4XOEA

Crystal structure of a fimh*dsg complex from e.coli f18 with bound heptyl alpha-d-mannopyrannoside
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
279
structure length
279
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catch-bond mechanism of the bacterial adhesin FimH.
pubmed doi rcsb
source organism Escherichia coli o6:k15:h31
molecule tags Cell adhesion
molecule keywords FimH protein
total genus 55
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoeA01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4xoeA02
2VCOA 4XO9A 3RFZA 5JQIB 2J2ZB 5F2FA 5CGBA 4J3OH 3BWUF 4AV0A 1N0LB 4XODA 3ZPDA 4X50A 4AVHA 1PDKB 4XOEA 4AVKA 4XO8A 5FLUA 3ZL2A 2XG4B 2W07B 3JWNH 4J3OG 5FS5A 5AB1A 4ATTA 5FWRA 5AAPA 4X5RA 4CSTA 5ABZA 5LNGA 1N12A 3JWNG 1KIUB 2JMRA 2XG5B 3ZL1A 2UY7B 4CA4A 4BUQA 1UWFA 4AVJA 5IQMA 5LNEA 4CSSA 5IQOA 1TR7A 5AALA 4J3OF 5IQNA 4LOVA 4AV4A 4AV5A 1ZE3H 3MCYA 4XOCA 2UY6B 3BFQG 5FX3A 3ME0B 1QUNB 4X5PA 4X5QA 3SQBB 1KLFB 4AUJA 2JTYA 5F3FA 4AUYA 4AVIA 3JWNE 4AUUA 4XOBA 4XOAA 2WMPB 3BFWA
chains in the Genus database with same CATH superfamily
3ZYJA 1RUQH 1MN4A 4H44C 2IWEA 5EBGA 5JQ6L 2D7PA 4NQCB 1N3NA 4PG2A 3OKEB 5EO9B 5SV3A 3NZHH 4X4XB 4JFXB 4Y8DC 2OZ4A 3QHZL 2V8MA 1I9JH 4NQSA 5AAMA 2YPVL 1I7UB 2YUXA 3QWRA 3VXTA 4BEIA 3TBTB 4HV8B 5JW3L 2M1KA 4QLWA 4GSXA 4YHPA 4Z7IA 1VFOA 4ODUA 1R3JA 1AD0B 3G04A 2DQJH 1IGCL 3CVHH 2WBJD 2BP0B 4ZOEA 4G80B 1Y18A 1AS8A 1YNLL 1KB3A 5IW6B 5KSAB 5EFIA 5JW4M 5E24E 5BO1H 3KLAB 5I1KH 2HN7A 2XZAH 3T0XA 2AEIT 4I3SL 2NW2B 5K9JL 4BHUA 3MA7B 3V55A 1KLUA 3V5KA 2FQGA 1FZMB 2F19L 1KPRA 1XZ0A 4GBXA 3QFJD 4OCXL 3EYFB 3HG4A 4HUVB 3RWIB 3V5KB 3SSGA 4NC0B 4LL4A 4JDZA 5T1DH 4DQAA 4QHKI 2VIRA 4FKKA 1A7PH 5MI0B 4GH7B 5J3HD 2RCSL 3W1ZA 4MJID 3WE1A 4PRHB 3GMQB 5DUPH 5C0AB 1I8LA 3BZFA 2J8HA 4I18B 3WY2A 2AKRB 4WFFD 1DEEA 1FL3B 4X6DB 2UXFA 3BESR 1V7NL 1XF5B 1A5FL 1B4JH 3UBHA 5CLWA 5FB8B 4OIAA 5C6WH 1OGTA 3P2BA 4AMKH 1KUMA 1UEYA 2I07B 2CKNA 3TA3B 2D0GA 3NUKA 5JOFA 3EH2A 3HBGA 4PHZA 3D85A 4HC1A 3MV8D 3DI3B 1ROWA 4PJ8A 1GGUA 2GB2A 4LSSL 1OAZH 5FYJL 5CCHE 3CLEL 4GRLD 1FVDA 5I1DA 5IQ7H 1WCQA 4HOXA 1AO7A 5E2WH 1KTKE 1Z9MA 1JGDB 2H1XA 3LAFA 3WNLA 4HIXL 1NGXA 2XG4B 4ODTL 3IBOA 5D7IE 5T3ZH 5B3JE 3RJOA 4EPSA 4QTIL 4X5RA 1AZCA 1MW0A 1KBBA 5AVVB 4MCYA 1D5BB 3TH2T 3RE0A 3TWYA 5I6KA 1QNZL 1E3FA 4P57A 2COQA 4LVOB 4M4PA 1VESA 3A4EA 5I6OA 2CGRH 5J6HA 4YSUA 4MMZC 3U0PA 3H1ZA 3DSFH 1UXMA 3OX8B 2I9LA 2OMNA 1A6VH 2FATL 3BAWA 3VWJC 4PJ5B 1FZOA 3UIZA 3KDPB 1E6JL 1U8MB 3UAAA 1MOEA 3ETTA 3LH2H 1W2KT 3FU8A 3BP6A 2WBJA 1T1ZB 3HZVA 3Q6GH 4NJ9L 2AEQL 4OFYA 4YE0A 4YHKH 5GS1A 4AQEA 4YSCA 4UIKH 4YK4C 3MV11 3WNPA 1VF5C 2FJHB 2XWZA 3GT6A 4LSSH 3RL1B 1F86A 4XP4L 1AGFA 1INQA 1N4XL 1P2CA 1A7BA 1UASA 2GBTA 4OY9A 3V4LA 1JNLH 1YRKA 5HI3D 3SDDA 4J3UA 3QVAA 1ZHKA 5I30L 1MJJA 2MCMA 3OAUL 4OCYL 2MKWA 3ZQWA 1L6PA 3TESA 3ARBB 1S9WB 5TGBB 1NCHA 3IGAA 3MFFB 2H8PB 3LKSB 5AW6B 1U8IB 2JJUA 1AGEB 4K5MA 1NMAH 2VDML 3DVNB 4HHAB 4HQQL 2FBJH 5DRZA 4ECNA 1II4E 1U8IA 2WXLA 3O4LE 3VGHA 1E9QA 4PRAA 5E1AA 3RGVA 3KL3A 1JJUA 4UMGA 3N42B 3QT2A 3VXPA 3FB7B 1TQWA 1WBXA 5IMOA 2VGLM 5K1JA 3HNSH 2EH7H 2YXWA 1TZIB 3ARGC 3LCYA 3RWDB 3HR6A 4GG6A 4AXWA 2NXZD 4F33B 1NC2B 1OCWL 1FVCA 5KSBF 5EOCJ 3ATDA 2TSBA 2V7HA 4UOQA 5FEBA 2H0FA 4IIQA 4ODHL 4EQ2A 3B5HA 5DJ6A 2NY1D 2Q3ZA 1BEYH 1CI5A 3HG1E 5L4JA 2OMVB 1URLA 4FDWA 4EEEA 1XMWA 5CLYA 1CR9L 5T3XL 5IFAL 3DX9B 2CJUL 2M83A 2ZJSL 5GGVL 2MPAH 4ZRGA 5E8EB 5I2IA 2BVQB 4GW4A 3WJMB 2OFQA 3N3EA 3O9WD 3QDME 4OLUL 3RFZA 3X11B 4GKZA 5C3TA 5KSBE 1YYMH 1S7UA 4E9SA 2BRRH 3N2JA 1UB6A 4X9GA 1C16A 5LQBL 4MXQD 4YDJB 1HKLL 2GUYA 2WTRB 1EEQA 3IDXL 4F15B 3I6SA 3EZJB 1X5LA 5I17A 4GAGH 2EEXA 4KI5D 3KYOA 2YC1B 4OBRA 4BQ8A 4HJGA 4QLRA 1CQKA 2IFFL 5GRUH 1OPGL 1ZGLB 4KXBA 4FFYA 4BJLA 5J6GB 1BJ8A 4YVNA 1RIHH 5FKPB 2V8LA 1DVSA 3MLVL 3Q13A 2V5TA 4OFDA 3N1FC 1F90H 1TEFA 4PJFA 1CE1L 4Q2ZB 5A2AA 1WGOA 4JANA 2DQTH 1KZYA 3GM0A 4UT6L 1J12A 5AWNH 3RILA 3ULUD 4DN3H 2H3NB 4FP8L 1AVAA 4WK4B 5AVRB 1GSKA 5H2BB 1JRHI 3SPVA 2VLRB 5ALBL 5LGYA 1TQTA 5LJYH 2R69A 2VDMH 5T1MB 2HRGA 2Y2TA 4WHYH 1KEGL 3TNNB 4I4WB 2JCWA 1LO3L 4JM2A 1VRSA 1WVZA 5E8NB 3HE7A 5MP6L 1XHHA 4Z7OF 2FQEA 5HHME 4OZFH 3K71B 1JGUH 1HE8A 3HBQA 5EOCL 2HKAA 5K9KA 4QXUL 4XHQA 1FZKA 3H9SE 4NRZB 4DP8X 3QYNA 4P04A 3P4MA 1XF1A 4FLQA 1KJVB 4XN7A 3Q5OA 1F58H 4POZC 1XGQA 4ZO9A 3X13A 1CYGA 2VO5A 3IDGB 3OHMB 4U1MA 4P2QE 2IG2L 2ZQKA 2ZXDA 3B9AA 3BOVA 4XPHL 3Q6FB 4UOJA 3T0WA 3MRGA 4BXSV 2XIIA 3BEVA 3LHAA 1F3DH 3B5TA 2EYRB 4L2LA 5JO5B 1UKTA 4PUBH 5FECB 1OW0A 4L4TE 2AITA 1EAJA 2WP3T 4XMKL 4IOFC 1I1AD 2AK1H 4XXWA 4YBHA 2BNUA 5A6LA 4IMLA 3SKMB 1G9EA 4GI9A 4PBVC 3GMNA 1L9RA 2IFGA 1JZDC 2YK1H 4QRTA 4X9BA 2J2ZB 3DX2A 5CSGA 4JDEA 2OMXA 3DROB 4GXFA 3WY1A 5IOPB 3MJ8B 3VMOA 1U33A 5AOLA 4N8VG 4PJ7A 2O61B 4PVMA 3CDYA 3PDOA 1VFUA 1J8HB 2WXOA 3D48R 2R1XA 2B39A 4K5PA 4PB9H 1Z2KA 4JRYA 4OFVA 3HFML 3MJ7B 4QRRD 4TMPA 5CSZA 2DRUA 1QFWH 4G83A 3CSTA 3HRPA 5CEZL 2WLLB 1QRND 5GGQH 3FU9A 4WJG3 5E6UB 3G5WA 4IEFB 2C9RA 3VXRD 4DO4A 1M2VB 2A9NL 2DQFA 2LOEA 3B7SA 4IDLA 