4XOEA

Crystal structure of a fimh*dsg complex from e.coli f18 with bound heptyl alpha-d-mannopyrannoside
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FimH protein
publication title Catch-bond mechanism of the bacterial adhesin FimH.
pubmed doi rcsb
source organism Escherichia coli o6:k15:h31
total genus 55
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoeA01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoeA02
4X5PA 5FWRA 3MCYA 4X5QA 4AUYA 1ZE3H 4XODA 3SQBB 4J3OH 5IQMA 5FX3A 2JMRA 3ME0B 4XOBA 4AV0A 4AVKA 1N0LB 3BFQG 4XOCA 3RFZA 3ZL2A 4CA4A 2XG4B 4J3OG 4CSTA 4AVJA 2J2ZB 2WMPB 3ZPDA 1TR7A 5JQIB 4LOVA 1UWFA 4ATTA 5IQNA 2VCOA 4BUQA 1PDKB 5AAPA 4AVIA 5AALA 5F2FA 4AV4A 4XO9A 5LNEA 4AUUA 5LNGA 1QUNB 5FS5A 3BWUF 4XO8A 2JTYA 4XOEA 3BFWA 4AV5A 4XOAA 3JWNH 4X50A 1N12A 5FLUA 5ABZA 2W07B 5AB1A 2UY7B 3JWNE 1KLFB 5F3FA 4CSSA 1KIUB 2XG5B 4AVHA 4X5RA 3JWNG 4J3OF 5IQOA 3ZL1A 4AUJA 5CGBA 2UY6B
chains in the Genus database with same CATH superfamily
1AJ7H 3A67L 3U36A 1U3YA 4GIOA 5DC0A 4JFDE 1HEZA 5HJ3A 2C3XA 3P3UA 3A6OA 1KCVL 4PGJA 4UIMB 2QQLH 3CZEA 5J7CC 3D50A 5C0ND 4LSSL 3RI5F 3VQ1C 4C55A 3EDJA 3QJVB 1G7PA 1KGWA 3V2AR 3BLPX 2KPNA 4K3DL 2CU9A 2R29H 5F21B 2Q2EB 2ZWNA 4S1QH 1PEZA 4ZSOB 3BQUA 5IWLA 1NL0L 2XA8H 4PVNA 4KKPA 5EZLB 1TZGH 4O5LL 1XR9A 3WTTA 5JUEL 1JG9A 5JXEC 3PHOB 1VPOH 4JPKH 1KC5H 4HGMA 3HG0A 4H1LG 1U8OB 1XH3A 2AEIT 1G9EA 3SKOB 2JQMA 5D1XA 5I82A 1JV2A 2OTUB 4FQJH 3AUVA 4WW2F 2OZNA 2ZE0A 3KDMB 5TE4L 3ZE0E 4IDLA 5HY9A 4BM7A 2QPEB 1BG9A 1Z3GL 5MEND 3DSNA 4HIQA 5EU3B 3RHWK 2BPBA 4DP4X 3FHAA 1BEYL 3TO4B 2EIEA 4PJ5A 4PBDA 2P5EA 3VD7A 1OTUD 1WWCA 4UT7H 3L1OL 3D9AL 4W9DC 4MJJA 3NEXA 2PW1B 1XL6A 1FSKC 2X7LA 3ARRA 1PDKB 2P28B 2WXJA 5I2IB 3DOHA 4S0HA 2EDTA 4P46A 2V5RA 5EBLB 5CGMA 3SPHA 1OAZL 4I0PD 5T33H 1DL7H 2A83A 3HN5A 3UJTL 3NZ8B 2F19L 4NUPA 5HYJE 4BWTA 4PRNB 2BCKA 2IVFC 3CUPA 2FQGA 1OVZA 1U6AH 1E7VA 1JWUA 4GKNA 3S3CB 5CZXC 4K5OA 4WFHE 2QQNH 3QGVA 5IVXB 1TEFA 1MG2C 2Z93A 4K7FA 3CWGA 3G04A 2WK2A 1Y6NR 4YMPA 3CC5B 4M1GL 4XC3L 5EOCL 4XMKH 5INCA 4R0LA 2GPZA 3K6NA 4BZ1L 35C8L 3II3A 4NQDB 4MMYA 1MHHB 1JXJA 4G42A 5DXWA 3IFOA 4NB7A 1DLHB 2EIJB 3EOTH 4ZUSA 5G5DA 3U7WL 1M4KA 1QFWM 3JTSA 2VLKB 1H8NA 3US9A 2XOTA 3F7KA 3BCDA 4Y5XB 3GD1C 4YE0A 5FO8B 1R46A 2EVJA 4PG9A 3GSRA 1C9SA 2BXYA 3U46B 3IDJA 5T1MA 3CFEB 1MOEA 2ILLA 2Q1EA 3I9GL 4FFTA 2YZ8A 1KJ2B 1ZEAL 4LMQE 5H35B 4HUCA 1ZS8B 4YSPA 1TETL 1TQCB 2WTRA 5DHVA 1BD2A 4Z0BL 1SM3L 1KYAA 3U1PA 1ZGLA 1MRFH 3WEXA 3VH8G 3Q8FA 4K8RC 4AM0B 5A3ID 3CFIC 1A3RH 3RVWD 2WAHA 4Z7QF 3A3YB 1DQKA 1JPGA 2GJZB 2O5ZL 5DFVD 3L3IB 3OXRB 3MYJB 4R9HA 1QSFB 3VI3F 3WN5B 1VFUA 5FX3A 2RBLA 1HNFA 2CA3A 1HINH 2FO8A 5C0BB 4TQHA 4AEHH 2XY1A 2RR3A 2XNAB 4YFLF 5HDOA 3L9EA 4GO9A 3RKDD 1I1FB 2HTKD 4DVBA 3V55A 4FQ1H 2LOEA 3DDGA 1HIML 2XKNB 2GTWB 3FH8A 2HT4C 2KZWA 1H3TA 2FX9L 3OKKA 2NW3B 4LK4A 5AOZA 3CPLA 1X7TA 2MNUA 3DVNA 4HDIB 2WTPA 3PP4H 3LIUA 3P4NB 1U8LB 2XIIA 3Q2LA 2MPAH 2R2HB 2YD2A 3N04A 5D1XD 1X5ZA 1SOQA 2YGVA 5DHDA 3H4HA 3SE4C 4AL8L 5EF1A 4YFEA 4LSPH 2MNWA 3ISRA 3PL6B 3B7UX 1G1CA 1ID5I 4RIRB 3VI3E 2RGSA 3PHSA 4NN7B 1P4IH 1V7NL 2OYMA 2NTSP 2P5ED 4M9OA 4PJ5D 4M02A 4Y2DA 2CCVA 4G43B 1Y07A 2EDRA 2XFXB 3ARFC 5F7EL 5F9JA 5GGTL 1DVTA 4GQQA 4LLUB 4QRTB 3DBXA 1IC7H 4FERA 4IBLT 4W9EC 2KUTA 4P46D 1BQKA 5AVRB 3IGAA 3VXPA 4XMXA 5I0WA 5DVLA 1NCJA 3ZDYB 4ACPA 3JV4A 2O6FA 2CJTA 4X4MA 1RD6A 2H3NB 3QHTC 1QNIA 4ANKA 6PCYA 2AITA 4WDIA 2J25A 1HZLA 5I1AB 2SODB 3LZFL 4EN3A 2WZAA 5LBSA 3JTTB 5DI8B 1W0VB 3UL4A 1IEBB 1ORQA 2YAOA 1NGXA 5D7SH 4ILDA 1SLXA 2BSTA 4MCYB 2BOCB 4HV8B 5GZND 2MCMA 4RFOH 2ETWA 2X1WL 1HU8A 1RIUH 1RULH 4TKWA 4L37B 5DR5L 1NDTA 2CJUL 3K74B 2ATKA 4N5EC 1B6UA 2VC2L 3BCFA 2KYIA 4N3TA 4P9ML 1BFSA 3QQ9D 4HIJB 3B5TA 3CU1A 4HXAH 2I26N 4WHYH 3S98A 1BHGA 1FIGL 2IDUA 5I5JA 4UQAA 1XQ4A 1QW9A 2AGJL 2J21A 3C8KB 4ODBD 4ONFH 5MI0B 4PCYA 1MJ8L 5I8OH 2ADGB 3SGKA 4BSWA 2BNUB 3MVSA 3BUIA 4ABQA 1DBAH 4PJDB 5D1QA 5D72L 1WZKA 2ZXEB 4HIEB 1NGZA 4ZFOL 2DQFB 3P0YH 5AYQA 1MWAA 1EZUA 3OD3A 4KK8D 4BGDA 2XX0A 1BD2D 5DEGB 3SCMB 1RZFH 1YEHH 4KO6A 3MJ8A 3QXVA 5CJOL 2NY1C 1KXVC 1LNUB 1G7HA 2AXFA 2JCWA 4R7VA 3CQPA 1G7IA 3N5AA 1THAA 5LBVA 4X6CB 5DZJA 3TPUB 3M17B 2R9HC 3QULB 3MFFA 3N42F 4PJ7A 2DMGA 5GS3A 5CBAA 1A9VA 3HE6C 2APXA 1E4XL 1H0DB 2WXFA 3D30A 2VDNB 3ARXA 4PJ6A 1TVHB 5AWNL 1S9XA 4HQQL 2H3KA 3VGEA 3MRGA 4YGVA 1EEYA 4LSDA 2P8LB 1AQMA 4IKKA 4XP4H 4YVUA 4G7RB 3BPOB 3SGJC 1KN2L 1WFMA 3ZO9A 2YAPA 3WNNA 2DEWX 3ZXAC 4AIXA 2XI9A 1BAWA 4XPBH 4NLHA 3S96B 5C0FB 4PRHE 2MH4A 4Q9CA 3UABA 1EFQA 1A2YB 1A0QH 1E9PB 1FFPA 3E3QE 4HPOH 2FEJA 1MVUA 5TDPA 3GUTA 1U8IA 1T21B 2DLIA 1IGIL 2UZIH 1IAII 2X41A 3Q1EA 2VXSH 5E6ZA 5F3BA 4KKNA 2GW5A 4Y2DD 1MJUH 2J56A 3DVFA 3NRPA 2YUVA 4L1DA 4YXHL 1UURA 4FLQA 3ZKND 2CGRL 3V7MA 3KWWA 2QEJA 1IU1A 1TTRA 3NA9H 4FP8L 3DI2B 3IFNH 1P1ZA 4KXZI 2MEJB 2QPSA 4XNZC 3K71B 4EN3D 2IMNA 1U91A 1A6AA 1DN0B 1JZGA 1QBAA 3OWRA 2DQHH 2QPUA 4JO1L 4MDJA 4YVNA 1ZANH 2AAAA 4RZCA 4LB8A 3LH2L 5E0FA 1UA3A 3AJ7A 1W0WB 2ZNXA 1RFDL 1N70A 4M7LL 4MJ2A 2VW4A 2EUWA 1F45A 