5DZJA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase 2 with carbapenem drug t206 in conformation a
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
351
structure length
351
Chain Sequence
LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords L,D-transpeptidase 2
publication title Non-classical transpeptidases yield insight into new antibacterials.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 91
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5dzjA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dzjA02
3VYNA 5DU7A 4JMXA 5D7HA 4JMNA 5K69A 4QTFA 4HU2A 5DZJA 5E1IA 5E5LA 4K73A 5DCCA 5DUJA 4A52A 4GSRA 3U1QA 2HKLA 4QR7A 5DVPA 3TX4A 4LZHA 3VAEA 4QRAA 5DC2A 1ZATA 4A1IA 4XVOA 5E51A 4A1KA 4GSQA 4QRBA 4GSUA 3ZQDA 3U1PA 3VYOA 3TURA 4Z7AA 3ZGPA 4HUCA 5DZPA 5LBGA 3ZG4A 1Y7MA 5E1GA 4LPQA 3VYPA 4ZFQA 5LB1A 4A1JA 2MTZA
chains in the Genus database with same CATH superfamily
2CSPA 3QBTB 4HUUA 4R7VA 5F1NA 4CILA 4OFQA 1KB9J 1IARB 4ODUB 5KSUA 1H15A 3Q2WA 1BQHA 2IPKA 1QEWA 2R2EA 5EF3A 1BM3L 2DLTA 2DAVA 2V37A 3S37X 3JVFC 4QRPE 1W9XA 1DVTA 1S3KL 3BSZH 3DX1A 1UENA 2NX5D 1EHLL 1IZKA 2R29L 1XTMA 4IBYA 3RWHB 3RX9A 5JHLL 5DZOA 5C2UB 2WLLB 2CDEB 3EGSB 3OKDA 4OF6A 4PCSA 3EIFA 4LLVB 4Q74A 1QRND 3SQOH 5IHZA 5D1ZB 1KTDA 3U36B 1KLUA 2FJHB 3MC0A 4H26A 2VM3A 5C0DB 1OCWL 2CDGA 1DQLL 1XCTA 4LLWB 1MJJA 1KBBA 3PWLB 3K6SA 1UWXH 2UY6A 2X3CA 1IT9H 3KCPA 1H6TA 4K3JL 5SWSD 3EFOA 3QDGE 3LPGA 3R4RA 5D6CB 4GXUN 3ESVF 1J9CT 4KUZL 5JQIB 5BO1H 1REIA 1T83C 2AABH 3E1F1 2FGZA 1F18A 4UNTA 1CLZH 5J6GA 5IMLA 4X9FA 1P7BA 5I9QC 2H3KA 3VFTA 3P40A 3DJ9A 3ZYOA 3DVNB 4MXVE 1Q9KB 4PRPB 1U8MA 1IQWH 5AZUA 3HZMB 2VWEC 4E9QA 3O4OC 1ZLSH 3ZOAA 2NYYD 3QARA 5IGXH 3VXNA 4ZOEA 3MRHB 4GMSL 4PB9L 1RERA 3HI5L 3UGXA 4X0KA 1HTYA 3QXTA 3E38A 1WZ1H 5DEZA 5I9QB 3HBZA 4J2XA 4KBPA 2EP6A 2V3FA 3FFCA 1QTSA 4R4FH 1HL8A 4OJAA 2C1PA 2CU9A 4AM0B 4HLZG 2GAZA 1VB9A 4LGRB 2EYRA 1ULVA 2C3HA 1MJUL 4RMRA 4UIKH 3BVDB 2RB8A 2HTLC 1U8HB 3MRLA 1LTXA 3GSQA 3SE4C 4EQ3A 4EZJA 1DN2A 4PJHF 4XN7A 3ROLB 4I85A 1J1XH 1ZSDB 4GUPB 3GLZA 5EBWA 3RDJA 4JHUA 3LKNB 4PGBB 3WLWD 4UV7L 1RVFL 4PVLA 4TQEH 4KKQA 4G9FB 4YPGA 1DQQA 4IRZA 4L4VB 2TAAA 4WI6A 3CHOA 1FYTE 4A55A 5LG1A 1YN7A 1W8NA 4PJGE 2WVVB 1AIZA 1F1GA 1TTCA 3QIWA 4NO3B 5AAMA 3WD5L 1RI8A 1XF5B 4XWOC 1KXVC 4HFUL 5FGBA 3GMLB 3ARGA 5C09E 3MXWL 3V4PA 3KWUA 3D87B 1OAYH 1F56A 2IDTA 4IDLA 3SDXE 5I1KH 4WDIB 1I9RH 4B9ZA 3CXHK 1FZMB 4YUEH 3T77B 4BYHA 2FD6H 3NDYE 4JCMA 1LEKA 3AJ7A 3VWKC 3EFDL 3D85B 3L3JA 1JYVA 1GTNA 5IJVB 3PGFL 4JVWA 4NO2B 2ARJB 3NESA 3ULVH 2WZPD 1U8OB 2CZNA 1J88A 1DBKL 4KVCL 4EN3C 4PRBA 1CBJA 2CALA 4JZJA 2UZIL 2BOCA 3GHEH 3I6GA 2FO4A 4LU5L 5JIMA 3JXAA 3VWKB 4URTB 2ADJA 3HS8A 3VXPB 1Y18A 3HMXL 4AGQA 4XX5A 3ILQD 3IWUA 2MSPA 5EO1B 3CMOH 1WGOA 3E9TA 1QLFB 4PCYA 4PY8J 2DLIA 3NJIA 4MMYB 1BVZA 3F2LA 3RUGF 4A37A 1NWOA 4Y2OB 5FF6B 1INDL 2X2UA 3B7UX 3C8KA 2H7WA 4OFKA 3CXDH 3OMAB 2AFNA 3A6BL 1DQIA 1JZFA 2V5TA 1NCJA 1VA9A 2GHWB 4KI5C 1MZZA 1H8SA 5INDB 2Z7YA 4RA0C 1U58A 1JV5A 3GIVB 1EAOA 4DUWA 4V1DE 5CEZH 1MHCA 1GJWA 2N0KA 4OJFH 4PS7A 1GJUA 5HHOD 1MVUB 1ZHKB 3BAEL 4G8FB 3A67H 3GO1H 2YSSA 4LBEA 5DJYB 4GB9A 2UY7B 1HNGA 3Q2VA 4YE4L 5GGQL 3MRIA 3G5XB 3GSNL 3O6FA 2W59A 4UT7H 5FKAB 1HKLH 3HNSL 4WQOA 5B3JF 4XMKL 4MCYA 5DR5L 3UC0L 1PPIA 2CCVA 2CIIA 4L3CA 4OZHE 3V8OA 4B27A 4NN7C 2W0LA 1U8LB 1V7ML 2XN9E 1T80A 2AKRB 5SWSB 2C3VB 3OLIA 2P24B 1ROWA 3APDA 3VFGL 4JHAL 3C5XA 1OCCB 1BVOA 2HN7B 1D5ZB 3TEUA 1FBIL 2NY6C 1QA9B 3MRJB 4NN7B 5TQ0H 3X2QB 2HFFB 2IMNA 2ZF8A 1HDMB 1TQWA 1K4CA 1S4IA 4FXLA 4XNUL 1BBJA 3FHAA 4A6YB 3ULUC 3WOVA 4P9ML 2I69A 2FR4B 3RNQA 1FIEA 3FSAA 4Q2ZA 3BPNB 2NY6B 3PWPE 4P3CH 5K9QI 3JWNG 1DYZA 3IXAA 1U91A 4MNQE 2JTDA 3DX4A 1UVQB 2P43B 3VFWB 3UAAA 3VFVA 4D8OA 3ZUCA 3DX6A 2ZOLB 4U1IA 2FWOB 3QNYA 2NY2C 1MCRA 3Q8CA 4N3UA 4Z5RB 2FLMA 1YMMD 2P8LA 3FOMA 3LZPA 3FZUC 3VXOA 3FRPB 2X1QA 3OAWA 4OB5L 5GPRA 5DC9B 5IWLA 2XTJE 5E5RB 2KQNA 1Q38A 3CNKA 1HCFX 3VWJD 1ZLWH 4A68A 4TSAL 2XBTA 1ONQB 1HHGB 5HVGB 4JQVA 4KK6C 1ZT1A 1EXUB 1T5XB 3DTDA 4LNRB 1DVFA 3HUJF 5HI4D 4L1DA 2WTOA 3UAJC 4F15C 4Y4KA 1QPKA 1CK0H 1MF2H 5DRWA 1XGUA 3MLPA 4OCYL 1JJUA 4IIQB 1OAKL 1CPUA 5L88L 4Y1SA 1ZPUA 2IWEA 3P54A 2EVHA 4HUXB 4HIJB 4B0MB 4MQXC 4YEEA 3UADA 4F1SA 3FUNA 1E9OA 4BSVA 4HU2A 4F15B 3BN9C 3PJSB 3QHTC 5ILTH 1ZV9A 3WE1A 5JIIA 2R4SH 2YKLL 4I2XE 1WSST 4LOVA 2A6JA 3U9PH 1NDMA 4QHMB 2XTSA 3GGWB 1U8CB 2K78A 5F97E 4UAOB 3PNWB 3Q1SL 4X98B 4QXWA 1LJMA 1KUMA 4QTHB 2YLKA 5C0CD 2ZWSA 3WTTA 4YFLI 5JUEH 4Q0XL 4ADGA 2A3TA 2W80C 3N41B 1WBZA 4Y9FA 3RPIB 3DXAA 4Y4HA 3VRJB 5CJXC 4B9FA 4AGMA 4I18B 5D2LA 5TK2A 1KXTB 4G43A 3VXTA 1KJ2A 3FO9B 4OLZL 1XL6A 2QEJA 3T0DA 4HX1B 4B7IA 3ZPDA 3IFOA 1QWHA 1K5NB 3QDJA 1O9WA 2TRHA 2NQ3A 1OALA 1EAPB 2DM4A 4BH8B 2CK2A 1DCLA 5D5MA 3F01A 4YHIA 3B9KD 2VB5A 5D70H 1QTYT 3KGUA 4UTAL 7FABH 5D72H 4LL9A 2NX5A 1A3LH 1AQDA 2EDMA 3KAAA 1SDAB 1VEOA 5AZEH 5E08L 1B4RA 1SJXA 3F7YB 1R3JA 2XWEA 4PJ8D 3S35L 1N6QH 3ECBA 5AW8B 2CK0H 4KNQA 3QWOB 2N3JA 3C5JB 1N68A 4KQ3L 4TNVK 3IN0A 2Z6FA 3BP4B 4OI9A 