSQL 3WDIA 1R5WB 3RZCC 3ZRCC 3D39D 4HIXH 1JV2A 2CHNA 4Y4KB 1PZ3A 4QHUB 1LP9B 3O6LH 2HFFB 3QIUA 2XZZA 1KLGB 5DS2A 1YSOA 1PZ2A 4X6CB 3BQUD 1A2YA 1EFXD 3N44B 3LKRB 4CU8A 1U3ZA 2EICA 5HJ3A 1NJ9B 2CG9X 4X7EC 3PV6A 1JNHB 5EZLA 1FL6B 1G9NH 3S37L 1EFQA 3MV7B 2IDFA 4PWGA 1E4HA 2XWTA 3VXQB 2VJXA 2L7UA 1F90L 2YK1H 3LHPL 1YYML 2CKNA 4GI6A 4YHIB 3ZKNC 4CDGC 3BDYH 1SYSB 2HMID 2APXA 4LIQE 1FFPB 3HG5A 1HAUA 3MBWA 1TPXB 1CXIA 1ACCA 5MEQB 2YXWA 3APFA 5EU5A 1AH1A 2WB1A 4LCYA 1F11B 4FG6C 3C5JA 3V0WL 5T5FL 3RDTA 1MLCB 1SPDA 2O26U 1EBPA 2YAEA 2CNYA 4ZFZA 4G8IA 5GISH 1T83A 3GKWH 1T0NB 1RFDH 1SDAB 3PWUA 5AYUH 1CYGA 3RWEB 1X5JA 3ZDXE 3JV5A 2PR9A 3P9MA 4NWUH 4UM8A 4P2CG 4B53A 2ZTBA 1V7ML 4NDMB 32C2A 4R4ND 4Q6IB 5JOFA 4KKCC 1B4TA 2PETA 2YPVA 1CB4A 4MGXA 5CP7A 1IC4L 1R6VA 4N9OB 5GS1B 2X4PB 3L3KB 3LXUX 1ILSA 5DO8A 3K5RA 2R1WA 1FVEB 1GW6A 1SEBA 2G60H 3ENEA 4J3OG 4R26H 3VXRD 2GSGA 3ILPB 4N8VB 3TV3H 3X3FH 1C16B 1HXKA 1WICA 3QZLA 5DSCA 3T3ME 5MEPA 2BFVH 4QHPA 3N0PB 1W72H 4EQ2A 1F58L 1VERA 4HOZA 1KPVA 2PXYA 2ZX5A 4XMKH 3KPNB 4BHUA 5L4JA 3CH8A 5D6CB 5KW9L 4I3RL 1LNUA 4KJYA 4PJHF 4DN4H 5A2BA 3TNMB 1OE1A 2JJTC 2P5ED 3ROOA 3G04A 3BH4A 2HLAA 4ZUSB 2D3VA 3PJNA 4GAFB 1S7SA 3EHBD 2Z8VC 2EIBA 3K6OA 2WTRB 4EKJA 4PB9H 2ICEA 3I74A 4M93B 4CGUB 2FT8A 3KZ8A 3PQYE 1W6LA 2EQDA 3EBAA 3NRQA 3SQOH 4BJLA 1HEHC 1JPSH 4OD1L 3BX7C 4GUPA 4JRYE 3QCUL 5JHLL 4LEOB 1NIBA 1AMXA 3MRDA 4FTVD 1RUML 3BO8A 2VDNB 5DZPA 4PGDB 5K39B 4CVZA 1RJZA 2VT0A 2B5IC 3CDYA 4UDTA 3UZEC 3RU8H 1VSCA 1U3HD 5IBTH 4AT6B 1MHCA 1P84J 5TPWL 2UVFA 5DHEA 2ADFH 1F4WL 1AP2B 1AHKA 1G6RA 1EEZA 4Z7WF 5C71A 3V5DB 1XHHA 3P0YL 4CA4A 3GBNH 3PGDA 1DQTA 1YNKL 5F0MB 4CW1B 1KDIA 4ZDHA 2X2UA 2ZOUA 5I6OA 3V4UH 3VFRB 1EXUB 4ZAKA 4AH2B 5D55A 2RB8A 4Y19E 3GSVB 3VGHA 3P54A 4NN7C 2MWCA 1UFUA 4GW4B 1TTRA 3QNZA 2AKRB 5AAWC 2FQGA 2F53E 2JIXA 2X4TA 2WZ5A 1SDDB 3KWWB 5DJDA 5IGXH 4G43B 4M4RB 1PZCA 1WITA 3X2QB 1KWGA 3IF1A 2HRLA 2EKJA 3B1UA 4JEGB 1JPTL 2ZOTA 1D5XB 1WF5A 1FBIH 1UCBL 2R1XA 1IBZA 1ERNA 1LWJA 1T5WA 5E8PB 4N8PA 4XI5D 1Z9OA 1AZUA 1I1CA 3NIGB 3WMQA 1ZT7B 1GGBH 2EJ1A 2Z3FA 3LPPA 3UGXA 1H9DA 4XAWH 4NQCA 1NFDA 1YJDL 1NSNH 5B38A 3IJSA 1IZKA 5HYJB 3B9DA 1Y6MR 2XPGB 3FN0L 4JY6B 2H1PH 2LABA 3C75A 4IBTA 5CJOH 3SZKC 5IK3A 2V3FA 2CLZB 1PZSA 4N2NA 4BFNA 1OSZB 3QEQE 2NNCA 1T1WB 3M88A 3T8XA 3TBVA 1AGCB 2VITB 3A21A 5DEZA 2VE6B 2CJUH 25C8H 3NSYA 2NLJB 3GJFK 4PJ5B 1AC6A 