5DZJA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase 2 with carbapenem drug t206 in conformation a
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
351
structure length
351
Chain Sequence
b'LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Non-classical transpeptidases yield insight into new antibacterials.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transferase
total genus 91
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5dzjA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dzjA02
4QR7A 5DU7A 1ZATA 5LB1A 4Z7AA 5DZPA 5DVPA 4JMXA 4K73A 4A1IA 2MTZA 4ZFQA 4A52A 4JMNA 4GSRA 5D7HA 5E1GA 4A1JA 4LZHA 5E1IA 3VYPA 3VYOA 5E5LA 5DCCA 3TX4A 4XVOA 4QRBA 3U1QA 4A1KA 5DC2A 3VAEA 5K69A 5LBGA 5DUJA 3ZGPA 4GSQA 5E51A 3ZG4A 4HUCA 3U1PA 4QRAA 4QTFA 1Y7MA 3ZQDA 5DZJA 3TURA 2HKLA 4LPQA 4GSUA 4HU2A 3VYNA
chains in the Genus database with same CATH superfamily
2XA3A 2NY6B 4RRPA 2HJFA 3UEQA 3T0EA 4CDGC 4JN2B 2GAZA 2CDEA 3QXWA 2EXSA 2LGNA 2CR0A 3DOSB 3F7YA 5IIEB 1MAML 4L5FH 3ESNA 3T65B 2Z7WA 3B7SA 3MV9A 1ED3A 3WS3B 5D70L 4HUVB 4XXDB 3GZOA 1TEYA 1SN2A 1ZGLB 4I0KA 4OCXH 1P4LB 3C60A 4LLWB 4N22A 4MWFA 4YC2B 1JRHL 2EUXA 3KYMB 4GAAA 4KHTH 1I8AA 1ZHKB 1H9VA 2K78A 4CC4A 1AC6A 4J3XA 3TZVD 5MHSE 4M61A 2A4CA 1CGTA 4R2GD 4AGQA 5I73B 4KO6A 4PGDB 4KMQA 5IQ7L 4XO9A 4ODBD 3GMMB 4JFDA 1C7TA 2CBMA 5GRJL 4FCHA 5DVOA 1MI5E 4JY4A 1USQA 2BNQE 3C5ZA 3T8VA 3ETBJ 4I2XB 3QRGH 4KK8D 1COBA 1RZQA 5FW8A 6TAAA 4W9GC 1LEIB 4OFKA 1PD0A 2OZNA 3NPSB 1ZS8A 4JCMA 4DO5A 5KVGH 2EE6A 5EOTA 4PGCB 1SDDA 3KLAA 1JGEA 2XWZA 4LDOB 3UTTE 3L4CA 4G6MH 1GJIA 2QPSA 3HOGA 1KCVL 1H8SA 3SDDA 1R34A 5A2KH 3FNKA 2EC9U 4LF3A 1SYSB 1M6OA 4N8PA 4XP5L 1ECZA 1MFDH 1HEHC 1N10A 3HB3D 4PJ5B 1HYRC 4OLXH 5GZOD 4YNYB 5I15H 5C0DB 1KXVA 1MHEA 1RI8A 1ZLWK 5D1XD 2W65A 4A7GF 3FU8A 4UB0L 3P2TA 1D7FA 1JG9A 25C8H 3BEVB 2EEFA 3GSNH 4LHJB 2UVFA 5ETUB 3KLSA 5EU5B 4PJIE 3RX7A 1DVZA 1KJ2A 5IM7B 3RIAK 1X9LA 4JW3A 5MERB 2VXQH 4F27A 1BVNT 3CE1A 3RNKA 4XR8C 2V3FA 1T20A 5FIEA 2G3NA 2R69L 1HJBC 3OJ2C 4J3BA 1SN0A 1AD9A 3GXNA 5T1JA 1EO5A 4U1LA 1E4XI 4TTDD 1KC5H 3PPEA 3D0LB 2RH0A 3T0AA 4DN3H 1G7MB 5GISH 1E6OL 2VDRB 4P57A 4UF7C 2MNWA 3ESOA 3BVDB 2HG5B 5HVFB 1D7BA 1QR4A 4K3HA 5I6XC 3MJ6A 4GRMB 2WNWA 4DQOL 1A4AA 3BGMB 3RPIA 1A6AA 4LSQL 3WFDH 3FRPG 1WHPA 2VMDA 1MW1A 3IDIA 1PW3A 3VGDA 1H3WM 5KVEH 4G42B 1IBZA 2BRRL 4G1MB 4RSYA 3DO7A 4IW4C 1RJYB 1JD7A 3OHMB 1M2VB 2WB7A 4MNQD 5JUEH 1C5BH 1G0DA 4OJFH 3DBXA 4KI5D 1ORSB 3PWLA 2VUYA 5L8LB 2GG1A 2CHDA 2IMNA 4JM2A 3Q2LA 4WUUE 3RNQB 4J4PD 4M4PA 1A4JA 2AK4B 4O51B 4AQ1B 4KZDH 2CCVA 3EZJB 5AKRA 2ZUQC 3SPHA 1PSKL 4F7CB 5DHMC 1IO4C 1AS6A 1FZKA 1U91A 2Z93A 5CGYD 1QEXA 2YN5A 4YHKH 1CLVA 1AKJB 3OM3B 3QFJB 4O2FB 5DMKA 4N90D 4JQVC 3GHEL 4BSVB 4I0PA 5I8CB 1DO6A 3GIZH 4G8IB 2P5WD 2BH0A 4UV4L 2XWBA 4MB5A 2CGZA 4CMMA 1FFTB 4QXTB 3LZPA 1BIIB 2IQ9L 2OLDA 1VGEH 4HJSA 3O6FB 5AKTA 4YXHL 4DP1X 2NZ9C 3QHZH 4LU5L 3RPBA 5GRYA 5FKPA 3HBGA 8FABA 3NUKA 4Q6IA 5BW7A 2BRQA 3QPXL 4U3SB 4GO6B 4I0CC 1QHOA 5FS5A 2EXYC 2XXFA 2EEXA 3FDWA 3UP1A 5DS8A 1WLHA 1MJUH 1QSEB 2XWTB 3EBIA 4FTVE 1AFVL 4Y4HD 5DMGD 1S7QA 4MXVE 2IH3A 4ELKB 3W0WE 5ISZD 1ZCRA 2WTRA 4NQCE 5E4AA 4QHPA 4APQB 1YQ2A 1W72L 1A0QH 4JFHD 4BD4A 5T5NG 3MGOB 4HS3B 2OW7A 3P1VA 5LQBH 1EXUA 3B2DC 5JW4N 4WCYL 3IFPA 3GXFA 5C0IA 3B5GA 1SN5A 4I85A 3S4SA 3ECBB 2SEBB 3FJTA 3L2MA 2P5EB 5AVYB 1IC5H 3X14A 4MDJB 5F3HA 1PQZB 3WTSA 4RFNC 1N70A 3FONA 3RWFB 4MX7A 