5DZJA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase 2 with carbapenem drug t206 in conformation a
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
351
structure length
351
Chain Sequence
LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Non-classical transpeptidases yield insight into new antibacterials.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transferase
total genus 91
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5dzjA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dzjA02
5DUJA 4A1JA 4QRAA 3U1QA 5D7HA 4A1IA 2HKLA 3TURA 4A52A 3VAEA 4JMNA 5DZJA 5DC2A 4HU2A 4A1KA 4GSQA 5E1GA 4QR7A 4Z7AA 3VYOA 2MTZA 5E51A 3ZG4A 5DCCA 3ZGPA 3ZQDA 4GSRA 4LZHA 5DU7A 4ZFQA 5K69A 3VYPA 3TX4A 3VYNA 5LB1A 4QTFA 4LPQA 5E5LA 4K73A 1Y7MA 4XVOA 4HUCA 5E1IA 4JMXA 3U1PA 1ZATA 5DVPA 5LBGA 4QRBA 5DZPA 4GSUA
chains in the Genus database with same CATH superfamily
2VZSA 3QZMA 2BH0A 3MODL 1CXEA 1QFOA 3MX0A 3MZTA 4F1SA 5EUOE 1VJSA 3H9ZA 3KVQA 1TUPA 1ZTXL 4JG9A 2V5YA 1ASPA 4ODVL 2BY3A 3OXSA 4W9EC 4U6VL 4WO0A 1NIAA 4QJ5B 1X4XA 4PJCB 3GSNB 4PHXA 2Z31C 2VDPB 4CSTA 5E1IA 1OEZW 3EF7A 3RL1B 1CGYA 3WUWG 1X5YA 4QKTA 5KBPA 4HUNB 3V7AG 4JRXA 2IG2H 5ICYB 3V4PB 1XIWD 1VFAA 4XPTL 4MJ5A 3VSQA 3H9HA 1DZBA 4P2QE 2JELL 4WJ5B 3LZPA 3MRFA 3O3UN 1NICA 2OMBA 1AR1B 1JG9A 4H0HB 4BK8A 1HNYA 1JOIA 1TG8A 4L3FA 1OAKH 2W5PA 4TSCL 2VLMD 1DJZA 2HH0L 1OPOA 3BKJH 5FM5O 1TF4A 3OMIB 3VD2A 5EPMA 3ES6B 5IR1B 2B7DT 4HK0B 1AIFA 1HHGB 2HPOA 5K9QI 1HEJC 1A1MA 3JT2A 4G5ZH 3O6FB 5IVOA 5KVDH 4MA7L 3T0VA 2V2TA 1MWAL 4WWKD 2Q3ZA 2ZSWB 2QTEA 2YMOA 3MTRA 2R2BA 4G59C 5GQBA 3TIEA 3MAWA 4QT5A 1KJVA 2DLFH 3KPOB 3LQZB 2QHRH 5SX5H 2BC4B 2X2YA 5IUCA 1FF5A 4F7CB 2BVYA 1WAAE 3FCGA 3L3IB 1FC2D 3GXDA 3RWCA 1ZV5A 3ZMEA 4QTHA 3LJ3A 4FZ8L 3RBGA 2VMCA 4E41B 4LVNB 2DJUA 5T1MA 3MYJB 3CZFA 1L9NA 3HI5H 3MRLB 3Q5YA 2W65B 3MV9E 4HX1B 4LCCB 4QCIB 5DS8A 3AY4A 2WMPA 2FLMA 2Q3XA 1YNTB 3MKGA 4CW1A 4IRJB 5ENWA 4GRLD 1YNLL 3C60D 2DYRB 4XOAA 1W0WA 2QDWA 1NCJA 5HHNA 5CEZE 2CSPA 2R15A 3LD8B 4NJAH 3SBWA 1H3TA 3X17A 3II2A 32C2A 5BZDA 2GCYA 1BQRA 1TZIA 3OKEB 5EBMB 3EJUA 3ULVC 3HBPA 5TK2A 1Z9LA 5F3BA 2PR9A 4LHUB 3SGEI 1DEEB 2J56A 3U0WL 2PWFA 1NJ9B 1P4UA 1QZNA 2I24N 4TN9A 2G0KA 5SWQA 2ITCB 1NFKA 4EDWH 4ZXBA 1KN2L 4HGWA 2BM3A 5AW1B 1ORQB 3QUZB 5K9JH 2DLIA 4IKLA 2PW1A 3Q0HA 1XSOA 3B9VA 4P3DA 1UH3A 3RFZA 1GIGL 2DEXX 2VLRD 5CU5A 3KLDA 4DKFL 2FJHA 2XY1A 3H0TB 4IYKA 4OD2A 2YRBA 3V0IA 1XGYL 4KPHH 5G4NA 4W9DC 4P2AA 4BSWB 1AR1C 3HI1A 1COBA 5LAPA 1MNUL 3UG5A 2X87A 3QIWB 3WS6A 4PB9L 5TF0A 4YAQA 1FN4A 4JPIA 2C9UA 4EI5A 1D9KB 2Y07L 5CD5D 4HJSA 4WHTB 1AC0A 3PDGA 2QGCA 3B56A 3D25B 4MD0B 5DMJB 3GSVA 4OLXH 2VAAB 3GJEA 2XETA 2PYEA 3QEQE 3GSRB 2J8HA 1EZVY 4XAWL 3O6FC 3WELA 2QKIB 3NACH 5BRPA 2NXZC 5AYUH 1CFTA 5HHXL 5J3HC 4FAAB 3CN3A 3TBSA 2MMXA 4PY7A 3FW6A 2FL5A 4FHJA 1JZ4A 5C3IA 1A7PL 3C09C 4XP9H 3RIAK 4YBLB 5HPMA 4EMZA 4A2GA 5FECB 2AGJL 4N20A 1DHKA 1RK1B 3L17A 4KVNL 2R39A 3IDYB 4NUGL 3LKRA 3MLSH 4UZUA 1E8YA 3O6ML 4LVNC 1UOKA 2JKWA 5FYLL 3DRQB 2OW7A 4OLZH 3O3BB 4ZOCA 3T71A 1G9NH 4IRJD 5I5MA 5C0BE 1WA0X 4G8FB 3UACA 4LCCC 3UZVB 1MVUB 4OF6A 2YAQA 3L6FB 3DJTA 4J8QA 1EO8H 2BNRD 2KPNA 4ANKA 4GPVA 4FQLH 5LQBH 2BZDA 4DTGH 1VADB 3AUWB 1CN4A 2LE9A 3P3SA 1FLRH 1G9HA 2CHWA 2C9QA 1Y07A 3HIZA 3TEYA 3P3YA 1H0DA 2H3NB 1KLFB 1Q1PA 3QDGE 1NPJA 3CC5B 3P9LA 4YFLF 5C0CD 3MRNA 2QGDA 3V9CA 3W0WA 1DQIA 4A37A 5AVRB 4LL1A 1HDMA 1AD9A 3UPCA 2EC9T 1F3DH 2YPLB 1M9SA 1MH5B 2CJTA 3QUZC 2VL5A 3KEDA 3AACA 3PP3K 3BT2H 3WEMA 3C6SB 2CHZA 1QHQA 2NYYC 5KOVC 5DF0A 5DUML 4JQXC 4LPXA 5E7BA 5AB9A 5FEBA 2CALA 5D7SL 1PZ5B 3BUQA 5D7LA 4OFVA 3IGAA 3PWPA 3KYKH 4HXBL 4Z3FA 3GMQB 3NYKA 3F3HA 3ZSSA 3RB5A 4EO5A 2ARJQ 2YAEA 3QIWC 5E8EA 1XF5B 1FPTH 3VXUB 1AE6L 3CDZA 3BISA 1D9KC 1NCUA 5HHME 5C0IB 4LAQH 4UT6A 4WCYL 2IAMB 4H88L 1UB5A 4IU3B 3T77A 1IGTB 1BYOA 2XN9D 4U6YB 5DD3L 3VXMD 1FL6B 1AG6A 3NCWA 2D3LA 3OKNB 2WO2B 4DZBB 1SJHA 5L8LB 2QKIC 2MTAA 3OLEA 4GIOA 2GUOB 2K6YA 4MHHI 4UTBL 2PCXA 4I1RA 3SKJH 3JSSA 3N1FC 4P2RB 1MY7A 3PQYA 4LEXL 1NCBL 4DGUA 2A77H 2HLAA 3RGVB 2PPFA 1IKOP 5I75C 1AKJA 4OZFB 4YBLC 2OSLA 3ZE0B 1NOAA 1J0IA 4L1HA 3DVNB 3IDYC 3HMWH 2HFFB 1XMEB 2JJSA 5TE4H 4HIEB 1VCAA 3D9AL 4FMVA 3KE0A 4K4KA 1QBLL 2WXPA 3K0WA 4AW4A 1PZUB 3OAYK 1DBMH 4X9FA 1HH6B 4HLZH 4M48L 4QXTB 4AV4A 5D7IB 3QA3A 4F9LC 4U1KA 5E5LA 4JO2H 5E8OA 1RIVL 4L29B 2VQUA 1IO4C 1QFWM 3WAKA 3U1PA 3HMXL 1EBAA 4N5ED 2OXGB 5EU7C 1CDHA 5DWUL 5HHPB 4PJXB 5E6SB 3VXNB 4MX7B 4M5SA 3ZDZE 2F7OA 3PHSA 4O2CB 3K4DA 4PLJC 4AJYV 3OPZL 3PL6B 1IC7L 1T7YA 3QDJE 4MJ2A 3WFDL 1LDSA 2AP2A 2IWEA 3A67L 4DVRH 1RIUH 5CP3A 2YKLH 5HHQB 2N1KA 1C08A 4TPRL 1D6EB 3EDKA 4U6XB 2NY0B 1BXXA 4UTAA 1OANA 3T8XA 1EZUA 5BOPA 3ERXA 5GZOD 1CU4L 2VE6B 4DO5A 1YY8B 3QJHA 1H3PL 3MROA 3ZL1A 4MMZA 2V9UA 4N2AA 2YAHA 3EFFB 2CO7A 4ZMZA 4AZUA 3BD5A 1E3XA 2CIKA 5I82A 2DYPA 3VXUD 5IFHH 3QNXB 1CXLA 4A2MA 3U1QA 4PD4J 5D71L 3RNQB 2IAMD 4PRPD 3LH8A 3ZX1A 4JZNA 1RY7B 1OP9A 1PYWB 2ESVA 2WTRA 5GS1A 2DTSA 2XN0A 1D7CA 4UNIA 4P9HC 1R75A 1A6WL 1G7LB 4G8EB 4KKAC 2NSQA 