4D8PB 3L5WA 4GEJA 1BBDH 6CGTA 2CQVA 2P42B 3VI4B 4KHTH 5IB1B 4X42A 4KGJA 3HE6D 2MOQA 4QRRA 2YOCA 3O3EB 4OI7A 1NLDL 4XVTH 2XY1A 3CXDH 3V6OE 2IPTH 4KHXH 5J1TC 5T1LA 4K8RD 5C0DB 1YEGL 4C4UA 2F18A 5DI8B 5EULV 3PGCB 3QJTB 1H0DB 5BS0B 4Y4FD 1Z66A 4KQ0A 4H88H 4WFGE 3LEVL 5AENA 1MOEA 4TNWF 3UTTE 4KKLD 3CHRA 1WTGT 4RA0C 5BZZA 3ZT5A 2F1AA 1AO7D 5HHOA 1YPZA 3S3PA 4NQXA 3KWUA 4O51B 4QRQB 2R0LH 1L6ZA 1H6TA 2Q8AH 2IGLA 2E7MA 3BSHA 1F4AA 5DWUL 1B6UA 3BPCA 4NJ9L 4TOYH 1BYOA 1UD4A 1JK8B 1HH9A 5IP4A 1GGIL 5EOQL 1V54B 4G82A 3X11A 3MRLB 2O72A 2YO3A 2BH0A 1WH0A 4APXB 1WBXA 3FU5A 4WI0A 1HU8A 2YQBA 3P30L 5DR5H 1QRKA 3TONA 5CGYC 1G5AA 5JNYB 3C08L 1CIUA 5E8OB 1DVQA 4NN6B 2ZOLB 1AXSA 1KPUB 5I71B 5K9QG 1QFHA 5JXAH 2JJTA 2GKIA 5DK2B 2FEJA 1HDMA 2VWEE 5H37A 5I82A 3VNYA 4Q9CA 2YR3A 4IU2A 2CBQA 2ILLA 4KK9C 3SOBH 1E67A 1XEDA 3L3IA 2P46B 1KB5H 1KPRA 2ZXDA 4LNRA 4JDZA 5BZDB 5HI3D 5FGRA 4U0RC 5J12C 1OO2A 2IADB 4DK6A 3VDAA 3MREB 2XUWA 5FYJL 1UWEL 2MTAA 5B22A 3F7VB 2WP3O 2QADB 3DYMA 2D9CA 5EBLA 1FYTA 1HHIB 2DWYA 4UZUA 1J8KA 4ELKB 5D7IA 2MNJB 4RFNC 4PS7A 1NFAA 5J56B 2EDMA 5BZXA 4G1MB 4V1DD 3QEHB 4UMSA 2X28A 3UZEA 4MAYC 3SD2A 2XOTA 2KBGA 5CHNA 2Z35A 3MA7B 5FYLD 2GW5A 5I8KH 1TO4A 4I89A 3U7YH 3HPJA 3T1WA 3O8XD 4PM1A 3K6SA 2O61A 5L88L 1D9KC 1F86A 4ZI8A 5KVGE 5GZNC 4F33A 2Y9RT 2XTJB 1G7HA 4R2GD 2ADJA 1PPIA 3HZVB 3QORD 2VJ0A 1WFTA 4Z3EA 3RUGB 3W0WE 3WIIL 5L0QC 4BSVA 1G7IA 1UZGA 5MERA 4FG2A 4Y1AA 2X4OB 1NGPL 3MCLL 5LGJA 2VSCA 3QDAA 2Q7AA 5C0BA 3UAFA 1T6BX 3LKNA 2GJ6E 2DQUH 3T5WA 2X4UB 4HZ1A 5DCCA 1J8HB 3QG6A 5IJDC 5GSVB 4X7SL 2LU5A 1TJIH 4DGWC 4ZTEA 2WKGA 3IFPA 4KVCL 3IJHB 3GINA 2Q2EB 3QDJD 4QT5B 1KG0A 1S5HB 2MTPA 1S3RA 3T4AB 1GA2A 4EZKA 3H4FA 3TO4D 5JMRA 1NGYA 1PF3A 4G1EB 2GK0B 2PYFA 5FO9B 3D4ZA 2WWMC 1AXIB 4M62L 4MQSB 3BKYL 4G8GE 4R4FH 43CAB 3TTSA 4NLAA 3LXBA 2BVQA 3MRPA 1R3KB 3HS9A 1AR1B 1OP5K 4HZLB 4XPBH 4UCFA 4Y9BA 1G1YA 1RP9A 3HMXL 1TF4A 4UQ9A 1CDUA 1YMMB 3QIBD 5DJAB 2BHUA 3SKOA 5LCVH 4EN3D 2Z1PA 1F00I 4X8CA 4Z5RA 1JGEA 1QLRB 1QATA 5KAQG 3SDAD 3EYQD 2ARJA 3UADA 1NMCB 1W8EA 4NHCH 1J48A 1ETJA 1E28B 4JM2C 5C2UB 3QXWA 1DBKH 2A6JA 1LMIA 1L5GA 3HPLB 4AG4L 3TT1H 3RL2A 4JY4A 3EYOB 3JVGC 2NY1C 5IHUH 1ECZA 3KCWA 5CF3A 2OR9H 4HFUH 1BM3L 1WZ1L 2NY4B 3VRLF 5C8JA 4WTZG 2Z4QB 4NO0A 2P8LB 4O2CA 1ZTXE 3QUKB 2CIKA 2VC2L 3MLUL 1ZOXA 5KSAD 4CSTA 3OAZH 1BXVA 4CU6A 4ESKA 2OSLB 4I0PB 4IW4C 1HXYB 1DYZA 