2E7LC 4EXPX 2HT2C 2OSWA 4TNFA 7FABH 1KLUB 1O6SB 3B83A 4NRZA 1BQKA 5CEZL 3U7WL 2R2CA 2MPAL 3PJLA 2V7HA 1ODAA 5DGQA 4B9ZA 2R23A 3FCSA 4QKXB 3TX4A 2Q10A 5C7ZA 4K23L 5AYQA 4GXVH 5LHDA 2EZ0D 1NDTA 5DMIL 2FT7A 3CFKB 4JQIH 1OAXL 4HUUB 1NMBL 5KSBF 1KTKE 3VD3A 4GUQA 1KXQE 1Y7MA 2E3VA 4KXAA 5FDWB 5JIPA 2EYRB 1CT8B 3MBEA 4QXVA 3T3PB 3PIQB 4LLUB 2PPFA 4GI9A 1A9VA 4D9LL 1XH0A 3ZX1A 5DVPA 3QJHB 4JS7A 4LVNC 1OTUD 3O9WB 5HYJD 3G3LA 3MRCA 1ZVSA 1C5DB 3F00A 1NGYB 1Y6KR 1U2CA 3HE7A 3S3JA 1YEDB 4XMLL 4OFQA 2P24B 5DD3H 1L7TL 4AVJA 4PQXA 4L1BA 4YVNA 2B1OA 4EI5C 5IREA 2AV1A 4C58B 5LN4A 1WIPA 4IRJD 4JFEE 3KXFB 3AG2B 3BAXA 3FS9A 1MHPL 3EOYG 4D2NA 1JYNA 1OY3B 4XHJC 1G9ML 2CLZB 4P2RB 4ZQTA 1R24B 3SODB 4GUOA 5KUMA 4M48H 3HC4L 3F3HA 3MUGA 3S35L 2KZ1B 4K5NA 2XUWA 5G4MA 1J5DA 1DVQA 3VFWA 2ZKWA 5J1AB 4LB8A 3OPUA 4EUPB 5I6MA 4IBSA 4JHBA 4PRAA 3US9A 1KACB 1SXSA 5D1QE 5IHUH 3CFJA 4K94C 5F7UA 2NUPA 2F74B 4HG4K 2WBXA 4GS7B 3CZSA 1LO2L 4UILL 2C4FT 1U8PA 3ARFB 3FUMA 3ZT5A 4NUJB 3AS0A 4HZLB 4A6YA 3Q06A 1R5VB 3P11H 4L8CB 2BNRD 5GS1C 2GK0A 1HSAA 2H32H 3IDGB 1ACCA 1IFHH 2APVA 2YMXL 1ZANL 4ZMLA 3QXVA 1KN2H 3LZRA 5EUOE 5BZXA 3VDCA 2KH2B 1AO7D 1PIGA 3JWOL 4R5XA 3T5WA 1F58H 4ZPVB 4I9WD 1I1FA 1L9OA 3MRRA 2AJSL 5T3ZD 1PMYA 3MRGA 4IJ3C 1NCWL 3WEOA 1J8HA 1NCDL 3LRMA 1I9RL 5A2AA 5FWQA 4ZXBA 2BIMA 3JYBA 4PU2A 1E4KA 3OJVC 4P8QA 4YSRA 1HU8A 2XTJD 2JE8A 3AC0A 1LXMA 4U0RC 3VG0L 2VDLB 3NJNA 4ATTA 1G6RA 4PJXB 3WIFA 4XWOD 4A7VA 5KWYC 4WSKA 3MLSH 2CKBL 1UG9A 2HT4D 1DBKL 2JJWA 3MOQA 3V0VB 2GKIA 4MNGA 1HTYA 4O4YL 4XPBL 2OP4H 3O81A 2JIXA 5IROA 4ALAL 2AP2A 2R4RL 1XR8A 4K4KA 4M43L 3B6SB 4G6AC 1HT6A 1XCTA 2IFFL 4TUJA 5E2WH 3QQ3A 3V4PA 2ZD0A 1A3QA 5D7LB 4WNQB 4ZTPL 1S5HA 4X5RA 3ZDZE 3Q2VA 5ANME 1H9DA 2NY0C 1IEBB 4OZIE 4JPSA 4Z7UA 1U0QA 4P3CL 1NWOA 3EHBC 4OGYH 1G0YR 1IC7H 1IKNA 4HISA 1GJUA 3KBFA 1NGPH 3H8NA 2VDQH 3GXTA 5I1JL 2GJ6B 2JH2A 5DO2C 4JO4L 4GIOA 3REVA 5I8KH 3T3PF 3II3A 1T1YA 4IKNA 5EEYA 4XN1A 3ZXAC 43CAB 2WXQA 5JPMA 1ZKAA 2AXFB 5D2LE 5IMMA 1DQJA 3JWNC 3VA6A 3MRNB 5CJQL 2ATAA 3DGDA 3LV3A 4W6XB 1HWHB 4GRLC 3IDXH 5DYOA 2XYCA 2Z8VC 2ICEC 4Z0BH 3ROOA 5ALCL 3GM8A 2NY5H 4WFFD 3MCLH 2NQ3A 5IESL 5C86A 1PIFA 1RERA 2E4FA 4I89A 4GG8A 2NLJB 4YHML 5E6IA 3R1GL 3R4DA 3D5OF 1WITA 3AWEA 3NSCA 1VGKA 1P2CA 1UASA 4H44C 3SE3C 1D5MB 3HZKB 4NO0B 3T77A 3RP1A 3HS0A 2OA9A 5JW3L 1CI3M 4KKNA 5FGCE 5I1LA 3FL7A 2OYKA 4W4OA 4DERA 1ZHBA 2NYKA 4B9IA 1YEIL 3DYMA 4NUGH 4P49A 3GXUB 4M9PA 5ESVB 3P02A 4PLOB 2J44A 3NZ8A 1U2HA 1FO0H 1WPCA 1DE4B 1DUZB 2JI2A 2V33A 1WF5A 4KKLD 1Z3GL 1L5GA 1SXAA 3D8MA 3UJIH 4BEIA 5IEKA 2YGPA 2GCYA 2P47B 3BOVA 4KFZC 3FU7B 4F57L 1DL7H 5I1EH 3BMVA 1MPAL 4UT6H 4JZNB 3QUXC 4KK5D 5KYUA 5LCVL 2X4SB 5I6XB 3TPUA 2CH8A 1MAKA 4PRHE 2F1EA 3LRGA 2VDPL 1U95A 2H8PA 5GIRB 1YJDC 1EZLA 3PDGA 1KGYE 1DBJL 2B9BA 4U6TA 5D6CA 4Z3EA 2NOYA 1NCCL 4GQ9H 3D4ZA 1YN6B 1DJZA 4ZFOL 3C2AH 4PJ6A 1OF2B 1Y07A 1RURH 4X7TB 4QNPE 1ND0A 3X13B 4R4BA 5FO8A 4OD2A 4E9YA 4QF1B 4QRTB 1TYRA 3JXAA 1LWRA 4NNXA 3BKML 3NSFA 3HN8A 1Y18A 3ZIMA 4L9LA 3O4LD 2L3BA 2NDGA 3B9AA 2Z65C 3OZ9L 2ZUQB 1D6EA 4PJXF 4I8DA 4NSKA 3VWKA 1VFBA 4P5MB 4BIKA 4HJJH 4OCYL 3VYPA 3WXWH 3GSRB 3EYOA 4FLRA 1O9ZA 5CFAA 3QJQB 5F1NB 3WAJA 2YQGA 4PJBB 2OI9C 3VXSE 1HZLA 1F4YH 3OKLA 4X6EA 1KNOA 1WBYA 2F19L 2N56A 4HGWB 2I69A 4NZTL 4Y4FC 4JPWL 4OV6F 3WKMH 3ZE2E 2BSRA 2IADB 4YHNB 1KB9K 1P1VA 3BQUA 4PW4A 3UZVA 5BRQA 1NJ9A 2FUQA 3FHQA 5TQ2L 3L3DA 1RUAH 4ZI8A 3OLDA 1MCCA 3LKRA 5HI5D 5HHOB 