2OZNA 5KJ7E 5EO0B 4K71C 5HYQB 4JMXA 5CUSH 1I3RB 4ODWA 1NGPH 5J13B 2OMVA 4S11A 3EBHA 3APFA 4HIIA 4S1SH 1AXSB 1KB5A 5B39G 5IVZA 5J5EA 2IBGA 4WNJA 1DSFL 3CHQA 4MJ5B 1TPXC 1MDTA 4QHLA 5EU3A 3BT0A 4JFPA 1GW6A 4LOFA 4R5TA 3VYOA 3FUMA 4DVBB 1U95A 4XBEH 4IBVA 3BPOB 1KJ3H 2G9KA 5E95B 3C09C 1KLFA 4QRSB 1OOAA 3LEXB 3TPUA 1QFHA 1I8IB 3WY1A 4AMXA 3QC5X 1QVOB 1KELL 3WMSA 3TIDA 2FX7H 5EZLA 3ZUNC 2BLFA 3P4MB 4WZ9A 4RETB 1EVUA 1Z66A 4IBLT 1UASA 2J5WA 4M6NH 3U0TA 4NZDA 5SX5K 4G5ZL 4FQXD 1GZPB 3C5SB 1YMMB 2QKIA 3OHMB 1IGIL 5DJ8A 3KPMA 2RHEA 1S7TA 2Y69B 2ZG1A 3K2KA 1AR1C 3HS9A 5D7LE 1RZJC 1G9NH 3KLDA 4OIAA 3IAQA 4O00A 4QTIL 2AK4A 4KROB 4RIRA 1X44A 2X10A 4BA0A 4X7SL 1HOEA 4HEPA 4IRJC 3TBVA 2A74B 3WNMA 1E50A 3DV4B 3O6MH 4WWPA 4YC2B 2DWTA 4AYSA 1BZ7B 4QOKE 1DVZA 2ZNXA 3EJYC 4NOBA 4BK5C 4B9GA 3FF8A 4U49A 4ZUSB 5BRPA 2AEQL 5I71C 3WHXB 3SYQA 3IJEA 2CLVA 4I48B 5JHMA 2VN5A 3ATDA 3FL7A 1OCOB 2XPZA 1QATA 5FYLE 5JHDD 1YPZA 2NY5C 4FZ8H 2WO3B 2HJFA 1DE4A 3OKYA 2WJ7A 3HW7A 3N91A 9CGTA 5I1GL 2ZCHH 3EH5B 2V8MA 3ZHFA 4AT6A 3QEGL 5MEOB 2GY5A 2CUHA 1QPPA 1PZ2A 2VL5A 3IS0X 4Z7WE 4PCTA 4X7CC 5DRXA 3ZL4H 3CSYA 5KOMC 3SDYH 4QYOA 3HZYB 3CC5A 3TONA 1SLUA 4JRYB 1NFDB 4XCNA 2Y6SD 1E5CA 4KZCA 5ANMA 1VSCA 3MLZL 4PJDE 3D09A 4LSVH 4Y2LA 4MCZB 4GO9A 2ZXQA 2AXGB 5C0BB 2H45A 5KSVB 1MHEA 1PJ9A 1EO5A 5CMAA 1XR8B 4M7JH 2X4PA 3CVIL 5C0CB 3ARED 2ZP9A 3GF8A 4UWQB 1D7CA 5K59F 4QHUB 5HHPB 4KC3B 4I0CC 5DD5L 5DLMH 1TZHA 5FDYA 3JZ7A 4B50A 4LCUB 4X80H 5DJ2A 3EYUL 5C9JA 4HEME 2KC0A 2WWOA 3GRGA 2ZOUA 3RX5A 1LM8V 2DM2A 3GIZL 1E4KA 1ET7A 4JN1H 5EBLA 5JORB 1GOHA 4P9HC 3BIKB 1SEBA 4DP7X 4YJZL 1DJGA 4HDIA 3VG9B 4JQIH 3VD7A 4CADA 3HOGA 43C9A 5IROC 2WQAA 3QYCA 3BHBA 3X3FL 4ZFZB 1PG7L 1I1AD 1A2YA 4B9JA 3IBEA 4WFFE 3B9KB 2R0LL 1IM9D 1EJFA 3HCVB 4GAGL 1S9XA 3B9DA 5E7FA 3HFMH 1ASQA 4JPVH 5IJKC 4P8QA 5D1XC 5KBPA 3PE9A 1NCOA 4AG4H 4ZX4A 2R56L 2GC7C 3AAZB 1HQ4A 1LD9B 1MWAB 1I82A 2P9RA 1R19A 4ORGA 4XC3L 1MZYA 4A1RA 4UNUA 1YNTB 1QFOA 3J2PA 1OARL 2AQTA 4RZKA 3GK8L 5DSCA 3RIKA 4CVZA 5EOCH 4WUUA 1HZLA 4HISA 5KANG 5E6ZA 4U1LB 5KVMC 4G80A 3IGAB 1TLKA 3IDJB 2E7CA 2RCSL 2WQXA 4LO9A 4TSBL 1CVSC 5BO0D 4FNPA 3L4UA 3ZZ1A 3KVPA 1IAIH 3GS7A 4HHWA 3WO4C 2NNFA 3L5WA 2FJFB 4ZZFA 5AW7B 3DHJA 2WZ5A 1Q9WB 3FOLA 3ZN6A 3BEWA 3MSPA 1XF3B 3GLAA 2G4GA 1BQ5A 4AGOA 1DSWA 3ZO9A 4DKEL 1OP4A 3FTUA 3MLYH 5L8KB 2VDPL 5DZ9A 4WO4C 4XCCH 5T3XL 4BQBA 1JZ4A 1X7TA 2ZCKL 4IRZH 1IU1A 1EBPA 4PJ9C 5AG9A 2OMTB 2YKKA 1PLCA 4FQXB 2PPDA 4OKDA 2PPEA 1CR9L 2H0PA 3DRTA 1J5IA 4AL8L 5KS9F 5LDUA 3OKMB 3IXTA 3I9GL 1B0RA 3CVCA 2AQQA 4GP5B 3V4PH 4JFVA 5E94B 4K0OA 1TZIB 3L4YA 3CFIC 3VWJA 3OSVA 4AQZA 5DUJA 4H1LA 1FF5A 4N8CL 1TU2A 2VLLA 1UM6H 3RBGA 1J8RA 2FATL 4DGIH 3TJHC 3QRGH 3TTSA 4WJ5B 4NZTH 4S1QH 1JGLL 4IYKA 2JCWA 3RKDD 4UZGA 3ZDXE 4YDVA 3TNMA 3IDIB 2EACA 3HG4A 4FG4A 4YSRA 3WIAA 4M6OH 5JHDB 2C9AA 4UDTA 3ZDZF 3X11B 3WEOA 2VXQA 2X4SA 3H0TA 1Y0LA 2COQA 2WBXA 4QJ4B 4NYLB 2R2BA 2HAZA 3O41B 3PS6A 2CWRA 4DN4L 5L6YH 1K9TA 1UM4L 4NC1E 3VDCA 3ZKMC 5EPMA 3ABLB 1JHKH 4Z7OE 3B3IA 2UVFA 2F53E 1WT5C 3FH7A 2H8PA 1LO2L 1U33A 2V5YA 2WKOF 1PG7W 2OR9L 4A7UA 5HYFA 2B2XH 1D5MA 1D3CA 4JKNA 3V4UL 2NTFA 4LDOB 4N8UA 5M7QA 3M7OA 4ADIA 2I85A 2XOTA 5D1QD 2N56A 3AREB 1AAJA 2YD2A 3DJTA 4XVTH 2ITEA 1IUZA 3NIFF 1FNGB 4KGLA 1N9PA 3BO8A 3HLAA 1T03H 1INQA 3TZVA 2W81C 3EF7A 3Q5TA 4NUJB 2HKLA 1H8LA 1A9BB 4UT9H 3OHXA 2GFBB 4JFFD 2QMJA 1RK0A 1VEMA 4IEFB 5LGHH 1CQYA 3B7SA 4H8UA 2R9HC 4JAMA 1D5XA 4DGUA 1RZKL 3W11D 4M7ZC 1II4E 4PGDB 5I2IB 3BW9B 4M7KH 3KYOB 5FFOA 5KUKA 5JZ7C 3BAJA 3WKML 4JPWL 3O8XC 4L2LA 1BSIA 2OKMA 1HE8A 4MJIB 1AHWB 1IM9B 5FGSA 2YOCA 4L05A 3TH2T 1H8OA 4L8BA 5F0JB 3RY5A 3L7FB 4JK0D 1LP9F 5BRZA 3MRNA 2D9CA 3P11H 3S98A 2Q3AA 1DQMH 2VNCA 4HZ1A 3SDDA 4KVPA 5ETUA 3L17A 4MMXB 3T0WA 1BOGA 1U0QA 2O5YL 2D03L 1DR9A 3CDGB 5B1JC 2J6EL 5D7IB 3QXDA 5E99L 4ANXA 1S9WA 4GW4B 2YK1H 3QAZC 3D18B 1BZ9B 1LDPH 4WV1C 2ESVD 2I7OA 4DP4X 4YHYB 4NQEA 4AIOA 4HAFA 5C07D 1G7LB 1NAMB 2HTKD 2X4UA 1BVLB 1K8DA 3K74B 2P49B 4JZNB 5HGHA 4EUPG 3NN8A 3NJNA 2GTZA 1U6AH 2V7NA 1BCIA 2WXRA 3JWNE 4GKSA 5I1AB 4PJXF 4B41A 4YX2H 3QAZB 4NM4L 3LEYL 1TTFA 4WV1B 4POYA 5IB3B 2G60L 1TCRA 3PL6B 4Z18A 1CDGA 1GGIH 1MQKH 3HZKA 3CU7A 4NKMA 4WWID 3SBQA 1OGAA 4LGPB 3ZQ9A 5GRZA 3UP6A 4WTQA 4UOW1 1DLFH 1QSEE 3V5KA 4XPTL 4MSWB 4IBTA 4Y16D 3A47A 3FAXA 4AZ8B 2YFOA 4E41E 5K69A 1VFBA 2ZAGA 1Y6KR 2CM6A 5DTFB 4QDGA 3H9HA 4CSZA 2AABL 4DH2A 1BD2D 3G6AB 2GSGA 3ELAT 1E7VA 4XXDA 2AANA 3T2PA 3X3GH 1QWNA 3CFNA 2UWEA 3HC0A 1OEZW 1DDHB 2G75A 1X7SA 3BSHA 1YECL 3OJVC 2WP3O 4BCYA 3ZO0A 1CXKA 3FXIC 1UWEL 3FQWA 1LYQA 2APBA 4G6JL 4ZMOA 4P5MB 4OLUL 4YHML 4KJPC 3MXVL 2B14A 3N0AA 1I4FA 3TESA 2PF6A 4NRXA 2CJUL 3KGTA 3H2QA 2HRLA 5AL8A 5EIQA 3TT3H 3U4EA 2QR0B 1O6SB 4PGCA 1NEPA 1T0MA 2GJ6A 1JK9B 1FUNA 3LKPB 4P3DB 5ADPL 2EVIA 1CF8H 2Y7QB 4N25A 3SO5A 1IV8A 1VDGA 5KYYB 5GGRB 5IOPB 1JPST 5EU6E 2B20A 4MHHI 2YD6A 1SXNA 4XH2A 2EDRA 2K6ZA 3VW3L 4M5TA 3GXPA 3LIZL 2BMKA 4X6EA 4XMLL 4H5SA 1FRGL 4G82A 1XZWA 3A4FA 3S4SG 4J28A 2WCGA 4UB0H 1OPGH 5GGVY 4X6DF 3DO4A 1G9HA 4WI2A 3MNZB 1BAGA 