2VC2B 4GP5B 4XMWA 1OSYA 1QWNA 2WLLB 2QL1A 3GXPA 2ZKHL 3DC0A 3ZVVA 1JGLH 2A9CA 3MV9E 4HD5A 3T04D 4AGOA 4B9CA 5HHXL 4X4ME 2DLFH 3X13A 2HSIA 2W94A 1N6QH 3VTMA 1DUYA 4OF5A 3N91A 3WNNA 1DJHA 3GRWL 2ZCKH 2I69A 5GIRA 2W07A 5J13C 1T20A 2YRBA 3GLEA 5AZ2L 1UA7A 1E9PB 3I50H 2PCPA 4ODTL 1T1ZB 4F9PC 2EUWA 2XYCA 4JLRB 4LSPH 2WQ8A 4RWYL 5A3ID 2E7HA 1KXTA 1IFRA 3DX3A 3WY1A 2V2TA 2H2SD 2GJRA 3GJFB 5I1EL 1ZRUA 1BM7A 2W0FB 3GJEB 5DO2C 1MWOA 5F89A 1IGTA 1AG0A 4H8HA 4B9JA 2V17L 3VU1A 5HHVL 1WC7A 1T2QL 2FL5B 5GRYA 5JPMC 5ESQB 1TFHA 1S9WA 1AGBB 1U8QB 2C9RA 3C60C 3BGFC 3QNYA 5CIPB 2W9EL 2AJYL 4MA7H 1WZMA 3QDME 4E41D 4Z0BH 1R3JB 2AP2A 4G7VL 1NEZG 2D0GA 3EOBB 3FQ1A 4LP5A 2B59A 3G6DH 4MAYA 4MJIA 4NJAH 1VKXA 2GEEA 3NIDE 4QTHA 3VD9A 1B90A 3FU3A 3A6BH 5A2KH 1OGAE 2R0KL 2ATAA 1K3IA 5I0ZA 4PGJA 1RZJC 1JVLA 1D9KA 2FJSA 3CN3A 4TM9A 5GZNA 3ZKMC 2ERJB 3WLWC 3U30B 4TV3A 4JKNA 3RIFK 4OI8A 3MZGB 4FQLL 1QRND 1MFEH 1AQMA 3C6SA 4KPHH 3MRCB 2J2ZB 1UH2A 3BP7A 3V10A 1SLXA 2MHAA 2V2XA 1S7UB 5D1QE 2VIRB 3FTUA 1LWRA 3REWA 3RWGA 3W38A 2VL5B 2XN9B 1F56A 1QEXA 5J9PA 3LKPB 3ASOB 5F7BA 3EZ8A 4PUBH 4RSYA 3X17A 5D7IF 1EVUA 3SDCC 5F9JA 5I1DA 3F7YA 5F0LB 1GYAA 3P4OA 1U8LA 5EDSA 3T2PA 3IAPA 5I6NA 2D31A 4G9FB 4HEMA 1DJGA 3W9EB 1FV1B 4Y9CA 2AAAA 4NUJB 2X2JA 4XNZB 2HXAA 2BSSB 3W2DH 1L9SA 5F7NC 4ZMVA 4PJ6A 3L7EA 4HGWA 4DPCX 3NCWA 5HGHA 3I6KB 1N19A 4CGTA 2AJZA 4ZJ9A 4P0DA 4Y5XB 2QV4A 3S5YA 2X6UA 3CXHK 4PG9B 1BG9A 3O6KL 2D9QB 2B0SH 5GJSL 4JGNA 3LYRA 3B4NA 5E5RB 1VFAB 2F19L 3EOYG 3SD5A 1S7WB 3BGMA 3ULVE 1Q9KB 1ZS8B 3BCFA 4QRPE 5DRWB 5CN1A 2BP0A 2NT0A 2WXOA 4Y16B 4QO1A 4D7BA 3MFFB 4AC4A 3ESMA 1K85A 1BXUA 5T33L 2AJXH 1E5YA 3TBTA 5IV2B 3CK0H 1JCKA 3OZKA 3PUCA 1A6ZA 3WO3B 3IDYB 3ESOA 1CICB 2OX5B 4JM2A 3K4DA 5DHVB 4ETQA 3PL6B 2R8SL 1URLA 2G2NA 5EUOA 2ZWYA 4GKSA 1NFIA 2GJZB 1IEAB 3I3EA 3JVGA 4Q8BA 4N8VG 4Q89A 1BREA 4AQ1B 4FQHB 1OT2A 4DUXA 2R9HD 4PQXA 3HNVH 5E9DA 2YPLA 2NXZB 5ETUA 1V05A 4L9LC 4J8RA 2ODIA 2AJ3B 2FJFA 2UZIL 4HP5A 4UTAH 3O3DB 1VEOA 1YY8B 3TBYB 3QJUB 4XVUD 5I1AA 5F3HA 4KZ0A 1EZLA 4RQQB 1XBRA 4QTIH 2A38A 3DX6B 4PI2A 2O1AA 3PXHA 2Z31C 3C2SA 3SYAA 2ZG3A 1TQCB 3WAKA 1SHXA 4QDGA 5KYWA 4OLVH 1CGSL 5JDJA 3AREB 5HJDA 1KZQA 2DQEH 5EOTA 3CVHL 4XO3A 1KTBA 2Z1KA 2FGWL 4J28A 4R8WH 2JMRA 4QY8A 3CVHB 4PTTB 3ARPA 3P73A 2FT7A 2XIIA 3ZN6A 3EYVB 4XCNB 3WFBL 2EXYC 3KBHE 3MHZA 3D2UB 1IGMH 3F85A 4R4NC 4I77H 1AS6A 2CALA 4LRNH 