1CR9H 1HL9A 1MY5A 2EYTB 3QUZC 2F9BT 3H3KA 2YHGA 3ME0B 3TVMA 5AENA 2QBWA 3FT4A 1HE7A 5DJXA 3DKHA 2YKLH 4KTDH 4Y19B 1DQMH 1VACA 3H9HA 3L3IB 3B9EA 3MQIA 4DPBX 3P3UA 2EIZB 1JK8B 3BZEA 5F7YC 1OK0A 3NVQA 4XX5A 2WUCH 3WYRA 3P73A 3V52L 3I6LE 1ZHLB 2BSED 3DNKA 4KUZL 2HFEA 3NCYS 2FWUA 4MMYB 4ZMZA 3OAYH 2JKWA 1QQDB 2QSVA 1R3IH 4IOSD 5C9JB 1FNEA 1PG7W 3VGEA 3SGEH 3VI3E 3VD2A 3MR9A 4BSJA 1KGWA 3M07A 5HHQA 1XR9B 5T3XE 1TZHB 5JHDD 1RAMA 1XGRB 4JZOB 3SBWC 3JV0A 4RFNB 5LBGA 3LIZH 3ES6B 4PB9L 2DDQL 3QNZA 2VZ3A 4HIEA 5I76B 2ZOLB 4L29B 4E9QA 2WANA 1T83C 3QDMD 3ZSTA 2ZYIA 1R17A 2O5ZL 3RHWK 4PREB 4UMGA 1F4XL 2IWKA 2NY6D 1CFSB 2DQUH 2JCCB 3C6LD 2R29A 1AIZA 3FUFA 3U9UA 1I9JH 2EADA 3FH7A 2EUZA 3IXTA 3GSVB 1D2PA 2B77A 3HR5A 3MJ7A 4NQED 2H45A 3C8KB 2A9DA 3EOBB 1S5IL 5BOPA 1KY6A 4MD4B 1RMFL 1TTUA 2FWOB 4LVNB 4UV7H 1H3VA 2O5XH 2YPLA 5KS9B 4LAQH 2QKIC 4MJIA 4H8VA 1S7VB 3MCKA 5CBAB 3ZZLA 2ALAA 4RH4A 4DVBA 3V5HB 1FH5H 2DLIA 2XC8A 4FA6A 1DANU 2VN7A 1JZIA 1A3RL 4NJAL 4NZRH 1X3DA 1AS7A 2X9XA 5C07B 4EI5B 4X6CA 3MKKA 5C0GB 3U0PA 3QHFL 2YN3A 2EIJB 2LU3A 1EQWA 3H42L 4GXUN 1JHKL 4PWFA 4WKXA 4WU5B 3T4YA 1HNFA 1B6DA 1SLUA 3F58L 3F6IA 2ALWA 4X8CA 2Y6TE 3FRPA 1FGVL 3SPVA 3HIZA 5JHAA 2AV7A 4S1QL 4D7PA 4O9HL 4JFFE 1BG1A 2WK2A 3HR6A 2VIRB 4BZ2A 1JWSB 2IV8A 4Z7QB 4XNBA 2ADFH 4FQ2H 1NGQL 1QTYT 2QPFA 3STZB 2LFGA 1B90A 1BZEA 4MZ3A 4LSSH 1SHXA 3FO2B 1MFAH 2GT9A 2EDLA 1JWMB 5EIIG 4OD3L 4QXGH 1KZQA 3S5LB 3RU8H 4PS7A 4LEXL 4XTRC 1UADC 1NGZA 4F5CE 4XNDA 5D7KE 2VAAA 4I5BA 4QHNA 1U3NA 3V4VB 3MRMA 1I82A 1IGCH 4PJ8A 5HHXH 2EDNA 2FLMA 4LQFL 3CK0H 5TF1H 3LPPA 3KEHA 4M7JL 5GS1B 3GJEB 4NQVB 3PP4L 1MNUH 4WF7A 4KFMA 4DGYH 3PJNA 2AK1H 1K72A 1ZTMA 2PWEA 2HLFC 4BFIA 3LN9A 2BNUB 3WFHA 3IYLW 1CFVH 4FX5A 2EVFA 2YGNA 2JFCA 4NWTL 4R0LC 2OM5A 3IF1A 3E2HC 1MCNA 4PI0A 4IJ3B 4M5SA 1PLGH 3B2VL 1AHWC 3ECQA 3WY2A 3QIUC 5LDUA 4BRVA 3AAZB 4PJFE 5FHAH 5JO5B 2OK0L 4U0RB 4IOFD 4XCEB 2R0LL 2VQ1A 1I3GL 4P23D 5ERWA 2QADC 4OGQC 3SPCA 3QCVH 5TDPB 2LU5A 1FIEA 1IBBA 4DKTA 2QFRA 2WLMA 2XWCA 5DS2A 1BJ8A 4NKDA 2A6IA 4QRUB 2BIHA 2K7QA 1H3PL 3QNYB 2FJUB 3QIBC 4PG9A 3TT1H 1UWFA 4EPSA 2AJVH 4FC3E 3QW9A 3NIFB 4YSAA 3Q8BA 5ID1A 4UTBL 1RUQH 1A6TA 3W37A 4B3VA 4DK6A 3CUPA 1TKWB 4JFVA 1IBFA 3D3VE 4N9OB 3BRFA 4WWID 3S36X 4C83B 2CGRL 4JR9H 1TCRA 2M2DA 4L4TB 2NY0B 1VZGA 4N2HA 1AOZA 3E8UL 1PS3A 2C7UA 2GTZB 3RFRA 1FDLL 1UZ8B 2AEQH 3EHBB 3ZZSA 2JCCF 4YBQC 4C55A 1U8MA 2QR0A 4Y2DD 2BHFA 3SE4A 3ENEA 1B4LA 4TNVF 4PWHA 4L3EE 3S88L 3ELAT 4A55A 1U4EA 2X2IA 3VXUB 2EDDA 3FO9A 1E8YA 2ZXWB 2Q6WB 2D7NA 2DH3A 2PCXA 2WSPA 4K5MA 4KJPC 3DDFA 1W91A 1YMMB 4E42A 2O72A 1ZD6A 1AKJD 3EYQD 4PJGB 5HDBF 3Q3GB 1YA5A 3QFJD 1KBGL 5FYKE 2AMGA 2EDEA 5KS9F 4ENED 1QHPA 4GRLB 3OKYA 1TVBB 2BY2A 3O4OC 4F7PB 3CCHA 2B59B 4K73A 2DS4A 5J3HC 2ICEB 3Q6GH 1ACZA 4BXVA 2AJ3A 2KT6A 4HS6A 5HI4D 4I13B 4CN4A 3DARA 2WOYA 4OIIH 1TU2B 3O6FD 1SXBA 4MKMA 3QI9D 3B9KA 3P4OB 2WKLA 4PG2C 1KLGA 4LCWB 4HSQA 4QYOA 2P8LA 1X5ZA 3RVWD 1GSMA 1RJCA 1GOGA 2AXWA 4QKTA 1ZTXE 2VXSH 5F7WC 1GHFL 1O5DT 1XGYH 1EJ6A 3PAVA 4WHYH 2J8OA 2ZXGA 3FCUB 3BKCL 4KKZA 6FABH 3OHXC 2ZOKB 3HMXL 3VXMB 4NWUH 1BF2A 4G59C 1CPUA 1RZKL 4APQD 1JNNH 2C1OB 5SWSA 2FX9H 4HQQH 3T8XB 4FDWA 3IXAA 5H4YA 3UBHA 4X6BA 5EO0B 2Z92A 1FFPA 2P46B 4PCSA 4RFEB 1E0OB 4AJWA 4GP4B 5C6TL 1MHHB 3FFDB 4E9RA 3EXJA 5EO1B 5DDHA 3QUXB 1C9SA 1ZEAL 5DTFB 2H4EA 3WUWG 4G9FE 2P5ED 2PYEB 2NQCA 5EH1A 1N59B 3ULSB 3EW3B 1CGVA 3A6OA 4CAGA 3RL1B 5T33L 3IKCB 4XVUC 3MV8D 