4OQTL 4WFGD 5DFWH 5AW4B 4X8JB 4Q4EA 5DWUH 5AUMB 1XGTB 4AW7A 3AXLB 1AGBA 2GJRA 3D0AA 1ASPA 3MROB 1I7RA 3RPKA 1KLUB 3U82B 2BNQA 3WEMA 2WXIA 1RK1B 2KZ1B 1RURH 4ACTA 1NMBH 3NQKA 3QQDA 4ZOAA 1MHCA 3S8GB 1G6VK 4BZYA 4X5XA 5ITFA 2C9SA 2VJ8A 3SGDH 3C6EA 4LXFA 3NRFA 1QLEB 2Y22A 1DCLA 4MKMA 1NCUA 4PJCE 1A4CA 3KPNA 3U4AA 1JGUL 1VACA 5EOCH 4XPGH 1LEIA 3QDAA 1L9QA 1RP8A 5MP6H 3BN3B 3VD1A 3JWDH 3CHRA 4XP1L 2KMWA 4FXLA 4MX7A 4FQCH 3KPSA 4QYOA 4EUPG 3CZSA 1WJ3A 5LGKA 4AI7A 4K5NA 1JDAA 3QXUA 2Z4TA 1FAKT 2UXTA 2VABB 1AZRA 3KM1A 1SLVA 4TNVF 1TENA 3ZQ9A 5D1ZA 5LN8A 1ES0B 1BZDA 3AG4B 5D55A 1WC7A 4ZUUB 2R2EA 4PJCF 3TXAA 3AABA 3BPCB 4G59C 4FQ2L 3U0WL 3F84A 3GXPA 4LL9A 3ZUNC 4C4KO 4X0KB 3DK0A 1ORSA 4JFYB 3SE3C 4AMWA 4ZT1A 1I7TA 3HOGA 1T0MB 4TVPL 5JW4Q 4BA8A 5F21B 2MHAA 3CH1A 5ACZA 32C2B 2VO8A 3L45A 4TNFA 5I6NA 5IEKB 1NQBA 1OCZB 1QFOA 5ADPL 4JO1H 2J57A 4GQPH 3V9FA 2ADGA 4QO1A 4F7EB 2R0KH 3NCCB 4UDUB 3ABKB 5DQJA 2WMPB 4M1CC 4U6XA 4LQFH 3PGFL 1F8TL 3TJPA 4U6VH 2R0WH 5E9NA 5DQJB 4AQZA 1FQ9C 4X9YA 3EJTA 1R5VA 2VQ1B 1EHKB 2O5NA 4N0UB 3TL5A 1DN2A 5CP7B 3WFHB 3ATAA 4Q9QL 3KPSE 1XBRA 4KZDL 5FO9A 4PJAB 2Y5EA 4X4YB 4LPCA 2YAPA 1F4AA 4JGMA 4MJJA 2PP9A 5J9PB 3FT1A 5B3NA 4JQIL 3LPPA 5DJCB 3K72A 2PP7A 2ATPA 3ZY7A 2D03L 3MLWH 3CDFA 4AEHH 4OQTH 5T5FA 1E5YA 5C92A 1JRHL 3K80A 4JGUA 3TBVA 4YQXL 2ITEA 1P9MA 3QP3A 5D1ZD 1YQVH 2QZQA 1RURL 4MA8H 3LOWA 5LNGA 5I1AA 3K0WA 3GXMA 4IBZA 2ZX6A 3HBPA 3D4YA 1HZHH 3VGFA 3QUYC 5JIHA 3MSPA 3WO3B 3AACA 4NI6A 3FQXB 3QG7L 1B88A 3QR0A 4Q0XH 4J3WA 1HIMH 4BFIB 4FQLL 4M5ZL 1NEZA 2JJSA 3FYIB 5BJTB 1WYJA 1SLUA 4AWJC 1P4BH 1TYEB 3OC8A 3ECBA 3VSVA 3KBEA 3LRKA 1RSFA 3R7RA 1UWEL 2C8NA 2G60L 1EMTL 4ZMZA 4H1LG 4XNYL 4PJGE 2NOYA 3CXHJ 1MQKL 2I5YH 4N86A 1KFAH 2G2RB 4XPHH 1OB1B 2NT0A 1HNYA 3WJLC 3BLKA 4K5LA 4PP1C 4RBPH 3NIFE 1NOFA 3DYOA 4Z7VE 4LSRL 2OR8A 3DX9A 1QBAA 1AC0A 3HTLX 3KGTA 3ZTCC 5C2BH 4G8FA 1KB5L 1HHGB 1U2YA 2MCAA 15C8H 4O51A 4NN5C 3QJVB 3QXDA 5I18L 1SXSA 2BVEA 1P4UA 3APMA 1HJCA 4QHPA 3I9AA 5MEND 1U8JA 1CWVA 3T2NL 5HY9B 1DQDH 2V17H 1BG1A 3BN9C 3F83A 3EH1A 1RXLA 3IE9A 1E9OA 1NCBH 2JI1A 1RV6X 4E0RB 3HZ3A 4KX8A 2WTPA 1I1FB 3DTXA 4Z7UF 1E9OB 4LOVA 3UAFA 1UEMA 3RDTD 4QY8B 2JQAA 2VDKL 1PU0A 1RHHB 3JWNE 4HH9A 2CAKA 3ZRSA 1ETA1 5J6GA 4NZFA 3CZFA 3FTYA 1NEZG 2IIJA 3VVVA 3KR3H 3CLEH 3AAZB 4NENA 1PG7H 3F7KA 5IB5A 4QRTB 2VMJA 4H0GA 5CD5D 5AOJA 3BKCL 4XCFL 4OCXH 2VDLB 3NCYP 1N7MH 1S3KL 3EFOA 1DVYA 2CDGA 3FU3A 3QHFH 1MCBA 3O3EA 4ZMWA 1JE6A 5DRWB 3QNYB 3HN5A 4ZMVA 4OD2A 5C0FA 5I8EB 3MCG1 4AE0A 1VADB 4TOYL 3VYOA 1S5IL 4NGHH 3MMEA 2Y24A 3TNNA 4G71B 4P2OA 1T20B 4XMPL 4WI2A 2WQSA 1P6AB 5F0MB 5HGBB 3PWPB 4EUPB 3LKQB 1DQIA 2DJ4A 3TEXA 2WTOA 2O26U 4G42B 1KG0A 1TQBC 3K71A 5GGTA 5SWQA 5DJ0B 3DARA 5FF6B 3MV9E 1XR9B 2X4NB 3FAWA 2A74B 3HE7D 1FVEB 4PJDE 2OQJA 1KB5B 2OL3A 1MF2H 3U1QA 4ONGH 4JN1H 3K2UL 2WVVB 4TUJA 3U7YL 4Z8FL 4ICXA 1A6UH 3E9UA 4Q6IA 4R96A 4GP8B 3STZB 3D7PA 3NP4A 3CG8A 4HPYH 1BAWA 2AQRA 3STZA 4LBEB 2NDGA 4P4KA 2X3AA 1TPXC 5EEWA 3MJ8A 4FERA 4L4VD 4OLZH 1OSZB 4UINH 5D2NA 4DWHA 3VFPB 4CC1A 2EVIA 4N6QA 5FB8A 4IRSD 1MWOA 4KXZH 1WS7A 2WGNB 2YAMA 4RDQG 1HEZA 4MX7B 5AL8A 4ODHH 3ETSA 3MRQA 5IJDC 5JOFB 4M3HA 4RFEB 4KOBA 3SYCA 2AJ3B 2IAMB 2J72A 3L3OA 4ETQA 2WBJC 5C09D 1DJHA 4H0HB 1K5NB 4EZJA 2CLVA 2XQ0A 2BK8A 2CK2A 1XZWA 2P26A 3MREA 4N8VA 5GRVK 2XWRA 1FBIL 3UEQA 1YN6B 3F12A 5HYFA 3OR6A 3QR2A 4ELMF 1O5DT 4MS8C 3VSTA 4LPVA 3HC3L 3LKRB 3KDMA 2YQBA 5AUMA 2X2UA 2XQBL 4GBXC 2MNWA 2XFXA 2XWXA 4YR6A 3BRDA 1GGIH 5DVOA 2QBWA 4ANXA 4WCYH 4BQ6A 1SF5A 1E67A 4KNTA 4JANB 2WV3A 3BSHA 3T08A 2VLJE 2BJML 3VRLE 1KYUA 1XSKA 2HPOA 3MKKA 3VQ1C 2N1KA 3P0VL 4PV8B 1UM6H 1TSRA 1DZBA 2X9WA 3U30C 3D2UA 3L8QA 3WN6A 1P1VA 4IBTA 3NIFB 5E5MA 4RGNB 5EEYA 4BZ1A 4R3SA 1TVBB 4M6NH 2YSSB 4R5XA 3DDGA 5JIKA 5D2NE 4GT7A 2Y7SA 4YHNB 1MVUA 4MTMA 5C08B 3N9GH 3OVUB 3QQXA 4BSJA 3GMMA 4DCQB 1EAPB 1WEJH 3T0BA 2FO1A 1CF8H 4ZXBC 3SDCD 2WINB 2FWOA 3U0TB 3BAIA 1CZ8L 1PBYA 2F0CA 2JI2A 3OZKA 4MDIA 4LPXA 4XC3H 1KPVB 3UZVA 4LMQE 4LLWA 1F4WH 2BCKA 5JHDD 2XTJB 3F3HA 4KFMA 4JREB 3U9PL 5I8OH 5KYXB 2OMZB 2B1AH 4JO2H 3L5IA 1RAMA 1PPIA 3C8KB 3L2NA 2JSFA 1WV7T 5DJ2A 3FCGA 1IE4A 3PDGA 2FECL 4Y4KD 4ZAKC 5IF0B 1CFVH 4XH2A 4MXVE 1Z3GL 5IGXL 1LO2L 2IPKA 1KIRB 4KK9D 3KL5A 3AS1A 5AW3B 3RU8L 3UYRH 1A7RH 3IDJB 1I1RA 1SFHA 2DQTL 3QC6X 1AXTL 2QDVA 5C0CD 2I9TB 1ROCA 1JAEA 2EVJA 5FGBC 4KXZI 3U1SL 2D3JA 2CZNA 4CSTA 1KJ3H 3GTVA 4MS8D 2UZXA 2HKFL 2EKSA 1Z5YD 4JM2B 5CHNB 1IVLA 4IHOA 4OFQA 4PGCB 3PGDB 1JPFB 2UY6B 3WHXA 3AGVA 4J4PA 4LCUA 3EOTL 4HUXB 3IKCB 1QLRA 4RMRA 4NUGH 4KZDH 3EBHA 4X7TB 2IDUA 5DJCA 4DPAX 5BMFL 1JTOA 4UM9B 5DGQA 3ZVVA 3B2PA 5E7BA 1C5CH 1MAJA 4XBMA 5HI4D 4OV5A 5DZ9A 3OSVA 4UAOC 2ADIA 4NBYB 3IXAB 1CQYA 4YL4A 3DBXA 5HBBA 3EDKA 3AB0C 4N2GA 1E42A 3QJUB 3OKNA 4DEPC 4C83B 4N9OB 3ETBF 4WNQB 3BYYA 3A22A 4DIXA 3NACH 1DEEB 4HCIA 2DH3A 2IQAA 4HISA 5IG7B 4YXKL 3SCMD 4A2FA 2YOAA 3IN0A 3O11A 3OLEA 4TSBH 3KCPA 3AREB 3UPAA 3BFOA 2WIIB 4WUUA 5D70L 1EAQA 5E6ID 4B5ZA 3RWFA 4EVNA 1JTPA 1XH0A 4BFIA 4N8UA 3NA9H 1BBJA 1WZAA 4YSOA 2VERA 3AAZA 4NENB 4U6YA 