4CC0A 5T5FA 2H5UA 5D1QB 4U1JB 3FUEA 3ARDB 1G6RL 1XGZA 2FL5A 4XN8A 4I3RH 3UTTB 5HYSG 5L4MA 3MRCB 1WUZA 2XXMB 1F4HA 4R6UA 4TM9A 4ZT1A 3UTSE 3QAQA 4KMQA 3T3PF 5F7MC 1WEJL 2DM3A 2B4CC 1FFNB 3O2VL 1DL7H 3VXME 5BZWA 4UU9B 1QO3B 5JDJA 2RMNA 1FWXA 4ZDHA 4PJCA 4JHWH 4Z6AT 1WRFA 2HKFH 4XPFH 5DRZA 4TVPD 4KKLC 3O3AA 3QZBA 2C3XA 2A4ZA 2OULB 4OLEA 4FXKB 4HVBA 3AC0A 4WUKL 5LXGL 2J8UA 5F71A 3N42B 1AJ7L 2Q7AA 5JHAA 4IRSD 3ZTJG 5F7UA 5DYOA 3ZTNH 3CZFA 1W8OA 3WFCH 1RU9L 4KNUA 1I1AA 3GDCA 5FYJL 1A3RH 3SOBH 3MRBA 1MJ7H 1HZHH 2XQ0A 2BNRA 2AJUL 4GG6B 4HUVA 1IEBA 2A77L 3DGCR 4D0CB 5HGDA 2QQKH 2WN3A 5FB8A 1MLBB 1H5BC 2FK9A 2GJZB 1RUQL 2FWUA 4JFOA 3DX8B 4PRNB 4IK7A 3S8WA 2XWTB 2Q86B 3QUML 1J8HA 3OM3B 4IU3A 4LEBA 2EXWC 1TITA 3MTXA 4XP5L 5JXEA 1IC1A 1KIUA 5C07B 2XFXB 1ETZB 3SCMC 3NFPB 3S2AA 3V6OC 4A7VA 3A4DA 5FM5M 1EAQA 4BUGA 4ONGL 1MCKA 3GO1L 2IV9A 2DJSA 3GRWA 2BXYA 4GUOA 3RWDA 3HC4H 3VGDA 4ZO8A 2KS0A 5C97A 5EEVA 1MEXL 3EGDB 5IVXB 2PETA 1JFHA 1ZHBB 1HCYA 1KPVA 3QCTH 1HKLL 3L08A 3SGEI 3MPCA 1FL6B 4JY6B 4A2HA 3FT2A 4OM0H 3IVKA 3QPXL 2H2SC 1RY7B 1XSJA 2OSXA 2B59B 4QRPD 4Y16B 5A7EA 1RSYA 3RB7A 4PS4H 3RGVD 2TSAA 4PJ5A 4MAUH 2R7EA 1A4KA 1YNKL 4HF5H 4BFEA 2KQMA 1WZMA 4OFDA 5T3ZE 3JT0A 5AAWA 5DD0H 3UG3A 3SE3A 1D2OA 2A6IB 2IPTL 3RI5F 3BEVA 3M45A 5FPIA 5DDHB 3KYMB 2BRRH 3FB8A 2EZ0D 5EC1B 3QDGD 1HHJA 4CNIB 4KTDL 5IB2B 1FL3B 1KYFA 1ZHNB 4PGZA 1I7RA 3HNTH 3JWOL 5DVPA 1I3UA 4NQSB 4HIQA 4DGVH 2ZYHA 1PX8A 5DJDB 3FAWA 1U8PA 3UCRA 2ZXWB 4K23H 4XPBL 1TJHH 3V0VB 5HY9A 4ZG1A 2MPAH 3AU0A 2DEWX 2MOVA 5JOEA 1E2ZA 1XSIA 3MV8E 4WWKA 1AACA 5CBEA 2APXA 4FLSA 3VD5A 3AT8A 3ZYIA 3NSYA 3QUHA 5F7NC 3V55A 3DSNA 3A4AA 2MH4A 1E30A 4U6HA 4XNAA 1RL1A 3L3GA 2O5XH 4AMWA 3EUDA 4QEGA 3IDXH 1AD9B 4I5BA 4DQOL 1B6UA 3FTGA 3HN5A 3HHSB 5CXPA 1FDLL 3C60A 2NDGA 3QRFM 1YEWA 2AZAA 2JI1A 2FHFA 4N4YB 3HZVB 1BQSA 2E3VA 3TFKC 1C08A 1SDDB 2CUMA 3WXWL 1FVEB 2CGYA 3PQYE 3M07A 1OTSD 2XCMC 4PH8A 2J2ZB 3ZE2F 2HYMA 4OGZA 4H20H 1VPOH 3DO7A 3EF4A 5F88B 1EO7A 2NY3C 1TTRA 5AOJA 3S97C 1C5BL 2V9QA 5J8OA 3LDBB 5TF0A 4UT6L 1KYOJ 2NTSP 1IKFH 5I73B 4ONHB 3LH2H 12E8H 2ICWB 5B8CB 1UZ8B 4S0TD 3QG7H 3WEXB 3BH4A 2R1WB 5IESH 1UT2A 3Q05A 4ZTPL 3VRIA 1N6VA 2VITA 2QV2A 3MACL 1FYTD 5GGSB 1AI1L 1OAQH 1ZV2A 4ODXA 2QADD 1EH9A 3S9DB 1QHPA 1NGYA 2RFXA 2O6DA 1GHFL 4PLKC 5E2JA 5GGUB 3K6NA 2D7TL 5KOVC 4YSDA 5C09D 3W5MA 2COVD 1PZSA 1B3JA 3L13A 4Z8FL 3WN5A 2N1TE 4AYGA 1T22B 1L5GB 4BSWA 4IRSB 1ODUA 4TLKA 1G7PB 1A65A 4RFEB 4X8JB 1WE5A 4PY8I 2MRYA 2VISA 1A6UL 1TOXA 2VABA 3H3PH 1DBAH 4DUXA 4XXWA 1AKJD 4JG5A 1SJVA 3CFUA 1T0NB 2VDQH 2X42A 4J6RL 4YN3A 1AXTL 5EUKA 4HK3J 3ZHKA 5AVRB 2XNAA 2VR5A 5L4IA 4CKVX 2VDLB 3QQ4B 4OZGA 5JMRA 5I8EB 4RGNC 1P6AB 5FHAL 3U1SL 1ZRUA 4ZFOL 4FQ1H 4WTZA 4G70B 3OR7A 2WWKT 3FSWA 4Z95H 2OTUB 3W82A 4AIZA 3D39B 1AGFB 2HWZL 3QDME 1EJ6A 2ZXEB 5C0ND 2NNCA 3STLA 5GGRY 2R69L 1OE2A 3LEVL 4KRPD 1B2WL 2HG5A 4JPSA 1DJWA 2BSRA 4JJ5B 4C47A 5IB1A 4V1DD 4U6YB 1ML0A 4YHPB 2Y4SA 4TTDC 5LGJA 4LHQB 1W91A 2CNYA 3EG9B 4H1LH 2K6YA 3CVHH 3AMLA 2IBZX 4G72B 4MQ7A 4QRPB 5FK9A 5IR1A 3DHUA 1JZJA 2XPGA 3VD9A 3RGVB 1FFOA 1D6EB 1MW3A 2C7UB 2FQFA 3L9EA 4X7TA 5IK3B 4HOMA 1B9KA 2DWYA 4HMCA 1NCDL 5B21A 2YC1A 3HAEA 4GRWE 1QNIA 2Q8AL 4N6RA 2WY3B 5D71H 1RIUL 1M4KA 2XN9D 2Z7UA 3NIGF 4JFDA 1BD2A 3FDWA 2W8CA 1F6AA 3C9NB 2C3WA 1UM5H 2HLAB 3L95A 3QDGB 1PCSA 2WBWB 4N9GB 1NGXA 1RJYB 1WZLA 1S8DB 1NKRA 3MCKA 4N20A 3RUGE 4ANVA 5EG6C 4MNHA 2IALB 4XBEL 4GY4A 1T7VA 1KJ3L 2QGEA 5F9JB 1G43A 4I9XA 4K5PA 4NNPH 4LOUC 5D2NE 3IRZA 3V2AR 4FTDA 3CFEB 1QW8A 2AV7A 4WK0B 5CZVH 2I60H 4HCRA 2Q6WB 3R7QA 1J5OL 4K3EH 5GS0L 4WI7A 1T21B 1P1ZA 4JDTH 5DCCA 3ZTDC 5L4JA 3PWPD 3V6ZB 3IE9A 1OT1A 4MNQD 4P59L 4QF1B 3F6LA 4LKCB 1G6VK 4WCYL 3L5IA 1GRWA 5CCJA 3JVGA 5M94B 3KVDD 5FYJU 1BFVL 3NT0A 3OZ9L 5DMGC 4JFQB 2E7MA 2NUTB 2Z3FA 2MPVA 4X9HA 2EEAA 5IBLC 4G71B 1AGBA 3VQ1C 1NIBA 3MX0B 3RA7L 2ZPKH 3P0VL 5EIIG 4F2FA 2DDQL 4F33A 5B3JE 1S7XA 2ED6A 4IK6A 4HH8A 3RFZA 3JTSA 4ZQKB 2C4FU 1HK6A 3WJJA 3OJDA 4O02A 3GSUB 1RZGB 3D34A 3X17A 3GEFA 1A7QH 2XTJD 35C8H 5INCB 1HOCB 4LEOA 4LSSH 3QIUC 3KJ6L 3VFRB 1T7YA 2OPCA 2QQNL 3BX7C 1SFHA 1QBML 2VQTA 5IF0B 3WTYA 3FQUA 4K94H 1A21A 4QD2E 3II1A 1MI5B 4HUMB 4HPOL 1F58H 2D3LA 3AB0C 3GSOA 4PJBA 4JS7A 1CVRA 4F8PA 3UYRH 3EOTL 1CG9B 3RHWK 3QI9A 2ENJA 1UXLA 5FV2A 4OLYH 4PJGB 5I6XC 1TVHA 1EX0A 3U2SB 3BP6B 4HS8H 3HG1B 3VYPA 1NCTA 1FVCA 3PV6B 1YEDB 4MJJA 2VC2B 4JUSA 4XT1C 4JW3A 2FQDA 3SDXB 2BVOA 1N19A 2G5BB 3K7UA 1J9QA 2Z35A 3M46A 1FJ1B 1H3XA 3RG1C 4F8LA 3DX9B 3OZLA 1DUZB 5E8DH 5CD5C 1VACB 3H8NA 4YEFA 1EZVX 1PZDA 1T1WB 4JFZL 4H7VA 5FHBH 2GJJA 1ASPA 4ZUUB 4ZD3H 1AO7E 4ERSL 1JHLL 1AKJB 1U92A 3GNMH 1QYGL 4KJWC 4AYFA 4E42B 1A8JH 1J12A 2IOMA 3VFMA 3ZYJA 1Q1PA 1EZSA 1P2CA 2B5IC 3CUPA 3BYTA 3LV3B 3VE0A 3VACA 4BK8A 3HUJE 1JZ3A 2DM7A 1OF2B 3CVBA 5HYEA 1I8UA 1XB3A 4Y89A 4XI5D 1U3NA 2NCMA 4XN9A 1D7FA 1FORL 3P2TA 4MB1A 5IHUH 4AENB 1X5MA 4FG6D 3HLKA 3QZWA 4WO0A 5JPMC 1UT1A 5EZOH 2XXCB 1T04A 1JN6A 4CN1A 2B5IB 1T89A 3VDBA 1N8ZB 4PR5B 1C12A 5E5UB 1BECA 4MBRA 3NQIA 3WXVH 5ALCL 1UGKA 3UBXG 5DJXB 2AMUA 