4IYKA 5DJZB 4AXWA 3ZY7A 1OP9A 1S4IA 2IALA 4Y9GA 4Z78B 5BS0A 1E9QA 5J57B 5B1KA 3DYOA 5D9SB 3N40P 1U8LB 4NKIH 5A2CA 4X99B 2NX5E 2V7NB 3FBKA 3RAJL 3DX6A 4HWBH 4HF5H 4JFPA 1JV5B 2EIEA 2VT0A 1S78C 4P9HH 1KGIA 4H13C 3T1FB 3N55A 3CBKB 3OR6B 5BRZA 2CNZA 1I7ZB 4FFWC 2K9FB 2VXQA 4PGZA 2DEYX 2Y1AA 5AYUL 4JZJA 3ZKMC 4FYSA 2VXVL 1VEMA 2F15A 1JE6A 1NIDA 1Q9KB 5FKAA 2Z34A 1IKFH 5E8DL 1KENH 1TT6A 3K4DA 4G8GA 4P2OC 5C3TA 3TC9A 1MEXH 2E7CA 3U2SA 1NEZG 2EXWC 3H85A 3OBAA 1KXHA 4ODUA 1A6VL 4ZQKA 2W60B 3EFFA 1CS6A 2XICA 2ICCA 3A6CL 4JDVA 2OI9B 7CGTA 5FF6A 3O9WD 4Y4FB 5ECJE 3A47A 2V9UA 3L7FB 1ORQB 4DGIH 4Y2OB 1JZ5A 1YDPB 3I2CH 4XBPA 4OVVA 1ACYH 1G87A 4FP8H 1DJXA 3NJIA 1XBDA 1WA0X 3BVNA 1M4KA 3CZLA 4RBPH 1MFBL 2CBPA 3QUZB 4Q6KA 4R7DA 4Y9BA 2J8UE 3O11A 2IDFA 5EU6E 2ZX8A 1E43A 1LWHA 5C0NC 2EC8A 5D7HA 2A5UA 4WJ5A 3NSXA 3J2PA 4RX4D 1H6UA 2XKUA 4MQSB 5J11C 4ZMVA 1KB3A 1O9VA 3BW9A 2L8AA 4PS4H 2B2XL 2X89A 3FOLB 1A25A 3SKNB 1LHZA 4BWWA 1FORH 3JV4B 2C3GA 3VUAA 3F62A 4D8PA 5EF1A 4OI8A 5MEPA 4AX3A 3EYFA 2D31A 3BH9B 4S2SA 1N6VA 3RWDB 1H3TA 1DVUA 1H3UA 1IT9L 2CKNA 2WLNA 3QCTH 4EN2A 4QCIA 2OMXA 2JELL 5GJTH 3LEXB 5C0CA 4K7PY 3V9FA 3QC5X 3VWJA 1I8LC 2YUWA 2GI7A 2VLKE 1U58B 1OP5H 2V2XA 5CZKA 5B1CA 5I0WA 2RAMA 5AL8A 4NCC2 1YG9A 2XA8L 2A9ML 1AG0A 4N0UE 4XNXH 5TF0A 3X1GA 4A66A 1WAAA 4HWEH 4OI7A 1JD9A 2NNCA 2GABA 2WXKA 2OJEB 3EG9A 1JVOA 3DA0A 3NFSH 4IKJA 3N43B 3CV5A 2KQNA 2QHLA 4AJ0A 3HZYB 3PHQA 4AG4H 3WIHH 2YAHA 3QG6A 5DRWB 5AKVA 3CX2A 4QO1A 3MLRH 2GIMA 3MRPA 3X1BA 1A4KA 5F88A 3M7FB 5D4QA 5E9NA 4R26H 3FOMB 4D3CH 4LCUB 1PZDA 3T4AC 5HY9B 4L3CB 4WY7H 3BSZA 1BFTA 3NA9L 5CSZB 2CUHA 1RK0A 3GBMH 4HLEA 3BIKA 1QRND 1CBJA 4NQQA 4DP8X 5IJVA 3BDYL 3V4UL 2K6YA 2ZUSA 1ES0A 2WVSA 2QKIB 2PYFB 3DO4A 5BZDA 3IFNL 1CFTA 1J9RA 2P1YA 5FECA 2VDKL 1UA6H 5TE7H 5DI8A 1M9SA 4S11A 1ZOXA 5D5MB 5D7LD 3KNBA 4EOWH 5FO9B 1M7DB 1BM7A 3KPQB 1EEYB 5SWZB 2B7DT 1DN0B 3PFQA 4LDLB 2OMNA 1TIUA 4FQJL 4PRNB 2ED6A 1ZLUH 5A6MA 4YR6B 1JHTB 1F6LL 1SJEA 2VLLA 4O5LL 5I6OA 4AITA 1XV8A 3WJJC 3CN1A 4JQIA 4ODVL 1EFXA 2EVJA 3GK8H 2WXPA 3BUDA 4AEEA 1SRDA 5EC2B 1WFJA 3OPZH 3UTSD 4EIUA 4I3RH 3IDUA 2KZBA 2YC1A 1TITA 4QRFA 3CHXA 5J6HB 5DEFB 3EGDB 4J3OG 3QQ4A 4S1RL 5E1AA 4LEOA 5JOPD 3KLLA 1OSPH 1CE6B 3INOA 2Q20A 5EC1B 1I3VA 3TIDA 1Q9WB 3PAYA 1H6FA 2KHAA 2CCWA 2RCSH 1KMGA 4YDLC 2R2EB 4XOBA 3PABA 1MFEL 2HH0H 1PDKA 4J6IA 3TN0C 1XGTA 4NO5A 3CVIH 4QHLA 2V9RA 1U3HC 3MGTA 2MEJB 1EAJA 2FT8A 3DBSA 3T0EC 4NO0D 2W38A 1FZMA 1FE8L 3W9DB 4XZ4A 3NJXA 4FQIH 4J1UB 5C08A 2G75A 3CPUA 1GS7A 3IU4L 4R0LB 3TBWB 5JDSB 5MEOA 1TYEB 4JM4L 1AHWB 3UYOD 1TLKA 3QIUB 1OTTD 1E8XA 5B4MD 1O7SA 1XIWA 1CXIA 3L3JB 1I8IB 1OAZL 4OUUA 5L9DH 2ESVB 3QJUB 5IK3B 3H9SA 4MB1A 5BMFH 4I18A 4HFWA 5KBKA 2FYVA 4LSTH 1JGDA 2FX8L 4H8PA 3ARBD 2AEPL 4O00A 4PJCA 4X50A 5HGBA 5AG8A 5C0AA 3C60C 5DJ8A 2IV9A 2CD0A 4TLSA 3L13A 4TNWF 5C09D 3PV6A 2IXQB 4CC4C 5FCSH 2Q87A 1ZXKA 2J6WA 2WSDA 1NDGA 3HHMA 1BFOA 3N3EA 3GIVB 3QIBB 2X7LB 5J5EA 1FFOA 3BP6B 5ICYA 5KN5B 4NPJA 2H32A 5ADOH 4AIZB 2D3NA 1UFUA 1QSFE 1TTBA 1Z9NA 4N2BA 1FQ9C 5T1LB 3VFMB 3WGUB 4EIZC 1MJ7L 3N43F 3C5ZC 3NJGA 3PS6A 3ZE0E 2DTMH 4PJ9D 3DV6B 5K59E 2PWFA 3FQWB 3W56A 1YC7A 1DCLA 1HK6A 1VHPA 1AGFB 2HJKB 5JW4Q 3MBXH 1IV8A 1J0KA 4YSEA 4Z3TA 4O2EA 1UCBH 3FB6B 2J5LC 4LZHA 2OZ4L 2Q3ZA 1EZVX 3SY6A 2K0RA 2YQ3A 3SDDC 1IM9D 1DR9A 1YEEH 4GAGL 3RWJA 4MASA 4C57C 3JTSB 2DWTA 3LMJH 4AQEB 1D5RA 4DP6X 1XZ0B 1NA8A 2NY1C 3O4OB 4MD0A 3BZFA 4CA4A 2W9DL 1A3LL 