4WI3A 5E1HB 1XH3B 1OF0A 3ZMNA 1F4HA 4YHLL 3F6JA 3HMWH 4YWGH 1UWFA 2JI3A 1RZKC 2OJZL 4EOWH 3KPRD 3HS0C 1SDAB 5KW9L 3JUYA 4YX2L 2F5AL 1U92A 4L4JA 2VZTA 3RGHA 4LCVA 3EUUA 1RIVL 2CH8A 4RFOL 1KGIA 2E7HA 5FYKL 2IALA 3VFRB 4HWZA 3VW3H 3RI5K 2EVFA 4Z76A 4JO4L 1OE1A 1FLTX 3OAUH 5E6ZA 5IQLA 4U1SB 2W9DH 3MYJA 4XXDB 1GYVA 3U9WA 3BRGC 3OL2A 2ADYA 4JGNA 5CCKH 1VA9A 3S9DB 1RUMH 1YDPA 3LPWA 2XN1A 1XFPA 4ODVH 4YGAB 1PW3A 1Q1JH 1NMBL 1E2VA 2B4CL 2ZZUT 5FM4A 4B9CA 3ZMEA 1EPFA 5D6DC 3HI1B 1VACB 3UYRL 2B9AA 5FECA 1BZ7B 1OAKH 1PIGA 2RBLA 3AITA 3X14B 4BKLA 5LGJB 3EH3B 3CX2A 3BP6B 4FI6A 4YFLF 5E7FA 3EADA 3VTAA 2ZKMX 1MCOL 1VFAB 3WXVH 4MMYA 5KZCB 5IMKB 3OLDA 1FFPB 3JQOB 4ODWA 3VGAB 1X5XA 2YR3A 2NUTA 3APFA 3IPFA 1WISA 3NYKA 4OT1H 4P2RE 3G9VA 3T0ED 2YEZB 43CAB 2KERA 3S36X 3SO3C 2DZEA 1UT9A 3GZKA 1HZKA 3FFCD 2OR9L 4APQA 3RKDD 2FHCA 1BZQK 1DHKA 2DS4A 5EZJA 3HNTH 3ZDZB 4YFLI 2PWGA 2YUWA 3QDGB 1MFBH 3O3DB 1IFRA 4J12A 4AIOA 2Z34A 1XXDC 3D2TA 3D9AL 3ZL1A 5FHAL 2GIMA 3UZEA 1C1EH 4PRPB 1U3HA 3RIFK 5L7XL 4OZGE 2V9QA 4KJQD 2E7MA 1F97A 3FT0A 4PUBL 2V3FA 3UBXG 1MREL 3A67H 3GXIA 1MCOH 2PWDA 3CGTA 5GGSB 4S0HA 1BFOB 5AW8B 4XPTH 2QPDB 1PLGH 4I3RL 3NJNA 4F7PA 4CC0A 4FC3E 3ZX1A 1TMQA 1GZQB 3CWGA 1H3PH 5CJ8A 5FLVA 5EOQL 4IBLT 4P9HL 5L2KA 1IM9D 2XZZA 4YQXH 5C0RH 3V4PA 4GW4B 3WJMA 4FADA 1JXGA 1KEGH 2RA1A 3H9YA 1UQSB 3Q05A 1XGRA 1TPXB 4YIQB 1S7UB 5IY5B 4ADJA 4XB3A 1YYLL 1R5IA 3I2CH 1F00I 2Y6SD 2FLBT 3HG5A 1TTGA 4ZOCA 1SXNA 3MBEA 3MVSA 4TNEA 4PTTA 4NQXB 2A2QT 2XWEA 2YRZA 1NGPL 3QORD 5HHXL 4R7NB 4HZLA 1IBZA 3HI5H 2VWEE 1U95B 4NQXA 3C9NB 5F7NC 3ZMRA 4R7NA 5DVKA 1F2QA 1GGYA 1IEBA 3GIVA 4JRFA 2DWEA 2DQEH 4Z7VA 5A2KH 5JLZA 1O75A 3C8KA 2R29A 3VX1A 4HU2A 5HHPA 1CD9B 2MNJB 3G6JF 1JPEA 3H7BB 2K8MA 3OKYA 4K7PL 2W9LA 3JSSA 1TLKA 3B6SB 4FXKB 2P42B 3QUZB 1IJNA 2F7PA 1IQDA 4JO8A 4A7TA 6PAZA 1IT9H 3EYUH 1PDKB 3UTTD 5LXVA 5LAXA 3HPLA 5DTFA 3VFOA 3P30H 1RLWA 4XGZB 4AYSA 2VR9A 4I3GA 3QI9A 1OGPA 3VXRB 3CBJB 5I1HL 2GTQA 5FYKE 3ZZ1A 2BP5M 5F7LB 3ZGHA 5IQNA 1MVUB 3HIZA 4OJAA 3EJYC 2P1YA 1ACCA 4XTRC 4B96A 4Z7UB 1W72L 4QJ3B 3HS8A 4M7LL 4W93A 4DTGH 2EXYC 1R3KB 4KY1H 1KJVA 2J6EA 4NKIH 2ZX5A 4NN6B 2E9WA 1T0NB 2AJZB 3GO1L 2MOGA 4FXTA 2CKBH 4S1QL 4ZPVB 3HHRB 1DUZB 1YMME 12E8L 1JS4A 3AMKA 5HJGA 3CUPB 1BD2D 2Q8BL 2IV9A 1WTLA 5G4OA 2HSIA 2F8XC 4QKTA 3UEZA 2PW1A 1FNFA 3VH8G 2ZCLH 4KZCA 4JPKH 1N7ML 1S3KH 3FOMA 2PWFA 2YPKB 2YAOA 1O9VA 3DVFA 5JIPA 3ULVD 3JV6A 3WEXA 1EEZB 4P5TD 3HFFA 4HUVA 1MVYA 1OD7A 2R0ZH 5F88A 1KPUB 4AIZB 1PLGL 4I3RH 3TH3T 2KZBA 3VI4F 2ENPA 1IKFH 2PCXA 1YEIL 3U7WH 2HRHA 2QFPA 2X0WA 4N3UA 2GTZB 3S0PA 1DQJA 3LZLA 1H3UA 3OLIA 3C5ZA 3WTWA 1OF2B 1QEWB 4TN9A 4YNYA 2FGZA 5FS5A 5A2IH 3QDJD 5EO9A 3PE9A 1BQ5A 3CDCA 4IS6B 4M8QB 4Z5RA 4DGVH 1NBVL 2IBBA 2OZ4L 4LLUA 5IB1A 3VA2C 1UKQA 4OVVA 3CE1A 3L1FA 3MRKA 4YHOH 1YC8A 1CPUA 4IS6A 3CXHK 4M8QA 4DKFL 2ILLA 4Z5RB 5E4OA 1F56A 1IVTA 4EIUA 4JFQB 2AGJL 3FRUA 3K1DA 4OZIA 5C0EA 4XPBH 3QUXB 4P3DA 3BWAB 3CLWA 2YA0A 4FLSA 3ZDYF 4JFED 3I6KA 4XXWC 1RHFA 2ZPKL 2H47C 3VCLB 2YLKA 5T5NG 4LO9A 2CDEA 3FHQA 3ARGA 4HEMA 2X4PB 2XA8L 4LP5A 5CGYD 4I5BB 2W0PA 2FH6A 2KQNA 2D2OA 1ZHNA 3L16A 2P47B 4HUNB 3E6FA 5GSRB 1GAFH 2V9UA 3LD8B 2J1KA 4PJXF 4UT6A 2VL4A 4FABH 1SEQH 2ICWA 2PCPA 1WITA 1A22B 4JPWL 3F8UB 4IOFD 4XCNB 1T2JA 1RIUL 3BZFB 3BDYL 3V0FA 4ONFL 3SYQA 5T3ZL 2VDRH 3B3IB 4HKZA 3LB6D 2DM3A 3RWFB 2YD4A 5G4NA 1OAZL 3QIBA 5ITBL 1O9ZA 3MRQB 4KROD 3Q9PA 1IMHC 5GS0L 4F27A 1J05A 2UXVA 1Y1DA 1ES0A 3UGUA 4L3EE 4KJWD 3VI4B 3NBNA 1SHXA 1P4BL 4M02A 5I73B 3DPBB 1BLNB 4Y16D 4UYPA 4JQIH 2P80A 3W9EA 4FYSA 3LQZB 3RZCB 4ODXA 2B0SH 5DJAA 5AYTA 5MHSD 4GAJH 1RU9H 1AO7B 2VDLH 2ZKHL 3BHBB 4RZKA 2EE6A 2J56A 5E5RB 3VFRA 2Z7YA 5EU7C 4J3VA 3TBYB 4UQAA 2AJSH 3DVNA 3ZKMD 3I3EA 1FNSH 4CADA 4QUOA 3QDGA 1YY9D 4R2GD 2D31A 1XH1A 2RFXA 3MRLB 3VWKB 4LSPH 3ZHNA 1WS8A 5JZ7C 4NDMB 4NQCA 4OZHA 1XF4B 1VERA 2J8UA 1D3CA 4PD4J 2HVKA 1DBKH 4R7LA 3H3PH 1S5HA 3GMOB 1JZJA 4JFFA 1F0LA 3GSVA 4EN3C 1A3RL 2HG0A 3KWXA 3PP4H 4WTWA 5GHWH 4L1HA 2FL5B 3SYAA 1E9PA 1J0YA 3B37A 3JTSB 1RJYB 1XR8B 4H8WH 4NSKB 3GSVB 1CBVH 5DI8B 3O2DL 5E2VH 3FU6A 4CC4A 1HT6A 4MAYA 3JVGC 3BJLA 4NB7A 4XE5B 2XVKA 2WAQA 4AKOA 2X9ZA 1FE8L 3K74B 4R0LA 3ZKNC 2YFOA 5L88L 5HVWA 2HYMA 5I0WA 3CFDB 2DBLL 1IAIM 3N1GC 1TO5A 1KWKA 1JMXA 1S78C 1CGTA 3MO1B 3Q5YA 2OMUB 4IOIA 2ZG3A 4ALAC 4WI6A 4ENEC 1JK9A 3D39D 5ADPH 3PU7A 5T3ZE 4KHTH 4YEFA 2BC4B 4TQHA 5KVEL 2YN5A 1IAKA 5EPMA 4PYGA 1E9QB 2V5MA 3RGVB 1DBKL 2J1ZA 2MH4A 2WQ8A 1UWGH 2ZUXA 3AG2B 5F44A 5C3LD 4JRXA 4GRMB 5FCUL 5HYSG 2LLNA 4LOEA 4LSUL 4KXAA 3RY5A 2Y7OA 2GT9A 4LOUC 3B2UD 3QUZA 4U3XA 5KBMA 3IB4A 4BZ2H 4H20L 5B38B 5D2NC 3NDZE 5IVXB 5IGXH 1R9FA 1J9SA 3HPLB 3L5JA 3HC4H 1JGVL 2W59A 2DB8A 4JG0L 4ZMXA 1ZKAA 3WXWH 3HNVH 1JF1A 3CQQA 1FFQA 4W9HC 3BKMH 4XBGA 4MCMA 3U4EA 3QDMD 2EINB 3LKNB 3N0AA 4A55A 3DXAA 3PREA 5IKCA 5HJ3A 2HG5B 1QLEH 2ENSA 3TIEB 4XO4A 1JYXA 3LKNA 1F2XK 4YIQA 4XOEA 3ABGA 3U1SH 2KLSA 4GNKB 3VXUD 3W39A 2EXTA 2N01B 5I5RA 3CFTA 3Q1EA 2Y25A 4HWUA 4AQ8C 2AS5M 4C4BA 3LZQA 5CGTA 1WCBB 1GGBL 1R34A 2EXWD 2GK2A 1AZBA 4K7PX 5IVZB 1Q4NX 