4ZFFA 4LLYB 4AOFA 2HTLD 2VLJE 4DKDC 3DV6B 1YN6B 2E6JA 4HIEA 3S5LB 5FA3B 4YVNA 3WTXA 1T1XA 4ODVH 4OY9A 3N85H 4V33A 3UXFA 4A38A 5L9DL 5CFHA 1F90H 5DUMH 3HZ3A 4C4BA 4MS6A 4HOXA 2DQUH 1MW1A 4OZHB 3WFEH 4DW2H 4ALAH 3D0LB 1UQSB 2VSCA 4QLWA 2AQRA 2WB7A 2XN9B 5D9SB 1IKOP 2APWA 3MNVA 4FTVA 5GGSY 1MCPH 1JRHL 1J9SA 3KYKH 3FW6A 1PY0A 3KDMB 3DLQR 5AW9B 5EOCJ 3C12A 1VGKB 1CFTA 2N7BA 2I26N 1RLWA 4UQ3A 5JA9A 4IW4C 2P80A 3O3EA 4C56E 1LE9A 4JFWA 4Y88A 3DX3A 3IETA 4PJIA 1G7QA 4P46A 3K4ZA 2H32B 3RVUD 4EN3D 5DK2A 1CB4A 2M1KA 5CF3A 3UZQA 4IRZL 4LVEA 2A5UA 3PWPB 5GIRA 2VKWA 1P7QB 4MNQB 5CJ8A 2Z34A 2GW5A 3PAZA 1I7UA 1R3LB 4XNYH 1EHAA 2DIJA 4YDKH 3V4PL 3BI9X 5I1DB 1CD9B 2Y3NA 1VENA 7CGTA 4RGNE 3DMMC 4L0ZA 5I19L 3S6CA 3AY4A 1P5VB 3D05A 4RWYL 2NCEA 3IMVA 3RIAK 4B95C 3MR9A 5F6IC 5EOTB 5SX4I 3RNKB 2XTJB 5D7LD 2IFGA 4LHJB 5I6OA 2OL3B 4N2CA 3KPSE 5AKSA 4JANA 2DWSA 3SQBA 2UV3A 5B4MD 4LVNB 3EYVB 3OMNB 1MPAL 4HT1H 5CJ5A 1CO1A 5F6IB 5D8JL 4WEBL 4QOKD 2BVPB 1TEFA 2VXVH 3MCYA 5E8OA 4AWJC 4B7LA 4FQPA 2P1YA 1YJDC 2WPGA 3CBJB 4QJ5B 2CKNA 2PR4L 4HHAB 2WQ8A 5AUMA 4IKLA 1A4JB 1ETA1 3I6SA 2O26U 2WOYA 2XPYA 1N18A 5FYLD 1D6VH 2CBMA 2F6AA 5AD0B 1KN4H 1TQVA 3NK3A 2QSCH 4Z78A 3BKCL 1O0VA 3QNZA 1PIFA 3PWJB 2AJSH 1QG3A 4YDNA 3UJIL 4R0LA 1SVCP 4GW1B 2Z9TA 1OLLA 4HC1H 2QVFB 2WLMA 1P9MA 2LTQB 4I2XB 4LLDB 3QEHB 5MI0B 4LAQH 1MY5A 3G6JA 4Q9RH 4FC3E 2O1AA 4HETA 4ZYKA 3GLEA 1JV2B 4MD0A 1KYUA 4OZIE 2FT8A 2E75C 1GGCH 4G8IB 4WHCA 3T2LA 4CN6A 3K8MA 2H6OA 1MREL 2VXUL 1VFAA 1FZJA 2GUOB 2VIRA 2VDKH 2XN1A 1CL7I 3DKHA 1E67A 4Z7VA 4PRHA 4UINL 2XI9A 3THML 4Z76A 1A4CA 1K2DB 1WP6A 3CU1A 5KBLA 1JWUB 1NKGA 5HDLA 1E5YA 5BVJB 3RL2A 3KE0A 5LGHL 5E1AB 1KEMH 5T1LD 3PP3H 3WL9B 5JDSB 5LBSH 3HE6B 2OI9B 3L3DA 4PWFA 4U31A 4N2MA 4OFPA 2NY2D 3BKJH 3IMWA 4ZW8A 3BGAA 3IK2A 4RRPM 3OL2A 3O11A 3DX7B 1UWGH 1OD7A 1NCCH 5J9PB 1PKQA 3WUWA 4V1DA 1V3MA 3K4AA 3QEQE 4EIZC 1VIWA 5CCKL 5JR1H 2PMZA 1ZPLA 1AZNA 1DJSA 4NDMA 4P0DA 5ESVB 2DQIL 3TJEL 1KIQB 1SJEA 1Y6MR 4WFFD 3KG5A 5JYLA 3ESOA 2VW7A 4O51B 2X4QA 4G8GB 3TA3B 3H3KA 4H0GA 4KZEL 2VLKA 4YBLC 1XF4A 1YAIA 2EDTA 2EQDA 2OBGA 4PUBL 1U8NA 1BOYA 3STBA 2P5WD 4FFWC 15C8L 4G6AC 3LXAA 5K59E 3QRLA 2Z31D 2G9HB 3NMEA 4K9EL 2VJXA 4XGZB 5DHXB 5I0DA 5I16B 1KC5H 1SN5A 3BDBA 3R18A 2CLZA 5T1MB 1OP3H 1F2QA 3QUXD 2W65A 4OCSL 3MJ6A 4YHOH 4A2FA 2Z93A 4HGWA 4X8XA 4TULL 4HZLB 5B7FA 1T4KB 1I8KA 1DLFL 1XMWA 3L48A 3OXRB 5D2LF 1ZVYA 3ZKND 2FNWA 4KWUA 1RZ7L 3WEMA 1GGYA 1QSFB 2BS71 4GRLD 4F9LC 5T3XE 3ZKXC 2WQSA 3TO4D 1NC4D 4CL7A 3W9EA 5T1JA 3UZVA 1CFSA 2FBRA 5CKGA 2ZUQB 5LUMA 4X4ME 3S88L 2ZXCA 2E7BA 2PN5A 2VR6A 3U4BL 5I66A 3ULVC 2DBLL 5D5MF 3X3GL 2CJTA 3K91A 2HT3C 1JNNH 2NNRA 4XNMB 3S36X 3EUUA 1QKZL 2UXVA 5D7LB 4PTUB 3GINA 3EOBB 1HWGB 3LTVA 3ZXAC 4CMMB 3DHPA 2WHVA 2VR7A 4RFNB 3RWHA 3DBSA 3CE1A 3TWCL 2R23B 2WLLA 2CDEA 5JPNB 3EGSA 3LX9A 3S3JA 3CBKB 2C4XA 1DBJL 1LK2B 5C71A 3NCJL 1YSOA 2FEDC 5HJ3B 2FJHA 1KXHA 2X1PA 3KBPA 1D9KD 5C0DA 1G9EA 2ZKWA 4YZFE 1CF8L 1E4WH 3U82B 3WGVB 3PREA 3RWIB 3FT3A 3GBDA 5DMKB 3QJHB 5LB1A 5I8OH 4NI3A 5TPWH 1KJ2L 3WIHH 3CZEA 3EZ8A 1UUSA 3GI9H 4Z7WB 1J0KA 1Z32X 3DVNA 5J1AB 4PRPA 1IC7L 1TNMA 4G5AA 2F53D 5E2WL 1MW0A 1T83A 4JN2B 3PP4L 4NCC2 4PJDB 5I30L 2BSEA 4PRIB 3FCUB 3MRHA 2C9PA 2QVTA 3BVVA 1VCBC 2XQYK 3U9UA 1MLCA 2C8NA 5A3IC 4GXVH 2WNXA 4NWUL 1KCKA 3FTXA 3IFNH 4LSUL 4AM0A 4X6FB 5E0FA 1UXWB 2YMXL 3GM8A 4FFVD 5B1AB 3TYFB 3UJTH 4XPFL 4Z7UE 4KXZI 4F27A 4ZS6C 1R24A 1OB1B 4RMWA 5AZ2H 4LCIH 1MCOH 2E5EA 4HS3B 5D7JD 1EERB 2GBAA 2DQHH 2J4WL 3CN4A 3HB3C 4IM8A 3MGAA 3HAEH 1UWFA 3ROLA 3ZDZE 3US1A 4OTXL 3ZE1B 1KB5L 3U7AA 2NXYC 3IMUA 3LKNA 2J8OA 1AR1D 3RVTC 3FU3A 5A1AA 1YPZF 1KJMB 1U36A 1WICA 1BAFH 3OKEA 4HU8A 3LYRA 3SE4A 3DARA 1JNJA 2WVVA 3D30A 4NO3A 4YMPA 1XF5A 4M00A 3F5WB 5IJDC 1J87A 2JCCB 4NJAH 4DKTA 5IHWA 1IO4C 3GHBH 1Z3RA 2DQDL 1IBDA 4WDIA 5JXAL 3MUGB 4DSYA 2PO6D 3IJ9A 1TDQA 2AJYH 3D85A 1LDSA 3NIFE 3F83A 3ZGPA 2Z31B 4KAQL 1KXVA 3O6LL 4U1GC 4RFOL 4DVRH 1G84A 2HVJA 4NO2A 2ARJA 2ATPB 1U8OA 5ESAA 2XWXA 3WNNA 4N0RA 3MODH 1SN2A 2IMMA 3UEQA 3QUXB 3QNXB 5F96H 5DVKA 3NJLA 3PDOB 1BEYL 3V0EA 4HKZA 2APTA 3UYPB 3VWKA 3WJMB 2AJZB 3H9SA 4LZHA 2NRDA 1O7SA 3MLWH 1KGWA 3E9UA 1FGVL 4JDEB 4ADJA 4EN3A 3VFOA 5F7HA 1NUGA 3TO4B 2ZUYA 3O2DA 4K7PX 5H35B 4AIEA 1W6LA 3VRLF 5DGQA 5IJBC 1ZT7B 1LP9E 3L3HB 4MD4A 1DANU 3K46A 4FL4C 5MEQA 4KFMA 4E41D 2LR4A 3GIVA 3MREB 4IOFD 4K8RH 3VH8A 3HVDA 4KKAC 2WAQA 3RZCD 4G8FA 2XZAH 2LU5A 3C6LC 4F7PA 3PWNB 3X1GA 1FG2A 2Q87A 2D0FA 2LOEA 3TO2A 4OCLC 4LSRL 5DJYA 1AR2A 2UY7A 2ZXDA 5B1KA 4PJAB 3T4AB 4KPHL 1GSMA 5FKAA 1TVDA 4HSCX 2ZUTA 4NFBA 1WH0A 2JXMA 5DQDH 1IVLA 4HWNA 5IM7B 2EIEA 5I82A 3C6LB 1D9KB 4YFEA 1PDKB 4IBQA 3KEHA 2EDJA 2Z91A 2P24A 2H6PA 3VI3A 2YQ3A 2DI7A 3K2UL 1IGCH 3FT0A 2FEJA 5DUPH 2PW1A 2HN7A 4ZW5A 1AGEA 2AI0H 3SD5A 1QA9A 2BY0A 2F1BA 2HFFA 4HA1A 3C75A 3KPTA 3NUKA 1A1NB 4PIRF 5EEXA 1IGTA 2QFRA 4N2LA 1J9TA 1TJXA 4Z7OB 5EU6D 1MRCL 1Q9LA 4M62L 4K3HA 3S3CB 2Y5EA 3EYQC 2XRAH 4O2FB 3I9AA 2HKHL 1WCBB 5DI8B 3QXAB 3SGJC 4A39A 3LH2L 3BWUF 4G7YL 3QH3B 2OP4L 2GJPA 2LE9A 1AP2B 3MN8A 