1XCTA 4GSUA 2J1YA 1KJ2B 4Y9EA 4F9PA 1ASPA 3X1NA 4S2SA 5BUAA 4ONOA 1QHOA 3KLHD 1F02I 3WNMA 2V5TA 4HCIA 1MY5A 2F1BA 3CVCA 4O9HL 4GQPH 1CFQB 1BGXH 4PG2C 1J0IA 4L3AA 4N3TA 5ICUA 3SIKA 3GSNL 2X4NB 4AMKL 1TDQA 2NY0B 1T21B 1YMHA 3BH8B 5T3XD 2K6WA 1ZS2A 4IMLA 5DQ9B 2CDFB 2BJML 4FA6A 2GFBB 1IT9H 1LGVA 5HHNB 5KANG 5DMGD 4FNRA 4GRWH 2A83B 2EZ0D 3ARSA 4GAJL 3C60A 1XCQB 3D6GA 1EJFA 2EEFA 2D0HA 1NDGA 1GZQA 3GMPB 2D7PA 1LO4H 3QHZL 1FL5B 2BC4B 3ZK0A 4HWEH 1AE6H 1T66C 3RTQD 3P0GB 3KDPB 4QOKA 5IB3A 2FUTA 4J5VA 3BAEL 1MG2C 3NCYP 4GAGL 3ZL4H 2VTFA 2C1OA 5DUJA 3P3UA 3QRGL 2H41A 4OFYD 4L9DA 1FZMB 5DJZA 1D7DA 2JXMA 1SM3H 1A5FL 1HH6B 1E6JH 1ET5A 2EAEA 3GGWA 3HC0B 4MKMA 5AW7B 4PAZA 4JE4B 3VDCA 4X6DB 5TF1H 3U46A 2BHZA 1K6QL 1EAQA 4ONFH 2PABA 1UKQA 1IQWH 3QHFL 1NGZB 1NEUA 4GKLA 1F1GA 3ABMB 2ZE0A 3II3A 3BEVB 3GIZH 5AOIA 4FQCH 4UAOC 3N55A 3SDCA 1SJHA 3P11L 1U58A 2E76C 2BIIA 2Y6SD 4ZMYA 3QPKA 4ZSOB 3FRPA 3UXFA 4RFOL 3D4CA 2MFNA 4R97C 5TQ0L 4OZIF 3BD5A 3HG1D 3QRLA 1GGYA 3RGHA 2TSAA 4LLMB 1ILUA 1NAMA 5CEXA 1FO0A 3ZHDA 4E9SA 3VQLA 3JWNG 3UTPD 2AHIA 2V3EA 1UURA 3CDZA 1IAIL 1ZEAL 4HQQH 4ZXBB 4ERSH 4EZMA 2WJ7A 4TLSA 1BSIA 3D9AH 1AHWC 3CDGB 2IFFH 4H8WC 4GLRI 3V6OC 3MV8B 1SN2A 1QSEE 5E7BA 1DN0A 2NW2A 2KQMA 4KROC 2HN7B 1VACA 2R4SH 5DHXB 4L37B 4PLKD 1CK0L 4B7LA 4TUUA 5GGTA 4CJ1A 3NTCL 4OIFA 4IKLA 4OLZH 3RWJB 4NZDA 4BQ6A 4U0QB 1RPQA 4LMQE 3WGUB 5L8LB 4JPVH 1E4KC 3AS0A 1JS4A 3ZL1A 2O5ZH 4FZ8L 2VDNH 3EGDA 4Q2ZA 1T7YA 3UBGA 4A7QA 3WN5B 1KV3A 2D7TH 2X7LB 3LRGA 1O6TA 2Z9TA 2IO5A 5D5MB 4NQUA 4PJEF 4G6ML 5EPMB 1Q72H 2WVVB 2YRLA 2AV1B 4OB5H 4IRJD 3EAKA 3S4SB 4MQ7B 2NY6B 5T8IA 2ATKA 4YUEH 5D7EA 5FKPB 4MA1B 1X5MA 4LRIC 1UUNA 2HT2C 2CJ3A 5JHDB 2Z7UA 4CRPA 4K7FB 1FE8H 2B2XL 4JFFD 3UCQA 4YSEA 5LG6A 1WHOA 3TPUB 2VLRE 2KC0A 1L7IL 1T7WA 2Z31A 2EC9T 3U2SA 1K5NB 4UILL 4ONHB 5GGSA 3LZRA 5SX5H 4AEFA 3W5MA 4O2FA 3PDGA 2JB6B 2O5XL 2Q10A 5ICZB 3BP6A 4YE4H 5EUOF 2AXHA 3V0JA 3DRTB 3TN0B 3O2WL 3KL0A 3WHE1 2G5UA 3JT0A 2P8MA 4GO8A 5KN5B 4M1CC 1LE9A 4ILDA 5IVZA 4BRVA 1HL8A 2AQRA 3GSWA 2FLRT 2ZG1A 4ISVB 3IETA 1AGFA 1NGWA 1QASA 5GGRB 5I15L 5CZXD 2O5YL 4YFEA 5DD0H 4PG2A 2DBLH 3DXAE 2ZPKL 2V7HA 5IMMA 4JO2H 1I9RH 4E68A 3BPNB 3BXNA 1ZK9A 3D4GA 3UZVA 3KWXA 4NOFA 3FKUS 3RA7H 4OGYH 5KYNA 3MRBA 4HHAB 3VFTA 1MFNA 3O0LA 3H9SD 3RLSA 4KRPD 5JYMA 2IDTA 2VLME 3L3GB 2YD8A 1YN6A 1XGZA 3HUJA 4Y19A 5EZOH 4Y2OA 4OBSA 3ARGD 2YAHA 2XQYA 