4BINA 1Z5HA 7FABL 1A3QA 2K0RA 4J7RA 4JFWA 1K8DA 3QNXA 3RBSA 3W0WE 4HJ0D 4B9PA 2QADC 1FIEA 3JV0A 5KYYA 2CM5A 3HRZA 5IMKA 4NCC2 3QORB 5FFOA 1X4ZA 3KYMB 3ULUE 2XKNB 5IHUH 3K4ZA 4PHXA 3JYCA 4PWHA 4ONHA 1GW6A 1C5DB 1QRNB 4OF6A 4Y9GA 1DL7L 1KBPA 2YD0A 1CTMA 1I3GH 3S5LB 5L6YH 4ZFFB 4HIXH 5IBUB 2YS4A 2APSA 3DXAD 2FAUA 4HHGA 1KJ2B 3KLHC 3NCMA 5DMJB 1ECYA 7CGTA 2VDPB 3BGMA 4J6RH 5FYJH 3NJLA 1QVOA 4UT9H 4X4ME 4AY0A 5CZVL 1V7ML 2ZUQB 4LCUB 4FD0A 1BQHB 4M93C 3LN5A 1BIIB 2GSIA 1FHNA 1IB5A 2J8UE 3EJQA 3UBFA 4P49A 5KJRH 1J1PH 3QPQC 3QPXL 5F8RC 3H53A 4J3OC 4K8RD 1XIWC 5MENE 2EP6A 2X6VA 2GJ6B 1OV8A 3O8XC 2HA1A 2OXGA 2XV3A 2YMTA 4WGVB 25C8H 3NVQA 3BH8A 4PJ7F 1GGIL 1M7IB 3I50L 3ZUCA 4NI3A 5TK2A 3RWEA 4F15C 2VT0A 1MCFA 2XZQH 3O4OC 5F7WC 4PG2C 3U46B 4JPVL 2NZIA 4Q56A 3FUKA 1GYAA 5CNHA 2HMID 3P9MA 4LHQB 3CZJA 2CALA 3MJ9A 5KEZA 2VJXA 2R4SH 4NUPA 1AG6A 4XN2A 2VSDA 1NSNH 1LMKA 3GMRB 1NPUA 3UG3A 4ANKA 4F57H 1H0DB 4YBQC 3BSZH 1VAHA 3ARDA 3UDWC 1GKEA 1J8HA 2Q3AA 3DRQB 3KWWA 4FI8A 4HIIA 1ONQA 1AQ8A 1U58B 5KVFE 2VDPH 4HJSA 4YLCA 5DMKB 2YPLD 4K73A 1SN2A 3N04A 1LP9F 1ONQB 1E28A 1KF9B 5HP5A 2DMGA 4AJYV 5C0GA 3L81A 1OZTG 4LFHG 3AT9A 2WZPD 3A4DA 4NGHL 3WHE0 1S7QA 3SD5A 2WK2A 3DJTA 4TUUA 3K5RA 1LWHA 4NO3A 4BUGA 4KVCH 5GJSL 3HUJE 2E59A 1G0DA 2ARJB 1GTNA 2K7QA 5DZNA 3SPJA 4OTXL 1NCWL 2OW7A 1IKNA 4FA6A 4XNQA 4PV8A 1AR1B 5GJTH 3I9PA 3QG6B 3KPMB 2F1EA 2PF6A 4N0YL 5CP3H 3WTTA 2KHAA 4U3SA 1YMHA 3CSYB 3FB8A 1OE3A 4XXCC 1NZRA 4JHZA 2MPAL 4HK0A 1V8HA 1YC7A 1PG7W 3RY6A 3TM6A 2YXFA 2GVYA 5FA3B 1TETL 1DVFC 4RGOL 4D3CH 4XNBA 3BSZL 5MENB 4PI0A 4KKLD 2DH2A 3V10A 3KW8A 3QWRD 3E1F1 3FUMA 2CO6B 3UTQB 3D5OF 3C87A 5KJRL 4M48L 1UUSA 3GMPB 3PUUA 4JJ5A 4NN7B 5GZOC 1ECZA 2P45B 1LK2A 3CFBA 3QIBD 1OTTD 3QUGA 4JPVH 3T4YB 3TEWA 3QULB 4E41E 2AEPL 2HJLB 3EG9B 3T09A 4QRPA 5DHYA 1RZFL 2BWQA 1JNNH 1MHHA 1A2YA 4I88A 4U1LB 5TFSL 4PP2A 3S6CA 2OYPA 3TTYA 4I9WD 1UOLA 3IDNA 3S37H 3ULUL 3CBKB 4XZ4A 2WANA 4ZAKD 4WUUD 3DI2B 2A1WL 3BH4A 1ZOXA 5I26A 1JPSL 4Z0BH 1ZV2A 4GO9A 8FABB 3GMLB 1QPPA 1U36A 3MOBH 3N85L 4ZTPH 3EDDA 4ZDHB 5IOPA 3FMGH 1QBLH 4WO4A 4TUOB 4Y2DA 4RMTA 3C09B 1EXGA 3ZL2A 2DJUA 2MEJB 4AGMA 2J5LC 1NDGB 3RNKB 5I18H 4UV7H 4N2HA 3RURA 4PJBA 3SDXE 5IB2B 1ORQB 1TZHA 4JFEE 5E03A 3H2WA 4XC3L 1DBAL 1XCWA 1JPST 2ENYA 3UTSE 1NPNA 2X3BA 3AC0A 2CR6A 4JCLA 4M6OL 5IW6A 1GJUA 2R15A 4PSPA 1DUZA 1JNNL 2YRBA 4B9GA 4E9WA 2P5WE 1A6PA 3WL9A 1JRHH 1PCSA 2ERJB 3VCLA 3DSNB 2PETA 3SE9H 1U2HA 2FGWL 3HAEG 2EIZA 4M5YH 4HSCX 1HCFX 1MY7A 1U8QB 4OGYH 3WJJA 3VB8A 4JZJB 1ZA3B 1B90A 3QUXC 3FQYA 5EA0H 3ZE2F 5K9QI 1KYFA 4M00A 4ENED 3V0IA 5I1AB 2BSDA 1KNOB 1U6AL 3AU1B 2DWEB 1F58L 2AFNA 3LEVL 3ARUA 4DKTA 1Q0EA 3FU5A 1NGZB 4WSKA 4ZQTA 5EU5A 5JNYB 1J5OH 2B4CH 4WGKA 4YLBA 2Q2EB 5J12B 4KK8D 3FTGA 5BRZA 3DGDA 3F2LA 3C08L 3NZ8B 4M93B 2KDYA 1UB5A 2VN3A 4JB9H 5DFVC 1KOAA 5AALA 1HH6A 3VFWB 3PWPD 2CDGB 3LH9A 4F8TA 3MC0A 3QQ4A 4XNDA 3KPRE 2IDFA 4DT2A 1MFAL 4FNTA 4XB7A 4HPOH 3CPUA 1VADA 3B2MA 1T5XA 4AEIL 3QIWD 1A7NH 3F5WB 1HEHC 1NC4B 5FW8A 4XBPB 4XWOC 2QVKA 5LXGH 2ZSVA 4NNPH 4RWHA 1A7PL 2C1PB 3H9SB 3P3UA 2Z4QA 4O2FB 5I0VA 4OGZA 1MCLA 5A16B 3VFSB 5T3XH 5IFAH 2H6UA 3KNBA 3RGVD 4MA1C 1BZ7A 3SCMA 8PAZA 2QDWA 4K8RH 5CR8A 1MPAH 1CTNA 5E99H 4KKBC 4B0MB 5CJXA 4ELME 1SEBB 5DMIL 4L5FH 5F9WC 1E2WA 3C60C 1OAXL 3HJ0A 3IETB 4G8GE 3EXJA 4UOZA 5DUMH 3EH4B 3UTSA 3ILQC 3GSQB 4FQ2H 2QL1A 2V4LA 3KYMA 2CO4A 4PJAA 4Y9EA 2FB4H 3GSOA 4CKVX 5JHDB 1WFIA 2F15A 3IGFA 4KY2A 5EIIG 3DJ9A 1R33A 3GSQA 4ANUA 3RVWC 1MWAA 2R2CA 5TPWL 3TVMA 5FYLH 1HE7A 1W6WA 2EDTA 2VM3A 1R3IH 4P5KA 3EGSB 5J0BA 2FO4B 1QR1A 4APXA 3CTTA 1X4YA 3MO1A 3T2LA 2YARA 5FYJD 3C08H 5C08D 3I3DA 2PW2B 2XQYA 4PLKD 5HI5D 2H32B 3EJZC 3MNVB 4HK3N 3GYRA 5ERWA 3ZTDC 3ERXA 2VXTL 4U1JB 4K9EC 4MJ2A 4PY7B 4H5SA 4HT1L 1HKFA 3FB5B 3I02A 1BAFL 4M4RA 3ZKSD 3IU4H 4G42A 3ZDZE 4MMZB 3TBSA 4Y2DC 3NTCL 4H5SB 1KYAA 1VSCA 5I5JA 4X6CE 3TO4B 3GRWL 5B38G 2OMTB 4QO1B 2VISB 3JTTB 2HT4D 1U6AH 3P0GB 3PRZA 4PEEA 1FNAA 4ZS6C 5JYLA 1PQZA 3IDYC 1S5HB 4JFFB 1FUNA 3T6ZA 4WHTA 1T1XB 3B7RL 1DFBL 1JD7A 4K3JH 3P3RA 4AVHA 1G7PB 1ZPLA 4Y4KB 5BXFB 1BJ1H 4FNLH 4AENA 2Y07L 4RSYA 2ADJA 5EF2A 3OMIB 5C0AE 2Q6WA 3ZDZF 3B9EA 4KDTC 5SWSB 3EYVB 1KCUL 1SM3L 1B4TA 1TVBA 4LPTA 3OXRA 1KTDB 4IBWA 2HWZL 1JHKL 4E42A 4NZ8A 1AD9B 4V33A 4N2MA 1JZ6A 3D87B 2WWOA 1T6VN 4XVTH 4ELMA 3BPLC 3MRIA 2LR4A 1UB6B 4O4YL 4WNSA 3NG5A 4RDBA 3LJ3A 2VR7A 4PVNA 4JRYD 1K6QH 4DESA 5I16A 2FEJA 1OAUL 4LCWD 1Z0NA 4PJDF 5I75C 1IQWL 5CLZA 1I8UA 4Z3IA 4HHWA 5EBLA 1CL7I 1UZGA 3FT2B 2C3HA 4HGWA 1E5ZA 3PWVA 3KDMB 3A6BH 3MUHL 2BFVL 4RGNC 2BJMH 5A3IC 3FTXA 1KC5L 3PLYA 1FL6A 2K1MA 1E3ZA 2XBTA 4L9LB 4LK4A 4LNRA 5HHVL 1HOEA 4HC1H 3VXSB 5JDSA 4D0DA 1HWHB 2Z91B 2XTSA 3WSQL 1YECL 2WYTA 2EO7A 4BQCA 5AVXB 4X5LA 1D7DA 3TEUA 3UJIH 3IS1X 3MBED 3FUNA 3QRLA 2EVHA 4NOBA 4X5WA 2VL5A 3KPQA 4YHZL 2GHZA 1CFNB 4FQIL 4J3OF 3W81A 3G6JB 4YE4H 4PBDA 5MEQB 4NHUB 4OBSA 2XJKA 1HKLH 4MWFB 3N1QC 4PJXA 3UBXA 3RP1A 1SQ2N 2GJZB 3LMJH 4X98A 3O9WB 1MNUH 5HY9A 4YH6A 3MRNB 1YSOA 4GRWH 4W4NA 1FCGA 2GJZA 4JJ5B 3T4YA 1KB5A 2OL3B 3MRGB 1DE4B 