4JFHE 4JKPH 1DVZA 4FFVD 1MCCA 4KRMB 5DJXB 4HF5H 2H2PD 2XFGB 2PWEA 3TP4A 4HWEH 3CCHA 1INEH 4JFXB 2YSTA 4JFFB 3LCYA 5DJ8B 1E3FA 1FNHA 3B9KC 5GZOC 1CK0L 5EZIH 3VB9A 2OXGB 3CBJB 3JV6B 1JFHA 2QVMA 3BKYL 1M7IA 3ARDA 3FB8A 3MV8E 3MUY1 5FUCE 4XVUC 1SMOA 4IBYA 2RQEA 1A1OA 1D6EA 5D1QD 2A6JA 5AZ2L 2BS8A 3RDTC 4ELKA 3GXIA 4OCWH 2YMOA 3TX4A 2NTFB 4B6ZA 3MC0A 1RK1B 4D8OA 2JMRA 2EKSB 2IBBA 1DBBH 2ZCLL 4I8DA 4AZUA 1WCBA 2VDMB 2IAMA 2M8XA 3HHMA 4NHUB 3H54A 3ISYA 2AVFA 4IHOB 2BY1A 5E8OB 3GBLA 4O9HH 4E9LA 2HH0L 1RUPL 1D5ZA 1T22A 2B0SL 2X9YA 2CXGA 3BFQG 4IKJA 3SKUD 4M5TA 2ZUWA 1V7ML 3FAXA 3G6JB 2CO6B 1FPTH 4FTVE 1LO2L 3WHXB 3FU9A 1JYXA 2VDPL 4AQEA 4P3DB 4IK7A 4OSUH 5EC1A 5IB2B 2OJZL 4XN2A 2UX6A 3W9EA 1EHLH 1GGBL 2IPUG 3CZFB 4UB0H 1AZUA 1UADC 3F84A 3WJMB 4UNTA 2ZCKH 4UQ2A 5A16A 5IB3A 2OLDA 5ALCL 4KPHH 3W9DA 1F13A 5ESAA 4N8VA 3OAUL 1DDHA 1QR4A 1JTOA 2UZXB 3WMQA 4IRZL 4HKJA 5K9KB 5FF6B 4FG6D 5KYYA 1JPTL 3CK0L 3EOBA 2CNYA 1IEAB 2I9TA 3FF7A 4MAYC 3O2VH 4XHJD 4HFUL 2IQAA 3VU2A 4AY0A 4KI5D 4PV9B 2BFVL 2M1KA 1TVDA 4BK8A 2FJFA 1TNMA 1UVQA 5FYJH 5D93C 4AQ1B 1RIVL 5J06A 2Y1ZA 3WE6B 1VGEH 1X6NA 1X5YA 4C83A 5GHWL 3RL1A 4QHLA 3QQNA 3L3GA 1XSIA 5CD5D 3MXWL 1M9WA 1FG9C 1KEML 1P7KB 1WFJA 3UMTA 5CCKL 3EO1B 5IOPA 5D8JL 4UQEA 2OYLA 3UTZA 3GTNA 5I1IH 3TN0A 1E7UA 2XPGB 3B7TA 4XPFL 2FR4A 3LIZH 2IV8A 4DCQB 4UTBA 3H7LA 5TQ0H 5CM1A 4WHTB 1IGJA 2C1OA 1MAKA 2VM3A 4XGZB 2ZT9C 1T4KA 4R7NB 2QHRH 2O61B 5DK2B 8PAZA 5ACLA 1BQHB 2BP3A 1XSOA 4IGBA 2VDKL 3C5JA 3JWOH 2V2TA 3KWTA 4MJHA 1HQRA 4WI5A 4B96A 5LQBL 4OIIH 1B88A 2VDOH 2C3VB 3ARDD 4Y4KA 3FCGA 5J12C 1SVBA 1IL1B 1IBHA 3ARGC 2ZKHH 2DJMA 3QC6X 3OJVC 2YUWA 5F7KC 1J5DA 5BQ7A 4LLMB 3HI5H 1RIHH 2YAEA 3MRJA 3ASWA 2HTLC 3B3IB 3WI9A 1VEOA 3PP3K 5CIPB 4IRSC 2E9IA 2PWFA 2DTML 1ASOA 5I8CA 4FNPA 4P4KC 2NUPA 4FHBD 4HIIA 4NQVA 4UOJA 3DV4A 3TBWB 3GRWA 2IAMD 4HUWA 3QQ3A 1PCXA 4N0CC 5AYTA 4CVUA 2BDNL 5IVXF 4JFZL 4ZUUB 3FFDA 4WHDA 3TIDA 3US1A 3PNWA 3D51A 4HWZA 3BP7B 4HD9A 1NUFA 2DIAA 1YUKB 3ZPDA 1MH5A 3O2DH 4Y5YA 3CVIH 1KB5A 2P5WD 3FT1A 3WJLA 4OV5A 4G80B 3MBWB 3GMQB 1Q9WB 2HVJB 4NN5B 2FSEB 5E6SB 3EH2A 4HWNA 4QRUA 1T66C 3QO0A 4QHNA 2N56A 4KK6C 3UO8B 2ZZUT 3O6KH 4HK3N 4YSQA 3L4UA 2JJSA 4TUJB 2X4RB 1OTSC 2I32A 4LQFH 2AEPL 5JTWA 4KZDH 4UDTA 1I53A 5JW3L 3VXSA 4XCFH 2AABH 2CK0L 5FO7B 2BP8B 3ZR6A 3ZYOA 4BH7A 2ZP9A 4Z77B 4ETYA 1NSNH 3KPQA 2XZAH 1K72A 1E4WH 3LS5L 4Q74A 4UQCA 2L7QA 2LLGA 4JFPA 3JVGC 2EO1A 3VFVA 1O6VA 4AGNA 1PEWA 1QKZH 2VSDA 4RBPH 5HHNA 5C0GB 5C0AA 2KQMA 2EECA 3OBAA 3K1KC 4QHUA 1ODUA 5G4NA 2V9UA 2YGQA 4OZFB 3ZKQD 1XV8A 1N2RA 2VLKE 1EBPA 5FM5O 4ZMXA 1J1XH 5I8KL 4WK4B 5EV7A 2FWOA 2W65B 2YEVB 3RLSA 1FYTA 3UTSA 1K9TA 1Q8MA 1U8KB 1A14H 4WFGE 3GZKA 3MV11 5E4OA 5FOJA 2H9GA 3LH9A 4U1LA 3L7FB 4ZS6D 5CBEA 1NBZB 1ZHLB 3NQKA 4XP6L 3V4VH 4HC1L 3TN0D 5C70A 2Z0BA 5K9JH 1GC1H 5GJTL 1IEHA 4G9FE 1HHGA 1XIWB 2VLJA 4FXKC 2OSLA 3M1CA 2QSCL 2A0LD 3SE3C 3GMLA 2W9DL 3HJ0A 1J8HE 4NZUH 1AOZA 3QJUB 2NW2A 3H1ZA 5IREA 1AC0A 4B97A 1JJUA 4IGBD 1EFXD 4JHZA 2EVFA 4R8WL 5L2KA 1ZLSL 4DGUA 1E4JA 4U6TA 1GTFA 4TSAH 5D2NE 3SQBB 2CKBB 3ZY7A 4E9YA 2K4WA 5LXGH 4AC2A 1J12A 5ADOL 1OD7A 1J9TA 5B1KA 4NOBA 4CSZA 5ITFB 3NIGF 5I0ZA 5L4JA 3GNMH 4NKOA 4UAOC 4X7CC 4YHOL 1WV7T 4LL9A 3N91A 4E9XA 1ZMYA 3ZDYF 2CMRH 5IFHL 3D3VA 2CKNA 5FW6A 3QNZB 4A37A 4UAHA 4DEPC 1R6VA 5T1LB 4LSTL 4UTCA 4EDXB 2DDQH 2R51A 2Q7AA 2B1AH 2X87A 3FK3A 4MNQA 5CEZD 3BH9B 4K23H 3DVGB 3LD8C 3QR2A 5EZPA 1BG1A 1N8ZB 3T1FB 4ZNEE 3IJHB 1JGVL 1SPDA 4YX2H 4ZUWB 2HN7B 4QWWC 2MCG1 3K81A 3NIGE 5F7BA 1I7RA 2X4PA 2VIRA 4EUPH 2YOAA 2O26U 4LPCA 1M3JA 2IAAC 3FTXA 3FJTA 4NWTL 4P23A 3RJDA 5T1JA 1XBRA 1FBIH 5K39B 3SIKA 3WV0A 5E6RB 3SDXB 5J5EA 3CFCH 3CLFL 3T8XA 5CFHA 5K33A 5CILH 1JK9A 4O58H 2BX5A 1FH2A 2KZBA 3OWEA 4KWUA 3VXSD 1CLOL 4GS7C 2R69H 4M5SA 4Y9BA 1KEGL 4HMDA 4AUUA 1EGJH 3CN1A 4LLYB 3ZMNA 1ZJBA 3MAWA 1VGKB 3PQYB 4DP8X 5A7BA 5F1NA 5LGHH 4LBAA 4PJDF 1CDYA 4HKZB 2QFRA 1K3IA 2VT0A 3SBPA 1KGCD 3MODH 5C0AD 1NLBL 4N85A 2WSKA 2NXZD 4NO0B 5DTFA 4JZNA 1YEFL 4RFEB 3UAAA 3GJEA 3Q5OA 2W07B 3D0LB 3BZFA 2R4RH 4XXCC 3C87A 3ZKMC 3QDHA 3FUNA 3OMAB 5AVWB 1SXAA 3K0WA 4NFDA 1YEDA 5JPNB 3CX2A 5A6MA 4KROD 4BCXA 3FONA 1FYTD 5DQDH 3UTSD 3V4UL 4Z6AT 3IJEA 4OD1L 4XP9H 3WHE1 3WL9B 4QOKE 4GSRA 3S8GB 1SXNA 3TOPA 2WQAA 4M03A 5FKPB 2XVGA 4PJDE 1J5OH 3WIIL 2VJXA 1CN4A 5EBMA 2VLJD 1LE5A 1U8CA 1CVRA 3AABA 3NPSB 4OCRL 1FUNA 4I1PA 2ZKYA 2MHAA 1RZGA 3MLXH 4FHJA 5I1LA 4EOWL 3TZVB 4QY8B 3V6BR 3RPKA 4KVCL 3BPLC 5E6UB 1CT8B 3MREA 2FD6L 4U6XB 3ZHLA 3SJVD 5L2KD 2HB0A 2BMKB 2AXGB 5B3JF 4WZ9A 1G0YR 3CVHL 4Z7WF 2CO4A 4J3OH 1LO3L 3BSZA 4LSSH 1S7WA 5EO9A 2UYLB 3L5XL 2CNZA 5D7IA 2PYFA 4K3DH 4AKPA 1T5XB 4QCIA 1YYML 4OD3L 1DZBA 5IB4A 3DRTA 2RH0A 3TNMA 3IRPX 2EDNA 4LCYB 2VR4A 2TSAA 1NL0H 1KCBA 3DGGA 4O5LH 1UWXH 2YS4A 3D3VD 2OZ4L 2Z7UA 4LP8A 3MJWA 5JUEH 3SD2A 4LL4A 1CL7I 1SLVA 3KE0A 3U6RA 3GF8A 1M6UA 1R3IL 2P5PA 4MNQD 5D6CB 5C07A 1SBSL 2Y7SA 1L0XA 3PAUA 2X9ZA 1U8QA 5B3JE 3HKFA 4Z7WE 4HD5A 5E9AA 2Q86B 3BHBA 5DEFB 4JRFA 1BEYH 4KQ3L 3MRLB 4TSBH 1CJYA 1XR8B 3L1OH 4P23D 1NOFA 3SBQA 