2VXUH 3I84A 1EEQA 1YECL 3VJ6B 3C6SA 1KXVC 1OGTB 1ZT1A 1WE5A 5D5MF 4F1SA 1TUPA 4MNHA 3GRWH 1GAFL 3H0TB 5E94A 5TQ0L 3ZQWA 3LRSA 5HHOD 3GMQB 3D12B 1IL1B 5E08L 1VERA 3TIEB 4H40A 5D1ZD 1HINH 5M95B 4LOEA 5D8JL 3R7QA 3LH9A 1KG0A 2EH8L 2GPZA 2ZJSH 3O2WL 3B9DA 4HC1H 2EXYD 3QUMA 2PETA 1Q0YH 4YE4L 2ZXQA 3DVNB 4FZ8H 3ATDA 3HUJB 3QT2A 1UGNA 4YDJA 2YD6A 3OHXB 4CADB 3JWDH 1J8SA 3GEWB 4PGEB 1FL3B 1GKEA 1MDAA 1SBBA 2YSTA 3EO1B 4GIPD 4LHUA 4PV8B 1U36A 2DOCA 4XPGL 5D2NE 2FATH 3DOHA 1UXSA 1PY0A 1TZIA 2M26A 1GYWA 2VDRH 3FQTA 4P48A 2WINA 3IFLL 3R06B 3Q9QA 3FB8A 3T3ME 5AVZB 2GVYA 4ELMB 1UQSA 1RZ8A 2CE6A 2BVTA 3MNVB 4FKEA 5EFIA 4XP6L 2IDTA 5LGKA 2HFTA 2HKFH 1ZE3C 1WFOA 5E2VH 3WY1A 1E4WH 2DQJL 5DRZB 1NLBL 3VQ2C 5EIIA 3GTVA 4K8RD 3AY4A 3T2LA 5D1XE 5D55A 2RHEA 2HT2D 4IMLB 1HSBB 1ZXQA 4NKMB 2EVIA 3FBQA 3MC0A 2QGCA 3GO1L 4YUEL 3QCUH 4JM2C 2EE3A 4NQTA 2XETA 3OVUB 1WICA 1L6PA 3VFRB 1WFMA 3IN0A 4O02H 4N2AA 4XMWA 4B0MM 4BDVA 1A1OA 2BM3A 4I48B 3KE0A 1CGUA 5DJYA 1E6JH 1HKLL 1F90H 1FF5A 2FEJA 1RZ7L 1FO0A 2JB6A 1MH5B 4NP9A 1P9MA 4YIQB 4G8FA 4XCCL 1T7XA 1X5XA 3GHPA 4P2OB 2LW3A 2YPVA 1D9KC 1CD1A 2GQHA 4K8RL 1XO8A 4X9HA 1A7PH 2ZPKL 2ZICA 4GKNB 3QO0A 3BP5B 2FECI 3OWEA 5CZVL 1XSIA 1MHCB 1G9NH 2F0CA 1V7NH 1XGQA 1SY6L 3FU5A 4KXBA 4UT6A 4WHTA 1CL7H 4U6HA 4TSBH 2Z0UA 2DQDH 2PP8A 3FB5B 4LKXB 2IH9A 4Z7VB 4LOVA 1RQ5A 3P0YL 3PRZA 1NCJA 4MA3A 4B9GA 4Q6IC 5BVJB 5BW7C 3GBNL 3BLKA 4FQXA 4L3FA 5F96L 3VRJB 4LLQA 5JORA 3ISRA 4PJHB 5LWYH 2R1XA 3BUYB 4XHJD 2OQJB 4KI5E 4RFOH 2HVJA 3AU1A 4OR1A 4OZHA 1E9OB 1Q0XL 3U36B 3AQYA 4IDJL 1LP9A 3P30L 4ZUSB 2QQKL 3I75A 4AGMA 5E5UB 5L88L 4RAHA 3P2BA 3ZTNH 4MSWB 1P6WA 4PP1C 2J20A 2GJJA 4N90E 3UBXI 3DMMA 2W94A 4F58L 2K8MA 3P4NB 2FVNA 3BPCA 3WFCL 4XMTA 2P5WE 2ERJC 1A4BA 1G5GA 5AVUB 4MBRA 4N8VG 2GJZA 3WBDA 2Q76A 2UZXA 1BSIA 3S36L 4MJHA 3VDBA 4TVPH 3GMLA 2VSMB 4XXCA 1ZLEA 1GIGH 4U6YA 1H0DA 4G6FB 1NFIA 1JOIA 5AOMA 2WWKO 4Y1AB 8PAZA 5IT2L 4IU3A 5EZIH 4S1SH 3QUKB 1SYVB 3QH3A 2NYYD 2CIIB 1BJ1H 5HVWA 4UBDC 3DV4A 2F5AL 2X28A 4YLBA 2Y3NA 1HHIB 1AR1C 3HUJF 4OF6A 4JG1H 3RWGA 3HC0A 4P04A 1I31A 3HMWH 4Y9EA 4UOZA 2X3CA 2J4WH 2EIKB 3MBEC 4HIHB 4TQ8A 5ISZE 4KKCC 4P2QE 3TYGL 1GGCH 3BO8B 1XZWA 3T4AB 1XAUA 3CMOL 4IJTA 3LKPB 1YNLL 3G6JF 4DTGL 4ELMF 3N9GH 4ZX3A 2E46A 2E7DA 3OJDB 3O3EA 2IMMA 2RFXB 4AQAB 1QNIA 3HE7C 3MLXL 1HH6A 1P84K 3L45A 1CCZA 4LNRA 3LSOB 4NQSB 1JWUB 3LKQB 5FYLE 1DBMH 2BSBA 2OMYB 2W5PA 3BWZA 4QTFA 4G6AD 4R5TA 4YGAB 4KUCF 1N2RB 1UOLA 2PW2B 4U49A 1KFAH 3IJEA 3LIZA 5DJAB 2EABA 2AQTA 1J9CT 1MCOH 5AB9A 4IEFA 1JK9A 3F12B 1N7MH 3LEYL 2W59A 4E9TA 3BUQA 3IMTA 4ZMQA 1N5AA 1G1CA 3WUWA 1F5WA 5K5YA 4NPYB 3HI6H 1HHJA 2A73A 4JPVL 3CG8A 5G4NA 1NL0L 2Y24A 4PRID 3WTXA 3K0WA 4IBVA 3UXFA 1NC4A 5HJDA 4RBPK 5DO2D 1NINA 1YYMH 4V1DB 2M1KA 2AXGB 2XT1B 3TCTA 2A4ZA 1WRFA 4NKOB 2DIBA 4LPYA 4BYHA 2D4FA 4I1NB 4F9PA 1VDGA 3G5VB 4JAMB 3NEOA 3Q9PA 2J55A 3F7PC 4M9OA 1T5XA 3BZ4A 4X7SL 3RWHB 1AGEA 2QV4A 5MENB 2YUVA 4B9CA 4P3WA 5IBUG 2MJWA 2WO2B 1FL5B 1NEZA 1OAYH 4Z7VF 4YDLB 2HTKC 4NYLB 1T80A 3TN0B 3ILPA 2YK1H 2DMBA 5K9KB 4UOW1 1J8KA 3AT8A 5EORH 1U3HB 5L2KA 4OF3A 3IJHB 2DL2A 2HJFB 4PJHF 3T0EB 1DTUA 3ARUA 1MI5A 1OE3A 1Z9PA 4PN6A 1W9XA 2GC4C 4B5EA 2YOAA 4ZXBC 2F53D 5E5MB 1E4KC 4XP4L 3F7YB 4OFVA 2VDLH 3SQOL 2DQHH 3MV9B 3K2IA 3SB3A 1A7RH 2VLJA 3MLZH 2IBGA 1CVSC 3VXMD 4FQLL 1ZT7A 3CBRA 5DK3A 1NICA 2AQ3A 2FSEB 2VNCA 1OGSA 3RWEA 5T1KA 3C60B 3W81A 3CVCA 4YSTA 3GS0A 2EDWA 2Z64C 4N1EA 1SDAB 5F2FA 5IROC 