4OKDA 1HH9A 1QZNA 5E00B 1MIEH 2VH5H 5ISZB 3P40A 3IKKA 3V0JA 3EUDA 1BF2A 2E46A 3L1EA 2DIJA 3B5GA 2F1AA 5SWSE 4IMLB 4B9KC 3OKKA 4I87A 1KBGH 4H88H 1SF3A 3IJ7A 4XBEH 4CDHA 1DDHA 5EPMB 2VR4A 5KVMC 4HIEA 5I6XB 3VXOB 3UTTA 3GRWA 4C54A 3OV6A 4X9IA 3JBG7 4G1MA 5ICZA 1IFHL 3K6IA 3GMQA 5C0AA 1J0ZA 1S9VA 3MV9A 5MEOB 1QG3A 3VWKC 3WIHA 2NYYC 4LHUA 1KCKA 3T3PE 2E75C 4HCGA 4TRPH 1OGAE 3SGEH 4WV1A 5MEOA 1K72A 2YO3A 4OLYL 4Y16B 2QADD 2ESVD 2PCFB 4AL8H 1W8OA 5TE6H 1G9NC 3IF1A 2H9GB 1BOYA 3ASOB 1AO7D 5IB2A 2FLMA 1E28B 5T1LA 5L2JB 1U93A 1NM4A 2GQHA 5EF1A 2WD0A 1I1CA 1Q94A 3A47A 3L2MA 3LN5B 4DHLA 5KSVA 4DK3A 3WTVA 4I1PA 3W0WA 2BP0A 1RUQL 4ZS6D 2PP8A 2CDEB 4GRWB 1NBCA 4POZD 3ULSB 2CRMA 3PP4L 5GHWL 4E5XA 4JB9L 4AW4A 1SYSB 3DETD 3BT2L 3QHFL 3NFSH 2YLHA 3OC5A 3ULVF 4Z76B 2QLYA 4R97B 2P46B 2FZ3B 2VSMB 4LLAA 3WSQH 5C0IA 2P8LB 3FFOA 5E9DD 2I60H 3FU7B 2H5UA 5L4MA 4HS3B 1SZNA 5A6IA 3US1A 2BO0A 4TSAH 5HHVH 3AROA 3FCSA 3WMQA 1F45A 3BPNB 2BNRB 5H94A 5FYLE 2W88A 2X89D 4XNUH 2WN2A 3LMJL 1OHQA 3PP3H 2X0UA 3WS6C 3QZOA 3FF7A 4Y19E 4Y4FC 5FWRA 5SWZB 2A77H 4KKCD 1AQDB 3QSKB 3OKDA 5K59F 4GLRI 5FO7A 4RLDA 1H8LA 2P44B 4KKQA 4WUKL 4TS6A 3X1GA 4LAJH 3H8NA 2VKWA 3CMGA 3MGOB 4HX1A 2Q9OA 2DTSA 4HS8H 1PLAA 3REWA 3TC9A 3V79C 4IRJD 4OD2B 4DZBB 3HHMA 3QRGL 3BAEL 4TQPA 4UV4H 3SQOH 3U1PA 5KYXA 3IJSA 1ORSB 4JFYA 4G6FD 1I7TB 4PJ7E 1RUAH 5AKSA 3KPSD 3RVVC 1RP9A 5JXEC 3I6GA 2WYIA 3IDNB 3T3PB 3KGRA 3L3JA 4HJUA 5F7EH 4DFHA 2AC0A 2YD3A 1SEQL 4OLXL 1TDQA 5CAYB 1TXKA 1E0OB 2PXYA 4MCYB 4PGBA 3GGWA 3VQ2C 3F58L 3GEFA 1L3WA 5LDUA 3VXPB 3OGCA 1BX2B 2AQ2A 3LS5H 4YC2C 1CI3M 3IFPA 1B9KA 5B8CC 5IMOB 5FIEA 4NC1C 3OKEA 1S8DB 3QFDA 1ZT4B 3BEWB 3RWDA 4QRFA 4RMUA 5FA3A 5EO0B 4JY5H 3REVA 3EDFA 4OZFA 1SPDA 1UOVA 1I7UA 5I0XA 5INCA 4L4TB 4TSAL 1QFWI 1W0WA 4XNMB 3X1NA 5HGDA 1JK8B 4AC2A 3RRQA 4OD1H 1PZ5B 2AGJH 5HD8D 3L5XH 4NFCA 1RUML 3DURB 5IB4B 2X6AA 1J88A 3CFKB 1DBJL 1AOHA 3KAAA 3RL1A 3HNVL 5EZIH 3BZDA 3RWCA 3P4NB 3I74A 4WJ5B 1PS3A 1SOQA 1ZANH 1RZKH 5AG9A 1YJDL 1KCVL 3QFJE 1R3IL 3WCYA 3CH8A 2JCCA 4MDRA 1ZV9A 1QO3A 4LHJB 2NPLX 2X4TA 2I60L 2IBGA 3QZMA 2HRLA 2JCCB 5G4MA 3HZKA 3ALPA 5GGVY 1T6BX 4BFJA 4OGQC 1MSPA 5I1HH 1XCQB 2RD0A 4WEBL 5D7JA 1OSPL 2I69A 4MJIA 1RSYA 3Q2CA 1QLFA 2PYEB 1KCSH 5FGCE 2VB5A 4KVNL 1EWHA 5CWSB 2XTJD 4LP8A 4LZKA 1BREA 5EO1A 2Z9TA 5E08H 1IC4H 1I8IA 3JWNH 5DUBA 3IFLH 12E8H 1J9CT 2VDNL 3OKOA 2XBZA 3SBRA 2JJTA 4M8RA 4RIRA 4YDZA 1FV1A 4ZMQA 4HFUL 1NKRA 3NCXA 2DQEL 5E0QA 2JJTC 4QRSA 5C0BA 4U4IA 2IGLA 2YN3A 1QTSA 2Q76A 3ARDC 2G75B 3C75A 3QEQA 1QI5A 1U3HC 1T7YA 1D5XA 2HFGL 3HI5L 4C4KT 2IALB 1DN0A 3BP4B 3W39B 2LT9A 1S5IH 2QLVB 1VKXB 3QHZH 4O02B 1KLFA 2A73A 4L4VE 3FK3A 1OTSC 2BVQA 1O7DE 4G9FD 4POUB 3T1FB 4MZRA 1XXFC 1JV2A 4K0OA 1ZE3C 5FA4A 3II3A 3QXVA 3NJKA 3GXNA 3P4MB 3Q8EA 2Y06H 1WHOA 3OXSB 2AI0H 5HYJE 2N4IA 2CIIB 3PXLA 2F8OA 1OSPH 4WFGE 4GRWF 4U1MB 2V3DA 5DJDA 4KO6A 2HRPH 3EJJX 4TVPE 3DLQR 3NT0A 3BCDA 5KYNA 1C12B 1NCAL 2DF3A 2DD8L 4N2EA 2DQIH 4LCWA 4QOKD 3QPKA 4KBPA 3UTSB 4LCWB 3SGJC 1FFPA 3H9HA 1KENL 4UM9D 4GAJL 1UG9A 4NOFA 3CC5B 4OSUL 1LO0L 5SX5H 4P5MB 4Q97A 1YJDH 3Q48A 5CEXA 5D7HA 3U2SB 4YHZH 1UXWA 4R6UA 4YSEA 3WTYA 4G7VL 2YGQA 4JS7A 3VXRA 3CLFL 4IKNA 4AYDC 2EILB 3TBTA 4QHUA 4LPUA 3LKSA 5JHAA 4NNYA 4WEMB 4U1SA 4XXDA 4TXVB 5E6IB 4NNYB 1NFIB 1UOKA 1NL0H 2ZOWA 4U1NB 3SDCA 1FO0H 3BDYH 4HUUB 4JMXA 3G6DL 1P84K 4G7SB 4QJ4B 2YQGA 3X13B 3BSGA 4XTRD 1LM8V 3LTVA 3RWEB 1YA5A 3LIZH 2ENQA 4M5ZH 3Q6FA 4G1EB 4U1KA 4RA3A 2KBGA 3BISA 3KPPA 1L0PA 1PJ9A 2WWMC 4NO5A 3SYPA 5IBTH 2VIRB 3SDXF 2JXMA 5MERB 4L3CA 3FUEA 5HDBE 4ZMYA 3O45A 2OTWB 3GBNL 4GFTB 2X7LB 3FO2A 3CU7A 1EJOL 2IPUK 3HNTL 3R06B 4O58L 1AP2B 4AX3A 4A6YA 2OTWA 3LQAL 4YBQD 5I1CH 2VE6A 5TDNA 2X7LA 3HI6L 3LPFA 2ZP0T 3IM1A 4TTDC 4M8VA 3PDOB 1XGRB 5LUMA 3NCFB 3TPKA 3LZNA 4Y4KC 3UTPE 5CD3A 3KPSB 2OKMA 5ICXB 2BP3A 5EWIL 4FKHA 1YQ2A 5CLXA 2EUXA 3WIIH 1HCZA 2ED7A 4WTQA 5EUOF 2P8MB 3PABB 3GLDA 3PQYD 4PTUA 1ASQA 1THAA 5CFAA 2H32H 4N2BA 4EN2A 2V6HA 1E4WH 5I17B 4OZIB 3P77B 4ZUSB 2GYSA 5AOMA 1A6WH 3QUXA 1J0IA 4HJGB 3C6LD 4PJHE 3ZTJH 2VUKA 1U3HB 5FOJA 3GI8L 3VB9A 3FN3A 3H6JA 1B6DA 2XRAL 4WFED 2W9EH 3NPSB 4U6HA 3RY4A 2AV1A 2EDXA 4LLYB 1EUTA 2IF7A 3KXFB 2HUHA 3VFTB 3FPXA 3DX4A 3VFSA 1N2RB 4CAGA 1XDTT 5T1DL 3C6SA 5A16A 3X1FA 4HT1H 4NZDA 1KXQA 3QCUH 5DRNB 1RMFH 4UT7L 3FPYA 3PIQA 4UYQA 2FJFB 4OB5L 4L3EA 2XC8A 2ZOLA 5F9AC 1HHHB 4G8GA 5FKAB 5HJDA 1FO0A 1G7LB 3J27A 4YHIA 2PCPB 1H3VA 1NBZA 3QIUA 4LSTL 4QRAA 3BKJL 4LAQL 1A14H 1QP1A 2J21A 5IBLD 5JW4N 1TQVA 2UVEA 3QIUC 3O4OB 3IE4A 5D6CA 3RZWA 5EU3A 5CJXC 3JTSA 4G80A 1PX8A 1NINA 4LKCB 1KLGA 1NCTA 2R2HA 5FO7B 4DUXA 5KW9H 2F9BT 3V6FB 3E6HB 4LT7A 3LKOA 3VDBA 4FN0A 5EEUA 1BM3L 5AYUL 3AUVA 2NW2A 1ZLDA 2EDJA 3GQFA 4MD4A 4S2SA 3MLRH 2QSCH 1JMZA 4O02L 3NGBB 5F1NB 5EEXA 1XZ0B 2X1QA 4GBXB 3AQYA 4HP5A 2IDSA 4ZUUA 4KUZL 2ZCHH 1VDGA 3N50A 2HVBA 2Z1KA 5EDSA 4FFVD 2C1OB 2VJ0A 5JW5A 5AZ2L 1J8HE 2E47A 3MV9D 4WI5A 1E6OH 2UZIL 3GZPA 4Y7MA 5JHMA 5E9DB 3AY4A 2PTUA 1G7IB 2GTWB 2ZOKB 3RVWD 4J1UA 2K6ZA 1U8LB 1SY6H 3GSXA 1J0KA 1UWXH 1MKFA 5DTFB 3VFOB 5I6PA 