2O5XL 3EJRA 4WK0B 4TUUA 3OLIA 4X9FA 2A6IA 1AACA 1OAZH 4N1CA 3CC1A 1E27B 1SJXA 1MEXL 4HCRA 1LO5A 1A6WL 4MXWL 4PCSA 5CKGA 3FCTB 4BFBD 2VR5A 3JWDL 3RWDA 5EUOA 4JHUA 2AAVA 1M1XA 4H25B 5LN4A 1P5UA 1NMCB 5KYXA 3PAYA 5IHZB 1L5GB 5FW7A 2ZX6A 2C4FT 5E8NA 1U58B 4U1KA 1C12B 1CGSL 1F6AB 3NJMA 3WAKA 3IJSB 2VW7A 5FEBA 1MCFA 5AOKA 4GI6A 3FSZA 5DJ0B 4DETA 3ECBA 4M1GH 4XC3H 5EOCH 4TNVK 4F5CA 35C8H 3KPPA 4W93A 1RP8A 1I9IH 5KWYC 3X11B 2NY0D 5IMOB 3L4TA 4HPYL 3CN4A 1A4KB 3RX8A 4ZAKC 4JFFE 5L4IA 1UD3A 1VCBC 2ZWLT 4HJIA 4FG0A 3HG1E 1IQDA 1NJ9A 4GP4B 3MLWH 4I87A 4OI8A 1JNLH 2DQJL 2HKAA 2AXJA 3B1UA 1HESA 2WP3O 2DYRB 3V0IA 1S8DA 3OAWA 2DB8A 3MBEA 5DYOA 4PRBB 4FC3E 3S4SA 3POCA 5HYQB 3TBCA 1W2KT 5C0NC 3ARBB 3PWPE 3QDGE 2EIZB 4CU6A 1MFAL 3HRPA 2ZXBA 1TETH 2DWDA 2DQEL 2GSGA 4Z0BH 5HHXL 2BS9A 1R3HB 5EU4A 1D5RA 3N6YA 5IMKA 3WMPA 3C09C 1PW3A 2JJTC 3QCUH 1UUSA 3WY4A 4WEMB 4UOW0 3CH8A 4M8QB 1NFIB 4FJ6A 3ZTDC 1LO4L 3HAEB 2O5ZH 1XMWA 2Y9RT 4FCHA 3WY2A 2WWMD 2J5LB 3MRNA 1JD9A 2ICES 3ERXA 1DQQB 3AXLA 3LS4H 3IFPA 2D0GA 1Y18A 3VYOA 2N3JA 1MW1A 4CJ0A 4UQBA 4BFFA 3ZZQA 1KBVA 5HVHC 4I1NB 2XTJC 1RUQL 2Z4QB 1YYCA 3WSQL 1DBML 5HHVL 3QYMA 5CEYB 1XGRB 1TCRA 3FF8A 4CDGC 1HIMH 2ENJA 3QUMA 4EUPG 2FX9H 1UACL 2BZ7A 1OTUC 4KJWD 4Y4HD 2EYTB 1NIFA 2PWHA 5C07D 4HX1B 4A66A 4GKZA 1AS6A 1CDIA 1E9QB 3TBYB 3OGCB 1SZNA 3BDYL 3JSSA 4I13B 4YLQT 5AB2A 4XMLH 4CW1B 2OM5A 2GJ6A 2UXFA 3F12A 2NDFA 4FLRA 4WU7B 5AZEL 2DKMA 1HL5A 3U4EB 1V7NH 5HYFA 3SDDA 4HK3J 3WIFA 2R4SL 1IBDA 2Z0UA 1NGWA 3ZJAA 5GGTH 5F7EH 3DRQB 4GUPA 2ZUVA 3KNBA 3L2NA 2XRAL 4D9RD 5CMAB 4YBLC 3QXUA 3INUL 4AE1A 5AKRA 3IS0X 3OPUA 1QX1A 4HFWB 3B5GA 3JUYA 2GBUA 4PRIE 1QLRB 4XT1C 2J3SA 5KN5A 2WO4A 4YS4A 2BVOB 4N9GB 4OCLC 1WITA 2Y7OA 3LZFH 1BIIA 3QJHB 2I9LB 1FFOA 1CF1A 4PS8A 1IX2A 2Z6FA 2N7BA 2BRRL 3GINA 4N68A 4B5EA 2EUVA 5HP5A 1R5VA 4TXVB 4ETQB 3OM3B 3EYSL 2ITDB 4BRJA 4YQXL 1NFDA 2SEBA 3CN0A 3KLKA 4ZS7L 4LEOA 2FWUA 1CBVL 2P48B 2J71A 2XQBH 5DR5H 2CJUH 2VXQA 3OZLA 2GEQA 2H32B 1WE5A 4OLYL 1C5CH 1XCXA 1OP3H 2QMKA 4KO7A 3QRBA 5KYNA 1HSBA 2NY2B 4JFEB 1D9KA 4Y1AB 2H6UA 4MASA 3D25A 1MJ8H 3QS2A 4DP2X 4JRLA 4AC4A 1YMHB 1JP5A 5FCUL 3L16A 4G6FD 5F0LB 4QHMB 3S8WA 1PTZA 2WXLA 3FFCE 5D72H 5DFVC 3Q9QA 4GO6B 4Z95H 4RGMB 3DUUA 2LTQC 1S78C 4LKXA 3ELQA 1IC5H 1KFAH 2B14A 4LLWA 1JUFA 2EIKB 4K7PY 2W0PA 1RY7B 3BQVA 2ODHA 3F01A 4YPGA 3KCPB 1OW0A 1OXYA 5DS8A 1AR2A 4JY4A 3S6CA 5IWLC 1FORL 3RKDC 1MREL 4P5TB 2K9UA 4YOKA 1H3VA 2V5TA 1ID2A 3UROR 2YD7A 2YGOA 3WTYA 5SWSB 4HGWA 4YEEA 4KMQA 4F2MA 3FB6B 1JPST 2X4SA 1E4XH 5D1XC 3CFJA 1S9KC 3RNQA 1A1NB 5I0YA 2A4ZA 4MFHA 4PWEA 5DUJA 5AWNH 3MQIA 3DV6A 3C5XA 3L2LA 4BV1A 5KYWA 2COQA 5L8LB 1XD1A 2R23A 2YPLE 3UBXI 1JWSA 1UT9A 3QI9C 3VWKA 2NR6A 5KAQF 5KSUB 2BWIA 1KN2H 5HHOA 3PFUA 4JM2A 2EYSB 3QO1B 1MHEA 3Q6FB 3TA3A 3QDAA 4PCTA 5I1EL 4RNRA 3GEWB 5FV2A 5IEHB 5ISZE 2GJ6D 1MHPL 2BNRE 1DJGA 1U92B 1GSMA 1IGIH 2E7DA 3QDJA 5AKSA 2EDOA 2VLMD 5EDSA 3IPFA 2NRDA 3QEHB 3ZYJA 3HFFA 1OGTB 2E7CA 4F8TA 2Y0SA 2FT6A 4GKOA 3QCTL 4L8DB 1F02I 2BJML 4BSJA 4PJHF 4YXHH 4ZQTA 2G5BB 2YR3A 4PGEB 4Y9FA 4FQXA 5IJKA 4L4TB 4PY7A 3ULVD 2ICEC 2CGRH 1UXWA 1YY8B 3P4OB 5DJZB 5GZNC 3IRCA 1ZHNB 2DWYA 3P73A 4IIQC 4FP8H 4YDMA 1EXGA 2G2NA 3E2HB 5CLWA 4X8JB 3N55A 5G4MA 2X38A 3GKZA 2KH2B 3BRFA 3FRPG 1DVFB 4MHHI 4JO1H 4MXVE 3B2DC 1KXTA 4DK3A 2NY1B 5J6HA 3J2PA 1XB3A 3WD5H 2FT8A 2P44B 4CC1A 3CZGA 3QQ9C 4K7PL 5CN1A 3Q2NA 1XTLA 1RFDH 2H6OA 4M7LH 3U7YL 2ZCZA 3K4AA 5HI3D 5A40E 1FDLL 3QXTA 3LHPL 4ZO7A 2D2CC 5KSAA 4RH4A 2CPUA 5D6DA 1NEUA 4PJHE 3VD2A 1XB6A 3NTCL 1WUNT 1C7SA 3OQ3B 4N24A 4AMWA 1CK0H 5D7LA 3L6FA 4DHLA 4GEJA 4J4PD 1J8RA 1D9KD 3BKYH 5H8DA 4JY6B 3FTUA 1VZHA 2XWTB 4A04A 4JB9L 1Z2KA 4NQCB 4YAQB 1FJ1A 1AAJA 3N44F 3SDXF 4RAVA 4YDVB 2VQ4A 3RGHA 4TVPL 4ODVL 3FU6A 1K3ZA 5AZ2H 5F9WC 3KPSB 3E1ZA 3AQZA 3QG6B 3NFNA 3EYUL 3NGBB 4LRIC 2P7TA 4G3YL 5FM8A 4M48L 4MA8L 2NNXA 2FH8A 4JVPA 2ZCLH 2HKFL 4WUUB 2DMKA 5SWZE 1DVUA 4X7SL 5AENA 1FZOB 3U30C 2CBPA 2XT1B 4NCDA 4TVPE 1DLFH 4GW5A 3K2UL 1RUPH 2B0SH 1DE4B 1FL5B 3QUZA 1HYSD 1ETZA 1V7MH 1HSAB 1R0AL 2DEXX 2ZUUA 3ABLB 4OJYA 5E95B 4NUJB 4NNPL 2DPKA 2ZXQA 2VDPH 1DQJB 3HVDA 1KYFA 3TBBA 1P6WA 1TZHB 2OJZH 2QZQA 5C09A 4AH2A 3VWKD 2NR6D 5A7EA 3P9LB 32C2B 2F54B 3NCBB 5HHOD 2FEEI 1ZV2A 2KC0A 4JM2D 4Y2DC 3TA3D 2W95A 3OAYK 3CLEL 1NANI 2PWGA 1EAOA 5ALCH 5C86A 3H3KA 3ZKNC 1J5CA 5IZ7A 3F05A 3OAUH 1ITCA 4X6EA 2J8UB 5DYFA 4BA0A 4MQSB 4ABVA 1YCSA 1BYOA 5DJAB 4IRZH 1OQXA 3QDJD 3L9RB 4WCYL 3QWQB 2FECL 1JPTH 5KBMA 5AW8B 4Y8AA 4NO5A 1UB6A 4X2UA 2DI9A 4KHTH 3AU1A 1JNHA 4NQEA 1RJYA 4HFUH 1BSIA 4U33A 1GGUA 3EH1A 2CDEB 4UV4L 4FQXD 1JZ5A 3OV6A 2CBQA 3WOVA 3VVWA 4RAUA 3LB6D 1RIVH 2EYRA 2NXYB 2QGBA 1KFGA 2VOTA 2EADA 3MGOA 5GHWH 5I9QB 4GAYB 4PRAA 3VRIA 1PYWB 2H2PC 3MXWH 5CCKH 2VLRE 2HG0A 1Y7VA 4WKZB 3L3DB 2YFOA 5JR1H 4X9YA 1UD2A 2ATPA 3CSYA 5D8JH 1ORSA 4DW2L 4N2AA 4ZFQA 1QP1A 4X5WB 1NM4A 25C8L 1TJIH 4XPFH 4H8VA 4GAJL 1A22B 2NLJA 1KPVB 3GHPA 2CLZB 5TF1L 2A9NL 1S9VB 3F7LA 4R2GB 1XGTA 1D5BA 1PVHA 3U4BL 4O02L 5D1ZB 5KSAD 1FYHB 3SGKC 4MCZB 4HS3A 3BAYA 3OTTA 1KIQB 1QLFA 