4WWNA 4AYMC 5A2IH 1GS8A 5DT1H 4F8QA 5DEGB 2FWOA 5FUOL 1HYSD 3QWRD 3V4VB 1RPQA 3KPPA 2OMZB 4MQSB 1YQ2A 4MQTB 4WW2C 3UTSD 4BGDA 2DI9A 3KLLA 3MRPA 1NMBH 4DK3A 4AEEA 3UTOA 5BW7C 5JYMA 3VXMD 1ZY9A 4L8SB 5HHNA 5AVZB 1RJLB 4PJ9D 5BV7B 1YYLH 5I0WA 1ONQA 1BW8A 3AXLB 3P2DA 3F7LA 1PSKH 1EXUA 1T5XA 1W72A 2QMKA 4G1EA 4GRMB 3VDAA 4AVHA 1ICTA 1KCVL 3NZHL 5IQNA 3CHSA 5FYJE 4QHNB 3IRPX 4JY5L 1J11A 1MHPL 3TVMC 2NSMA 4R4BA 5EF0A 4J8RB 2XKSA 1MCWM 4GKLA 3HR5B 3HE7C 4HUXA 2B1AL 3D9AL 2FBJL 2MMXA 4HIJA 2AV1A 3CGTA 2CA4A 4ZAKC 3JV0A 2AVFA 1OP9A 2WWMC 3Q9QA 3FNKA 1FFQA 5HDBF 5LHDA 1MCBA 2IQ9H 3UAJA 2CRMA 1G9NC 2YEZA 4NQVA 2HA1A 2BIMA 5AWNL 3LMJL 3RBSA 2PO6B 2IH3A 5ACZB 3ASWA 1IEHA 5GRVK 3QQNA 3X13B 2ZUWA 4AQ8C 2P5WA 3WENA 3HE7B 4NCC1 4F7MA 1G7IB 3QCVL 3QUKA 4ZAKB 2CHDA 2DLGA 1UH3A 4AW4A 3T3PE 1OL0A 1GAFH 2FWLB 2E0PA 4E9VA 1XGQB 5CIPA 3GGWA 1MFCH 1VZHA 3ZKMD 1D7DA 2IH8A 2EXTA 3GUTA 3PNWA 3U0PB 5I6LA 1OZTG 2W9EH 4OAWB 4QTHA 4XZUA 4C54A 4HIXH 4P5TB 3WS6C 4NHCH 3O0RH 4AYEC 5FV1L 3RPIA 3VRJA 2NOYA 3H7BA 3LXBA 3IE4A 4FABH 5ISZE 2VZOA 5C0EA 3RVXC 1KXTA 2Q7YB 1QSEB 3S37L 1OTUC 2H47C 5L7XH 4BKLA 2WGXA 4XCFH 4TUKH 4ZJ9A 3SPCA 1W0VB 1Z9PA 2F18A 2VXQL 5E2TH 1QUPA 2VM4A 1W0WB 3EHBC 1AD0A 1K5NA 2J8HA 3M17A 3T0XA 3ARVA 1IEAB 1PY4A 3HMWL 5T3ZD 4MRCA 5CJXA 1RZFH 1ZGLM 1OP5H 4EBQL 4S1DC 5K93A 2OSLA 4KOCA 1EAPA 4EXKA 1T2QH 2N0MA 4P48A 3UBFA 4LDCA 5FOBB 4EVNB 3B2UC 1QHOA 4LCYB 4P07A 2YBGA 2I5YH 3N0PB 4N2DA 3WIFB 4BWWA 1L9TA 4C83B 1RULH 3IT8D 1KN2H 3F7YA 3GKZA 1XHHA 3OPZL 4JO8A 5F9AC 4QXTA 2BOLA 1TMCB 3C5ZC 3O9WC 3QWOA 1AOZA 2BIPA 2EDKA 2YMTA 2EKSA 1SNRA 2EC9T 2FJUB 3FO2B 3MV8D 4AEIL 3MBXH 5H2BB 1NAKL 3VM5A 3K5RA 3AGVA 3GXDA 3EO1A 1J86A 4I0PD 3IKCB 2NW2B 1L9MA 4KJQD 4GBXD 1DEEA 1TKWB 2AQPA 2J1XA 2ZSWA 3VFUA 2Z92B 4U7SA 2JVUA 1QACA 5E9DE 4OGAC 3AACA 2GIXA 4I3SH 3GXUB 3LZRA 1KIRB 1QFUH 1NIFA 2F53A 3M1OA 3MU3A 1F11B 4BHUI 4DEUA 1MY7A 1KT2A 3PHSA 3LEXA 3REWB 1I8IA 3SO3B 1HNYA 3PQYD 1A7NH 3U1PA 3T2NH 2MOGA 4B60A 3TCLB 2I9LB 4JPIA 4PI0A 1XH0A 1QI3A 5CJQH 3UJJH 4KTEL 3QQDB 3RDTD 4I88A 4QRTB 3LZFH 3H42L 1NMCB 1GZPA 2QHRL 1BAWA 2UWEF 1MOEA 3C5SA 4LCWE 1MWOA 2OXGB 5KVFL 4ZUWB 3VD3A 3VXMB 2EJ1A 2WLIA 1ZXKA 3QFDB 3NJMA 1D5IL 2MQ0A 4B5EA 4KK8D 2IGFL 4EIGB 5GZOC 4JL2A 3M8OH 3JTTA 1R5WA 1T3FB 2HRPH 1HSAA 1LO5A 4C4KT 3SKJH 3CPLB 3DV4A 2WXJA 1PVHA 1V3JA 3BUBA 2BDNL 4NJ9L 4ZUSA 3H2WA 1JFQL 1SM3H 2J1ZA 1N2RB 2P5EE 4HQQH 4I48A 2YS4A 4AVKA 1FVDB 5CWSA 1FI8C 4EEEA 4IRJA 5ANHA 3LHPL 3QIWC 1THAA 5DZLA 3VNYA 3QUZD 2Y1YA 3DGGB 4BK5A 1S7SB 4QR7A 4UCFA 1PD0A 5AL0A 1ANUA 3JUYA 1ACCA 3O3UN 1GZHA 5TE6L 4MZIA 3KH3A 4YXHL 3KR3H 4OZFG 1S5HB 3HZYA 3LNDA 1NJ9A 5EZOL 5B39B 5JHBA 2I9TB 4MDRA 1UACH 3CSGA 1CLOL 2R83A 5DMJB 1S46A 1CE1H 4P5KA 1FNSL 3LQAH 3TN0C 1JNLH 3WXVL 5KSVA 5IV2B 3ZR6A 3FFDA 3QDMD 1CT8B 1WAAA 1USQA 4P2YA 1B0GA 2VSMB 5I75C 5IJCC 3IFLH 1IL1A 5B38A 5HHPA 4Q9CA 1UWYA 3HBPA 2EVFA 1INEL 3MV7B 2VXSL 4ACPA 4PJCF 1CD0A 2JSFA 1M56B 2PTVA 1MRFH 3HS0C 2PTTA 3TN0B 2ED9A 2O5NA 2DQUL 3U0WH 3HI6L 2DIEA 4DW2L 3BKYH 2Y5TA 4HXBL 1VF5C 1CGVA 2OQJA 1KBKA 4NN6C 1J0JA 4LDLB 4BKSC 4IBSA 3UABA 1YDPB 3SY0B 3BPCA 4JFEE 3HS0B 2IDUA 4OLWH 2V17H 4PREB 3SJVB 4ONFL 3WE6B 2X2IA 1X7QB 4JREC 4ZFZA 1QFWH 4TUUA 1HVXA 4KGJA 2WYTA 2ZX7A 3GB7B 5IKCA 1SBSL 2CGRH 2VO8A 3B7RL 1E6JH 2ICES 4NM8H 1TQSA 5CGTA 5AB1A 4YSCA 1JK8B 1P0SE 2V5SA 4JDVB 1IGMH 4KHXL 5T5FL 2ADYA 5IROA 2CRYA 1AS8A 1CZ8L 2C1OB 3VFPB 4HYTB 4LARL 3STZA 4HEPG 4X83A 4XBPB 1Z0NA 2FX9L 1JAEA 3MV8B 4ZXBC 4A67A 2HJLB 4LRIC 2DPKA 5IJKA 4LPYA 4I0PB 1KBGH 3O2WL 5D1XA 5K9KB 3ARBB 3ZE0F 1MFBL 4U1LA 4N1EA 1UOVA 3B7YA 3OSKA 3KL3A 5B7EA 3EJJX 1UD4A 2DB8A 3CIQA 2V6HA 3Q6FA 2JKXA 1W15A 2H3XC 4FADA 4OIBA 3A4EA 5DD3H 4MCMA 4YHKH 4AXWB 1Y1UA 5F72S 4W1TA 1XF3A 3APMA 3PQYB 4JO2H 4Q6IB 3NIGE 1FA4A 4GS7C 4KKBD 2PPAA 5T1KD 4GXUM 2PYEA 5KYWB 4R96A 1NL0H 2ADGB 2ZG3A 5BUAA 1RUAL 2F7QA 4YHZH 3RDTB 4X4XA 3UC2A 1N4XL 2KI6A 1NBZA 2OMTA 2WYZA 3F7VB 4P57B 4OIIH 5IEHA 2Y36H 1S9VB 2H9GA 4YXKL 3FF7A 1DQDL 4Z3JA 2ALWA 2P45B 3OKMA 2EIZB 1E8XA 4X6CA 1VRSA 2XY2A 5E94A 1TZIA 5BVPL 1JDAA 4WO4A 5C6WH 2MJWA 4F8TA 5I26A 4LIQH 5CP3A 3E8UL 3MRGB 2CO4A 2Y1AA 4M8QA 4WJ5A 1GGBH 1H3PH 4AM0Q 3GRWL 3HHMA 1H9DA 5BOJA 1Q9OB 3BUYB 1WBYB 3CLEL 2VDKL 2X88A 4M43L 32C2A 3WN6A 3PHOB 4N5EC 1BBDH 2IJ0C 1T20A 3GSVB 3MV11 2BWQA 1TO5A 3O41A 3O6KL 4W9HC 2V2TB 4PJHB 3QS2A 4J3OF 1BQLH 5ICYB 4P3WA 5EFIA 3OPUA 4QRFA 3O2DH 3TBSB 4GKZB 3U48A 2ATKA 4F7TB 1W16A 3MJ9A 5I18H 3E2HC 4G6FB 1UWGL 3W5NA 2CHZA 5HDWA 4DP9X 3QDMB 4WGKA 4R97C 3BRFA 4FKKA 4PY7A 3WG7B 1XGYH 1WT5A 4NAQA 1WITA 4U6VH 5E8NB 5GRUL 1IE5A 1FNGA 3QQ9C 1RK1B 4LLQA 4MZ3A 2P26A 4F7CB 1HILA 3E2HB 4YGVB 2MHAB 4IBZA 2V9RA 1GZQB 5AVUB 2VLJD 1GPOL 3A0OA 4OZFH 3SOTA 5ECGA 2A9NL 2ARJQ 1U3HD 1S6NA 5J6HB 1K85A 2GFBA 4HJ0D 4MA8L 1NCBL 2Z0UA 2X2HA 3FFCE 2FT7A 1JRHI 4RAHA 2LHAA 3LQZB 4NFDA 4XP4H 3VTMA 4BFJA 4PGDA 3KYOA 1IAII 1KCUH 4WEMB 1PNCA 2YRBA 3O3DB 4WI9A 2DD8H 3GXMA 4MJIA 4XPGH 4DAGL 1MIEH 2VSKB 3D07A 4YHOL 4QXGH 3WY4A 4M3JA 4L1SA 3QUGA 4ZZKA 5I1JL 5IIEB 2VRQA 1P5UC 1BF5A 1SQMA 4I1NB 