5GQBA 4K23H 4NWTH 4UT9A 4FEIA 3MR9A 1S8DA 5H37G 3QFJA 1A21A 1KIQA 2ITDB 3JWOC 5B8CB 1MCWW 5JXEA 1N5YH 4U1HA 5TTRA 1F1GA 1NCOA 3WHXB 2FX8L 3UZQA 1Z9PA 2X0VA 3SDCC 4LRIC 1KCBA 5LN4A 1LTXA 1W0VA 4X6EA 2WOYA 4KNUA 3BJ91 4NM8H 4KZEH 1QUNB 4JY4A 3TYGH 1SMOA 1GY2A 4YLQT 4OD1L 3CUPA 3QEQD 5F96L 2P49B 3P4NA 4A04A 4KPHL 1FZMA 4NFDA 4RNRA 1DSFL 5T3ZD 2A9BA 1D5BA 1CDIA 2ZWSA 3BAYA 4XP4H 2IDTA 2QR0B 2ATAA 1TVHB 1BHGA 1UKSA 3IJ8A 5I73C 1MDAA 4KMTH 3U25A 4E41D 4A2MA 4M9PA 1MZZA 1RVFH 3UZEC 4C83A 3DKHA 2IADB 1EEZA 1H19A 3EOYG 4I2XA 1WAAE 2BOCB 3DIVA 3HG2A 3TTSA 3ET9F 3SDXA 4MFHA 1WIPA 1S9VB 5I19L 4HWBA 4KRLB 5F7DB 1PL3A 3TCTA 3DSFL 5HYSA 4DUWA 4DK6A 5EN2B 3O2VH 4HG4K 3TT3H 4OCNC 2VC2B 3O0RL 4PLOB 4FXKA 3CFEA 4HA1A 4LVHB 3FCUB 4EE2A 2XZCH 1AZUA 1DBBL 2A9DA 3QWOB 2WW8A 3JV5A 5ICYB 4XGZA 2JKJA 2PPEA 1G9ML 4OQ1A 3OKOB 1PKOA 4ODTH 1UWEH 4EN3D 1MW3A 2X88A 3C09C 2X1OA 1QHQA 4JNXA 3L3HA 2OLDA 5C0DB 4Y4FB 4G9DB 2XU9A 4NQVA 3QYCA 1WP6A 5CJ5A 4WWOA 2HP4A 5ABDE 5DHVH 2QVMA 3AM8A 1J11A 3MNWA 1G1CA 5MEPB 1TLMA 2WYHA 4EUPA 1DDTA 1IAII 4DGVL 1PGRB 1SHWA 3B3BA 4XNUL 2WWKO 5C09E 1T89C 4WW1B 1EK3A 1I8KA 4GMTL 1BPLB 4JGJA 5DZLA 5GSRA 2KLRA 2IBZY 2ADFL 1IBDA 2H2SD 3OXSA 4OZHB 3T6XA 3SKOB 1KIUA 2CMRL 1T5KA 4U1GB 3T0VA 1M71A 2B3RA 2BNQD 3MJ9L 5FM5O 4QRPD 4KJYA 1BSIA 1QLEL 2F18A 5FYKU 1MI5A 5SWZA 2FIKA 3BT2H 4NO5B 2MCPL 3TYGL 1YY8B 1CLCA 4EI5B 1W8EA 1BXXA 1X44A 4ZXBA 5LG1A 2HLFC 3GJFA 3IJHA 4TTDD 4Z7OE 3NCYS 1MHPL 4A68A 1GMIA 2C9XA 3WD5H 4I7ZC 4OJCA 5D93B 3NSYA 4KVCL 3OG6B 4WRLA 2X9XA 1U21A 3L4WA 3DPBA 4P2AA 4YDVB 5D7EA 3SBPA 1OXYA 1GYCA 5CZRA 3CD4A 3MFFA 3BUQA 3IPEA 4HH8A 4M7LH 1TJGH 1EDHA 5CD3B 1XIWB 2DTML 3GM8A 2CD0A 4LQFL 4MZ2A 3TU6A 2CJUH 2X6CA 5DD1L 2DWDB 3L9EA 2ID5A 4PJ8D 2BSED 1I9JL 1UACL 2WQAA 1BMWA 4OAWB 2YD1A 3U48A 2IFFH 5DD5H 5I74B 1XCQA 3M07A 1YUKB 3TWCL 3RDTC 4ZXBD 3P69A 5D1XB 3BP5A 4W4OC 3WDJA 1ZE3H 4H88L 1S6NA 1HDMB 3GSNL 4GXUN 1T89A 5F9JB 1EBAA 3H55A 1EEYA 4UT7H 5C9KA 1PX4A 4F2ME 5CU5A 1KDJA 2WZAA 3KPPB 4AVKA 4N8CL 3V2AR 2OXHB 4LE8A 4G7YL 4ALAL 3LQAC 3O45B 3ARRA 1SDDB 3GF8A 4QRSB 2SEBB 2CXGA 4JPSA 2WO4A 2NX5E 4HJEA 5FO8A 2E6JA 4ZMOA 2F08A 1UQSA 2CBPA 2BERA 4QF1A 3ESMA 3O6KH 5H4ZA 4ZQKB 1I1YA 3MRIB 1IAOB 4NKMB 4OZGF 2X4RA 4GBXD 4X6FA 4HBCH 1CBJA 4KHXL 5BZXA 1T0OA 4MJ6A 2Y36H 2DEYX 2WXGA 2DYSB 4KZ0A 3VYNA 1MFDL 4MJ6B 3LHPL 2VMCA 4PTUB 4EF3A 4B27A 1CGSH 2HJLA 1CXIA 4HJIA 1NFKA 4WW2F 5E94A 1G7QA 4QY8A 2F2HA 4LARH 2NNXA 1XF2A 1TQCB 1B4LA 1FGVL 3UYPA 4Y4HC 4MJIB 5KG9B 3N5AA 2X42A 1HINL 5DRXA 4EO5A 2PPCA 3K2KA 2XFXB 5EC1A 3CAFA 3VXSA 2EYTA 4JG1L 3GSNB 3N42F 4AG4H 4HCFA 4XH2B 5JZ7D 3EJYD 3C6LB 4G70B 1U8CA 3U9PH 3ORJA 1E8YA 1PSKH 3J7HA 4X80H 5E8DH 1G7LA 2VRAA 3E8VA 5BZDA 2J4WH 4YVUA 1MCRA 1NBZB 1I8MA 2Q7YB 3SGEI 4ZFOL 3QFJB 3ISRA 4LKXB 1UD5A 1I9EA 3W38A 3K6SB 1H8NA 4WDIA 3FC8A 1KACB 1CYXA 3PGCA 2FIRT 1JPTL 1LXMA 1BYPA 1Y1UA 1WA0X 5KVDE 3CFKA 3U79A 1PZUB 1WK0A 2AEPH 2RGSA 3RJQB 3SDCB 1JFHA 2WJ7A 3RVTD 3QUKA 1Z32X 4TV3A 1PKQE 3IK2A 3VNYA 4XWGL 4MA7L 2ZYIA 3VYPA 3HG1D 3V9CA 1RK0A 3LV3B 4NM8L 3WFBH 4KZEL 3G6AA 1LO0H 4GS7B 2OMZA 3M7FB 5IW1A 1U2CA 4PP2B 4MXQC 4Q6IB 4M7LT 1HINH 3O2WL 1CJYA 4MQ7B 2CO2A 4LSQL 1F4XH 1OZUA 1S3RA 1RULL 4HCRA 4Q9RL 4Z7OB 2GTZA 4M8UA 2Y6SC 2EADA 3TBWB 2YGNA 1JZEA 1LD9A 1G94A 2FT6A 1CVSC 3U83A 2WZ5A 4U6VL 3OQRA 3P9WB 2IGFH 3FJTA 3TGXA 2EDRA 2DLEA 1SY6L 4QYOB 4BFKA 2I9TA 1I1AA 3P0YL 1F6LL 3V6OA 3Q8FA 1NCCL 2CHNA 3B43A 2N0MA 3PQYA 1P7HL 4PCSA 3DTDA 2JFCA 2Z3FA 4OGXL 2Q87A 3UERA 2UZXB 2XZAL 1OLZA 4J8RB 3TX4A 3MCYA 2VW7A 3ZJAA 1E8XA 3ALWA 4UNIA 4CVUA 1RJZB 4HS6A 1V55B 1HC1A 2IEPA 2G9HA 1K4DB 1IZKA 3ARBD 3FONA 5CILH 4OLZL 3MREB 4UINL 3FW6A 1E65A 4LQ1A 5DHMC 1GCYA 4K71C 1SXBA 1L9OA 1OP9A 2EE3A 5M94B 4OKVA 4YDIL 2E8ZA 3LKRA 4RWYL 1TFHA 2ZJSH 3NN8B 5TDOB 5I24A 2GITA 3EO1A 5FOBA 1JV2B 2H2PC 5ANHA 2N7AA 2Z31C 1EFXD 1S9XA 5KVEH 5T1KB 5F7BA 2RH0A 4L1SA 5DURB 5C0CB 2BVUA 3RJDA 2V2TA 1OL0A 4PCYA 2IXQB 4GW1B 1LEKA 3F7YB 2DWSA 4PJ9B 3JWDL 2G5BB 2VZSA 4KXCA 4KNQA 1YDPB 2QJDA 3GB7A 4JR9H 4WEBH 4JQVC 3UP1A 3KE0A 4KJWC 2CLZB 1FFTB 4MNGE 1G6RL 1QSEB 4GI6A 2VR3A 3ZT6A 2F8IA 2F54D 2FIKB 4JQXC 1S7VB 1MIEL 1QSFA 4UQIM 4GAYB 2NY5H 1HI6A 1J05B 1YEHH 3F6IA 4UU9A 4XT1C 4ZO6A 1PEWA 2EC9T 4HFUH 1XTMA 4KRPC 5ICXA 1H3XA 5BW7A 4IIZA 3WEBA 2ZYSA 2UWEB 4RRPA 5FX3A 1AHKA 2H7WA 3E2HC 2CGYA 1EDQA 4XMUA 1HOCA 4JVUA 1NCCH 4GKNB 3QUYA 3KYNB 3GUTB 1U8NA 1DSWA 1V3MA 1VZGA 3ARDD 2ZUSA 1JFQL 3OMNB 1NAMB 2GBVA 5KJ7E 1GKOA 3E8UH 3IT8D 3F7PC 2CIKA 2DV6A 2IGFL 1XGYL 3F5WA 2K8QA 1TJMA 3MLYL 4FXKC 2V2WB 4XRCB 2K45A 3DO4A 3GI9H 1TQSA 4OJYA 3VFTA 4LESA 2XRAH 2IPTH 5TF1H 4M1GH 5DEZA 3RL2A 1DR9A 4XRCA 5KUKA 5JORB 4NDMA 1ZEAH 4C56D 1F4XL 2O6DA 3CVBA 5CCGE 5IMLA 2XTJC 3NJGA 5I28A 4Q7DA 1H8OA 1FH5L 2KLTA 4U3SB 5D1XA 2AEQH 3CVIH 4Z7NE 3W5NA 1R3LB 3VI3A 1A7OL 5T3XE 4YHMH 5CZVH 5LLIC 5DDHA 1FP5A 3BT0A 1GC1L 1N18A 2NY4B 4X99A 1CL7L 2DQUH 4HMCA 4GAAA 1DQQB 3DECA 4KTDL 2A9NH 2EYSA 4IU3B 4P46B 1BFOA 5GGRY 4PWIA 5TJWK 4P4KB 1EO8H 1U8HA 1IQWH 4PGCA 2A38A 4MNHB 3QCTH 1XD0A 3QUMH 4X8CA 2APBA 1W6LA 5T5FL 1HHGA 1KFAL 