1J5OL 1NMAH 1TTUA 3AB0B 1P7QB 2J21A 4A63A 5L7XL 5HI3C 4YL9A 1ACXA 1OSPL 4ZTPL 3KGUA 1L0XA 3GRGA 4WK2B 4NM8H 5HI4C 2EDQA 3II1A 4Q6YA 4AVIA 3ZSTA 1IAIM 2VJ8A 3PU7A 2ROXA 4KV5F 5JW4M 4IGBD 2JFCA 1KC5L 2YAMA 1L9RA 4TSAH 5KYYB 2VR4A 4RIRB 4UDUA 3HI1A 5DYFA 2OTWB 5FA4A 4H1LA 5EU4B 3SJVA 3KVDD 5DLLA 1G9EA 4HYTB 3IBOA 1QHQA 4BKLB 3QSKB 5AG9A 3HI6L 2PNDA 3LZFH 4YDJA 5E99H 4ONGH 4JN2A 4YBLB 3QJRB 4R3SB 3ZYZA 4WEBL 3D0AA 4CL7A 1BD2E 2FIKA 3DVFA 2DTML 1P4LB 3LPWA 2FJGB 4HDIB 2P24B 2NR6C 3GSXB 4FQJL 3ZDYB 3N85H 2HFEA 5IFHH 2X1WL 4JE0A 3N9GL 3VXTA 3ZE0F 1ZHLA 2HCZX 4Z0XB 1TXKA 4L1TA 4ENEC 1ZPUA 1KFAH 3ECUA 5I1JH 1RK1B 4W9IC 4I2XA 2J72A 3MLZL 2D3NA 2I9TB 5ESVA 2I5YH 1PDKB 1ZHBB 1I3GH 5JW4N 4IRSB 2FX9L 1AHWA 3V6OA 3ILDA 2DM7A 3FT3B 1MFVA 2NY2B 3H85A 4LVHC 1AQHA 2AEPH 1F3JB 3DTXB 2WYIA 3QJSB 3V4VL 4WVRA 4OFKA 5KYUB 1A4JB 2AJVH 4JMXA 4E9VA 2JKJA 5K9JH 3BPOB 4DP7X 3W56A 2LLGA 3DPBA 1I1YA 1KTCA 1N67A 4F2MB 2QDVA 2VN7A 4AQEA 2A6DB 1CFVL 5DURB 2HWZL 1U91A 5CFAA 4NQDD 2BXZA 3GMRA 3VWJD 1PLCA 1ID2A 3C12A 3DJRA 4P2YA 3VH8A 1SBSL 3BCDA 1GS6X 2QQNH 4UT9L 3EH4B 5E6UB 3FO9B 5KS9E 5BQDA 2IXQB 3U25A 3SDAC 4L8CA 4WW2B 4LRIA 1JF5A 1QSFD 1QBBA 1C5DA 3AROA 3CQQA 4N0CD 1E4WL 1WK0A 3D85A 4LSSH 2HUEA 3TEYA 3ZDXF 2X6BA 3MRRB 1Y6NR 3PPEA 5AD0A 3J27A 2HH0L 2DWTA 4H40A 3FB6A 4WSJA 4AXWB 4G83A 2AJSL 4UQ2B 3CFUA 5E08L 2NW3A 3ULUH 4GAYA 5KSAC 4L3EE 4QEGA 4TNVK 1LQSR 4KVNH 2OV0A 1S9VA 4JREB 1A7NH 1T22B 1UM4H 2ICWA 3B2UC 3K1KC 4GMTH 3VMOA 4EE2A 3H9HA 3S36H 5DMYA 5I19H 3T3MF 2PO6A 3H2QA 4JG9A 5JHAA 4GOSA 5GS0D 2C3GA 3VCLB 2YBGA 3NJNA 5E8NB 3RPIB 4PRIE 3ZDZB 5DFAA 1JPEA 4N25A 3C6LC 1X9QA 5K33A 1DQJA 4BFEA 1TQBB 4PRNB 4Q9QH 2HLFC 1F4HA 2FYYB 5CKAA 5I1CH 2WAQA 1OAZH 1NCTA 4BFJA 1AY1L 4Y7OC 5BV7H 3CLWA 1X7QB 2ADGB 2X89D 2C1PA 5F7KC 3X12B 1TTFA 4RGND 5KJRH 4RNRA 1SVZA 1FVDA 2PCFB 4P2RE 5EBWB 1K8IB 4DP0X 3GZKA 3W0WA 4GG6E 1Q0YL 4I0CC 4S1QL 5D1QC 3L9RA 2WK2A 3FTWA 5C6TH 5ILTH 3MRNB 4E5XA 3OX8B 4IOIB 2Y36H 1XGRA 1EXHA 2QT6A 3H4HA 2PYED 5I30L 2BVYA 3FF7A 2VDOH 5LDUA 4J3TA 4HV8B 1BQLL 1MH5B 5C0AA 4DW2L 2GJ6A 3PWVA 1NCBH 3UC2A 2ZUXA 2PW1B 3GB7A 3VGFA 4HMEA 3JWDL 1TOXA 2BNRE 3MBEB 4MD5B 5GS3A 3FC8A 3SDDD 1QFUL 1UOWA 1BMWA 3OAUH 4QUOA 1CZ8L 3K71A 4AUUA 2KHAA 1RZIB 3VQ2C 4RA3A 1JNNH 4HIPA 4ZT1A 1FLRH 1R3IH 2B1HL 5CLWA 1ADQL 5IIEA 5E4IA 3IU3A 1KIQA 3K1DA 2AK4E 5JO5B 4XN9A 1B0IA 2YRZA 3B7SA 3SYOA 4UOZA 