4AENA 5FHBL 4A7TA 1IC0A 5CZKA 4ZMLA 1O6TA 3ZDXB 1PZCA 1F6LL 2AEQL 8FABB 4BRJA 4GW1B 1UT1A 2KLSA 1MHCB 3EJZD 5D72H 4FYRA 4PJ9B 2X12A 1QMUA 3ABZA 1IAMA 4POZC 3CTTA 4FLQA 2FDBP 4TOYH 1CXIA 2E46A 2AABH 4OGYH 1NFIA 4YX2L 5DVLA 1MCHA 2GI0A 3MKKA 4L3ED 4IMLB 5E6UB 2OS7A 2JQAA 5LBSA 3ZYOA 5C6WH 4Q9QL 4BKSC 1NQBA 5FO9B 5LG6A 2BVQA 1AYRA 1VRSA 5FLVA 2GJ6B 1MJ8L 5CCKL 1YEFL 3OGCB 2X41A 1IL1B 2AJ3B 4ONHA 3AC0A 1GTFA 2HJLA 5MEQB 4FQHB 1JGEB 4HJGB 4QRAA 1ZEAL 3PRZA 5C0ND 3FOLA 1MIMH 3ZMNA 2ZPKL 1N64L 1Q94B 4EUPB 3GSNL 3TBCA 3TO2A 3WLBB 1DUZA 3PL6D 3V9FA 4MQTB 1PLGL 4WI9A 1IEAB 5KYYA 1D5BB 4WNQB 1AQDA 5DT1H 5D7JA 2H26B 4NSKB 4BQCA 3FQ2A 3UTOA 3SBQA 3V4PL 4ADGA 3MOQA 4HUVA 4PSRA 4GG6B 4O02B 1NIEA 3SOBL 3M7FB 4I18B 3GXPA 4WRLA 5KS9B 1PLCA 2OMWA 3BP5A 4HGMA 5MHSE 4Q56A 4A04A 4MQ7A 4DAGH 3WGVB 2DWXA 2NY0C 3CZJA 4QAMB 2M83A 1M6UA 4NZJA 1RH8A 4UYPA 1EV2E 4F5CA 5C07B 3DRTB 3OLDA 3H6JA 3P54A 5TH2A 5J6GB 3HLAA 2MWCA 3O6LH 4JR9L 1PQZA 1E4XH 5LGJA 3S97C 3KPRE 2VR9A 2VXQH 3KXFB 1OLLA 5FCSH 4HAFA 4CMHB 5TDOA 4A2HA 2AAAA 4Q89A 4PY8I 2G5UA 3PABA 4UIKH 3DTXA 5DFVD 3D39B 1U8JA 3NGBB 3G5ZB 5IB3B 4HJUA 4DKEH 4K3JH 1DLHA 4AJVA 3VCLB 5F9JB 1OAYH 4XRCB 5JA9A 3CH1A 2CK2A 3HG1E 1FYTE 1XF4A 1BM3L 2AEPH 1A64A 1I1AA 3CSYB 5D1ZB 5IHUL 5JORA 1RLWA 4OIFA 1JYWA 2XPGB 1AXTL 3IJEA 4Z8FH 4EN2A 3G6DL 3HJEA 1ND0B 1WUNT 3E2HB 4IGBA 2NY4D 1NSNL 2CK0H 4FG6C 1I53A 4N2BA 1KIUB 4KY1L 1KT2B 1MHPL 2PYFA 1TFHA 4C56E 1MQKL 3DXAB 3SGEH 1L4IA 3C6LC 1QX1A 2NX5A 4QRRE 3NCCB 4MFHA 3PJNA 3PY9A 4DHLA 3LKNA 5CEXB 1IEHA 3GJFK 1XZ0A 2DIEA 5TQ2H 3AADB 4LSUL 4W4OC 5I0YA 1R3JA 1WS7A 1I1FB 4IS6A 1FORH 5FYJH 2W81C 4A7VA 5BRZD 3QARA 1RL1A 3UAJC 4EDXB 4LDEB 1ZWIA 4GYBA 3EKCA 2HMIC 3MV7D 5I71B 3VD5A 4JPQA 1DO6A 1J1PL 1OT4A 3AQYA 1R0AL 3T4AA 3QJXA 2GSGA 1WFJA 5I74B 2EDQA 2MCG1 4H20L 1TVBA 4CGUB 4I89A 3HA0A 1EDQA 4Q52A 4ECNA 4B9KC 4XBMA 1UH2A 2CNYA 4WU7B 2HJKA 2QZQA 3U6XA 3VVVA 4HKJA 4PV9B 3QXWA 1FFPB 3QO1A 4J28A 1S7QA 1TTRA 3PGDA 4I18C 4ZUTA 5C07D 2VLKD 3IETA 4ZQTA 3DROA 3GRWL 3FJTA 4HIHB 1JWMA 1TCRA 2EE9A 3QJRB 4TNVK 4JGNA 3S88L 3HZVB 3L8QA 2DJ4A 1E42A 1KFGA 2LHAA 1JNLH 5FDWA 1D5RA 3O2WH 7CGTA 1X5LA 1U8MA 2OI9B 4CVZA 5HPOA 2BRRL 1BQUA 5LGHH 1B4JL 1JXDA 3UZEA 4NN7B 4JFFB 4JFDB 5I17A 1SEQL 1S9XB 3K81A 4UV7H 3D85B 3BI9X 4ANXA 3MLTB 3KEHA 3GHPA 3TT3L 5DD0L 3HUJF 4FFWD 4JRXE 3ETBJ 4CJ1A 5D1ZD 5J1TC 3VJ6A 1HSAB 2AQTA 2DPKA 2UVFA 2ZTBA 4FTVA 4I5BB 1G4RA 1RQ5A 4GBXD 4LAJH 4CUCA 4I9WE 3DOSA 1X5AA 4PRIB 2UWEA 2MCPL 4BUGA 4XNYH 1DBKL 1YEWA 4KQ3L 4OVVA 1N3NB 2XY2A 3B7SA 1Q9WA 4P23B 3OM3B 1FA4A 3CDCA 1BQ5A 3DXAD 1LEGB 4QHPA 1MG3C 1YMHA 1VZHA 2Z7WA 3KBEA 3E2HC 3VMOA 4I3GA 5ABZA 5JDJA 2EYRB 4AQZA 1JGVH 1UURA 2KDYA 4YDJA 4WGKA 2YGPA 1TTGA 1DSFL 5GSVB 3UBXB 2XWBB 3TPKA 1H3VA 5EEZA 4UI2A 3BWZA 1A7QH 2FEDD 5KSAA 4XPGH 4S0HA 3D2UA 4I3SH 2ARWA 5B1CA 5HTSA 5F1KC 3MV8D 3NIFB 3FRPB 2C4FT 1QP1A 2IGFH 1FG2B 1U33A 5D4IA 3WXWH 2DL9A 4Z7NE 5EHFA 5F3HB 3ZBMA 4G8AC 3QG7H 2C1PA 4P9ML 1EERB 4WHYH 5EU3A 5I74C 3MR9B 3U48A 5L2JA 4OCRL 2PTUA 1VERA 1WTGT 4OTXL 3KLSA 3EYFB 3CXHJ 4YHMH 1RUQH 3L4YA 5E70A 4XP1H 3TC9A 4HWUA 3C2SA 2ZXAA 4POYA 1U8CB 2R0LL 4MA1B 3PWJB 4BWWA 1UOLA 3F7PC 1I8IA 4M5YH 3LEYH 3CAFA 2VAJA 1F1DA 1MEXL 4P46D 1FBIH 3UOAB 1RJZB 4PEEA 3U2IA 2O6FA 5DJDB 1JHTB 4GO9A 4JG0L 5DRZA 1IKNC 3ROLA 2WLIA 3CZLA 1KB5H 4GAFB 2OPCA 4EBQH 1VEOA 1HT6A 3W56A 1HE7A 2OI9C 2XTJE 3BYTA 4G7SB 3PU7A 2Y9RT 1KG0A 4P9HL 3HC3L 2ZP0T 2WLJA 4X9BA 4Z7UE 4M93B 5IESL 4U2ZA 4DN3H 4HQQH 1WBZB 3CIAA 3INOA 4PJ6A 5EULV 2H32H 5B39A 4DWHA 1LO3H 2YZ8A 2PO6C 3MVSA 4QRBA 3WKNA 2XFXB 3WN5A 1U4EA 2B4CC 5ES4B 1B3JA 2P47B 3ZTNH 4X0NA 1M7UA 3OR7B 3UO1H 1TQBB 3ME0B 4HC1L 2XN2A 4XNMB 4X6FB 4Y2DB 4N87A 1S9WB 1U8PB 3PNWB 4Y4KB 5CINL 4LCUA 5I1IL 1U3JA 2XN1A 4G70B 2GBUA 3VXOA 4KZEH 3QRGL 1SBSL 3U25A 4XO9A 1HE8A 2AV1B 4P23C 4CVXB 4F24A 1FUNA 4JK0D 1CR9H 1IBZA 3EYSL 1E9QA 2WM0A 2PPCA 5FO7B 5HYSA 5JW4N 2KZ1B 3R19A 4G11A 1FGVH 2OTUB 4OM0L 3CGTA 1L5GA 1NC2A 4A2LA 3CFBA 2VXUL 2IC2A 4ZS7L 2NNAA 2DEYX 3OAZK 3OQ3B 1Y7VA 2E6QA 3FQUA 3WG7B 1QR4A 1T22A 1E9PB 1YAZA 4PRBB 1ZANH 4YL9A 3GF8A 2FO4B 5DZLA 3CHOA 3QXAB 3FB5A 4RBPH 2KS0A 2FYYB 4LIQE 4TSAH 3CVBA 1S7UA 1EA9C 2RQEA 4PRHD 4QHLA 4ZSOB 4YWGH 3SDAA 1EGJH 1IE4A 3QK0A 3GB7A 4NCC1 4P4KC 2QVKA 2VSMB 1L0YA 3OSKA 5CCGE 2YEZA 2HRPH 3Q6FB 4JM2D 3QPQC 2OKMA 4UOZA 2D7PA 3V79C 3GTVA 4LGSB 5EN2A 3TH4T 4AITA 1IBGH 5D7HA 3KPSB 4C4UA 3AG3B 3WD5L 1LNUA 1WT5C 1OT2A 5GS0D 1A3LL 4MA1C 4D9LL 4ODXB 3CH8A 5AL0A 1PDKB 1K4DA 3C5ZA 3NUKA 4GOSA 2EH8L 1NA8A 2HRGA 4X6CE 4AT6A 5C92A 5I8CB 5EEUA 5IJCC 1KPRA 4HIIA 1U21A 3QO0A 1UCBH 2X4RB 4AEIH 1OOAA 4EIZC 1OHZA 5E0FA 1BQHG 1ZA6B 5IROA 1NOLA 4QRTA 1TENA 5L0QB 1BAFH 2NXYC 4EOWH 2P5ED 1AXSB 2BP8B 3P9MB 4PRAA 3DSNA 4HH8A 3VXRD 1TNMA 4QXVA 3IDJB 4I77L 5GGTA 1I7RA 3QNZA 1IFHH 3IMVA 2ZYIA 4OJEH 4QF1B 4XH2A 5IB5B 3TVMA 5ACZB 2WVVA 4M93C 1T83C 1KELL 4KQ4L 4MB4A 4RGNB 1R5WA 1BEYL 2ZG1A 3K46A 3ZGIA 5C0DB 3ZKNC 3BIBX 3DUSB 3EFOA 3VRLE 5IEHA 4U1LA 3WTVA 1SQ2N 2LU4A 5BOJA 4G6KH 1BZOA 4Y4KD 3MRQA 3H3PL 1M2VA 2WLYA 1HXKA 1VPOL 