1YEKH 5EOTA 4HEME 2GJJA 5C0BD 2YXVA 1MRDL 4CJ1A 4G5AA 3PG2A 2MFNA 1MW1A 2X4QA 4X6FB 3GZQA 4XC1H 5DR5L 5DA4A 4X0NA 4QHMB 3HZKB 3RG1C 4RMQA 4JDTL 3SJVA 3QWQB 4R5TA 4WSJA 3QEGL 1AYRA 3D3VB 3FCTB 3QISA 4XVUD 2G3NA 1MLCA 1QBLL 1JWSA 5I9QB 2X89A 3X12A 4YDKH 5IQ9B 4A63A 3RWJB 1F13A 3RWHA 2G0KA 3PAVA 3LEXB 4PFEA 2UXGA 3T04D 2C9AA 5ISZD 1R24B 4FNPA 1MJ7L 3RWHB 3M46A 4EVNB 1N26A 5F7AA 1E5BA 3ECBB 4NWTL 4F3FB 5I74C 1COBA 1ZEAL 1D7FA 1QI4A 4NUQA 2PYEE 1CLZL 1T5WB 5DC0A 5KVEE 4F58L 5BV7H 4GIOA 3NFNB 4N0RA 3NZ8A 4Y4HB 3VWJD 4UTAH 3PS6A 4GI8A 2R23A 1T4KB 1SVBA 3IU4L 3POHA 4D9LL 2Q20A 5A1AA 5HYQB 4NAMA 2Q1EA 3MJ6A 2Q7NA 3NDYE 2PR4H 2Q6WB 5B1JC 2NW3B 5C08A 2QKIA 5F9OL 1FC1A 2WNKA 5J56B 1BLIA 3ZDXE 4ZNEE 3COOA 3VO0A 1JGDA 5AVYB 4JUSA 1AD0A 3G04B 3QZPA 2FWOB 1L7IL 3U0TA 4JZNA 4X4MA 2DQHL 2X4NA 1IBHA 3I6LD 2J6EH 2X40A 4PRNB 1HU8A 1A0QL 2BNRD 4OD3H 3MRNA 1FLRH 1EJ6A 3WGUB 1F8TH 5DJ8B 4LRIA 2NUPA 3BVTA 4TRPL 2K70A 2DM4A 5LDSA 1K8DB 2VLLB 4XP6H 4PW4A 2B14A 1RIHL 4LLVB 1DQLL 4A2HA 3G6AB 4K94H 3W2DL 2A83B 4LLMA 3GTTA 7PAZA 4HGWB 1OPGH 4JY6A 2Q5BA 1BXVA 1N0LA 1ZVYA 2CR0A 2CXKA 3A6OA 2R29H 2F7IA 3C8HA 3IFLL 2HT3D 3MRMA 3S5ZA 5L6YL 5I1KL 1DANU 4H0LC 4K2UH 5IMMB 1N0LB 3ALXA 4DO5A 2B2XL 3APNA 1NIBA 3K2UH 3PV6B 3NPSC 4AQOA 3TP4A 3WYRA 1T1WB 4LEEA 4XPFL 4TUOA 2WIMA 3QAZB 3PV6A 1P2CB 2QKIC 4NPYA 4I0PB 1BXAA 3DTUB 1WAPA 3VFWA 4LHUB 5CLTA 1BMGA 1NDGA 1NIFA 3QJTB 5DGRA 2VOTA 3MPCA 4GSRA 4QTHB 1Q9KB 2Q7YA 4LCCC 4OCLC 4TTGA 3NZHL 1MCPH 1Y6KR 1ZAGA 2CUHA 3ME0B 3N40P 1KCRH 4NO0A 3QIWC 3Q2LA 2OYMA 2GSIB 2XHNA 1NFIA 2VCOA 2QHRL 5ENWA 1WFUA 4NJAH 1DLHA 5KAQF 4G8IB 3IAQA 2X2YA 1NAMH 2BVTA 4Y5YB 3UBXB 4YXLH 3HPJB 1IX2A 4P0DA 1GW0A 4L29B 3FB6A 4LGSB 3L9YA 4E5XB 3LKPB 5BRZE 3P3YA 4R96B 3NPZB 1NA8A 1OP5K 3TJEL 5F8QC 3L4UA 4AGNA 1UCBL 2ZUWA 4OD3L 1O6TA 2Z35A 3EJZD 3FO1A 2X2JA 4H2CA 4J8QA 3RX8A 3PHAA 3Q3GB 2OCCB 3G9AB 3I9GL 2DQCH 3O41B 4GW1A 5E5MB 1MHCB 4FXGC 3M7OA 1NGQL 3M17B 4KTGA 3HG1B 1BA9A 2J5WA 3SY6A 1FIGH 3KCPB 3ZKXB 3HW7A 4IRSC 3BPLB 4S11A 4M1DH 3VXUB 4GRLC 2WNXA 5EUKB 4NPKA 4ZQKA 2C3VA 3O6FA 3S3CB 3ASWA 4IRJB 2L7QA 3SYOA 1PFCA 4HKZB 4Y16A 5JPNC 4RFEA 1IM9A 3WE6B 2JTDA 1WZMA 1Z66A 2PTVA 3WNMA 2GY7B 3UTPD 4JKPH 3L6FA 3WG7B 2R0LL 3P3SA 4UIKL 2ESVA 4KJPD 1EXHA 1CXKA 4FG6C 1IUZA 2C4FU 3BP7A 3FFDA 4JHAL 3RBGA 1FRGH 3BD3A 5DK2B 3Q6GL 3ASNB 3BQUC 4R4ND 4KX7A 3V0WL 2G60H 1E50A 1W9XA 2CIKB 3GZOA 3O9WC 4K5OA 3M1BB 5MEPA 5FHAH 3ARYA 1OD9A 5L4IA 5DRXB 5ISZE 2Y07H 2OZ4H 4GSDH 4NAJA 4PV9B 3PYCA 5JIIA 1JPGB 1NCDL 6CGTA 3CK0H 1B3IA 2B1AL 4PJFB 3DV4A 4FZ8H 4JFZH 4JVPA 4P4KC 1JPGA 3FOLA 2AQQA 3O3AB 3S34H 4R5VA 3OGCB 5EEZA 4QNPE 1S7SA 4O4YH 4XAWL 4LBAA 5K5YA 1OWRM 3KH3A 1FGVH 1NUNB 4XVTL 2ZPKH 5HDRA 1NL0L 3OKLA 4NO0D 3VI3E 4FS0A 2A9ML 1KIPA 3DX7B 1EFXB 3S35L 1CFNA 4WUKH 1UENA 2BP8A 1KN2H 3V4UL 4LDEB 4P46A 3ROOB 1IEAB 1LK3H 2DLTA 5JPMC 5E6IC 1WH0A 2VLJD 4GMSL 4N5ED 3L1OL 4PRIA 5IHZB 2BDNH 4BH7B 2GCYA 3KZ8A 4AM0B 2NXYB 1CMOA 3DXAE 3S8FB 3ZSTA 4KTEH 5E8OA 3EAKA 1V54B 1TTUA 3P73B 4J3BA 4JE0A 4P9ML 3B56A 4WJ5A 3L17A 3QS3A 2IWGA 5EBLB 2FEEI 2H32A 2HH0H 3EOBA 1U8NB 5CKGA 5DJ2B 3VSUA 1VLXA 4GYBA 2VSKB 2X4UA 3FHEA 3VXUE 1C08B 3E2HB 3O4LA 3EHBD 4YDNA 1AFVL 3L4VA 1N6UA 4L8SC 1AOZA 1D9KC 3WUWB 5EU7E 5DURD 2P24A 3NIDE 3CVDA 1NOLA 2YKKA 1EGJH 4QHNB 1WBXB 3PGFH 3TONA 1R4XA 2YUZA 4KV5E 2R56L 4B9YA 1JL8A 3BVNB 3DO7B 1ZJAA 2YD9A 4NO2B 3AXIA 5IR1A 4FJZA 1IC7L 4GG6B 1NIEA 1BBDL 2EUZA 3HA0A 3KPQB 1ZHBB 4QHLB 5CWSA 1JG9A 2A6DB 3SGKC 5BO1L 1BVOA 3BD4A 1UWYA 1TITA 4FI7A 4MRBA 2OBGA 3L4ZA 5CIPB 4FMKA 3NIGB 2DQJL 3CVCA 3CVHL 4DFIA 4MNHA 3W0WB 2VH5L 3MBWA 1CYWA 3TO4C 1IAOA 1U8PB 5C71A 2NTSP 2XSKA 3IU3B 1FJ1B 2DLIA 2QTEA 4P59L 1XGTA 4MJIE 1VGKA 5C0ND 3FT4B 1VPOH 5BRZD 3RFZB 2VDOB 5E08L 3D25A 4XP5L 2BNQB 3L1OH 4HIHB 5T1KA 3BMWA 4PU2A 2Z7WA 4CU8A 1JOIA 3L3GA 4OZHE 4ZPTB 3WN5A 3U0PB 3L5XL 5DJYA 5ITFB 2TRYA 4NQCD 1RD6A 3HB3C 3TCLB 2NZ9C 2FTAA 3PV7A 4Q58C 4PJ5A 2AEWA 3VJ6B 3UYPB 1D5MB 2ZUUA 1LO4H 2MQ0A 5E8PB 2AJUL 2DJSA 1OP3K 3DIDA 2EYTB 3TN0B 5K39B 4GAYA 3MV7D 1JZ2A 4GRMA 2OMXB 3DROA 1WZ1L 4N9GB 2WCGA 4K55A 3S36H 4GP4B 2PR4L 3SZKC 3A3YB 3D4GA 3TIDA 5DZJA 3FN0H 3ENEA 5B1CA 1CTOA 2VABA 3B2DC 3RYMA 1QFWM 2BSTB 2VLME 5GPRA 4LIQH 1ZLVK 3ROLB 3MODL 4ZMNA 3TVMD 2BIQA 3D2UD 1B0WA 2YFNA 4IGBD 1JGLH 3MZGB 3ZZLA 4B9FA 1HCVA 3BWUF 3LNDA 1B4RA 3EFFA 2IWKA 1Z3RA 1F4WL 3KG5A 4MCZB 4OGAC 3IDMA 1FWXA 3SOBH 3T8MA 3MLTB 2ZUTA 3GHEH 5E2UL 2BM3A 3GBNH 3EF7A 1S7RA 3QUZD 1A65A 5JORA 4UMSA 5E2TL 4BFFA 4U4BA 2XG5B 1DJSA 2HWZH 2W60B 1I3RA 4IBVA 1NCBL 4XAKD 2GFBB 2XXFA 1OCCB 3DYPA 3TT3L 1WG3A 4A7QA 1QYGH 4PVLA 3GSUA 4P2OC 4ZX5A 4DGWC 2FRGP 4Y2OB 3QAQA 4DUVA 5IJVA 3MOBL 3N85H 3MA9H 1I85C 4ODBD 4WUUE 3WO4C 1G6RB 5HVHB 3K4AA 1OVZA 2D4FA 3FHAA 1NGQH 1SJHA 5ICZB 1AGCB 3D39A 1FNHA 4L3CB 1FRGL 1H8SA 2XBDA 1GPOH 1RFDL 5DC2A 4F37F 1BM7A 4PJCA 5F7YC 5I8KH 1UOWA 2EECA 4PRDA 5EZPA 4MQSB 3DUSB 5JYMA 5AVTB 3ZKXC 1C9SA 2X6UA 2AJVH 5BV7C 3U30B 1CDCA 4LVHC 2NRDA 4MAYD 1N6QH 4F93B 2XWTB 1R6VA 1KJ2A 1ZV5A 2DYPA 2JKIS 4N6RA 4KHXH 4EIBA 4QEGA 3DK2A 1NAML 5DMKA 3PXJA 