2VDKH 2X5PA 5D4JA 2P8MA 3QRFM 2CCWA 2Y23A 4MJ6B 4OD2B 1HQ4B 5D7LD 5LQBH 3O8XA 1TJHH 3VD5A 4WY7L 4NKIL 3MOBL 3L3OB 2XG5A 3BP6B 4Q9QH 4Z3FA 2RAMA 3IXAA 1FHNA 4DN3L 1B9ZA 4JDTL 1F4XL 1HOCB 2E3VA 2WW8A 1OAYL 3EYFB 1ZAGA 4GNKB 1AGBB 4OAWA 5DRZB 3OSKA 4L8BA 4B60A 4I0CC 3ZW3A 3NEOA 4KZEL 2DTMH 4DOHB 4ZW3A 1DQDL 1FNSL 1TJXA 5FC9A 4XZUB 43CAB 2MSPA 2HX7A 5CHNA 4F2FA 4OQTL 4MAYB 4PJXB 1Z9OA 2BDNH 3C6LA 3T4AA 4JFZH 3T09A 2OL3L 2TAAA 1MCPH 4KKCD 1WS8A 3QUZD 4Z5RA 5LUMA 4UT6H 4Z7VB 3CHSA 2G5UA 2WBJA 3BGFC 4WI6A 1NEPA 2WBWB 4CN4A 3FCUB 1X5IA 5DA0B 3WE1A 1QSEE 4HETA 2IG2L 3SYOA 4P0DA 3RUGE 4L0PB 3MTXA 1ZK9A 5IIEA 1OOAA 4LHUG 5C09D 1U8PA 4NC1E 4XR8C 3EIFA 1GY1A 4FG6C 2AEPH 1GJWA 1MY5A 3GKWL 3OKDB 3MU3A 4KJYB 2WB7A 2ORBL 2CK0H 4XHJC 5KG9A 5JO5A 4KI5C 2FX8H 1QWNA 1BVZA 3LS5H 3HPJA 4R5TA 5H94A 4B95C 4I48B 4YHIB 4HUXA 4O2EA 4XX1G 3MCG1 5FV1L 2DM7A 5I6XC 4P57A 5I1KL 1TMQA 3N1FC 1P6AB 1FVDB 2DQTL 1HXYA 1GRWA 2ZXAA 4TNVF 4NQED 4I7ZC 3BFOA 1H9DA 1ZT1B 5GISH 1MDTA 4M4RA 1BMWA 5LWYL 1NCBL 4AEIL 2ERJC 1NAMA 4N2BA 3IM1A 3HBGA 3LNFA 2Q7NA 1HHJA 1KJ2H 3MROB 4PWJA 5I8KH 1EAQA 1BREA 5DRWA 1A1MA 3LZQA 4MA3A 2X53A 3RX9A 3MGTB 4G11A 3FQ4A 3EXLA 2WSDA 4PW3A 4WO4A 2OSWA 2NZIA 1NGQH 2KQNA 3V4PA 2XQYK 1RUKL 2BNQA 5ALBL 4XP6H 4HC1H 4N0UE 3AU0A 3BOVA 3AY4A 4ODUA 5EORL 4B50A 2DQGL 5KUKA 2WCPA 4PJEA 1XF3A 4RFNC 1J1OL 2QSCH 1T5WB 4X5QA 5FDYA 1KDIA 5GSRA 5LCVA 1GOGA 3HZKB 4L1BA 4L3CB 5E8PA 1EH9A 3K1DA 3N85L 4XBPA 4HIPA 3RWFA 1OIOA 3VI4A 1KYOJ 2F8VA 3BUPA 3MCKA 4R8WH 4Z1PA 5IMMA 1Q9OB 1ZLSH 4DIXA 4GEIA 1AZRA 2YO3A 4G8FB 4P5MA 2CGYA 3UJIH 2EIMB 5ADOH 5K5YA 3QW9A 2BIHA 4D0DA 3K4ZA 1KT2B 2IAMC 5IJVA 4YHOH 1SMDA 4F3FB 1XVSA 2DWSA 2H47C 3MMEA 3WEMA 2IOOA 1OWWA 3FQWA 4HOZA 3GMPA 5GRVL 1S9YB 5ERWA 1LP9A 2A4CA 1NPUA 2YSSA 3GBNL 3E6FA 2DJUA 4LSTH 4YIQA 3AG1B 4RRPG 4LVHC 4NQSA 3C6LD 4J3BA 3OJMB 4N25A 1L4IA 3IAQA 3LNGA 1CDBA 1U42A 1I85C 1EEQA 2HX9A 4N8UA 1JFQL 1MI5B 5CZRA 4AQAB 3M1BA 5E9DA 4AYID 4UMSA 1YPZF 4KGLA 2E0PA 1U8MB 1DSFH 5KBLA 4F8QA 1FZMA 3J07A 3X13A 5KANI 1XGQB 2E8ZA 3MNZB 4NWTH 3EJJX 3MOAH 1X5XA 2ZUSA 1UM4L 3M46A 2ICWI 2QJDA 4IBSA 3CLFH 4OJFL 1PBYA 2DH3A 2BVPB 1QATA 4YHPA 4FFWD 1X5MA 5DC9B 2M2DA 3RBSA 4FQPA 2EH7L 1CE6B 1BZ9B 3FO9B 4JDVB 4PGDB 5KOVC 1KEGH 3VG0L 2QKIC 4N2OA 2ZF8A 1S3RA 2WD0A 4QRBA 5C0CA 4QRPE 4L3EB 4LO9A 1YLBB 4AIZA 2A7BA 5E1HB 4WFFD 1T3FA 1YMMD 2ZWZA 1HWGB 3WFDL 1U33A 2B15A 2WKOF 3T71A 4LHUD 3GSQA 2AMUA 4N2MA 2V5YA 1NLBH 4G6JH 3S3BB 4B0MB 1EXHA 4B9KC 5C3TA 1YPZE 1P0SE 1YEFH 2F61A 4ELDA 1YDPA 4ELMF 2J6WA 3C8DA 3WFHB 4MD5A 3P69A 3TN0C 1M9SA 2WUBL 4PJCA 4XNAA 3HS0B 3K72A 2R1YA 2OP4H 3QIWA 2A0LC 3V4UH 2QFPA 1W72A 2DWXA 4CJ1A 4WO4D 1RP9A 2EILB 4YSRA 2IXQB 5K59E 1T7ZA 2AK4E 2RTTA 4IGBC 4IS6A 3KLAB 1WWBX 1KSRA 1KV3A 5F71A 2FT7A 5IG7B 4OCRH 2CUHA 3W0WA 1P4LB 4POUB 5F7DA 3CE1A 4KVCH 3WTWA 2JKNA 3PYCA 4BFNA 3FO0L 4ELME 5J89A 5BRPA 1BVNP 1DEDA 4FJYA 1N7ML 3K5SA 1TTAA 2OK0L 1F86A 3MUUA 5CAYB 5IBTH 2KL6A 3LPWA 3CVHH 4XOBA 3FO1B 1NEZB 4U1GB 1O9ZA 1LO3H 5AW5B 5SWSE 3D1MC 5I73B 3L5XH 2F68X 3QHZL 1JGUL 3PHOA 4NOFA 3CAFA 3SYPA 2D31B 2OXHA 4OD3H 1U8OA 2GTZA 4ABUA 1V3LA 1LWHA 3SKOA 4QUOA 3TA4D 1RHHB 2X4TB 3QYCA 2X6MA 1GA2A 4LSQL 3V0HA 2OZ4H 3GSOA 2XHNA 3FOLA 3VD4A 3HE7B 4JRXB 1L9SA 5IJBC 1QA9B 4YH6A 3TO4A 5C0EB 4Y5YC 4ZMWA 3WJLC 1NGYB 1WAAF 2PP9A 1SBSH 1CD8A 1PDKA 1OARH 3D8MA 2VDLB 2XXGA 3HI1A 1PG7L 2JJSC 5EBLA 5E9DD 3VGAB 2ZICA 1MFDL 1PZ5B 2VDRL 1USZA 3K7UA 4JO5A 3UPRA 3FUIA 3H53A 4KQ3H 3IJYB 4X7TB 3FZUD 3NZ8A 5BZDB 3UP1A 4PRNA 1F00I 5B1BB 3ZO0A 4L4TE 1JE6A 1FO0L 1ND0A 3ULAB 1JTTA 3R0MA 2FGWH 1TQBC 5IY5B 1HDMA 2GABA 4G1EA 3CC5A 4N22A 2NXZC 4MXWH 4ODHL 4M43L 5HGAB 4MNGB 3JWDH 2ZPKL 2V2XB 2DJSA 4LP5A 4GBXA 1WAAE 2VAAA 4JFTA 4P2RB 4TLSA 1NDGA 5C0CD 3RPIA 1ECYA 2QQQA 5AB1A 2BIIA 2L7JA 2JK5B 1PKQB 1CGSH 4CSSA 5CP3H 1F4YL 3O9WA 5KVDL 4E41E 2WO2B 2K4AA 2QADB 2YAQA 1F3JB 1U3NA 4KROC 1S7VA 3IGKA 1H3GA 1AQDB 1LEKB 4KRLB 4WSKA 4A63A 2LFGA 4R97B 1JIBA 1MIML 5FO8A 2EQDA 2IOIA 3MV9D 4ADJA 2YLHA 3VFPB 2ARJB 4PMFA 1QOKA 2X09A 2F9BT 3CFEA 5E4EC 5KVDE 5CU5A 3S3JA 4Z3JA 3QIWD 3K8KA 3QFGA 4K5PA 1K5NA 3FXIC 3CFMA 2B16A 4PU2A 1ZS8A 3K6DA 4MJIE 2DQJH 4NPJA 1KTCA 3ZDZF 3PCYA 5TH2A 1OGAB 3KJ4B 1SJVA 3C2SA 4AM0A 4AMKH 1XGUA 4G1MA 1FG2B 4ZK8A 3JBG7 2WLIB 3OXRA 4JREB 3DUHA 3MYJA 3W0WD 3QQDB 3CDZB 3GSNB 3IMSA 4U6YB 2DQEH 2PYEA 4HHAA 5GS1B 5HHXH 2VGLM 3KPRE 4I4WA 5GRYA 5HHMB 1PAMA 3OJDB 1QRNE 3BI9X 1UT1A 1LO4H 3NPZB 4FNLL 1KJMB 1MWOA 3R7RA 2GTWA 2J1WA 4TNGA 1MELA 1NTDA 1PSKL 4AMXA 1WZMA 3ZDZE 3B2UD 3UPCA 4F93B 3P4NA 2WMPB 1RUQH 2R2HA 1T1WA 3FT2B 2ESVE 4URTB 3T4YB 4EBQL 3WSQH 1DBMH 3QIUA 2APTA 3PL6A 3KPMA 5KBPA 1HL9A 1W8OA 2WANA 4LLAA 3TVMA 3I9PA 3TO4D 1LJMA 1UACH 2WLNA 2ADIB 4LLUA 4OZIF 3BDYH 1HS6A 3OVUB 4AV4A 3CSBA 2Y1VA 1R19A 5AZEH 1EUTA 2H3NA 2R4SH 5TDNB 3PWJA 4UINL 4JDEB 1NWPA 5I1AA 2JI3A 2XRAH 5CINL 5ESQB 1ZTMA 4IKLA 1SOXA 3K2KA 3F5WB 3INUH 2VDQB 1W0VA 1O6TA 4UMGA 3POHA 4Y19A 3SSGA 2XV6B 4APQB 2DLGA 4MCYA 4N0RA 4H88H 1JGDA 4UZUA 3WJJA 4G7VL 4NQDD 1BVOA 1CTMA 5B1AB 1KTDB 2GT9A 3IU3A 3MRKA 