2D2CC 5JPMA 3MUGA 2AJZB 1TQBC 1ZT1B 1RZKC 1R5IA 1L9PA 3MBEB 4Y2DC 1WF5A 2M1KA 4WI3A 3MLYL 5IIEA 4MAZA 3B2PA 3GIVA 2IGLA 1WO2A 3FTGA 3PWPE 1CG9B 4NQEB 1TCMA 2H2PC 2WC7A 1OAQL 1YC7A 2KZWA 2IAND 3WENA 3ROOB 1YJDL 2NY6D 2X3BA 4B9IA 3FTYA 3FFOA 4K23H 3ULVH 5E00B 1EO5A 4J3TA 4YGVA 1N67A 3QISA 2ATKA 2ICEA 2EEFA 4E9RA 2XVLA 5I2IA 1KNOB 5AKSA 4DVBB 2X4NB 1OSZA 3UYRL 1LEKB 3AU1A 4J23A 3UZQB 4YZFF 5E0QA 4XO3A 5SWZA 4Z7IA 5D2LE 3FUIA 2X09A 2HVBA 1CICA 3PPEA 4Z7VB 3RHWF 4J3OF 2X89A 4XT1C 1XH3A 4G7QB 4MZRA 2VDKB 1H19A 4PPTA 4I9XA 4I48B 2WUCL 1WH0A 5FB8B 2ZOTA 1X4YA 1MG2C 3REWA 3OKKA 1OL0A 5GZNC 3QZWG 2EDNA 4L8CB 4AM0Q 5DHVA 4P5RA 3RIFK 1RAMA 1JERA 3E8UH 4PMEA 5AVSB 3D7PA 2R27A 2GI7A 2R9HD 2WSDA 1CDYA 3BEVB 1U2CA 1X4ZA 3QR1A 3L3HA 4N0RA 1FE8H 3PGCA 1T1WA 5L0QC 3VDBA 2VDNH 4RGND 5EO9B 1GGIH 1M42A 1RUMH 2LAAA 5EH1A 5EO0B 3RVTC 4GAAA 3EIFA 4H2AA 4NIKB 1M1SA 3LHAA 4LPCA 4L0YA 1J9QA 3FQXA 4LEOB 3A6OA 5EU4A 2CPUA 1N2RB 3WHE0 1HYRC 2WK2A 2XWZA 1A14L 2YFNA 3NAAH 1QABA 3LNDA 4O4YL 3ZYIA 1UZ6F 1MCNA 2V2XA 3IDIB 1SYVA 1S8DB 3CSFA 4HOMA 3VXPB 3STLA 1V5JA 2FGWL 3N3EA 3HZMB 4KJWC 5KW9L 4NUJB 4ONFL 3BCFA 4IIQA 3IFNH 4YZWA 1DBAL 4MNQD 5CBAB 3BKJL 5K1NA 3LXAA 2UY6B 4LZHA 1DVSA 1JGIA 3MV11 4L8BA 2K45A 4XNQB 3PG2A 3QZLA 1PG7W 3QI9A 1ES0B 5EIIB 1UTDA 3RWIB 1CYWA 4FA6A 1OD9A 2HJFA 5D1ZI 2UUDH 5ANMB 3VH8G 4BZYA 2ESVE 5D1XD 5DRNA 1AMXA 3OB0H 1KPVB 1TVDA 5ACLA 1A6PA 1X9RA 1P4BL 1TJMA 5IWLA 4MNGE 4AL8L 2PABA 1B2WH 4KOCA 2A74B 5E5RB 5IW6A 4G6FD 4EF3A 1LM8V 2UZIH 3BQUB 4XNUL 4NUPA 2XXCB 2GTWA 4OGAC 1A5FH 5IEKB 3FU0A 3WLWD 5A16A 3DOIA 5EO1A 4MJIB 5ADOH 3WNNA 4FCHA 1CXKA 1TJHL 4JJHA 3U4AA 4ZYKA 3RX7A 3PV7A 4HKBA 2IPTH 3EH4B 5DJXA 2FX7L 3P0GB 3PHAA 1UZ8B 2K9UA 2PXYB 3EUDA 3FUKA 4QRUA 4H25B 4P2OB 4LASL 2NNXA 1XF3B 3D18A 5F8RC 2ZOKA 3ULUH 3O3AA 4M29A 5A7EA 1DQDH 4E9LA 5EC1B 4XOEA 4TUKH 4ZW5A 1P6WA 1Q1JL 1ZOXA 2PPAA 4FFZH 1SLUA 4KKNA 2B5IB 3S96B 5F97E 2WANA 5CSZB 4GAGH 1E5UI 3LAFA 2C7UB 1UXWB 2P5WD 1I4FB 4UAHA 3V6BR 1QPXA 3QIUD 2I9LB 3M8OL 4JKPL 2X6VA 4XI5D 1N0XH 5PCYA 2OL3H 3F6LA 1I9JL 1OW0C 4AMXA 3GFUA 3QXVA 4QTIL 1FNLA 1YHPA 4EN3A 5B4MD 2B4CL 3F5WA 4QRSA 3FU8A 2RAMA 1U95B 2D7MA 1ZIAA 2MKWA 2ZE0A 4QYOB 5DK0A 2ZX8A 5K9JL 3N85H 1NFAA 1CE1L 5F96H 3ZKXB 5EZOH 3MRIB 2MPAL 1Q9OB 2AKRA 1KIRA 3FDWA 5I1KL 3AS1A 3HW7A 5JW3H 1FO0A 2Z4TA 5FOBA 2W92A 4CADA 1QG3A 2P8PA 3O11A 4HKZA 1E8WA 2C1OB 5D8JH 2DIBA 4AG4H 4HHAB 4ZAKD 5IFJA 3SCMD 1BD2E 4JVUA 3QNFA 4YHNB 4JQIH 1XF2B 4G3YH 2DI9A 4R4ND 3SDYL 4L5FE 5HVHC 1UATA 1XXDC 3L45A 4X5XA 2XPYA 1R46A 3QWNA 1JF1B 2DWTA 2I5YH 3K2UL 3MRCB 5KWYC 3F58H 2J8UF 4RWHA 2FSEA 2OXHA 1SOSA 3DKHA 3RKDD 5CKAA 4KX9A 4FF9A 1FJ1A 1KBGL 5DLMH 3GMMA 4TTGA 5FUCC 2J5WA 3IEAA 4N68A 3BQUC 3VI4F 3WHE1 5C3LD 1UJ3A 3O2DH 3SBPA 1OTTD 2IOMA 3ULSB 3FHEA 4XAKE 3UBXI 5B7FA 1ET8A 2ITFA 5JLZA 4ZK8A 4KVPA 3KPMB 1YSOA 4TKWA 2M8XA 2LFEA 4XMLH 4IEFA 4DGYH 3SGKA 4KAQL 5FYJD 2G2RA 1KENH 5HHOA 2NX5E 3F85A 2PXYC 3HS0A 4P2OC 4URKA 5DJYB 4OCXH 3W9EB 1J8SA 5GS0L 5DVOA 2MRYA 2B5IC 1L7TL 1T21A 2ICWB 3FOMA 4NP9A 1ANUA 2DMCA 1NGYB 3ATDA 3LS5L 3X12B 5KVGL 3H42L 2C7FA 1ZS2A 4G8GA 4YR6B 3MXWH 4JAMB 3ARXA 1SHMA 4PJEF 4WSKA 2L04A 3N5AA 5TPWL 1O6VA 1MKFA 3ETSA 3WFEL 3VO0A 4KRNA 3HTLX 3MYZA 3US9A 5FHAL 4JFED 3QYMA 4AGOA 3CBJB 2V5RA 3BGAA 3KNBB 1N5AB 4XZUB 4FNQA 1MUJA 1AQHA 3EO1A 3F2LA 7PCYA 8PAZA 1RSYA 1PKQB 5DI8A 3KYNB 2LU7A 5GS2H 1JZ2A 3QWOA 2AZAA 2WXHA 2CLZB 2WIIA 4UIMA 3MSPA 3BP4B 4H8WC 4PJGF 5EBGA 5D1QE 1IGJA 3WFCH 3GSXB 5DMGD 1SLWA 4CMMB 1MCPH 2D3VA 4HG4K 5DMIH 5GRJH 2WKLA 4RRPA 2OYLA 2DLTA 1QR1B 3FB7A 2X53A 4JN1H 3BLPX 3HG5A 2XWRA 5GJSL 5BVPH 5E5UB 4JO3H 3RJDA 3LZQA 5CCJA 2VXSH 1B4LA 3FU7A 1PCSA 3I50L 1KGUA 3QZPA 4LMQI 2YAFA 2UWEE 3HNVL 3O6KH 5FC9A 4JFSA 2DQDL 4ZDHA 3U30C 2B1HH 1MFAH 5JR1H 3C5JA 4DESA 5JNYB 4P5TB 4ZPVA 4CNIB 1SJMA 3U1SL 3F6JA 4WW1B 3MRGB 5T3XE 1TEFA 2EXWC 2DAVA 2A6DA 1EAJA 4JLRA 4LBEB 5AFAA 3IWUA 3NG5A 4EZKA 5I24A 2J4WH 4XVUC 3OB8A 1YUKB 1OVZA 4FMFA 5JMRA 1YN7A 3JWDL 2ZKHL 3ZYZA 1FZMB 1S7TB 3GIZL 3HE7D 4FQCL 4W9KC 1YNKH 3MRHB 3VWKD 3UTZB 4RA3A 2GC4C 3IT8D 4MJJA 3SYCA 2W9EH 4R0LB 2FBRA 1BVKB 1J0YA 4JVWA 5ETUB 5ILTH 2WB7A 3Q8EA 3T2NH 3UC0H 5HVGB 1QFWL 3VTTA 4NQDD 2DLGA 2R29A 1E4WH 1A4KB 2J6WA 3VGFA 3CN2A 4NWTH 3JV4A 3FUEA 3WTSA 5IM7A 5I8KL 3PHQA 1J9RA 3HUJA 3NVQA 4UU9B 2LABA 1PZDA 2G5RA 5CGYC 4GXUN 2OJEB 4BHUI 5T3ZE 1VACA 1V7NH 3AY2A 4ADJA 3EUUA 3WFHB 4BKTC 1T3FB 3ETBF 1KCSL 4UMSA 2PPDA 3RWEA 5MEPB 5IFHL 4ODSH 1ZLUH 3KW7A 3AG4B 1YYML 3NRFA 1FLTX 4FGMA 2HTKD 1G6RA 4N0YL 4X4MA 4ELMF 2F5BL 4GKSB 1IB5A 2OV0A 4B27A 3KAAA 1FNSL 4ETQA 4WW2F 3UJIH 3KPQB 3UYOD 3GPSA 2G9HB 3APCA 3WE6B 3WUWB 1OSPL 1IM3A 2IWFA 4M8QA 2ZCHL 3IMTA 1SEBA 2FZ3A 5IUSA 4AYFB 3F65A 4KITB 4Y1TA 3NDZE 2BNQB 4JO8A 2HX7A 4EUPH 2O6CA 4FERA 4UAOC 5DJZB 3A6BH 5JIIA 1IRAY 3H9SA 5AYTA 4HZ1A 4JKLA 1M7DA 2WCSA 3LNGA 3G6JE 2IH1A 4HSCX 4TVUA 3WTXA 1KLGA 5C2BL 1YY9C 2EIMB 1HEZA 4HIXH 3FKUS 4O02H 1GAFL 2BO0A 2X4SB 3MJ8B 4NXKA 1ZLSH 3B7UX 1NLBL 1S7VB 4F33B 4WFFE 1O7DE 3PWLA 1G4MA 2GC7C 3QJOA 4P5TC 2NT0A 4JFPB 4MMXB 2VERN 4PS7A 