4KHXL 1MIEL 1BAGA 1HWGB 4FFZA 2CALA 5F21B 4HUXA 3NMEA 5LKNA 1DLFH 1T4KA 4MZIA 3NGBC 4M61B 3QUXD 1SQMA 4QRPA 1X7QA 1SNRA 2V2TB 2G9KA 4PUBL 2MTZA 2WGNB 1TMQA 3HZVA 2IAMB 4KKBC 4B50A 4PVNA 1GZQA 1Z66A 1U42A 3BKYH 3LNFA 4RSVA 4XP1H 5MP6L 1IKNC 4RDQF 1BOYA 4JY4B 3WE6B 3C5ZB 3SOBL 2BSSA 4AQOA 4PB0L 4I9WE 4JX0A 5E23A 1L0XA 4KRMB 4XAWL 5T3ZE 1ADQH 2E7MA 4K3EL 3G5ZA 4LARL 4M5YL 4XZUA 2ATPA 4YHPA 1F8TL 2C9RA 1BJ1J 3C75A 1ZS8B 3GLEA 4TSCL 3QEUA 5HJ3B 2XTJE 4AYSA 1MWOA 4AKQA 1B3JA 1SDDB 1JGEB 2J5LB 3KLAB 4G7VL 5JPMC 4YDKL 4FNLL 3SDDB 5C0BE 2BY0A 3KVQA 4LF3B 1IGIL 2D3LA 1M6OB 4HEPG 3SPJA 5HGHA 4OM1L 2EECA 4RZKA 5D72L 1YY9C 3Q1SL 1ROWA 2NY1B 4ZSOE 5BNXD 4LXFA 1HCFX 3L3KB 5LXGL 2YA0A 2F54A 4AMKH 4GG6A 1ZS2A 5E6IC 3RJDA 1MHEB 5FGBA 4N3TA 3QJTB 1PGRB 5D7IF 2HKLA 4IHOB 1F4WH 2NZIA 4K07A 4QTIH 2YD2A 2MCPH 1A02N 5CP7B 4KDTA 5JXEA 2EKSA 3HS0C 3QXTA 2JI1A 1WCBA 3QUZD 4W4OC 1SMOA 4YBHA 1OSEA 2HUHA 2ZOUA 1IKOP 2XCMC 4WUUA 2C4XA 3C5SA 4F2FA 1ETJA 2NW2A 1P7QA 3RNKB 4LSPH 1T20B 5CN3A 5BXFA 3Q5YA 4JFYB 4WEEA 5E4OA 1AXTH 5AVTB 1AD9B 2G5BA 4P59H 3PLYA 4KITB 2HKAA 3MRBA 1RVFL 4U1LB 5FYJD 4HIJB 3QZWG 1DQTA 4LCCA 4OJDH 1NGWB 3GMRA 2BY3A 1C12A 1E5UI 4P57B 4KY1L 1A6UL 3NIGE 3GBLA 5B3JF 1ETZA 3OL2A 4KKQA 2IGTA 3PWVB 3RPIB 1A6AB 1DSWA 4JPKH 3DECA 1EJFA 5D96C 3IDIB 3DO7B 3DVFA 5FEBA 5DK0B 3VNYA 3RA7L 5F71A 1T1ZA 5AW7B 3I50L 1BYNA 4U6XA 3WHE0 4NN7C 2X12A 1XSOA 4KGLA 3OGCA 4GIAA 3DBXB 3I9IA 1W0WB 5FLVA 1BMGA 2W0PA 3IRPX 1OAUH 3R0NA 4JM2B 4B95C 5DU7A 1A4JB 1FVCA 4PJ7A 4L9LC 1M57B 3SE8H 3TCLB 4FTVA 4KV5E 1XF5A 4G43B 2V9TA 5FOBB 5IV2B 1X6LA 2AC0A 3W0WA 3VWKC 5JW5A 3GI8L 2P80D 1FZKB 2J6EL 2YOCA 4NQCA 2ENJA 4ZO7A 3RY4A 1Z9SA 2PO6A 1J1OL 4U3HA 3VXOA 1I7UA 2JKIS 1X5KA 2C9QA 2B4CC 1EO8H 1XD1A 2XU9A 2ARJA 3MRDB 1ZVYA 4NZUL 1D9KB 1K8DA 1KJVA 2VRKA 5I74C 3L95A 3P3TA 3BQUC 1MVUA 1L7IH 2XZCL 2IOIA 5C7XL 3LB6D 1TZGL 3MRIB 1ZT4A 1AZVA 1T5WB 2IBZY 5D71L 2DIJA 4JY6A 2JKLA 3MROA 4FADA 3VMNA 4GKZB 2RGSA 5E1GA 5FKPB 8FABB 1X7TA 4DW2H 4Q6IB 1IJNA 2F5BL 3QORA 1CICD 3KCWA 2H1LM 2PPCA 1KBVA 1XEDA 1N3NA 1YNKH 3E6HA 5AZUA 4XNQB 5JOFA 5SWZD 3EBGA 1XB3A 1QFPA 3MUJA 2D9CA 2LLGA 3S8WA 4HWBA 4NO3A 4UZUA 1Z3RA 1S7QB 2BZCA 4RGMC 5AEAA 1ASPA 1R46A 2VDKB 3O4LE 2WTRB 1JYWA 1MWAB 5HDOA 1K8IA 3OKEA 5A2BA 3ULUC 5AW2B 1A8ZA 3KPOA 3HG3A 3K46A 5CJ5A 2G9HB 4QXWA 4ZD3L 1EXUB 4DGVL 1NPNA 4XCYB 4AK2A 3ZO9A 2DB8A 4ZYKA 4GW5A 1OAKL 2I32A 3IFPB 5DQJA 2Y5QA 3FTUA 4FAAB 3LS4L 3S4SB 2E6QA 4CL7A 2VW4A 4XTRD 3NPZB 3KCPA 4X2UA 3GSXA 2RB8A 1UZ6E 2ERJB 2XPYA 3H54A 4KDVA 4RMSA 5F3HB 3RX9A 3FONB 3TV3L 4WJG3 3CXDH 3UEZA 3WJLA 1MZZA 4MX7B 4WVRA 1RK7A 4QRRB 5GGSB 4HOXA 4XB7A 5DFVC 3T6VA 5IB4A 3K7UA 3DRTB 4NRZB 5F9OH 4EZMA 4K5LA 3KW7A 4G7RB 3FQXA 4GMSL 2HLFD 2V7HB 3LVEA 4H88H 3FCSB 4H8WC 3MKGA 4N0YL 4Z3FA 5I66A 2A6KB 5GZND 4G2AA 4KMTL 4RWHA 1RUKH 5I1HL 2MCAA 4MCNA 3QAZC 4W81A 3RBGA 1UH3A 1AR1B 2HMIC 1SVZA 2Q3XA 2VDOB 2E76C 4YDMA 1RK1A 4RQQA 4MA1C 2XX0A 4LEEA 4WGVB 4E9VA 3L08A 1X5GA 5D1QA 2WZPD 4R7NB 2DD8L 2QADD 5BUAA 4UIKL 4HKJA 3APNA 1SZNA 1U8CA 2OTUA 5GRZA 3TNMA 5CUSH 2AZAA 2BFVH 3RDTA 3VGGA 3Q01A 3HE7B 4LLMA 5JHBA 4JGNA 1GVIA 1ETB1 2A9NL 4AOFA 3BJLA 5HDQH 4OI9A 3H3BC 4GAFB 5JHDE 1AY1H 4D0DA 3FN0H 4X8XA 2Q2LA 2VDNB 1XEUA 1HI6A 2X44D 4MMZA 3ZHLA 1CL7I 2MOQA 2DQGL 1YMHA 5EUOA 4HUCA 1R3KA 3ILQC 3MOBH 4LL4A 1A21A 2KDGA 3QDGE 4Q56A 4JM2F 1JRHH 2AJZB 3QDME 5E6RB 3APFA 5T1LD 2QGDA 3A4DA 3FQNA 3Q48A 1CFQA 4DKFH 3MUGB 4YBQD 2H3NA 5JHLH 