1EDQA 4LVEA 1AQ8A 3L3HA 4OZIE 4R84A 2BRRH 3O9WD 4UOW1 1A3LL 3N3EA 4UQ3A 3ABGA 4BWUA 5I1GL 4CMMB 1A21A 3EYSH 1H15B 2JQAA 3T77A 5HYEA 3W5MA 1QFWL 4YQXH 4PJXF 4RMVA 5BW7C 2IV9A 2W59A 3EBAA 43C9A 5PAZA 2NX5E 3C8KA 1YNKL 3QEQB 2B8OT 1IAIM 2F5AL 2ZWKA 3EOAB 3MUZ1 1AYRA 4LCUB 4CC0A 5CIPH 4DZBA 5L9DL 4Z7VF 5GGRY 1MXDA 4JZOA 3H0TA 3FB5A 3SCMA 3U9PL 1UJ3B 4KH2A 3RX5A 2P43B 2J4WL 1SYSA 3AAZA 2BVQA 5FCUH 3T3MB 1I82A 3UZQA 2D03H 1HL4A 4JQVC 3OKOB 5JPMA 2VXTL 1BM3H 2Z8WC 4I0PB 4JKKA 4QT5B 4A6YA 3WTUA 2WWMC 3P11L 2A74B 1GR7A 1HHHA 4X6CA 4JHWL 3UG4A 3M17A 4E5XG 3T0DA 1E5YA 1FZJB 3BX7C 3QULA 1AXTL 1LDPL 1B4JL 1VKXB 3H6AA 2FUTA 3WNJA 3U0TA 4PH8A 1FORH 3LSOB 4XNUL 1MREH 4DWHA 1L3WA 2P8PB 4P48A 1DR9A 1AQHA 5AYUL 4Z7VE 3IKKA 2P8LA 2X10A 4KJWC 4Y4HC 3KVPA 1LQSR 2XZCH 3MNWA 1CC3A 3UAEA 3F65A 4X5XB 3TTYA 5DK3A 1MQ8A 2PPEA 5IQNA 5DJDB 1J87A 3IVKB 3S96A 1FZKB 3EGDB 5IMLB 4X9GA 1LO0L 3GK8L 3PL6D 4JQXA 3SGDI 5AD0A 3UBXA 1ASQA 1I3VA 3FUDA 2XV3A 4N26A 3GI9L 2CSPA 2DY2A 4UNIA 3BUDA 5GRXG 4PS7A 3TV3L 5I8EA 1EO8L 2B7DT 1KGYE 3QUKB 4ENED 5AB0A 3O41B 5FAAA 1QEWB 3KXFB 4OZ4B 4KDTA 3HS9A 4TNWF 3LQZB 4AK2A 4A7GF 3HLKA 4ANUA 4MHHG 2K3TA 2A99A 3KL5A 5HJ3B 3QCTH 4LHJB 3WCYA 2BJMH 4NO2A 2A9CA 2VH5L 5E23A 2FCBA 4S0TD 2WVSA 3QQXA 4GINA 1YEGL 2R2BA 4ZDHA 1IVTA 2XQ0A 1G7PB 4X98B 1ES0A 4YLCA 3STLA 4ODSL 3T0WA 3U4KA 4H8HA 5DJXA 2PLTA 4FXGC 3BQUB 5EFIA 3JWNG 4R5VA 2IDFA 4QRRA 3FQ2A 3FTVA 2AW2A 1XR9B 4PHZA 5DJ8A 1CU4L 2CKBH 3C8HA 2X1OA 4K7PH 4LSVL 4E9SA 1M71B 1KCSL 3H9YA 3RPBA 3U7YH 1I8AA 4TQIA 1FDLH 4PJBA 1CXKA 2J20A 4NM4L 4TM9A 5LXVA 5D1XB 4PWIA 1JV2B 4FABL 4H13C 3RFZC 3W2DL 4ZO9A 5HY9B 4N1HB 2OBGA 3V0WL 1KELL 3MUHL 4L5FE 4P3WA 4PREB 3JV0A 3NFPB 5EN3A 4E36A 2A9AA 3I74A 1ZVHA 1QRKA 3SCMD 2BP5M 2NTFA 4FFZL 1RK1A 2HAZA 2UWEA 1ZIAA 2X70A 1PD6A 2LQRA 4P46B 3RZCB 1HWWA 2YLKA 2WLZA 4IHOA 4ODVH 4TVPH 2Q5BA 5E8OA 1INDL 1CD1A 3EZJB 4NCC2 1Q0XL 3HCVB 1F4HA 2X28A 4G3YH 4A39A 4M48H 4MA8H 2JCCE 3UGXA 5FYLH 2BCKB 3G6JA 5JYLA 2CO6A 4Z7UE 2XVLA 2HKFH 3KYOB 1JWUB 4X7SH 1JNJA 3DO7A 3HLAA 2AV7B 2Z93B 4K7FB 3G04B 1P2CA 2JF1A 1UWEH 2E8YA 4L4VE 3K2UH 4Z3IA 1ETJA 1J5IA 1JZ2A 1IBFA 5INCB 4R0LB 2I25N 4XX5A 3MRQA 1ODAA 4MMYB 4G42B 3IFOB 4EVNB 4NNPH 3JTSB 2NY5C 5B39A 3MV7E 3EZ8A 3K2IA 3QZWB 2WQVA 3TEZA 4GY4A 4M3JA 4TL5A 5AUMA 3CLEH 4GIPD 5K9KA 5FF6A 1CDHA 2JWYA 2XG4A 1QFOA 3GSRB 4ZOCA 3IDJB 4LGPB 5E70A 5ICYA 4L3EE 1L6PA 4S1SL 4F57H 1NCNA 4LCWA 3DMMA 2W88A 1H19A 3D85A 2XSKA 3ULVC 5LGKA 4WWID 3AG4B 1YEJH 3U79A 5B4MD 3UAFA 4WCYH 2WTRB 5DHVB 1BD2B 1ZGLB 3FNKA 2FO1A 3UTOA 1BQHG 7CGTA 2YUZA 1KLFB 3ZE2B 4XPTH 4UV4H 3EF4A 3EO1A 3VJ6A 3QZPA 1HCZA 3VMNA 1JPGB 3H9HA 4HBCL 4JHBA 1ANUA 5KOMC 3LRGA 4GB9A 1T20A 4FNQA 4DCQA 1IT9L 4OBRA 3DTDA 2YRPA 5D1ZI 1LL1A 3M88A 3EH3B 1ROCA 4QRRD 5DK2A 5FHBH 3OB0H 2AJVH 1D5XB 4DVBB 4DW2H 2IO5A 3IBOA 1ZSDA 1UCTA 4OQ1A 3TNNA 25C8H 4L8SB 2FEDD 4KY1L 3OKKB 4J4PC 3EUDA 5TF1H 3CPLB 3DVNB 3QIBA 4LESA 1KGUA 3BWZA 4U7KA 3WO3B 2C3VA 5E2TH 5I19L 4O02H 5SX4H 4AZ8A 1SN0A 2X9WA 5GGQL 3HPLB 4ICWA 3LH8A 4LLMA 5J56B 1TQWA 2ARWA 3WGVB 1QW8A 3SGEH 1E0OB 1QLEL 4NKIH 3BAEH 4QTFA 1WCQA 4MNHB 5F9JB 4DN3H 5D2LF 4JDTH 2EEAA 2YOCA 4UM8A 1OAYH 2L7UA 1DQVA 2BLFA 1OM9A 1CFSA 2MKWA 3VXPB 4Z78B 2AV1A 3JV4B 4JRXE 4KZEH 2C34A 1CYWA 4WDIB 4XC1L 5C0DA 4A2DA 4OQTH 4EN3B 2KLSA 1YUHA 3MJGX 3QDMA 4BK5A 4ATTA 3D08A 2R1XB 3MBWA 2OL3H 3GMQA 4G8AC 2HVJA 1FVEB 3B8SA 2NR6C 3VWKC 2MIZA 3M7OA 2BSTB 2LR4A 1KBBA 2XWZA 1HN1A 2X4RA 4MAUL 3I50L 4NKMB 1EUUA 4OZFG 5TPWL 2XIDA 1SY6A 2LLLA 3EJCA 4LBEA 3ARZA 4KU1A 2IG2H 4M93B 4M8UA 4QAMB 5D2LE 3SOTA 2ATKB 5ES4B 2K9FB 3NCYS 1MFCL 5KAQG 4LNRA 5LB1A 1K5WA 5DWUL 4NDMA 4C47A 2VLLB 1MY7A 4PIBA 4GRLA 3QRGL 5C0GA 2PMZA 3LNHA 4DN4L 3VW3H 4KXAA 2ORBH 3KPOA 4P2RE 3ALPA 1JCKA 4X42A 3NJXA 3EF7A 4LCWD 1JHKL 4FQXC 4N6QA 4BSWB 3D85D 3B7RL 4WW2C 3SDYL 4AE0A 3LB6C 5D1QB 2APBA 5BS0E 1TFPA 1NGZB 3IBEA 3B9DA 4WI0A 1MWAB 1UH4A 2XBTA 5C08E 5I1KH 2FL5A 3IN0A 1VERA 2DQTH 2WQRA 4H5SA 4YC2C 1U8KA 4IMLA 4YHKL 3BZEA 4MJ4A 4MQ7B 3MJ8B 1JZDC 4OVUA 5D7JA 1TTCA 1V05A 1NCBH 4B3VA 5LWYH 4FNUA 2JI2A 1G7HB 2AXFB 2H0PA 4GXVL 4NZFA 4DKDC 5BV7C 1BX2A 1NBZA 1ZHLA 2YARA 2BXZA 1G7IB 4HZAA 4L18A 4GUCA 2UUDH 3VFMB 1XIWA 3MFFB 2IH3B 2UXVA 4PJ7B 3R18A 3AREB 4GIAA 5D4IA 5CGBA 4NI6A 4RRPM 4B9ZA 1BOYA 5KSAC 3DK0A 2JKTM 2QKSA 1XFPA 3KW7A 5T3XL 5E6IA 3NZHL 4N2KA 1RUKH 1S9XB 5ALBH 3MRGB 1EXUA 3GSWA 4FZEL 4G8EA 1EEYB 1SLWA 3HAEH 3O2DA 4HISA 4XTRD 4Y9GA 5EORH 3VXUE 4H20L 4GAAA 3OR6B 1J1OH 4PPTA 1GMEA 2F53E 2CJ3A 4QXGL 2WINA 1WBYA 5ITFA 3PXJA 2HLFD 4KBPA 4MTMA 5F96L 5T3XE 2EDJA 4IOSA 2DQIL 1G4MA 1I7UB 3O4LE 3QE5A 4IJ3B 1FFPB 5TDPB 1MVUB 1U8IB 1GVIA 2I07A 2I5YL 5F3BB 2YKLL 3L1EA 2DOCA 3O4OC 2G2RB 2EDBA 5T1LA 1IAOB 4EDXA 4K3GA 4PGBA 4BA8A 3BKJH 3BH9A 5JW5A 1A47A 2J57A 4G5ZL 5I71C 3QUZC 3T1FA 3GBNH 5KANG 1MCRA 3IJHA 3PFQA 4ZUWA 1P1ZB 1WUZA 3MKKA 4BELD 1U91B 2EP6A 4GG6E 1XZ0A 4MXQD 1A6AB 1WRFA 2YHGA 5CCJA 3FHQA 1CZ8H 1YJDC 5D4QA 2V37A 1JFQH 5ANME 1VA9A 1ZDSA 4Q2ZB 3RL2A 5CEXA 5EU5B 2JNZA 4G8IA 4YHMH 3LZNA 4HOMA 1OK8A 4Z8FL 4K8RH 3CCHB 