4RZCB 4CAGA 1TZIA 2BY2A 3ZBMA 2AXJA 4HETA 3U2IA 4AGNA 5EF0A 2NR6A 3WNOA 5I1HL 3DHPA 3Q7JA 4TVPL 1SVCP 1J9TA 1A7QH 2BSDA 4JFYA 3SE8L 3RGVD 3UROR 3WFDL 5AW0B 3X3GH 3MJ7B 1VGEL 3MX0A 5AVSB 4TUKL 1QBLH 1HHGA 3ULVC 3T2LA 1DQMH 1IB5A 4NENA 3WJMA 5F7UA 3LKOA 4WLCA 2VLKE 4EBQH 1G7MB 1JZ6A 2WB7A 4J1UA 1SY6A 4N8CL 4MNQB 4KTGA 5F7MC 3NJIA 4QHKI 5EG6C 1HHKA 1JFQL 1XB6A 5J6HA 1N4XH 4Z95L 1KXVC 2EDYA 3GJFH 3GYRA 4TTDC 3GXNA 4ZQKA 1FG9C 3Q5TA 1IX2A 3VFSB 1VEPA 3QUZA 4XNXH 3DSFL 2RIKA 2P28B 4G6AC 2FEEI 4D9RD 2VXTH 5BXFB 3KPSD 5A7BA 4YC2B 3F6JA 1AFVL 4LASL 2EDJA 3WGVB 1SYVA 5CIPH 4NKIL 2EIMB 3DDFA 2YEZB 4G8EB 2F8OA 1Z3GH 4YR6A 1HIML 4G80A 1JYWA 4NT6A 3O9WC 3VG0L 5F0PB 3KGRA 4DHLA 5KVFH 2R69A 1WAPA 1N6UA 1U8JB 5TDOB 3ECWA 3OKLA 3FHAA 1TU2B 3MV9A 4NQED 3O45B 2DDQH 3O6FD 2A2QT 4NB7A 2ENJA 1YVLA 4K23H 4JHAH 2CBMA 1ZA3A 1FZOB 3QI9C 4FOMA 4OZ4B 5C0CA 3GMOB 3VFNB 2H6PB 1HX0A 1K5WA 5C0EB 4I9XA 4XVJH 2X5PA 3EADA 1MRFH 2BNQB 1BVNT 3RY4A 1INDH 4U1JA 3RKPA 4KKBD 4AL8L 4P9MH 4HH8A 4P2AA 3FO0L 1EZVY 1FZJB 4X99A 1NCIA 5DVNA 2ZWZA 4J23A 1HEJC 4P3WA 1CDIA 1OPOA 3CCHB 2NUTA 5E6IB 5I18H 2DJ4A 3LRLA 1WV7T 3HRPA 5KSAA 1JG9A 3O4LD 5FB8B 3HE7D 4Y2NA 4BRJA 3Q3GA 4JZJB 2XZCH 3PIQA 1ED3A 2FTAA 3MACL 2LFGA 4KKRA 3V0DA 4O2EB 2BZCA 3QEUB 5AYTA 3BE1H 3EKCA 1QZNA 1ACYL 2NY7L 2OJEB 4EN2A 4X5XA 5HPOA 5DQJB 4HIHB 5F8QC 5A6MA 1C5BH 2YUVA 3QDMA 5I8CA 1QKZL 3BWUF 3C8KB 5KZCD 3QPQD 1E5AA 5J89A 3UPRA 1N5YH 4MAUH 2RR3A 3C6LA 1JD9A 3H2WA 4RLDA 3CXFA 3HS0B 1CR9H 1SRDA 4MCZB 2ADIA 3PJSA 1D7BA 3BPLC 4F7TB 2XKUA 4JQIL 5EBMB 1ZXKA 2EILB 1OAXH 5DA4A 1D5RA 2R2EA 6FABH 2HG5B 4UU9A 1SOQA 4BZYA 1FDLH 3DURB 3HZKA 4FNLH 3ETBJ 3HN8A 4FQIL 1J8SA 1EX0A 1PIGA 3WNKA 1NWPA 4JKKA 4GP8B 3LQAC 4N3UA 1LD9A 3LZPA 4Y7MA 1VLXA 1JNLL 4WFHE 5D1QA 1CXFA 2VLLA 5SWSE 5EN2B 3LRSA 4F7EA 3LTVA 3L13A 3I75A 1UACL 1ZGLM 2CLVB 1E30A 2E6JA 4QKXB 2ZUYA 2Q7YB 4QHMB 5DHVH 5B3SB 4XCYB 4OUUA 5B1KA 2EZ0C 2BCKA 1DJZA 2A74A 1CE1L 2XJKA 3CFCH 1S7RA 2BVPA 4CVUA 4F3FB 2W0LA 4X0NA 5K93A 3WV0A 1PNDA 1HKLL 1FPTH 2EYTA 3RTQC 3IDXL 3GSUB 3ZY7A 5T1KD 3UO8B 3EW3B 5IW6B 4FFZA 2L7QA 4X50A 3T08A 4WW1B 1BEXA 3WAJA 4OCSL 1A9BB 1TTAA 4BFRA 4QF1B 1KYOJ 2A73B 4JDTH 1UASA 4A6YA 3Q2LA 3PYCA 3E7JA 1A21A 2Y72A 3NA9H 3ARWA 1S7TB 2WZPA 4LF3A 2K6YA 1NEPA 2D8KA 5DJ0B 5DQDH 4YGVB 1IM9D 4YNYB 2WLIA 4QRPA 3RBSA 4WUKL 4MZIA 3ZOAA 1UKSA 3CXHJ 4XNUL 3RIAK 2P7TB 1KJ2H 1QUNB 2NCMA 