4XOBA 5JXEC 1HESA 5C08A 3FC8A 4Y7OC 1CDBA 2VDKL 2FH8A 3OX8A 1TETH 3Q13A 4QMEA 1CD9B 1EJOH 5E56A 4OLVL 4XGZB 1EHAA 1T7WA 1A1NA 4FP8H 5IHLB 1W72B 2R59A 4FABL 3E6FA 3I6KB 5IVXB 1RZFL 4KKBD 4WEBL 1CGSH 4JFQB 1MCRA 3FFCD 1JGDB 1RP9A 4PR5A 1E28A 4XWGL 4DCQA 4HD5A 3B2MA 1RJLA 1ECZA 2W1NA 4WI5A 1WV7T 1ZVSA 5GGVY 2PWDA 1L7IH 4OM1H 1EFXA 5F72S 5ITFA 3KLHC 3OGOE 5DC2A 2Z92B 4Y4HB 2CDFB 5E1GA 3ZHFA 4MYPA 3O45B 3NTCL 4O2EA 5SX5K 2ENSA 5EZLA 4LLUA 4OD3H 2YOAA 4QOKB 3VGHA 4DQOH 3DO7B 4L3AA 4NPKA 3CXDL 2DD8H 3PFUA 2NYKA 4JANA 4NHCL 4U3SB 4OAWA 2YBRA 4F7MA 4XCCH 2F54B 3QUKA 1UACH 4LK4A 3QUYD 1LILA 3HR5A 4JDTL 5HDBE 5DJ8B 1ZGLM 4XN5A 1B6UA 4ABVA 3EBGA 4LLVB 4NQQA 3EJQA 5DEGB 2UYLA 1XR9B 5E51A 1BYNA 4PJAB 2B2XL 4XO4A 3J07A 1BECA 2VC2H 3UJTH 5DUPH 3VSUA 4GUPA 4RQQB 3UDWC 3HZKB 5EMYA 5KSVB 1JXKA 3HHSA 2YPVA 2A6JA 1B4TA 4YIQA 2F19H 4WTZG 4HUKB 5LCVH 3O3EA 3IXAB 5HGDB 4UANA 4Z77A 4DUXA 1JCVA 1FVEA 1T89A 1AVAA 3BUPA 2WLZA 4JN2A 4R6UA 2O5XL 3DGGB 5EEVA 4OT1H 1I8KA 2K7QA 3T0XA 4TVPL 3IJ9A 1H5BA 4H8PA 2DOCA 3ATFA 4NBZB 4TMPA 2QQLL 2D2OA 2GITB 2MQ0A 3V4UH 2I69A 4NZRH 4WWPA 5BZWB 4MDJB 5FA3B 2YS4A 1VIWA 4JO1H 3SDXB 3BE1H 2W88A 1PSKH 4WU5A 3QJTB 5F1SA 4QEGA 4FN0A 4APXB 4CVWA 4AQ1A 2KBGA 1M7XA 3VXTA 2BSCA 1GYUA 1E43A 5C1MB 4XPAH 3SBWC 3UGEA 1QTPA 3L3OA 4XB7A 5E6YA 4DN4H 4X6BB 4Y7MA 5ISZA 1B0IA 1FDLH 4KJQC 2FWOA 1DQQB 1JPGB 2HT2D 2RA1A 4PJ8A 2EAEA 3JV6B 1DANU 4BH7B 1MRDL 5FGRA 3EFDL 4Y4HC 2EUWA 3UIZA 5CJOL 4NPYB 3C9NB 4X5RA 4Z9KB 3BESR 3LN4A 3B2XA 4Q6YA 4UT9H 1C12A 1ODAA 2ENYA 1CLYH 2H47C 1CFVL 2F15A 4NO2B 3SDDA 4BK4A 3GSWA 2R69H 4S0TD 4ZXBC 1OGSA 4UQ3B 4X8JA 1XGPA 2EABA 4TSBL 2A9BA 3V8OA 4JJ5A 1U3HA 2RQ8A 3CPLA 3RZCB 4E5XA 2VO8A 2EDTA 4WIQA 1CBJA 3X14B 4XN9A 1M1XB 5I1LB 5HY9B 2FATL 2NXZD 3WEAA 5I0VA 4JO5A 3ULVF 3AWGA 5HHVH 3CZGA 3L3JB 4ZNEA 3L5WA 2NW3A 3ZRCC 4PJCF 2QTVA 3GS0A 3LKSB 4EI5C 1IBFA 1LEIB 1QUPA 1ORSA 4PGBA 5DHXB 2J5LB 3NFPA 2BNRE 2IF7A 4UNVA 4M62H 4O58L 3QXTA 4XBGA 2XZCL 2IPUK 3F7VB 1PZSA 2X9YA 3B5HA 2TRHA 3MRRB 3CQPA 1M6OA 2HSIA 4Y5YB 1NGQL 4RX4A 1JI1A 1QQDB 3DETD 4G9FE 1BVNP 1X7SA 1K2DA 1GOGA 3U6RA 4R7NB 2ITEA 5HJDA 5BW7C 1XT5A 4TLSA 2JQZA 5C0CE 3Q2WA 4F9PA 1N6VA 2BNUA 1DQKA 2BDNL 1BFOA 5CIPH 1M57B 4GSUA 3T3PB 1NFDE 3T65B 3V6FB 5JUEL 4L1BA 3RA7L 5AD0A 4N24A 3JBG7 2PR4L 4YEEA 1HXYA 1USZA 1S9KC 5BQDA 3PIQA 1JZDC 3MO1B 4W81A 3DMMD 3RILA 4TNFA 1DP0A 3IYLW 4P59L 4XMTA 2XC8A 3TBYA 3UAEA 3UAFA 1G0XA 1Z6JT 2E5EA 2WLNA 1WA2X 3MJWA 4YUEL 5TE7L 1SXAA 2VMFA 3K6SA 4JFOA 4NM8H 3V0VA 4XXCA 4FQXB 3N06B 5TQ0H 2ZUQB 1PAZA 1GJIA 4GO6B 1NOFA 3CVCA 4HF5L 2ZSVA 3K0YA 1E5CA 1K6QH 7FABH 2CJUL 2XA3A 3LXCA 3BXNA 4NKDB 3QP3A 2P24A 4AJWA 4A1IA 1BBDL 2ROYA 4Y88A 3VG0H 3D69B 1I8UA 4ALAL 4BSVA 2YR3A 3Q06A 2FT8A 4KMTH 4D3CH 3ULUD 1BP3B 4U7MA 3RAJH 4PTTA 3N1MC 4YDVA 1KBPA 3QJFA 1RZKH 3RU8H 3FFDA 1UVQB 4DNLA 3NSJA 2D9QB 1FNHA 4WWNA 1YNTF 2GYSA 4R7VA 4AY0A 2CDEB 4FDWA 2IQ9H 2NUTA 2DIJA 1CK0H 2HKHL 5I28A 4QHUB 4MRCA 4NZUH 3RZCC 3I2CH 1GZHA 5ECJE 2QGBA 3W3BA 4H0GA 3QNYB 3FCTA 1KTJA 1MDTA 1EZLA 3CBRA 3GNML 3NSCA 1N0LB 4LLYA 4WUKL 5DEJA 5K93A 4BYHA 5JTWA 5CEZH 1JN6A 3IJ7A 5CFAA 3H53A 4KUCF 1J8HD 4XC3L 5L88H 4RAVA 2OULB 2EDBA 3BUBA 4XVSH 1S7XA 5E1HB 1N59A 2J5LC 4B50A 2VN7A 2VLJB 3BHBA 3D3VB 1XWVA 3PGFH 3TBBA 2CRYA 1EEQA 3E6HB 3ML8A 3UO1L 4H5SA 3MJ9L 2BY0A 3MLUL 4TLUA 3BZEA 2CIIA 2H1XA 3F7QA 3K72B 3L7EB 5I1EH 4G6JH 2CGRL 4Y5YC 1I1YA 3BD4A 1KPUA 1HWWA 5HYJB 2DJSA 5D2NB 4U1SB 3N6YA 3VXSD 4LL4A 5KYXA 3GBNH 4OZHB 3U79A 5H37H 4MQSB 2XQBL 3SQBA 4OBRA 3OG4B 2BOLA 1UOWA 2GK0B 3EJTA 4KNTA 3U7WL 5IREA 3VFTB 4Q9CA 1XEUA 3BIKA 2D7TL 2EIEA 1RZJH 2QADB 5A2KH 2NZ1A 1I7UA 3ARSA 3SPJA 5JHDB 2KMWA 1TVHB 2VISA 2AJSL 4P05A 3EYVB 1ZJAA 2VITB 3GRGA 4HPOH 4PBVC 5E6RB 2ZCZA 3HI6H 1E5ZA 3QFJA 3THML 1SJEB 2W91A 5IT2L 4MAYA 3AWFA 4XNXH 5SWSD 3QUXD 1QSFB 2CUMA 2HKLA 1ZAGA 2OYKA 4PGZA 3N41B 3LMJL 2X1XR 4FQXC 4HZLB 4R7DB 2Y6SC 2OCFD 3KPNB 4YHKL 5DHDA 2ZUQC 4HJEA 4YHLL 5C7XH 2R23A 1HS6A 5DJAA 5A40E 1CGUA 1PF3A 1WC7B 3TX4A 2AAVA 2DTMH 5D6DA 4K94H 1EEYA 1MRCH 5IW1A 3CDFA 1M05A 4PD4K 3MI6A 5B3JF 3IMWA 5I76B 5IF0B 3T4YB 4LARL 4LCWB 1RCYA 3DIFB 2X3CA 1NCAH 4I87A 4B7IA 4U0QB 3U0PA 3PJSA 4NI6A 5HHOE 3GMNB 3RY6C 1KV3A 4JHUA 2P44B 5B7MA 1G5AA 1XF1A 3Q7JA 3F7RA 3L81A 5E1QA 4JY6B 3GZOA 1QLEB 1K8DB 3KG5A 3ESPA 4ODHL 2CE6A 1JHLH 3CFDB 1TMCB 3PYCA 4PWJA 1BG9A 3MRDA 1IAOA 1U8HB 3GEWB 2VZ1A 1RIHL 4LOFA 4RWYH 5JW5B 4HWNA 1WZ1H 4FOMA 2VO5A 4HGKC 4IJ3B 3OHXA 1OIOA 3CMOH 4G8GE 4ELKB 1KTRL 5IB4A 5I30H 3ESVF 2UZYA 1WFNA 5GS1C 5JQHC 3NRQA 4M43L 3QDMB 4RMSA 4Y1AD 3GLAA 2WQ8A 2ZNWA 1KC5L 2J8UA 1DL7L 4ODTH 1XQ4A 5FFLA 5GS2D 4XMPL 1Q9KB 1XGZA 5HGAB 3VACA 1QNZH 1UGKA 5F21B 3VI4A 5DO2D 3UTPD 1HINH 3CG8A 3KS0J 4Z18A 1KXTB 3I3EA 4BZ2L 2GTQA 5CZVH 1TZHB 2BCKB 4JFYA 5JHLH 2BOCA 1C5BL 5C6TH 3TA3B 4ZO9A 3V52H 2I27N 3ARGB 4YSSA 4ZX6A 1PZ3A 3B43A 5F1IA 4QRQA 1AS7A 2K6WA 4PCSA 1MREL 3GI9H 2O30A 5MP6H 2WXGA 2QADC 4ZX4A 4RDQG 3KWWA 3QW9A 3E7JA 2ZNXA 1W72L 4GI8A 3B2DC 5DVNA 5GSRB 1QSFD 4BQBA 5DMKB 4KKPA 1I8LC 1AHWA 4LESA 3ECBA 4X9YA 2VH5L 3B8YA 