1NQBA 3VFWB 1FA4A 3QIWD 3I02B 3UC0H 1NDMB 5DQDH 4BSWA 3I6KA 4PRAB 4LGRB 1T7VA 1XX9C 4K3DL 1HOCA 1DVFA 1IZJA 2XKSA 2HVBA 2R83A 4MQ7A 2H47C 3DI3B 5EOCH 5FFGA 4NQEE 5BO1H 1PG7X 2MKLC 2ZNXA 2XKNA 5BOZG 4QWWC 1FRGL 4QLRA 1W6LA 3A6BH 4PAZA 1U8PB 3V4VH 1T4WA 2RR3A 1GGBL 2Y2TA 4PJ8C 4TM9A 3CH1A 4A6YB 4RA3A 1WS8A 4M3JA 5J3HD 5C2BL 1TJGL 3LDBC 3WN5A 2ADGB 2A9CA 4XMKL 1KCSH 3ZU8A 2OMZA 5KVDL 1KCVH 5L4FA 3A24A 4OZIA 2WYTA 1FN4A 5ACLA 3HLAB 3X2QB 2CHWA 2XZAL 1IE5A 3MRGB 4ZBJA 1J8HB 1MCHA 4X9FA 2AITA 4Z8FL 3AG4B 4FQCH 4R3SA 5GGQL 1R3JA 3JVGA 1G6RB 3HJ0A 4NP4L 3CPLA 4M6NH 5GSRA 4HKBA 2XWJA 2FEDC 1PNDA 1CG9A 1Z6JT 2KYIA 4QRSB 2CXGA 2FT6A 4FJ6A 4GMTL 5EN2A 5FYLD 4DN4L 2GBTA 1B9ZA 2JIXB 3TO2B 3RWCB 2V2WA 1EHAA 5FA4A 1NCAL 4Y4KC 3IGLA 1J1XL 2R69H 1XCTB 2FJGB 4TUJB 4X7DC 3NGBB 5GRXG 3QQ3B 3AT0A 4ZPTA 3OQRA 2A9AA 2H6PB 2M8XA 3KZ8A 2DWEA 3UCQA 3G6DL 1XBRA 4XVUD 4ZW7A 4KUCD 3IDJB 3U6RA 4Z7UB 1E6OH 3UTQA 4WI4A 5KVMC 3HZMB 1A5FL 2O26U 2FE0A 43C9A 5I5IA 4N8VA 1UCTA 1AI1L 2HLAA 4HALA 1QW9A 3QBTB 5FYLL 3UACA 4EIBA 4DQOH 2JMRA 3PG2A 4RMBA 5IIEA 4IIQA 1S78D 3K91A 3WS3A 3GXDA 3REVB 3CMGA 4FFWD 4HUVA 4XXDA 3C87A 4ODXA 3BH8A 1T1YB 1PCSA 2BDNH 3RWIA 3UO8B 1DJGA 1OW0A 3ZKMD 1OCWH 3ZQXA 1PU0A 2E27H 4HPYL 5LBSL 3QP3A 5KEZA 3JWNH 5JPMB 5KSBE 3AJ7A 3E80A 3G04A 1DZBA 4P2OD 1P4LA 1VIWA 2K70A 2PABA 1QBAA 3LV3B 4L0YA 1I8KA 2HP4A 4X4YA 5DYOB 1DSFH 3KYMA 3WDJA 1BVKB 2GEQA 4WGKA 5ABZA 3VXQA 1ZHKA 4XMZA 3ROOB 4P46A 5KBLA 3QQ9D 3M6DA 3ZHNA 3D0AA 5FOJA 5FO2A 3GZPA 2WZ5A 5CCKL 1EDQA 5AWNH 3MVSA 4A2LA 4C4UA 4GG8B 5E6IB 1BQUA 3IETA 3B9KC 3DSFH 5EEUA 1VGKB 3TEYA 4H25A 1R5WB 4KKPA 5DF0A 5TDNB 3OR7A 3QSKB 5F7FA 3EO0A 4AQ8A 3HS0B 5I1LB 1E9PA 2KERA 2V8MA 3LOWA 2OMTB 4UV4H 3TYFA 1CLOL 4I2XA 4Z1PA 2IQ9H 2WXGA 5C0ND 3GUTA 1LEIA 5B3NA 4OV5A 2HKHL 4BGDA 1QA9B 3NZ8B 4YXHH 2PPDA 3S8GB 4YZFF 4LU5H 2VLMD 3VI4A 4LAJH 2MFNA 3HE6A 3NJVA 2GK2A 2O4EA 3L3OC 5IEKB 5EB9A 2DY2A 5I82A 2GCYB 3WNJA 3QZMA 3HG4A 3JTTA 1J88A 5I6KA 3O8XA 2WXHA 3EJRA 5EOCJ 5BJTA 2NNFA 1T7ZA 3BCDA 3LH8A 4PJ5A 3FULA 1T3FA 2BHUA 4HCFA 3X3GL 3KWUA 5KYUB 3ATAA 1ZWIA 3TPUB 2Y06H 1AZRA 3NRPA 4BZ1H 4WEMB 3U7YL 3LRHA 1U95B 2H8PB 2APSA 4N87A 4S1DD 5KW9H 2V8LA 5D96B 4AIXA 3AADB 3BEVA 4F8OA 3GRWA 1FPTL 4HUNB 3AG1B 1OAQL 2UUDH 5JZ7D 4R4BB 4NN7B 1OF0A 4OD2B 5EU5A 5FO8B 3NZSA 4Y1AD 5LNDA 1CLZL 1H5BC 2PPAA 1K4CA 1KYUA 3QXUA 1U3HA 5DLML 3RTLA 3P3RA 4HC1A 5G2NA 4F7MA 3QULA 4NFCA 4ZUTB 1D6EB 4HT1L 4ANWA 4OQ1A 3VWKB 1ERNA 3ZYIA 1W8NA 4CC1A 2EILB 2J21A 5CEZH 3P0VL 3ZOAA 4XN2A 3NSYA 1EERB 1UUSA 1KUMA 1G7MA 4FXTA 5HPOA 4WQOA 4EJ1C 1TQVA 1F3DH 1FBIL 1KNOB 1PJWA 1WBYB 1VPOL 2HG5A 3NCJH 1XSJA 5I74B 2BSRB 3SDYH 1OAXH 3UAEA 1KN4L 4IBUA 4M5ZL 4P5KB 4WDIA 2IANA 3BQUB 4LSUL 3BGMA 3UMNA 3RE0A 4FRWA 4F2ME 4PS3A 3L3DB 5EBLB 3ZYOA 3RIAF 3LKRB 1XSKA 3MMEB 3RGHA 1M53A 2P5EE 5DQ9A 4G42A 4N6QA 4P9ML 1BQLH 5FFLA 4D9LH 5HHNA 1NCGA 4Z7UF 4AIOA 3MV8E 3ULVC 1QSZA 4AMWA 3TBTA 4M7ZC 3UC2A 1ORSA 3FT4B 5DJXB 3ECVA 5HHVH 5DUPH 1MFNA 1CF8L 2ZCLL 4G6JH 4MA7H 1AACA 3DHMA 1LEKA 2AK4A 1DBAL 2KKQA 3LZLA 4XMLH 1J05A 1Z9LA 3WFEL 4YHYC 1JPSL 4LFHD 1UTDA 3ABLB 3FH8A 4O02A 1L7TH 4RGMB 1BVNP 4DP5X 3BZEB 3KWVA 1C7SA 1KBBA 4NM4L 1SJHA 5FYJH 4F7CA 1RU9L 4U6VL 3P73B 4V1DD 3MSPA 1AXSA 1MHPH 3MNMA 4M93C 3CJJA 1E7UA 2BP0A 5I8CA 3VMPA 1DQQA 3FQ2A 3NDZE 4G8IA 3MR9B 3VWJC 3UERA 4JFOB 1VFUA 2KBGA 2F8OA 4NO2B 5HHQB 5DD5L 2C3HA 3OAZK 5CILL 1BIIA 2I9LA 1CGSH 5MEND 2MIZA 1Q9LA 2Y2WA 2Z7ZA 3L2LA 4LIQH 