4P2QD 4PRHD 1DBBH 4XP1L 1JZ2A 3OJ2C 1AD9B 5K9OA 4HAKA 4KAQL 4TUJA 3OHMB 1E6OH 1UA3A 2PPEA 1KDJA 4GSDL 5GGRY 4JPWH 1KXVA 5GGUB 5H35B 3ROLB 2DH3A 4M9OA 4RMTA 5D72L 3BVVA 2QLVB 1JOIA 4L4VE 2EDNA 2EIJB 3FT4A 2PTTA 5HHPB 3GLZA 2F54B 2QQLL 1F2QA 1FHNA 4W81A 4YMPA 3DJTA 1NL0L 1E90A 5CZRA 4JO4H 3HKFA 2W9DL 1OVZA 1N0LA 1KWKA 1RULL 1AOHA 1KIPB 3RZCB 2M8XA 1JPST 3O9WA 4L4TD 4OTXL 4Z3GA 1NOFA 1QA9A 5HYFA 1NBQA 3TH4T 3BRFA 4UOQA 3SY6A 1INEL 1RZKH 5HI5C 5EDXA 1WZAA 3SY0A 1HQRA 4DUVA 2WBJB 1N3NB 5IVXB 4DO6A 3QI9A 4AIZA 4F7CA 3DV6B 4YHYB 2IGTA 1L3WA 5LLIC 2VKXA 3IDGB 5LNGA 3ARDC 1XMWA 3DJ9A 3PWNA 4NRYA 4G9DA 5E2WH 4CJ0A 4LVNC 4PBVC 3MLWL 2VMFA 1MFBH 4XN7A 4AQAA 5ABDE 2VXQA 1MN4A 5T1MA 3ZKXB 1Q0XH 1WBYA 2G3ZA 4IRJC 3FXIC 4OJAA 1H5BB 5I17B 5IHLB 1JYXA 4YXKL 3DX1A 3UEZA 1GOHA 2PTUA 3EFDH 4AIOA 1KXHA 3IKCB 3UL4A 3PPSA 4JPKH 2ENYA 2EDDA 5CJBA 1K72A 2FWUA 5BVPH 2YN5A 4YHNB 5FPIA 3ZMRA 2C9QA 1EUUA 4FNSA 5DVLA 5KSVB 4OV6F 5EEVA 2VRKA 4PJDE 2UXFA 3GHPA 3DGGB 4NZRH 1IBFA 3UBXA 2WLYA 2Y07H 4TSBH 4IOFD 1E8ZA 2H45A 3FFCB 1PU0A 3PQYD 5I1IH 3RILA 2JJWA 1G4MA 4PW3A 4PY7A 2JI3A 2GJPA 4XC1H 1Q0EA 4JRYD 4Y2DD 3D25B 4AWJC 3AS2A 5F7EL 3O2DL 4I3SL 4NLHA 1NIAA 4TULL 1UD3A 5FM8A 4Y89A 4YLBA 3V4PB 1KJ3L 2R39A 1XF5A 5F1NB 2DQHL 1KBKA 5I1LA 1AI1L 3ILEA 4L8BA 1NGXA 2N3JA 3I9IA 3FQXA 4HBCH 4W9FC 3ZZSA 1OWWA 4BIKA 2WXNA 4F7KA 3AT0A 1MFCH 3OL2A 5EU3A 2C9XA 1WAAE 4NP4L 1X6LA 5SWZE 4FS0A 2GHWB 1P6AB 2LFEA 5JIMA 5F6HI 4WUUB 3NCEB 1C12B 3QUML 2BP8A 4CMHC 2YS4A 1D6EB 3TZVD 3AY4C 4A7TA 2F53D 1B0GA 1GMIA 3NIDF 5E24E 4G7RB 2Y69B 2V6HA 1IGYB 3G6JF 1OQXA 2NDGA 5IB5B 4ZW5A 2WCPA 2Q9OA 4P3DA 4WSKA 1FP5A 2V7NB 4BSWB 3E6HA 4HFWA 2AERT 5CU9A 3IE9A 1NGQH 3IKKA 4M5ZH 5AZEL 4NO2A 4Y5VB 3KLQA 4U1HB 3B5HA 4XX1G 2VN6A 3NQIA 3PWPE 3NCXA 5F97E 5L9DH 2IANE 5ITFB 2DJMA 4HU8A 4PV1C 4YSSA 1HHJA 2R23A 3OXSB 1CF1A 4Z77B 1QSEA 2AEQL 1RZ8A 3KYKL 4M43L 4JBSA 1WVZA 1FORL 3SKMA 2WIIA 4MXQD 3QEQD 4NC2B 5FO7A 4HJUA 1NCAH 1YZZA 1AZNA 1TLKA 2BSEA 1SF3A 4WWPA 2ZSWB 2JB5H 2C9UA 4HKZB 3WEAA 2HJLA 1A22B 3PS6A 4HUWB 1R5VB 4NGHH 1HNGA 1RY7B 2XQBH 4LSTH 4P46A 3SDYL 4OF8A 4ADGA 4NN5C 4BWUA 1XVSA 1CFBA 4U6VL 3S3BB 2GG1A 3OR6A 4DKFH 4NQTA 4MRCA 3RL1B 4JFEE 2G5BB 1OK0A 1I1AD 3RYMA 2O6EA 4LLUB 4YDVB 1UCTA 4RMBA 4UV7L 4XMVA 5DVMA 4DKEH 2W81C 1QR1A 3B9AA 3WJJC 3DIFA 1GC1L 4I87A 2XU9A 1U2YA 2IBZY 2X70B 3MYJA 1IGIL 3HZ3A 1MCPH 2CXGA 5ABZA 