4I3GA 3IYLW 1CDIA 4A6YH 3MVSA 3O8XA 4C56D 5D2NB 2PABA 5D4JA 3CDGA 4AUUA 4JM2C 4AH2B 1I85C 2F54B 2VH5L 1HQRB 3QO0A 3W2DL 3D2UB 3WHE0 1P4IL 1ETJA 2UXGA 2OAAA 4JB9H 4HIHA 4LQ1A 4M5YH 1Y7MA 1EXGA 1G7LA 1BVLA 5B1JA 4JZNA 2IDSA 5I1AA 5E6RB 3AUVA 3VJ6A 4RGND 1LK3H 2CLRB 4LSTL 5F1SA 3VD4A 1RZ8A 5DMIL 4WV1A 3N04A 1JTTA 4N2OA 3PL6A 3RY4A 2JB5L 4EF3A 3BQUC 2GCYA 5HDQH 3HEIB 2JB6B 5T1KB 1WA2X 2Y23A 3KPSD 3N1MC 1FNEA 2Y06L 4LASH 4MJ6B 5DJZB 1SLXA 5EC2A 5TH2B 3KLHC 3BKML 3DRQB 5DFTA 4AZ8A 3WELA 2QQLL 3GSXA 3HNVH 2B7DT 1A6VH 4FQIL 3CHRA 1XH3B 2XN2A 4NPYA 1CE6B 5HHVH 4EI0A 1RPUA 5KYUA 3QA3A 1KV3A 4LPXA 3T3ME 3L45A 2NY1D 4YIQB 3FJTA 2EH8H 4CMHC 4KH2A 2XVBA 3FB5A 1NH6A 2WIIB 4XC1L 4LPWA 5J12C 4DEWA 3V52H 5IBUG 1B0WA 1SXAA 3PGDA 1ES0A 4EI5B 3ULSB 1IGFH 1C5DB 1DLHB 4P5MA 4HHGA 1O9VA 1OM9A 3DURB 1S5IL 4FX5A 5L2KA 1TFPA 3SE8L 3LXCA 3D50A 1ZGLP 4CMHB 2NZ9D 4JKPL 1GC1L 2HT4C 2R1YA 4OD1L 1YYMH 1AO7B 3ML9A 3PIQA 5HPMA 1EXHA 1O6SA 3BPLC 5EU4B 4AYID 5LCVA 5KUMA 5EZJA 2ORBL 4P3DA 5JQ6L 3VCLB 1RIHL 5KYYA 4LCIL 1F3RB 1N64L 3CFBB 2X09A 4UQ9A 3HUJB 1HHHA 5E5MB 5KAQF 4GKNB 5ESQA 4EUPB 1JZ5A 4D9RD 2KMWA 5ECJE 5I5IA 5CLXA 1NUDA 1USZA 4YZWA 5DMGD 1RUPH 2CJ3A 2AXJA 4MA1C 4PJBF 3BVXA 1HEHC 3RU8H 4GEJA 4U1JA 2F5BH 1NUNB 5C7XL 5IP4A 4N85A 4NO5B 3MBED 2AF2A 3RTQD 3BH9B 3QG6A 5E1HB 3UTTA 4P2OD 3MRCA 1ZS2A 3KL5A 3MLXH 5FXCH 4HLEA 1OAXH 3EJSA 2AW2A 4NJAL 2VLJB 1FSKC 3QEQD 2XVKA 3ESMA 3TBTB 2NR6D 4HCRL 4QLRA 1FFNA 4MGXA 1V10A 3F7KA 5EDXA 5I24A 1EVTC 1UA6H 2P8MA 4C59B 2CAKA 2OMWA 2RBLA 3WKQA 2IAMC 2R0KL 4PV9B 3LNHA 4DVRL 3KZ8A 4JUTA 2MEJB 3INUH 4UQAA 3RURA 3N44F 1WA1X 2J5LC 3SN6N 4EDWH 5JOPE 5IG7B 3V5HA 3QJQB 4U1MB 3EH3B 3ESPA 1E43A 5B3SB 5E5LA 2MOQA 3G08A 4O02L 2XA3A 3OR6A 3DYOA 5EORL 4D0CA 2MTAA 3FO1A 2BC4A 2HVKB 3MLWL 4KRMB 1CU4L 5CD5D 4ZUTB 5HTSA 4C56B 3TNNA 2IWKA 2NXZD 3BCDA 5H37A 1QR1A 4ZTOL 3VA6A 1EHXA 1Q1JL 5AVYB 1JPGB 1J48A 4LF3A 2V0AA 1R5IA 5TDNB 4APQC 1NM4A 3ARPA 5HJDA 3L3KB 1LO3H 1LWRA 1H5BA 4WIQA 2XG4B 5EA0H 4FJZA 1N8OE 2OX5B 3B83A 1N12A 1RD6A 4KHTH 4LPVA 3G5YB 2VZ1A 3LIUA 3GRBA 1KGXA 2WUBH 3S4SB 2XZAL 2CKBB 3M1CA 4FNRA 3MV01 4YR6B 1B4JL 3Q01A 4TL4A 1NA8A 1IAKB 3B2MA 3EGDA 3MBWB 1LNUB 3ZG4A 4GO8A 4WHYH 3QO1B 5DZAA 4JY6A 3SCMA 5HYSB 3V6OA 1TR7A 3S48A 3WTVA 2PCFB 5F7EL 4DP0X 3MLVH 5E6ID 1OD9A 1GCYA 1SOSA 3E1ZA 1TJGL 5H4ZA 5I74C 4GQQA 4UYPA 1HJCA 1L9RA 3ABKB 4FJYA 3GBNL 4NUPA 4N0FA 2Q8BL 2VUOA 1A5FH 4NNYB 4DN3L 1XR9B 2GI7A 2DQCH 4G7VH 5AQ0A 5EDSA 4G6ML 3LKOA 4N68A 4ZMQA 2ZX5A 2A6IA 4NFCA 5GHWH 3FU5A 2XWRA 2FYYA 1L0XA 3CWGA 2ZKYA 3RIFF 2BVYA 5C0FA 1K6QH 5EC1A 5GISL 1LQBC 4CNIA 4P4KD 1IKNC 2YGVA 2YN5A 4G8AC 3QIBC 5J7CC 3RWJA 3QDJE 1SJHB 4NQSA 5J89A 2NY5H 4NGHL 3ZJAA 2YAHA 2LU3A 1I8LC 3JV6B 4XXCC 1FPTH 4MMZC 3ABGA 5IQLA 5FCUH 2X3AA 3APCA 5D5ME 3V0VA 1XQ4A 5ES4B 2HRHA 3LPFA 4S1RL 3QIBB 5C3TA 4OI7A 1TETH 2X38A 4QGYA 1OSZA 5E1QA 4H25A 2BWDA 1XXDC 3J7HA 4YDIH 1YEIH 1YQVL 3CQPA 3Q6GL 4HPYH 4IS6B 1SYVB 2FIKB 3DYPA 1U42A 4MMZB 5CEYB 1HAUA 4BZ2A 4I13B 4PM1A 4P4RA 4ZFGL 1NMAH 2DWXA 1VADB 3CC1A 4GSDH 4D2NA 4ZODA 2G2NA 4DZBA 1FNLA 2UX7A 2MTZA 2W07A 4OV5B 4FFTA 1BREA 1YYLL 3LRHA 3G9AB 5J4MA 1M7IB 3N9GL 1WK0A 3TBYA 4LCCC 1SDDA 2B0SL 1WWBX 5KBNC 1KYDA 3OAUH 4AKQA 3MFFA 4DP2X 1MCEA 2HFTA 4YAQB 4M93C 3I50L 2QGBA 5GQBA 1AMXA 4MVBC 1JWSB 2IH1B 5CZXD 3RTQB 4M9PA 4TNFA 4P2OB 1AHMA 1R0AL 2V7HA 4LCCB 4ZW3A 3IBOA 4P9HH 2D7PA 2ARWA 3ZKQD 3WSQH 4KH9A 5GGSA 1I9EA 4QYAA 5CJBA 1I7TA 1RHHB 2GJRA 4Y9GA 2PWFA 3VGAC 3BAXA 4YSEA 4ZS7H 3HKZA 5TFSH 1A25A 5AW1B 1QBBA 3QZPA 3RWGB 4TV3A 3G6JF 4E9RA 3IMRA 3JTBA 1MWAH 2HRGA 1Z5LB 1LO0H 1YYCA 5AW6B 3IDNB 2X0UA 2NY4C 1A6WH 4E2OA 4KXDA 4X8JA 5GGVH 2F08A 1X9QA 5GSRA 5F7DB 2AK4E 4OI8A 5C6TL 5J3HD 4HJSA 2MNJB 4K94C 4QXUH 5AOKA 4I8DA 4Z7VF 1RP9A 4JNXA 4NHCL 3HI1B 4NQDB 3CG8A 4P23D 4HWEH 5KYXA 2DH2A 2NXZB 2X6AA 1QNZH 2NY4B 1HWWA 4UV4L 1EGJA 2ZKXA 4L4TA 5IFJB 1BPVA 2ZSVA 2X1XR 1T0OA 2R0WL 1T1ZB 2ITCB 2OFQA 3L9RB 5FYKL 4W70A 3SDAD 3BLBA 3P30H 4WU5B 4N5UA 1A1MB 1YPZE 2VDPB 2P7TB 3H55A 2BY1A 4GLRH 2X4OA 4LKXB 4NLAA 5HJBA 2EIKB 4M48L 3QORD 5GGTA 1SY6A 2OTUA 3ATAA 5F9WC 3ZZSA 2APSA 4FI7A 3OKNB 5KVEL 3QJRB 2BX5A 1T2QL 3ROOB 2FUTA 3FCSB 4FA6A 4FZEH 3DO3A 1UCBH 1XIWB 3TPKA 5AFAA 5ANME 4OQTH 4U6YA 4EQ2A 4X9IA 4RZCB 4YHPA 5ALBL 1RULL 2FSEA 5CP3H 1O5PA 3NEEA 1THCA 1SMOA 4L4JA 3KPRB 5E6IB 3TV3L 2ZTBA 4GAYA 4J3OG 1N59B 1D6EA 2C7UA 1J05A 4FMKA 1S7UA 1JHTB 3AU1A 2VR8A 1U3YA 3NJKA 4PVBA 3K2IA 4RDBA 1HKFA 3MBXL 2G2RB 2A9MH 1RQ5A 2YGQA 2H26B 1R17A 2QLYA 5DWUL 1ZLUH 5IT2L 5JLZB 1U41A 4X2UA 4N9GA 3LRGA 1RJYA 3P0YH 3QVAA 1S8DA 4G42B 4DP8X 5JNYB 2ZIDA 4NUQA 2VN3A 1YMHA 3VRLE 1MJ8H 2APFA 5F9JA 4FKHA 5GZNC 3J8F7 3CFEA 4XPHL 5A43C 5AOZA 1V7NH 3EJZC 5LBGA 3OX8B 3UJJL 1IBHA 1HL4A 5KS9B 3ZLQC 5AOIA 1QR4A 1XWVA 3LZFL 4ALAC 5CGYD 3P4OA 4OZIA 6FABL 4QF1A 4OV5A 5HYJD 3KHOA 5I0XA 2YPVA 4ZMVA 1OKEA 3AVEA 1ZTXH 3UAFA 1HAWA 5DJCA 2D0HA 3IDUA 3LNGA 4V2CB 4ZQKA 4XMZA 3GSUA 2K70A 2CRIA 4KNSA 4WUUE 3I6KA 4M4RB 4U1SA 5INCA 1HOCA 1JI1A 1XFPA 1ORQB 3T2QA 4F93B 2ADFL 5AOMA 1QUNA 5CSGA 4PJFA 3H1ZA 3DX0A 