4LLYA 4PR5B 1K4CA 1UM4H 3PQYA 3OKLA 4AEEA 2ICWA 4OCNC 1M53A 4OM0L 4OJFH 4X0KA 1OP5H 4PJ9B 3UBHA 1X5LA 3V0VA 4GRLD 3P40A 3KYKL 1ONQA 4X50A 3FB8B 1M7IB 2EH7H 3ARDB 5BJTB 5DJ6A 3OQRA 3O3AB 2DIEA 3VG0H 3BH4A 4OZHA 3ARQA 1HL8A 2OI9B 3D0LA 1A1OB 1SHXA 5HYSG 2H32H 1WA1X 3SE6A 4OY9A 3N43F 3WFDH 3AT9A 3I02A 2EXSA 4ELKB 1HWHB 3CX5J 2NT0A 5DMJB 1HH6A 5T8IA 1ZLWH 4A2LA 4DGVL 6FABL 4YE4L 4F7EA 3VXRA 1WCBB 4AGLA 3WL9A 3AS0A 3HRZC 1K85A 1JBJA 2BK8A 1P9MA 4AW7A 4OV6F 4NN6B 5MENE 2WUBH 3HC4L 3T3PB 1CGUA 1IC1A 4I9XA 1XIWD 3QR1A 1TYEB 4OLZL 2A6DB 4U1MA 3ESUF 1TQSA 4PY8I 3TZVA 4QY8A 5F3HA 2XPZA 2DBLH 4AQEB 2Q87A 1IO4C 5LO7A 3OZKA 1MW2A 3ASNB 2Z31B 3W9EB 1HAWA 2BMKA 2AXGA 4Z7OB 4NUQA 3L4YA 3O0LA 3AADB 1WBZB 4UQ2B 1XL4A 5A16B 4BFRA 5IB3B 1FH5L 4K94C 3RWEA 3KPLA 4AVKA 3C5SA 1KBWA 2E47A 3FO0H 4IOSD 4JE0A 3S88L 4JO2H 4EI6A 5E2UH 2QELA 3T0BA 4LCYA 5ID0A 3MKGA 2R69A 1EGJA 4FMKA 3AROA 1R24A 3EO0B 3LKNB 1FHGA 4PLOB 4YUEL 1MQKL 3BC9A 3MGAA 5KYYB 3EOBB 3QHZH 2I9TB 4PSPA 1JGUH 3NK3A 5T1LD 4HSQA 3CQFA 2IQAB 3C6LC 1Q1PA 5F0PB 3IAGC 1P5VA 5KS9E 1UVQB 5F1KC 4LSQH 1EK3A 1ETB1 4I9WD 4JRYA 5F6HJ 1XCQB 1NPNA 2ZQKA 1JXDA 2YMTA 5IOPB 4HJSA 3ENEA 1XR8A 2JELL 4FFYA 3QK0A 4FLHA 3VSTA 3ISWA 4IOIA 5C9KA 4XVJH 4M5YL 3UTZB 4Y5VB 3WLBB 3BVNB 2YXFA 1B2YA 1WICA 1PG7H 4FFWC 5JIDA 1MFDH 4P2AA 1AZZC 2VDRH 1IGJB 2R0KL 1E27A 4AYSA 1HX0A 1T4KB 5ID1A 2Y3NA 3BP5A 2AEQL 2OMTB 3RVTC 4H25A 5J13C 4IGBB 3PQYD 3C5JB 4M1CD 5DURD 2KT6A 5EBWB 4KXCA 4XNYL 3ZTEA 1HQRB 3TEYA 1UTDA 1BPLB 1FO0H 1VJSA 5J6SA 3F3HA 1YY9C 4HCIA 4Y4KB 4ODHH 4M43H 4U1JB 1A8ZA 2D2OA 2ZPKH 3AQXA 4N2IA 1CXHA 3QCVL 4Q7DA 1G6RL 3F7PC 4WV1C 3K80A 1RURL 5HVGB 3IYLW 4J1UA 4W81A 3MRJB 5F89A 1I7ZB 2P9RA 1GAFL 1F4YH 2FUQA 4M6OL 4UI2A 5KVDH 4KNTA 4U0QB 3BD3A 1UKQA 1KTKE 4RCAA 2NUPB 3RQ3A 2BM3A 1MCHA 2H1XA 4HIIB 4HUMB 4NQVB 2ZKWA 2AKRA 3Q48A 3ZRFC 4KO5A 1MIMH 2R15A 5D1XE 2ICWJ 4JQIL 2GBTA 3VYPA 3QQ3B 5LAPA 3HAEG 3FFDB 1DQIA 5A2LH 3TIDB 2JIXA 1XF4B 3PNWB 4HWZB 4P2CG 4PJ5E 2P5EE 4Q4EA 2WWNA 3TZVD 1NICA 1MH5B 4F37K 5LG6A 3G5VA 2V7HB 3A4EA 4TULL 3HFML 4OV5B 2GUOA 3NRFA 2NNFA 4QRUB 3N1PC 3QO0B 4FOMA 4QHNB 1ET8A 1Z9PA 4IKNA 5HYJA 1DJSA 1U4FA 3FN0H 3QS3A 4LPUA 3LMJL 4AGMA 5KVGL 1OSEA 3M8OH 5CD3A 1XT5A 3NP3A 4UDTB 4TV3A 3V0JA 2D8KA 1WEJL 1DQQA 3BLKA 4MRCA 5F7NC 3T6QC 4OGYL 1Q9KA 3MJ9H 1CB4A 5DVKA 2E76C 1ZVSB 3NDYE 4NXSA 4QHKI 4BH7B 2VN4A 2DD8L 3LXUX 1S9WB 1XTMA 4PJFB 3KLSA 1S6NA 4FNLH 4F91B 4KNSA 5CJXA 1GL4B 4RX4D 4HJGB 4QHUB 4XN7A 5DT1L 1PSKH 2OMVA 1JRHL 4HSCX 1QR1B 3EOYG 3FUMA 3ZE2F 4DTGL 4WEUD 3ZTCC 3BN9D 3BPNC 1WP6A 1DN2A 1N2RB 4BZ1A 2C9QA 3ZDWA 4EBQH 3OGCA 4PWHA 2ZG1A 1U93B 4TNFA 5H37A 5EWIL 1KLUA 2DM4A 4KKAD 4RISL 2WYZA 2NY4D 1FYTB 1MAML 3UTSB 3FZUC 4YSCA 2H9GB 3ARYA 3HI6H 1BQUA 2NNRA 1JF1A 4FEMA 5FB8A 3JYCA 4U1LB 1C08A 1JVKA 2V3EA 1DUZB 2PTUA 4HS6A 5CMAA 4X6DE 1HHGB 2OSLB 5C97A 1U8HB 3DX9A 3GMLB 1QFUL 1BD2E 1NAKL 1R17A 1SBBA 3OLDA 1EZVX 1T04B 3LEVL 1ITBB 2NZ9C 4N9GA 5GRUL 1FRGH 1SUJA 5CINH 4LCCA 5L2KB 2FO4A 1J0IA 4ZO6A 2WNKA 3WTSA 4I3SL 2Q9OA 3IDUA 1CICB 1T4WA 2MOGA 3FT9A 4M9PA 4ETQA 1VIWA 1T7WA 4L3AA 2ITDA 5E5UB 2O5NA 4G7VH 4DUXA 4NKOB 5GGSY 3TV8A 1IGML 1SHSA 3QJFA 4F8OA 3KHQA 5JIHA 1M42A 1IJNA 1GIGL 1IARB 3SE8L 2CALA 4XPHL 3D3VB 2C3HA 5I1GH 1PMYA 4X5PA 4IRJA 5GSVB 5F7FA 4PRPA 5I5IA 4JFEA 2JKSA 4MNQB 1PFCA 3CLWA 4JPWL 4M8VA 3BKML 4ZMOA 3I6KA 1YNKH 3LV3A 3QC5X 4JG1L 3BUBA 3BUYA 3RFRA 1WHPA 3TESA 4K5NA 3OX8A 15C8H 4GLRH 3ARBD 3DA0A 1I7RB 2X4PB 1MW3A 3U9PH 4FQIL 2OW6A 2WQWA 4P23B 5F9OL 4IU3A 4C56B 3KCPA 3II2A 4UDUA 1J48A 2J4WH 3T8XB 4WNSA 3JT0A 1B4RA 2VXTH 1FE8L 1DVSA 1MFVA 2VJ0A 4GW1B 4X4ME 4NIKB 3P11H 3VXMB 2XBZA 5DHYB 4UZGA 2FTAA 4JHWH 4MBOA 4J8RB 4WI9A 1AXTH 1E5UI 1LDPH 2BP0A 5EHFA 4BSVA 3B9AA 4JK0D 5CWSA 5F1NB 4X4KA 1JYWA 3ZL4L 1A1NA 3QNXA 2DMCA 2LU7A 5AYUH 1NBVL 3SYCA 3RY6A 1S7RA 3TO4C 5DTFB 3S34H 2EYSA 3QO1A 2NY0B 3GJEB 4MQXD 3BZFB 1WWAX 2A5UA 2FIRT 5IGXL 2F7OA 3CDGB 2L8AA 1UZ8A 5IEHA 1NCAL 3D09A 3IDNB 1LO0H 2O1AA 1A4CA 3ARTA 5JIIA 2W5PA 3P3SA 4PJ7F 5EIIA 2K6WA 1U92A 2YA0A 1HZHH 3IJEB 4FXLA 4WSJA 2XBDA 3GI9H 1HI6B 4DP1X 1UFGA 5HGBB 4TRPL 1AJ7L 3TV3H 1OGTA 1EO8H 5K1NA 3VX1A 1T83A 5I17A 1N10A 2H1PH 4KX7A 4X9HA 3UBFA 2Y7LA 5EBMB 2QQLL 1E8WA 3QWNA 3JT2A 1RPQA 3LKPA 2MHAB 4AYMC 5DJZA 3P4OA 5EOCJ 1ZHNA 1PZSA 2JQZA 2UY7B 3GSXA 2WY3B 2R29L 1CG9A 3BESR 3DX6A 3PWLA 1LXMA 2FLBT 1JPSL 3VGHA 2N01B 2VH5H 3P3YA 5JIQA 1HT6A 3BVUA 2DYSB 3GXNA 1YEGH 1S7WB 2F7QA 3DWTA 3F7QA 3SDCA 4XE5B 2VERN 4Y5XC 5D7IB 2PYFB 4N86A 2N59A 4PB0H 4YSOA 1KC5L 3SKNA 4QCIB 4B9CA 3OR7B 2E74C 3DRTB 4Y7OC 5LAXA 3TNMB 4KI5F 3UG3A 1DFBH 3T8MA 4D9QD 3DGGB 3MUJA 4PVMA 3ZT7A 1T7YA 5E5MB 2WN2A 2X9XA 1B2WL 1CFMA 1CU4H 2LHAA 4LSVH 4L5FH 4IRJD 1KCSH 1TQCC 3HZ3A 4PRHA 4PRPD 4C4KO 2NY2D 4JFED 4H8WC 4Y1AD 5K9OB 1WAEA 4NQXB 5C07B 2XIBA 5TDOB 3TASA 2DIJA 3FU7B 4G9DA 1U8QB 4O51A 3W2DH 4NQCA 5LGJA 3NIDB 1VFBA 4NQUA 1KELH 1YAZA 4YDVA 5AAMA 3UYPB 3BHBB 1E9OA 3WN5C 2QDWA 5D70L 4YHYB 1WH0A 4BUHA 1X5FA 4A7TA 5BMFL 3JVFC 4UQ9A 1FV1B 4FI6A 4FFZH 2IH9A 4QTHA 1BP3B 4DO5A 2BHYA 4KI5E 2AJ3B 