3IJEB 3WKNA 3UTTD 4YSRA 1OGTB 3IGUA 3L6FB 4G6FB 4XCFH 1S78D 2DQCH 2NDFA 3FULA 3L81A 1QFWH 2EIZA 5L2KE 3MV7E 4YGAB 5FO8B 4H0HB 4GRWE 5C70A 1E50A 1OOWA 1QEWB 3S5ZA 2HT3D 2VOTA 4KUCF 5F1IA 2UV3A 4HK0A 5EU6A 2YEVB 1UB6B 1M2VB 5IFAL 3ARDA 4YL4A 1KT2B 2W95A 2ZOKA 4F57H 2OCCB 1MNNA 1QTYT 1IKFL 2BIPA 2XG5B 1BIHA 1BLIA 3U4BH 2RACA 4AEEA 3UTSD 3ZYJA 4ZUUB 1INQB 4JO1H 4YDZA 3A67H 4NNPL 1T4KA 2RCSH 3CFEA 1TFPA 3EFOA 5AOKA 2E9GA 4GW1A 3SGDI 1X5KA 4KZCA 1D5MA 1Y18A 3WXWH 5DC4B 1T7VA 2CK2A 1CFSA 5C09D 4NKOA 4PJ9B 3LQZB 4AIEA 5IEHA 1AGEA 3CZSA 1KBGL 3KYOB 1W0WB 4C56B 4F7PB 2IAMD 1FSKB 1SXCA 1K4DB 3CFJA 1Q1PA 4DGVL 1W16A 2YD1A 3GC3A 4HUMB 5TGBA 1U6AL 2UWEE 4LEBA 3LIZH 5CD5D 3LNEA 5D9SB 5IB4B 4FL4B 3IMUA 4J2QA 4X7CC 3WHXA 3RKDD 5FM4A 1JN6A 5DZNA 3GSRB 4AX3A 2DYSB 5I73B 5E94B 1L9MA 3WS3A 4J3OC 4L5FH 1JD7A 1A6AB 1UC6A 3INUH 1MCCA 4ODUA 5DYOA 5E4EB 3RJQB 3ZUNC 1DBAH 4NUGH 3EH1A 3S34L 3ULSA 3VW3L 5ESAB 1QWHA 5GS0C 2CO6B 3HS8A 4H0GA 3QJOA 1YEFH 2FHCA 3Q01A 3KR3H 3MJ8A 3UG4A 2HAZA 2IQ9H 4JFPA 3AAZA 4GT7A 1RQ5A 1MVFA 5I66B 1YEWA 5TFSH 3V95A 3RWIB 1G9ML 1DBMH 1EEYB 3MMEA 4UM9D 4YSTA 3DMMD 1ORQA 4HUUB 5AQ0A 3B7RL 4NRZA 5ERWA 4FKHA 4WO0A 4H26A 2F58H 3H9SA 3AY4A 4JFDB 3PFQA 5CUSH 4PR5B 1X6NA 4F5CE 1NANI 1MLBA 1SGKA 4FTDA 5J12B 3QXDA 5HY9B 2RMNA 4LDEB 3VACA 3O3AB 1IILE 4O02H 1BWMA 1IM3B 5D1XB 1X9UA 4O4YL 1QNIA 4JR9L 2Q3ZA 4GBXD 5ANMB 5EC1B 3VFPA 1KF9B 2Q5BA 3FSOA 4ZOAA 5K9KA 3P9LA 4WU5B 4N0YL 5IT2L 4YLCA 3IXTA 4G8GD 3NJFA 5C0NC 2MCPH 4XP9L 1ZJAA 1BAGA 3N1PC 3MLSL 2JNZA 1R3HA 1LEKB 4C8XA 3HRZC 2WXQA 2K4AA 3WLBA 2ZJSH 3Q9PA 5HVFB 4NERA 1U8OB 3EJRA 5KBPA 5BOJA 4B0MB 4KOBA 4RDBA 1I7RB 3UZQA 1LO5A 4CMMB 1B2WL 3VB8A 1HJBC 1TJHH 5JA9A 3GMLB 5HHQB 3GBLA 3ARBC 4PJGB 3D0LB 4CSSA 5SWQA 3HBGA 12E8L 3TV8A 3IGAB 2GAZA 1UVQA 3U4KA 4ZMQA 5B4MC 3PWJA 1TVHB 3GZOA 1JBJA 1X5IA 4DPRA 2AQPA 3WJJA 3DJZA 1BLNA 3MXVH 3NJMA 5C0JA 3UYRH 2UZYB 3U7WL 1UQSA 3J2PA 1COBA 1N7MH 1AJ7H 2VDLH 1JWSB 5HYJE 5ACMA 1JZ5A 1RUPL 3Q1SL 3WCYA 2E7LC 4R9HA 4GKNB 5AWNL 3SDXB 1TZHB 4UINL 1JWUB 1V3JA 2OMVA 3UAEA 1L7TL 5CCGE 4M6MH 2G9HB 4UF7C 3RRQA 1MF2L 2ZQKA 1GH7A 1OM3H 1T2JA 4L3EA 2ESVB 1B9KA 3VI4E 2VAJA 3BIBX 4G5ZL 1BFSA 2XDHA 1GW0A 5HGDB 4FQQB 3H8NA 4AV0A 3CHPA 1I8KB 3APCA 5AVYB 1IEHA 3O6FC 4X4YB 3TJEH 4PRIA 2I9LA 5GGVY 1VENA 3UYPA 1R0AH 5BS0E 2VSKB 2C3VA 3CX2A 3D08A 1BZ7B 2YMXH 4GXUM 3AQXA 5IESH 3KPQA 5IY5B 3WOVA 2XVKA