1SYSB 3AS3A 2BJML 1BA9A 4GIPD 4WTZG 1LEIB 3KMDA 4GQ9H 2R8SL 4YSOA 3FN9A 3RQ3A 4L9LB 5FYJD 3VFSB 1WIOA 2Z4QA 3NCEB 4MNGE 4YO0A 1HXYB 2G5UA 3QIUA 1GMEA 3MGOA 3HG1A 2P5PA 3CFJB 3NDZE 1NTDA 3OMZA 5DJ6A 1IBGH 1FO0A 4IDJH 1YEDA 3U7YH 2WTRB 3GEWB 3O81A 4R5VA 1WD9A 2Q3ZA 1O9ZA 2N4IA 2HT2D 2WBKA 2HX9A 3QQ3A 4BH7B 2J88H 3DX9A 2OJZL 1DUZA 3T0EC 1IB5A 1VACA 4GAAA 3NIFB 3T04D 1JNHB 3NZ8B 1T1WA 4PSPA 3MYZA 1NAMH 4ZUUA 5KVDH 4J4PD 3D08A 5AENA 5IQOA 4P23B 2QVKA 4E42A 2N7AA 3GLDA 3T0EB 3BN3B 5TGBB 4NSKB 4M4PA 4PG2C 4YFLF 2WSDA 3X12B 2VERN 1WFUA 3CLFH 5BQ7B 2WUCH 4WI0B 3SDAB 2VN6A 3RJQB 5JOFA 4X8GA 2K3TA 2NNAA 1G0XA 5AKRA 1ORSB 5HP5A 3QHFH 2L04A 3TOPA 4GAJL 5ISZD 3BGFB 5EIIB 2IPUG 1IFHH 2WSKA 4Y5VC 4R2GC 3N43F 5KSAD 4M5ZL 2CO7B 1KNOB 3OB8A 5HHXH 4PR5A 4DGYH 1OLZA 4NOFA 2PYFA 4AQAA 3UEZA 3VB9A 1U8IA 4M1GL 4F57L 3DOSB 1AGDB 3OMIB 3EAKA 4LLYA 1S78D 5CU5A 1PY9A 5JPMA 1YN6A 3WBDA 3GMMB 4Y1AB 1CYGA 4O2EB 4XNBA 2OCCB 1N10A 5FA3A 3RPBA 3S2CA 2ZYIA 1JPSL 1G0YR 1A22B 4IKJA 1NBYB 2X6MA 4TKWA 2EYTA 4BCZA 1NPUA 1BIIA 3EBGA 2E6PA 4H8WH 2AQ2A 4QTFA 1PD6A 5KAQG 2WC7A 3FCTA 3FPXA 2J1YA 4Z7NF 5IUSA 5E6UB 1CF1A 4PJXB 3MRDB 3X1NA 4X4YB 4Y5YB 3HRZB 2AEPH 4Y2DB 3ARTA 2F58H 5EN3A 3NACL 3T1FB 1VGKA 2AJVL 4J3TA 1E6OH 4KO9A 4XPAH 3U4KA 3WTSA 4MS8C 4HKBA 4RRPG 2H1PH 2BZDA 4HV8B 5DS8B 2MWCA 5DD3L 3FQYA 3U46B 2AJ3B 4U6XB 1D2PA 4URKA 4QCIA 2A6DA 5F7FA 1E4XH 4WFEE 5GS1B 2H32A 3P1VA 5E9DD 3V0IA 3IJSB 1YEHL 1OHZA 5BRZE 3S5ZA 1U93B 2KPNA 2H0JA 2Z7ZA 2WK2A 3LRSB 2VLRB 5HYJB 3LAFA 2DIAA 3IGKA 2WLYA 1HL9A 1WISA 4JVPA 1NSNH 4XP6H 5KVFE 1OE3A 1PD1A 2DLFL 3BZFB 3RY6C 4DPBX 1E3XA 4KI5F 4LCWD 3UL4A 3KLAA 3OF6A 5EOTA 3M1BB 3FQXB 3RNKA 1I9IH 5I15L 2QGDA 2IVFC 3NEOA 3PAYA 4N2GA 2JELH 4NQEE 4PRDA 5FYKU 4LB8A 4MAYD 2Q0ZX 3UBXB 3QFJA 4JO4L 3UH8A 4MA3B 5C8JB 4G8EB 4E0RB 2FAUA 3MLUL 3DMMA 2VDOL 3GMNB 4L8DB 4LP8A 3PHQA 3QZWG 4XHJD 4KKAD 5FUZH 4LSPH 5I1HL 3D3VB 3VI3F 4QRRB 3QUYC 2APVA 4PW3A 2BWIA 2A73A 1XAUA 5L2JB 3R0NA 1OGAE 1I75A 3FH5A 1Z7JA 4HHAA 4XE0A 1DO5A 1YEEH 2P5ED 3P77A 2ZXAA 2XKNA 3OVUB 3VTAA 4R26H 4CC4C 4G7SB 2DQTL 4H0HB 43CAB 3O2DL 4PSRA 2XWBA 5FO7A 1M7DA 1V54B 3FMGH 4QJ3B 3QUMB 3QUYB 4X6DB 4Q97A 2EDEA 3PWVB 3PWJA 1KENL 4IGBD 1IFRA 1P7HL 2LGNA 2LV4A 2QPSA 3BH8A 1P53A 4GW1A 3K71A 1N70A 4KZDH 3GXIA 1NLBH 1ZWIB 1MCWW 4LLDA 5T33H 1CFBA 2UWEE 3T3PB 4LRNH 4PBDA 3ULUF 1M9WA 5C08D 5AALA 3RGBA 3NGBC 2F19H 1NANH 1YCSA 3POCA 1JGUH 3BSZA 3ARZA 1O7DE 4J23A 4ZX5A 2D7NA 2WZ6A 4HCFA 4QY8B 3EYQD 2DMHA 5C0AA 1KYOK 4L8CB 2VDRL 4BUHA 2HFEA 5F1IA 2Q3XA 3JYCA 4WWOA 4KDWA 5E1AA 2XN0A 1MAMH 2GJ6E 3KPQB 3EYSH 3RI5K 4XP4L 3QHZH 3ARFD 3WL9A 3C08H 5JDSA 2F7OA 1JERA 3B5GA 3CXHJ 4BFIB 5CM1A 1WHPA 4AJWA 4RGMB 1KCRH 3CQQA 5T1DH 3LNFA 1MCQA 3DX7A 1IX2A 4EI6A 5AYUH 4PVMA 1OTTC 4JFED 5J9PA 1UYWL 3DK2A 4PW4A 4LEXH 4M6ML 4P2AA 4U1KB 4HBCH 3KWWA 4R7LA 2FRGP 4OM1L 5FCSH 3G5VB 1KIQA 4MDIB 1A64A 2DKMA 1G9MH 3A5VA 3EO9H 1WFNA 2W9DL 4FF9A 5KG9A 2YWYA 3LS5H 3TA3A 1RP8A 1CICC 2UYLB 4JG9A 1KEGH 4XOEA 4NAJA 3F7PC 4JM4L 5BS0A 2C5DC 3EYOA 3ULUL 1FAIH 4U05A 3I02A 2R2CA 25C8H 4KMLB 3QEUB 4JFYB 2WWMD 4POZD 4XHQA 4PJCE 3MCLL 4XGZA 5FC9A 3VX1A 4H8VA 4BZ2H 5HVHC 1HYRC 1XMEB 4D94A 5ITBL 2B1HH 3D06A 2GBVA 2JMRA 2BVEA 1B4TA 1F4XL 2JF1A 2J8UE 1P4BL 4Y4FC 5TQ2L 3L5XL 1H3WM 3HBQA 4FQCL 4HJGB 4HZLA 4NWTL 1W72L 3H6AA 3HPLA 5E9DB 5DFWH 2CPUA 1BVNP 2O6EA 1YHPA 2BNRE 2A6KB 2GABA 3QZMA 4ZPTA 3O3BA 4O58H 1QSFA 5AW2B 4UF7C 1AGCB 4J3VA 2ID5A 1JVKA 4YSSA 2NSQA 4ETQB 3A21A 1KPRB 4EZMA 1FZOB 4M1CD 2EVGA 3IJYA 5F2FA 5IHBA 3V5DB 1J8HE 2WQUA 2EH8L 2OW6A 3QRBA 4F9LA 3MRKA 3WFBH 5JQHC 3BGMA 4TVPH 5JA8B 1OTUD 4GMTL 4WY7H 5JIQA 4OKVB 4MAYB 4OGXH 1LMKA 4MAZA 5DURD 2WBJC 1AZVA 4BIKA 5ID1A 2PXYC 4U3HA 3UGEA 3RX8A 1NBCA 3EHBD 3ARXA 4OFYD 1ADQH 3ILPA 3ZDXF 3QWNA 4PJEA 1PLGH 4OSUH 3ZE0E 1R6VA 4ELKB 4NQCA 1A8ZA 4ESKA 2MIZA 1CUOA 4LLUB 1LK2A 5HJ3A 2K8QA 3B2UD 3ISYA 3LD8C 4L3EB 1B2YA 1NGQH 2P5EB 4GINA 4I89A 5CP7A 4PG9B 4PV1C 4XOAA 3P02A 3L81A 4H0IA 3WUWG 1KG0B 5CHNA 4YDZA 4D3CH 1A7RH 1HX0A 4K8RC 2ICEC 5ICUA 5JIHA 4DCQA 4PJ5E 1RFDH 4PMFA 4YSUA 5IQ9B 3F62A 2GEQA 3ZE2B 4GT0A 1BP3B 3D0VA 1A6ZB 2FIRT 3P4NB 1MNUH 4IGBB 3WTUA 5HI5D 5ADOL 3C5ZD 5CFAA 3GXFA 4HUKB 4XMWA 4ZFOB 2FZ3A 3ISRA 3QJFB 3KXFA 1TVBB 1GGTA 4Y5XC 3IJHA 4AEHH 2EVJA 4JFHE 2E74C 4JN2A 3NFSH 3RVVC 3F3HA 3K1KC 4QT5B 4PRIA 2FEEL 5C1MB 3PY9A 3O4LB 1VKXB 2GSIA 1SEQH 3MLXL 2X4TB 2HJKB 4N0YH 4F24A 4I7ZC 1E28B 4ABVA 3QPQC 5IREA 1A6AB 4YSQA 4X6FA 1UXWA 5BVPH 5FLUA 4OLVL 2Y72A 3TYFA 3IDMA 3MA9H 5EWIL 1HL5A 2X7LA 3OKKB 1J0IA 1QX1A 3ESNA 1JF6A 1KTCA 1NCWH 3GJFK 1IAMA 2GTWB 2DI8A 1JZ6A 4J1UA 2J21A 3B7TA 1CI5A 1J1PL 1F0LA 1G7HA 3FFCD 4Z3FA 1AOHA 1PLBA 2XG5B 1E27B 4RGOH 5DD1L 5GSVA 1TJIL 2PLTA 3RWEB 1L7IH 3A23A 4JFEB 3SYCA 4N9OB 4XCEB 4TNVF 1KJMA 3LRMA 5IFAL 5K9QG 1DFBH 2IG2L 4KKZA 4L5FL 3PGCB 3MJ7B 4YOKA 5GZOD 5EEYA 5DQJB 2NPLX 4JO1L 4KVNL 4FGMA 4YHNB 3NA9H 2PP9A 1Y1DA 1JIBA 3KDPB 4LMQI 5EBMB 3WLBB 2JCCA 1E5UI 1LMIA 2EDYA 1BQUA 3MUGA 4NB7A 4CU8A 4TNGA 5AVQB 1LO3L 5T5NF 1R3HA 1YEGL 5IW6B 2DQGH 3DIDA 4X6BA 1RURL 1EHKB 1IC4L 