2AJXH 2JB6A 2CBTA 2WVSA 3P4MA 2E9BA 1FP5A 2AK4A 3QQ3A 2H4EA 2DQFA 1YMMA 4YPGB 4KJYB 4L1LA 3TCXA 4PJEA 3IGUA 5C8JA 3NMEA 4LCWD 3ZE0F 4AK2A 1BOYA 4FFVD 2YD1A 4NKIH 2HVJB 3LDBB 1U8LA 1K8IB 5E8PB 4ZW8A 1G84A 4HVBA 1JPTH 5KJRH 4Q6IB 3CLWA 4RDBA 4CC1A 3FQTB 5FKAA 5KUKA 3MCG1 4MLIA 4G7RB 4UINL 3ZIMA 5GRUH 3OAUH 4ES9A 1KXQA 2FWLB 3GI8H 2XQ0A 4GRWB 3FU5A 4D7PA 3DYOA 3UJJL 5D7IF 2G3NA 2DI8A 5C0AA 3JTSA 2IH9A 3FT2B 4PV8A 5FUZL 4BGDA 1I8MB 1QNIA 3WMSA 2WBWB 1BQSA 4PP1D 1AGCA 1OAUL 3M7OA 4JRYB 2DQIL 4PJGA 1ZMYA 4RAUB 4Q97A 4IM8A 2R1XA 2YC1A 3K8LA 2UXTA 4JO4H 2L7EA 5GHWH 3I9GH 4PJXF 1BDYA 1FAKT 3KPPA 3P0VL 2DICA 4J4PA 4WUUA 1E3ZA 2PCFA 4G9DB 4NO5A 4IJ3C 2VABA 1E27B 2ZCLL 4FG6D 3CJJA 3ILQD 5DURD 5F7HA 4JDZA 4XVJL 2Z4QA 1A7RL 3MRMA 4RIRA 1CFSA 1MF2L 3MV7E 2V9TA 1N5YL 1WICA 1SJXA 5EORL 2FJGA 2YQGA 3DX9B 5I15H 2IO5A 4RFEA 3SSGA 1JVKA 3BVXA 2E0PA 2XZZA 4JPKH 4KK6D 5LJYH 1GGBL 2DIAA 3ZZLA 1YLBB 3P40A 3P0YH 4LP4A 2WNWA 3LKOA 3SE9L 4L8DB 4X4ME 1HI6B 4IU2B 1BIIA 5CD3A 2BS71 5F9OL 3TA3C 3ARGC 2ZAHA 2D03L 4IW4C 2VLKE 4HMEA 1F2XK 3TYGL 2Q7YB 2AQPA 2QZ5A 2CRZA 3BUYB 3ZDXF 1TSHA 4H0IA 3O2VL 5EZIH 5J0BA 2WKGA 1DQMH 2FBJH 3E9UA 5EEYA 4HJ0D 4K7PY 1VSCA 3QEUB 1G7HB 3CZSA 1IQDB 1Z0NA 3H9SE 4LSPL 2X7LB 4PWKA 1SHXA 1CI3M 1NCWH 1RZ7L 35C8H 4G7YH 3TPUA 3KM2A 4KH2A 4HEMA 4IJTA 1BLNB 1KGYE 3D52A 5HYEA 4GIAA 4WVRA 1VZIA 2UXGA 1FFNA 3AS3A 3LDBC 3VD7A 1KJ2B 2F18A 2X4QA 4Q6IC 1OGAB 1YEHL 1P4LA 2CDGA 5JW4Q 4PJDE 1CDCA 4AMWA 3GLEA 1TQCC 2EC8A 1KEGL 3PWNB 4CDHA 5TJWK 3U7AA 1ACZA 4GAGL 4NGHH 4GXVH 3IPEA 4OKVB 3QH3A 3W2DH 4JRYD 1GVIA 3QQDA 1KFAL 5F7DB 1SXBA 5IG7B 1MZYA 2ADJB 2AXGB 1UENA 5F88A 4ELMA 3TBWA 1F90H 1KV7A 5KVDE 2IPKB 1QFUH 4WW2A 1NC4B 2ZUYA 5HI3D 1HHJB 1FIGL 1I3GH 3AXLA 3D4YA 3O4LA 3GHEH 4OZGB 5CHNB 4K71B 4X5LA 4IBYA 3MJ7A 5F93C 3IBEA 2QMKA 3TJPA 4JB9L 1UZGA 1W16A 3S5LG 1QRNE 1E6JH 4OFYD 4V1DD 5DC4B 1LP9B 3FCSA 43CAA 2W95A 4DKDC 1CBVH 3EH5B 3SOTA 4GG6F 2E27L 3CFMA 2G9KA 3KDMA 5F1NA 2ZKXA 1UKSA 2G2NA 1G7PB 3MV8E 2FIKA 3KYMA 3ZHKA 5KS9F 1NAMH 2LLNA 4MNHB 3JUZA 1GY1A 4XB3A 1J48A 5AVXB 3ZKSD 2BPBA 1I7TA 4IBLT 4PQXA 3OBAA 1J1XH 4Y9FA 4KBPA 1NPUA 3B9KD 4H1LA 5IQOA 2EKSB 4YEFA 3HPJB 5DDHB 3S35X 1TZOA 1YQVL 1SMDA 2BFVL 2V8MA 4Y4FD 2D4DA 2IFGA 5E9DA 3FK3A 3NJHA 4OJAA 4XNAA 3X3FL 1WA1X 4GKLA 3GMRB 4NBYB 4X5WA 3L5XL 2A73A 2JJVA 1QSVA 1AZCA 5DFTA 1SY6L 4HT1L 1U3ZA 2CNZA 3CFUA 5I8OL 3WSQH 2BWQA 3NZ8A 1DVFD 3L08A 4R9HA 3ARQA 4ZTPL 4AZ8B 1T0NB 1D7FA 1DFXA 1IJ9A 1H15B 4U33A 3H8NA 2YGVA 3OC5A 4OCNC 4UTBA 1J5OL 4AH2A 1IZJA 4LU5H 4LF3B 1JPEA 4BA0A 4PVLA 1MLBA 4W6WB 4TQIA 2NUPA 4L4VB 2EDXA 4UDUA 4YHZH 4AIEA 4DGVL 3J27A 4RZCA 4PGEA 2CO6B 4OUUB 1EHLL 1HL5A 4D94A 5FUOH 2NW2B 4FNSA 5I26A 4GUQA 2F53B 2ZXDA 4YSOA 5D4HA 5GGVH 2R1YA 4YXKH 2CM5A 1I9IH 2J1XA 3AFLA 3C8HA 1QLFB 1LK2B 2O6DA 4QRPB 3ATEA 4UZGA 5LWYH 1IU1A 2V8LA 4IRZL 4PYGA 3V0JA 1CE6B 2X4TB 4AKOA 4Q4EA 3MFFA 4UOQA 1NEZG 4OV5A 2AJUL 4M6NH 2Z31A 4AQEB 4M1CC 1RVFL 3HMXA 3BJ91 1QW9A 1TZAA 4JKWA 4MA3A 3SO3C 2XWCA 3GS7A 5J9PB 3WTUA 3ETTA 4FFYH 4K71C 4RBPK 1AXIB 1L9RA 3QXDB 2X1PA 1C16B 2NY1B 1W8NA 1BVLA 4V2BA 3QUMB 5EU6A 4UWQB 2XWJA 1OM9A 1LL1A 2WTPA 5KYWB 3L4XA 3ZKMD 2XI9A 2D31A 2VUYA 1KBKA 2BHYA 4JX0A 2WXQA 5DJCB 4OLUL 1WITA 2FHFA 4MXQC 4N8CH 1ZA3B 2I26N 3MV9B 4ETYA 3JWOC 1ASQA 1BQHB 1GS8A 4LOUC 4OLEA 1X6LA 2DM3A 2VM3A 3FO2B 1W0VB 3ATBA 3CZEA 5F7UA 4G42B 1IT9H 1WJ3A 5A2FA 5C9KA 2RGSA 3BPCB 3E38A 5D70L 5MERA 1ONQA 2HWZL 2VERA 2WOYA 1CLZH 3NN8A 3V95A 3ILPA 3IE4A 4FQJH 4KHXL 3VWJD 1ITBB 1QA9B 2OJ1A 3CHSA 4BWUA 1RU9H 5F9WB 4YVUA 4OFIA 4YBQD 1P7KA 1D5XB 1OE3A 3QORB 3UERA 1HH9B 1BZ8A 2Y69B 4N6RB 5IMLA 1XGUB 4HXAH 1R3HB 3PS6A 3QAQA 4P2QD 3IKCB 3VXRE 2CBMA 1J9TA 4QLWA 3SDAC 4H8HA 1MI5D 3BFOA 2V9RA 4XMZA 3FRUA 1JTPA 5CLXA 3CX2A 4YZFE 3UTSB 4PWHA 4HPYL 1K5WA 4LPQA 4JDVB 5HYQB 2XIBA 3ARDB 1U3YA 2V37A 5EIVA 3CZUB 1LWJA 3HAEG 3Q01A 2Y25A 5BMFL 5AZ2H 5GISL 5AG8A 3ARFB 1QLEL 3IBOA 1N10A 3V5DB 2DS4A 3C5ZC 4HCRL 4F92B 1TLKA 4NQCB 1UD8A 4TV3A 3X1GA 4K9EL 2XX0A 3NIFF 3IS1X 1E4WL 4U49A 4PJ5B 5JOFB 2GBVA 4AX3A 4DW2L 4PJCA 4FQ2L 2NY7H 3GSNA 2IANE 3UROR 3WKQA 3BC9A 3RL1A 2QQNH 4OJFL 2O26U 2WXLA 3NJMA 4JS7A 5ICYA 4R5TA 3L4VA 3V4PA 2EXSA 2J55A 4L2YA 4OJCA 3SQRA 3IU4L 2W0KA 2H1PL 3VRJB 3TZVD 3QJZA 4OSUH 4WJ5A 4HDIB 5L9DH 3QZWB 4HETA 1IAIL 5F6IC 2UV3A 3BSZL 2FT6A 5JPMC 4KO6A 4JBSA 1R6VA 4X2UA 5CEZD 5F7EH 4DPRA 2F0CA 1OGTB 1ECYA 4LQ1A 4PAZA 4D9RE 5E03A 2JCCE 4L4JA 1Z1WA 4KI5C 1P84J 3BN9D 4RISH 2H0FA 3DJ9A 5CWSB 3ES6A 4NENB 1T66C 4MB3A 4GNKB 5IR1A 4HK0A 1HHGA 2XJKA 5JPNB 3W11D 1AI1L 1U91B 43C9B 4LPVA 3O6FA 4BFFA 3WY4A 3QORD 1IAII 2C9VA 3RVUD 3SJVD 5GJTH 1KEML 2ZSWA 3QDGB 1IGIL 5F6HI 1JTOA 3QWRA 2NCEA 5K33A 4ZMOA 4JM0A 1GZQB 1PU0A 3KPOA 3LQZA 4ZFQA 2ICEC 2VLLB 3VYPA 5D9SB 1JXJA 2BC4A 3O41B 5DGRA 4ZQKB 4F7CA 4I4WB 3L3IA 1A2YB 3EGSB 4O9HH 3BEWB 3EOTL 4E41A 3QQNA 4UTCA 3MYJA 2V5SA 3VH8B 3MU3A 3MRLA 4S1QL 2W65A 4HX1A 4LCCA 4QCIA 4CL7A 4L2LA 4BZ1L 4FQPA 2WZPD 3MFGB 3ARDC 1A6ZB 1YNTA 3WKMH 1UB6B 4QO1B 3GS4A 4IRJA 5DS1A 3BRGC 5KVEL 3G9AB 2P42B 2NY2B 4HCGA 1S7SB 3CHRA 