3D7PA 2CQVA 3V9EA 2VL5A 4NUGH 3GJFH 2IC2A 3P4LA 1L9MA 4HU2A 1SGKA 1INDH 2O4EA 1LO5B 1TYRA 1FL5A 3D2UA 3CFDB 2OMYA 3RWDB 5EC2A 4OW6A 1M1XB 1P5UB 3VXNB 1ACYL 1HSAA 5KYXB 1HJCA 2VJ8A 2CRZA 4YDJA 2HPTA 5E8NB 1EIBA 4U1KB 3VGGA 1DQJA 3FU8A 1TZHA 3PL6C 4HALA 4NKDA 5F8RC 5AVXB 2CDGA 2G60L 4NN7C 3P9LA 3VCLA 3KPPB 5L6YL 4F7CA 4DP7X 2XN9A 4K3JL 4ES8A 1U0QA 4JGUA 3UCQA 1RKRA 4ENEC 3MRDB 1GYCA 1YVLA 4ANXA 2Y69B 3R0NA 3MV8A 3T3PF 3AQYA 1IQDB 2Z65C 1HNYA 3QPKA 3P0VH 2YC1B 5DFWH 4LVNB 3GYRA 2C5DC 1S8DB 1IVLA 1QBML 1CXIA 2AQ2A 3MBEB 5DYOB 3REWA 1L7IL 4S1SH 4LLVA 2X89A 3PPSA 3ZOAA 2AI0H 4GJTB 3KBHE 4ZOAA 1G43A 2VXVL 5JYMA 4IBUA 3T0EB 5I0XA 2X0WA 4KNQA 4K9EC 2GSGB 5T5FH 5DGQA 1EZSA 4GAYA 2ADFH 5FGRA 4IHBA 1KGIA 1MCWM 1PYWA 1S4IA 1TF4A 1BZ8A 5IMKB 3TPKA 4WKZA 4U1HA 1DVFD 4CBZA 2ID5A 1QYGH 2ZAHA 5LJYH 4HBCH 4JG9A 1Z5HA 2O30A 3T3PE 2H6PB 3FO2A 3SDCD 3HBZA 3MRNB 1OD9A 2EVIA 2RMNA 1CDUA 3AXLB 3PY9A 3IFPB 1Y18B 1KPVA 4HKBB 1S9VA 3VFSA 4GRWB 4QNPF 5MI0C 2P5WE 4K71B 4F9PA 5DC4B 1T7VA 4MCZA 4LSPL 4FULA 1QUPA 1TCRB 1MJ7L 2VRKA 5C3IA 3QUMB 5IHHA 4KY1H 2DQ6A 3CHRA 1FWXA 3SCMC 1W15A 1M7DA 2R0LL 1KGJA 3PE9A 4GKZB 2EO9A 3FYIB 1EA9C 2FJHB 2V7NA 2M83A 3ES6B 4TNEA 3VUAA 4F24A 1INQA 1IC7L 4NQCD 5GGQH 3ML9A 3WY1A 2GJ6B 2C9RA 3F12B 1SXBA 3G3LA 3OHXB 1KTLA 4DKTA 3KPSD 1CDJA 1QLEH 3SDDB 1FAIL 3WIFB 5CSZA 3VFRA 3DOIA 5B8CA 5JW4R 2BRQA 4KOCA 4GUPB 1HAUA 4IRZA 4J28A 4KK9D 4LPXA 3VM5A 1IZKA 4WUUD 2V9TA 5H4YA 1WLHA 5KVFL 5LVEA 1EHKB 4U2ZA 3UYOD 5JHDA 2DQMA 3MYZA 1IZJA 5D7SL 3N40F 4UTBL 1G87A 1JVLA 2ZJSL 2XTSA 5F0MB 3BPOC 2PETA 3D2UD 5KN5B 4N2EA 4M1DL 3DUSA 5MERA 3H9SB 2C9PA 5EDXA 4HUNB 4J2XA 4HKXA 3G6AA 4KDVA 5KVFE 1KWGA 3PDGA 4JQXC 4ONGH 1R5VB 2OYPA 2ZXWB 1JVOA 1H6UA 4WLCA 5F2FA 2F54D 5TPWH 3I50H 2RIKA 2XN9D 2ZYSA 2YGNA 4L9LA 1BBJB 3GMOA 1YHPA 2ENYA 1ADQH 3EGSB 3VD9A 1RK7A 3OAZK 2ZOUA 2PTVA 2H8PB 5ICZA 1MFCH 2R8SH 4ZPTB 3MV8D 5DVPA 3OPZH 1Q94A 2VERA 2JTYA 9CGTA 3V6FA 3DIFA 4HHWA 3SPIA 2X2JA 3D4CA 4MZ2A 4YHIA 3QRGH 1D9KB 4JG0L 4X6FA 3D25B 3VFNA 1WD9A 3GRWL 4LFHG 4DN4H 1FVDA 4N0FA 5CEZL 4KAQL 5J1TC 2X89D 2WZ5A 4S10A 4G71B 3SDYH 2N1KA 4BCZA 4KTDH 3DUUB 1DTUA 2NXYD 3ZGIA 2PO6A 3MROA 1JUFB 2H45A 4NIYE 4ZTPL 2R1WB 4GMSL 2WOYA 4YHKH 4YPGB 3U1QA 3RVXD 5CEZE 5IQ7L 1KB5L 3MGTA 4LDLB 4IYKA 1YEIL 3QZOA 2CBMA 2JJUA 2E46A 2GYSA 3QWOA 4GXVH 4N28A 2FEDC 1SYVA 4HGWB 4XP4L 2WXGA 5E2VL 2D3NA 1RVFL 4F2MB 5E1IA 3O2WL 2X4SB 4R2GD 5AL8A 1OAUL 3CFJB 5E99L 3FPYA 5HPOA 1DJYA 4L3CA 5D1ZD 5T3XH 1AKPA 2J73A 2OMUA 3NZHH 3DV6B 3QFJE 5KYWB 3FW6A 3PGDA 2R23B 4FZEH 5DMIL 1JWSB 5BUGA 2W92A 3JWNC 4HPOL 4X5LA 5AVUB 2XN1A 4H20H 3X14A 4JM2B 3VXSE 1O5PA 3TA3B 2FSDA 2VXSL 1DCLA 3UEZA 4DPAX 3ZVVA 4AV0A 1RQ5A 4QXGH 4RNRB 1C5DA 4S1DD 4UBDC 4X9IA 4YEFA 3TJPA 5F96H 1KT2A 4MLIA 3OLEA 2DQIH 3RA7L 4F3FA 3DO4A 1E2WA 2CM6A 2XKSA 4GQRA 1MFNA 1R4XA 3D2TA 1KGCE 1VEPA 4LOEA 4YGAB 5C0AE 3AM8A 3KGSA 5EH1A 1S9YA 3QDJB 2I5YH 3M07A 3APNA 2XQYA 4Z3TA 2YKLH 3FSAA 4U1IA 4CSTA 1XF2A 4L29B 2BSBA 4N2FA 3IMBA 1HZKA 2DQHL 5JHDD 1ZANL 4XBEL 1UXWB 4DH2A 5IHWA 4I2XB 3QJOA 3LOWA 3BZ4A 1E67A 4NT6A 4JUSA 3UTSE 5AOMA 1AZCA 1N4XL 4JKPL 2YK1H 4G9FA 1MNUL 3VDAA 3D18B 3WU1A 1T1XB 2OAAA 3D39A 1ECZA 3BYYA 1INEL 4FYQA 5J6HB 1J8HA 2RALA 2VDQH 2VLJE 4P9HC 3H7BA 1EANA 3QJXA 1BXXA 1TZIA 5DRNA 4Z7IA 3QR0A 4HC1A 1WO2A 4XAKD 4FI8A 4EI5B 1CE6A 2WJ5A 3FO9A 4HZLA 4N3UA 4PGDA 4JHAL 1OCCB 1P4UA 3L7EA 4XOEA 5D2NA 4Z8FH 3HNTL 3SJVE 2GSIA 5L2KE 4P5KB 4CL7A 5M7QA 2EIBA 4AENA 4AQ1C 3BXNA 4R26H 5D7LB 2FQDA 3L6FB 3KYKH 4XN8A 1ZLVH 4BQ6A 1IBYA 5ENWA 1OB1A 1OCWL 3VRJA 4C4UA 4O2CA 1FJ1B 2DL9A 4RAVB 3JV5A 4AG4L 3D3VE 2PO6D 3HS0A 1NQBA 3NFNB 5ECGA 3R4DA 3DHPA 2P7TB 2DM2A 3A0OA 4UZSA 2VL4A 4C8XA 1C16A 4DGVH 4MNQE 2AJXH 3V79C 1FPTL 4PD4J 1B90A 3S37L 3GXUB 2IXQA 5BOJA 1AXSA 3EFFB 3WXVL 3D06A 1H8SA 4XTRC 3KBPA 3QXWA 3TEUA 3DYPA 4GW5B 5ICUA 3HC4H 4FQLH 1E42A 1XMEB 2ZG2A 4C54A 5CJ5A 2VSKB 2H4EA 3APDA 1ETZB 5BNXD 1OCZB 1JAEA 3HBPA 3BD5A 1P7HL 1M6OB 3FBKA 2HLFC 1YZZA 3LXCA 1BAFL 4N90D 4HOXA 2F7RA 2DH2A 1KYOK 4YJZL 5C09B 4AH2B 2NMSA 3I3EA 1NEZA 5HDLA 3IPEA 3VWJA 4GQZA 2WQUA 4NX0A 2A73A 3OXSA 1FH5H 3T65B 4PIRF 3G5YB 3O2VL 3S88H 2KMWA 4NENA 5D5ME 4X6EB 2ZAGA 1MJJB 1RHHA 4FGMA 4FX5A 3GLDA 3MLPA 2CAKA 1F1GA 1VGEL 3F6IA 2YN3A 1MQKH 4XH2B 2J43A 1MCEA 4NO5B 1UB6B 5C0EA 3AU1B 4MXQC 1JNHB 4NQEB 1RJYB 1BEXA 5FGCB 1BLIA 4ZW5A 1KLGB 4BK5C 5F9AC 4Q9RH 4NN5C 4WFGD 4XBGB 2EYRB 1GCYA 1Z0MA 2PR4L 4DPCX 4QOKA 1GSKA 1MI5D 2XWBB 5JHLA 5D7IF 1QEXA 3WEBA 1IE5A 3DGCR 1ZXQA 2GQHA 4K7PX 4GUQA 4PRAB 3VRIB 1NINA 3F7RA 5I5MA 4AJVA 2JELH 4DVRL 3D39D 4UOZA 1J10A 2ATPB 1P6FA 1ORSB 4M5YH 1J9CT 4WWKB 4FADA 1LK2A 2B08A 2QVIA 1JI2A 2NLJB 4KTEH 3X17A 4OIIL 1TXKA 2R0KH 1KJ3L 1CGXA 3L2MA 4OTXL 2DLHA 1XGZA 3UAJA 3DURB 1XGTB 2D7QA 1D5BB 2ZKHL 5DZLA 3CXHJ 4HS3B 3FPXA 2GBVA 1EO5A 3IETB 3NIDF 2GY7B 2P8MB 5I0DA 5L0QB 2ITEA 3OZ9H 4HEPG 3QORB 2JK5A 3L3KA 3O8XB 1MVFA 4G7YL 1CFQB 3IDYB 4FYTA 1UUNA 2XG5B 1AQDA 3IXAB 1XH2A 3CVHA 3QCVH 8FABA 2VYRE 1YQVL 5F1OB 1HHKA 4HAGA 3VFUB 3VFPA 1G1OA 3ZL1A 1PNCA 5AKVA 5FYKU 3DVIA 1GAFH 5I74B 