2H2PD 4UM9D 2JFCA 3QIWD 2HLFC 1WAAF 4HWZB 4G1MA 2ATPA 2YPVH 3ARGD 4JJHA 3RJOA 3BRGC 3BE1L 5C0JB 2YRZA 5DUBA 2M8XA 2OMXB 3QNXA 3PXHA 1TYJA 1KZQA 3B6SB 2HUHA 2XQYA 4QWWD 1MHHA 5FO9A 4EOWH 1HIML 1I1FB 3CFKB 5I76B 3C6SB 5I8KH 5SX5H 1CTMA 3HVNA 4PMEA 1DFXA 2AGJL 2G3XA 4G6KH 1RZJL 5DZVA 1OP5K 1DVQA 1N0XH 4HAGA 2BSDA 4OBSA 2IANA 5IQ7H 3NIGB 1A0QL 3GJFB 1CDBA 4BHUA 4WSGA 1DEDA 5F0LB 5ITFA 3NTCH 1OF0A 5GHWL 5LWYL 1WO2A 4XCYB 3DETC 4OZGE 1YY8B 1DJIA 2Y7SA 5J0BA 3VVWA 3QP3A 4LCWA 2ZX6A 1E9QB 5IUCA 3ETBF 4GQRA 5IMOB 2VC2H 1I31A 1BWWA 1MQ8A 2NY5L 3PWNA 3G6DL 3K72A 4XP9L 3WI9A 1N5YH 1BX2B 1NOAA 3DSFL 4NENB 4PB0L 1MFDL 3TTYA 3T4AA 3U1QA 2SODB 3GXTA 3O45A 1QBLL 2EH7L 1CLYH 5F9OL 3W0WA 4HUUB 4FP8H 5F1NB 3DVIA 5H94A 3C6LA 4F20A 5KSUB 1H15B 1NQBA 3RPKA 2IPKB 6CGTA 2R2EB 1YEIL 3LN5A 5HD8D 1OCZB 1QLRA 4HD9A 3WO3B 4TTGA 5DWPA 3O6FD 3KL0A 5E6SB 3RTLA 3SPJA 3BJ91 5DFVD 1ZA3B 3EFFB 4ZRGA 5G5DA 1WZKA 3NIDE 3TYGH 5J1TC 1FIGH 4EAEA 2BNUA 4OGQC 5E70A 5HYIA 5IHZB 1KTDB 4PD4J 1A1NA 1KLUB 1T1YB 4KK5D 1XCTB 4ZXBD 4JFDE 1BD2E 3K6SB 1KTJA 2UY6B 1Q72L 3QYMA 1TZAA 3C2AH 4BJLA 5F7KC 2VRAA 5AW4B 4XTRC 2BSSA 4MXWL 5DI8A 2JQAA 3GBLA 4HUCA 4OUUB 1RIVL 5C08A 4ANWA 3QH3A 2EICA 3SDCC 5IMLB 5J6GB 4P9HL 1JTPA 3K4DA 5DEGA 1ZSHA 2XQBH 4X6CF 3CN0A 2K8MA 4MLSA 2M83A 3N3EA 3VG0H 4D9LL 1U8MB 4W4OC 4PP2B 5BZDA 1EZUA 2DQFB 2B3IA 1DVUA 1C9SA 5KYNA 3ETBJ 3SGJA 3VXNB 2OYLA 1G1CA 1K5WA 1O5DT 4X0KB 4PGEA 2X12A 4L8SA 2JQMA 4Y7MA 3FFCB 1NBQA 3HG0A 2C1PB 4ODHH 2EDWA 3BIAX 4XAKE 5BZZA 4NKIL 4GRMA 2GAZB 4IOIA 3H2PA 4WW2A 2WXKA 2FX8H 2XV0A 2JKTM 4NI6A 5BW7A 1NGZA 5JOPD 2IDFA 3MRLB 5A2BA 3GSQB 3MGTA 1QP1A 1ZCRA 3VH8G 1I9JH 1Q8MA 2GK0A 5C0IB 3RL1A 2JLLA 2ZJSH 2GY7B 4N6QA 5BZXA 2I32A 5FUCC 4ZPVB 1DVFD 1RKRA 1ZLVH 1JZ8A 2H32H 4PJBE 2XWJA 4GSUA 4YPGB 1GXEA 3TVMA 1DQQB 1F2XK 2B77A 3X13A 4X4ZA 5D4QA 1YN7B 3HE7A 4Z0BH 5GRJL 1J0HA 1EAJA 4HKXA 1G7IA 5EMYA 3I75A 3AY2A 4LVHC 4ZAKA 4WU7B 3ARGB 2NSXA 2P46B 5C2BH 1YEFL 3OWRA 3U6XA 5KWYC 4IJTA 1XGQA 3JSSA 4JLRB 1EFQA 3WMPA 3UZEC 1HEZB 3FRUA 1XBDA 1LEKB 3Q0HA 2I24N 3BWAB 4AQ8A 3U0PA 4AGPA 3IFPB 4OAWA 1MXDA 3L3JB 2EUXA 4LVHB 1WC7A 5TDPA 2OL3H 3S36L 2OLDA 4BRVA 4FQ2L 2BNQB 4PRBB 4JZJB 1FGNL 1C1EH 1R3IL 2E56A 1MAKA 2BOCB 1NEUA 2C9SA 2NY0D 2YPKA 3EJQA 3PPEA 3QJOA 2Y07L 2ZCLL 1GYUA 4C4UA 3FU7A 3QQ9D 3GS4A 1W0VA 5TE4L 2ADJB 3WS6A 4BRJA 1Y18B 5K1JA 1W0WA 2JJVA 1G87A 3WU1A 2X1OA 4UZUA 3CX5J 2UZYA 3N1GC 2RGSA 4MFHA 1DSYA 3LQAC 4APXA 2C9XA 3I6LE 5J11C 2GQHA 1WS7A 1KLGA 3SHSA 5GJTH 5FOBA 2XBZA 4LSQH 3C8KB 3LS4H 4OR1A 5HI3C 2JKIS 4QAWA 3MJ9L 2AAVA 1JGVL 5I1EH 4OFYA 1WDAA 5TDOA 1U58B 1JV5B 3NJFA 1KIPB 3QDJD 4EZKA 4P2RA 5J11B 3KPLA 1DQKA 1MHCB 3COOA 2DWEB 3I3DA 4ODSH 3WFDH 3L3OC 5AB9A 2YSSB 5D1ZC 4YK4B 1F4YH 3F12A 3FO2A 4YNYA 5H4YA 1ZTXL 1GIGL 5H2BA 1P1VA 2FQGA 1M57B 4AMKH 5LDSA 4P2QA 4IKIA 2CIIB 1AANA 5CSZA 5K1VA 1H0DB 5CEXA 4JM2D 3C5ZA 3O9WA 5J6SA 2Z92A 3L3OB 4FTVE 5C9KA 4QGTA 4K2UL 4YSAA 3FB7B 4PP1D 2E9WA 4ZMZA 1NLDL 1KIRA 5T3ZL 4JQIA 1F11A 3AXHA 2IO5A 4OJDH 4A7GA 4H8QA 3ME0B 4UDUB 3DROB 1BGXL 4NC2B 1GGUA 5JW4N 4D9QE 1J8KA 1K4CB 1TZOA 3T71A 3S34H 4CRPA 2RR3A 4KY1H 1E42A 4PJIE 4HH9A 1BBJB 3Q13A 4QRTA 3SD2A 5JW3L 1L7TH 2BCKB 4R4ND 4WHTB 3BQUD 1FL5B 4Q2ZB 2OXGA 1ECZA 1TF4A 3IDYC 1HC1A 5EULV 4ZUWA 1QI5A 2R0ZH 1GVIA 3RVWC 2ZOOA 3VFVB 4M02A 3DX6B 4YDLB 1OAZH 3L3IA 4U1IB 4RLDA 5LN8A 1T3FA 3QNYB 1MCHA 3IJ8A 1J1OH 3LN4A 4JZOA 2P8LB 1AZRA 3FOMB 3FQRA 3VXOB 2W60B 3VXRB 4Q9QL 3IDYB 3JWDH 1MFEH 2QVMA 5D96C 5HYJE 4PWGA 1RK7A 4TRPH 2HKAA 5GZOA 4I1RA 2FO1A 2AK4D 1FVDA 4FFZA 4RAUA 2WWKO 3L4CA 3QXVA 2D9QB 1LL1A 3SIKA 4A7QA 2Y7MA 1ZT1B 4EE2A 3CLFL 5AW0B 1J5CA 1DVFB 1EWHA 2H3NA 3CN1A 5FYKE 3SYAA 4KQ4H 5D96B 2FH8A 2E6QA 2R27A 2I07A 4Y4KB 1XGUB 3EXJA 4QRQA 2DH3A 5GS2D 4F58L 2HT4D 4GQPH 2FVNA 1Z3GL 5CN1A 1V8HA 1F00I 4UM9A 3FS9A 1NCAH 1WWWX 3B34A 5KVEE 3GUFA 1S9YA 4BSVB 2Y25A 4YLBA 4K7PL 1A7OL 3SE9H 3MRFA 1NKOA 1F1DA 1OM3H 3ZQWA 3GM0A 4FQJL 2ZX8A 3OGCA 4N2BA 5CINH 2V9TA 2OXHB 1ZJAA 1R34A 2DW5A 3G6JE 3MV7A 2CR6A 3PLYA 4X9GA 2EDBA 1M05A 3CK0H 2A6JB 3TN0A 4G59C 4N0CC 1H3TA 2J1KA 4ICWA 1A9EA 1QZNA 4ISVB 2NY0B 2NLJB 5DVOA 4DKFH 4I77H 1SHSA 2VMCA 1WTLA 4GRWF 4OGYL 3BJLA 2EDXA 2DOCA 2YD4A 4AK1A 3LB6D 3MLRH 4Z7VE 4PRHE 1F8TL 2K4AA 2G3ZA 5LCVL 1XB8A 4NP4L 3HS0A 3IN2A 1WBZB 3CBRA 3NCCB 3DXAB 4MXQD 1E6OL 4Y4HB 5FYLH 2HB0A 3SJVA 3CDFA 4GPVA 1LVEA 2YUZA 1DBML 1YEJL 1QSZA 5D2LB 3W56A 1OWWA 2IAMD 4KO6A 3VXTB 1KJ2B 3B2VH 4LP5A 3KYNB 1TYEB 3Q2LA 1NC2D 1JK8A 4JDVA 4HJJH 4N3TA 1XCQB 1ADWA 1GSKA 1PKQE 3NFNB 4MJHA 4F37F 3KHQA 5E8PA 4F7KA 2X89A 2C1OA 4DTGL 5D4HA 5E23A 2ROYA 1U8JA 1UXSB 4YQXH 1FV1A 4OD3H 2YPLE 2W0FA 4KTGA 5FUCE 3BT2H 4JFXA 2NX5B 3F8UB 4FJ6A 3ZTCC 1AQDB 4RISL 2F0CA 2QPFA 4OZFB 3ARBA 2VLKE 4UT9A 5DHVB 5K9KA 5MEND 1R3JB 2E27L 1IQDA 1QRNB 4HKJB 4UYQA 1YY9D 2JELL 1QMUA 1RUML 3NA4A 4DO6A 4ZXBA 3TX4A 4LRIA 4X9YA 3MLSL 4K3DH 1XZ0A 4G3YL 3EJRA 1ZAGA 2B4CL 4ODWB 5E2VL 1WAEA 4HIIB 4IKNA 1KB5B 4WUUD 2NYYC 5FEBA 4L9DA 5CBAA 3BPNC 3P73A 4DOHB 2YWZA 3D4GA 3TS8A 4QHLB 4UILL 5EU3B 5T5NG 3ZIYA 2YJQA 4U1NA 3F7VA