4Z23A 2VN5A 2WBJB 3QEQD 2GEEA 2DQCH 1JZFA 4X98B 5DUBB 3ARFC 2UUDK 1QSED 3TN0B 6FABH 3Q1SL 2OTWB 2OLDA 2ENJA 2YK1L 3OB0K 3B2UD 3OKEA 4P48A 2I60H 4W1TA 5EBMA 5EFIB 4LHUA 1DEEA 4PGCB 4BGLA 5E2JA 1HIMH 2C9RA 1NJ9A 4XO5A 2YD9A 1K4CB 5ICZB 3BDYH 5JZ7D 1D5MB 2C9XA 3F04A 5HVWA 3EO9H 2ITCA 2DMKA 4N2MA 4X7FC 4Q2ZB 4WJKB 2Z8SA 3BH8B 4AGLA 1QOKA 1INEL 1YEGH 2GBAA 1NAKL 1ORQA 3QUZA 4B96A 5C0BD 5KVMC 3CFCL 1IBDA 3FTVA 5HXMA 3N04A 3EDDA 1TYEB 4JQXA 4CBPA 1FNAA 5I18L 2C3XA 2QBWA 3H0TA 2ALAA 1WIPA 1Z7JA 2JB5L 2J1WA 2HG5B 5AUMB 4BSWA 5K69A 1FYHB 5DVKA 1NCDH 3QIWA 4TQEL 3I6GB 2VR6A 1T7ZA 2YXMA 4IK6A 1E5YA 1KN4H 1VFUA 4PS4L 4BH8B 1D9KA 3PHOB 1PGRB 4LL9A 2HB0A 1ZLVK 5C86A 2OSYA 1OKEA 4WHTA 5FAAA 1P7BA 1N6UA 2F19L 2OMUB 3D25A 3DOHA 2KT6A 4MD0A 5BS0B 3P77B 3QCVL 3QDGD 2VAAA 1NGPL 3QQ9D 1O9VA 4HWEH 4PVBA 3DX6B 4KKQA 2MQCA 3GSRA 2AFNA 2OMXB 3HRZB 3NZUA 4NP4L 3ZDZB 4DO4A 2QKIA 1BZ7B 5LXGH 1AOZA 2EUXA 5HDQH 2A99A 4R8WL 2P5WE 3VD4A 5C9JB 1DTUA 2J8UE 4MJ4A 3I9IA 3P4LA 4OT1L 3QDJB 1JWUB 3VFSB 1TZGL 5A3IC 3L3KB 4NO0B 4OQTL 4ZMNA 1OB1B 1X5JA 3TO4D 5FECA 4P2YA 3QPXH 4MVBC 1RK1A 4GQPH 5D55A 2I07B 2F1AA 3MREB 1JFHA 2Q3AA 1HQRB 4PWEA 1KJ2L 1KIPB 1UM6H 1E40A 1U9KA 2OP4L 3DRQA 4HOZA 15C8L 3O3BA 5JO5B 3SY0B 3M1CA 1NGWB 4G8FA 5CSBA 3BZDA 2VR8A 3UZVA 1ZHKB 1MVUA 5HHMD 3VQLA 3L6FA 2FLRT 4GJTB 3AZUA 1PZBA 1HYSC 2DQHH 2VWEE 3WY3A 8CGTA 3FO1B 2NY2C 3HG4A 3CK0H 1VADA 2VNCA 2WBJC 4XPFL 5H2BB 2WXNA 3TN0C 4Z76B 1IM9B 4UT6H 2B0SL 3Q8FA 1FHGA 3BAYA 1AHMA 3BFWA 5GS3A 2H3NA 2AEOA 2VZ3A 1KLFA 1MNNA 1UEYA 3V0DA 2XKUA 3CC5A 4M6MH 1IGML 1P4IH 1GHFL 2BVOB 2H41A 1M3JA 2BWIA 5K59E 1XL4A 4M1DH 2EUVA 3BPOB 3O2DA 1PLAA 2BIMA 4QHNB 4Z7VF 1X9QA 5K9OB 3ALXA 2E7MA 1IC4L 2YPLA 3HOGA 1MH5A 1C1EL 1JK9B 1ITCA 5DUJA 1N12A 3D07A 2EQDA 1WDAA 1YPZE 3C6SA 3O9WB 2B20A 1IQWH 1IKFL 5GZOA 1YEJL 2H9GB 1RERA 2VW6A 5I1GH 1PZ5A 4WO4D 2CO2A 2NLJB 4UNUA 3GMQA 4OFKA 3CLFL 4BE5A 4LRIC 4PJGE 3EH1A 4X99B 1XF5A 4E9SA 1JV2B 4KK9C 1TMQA 2EADA 5C0IA 2IAMA 1V05A 1NEUA 5I1JL 2BS9A 1RZ8B 3HNSH 4AQOA 4IU3A 1TPXB 1U2YA 4A55A 4TM9A 3NCJL 1IGTA 4U6YA 3RVWC 1A4JB 1FL6A 3QDJD 4J6RL 2ARJB 3OKNA 3LIZL 1PD0A 3NJKA 3QHFH 4NO0D 2VMEA 4DZBA 4XMXA 1EEUA 1P7QD 1N68A 3P02A 2GUOA 1YEIL 4RETB 4HJJL 2VZUA 3S35H 4P2RA 2P80D 3SPHA 3RGVA 1FNEB 4YPJA 4HC1A 4APQD 4TVSa 3APDA 3T0EB 4LKXB 4Z0BL 5EBWB 4OZFA 4J27A 1N7MH 5CP3H 2XWTB 4LBAA 2XCMC 3BAIA 3DVNA 4JFEE 4UTAH 4HFWB 4MA8L 4FFTA 1BGXL 1A6UL 1JDAA 2HFFA 3RIKA 3OMZA 4HIEA 2KZBA 5E7FA 4RMBA 3KPRB 5G4MA 2YRZA 1OF0A 4FYQA 3C75A 2FEJA 4QXTA 5D7IA 3FUFA 4X6EB 1F4XL 3OZ9H 3D30A 1F58H 5GRWA 2XA8H 3LNHA 4L29A 4IDJL 4MXWL 1IGFL 2OR9H 1M3IA 1JZ8A 4F37K 4J2XA 2EC9U 4OVUA 1JGLH 5BNXD 2OXGA 4KTYA 5HHPA 5IGXH 4PJXA 4E9VA 3VXNA 2DQTL 5KYUB 2B15A 4MX7A 4ZUWB 3HG1B 1FYTB 3DK2A 4O2CA 4G71B 3QUML 4NN5B 3PL6A 4NT6B 4HEME 4I0PB 4GAJH 4UMGA 1OALA 1RZPA 5IBTH 5E8DL 3NABL 4KX7A 4S1RH 4Y8DC 3BPOC 5HHQA 2Z0UA 4LCVA 4C57C 1D6EA 4U6XA 4KK8C 2ZJSH 5M95B 4GW5B 1ZY9A 1QBMH 1R3KB 3JV5A 2VE6A 4JL1A 4HS8H 1YY8A 3B9AA 1W6LA 4XBEH 2ZUTA 5LBSH 3EFFA 4ACPA 3O9WC 2F7PA 3T6WA 3U7YH 1AGFB 3LRSB 4L4TB 5TDPB 1OAZL 3QNXA 2VJXA 4F1ZA 1IC5H 3R8BB 3CLEH 4ELME 2BS8A 2NY5L 3NEXA 3RNQA 1ZSHA 3ARVA 3LPWA 1Y0LB 1CFNB 4JY5L 4BFRA 2Q86B 4Q8BA 2RH0A 3ZLQC 1PYWA 4Q4IA 3LRLA 5DHEA 3O4LE 5TE6H 2ZG3A 1WCQA 2ODHA 1T03H 2FNWA 1JFQH 3EOAB 3KM1A 3SDCD 4DP1X 5L4IA 1XCQB 3CSTA 4G8EA 1G7LA 1TPXC 2OR8A 1F45A 3LQAH 5T1LD 1CTMA 3I6SA 3MLZH 2CO3A 2VZTA 8FABA 4GW1A 1MHCA 4BSJA 4PJ9A 3L4UA 4HK3N 4NQDE 4XVUD 3E0GA 5F71A 4Y2OB 1T2QL 2GJZB 2YHGA 2QPDB 2Z9TA 5B38G 1ID2A 1EWHA 3T0EC 1VGEL 1UM5H 3DI2B 3NIDB 2EE3A 2QDVA 4IMLA 2AQSA 3S3BB 2R4RL 4ZW6A 1HZHH 4E9TA 3LX9A 5IQMA 4Y19D 2TAAA 1ZLUK 4K7PH 3RWJB 4W4OA 5E9DE 1BZEA 2F58L 4JPVH 1J0KA 5FO9A 4AYMC 5CF3A 1WIOA 3O0RH 4DO6A 2GJ6A 2ZKYA 4KDVA 5T5FH 5HYIA 2DEWX 3OGCA 2X1QA 1WWWX 3GBDA 1IL1A 2HUEA 2AJ3A 3KYOB 4W93A 3P3UA 3CU7A 3CUPB 5MEQA 4FQHA 1KZYA 1JGEA 3LV3B 4GKNB 4HJGA 4RSVA 1QPPA 4L5FH 4C59B 3GGWB 3WO3B 5J4MA 1Q94A 1FYTD 4EUPA 2RR3A 3BWAB 1U8OB 1XGRB 2IQAB 3WLBA 3V4VB 2A83B 5F6HJ 4LDOB 3HE6B 1IEAA 3NJXA 3PXJA 1D5BA 1HZKA 5CCHE 4LDLB 4WNQA 4A66A 3HFML 5DLLA 5C0RL 3HNTH 2H26A 1J10A 4NSKA 4OLYL 5FWRA 4YDMA 1TTFA 3AXHA 4O00A 2DQEL 2WLKA 4GG6A 4NN5C 4O02A 1FZOB 4C56D 4TF4A 4I0PC 1IV8A 5TF1L 2TSBA 4I18A 4DOHB 2X38A 4N1EA 1YCSA 3OZKA 5KS9A 4PJIE 4OCSH 3SY6A 5F70A 1EMTH 4QRRD 4IRSD 4DKAA 3PUUA 3HVDA 3RWHB 5C07A 2CRMA 3DRTA 1CVRA 2Y7QB 4EZJA 1XVSA 1LDPH 1DJXA 4LCYB 4J3BA 5J6GA 1AY1H 1UT2A 2WJ5A 4M5ZL 4V33A 3KXFA 2KKQA 1QASA 3P4NB 4PJBE 1MAMH 4KJPD 4F7KA 4WAFA 1GRWA 1JZGA 3EYUL 1HL4A 3D39A 2WWOA 1U30A 1UOVA 3G5ZA 5IB3A 3NA9L 5HJ3B 3FFCE 5CM1A 3VCLA 5F9JA 1QNZL 4NJ9H 5JXED 3NCEB 4XRCA 3SE8H 3CSYA 2FJSA 5D1ZA 3G3LA 3LEVL 1FRGL 2XPGA 5JQ6H 2P3YA 3TOPA 1G9ML 3V7MA 1ND0A 4Q58C 4PLKD 3S0PA 5BPPA 4QWWD 1KIUA 2FT7A 1KT2A 2FEEI 2YQBA 4JKNA 3N44B 5MENE 4ICXA 12E8L 2R7EB 3DXAA 1MY5A 4PRNB 1T6BX 2VM9A 5CEXA 3QUHA 5K39B 1I9RL 2FBOJ 3VVWA 2TSAA 2X6UA 4XB8A 5FCUH 1L9SA 1CLOL 4U2YA 1I1FA 2XTJB 2XZQH 3PP4H 1S3KH 4U0RB 5DFWH 4YFEA 4Z7UB 