1WJ3A 2PCXA 1XIWC 4FA7B 2IDTA 1GY2A 3I6GA 2X2YA 5EUOF 2Y5TA 4XXWC 5C07E 3DC0A 5DJCA 2FH6A 5HJDA 4JQIH 3SE9H 3EHBD 4WU5B 4AYDC 4XHQA 4H1LH 2WGNB 1URZA 2OTPA 2GHZA 3I3BA 3T4AB 1I3RA 4MMXA 4QO1B 5E24E 1SEQL 3Q1SL 5K93A 4Z5RB 3DHMA 1O9VA 2WBJB 1R33A 1AIFA 4LQFL 3W37A 5DSCA 1HHIA 1TJGL 3QQDA 4U6YA 5CF3A 1D6VL 5GJSL 2V4LA 1GXEA 4TULH 5IIEB 3HFMH 4D9RE 3D12B 3KVDD 2XZAL 5JOPD 3BZ5A 3K6IA 1U8PB 4HLZH 3P1VA 4PI2A 2CLRB 1QKZL 3VWJD 3FT3A 3AY2A 1P53A 2XDHA 5EUOE 3RU8L 1WEJH 2G3NA 1WQVT 5KG9B 4OGYH 5JO5B 1RZKH 2IFFL 3SDAA 2DD8H 1AIZA 2CH8A 5H94B 3UTQB 1LD9A 3AVEA 4IBQA 3W5NA 1AZNA 3QWRA 4O2EB 3HE7D 1DEEA 1BJ1H 2VMFA 2ZOKA 5DT1H 1AHWA 5DD6A 4CGTA 1JRHH 5C92A 1XHHA 1GS6X 3HG1A 4DTGH 4M4RB 5C6TH 2RD0A 4OT1L 4UV7H 1IV8A 3QZLA 2CLVA 1HHJB 4WI7A 2CR0A 3TBTA 5EWIH 2PW2A 2VZSA 4RISH 5DRWB 4AQ8C 3ATDA 2C9SA 2PPCA 1A1MB 4JFVA 4MA3B 1RU9L 5DHVH 3CBRA 2DI8A 4WO4B 3VFWA 1Q4NX 5A1AA 3BWUF 5CCGE 3L5WA 3PWPA 3QDGA 3QAZB 4M1CC 4M6NL 3T2NL 2BNQB 3PUUA 2DKUA 5ESQA 3FQNB 5HDQL 1W8NA 2AZAA 3C9NB 2DRUA 4PJEB 3L95A 3PWVB 1ML0A 1QFUH 2R0WL 1NAKH 5GSRB 2WKLA 3LEVH 3LKSA 4PJIF 3GNML 3LN4A 4XBPB 1IQWH 3N0AA 4GP5B 4OVVA 5GRUH 3VI4B 3GI8L 3IDGA 3MCKB 4EIGB 4XZ4A 3E7JA 3RWCB 3TH4T 4I3SH 1D5IL 3PDOA 1NOAA 2MTAA 1O7SA 2QADD 1LEIA 1I8UA 5IR1A 5HDBB 3BIAX 3IB4A 3AACA 1BJMA 2B1AL 3SBRA 5AAWA 4QKXB 4MQTB 1GZHC 1HYRC 4K23L 4C4BA 1GIGH 3FUFA 3FQWB 3ULVF 1ICTA 1IKNC 5ERWB 4XPHH 1CFNA 2NY5L 4F8PA 3NPSC 2YSSB 1QHOA 3QISA 3E6FB 3VB8A 3S8FB 3G7TA 3TZVC 4YIQB 1H3UA 4QRFA 3VXOB 5JLZA 4PJIE 1TSHA 2E9GA 4NQSB 1N59B 1UJ3A 4JPWH 3BKMH 1OGAD 1AR1B 4JG1H 2LE9A 4D0CA 2GJ6E 3ULVL 2PCPA 3CFCL 3DBSA 3M1BB 5TQ2L 5KBKA 2VLME 1CD0A 4O58L 1NFDF 1FZMB 4FQIH 4LKCB 1F1AA 1XCTB 1MF2L 3Q5TA 4PRIA 1GW6A 3D4YA 3IE4A 5HHMD 1AHKA 2WXNA 3ULVE 2WXRA 2QV4A 5CN2A 5A2KH 2W8CA 1FE8H 4YHPB 4FA8A 1IBBA 5IHUH 3MODL 1UJTA 3QXAA 4LL1A 4LSUL 3TO2A 4HLEA 4NLAA 2C1PB 1L9TA 2MOQA 4EQ2A 2ROYA 5C0CB 2VMEA 3G5XA 3BN9C 3SDAD 2R4RL 4OGAD 3RDJA 4PRDA 4AIZB 3MA7A 3EXJA 3HC2A 3PWUA 4U1SA 3ZL4H 1FFTB 5B1JA 3EH5B 1N5YL 3WUWA 1NMBL 2W94A 3GSQB 1A9EA 4RSVA 1NBVH 2NY4C 3JXAA 4XAWH 1NFDE 1P4BH 4P5SA 4CU7A 1MRCH 5DQDL 3UX9B 1YDPB 3HG1D 2Z9TA 4MD5B 1QFWI 2UX7A 2B9BA 5K69A 1YNTF 1FFQA 4K15A 1NCAH 5I66B 3K72B 4KUZL 3QJQB 3MXVH 3QIWB 4Q14A 3KXFA 5EOQL 3MLXL 1W72B 2C4FU 5JZ7D 3WKNA 2V0AA 1I8IA 4CC4A 3FFCA 2B5IB 4TRPH 3EBIA 4X8CA 1NMCC 5DD3H 2OSYA 1CTOA 4IS6B 3G08A 3DSFL 4XMVA 5FYKD 1HOEA 1WTGT 4Z0XA 1F8TL 4NYLB 3KAAA 5GS0D 1VFAA 2YZ1A 1SHWA 4JM2F 3W0WB 5F7DB 1NOLA 3ETBF 4MA7L 4APQD 1GJIA 1YN6A 1JDAA 4X98A 4UIKH 1OKEA 3TXAA 2ZAIA 1RZPA 2FNWA 1A3QA 1X7QA 2EE3A 2ZX7A 1JPSH 1JZ3A 3RTLA 3PS6A 2VQ1B 2J55A 2B9AA 3ZZ1A 5FA4A 2JH2A 5EIQA 1D7FA 2XCMC 1M71A 2IPTL 2OXHB 5LKNA 2HMIC 1IILE 2GTZB 2YPLA 3G9VA 3LXBA 1VADB 2VB5A 5HD8D 3PHQB 2AQSA 3P4MA 3UG5A 1VF5C 3BUTA 3QEQD 2EH8L 4JVWA 2CHNA 2E27H 3GSOB 3FOLB 2YD6A 5EMYA 1B2WH 3ARBC 5HHOE 1XGPB 5KZCB 3W38A 1QPPA 5E9NA 4PREA 1IAIL 3WIHA 3NFPA 4CAGA 4UT9L 4TSBL 4QYOB 5IVZA 2WPGA 2BNRA 3FB7A 1HH9B 2OMXA 4HLZG 4KX9A 4H2CA 3ZE1B 1XD0A 3HI1B 4A2GA 4P05A 3RZCA 3JTBA 3QDJE 3UPRB 2EEBA 1TVBA 2AP2A 2J5LC 5D70H 3RIFF 1UT2A 1Y0LA 5BMFH 3HCVA 5BVJA 1NMAL 2EDWA 2EDYA 2CO7A 3BWAA 3Q6GL 4L48A 4W68A 4WI2A 5AB9A 3KYOA 3U7AA 1FVCA 4V2BA 2HRGA 4S1RL 2AV7A 5BV7L 5I0VA 1ND0B 3WDIA 1MCOL 1QHQA 1HDMB 2VWEC 4G1EB 3ZDXF 4Y4FA 2EDLA 3H2PA 5I18L 3KS0H 1R3LA 3NJHA 1O7DC 4MQXC 4GBXB 2VAAB 1I9IL 4IMKC 1ACYH 1NDGB 3RPIB 3MO1B 4OFYA 1CWVA 3L1GA 4U3SB 4EVNA 3O9WB 7TAAA 4HUKB 3SY6A 4XNXL 4HIXL 3VO0A 1S7VB 1G7QA 2G60H 1X44A 4JM0A 4JPIA 4Y16B 2QPFA 3MLWL 3QZWA 1WT5C 1JNLL 5L6YH 2P49B 1KUMA 4K3JH 4PTTA 5ESVA 2N4IA 2GB2A 3KXFD 3WMSA 5K9QI 3ZDXE 1K5NB 3NJLA 2GK2A 1CDGA 5CGTA 5SX5H 3FFCD 1G7LA 1FN4A 5TH2B 2DW5A 4V1DB 1QBMH 2HKHL 1KLFA 1L7IH 1WYJA 3QCUL 3UDWA 1A7QL 3PU7A 1XGUB 4G1MB 4QGTA 2HPOA 2VXVH 2CIKA 3AXIA 3DPDA 2FWLB 1PKOA 4XN5A 4ZX5A 5SWZA 5JDSB 2PYEB 3LS4L 4HHAB 4Z3HA 1JGEA 4I4WB 5B38A 3NJFA 4ZFFB 3BQUD 3VD0A 1J0ZA 4YHZL 2IANB 1YJDL 3NA4A 1JV5A 3TU6A 1D5XA 2XVKA 3SODB 1KPUA 5FUZL 2FZ3A 4L8SA 1UZGA 4IRJC 2AF2A 2NY2C 5BZZA 4XODA 5KVMC 4LOFA 4YFDB 5DD1H 4WTXA 1T1WB 2EXWD 1PJ9A 3ATAA 3FCSA 4WNQA 4GQPH 3QIUB 4G6AD 4GYBA 5C09E 4Z7QE 3FTZA 3HPLA 1KENL 1PD0A 3KPMB 2XX1A 1MJ7H 4RGMC 4XMLL 1PG7X 4K3HA 1I8LC 3TVMB 1FL3B 2HFTA 1BYNA 1AP2B 4YBQC 2R0LH 1FFNA 1LTXA 2Q76A 4MNHA 2PTTA 3H9ZA 1USQA 2ZWYA 4WW1A 4P5TC 2Y24A 1F56A 3GMRA 3LZPA 3RZCD 4XNBA 3D69A 4Z78A 1OF2B 4ZJ9A 3O6FA 4JM4L 1DDTA 1FAIH 1M7UA 1T89C 3PWJB 2Z8SA 2KZ1B 4NQEE 1HEJC 2F08A 2HA1A 4KVNL 4S0SD 3UADA 3CDYA 2WP3T 5KVFH 2OTWA 3VAEA 2R1XA 3HC0A 3DOSA 4Y19B 2VLRA 1FVEA 4UTBH 2ZJSH 4OB5L 4NP9A 1KIPB 3MLVH 2X05A 1A7RL 4FXTA 2ZX8A 4M1DH 1JGDB 2BY3A 4F33B 4D94A 4NKMA 3Q2WA 5IP4A 3PGCB 2IPUK 1WK0A 2GT9B 1JZJA 1U41A 3IU3B 3MRKB 4JBSA 4Q0XL 5IOKA 4OFYD 5JA8B 2XQBL 3L3HB 1Z5LA 3PXLA 4UQ3B 1KPRA 1C5CL 4YN3A 3EJSA 2WLLB 3T77B 2VLLA 3QNFA 2KLRA 5T1KB 43C9B 1F90H 1T83C 1HYSC 2W60B 1NCWL 1PL3A 3LEXA 3PXHA 3P0GB 3RP1A 3RB7A 4PEEA 4N2DA 1XEUA 1Z9SA 4ZFGH 4DZBB 2C26A 1PLGL 1JMXA 3AMKA 2A77L 4Z95L