4MA1B 5BCAA 4YHML 4MNQA 4JFQA 2BINA 2WTRA 1IGIH 1NIAA 2FYVA 3IBEA 3TA3D 2FJGB 3AY4C 3BWAA 3L5WB 3VD5A 1JI2A 3I6KB 4S1DC 4L0ZA 4DN4L 2IPTL 5TF1L 5ILTL 1M1XB 2B16A 5AQ0A 5TDOA 1BGXH 2IANE 2GJ6D 2EZ0D 1D6EB 1GJWA 4XNXH 1LEKB 3VDCA 1JFQH 3QQDB 4L0PB 3WNNA 4Y4HA 4F7EA 5I9QC 1SDDA 4PJ9C 3T65A 1FNGA 3KPMA 5K9OB 1AE6L 2OP4H 2IWFA 4P5TB 3MCKB 3MRRB 1ADQL 1ODAA 4HW6A 2VDKB 5MHSE 4P05A 3IDXH 4LVEA 3TO4D 3TV8A 3EXLA 1BPVA 3MFGB 4FFWD 3PHSA 4ONGL 5I2IB 1CFBA 3II1A 4J39A 5IKCB 5B1BB 4OZGB 3BFQG 5T3XD 1R75A 4F8LA 1U3YA 5GZOD 5I8CB 4HD5A 3JYBA 4HU8A 4PIBA 3CV5A 3ILEA 4HPYL 4YN3A 3WJJC 1BYNA 2PW1B 1A7NL 1WQVT 5J1AB 3MJGX 5DJ8A 2EKJA 2IH8A 4XAKE 1O6VA 1G7QB 1NCWH 4JFDD 3E7JA 3TO2B 4KJPC 2MTPA 3VFVA 3EG9A 4QXWA 4MYPA 4TSBL 3MLSH 3KXFE 3KYKL 4BUQA 4OGXH 5FKPA 4HKXB 1PLCA 3GMNB 1JYVA 5DS1A 1TJXA 3FQRB 1IEHA 1D9KD 4NC2B 3S5LG 1JZ7A 4GUQA 3N1MC 2YZ8A 2YWZA 4KQ4L 3VXMB 2VM9A 3ARED 3ECWA 2RFXB 5EO1B 2ZOKA 4DEPB 4IBQA 3AGWA 1T83A 4UAHA 3O3AA 3MV01 2E7LC 2ZUVA 1KTRL 2HJFB 2E56A 3HKZA 4E9YA 3K6NA 3DVGB 2VDKH 2E86A 4N85A 4UTBH 3K6SA 4U7SA 1DO5A 1JHLH 4PB0L 4MDJA 4J3TA 4WDIB 1QWHA 3V0DA 4Y19A 1J1XL 2ERJC 4AJWA 1ILUA 3MMEB 5FYLD 3E38A 4KKRA 2NSMA 4MNQE 2YD8A 5CF3A 4KKZA 3L9RA 4HLJA 5LGHH 5D1QB 4L37B 5DJZA 1IBFA 4LKCA 3V6FA 5C70A 1PAMA 2ZIDA 4CBPA 2A5UA 2CG9X 1RZJC 2GAZB 2L04A 4XO8A 4KROB 2HCZX 2X4PA 4FQXB 1NBQA 3CN4A 5KBNC 1KGCD 2IH9A 5HGGS 3EJPA 3P73A 3VG9B 4Z7NF 2ORBH 1JI1A 1MFVA 3NABL 3D25B 4BK8A 1A2YB 3QR1A 1Z3GH 3TBWA 2VXSH 1ZA3A 2X53A 1TCMA 4W70A 4G8EB 4X80L 2CJ3A 3V4VB 3HG1A 2XI9A 1YEEL 1RKRA 1SHMA 5GRYA 3SPGA 4X6CB 5HHNA 3LIZL 2WZPA 3N44B 4J6RL 1TUPA 1A1NB 1A7OH 2W07B 5EN2A 2WXNA 3B4NA 4FG6D 1H6FA 1WBYA 2VXVH 4KK6D 5SV4A 5CGYC 1A1NA 2W07A 3QRGH 4PB9L 3ME0A 4B9IA 3QWOA 3VI4A 2R23B 1JYWA 5GRZA 1HL9A 3DHMA 4KPHH 1ORQA 1HXKA 1TZHB 5A43C 1KJ2H 3FH5A 1J8HD 1JUFB 3LNHA 4FULA 4MD5A 2G2RA 3QCTL 3ROLA 1ETZA 2W65B 3SE6A 5C7XL 1DJYA 3FMGL 5D7IB 1KWGA 4OM0L 3C5SA 2CHXA 2Y0SA 4Y1AB 5HJ3B 5H35B 4XCEA 1A9BB 3VXSD 4RNRB 4L4VB 1C8QA 3MXWH 1KG0B 2VDQH 4LEOB 2O93L 1GCFA 2OULB 4PW9A 5EZLB 3T8XB 2V7NB 2EEDA 4BKSC 2ICWB 1ZTXL 1Q9LB 1I8KB 4KRMB 2J8UB 2VLLA 4HAFA 4QRPE 3V6OC 2AJUH 5JMRA 4N24A 3KWTA 2HVKB 4F7CA 1IBGL 1JZ8A 2Y2WA 1FAIL 3VACA 4W81A 4G5ZH 4HJ0C 2WXMA 2R4RH 4LSDA 3E1ZA 5HXMA 4JO4H 2JCCF 1RPQA 2BP8B 1FGNH 3GSWB 4YFDB 2B1HL 2R0KL 1KTCA 3IETA 4ZAKB 1A6UL 4KQ3H 5E1GA 3R19A 1H6UA 3SBWA 4ZAKA 1E27A 1JGVH 4B97A 5ANMA 1EZSA 2Q8BH 3IJHB 5L0QB 2X1PA 2EICA 4PJAE 2AMGA 4TVPH 1DTUA 1JHTB 3VUAA 1N10A 4ZFOA 1X9RA 2CLRB 1CICA 3R4DA 4DTGL 2XFGB 5KANG 2QGDA 5FPIA 3HUJB 4KWUA 4B9ZA 3HLKA 4IRSA 4DVRH 2NYYD 5D71H 3B83A 5K1NA 3HC2A 5EV7A 2YPVH 4E2OA 5JW3H 1A6TB 5FAAA 2E5EA 4Z3JA 1YNKH 5DMGC 3GGWB 1ADQH 1GHFL 5ESQB 4F5CA 3ZDYB 3UBXI 4AVJA 5I1IH 1A3RH 4H1LA 1M56B 4F20A 3H9ZA 4DP6X 3PWJB 1Q8MA 3BVNA 1WE5A 1TNMA 4O5LL 3DUUA 1MCWM 4KUZH 4HIJB 3ARVA 4BBWA 2NQCA 1HHHA 3MRJA 2IDQA 2VZ3A 1NCIA 3PWJA 3SKOA 3V7MA 5I1JL 1ZLSH 3KPLB 1BV8A 2MCPH 1ZRUA 5J1SC 3GLZA 3QIUB 4JO3L 1CU4H 5F9JA 3BE1L 5IVXA 1MI5E 5ICUA 3SBWC 1EZLA 2VM4A 5MERA 3KPLA 3N0PB 1NDMB 4NC1E 4R26L 1JSYA 4EN3A 4P5TA 5IFHL 1R3JB 5HHOB 2XN9A 3QORC 4YSPA 3BGAA 2J8UF 1PJWA 3MJWA 3ZL4H 2VDQL 1ZDSA 3QAZC 4NCC1 4L8BA 4RQQB 1PZBA 4M43H 1MLBB 3MLUH 1QRKA 3FSVA 5EMYA 4DAGH 2X4RB 4ZUWB 1U58A 4ZNEA 3ZQXA 3UACA 4G5ZL 1B0GB 3TBCA 2AJVL 1IIKA 4NT6A 3SE8H 3ZE0E 2EIJB 2MJWA 3IXAA 4AH2B 5EC2A 4PJDB 4UI2A 2OMWB 5F7MC 1JVOA 3IVKB 5IVZA 3HNSL 1CDUA 3NEOA 2UZPA 1ZTXH 3RIFF 2YKLH 5EB9A 5EOQH 4AH2A 2NY2B 1ED3A 4KFZC 3GHBH 3LN9A 1AMYA 3VXMD 3LH2L 5HHMD 4U3HA 3BQUB 1M9WA 1DBAH 4PGDA 3VFVB 2FJSA 1NJ9A 4M62H 4MMXA 6FABH 4I18A 1P5VB 3AQXA 3KH4A 1OIOA 3A67L 4BA0A 1AIZA 3V7AG 1A64A 4G6KH 1HCYA 2NY0C 4YZWA 4DO6A 3RHWK 3AG3B 3ATEA 2JLPA 4JRLA 5I8OL 4TUKL 4LNRB 4IYKA 4L3EB 4EI0A 2W8CA 4B6ZA 5G2NA 2CO7B 15C8L 2D7TH 5IESH 4M6ML 1P53A 4X6EB 1X5HA 3ZXAC 2QSQA 1QPKA 5C0DA 2WJ5A 1SQMA 2KPWA 2VLRA 4FX5A 4HIPA 5DYOB 5D6CB 1FJ1A 1JHKH 4Y19B 3T0EE 2VDRL 2Y1VA 1NBYA 3ROOA 3S2AA 4AK2A 5HGBA 3W5MA 4E36A 3LHPH 1IGTA 4RFNC 2NY1B 4O9HH 1UADC 1T66C 4AM0A 4BFEA 5KSAA 3QJQB 2PPFA 1REIA 4XO3A 2P52A 1Q72L 4NZJA 4KO7A 4IJTA 3KS0H 2CDFB 2V5RA 1AIFB 3F7VB 3KEDA 4OIBA 3MLZL 3CVIL 1N59B 4G43B 2RAMA 4OZ4A 1RK0B 4Z0XB 4QRBA 4BELD 1WBZB 2DLFL 4Z7AA 5J11B 2VC2L 3UTSD 5E2UH 4E41A 1THCA 2EYRA 1AMXA 5JO5A 4JBSA 2O5XL 1YZZA 1FYHB 3C12A 4QXUH 2F5BL 3IN2A 1JGLL 1ML0A 2HB0A 3VE0B 5LAPA 4UBDD 4P5MA 4JFDB 4CMMB 3DO7A 1D9KA 1M7UA 4JPKL 2CCWA 4FFYH 3SE4C 4M43L 2Q86B 4BK4A 1ZLWH 1J8RA 1U42A 2E9GA 5HYJA 4YL9A 1SGKA 4Y1AD 3UZQB 5EU6D 4R83A 4HOMA 4HXBH 1WWBX 2W1NA 4JKMA 4QDGA 4KC3B 3IAPA 3U9UB 4PY7A 3SGKA 5SWQB 1AXSA 1ND0A 2DQ6A 4YX2H 4MD5B 3DC0A 4N87A 3KHQA 3WY4A 5J11C 4YSRA 2K78A 4APQD 1U8PA 2LVCA 3MLVH 1T66D 2JJSC 1TZOA 2BMKB 2NTFB 3VDAA 2W60A 3GBML 2ROYA 3IFOA 3NIFF 3OBAA 2VUOA 4L5FL 4YHLH 2GFBA 1G84A 5AW0B 1CDGA 3GDCA 1G9MC 2VW4A 3RZCC 1OY3B 1U91B 2ZXQA 4I0KA 3SPHA 3WD5L 1PZ2A 1L9PA 3VWKD 5LHDA 2H2SC 4D8OA 1QQDB 1NSNL 1A4JB 4OH2A 1RZ7L 4PWFA 5I6MA 4LSTH 5GGSA 4AGLA 2H2PD 3ZTNH 3CC1A 4JN2A 1YYML 5C6PB 4F8NA 2QSCL