4Z5RB 1JJUA 4EDXA 3Q5TA 2G4GA 3T6QC 4JRXD 3T0AA 4PVNA 3KR3H 4ZW3A 1GYAA 4Y16B 3R18A 5LO7A 3OC8A 4TS6A 2XQYA 5LKNA 1IFGA 4YSQA 1BMWA 1FZJB 1N4XL 1SUHA 1F3JB 4O51B 4HGWB 2J6EH 1LMIA 2HN7A 2BIQA 3TFKD 4Y2NA 4ZMWA 3HE6C 1TKWB 2G3MA 2N4IA 4WU7A 2N7SA 4OGXL 5CZRA 1JDCA 2MCAA 4KTEH 3TJHD 4PV9A 2Y24A 1FFPA 3RDTB 3ZE1B 3TT1H 3IXTB 2YLKA 4W6XB 4HIHA 4AIXA 2DQ6A 5T3XH 1KCVH 5H94B 3HZVA 4HFUL 3ZDYB 1KIQB 3UG4A 5LDSA 1Q9LB 2DBLH 2FX8H 3V5HB 4ZT1A 1P5VB 2Z8VC 2AVFA 4LSDA 4PB0L 4EIBA 3LH2H 3ULVE 1EAPB 2N7AA 5IMOB 1LXMA 4JFFA 4JFDA 1S9XA 1UFUA 1BOGB 2GSIB 3C8KB 3TNNB 3CFQA 3D85A 1UA6H 2M2DA 2PO6A 1F41A 5ECGA 2OA9A 2WQAA 3I9PA 1R3IL 3S8WA 3FUJA 2CPCA 4GSDH 3LZLA 2V33A 4K3EH 1WFMA 1EO7A 3P2DA 1HSAA 4R96B 4DT2A 3UCRA 5L4MA 4I5BA 4S2SB 1GSKA 2E9WA 3ZMRA 3G5YB 2V17L 4PRIA 3GXTA 5B1KA 4PW9A 3NZHH 4OCWH 4EQ2A 1N3NA 1T89C 4P23A 4MJHA 2Q9OA 1HJCA 1LEGA 4G5AA 4JQVC 4PCKA 4ZNCD 3INUH 2EYRA 3C5SB 1SGKA 4X6CB 3FU3A 4IOIB 3GRBA 3LS4L 1ED3B 3RL2B 1WFTA 3S48A 2QQKL 5IVZA 2A6KB 2XTJD 5KVFL 1MFDH 3W82A 3VM7A 3OMNB 4OCMC 3OKMB 1ZCRA 4Y5VB 4U4IA 5GSVA 3UBXA 2XWBA 4UT7H 1NKOA 5J11B 4J3WA 2JCWA 4GXFA 3JYBA 4U0RC 3H3BC 4J39A 1INQB 3FZUD 5TFSL 4YDZA 1MELA 3FRPA 1GC1C 5CMAB 4LLMB 1HWGB 3OJVC 2CO1A 1FG2A 4XCEB 2DQUH 3BQVA 4RMTA 5K1JA 5F3HA 1ETA1 5E9AA 4Y16C 3GSUB 2O93L 4N0FB 5DXWA 5JIMA 3MR9A 4JG1L 5BO1L 4G80B 1A7OH 1QWNA 1JI2A 2KZKA 2WXJA 2O5YH 3U4EB 2ATPB 3EYFA 3C08H 3RDTD 1WT5A 4YXLH 3JWOH 5E4AA 3UX9B 4NC1E 4XZ4A 1U8CA 2Y7SA 2V7NB 4AE1A 3PWJA 4HOXA 3KPTA 5C0EB 2RCSL 4EI5D 3GKWL 4NAQA 3SDDC 1SOQA 3WNOA 1USQA 4L1TA 5L7XH 2CGZA 1IC1A 4H7VA 3MXVL 5IVXF 3Q8CA 1QBAA 1JZ3A 4QRFA 1FV1B 1RJZA 2N59A 2FJFB 3H7BB 3TWCL 1GCYA 5DJDA 1JHTA 4N2DA 1S6NA 2PYED 1W91A 1FL5B 1AJ7H 1BFVL 1T6VN 4FNLH 4A6YL 1V3MA 2AI0H 3VNYA 4KY2A 1HL9A 2WXRA 1S5HB 3ASWA 5E1AB 5DCCA 2K3TA 2OYMA 4YSUA 2OMZB 4YNYB 1U92B 1GW0A 4S1SH 1V27A 1T83A 3L2LA 4MXVF 4PCYA 3UC2A 1WBZA 3F6IA 1BAWA 1OM3H 3BVTA 1RMFH 1EXUB 1Y6KR 3HHRB 2XFXA 2FO8A 1EHNA 3MACL 4MDIB 4YSTA 4JHAH 3VMNA 5D2LB 4YQXL 5T33L 4M6OH 3OR7A 1G43A 4XNMA 3ME0A 4LSSL 4ORGB 3BUDA 5T1KB 3VFGL 4X6FA 3VB9A 4Y2DA 1S9WA 1U8PA 3PNWA 4Y4KA 2DKMA 4WENB 5GGQL 5A43C 1UWEH 2CZNA 1MIEL 4K5NA 2AV1A 1D6VL 1GH7A 2WKOF 4AMKH 4CVXA 3ZR5A 3A4AA 2IDQA 3GK8L 4PJAF 5CZXD 1F2QA 5FO7A 4JPWH 4FADA 4NFCA 2OTUA 3HZYB 5DVPA 3LKQB 3L1OL 2Y36L 1OQOA 5PAZA 4WDIB 1F8TH 1ZK9A 2VXTL 3WJLC 5AW4B 4OI8A 1E9PA 4N8VG 4PRBA 4FLHA 4Y5VC 4A7SA 4HLZG 5HI4C 1KCUH 1Q0XH 1WCBB 2DDQH 2FO4A 4P04A 4PBXA 1M71B 1K5NB 3QXAA 4G6MH 3W0WD 2FYYA 1Z3GL 3QEHB 4F20A 4ZSOA 5GGTH 2WLLB 3OXRB 4G7VH 2NY3B 3HCVB 2JKJA 1J8HE 3V5KB 4F8TA 5IMMB 1T1YB 5C0GB 3Q6FA 4YDKL 2HFEB 2VUKA 2WO4A 1V3KA 5I1DB 3GLDA 1AO7B 2Q5BA 2ZCKL 3LPGA 5AALA 1OARL 2G4EA 3WXVH 5IOPB 3P11L 3KPSA 2DLEA 4KRPB 3PWPD 2VDRH 3SDXF 5LNDA 2IDFA 3BKMH 2Q8BH 2D3NA 3RPKA 4G6AD 4ENEC 4HS6B 4ODXA 3QS2A 1PDKA 3TBTA 3JUYA 5GZNA 1URLA 2CA3A 5I8CA 1IEBB 3ARBB 2GTZB 2KERA 4N2EA 2X4RA 1DBBH 4PRDB 3ZL2A 2CM6A 4GMSL 2FHCA 1ZA6A 3ZYJA 4BHUA 1OF2B 5MEOB 4MNGB 5EU7E 1CGTA 2XRAH 3M07A 2YMXH 4R2GB 1AXSA 2BP8A 3P9MA 3BZ4B 3Q2NA 5E4IA 3IDJA 3PQYD 1G1YA 4QF1A 2OM5A 2VDMB 5E2WL 3V0WH 5IB5A 5ACZA 5IB1B 3WCYA 3C2AH 1GPOH 4N3UA 2EDRA 5C0DA 3DUSA 3DSFH 3RVXC 1T20B 1WWCA 2HLFD 3KJ6H 3C6EA 2YPLE 3L9RB 4DGIL 2FQDA 2N56A 4BQ6A 1S9YB 2H6OA 1BZDA 1U41A 2AJZA 1ZT1A 4XMVA 4DUWA 4I2XB 1WEJH 4JKMA 1TJGH 3MBEA 2VSKB 4UILH 2EECA 3GBMH 4XTRC 2H0PA 5LBVA 3ZW3A 5I0DA 4ESKA 1UD3A 3LEXB 5B1BB 3GXFA 1LO2L 3MV01 4Q9RH 2X40A 3IDXL 1CG9A 4LFHD 4NQEA 4DPAX 3QCUL 4MDRA 3BWUC 2ROXA 4N85A 3ROOA 2OAAA 3P2BA 3A0OA 1S5IH 3FU6A 5FM4A 1IGCL 5DHVH 2FLBT 5E00A 3D8MA 4PS3A 5A2BA 2AQ2A 1MWAB 3FB8B 4DGWC 4XODA 1KNOA 3FPXA 5KTEL 4DVBA 3V4VL 5AYQA 1MZZA 1JXFA 2VDQL 3N40P 2X4NA 3DV6B 4Z95H 3CX5J 4EI6B 4P2RE 1UM4H 5CJQH 1LEKA 2Y3NA 3MGTB 2NY3C 4R7LA 1F00I 4OF0A 3UZQA 5GRZA 1J5DA 5D6DC 4QXGL 4HUMB 1MVYA 4KRPD 3BVNB 3T3PF 4YXHL 3ZE0E 4KHTH 3CXFA 1H6EA 4DFIA 1ZT4B 4EZMA 4Z7VA 3LB6C 2DYPD 2WZ5A 4U31A 4ZD3L 3LIUA 1CZ8L 4XCNB 1A4CA 5FXCH 4WFHD 3IN0A 4I48A 1BD2B 2ESVD 5FB8A 2JSFA 4ODWB 3UTPE 2ZWYA 1GMEA 2HT3D 1ZVNA 1JGUL 3DX7B 3ARBC 3BAEH 4L8CA 4S10A 4GUCA 1KXVC 3GSOB 5AKRA 3IPFA 3VNZA 5C09B 1RD6A 1XBRA 5EOCL 1EUTA 1NL0L 3UTTB 1NMAL 1OW0A 1PG7X 3BEVA 5BZZA 1MCCA 3GO1L 4JFZH 1CD0A 1YEDB 4OLWL 4PJXE 2A1WH 3H56A 4R2GC 5EO9A 2F9BT 3UL4A 5EO0A 1ZT7B 3OHXC 4XP6L 4AM0B 3UXFA 1KJMB 2Z91B 5E2TH 2QV2A 4YFDB 4OSUL 4LEOA 5FV1L 2APSA 3IDIA 1IIIA 1S8DA 3VXPA 3HZMA 1DFBL 4NUJA 3L54A 3MC0A 1SDAB 3GJFB 2HTLD 4PG2C 4H0LC 3A4DA 5CBAA 5DZJA 4DIXA 2BHUA 4I0KA 2UY6A 3A6CH 3HB3B 3N43B 4HAGA 4XNQA 3MRPB 4KKLD 1ES0A 5EIIA 3RWIA 2FCBA 3AB0B 1M9WA 2NQDA 3L48A 4MZIA 3WIFB 1BF8A 5ANMA 3QG6B 1KXHA 2RMNA 4LCIH 3TH2T 4XP4L 2IDCA 2JJUA 1KPVA 3NJJA 4FA8A 1GC1L 1LK3L 2BSTB 5D7JD 5TGBB 1SXSA 1JNNH 1BFSA 1A7NL 2A74A 4L8SB 3LQMA 2X0UA 3S34H 2A9NL 4K3DL 5T1DH 3ZDXE 1G1CA 1JBJA 4TNEA 1JRHL 4C8XA 2AW2A 1BF2A 2N01B 3BQUA 3FN9A 4X8GA 5DRXB 3AVEA 1E7UA 4WWID 2YPKB 1PAMA 5IEKA 4OZHF 5FK9B 3V0FA 4MJIA 4Y2LA 3T2OA 5CS7A 1CJYA 1SN2A 3X11B 3ZQ9A 2DWDB 3AREB 3P30L 2ZP9A 5CJ5A 4BFBD 1BQLL 4R84A 3DROB 1H9DA 4LRNL 1OPGL 3U4BL 2GJPA 1UZ8A 2PXYA 4H25A 4P2OA 2A9CA 2I85A 1XF3A 1DQLH 1GJUA 4L3CB 2O5ZH 1FO0H 1BMGA 1JRHI 5D1QB 4PSPA 5EC1A 1U8IB 4FZEH 4R90H 5FO2A 2GJ6E 4U1IB 3QRBA 4RH4A 1DDTA 3S96A 4YDIH 4MS6A 2VOTA 2ILLA 5CSZA 1L3WA 2C7UA 3N41F 1UXWA 1Y1UA 4UZSA 1I4FA 1N6QH 3AS0A 2PTVA 3BDXA 3CVHB 1Q8MA 1KGIA 3CNKA 4Q0XH 2I9LA 2GY7B 4LIQL 1R4XA 5F89B 2XLLA 1G7IB 1I1AD 3H6AA 1HHKB 4IKJA 4Q7DA 3QQ4B 3K8MA 4FLOA 3BO8B 1U95A 4QYOA 1JAEA 4IGBD 4YC2B 1SM3L 5EB9A 3MRIA 1NIDA 2N7BA 2BSSB 2EDMA 2Y5EA 3F00A 5C0JB 1CL7L 1Q9OA 3NSFA 4UOJA 4CRPA 5KS9E 2NX5D 3K5SA 3LRGA 2MIZA 2JNZA 4KUZL 3DO3A 3AMKA 3NIGE 5H4ZA 2F5AL 1Z9NA 1OCZB 1H3GA 2GUYA 4AUUA 3OMAB 4UM9B 2QQQA 2C1OA 3HB3C 4HHAA 4XNDA 2IBZX 4YHOL 2AC0A 3KXFE 1G94A 2WN2A 3S5LB 5I73C 1ACYH 1SF3A 1XF2A 3AB0C 2XKNB 3FBQA 2PCYA 2UXFA 1KTCA 4JFUA 4R3SB 1RFDH 3VX1A 1XCTB 5IKCB 3D39E 3NFNB 1JF1A 1QKZH 2GT9B 3MRCA 4UYQA 5DD1H 2V7HB 3VFNB 1AQKH 3GXIA 4L9LB 4L8SC 5LN4A 4DZ8A 1V7MH 3QE5A 1OAXH 1DJSA 3AW5A 3EHBB 3ARTA 4JM4L 1K3IA 4K8RH 3SZ6A 3EF4A 1MJ7H 3ULSA 3GHBL 4WHYG 2XZAH 2Q8AH 2C3HA 3KPMA 2R4SH 3HVNA 3TIDB 1ADQL 3MUUA 3AREC 1EANA 3FMGH 1FAIH 5DHYB 1WRFA 5D1QD 1HWHB 2D0GA 1RUKL 5IFAL 4HEPG 4ZJ9A 5G2NA 1EEZB 2E7BA 2R0KH 1EDHA 3VYNA 1KB9J 4FKEA 3SQOL 1I7ZB 5DJYA 3W9EA 4C4BA 4RRPM 2WHVA 1QUNB 1T0MB 3KL0A 1CF1A 1KDJA 3DBSA 2ICWA 5EZPA 1UWGL 1NGYA 4R26H 5EWIH 4NWUL 3X12A 4G43B 4FTVD 4YR6A 1ACCA 4JAMA 3C12A 1J88A 5I1HH 4LPTA 4XVTH 5CP7B 4IDLA 4MAUH 2WV3A 2C9SA 3G6JB 3VFWB 4DH2A 3STZB 4HW6A 1BSIA 5T3XD 4F57H 2ADIB 3KNBA 1N5AA 5JOPE 4YC2C 4XZUA 1XIWB 5EDXA 1JZJA 3VQ2C 1Z9PA 4HBCL 4ABQA 3CDYA 4GRWF 3T04D 1BZQK 1JF6A 1PKQA 1T7VA 1ZHLB 5EOQL 3KYNA 4DEUA 3FB6B 4I85A 4W9LC 3ZVVA 1Q4NX 2FD6L 3T08A 1NEZB 5KBKA 3VA6A 1QO3B 3T3ME 2CLZA 2DI7A 2MOQA 3ABMB 2EDLA 3BP4A 3JWNH 5KSAD 3B1TA 4HWZB 4ZUUB 3GSXA 1SRDA 3D2UD 4CMMA 1JYVA 4DSYA 3H2WA 5DU7A 1TTUA 2FB4L 3BSGA 3FF8A 4UNTA 4ODBD 4R4BB 4B3VA 4HH9B 2FECL 4M1GL 4O5LH 1Y18B 4TLTA 1QR1A 4ATTA 5I1CH 3QHFL 1JS4A 1JPST 1VLXA 3F62A 3RVVC 1S78C 4W9FC 2ATAA 3POHA 3FUDA 2OK0L 1ZS8B 2EJ1A 1H9VA 5F0MB 1XAKA 1OOWA 2E47A 4WWKB 2X5PA 1KBVA 3MJ9A 5E2UL 1CT8B 2R29H 3JXAA 5FF6B 4GKOA 4HSQA 5JXAH 1BZ9B 1TZ8A 4L9LC 2A9ML 1RZIB 4QR7A 3EHBC 1F11B 5ALCH 2FECI 4KGJA 4KNUA 2W0LA 5CLTA 5E99H 5JNYA 4P5TA 4CNIA 4J8RB 4OGZA 1MPAL 4WW1A 4ABUA 5IMKB 1O7VA 4NRZB 4KK5C 3HPLB 3SZKC 4AEFA 4YK4B 1MFBH 2IVFC 5I9QB 5HDBB 3LRMA 3VI3E 1J1OL 1A8ZA 3T6XA 2K4AA 4OQ1A 4LBEA 1SDYA 5LAXB 4ZS6D 3MLRH 1BV8A 3TCLB 3N9GL 4Z7WB 5B3SB 1QTSA 4JHWH 4K2UL 1KYOJ 4RSYA 1G6RH 2YUWA 2MKLC 1YA5A 3FONB 1AZRA 5IBLD 3WFBL 4GRLB 1FZMA 1SHWA 1S7TA 2GJRA 2PCPB 4UBDC 3C60B 3MRHA 3UTZA 4R0LA 1WHPA 4QGTA 1BVKA 2CKBB 3NFSH 5ETUA 5FFOA 4MMYB 1PLBA 5KBMA 4ONGL 3KW8A 3EOYG 5HJGA 4CDGC 1A4KA 2VXVH 3UMNA 2VDML 4EKXA 5G4OA 4LOUD 2AQQA 1UXMA 4WTXA 2EDKA 3T2PA 1YEKL 2EKJA 1FVDB 4N86A 4YDNA 1KCRL 2YSTA 3HAEB 3NH7H 4UQ9A 2LTQB 4UU9A 4WFFD 4AJ0A 5E08H 3MLPA 1F4YH 1UC6A 2OJEA 4JGUA 3MMEB 3WFHA 1T3FA 2AJYH 2VN4A 1MI5E 1XIWC 1SJVA 4AKQA 5MEPA 4EIGB 2DH2A 4XCYB 1NC2D 2OMYB 5L6YH 3ZRFC 1JHKL 3U2SB 1F4WH 2VLRB 2IMNA 4PS8A 3WL9B 4M3JA 4GKSA 1KYAA 3MNZB 4NX0A 3NESA 3GSQB 1HXMB 1P2CB 3BLBA 3FO0H 1FFQA 3I02B 3KPQA 4OZGF 5EDSA 4FNPA 4WKXA 4X5QA 2G9HA 3WE6A 3WUWA 1ZHBB 3UDWA 2CMRH 4NERA 3SGJC 1SYSB 2A9DA 5GGUB 1LP9F 1NBVL 1NDMB 4AEEA 4AYFA 2FX9H 4TRPH 1A1OB 2QVIA 3S2AA 2BNQA 1T4KB 4ZPTB 3KMDA 4PW3A 5DJZA 2CAKA 4FEMA 3QRFM 5K1VA 2D73A 4WWKC 5DD6B 4YE4H 1XV8A 3ZSTA 1QEWB 2ADFL 1OTSD 4RFOL 2X4SA 3MJ8A 1RULH 3GZPA 3C5ZD 5CJ8A 2CBOA 1S7VA 4F33A 4BZ2A 1QI3A 2EYTB 5ALBH 5EOCJ 3D08A 4JFPA 3FULA 4MMXA 2JKTM 2QSVA 2G60L 1UYWL 3LPFA 4MRBA 1MOEA 4YK4C 3WIHL 5IROD 4C55A 1NM4A 2YJLA 1TDQA 1DJYA 3CN0A 3MLWH 4XGZA 2R0WL 5BV7H 1AHKA 4LMQE 3ABGA 3Q44A 1W72A 3L1GA 3WY2A 1F0LA 3I6KA 5IVXA 3GMOB 2J71A 4XBPB 3TVMD 4JFQA 3AGVA 1JGDA 2BNRB 2K1MA 1T1XB 2K0RA 1OQXA 1ZE3C 4GRLC 1M56B 3GMPB 4QNPE 4BFOA 3C60C 1FH2A 5B8CB 5DJ2B 3WIIL 3REVB 3RTQB 2YPVH 3EAKA 3VRIB 3MA9L 3VW3H 4Y4HA 2Z92A 2X2UA 3W37A 4G9FB 2CDFA 5GRVK 2OZ4L 3O45A 3SJVE 1Z0MA 4X80H 4MS8D 1P84K 1EFQA 4N0UB 4NM4H 4N0CD 1MW2A 4QOKA 3DO7A 5C0CB 4EVNB 4XCFH 3GUTB 3F84A 2CHDA 1T6WA 4FQIH 3KPSE 1T66D 4GMTH 2LTQC 4U3SA 1NFDB 1IMHC 2F54A 2QMJA 5BUAA 2YUXA 3MOBL 1OP3H 5DZNA 2ZOLB 3F7KA 1PG7H 2AXJA 4KQ0A 3DTUB 3QHZL 3LVEA 5DJ8A 4A39A 2J88L 1E5AA 3F12B 1O9ZA 2HKAA 2WKOA 3HC4L 4LLVA 5DEGA 4AEHH 3RPBA 1XR9A 3ZHLA 1Y6MR 1MFCL 4NO3B 4PJAA 3KCPB 4BKLB 5JIPA 3R1GL 4D0BB 3MBXL 3OVUB 1Y1DA 4M7KH 4M03A 3KYAA 3HZKA 4RQQA 4F58L 2ISDA 5KSVA 1BF5A 5CD5C 4TULH 3S37L 1WAAF 1QSEE 5EA0H 5D5ME 1D5IL 3ULAB 1OCWL 3FXIC 4X6DB 4WWOA 5SWZD 3RUGF 4A2DA 1VHPA 1Z2KA 2XN9B 3VXMB 4P3CH 1MCOH 1CICD 3IXAA 5HGDA 2K8QA 3MLXL 3N1PC 3K1DA 5BW7A 4WI7A 3ZE2B 1EJ8A 2X89D 1E4KC 5FGCB 3DGGA 5DQDL 2JXMB 2EO1A 1BXAA 3MUHL 4KI5F 2GITA 25C8H 4F7PB 5BZWA 4MDJA 4GP8B 4N8UA 5FA3A 5TD4A 2XYCA 4NQEE 3SDXA 2VDLB 1A9EB 2AZUA 1Q72L 5AB2A 1A25A 3L7FB 5JW4M 1T5WB 5DC0A 4FQ1H 4APXA 2AK1L 4IRJC 1F97A 3BKYH 4CN1A 3VGDA 5IZ7A 2AS5M 2WQVA 5ADPH 3CVHL 4TNWF