2XN2A 3QNZB 4HEPA 4HIEB 4N24A 4Q89A 3TN0D 4LKCB 2FL5B 3R7RA 4AVIA 1HEZB 2QQQA 1N64L 1LO2H 2WQUA 3V0GA 5AOLA 5B21A 3T0ED 3R4RA 1QSEA 5DVKA 1E2VA 4YHLL 1YLBB 1RUPL 2NNXA 1XXDC 3U9UB 1EFQA 3QAZB 3D05A 4PJEA 4RWYL 4LSRH 1HZHH 2N1KA 2YMXH 3MV9D 5CIPA 4N2MA 4WWKB 4RAUB 5CKGA 4MA1B 2A3TA 5JXAH 4HS3A 4JE0A 1S6NA 2F68X 1OL0A 5K9QG 1OWWA 5E99L 4ZNEE 3U1PA 1C16A 1NCDH 2DWDB 3C60D 4MJIB 3UJTH 4X4MA 2BINA 3ECBA 2SEBA 3MCKB 1GYVA 2DRUA 1RZIA 3PL6C 4GINA 4QTHA 1HXKA 2WQRA 4J28A 2ZE0A 5IMLB 4ZS7L 2WQSA 4XCNB 5E8EB 4X6CB 5I5RA 3U0PB 5GRUL 3MI6A 3DXAB 3P9MA 4MS6A 5KYNA 4DUVA 4EQ2A 1ID5I 4JHWL 4UU9A 4XNZC 3T4YB 2HRPH 3AFLA 4JFDD 1XGZA 3C08L 2W9LA 3FRPB 2R4RH 3Q8AA 4ETQA 5FPIA 2NR6A 3C5ZD 4M43H 3SGKA 4AEIH 3CFKA 1TG8A 4BFRA 2Y1VA 4NGHH 3MFGB 2ADJB 5FDWA 1RZGB 1U8HA 1CT8A 2WLKA 4GEJA 1PD1A 2ADIB 4L4JA 3PFUA 1E5AA 1UT9A 3PIQA 1V8HA 1FG2A 3IE4A 1NMAH 3QJHA 4PJXE 3K3QA 2GT9B 1WCQA 3SDDD 4NI6A 1QRNE 2WJ7A 1N12A 1G7JA 4QHNB 4ZZFA 3RB5A 1CYGA 1QZNA 2NY1D 5E8OA 3EGSB 2Q2EB 1A1NB 3EJUA 5BZZA 3BIAX 3LDBB 1KIRB 1EEZA 4ONFL 5EIVA 3UZEA 3KXFA 4BK5A 4BFIB 2FO1A 3WFHB 5D7LE 1CF1A 5CJQH 2CR6A 5F3BB 4L37A 2CLZA 4HBCL 4P2RA 1PZUB 5FR3A 3IF1B 1R24A 2CZNA 1MLBA 2NY7L 4BRJA 3FO0L 3EO9L 3FSWA 1N0XL 4GKOA 1UM4L 5CBEA 4JREC 3W82A 1XIWC 2QKSA 3TESA 5DHXB 1ITCA 4L3EA 4N20A 4M1DH 4PYGA 5J1AA 2J57A 3QJOA 4JY5H 3N0PB 3UPAA 2WQXA 5K93A 3X1NA 4I18C 2AABL 5ERWB 3ULUF 1AQKL 1TETH 5A7BA 1MF2L 4JFZL 5JW3H 3FN9A 4WI6A 1WV7T 3UTSE 5I1GL 1Q1PA 4OTXL 4MHHG 4XMVA 1NEUA 2ZIDA 1MFCH 2L4OA 2A6IB 3QK0A 4N2OA 2ZONA 2A74A 3ARFA 4ISVB 4PG9B 3NJFA 4TRPL 3LHPL 1Y0LB 2X05A 4MFHA 3UDWA 4HZLA 5JOPE 4Y4KB 1R5VA 5ID1B 1NEPA 1A6TB 1KJ2L 3I9PA 1BEYL 2D9QB 4ORZC 4QRQB 3CUPB 1Z3GH 1DBBL 1DLHA 3CDZB 1EUTA 2YUXA 1TCRB 3U6RB 4HOZA 2OR7A 3Q8CA 4AYEC 1UKQA 4F57H 2C7UB 1RH8A 4MS8C 4ZPVA 4OLZL 3BFOA 4W9JC 4JO1L 1R75A 4R97C 4U1IB 1MPAH 4ZTOL 3MRQB 3NIDB 1U8MB 5FK9A 4JM2D 5LCVH 2QR0B 3VA2C 2O6CA 1RIUH 1TJHL 1LMKA 2WMPA 3UBFA 3D06A 2VDPH 2XN9A 1JTPA 2CK2A 3FO9B 2C3XA 2MHAB 4XVSL 3V4LA 4B5ZA 3PP3K 1GGTA 5FM5O 2IG2L 2OSXA 5E7BA 5JQIB 5DT1L 2N0KA 2G3ZA 3UJJL 5EU7E 3CZGA 4GAJL 1ANUA 2WLIB 1KFGA 3GRBA 3QWOB 1UWEL 3V0VA 4OCWH 3S3CB 4HWUA 2XY2A 1ZA6B 4QRAA 4I0PD 5EU4B 4OQTH 2D2OA 3CCHB 1O7VA 2YKKA 3B6SA 4OF5A 4R96B 5C09E 2AJ3B 4LBAA 3BGAA 2ISDA 2AVFA 2QSCL 3TEUA 4G9FA 4GT0A 2BIOA 3AW5A 3ZYJA 5B38G 4XC3H 4OCYH 4ZS6C 4X6CF 4N5UA 1HFUA 3B9KB 1KLGB 1JXGA 2H0EA 4GKSB 1KCUL 2WUBL 4WI3A 2F19H 2Z8SA 4YN3A 4U1KA 5ELIA 5C0JA 2QVIA 3APCA 2A38A 2LOEA 2GJ6A 3LH2H 2Y7OA 1MOEA 1N0LA 1U8OB 3RL2A 3US0A 3PAZA 1ESOA 3NSJA 1CD0A 2DJSA 2HZHA 3OAWA 2PUQT 2AAAA 4KXZH 4QOKB 2RMNA 3K2MC 3MLUL 43CAA 3LQAC 3L3OB 4IHBA 3JQOB 4OZ4B 2AXFA 4NI3A 4GW4A 1QZ1A 2OBGA 4X42A 1SF3A 4B9FA 4X6BB 2NY3B 2B14A 2Z92B 5B3SB 3AXHA 4L05A 4FS0A 2DBJA 3AS3A 3BWSA 4NNYA 4OSUL 4PP1D 5DDHB 5TFSL 2HYMA 4PEEA 5EMYA 3ZR5A 2Y07L 2NY5C 1BAFH 4YX2L 2NLJA 3CFMA 2R39A 4KUZH 1TQBC 2WBJC 4N25A 4AXWB 2AEIT 4ZUWB 1E9QB 1MAJA 2P7TA 5AAPA 4WFGD 3Q05A 4UYPA 4FERA 2J8UA 1IMHC 3PQYA 4ZO6A 3DX6B 3U0WH 4JFPB 5EU6A 2XQBL 1H5BB 4M6OL 3II2A 2BHYA 2YAQA 3WV0A 5BRZB 5I30L 1A7QL 4KQ0A 4HJ0C 3CC5B 4N0CC 2FCBA 3L6FB 1P9MC 2JB5H 5FKAB 5TE4L 2ZQKA 3FTXA 4G8GB 2I85A 4YSCA 2ZWNA 3MBED 4NNPL 3RFZA 3U2SB 2O5ZH 4KKCD 5AW9B 1PG7L 3H4FA 4ODUB 1HL8A 3FU7A 3EFFB 1O0VA 2YAPA 4GAYB 4JDVB 3D2UA 3N41F 5FF6B 3IRCA 3S96A 4JZNA 2C3VA 2DTSA 5T5NF 2MSPA 3QS2A 4KKRA 3HE7D 3IJ8A 1S3RA 1XH1A 5GIRA 2VMFA 4TSAL 3NRFA 1J1PL 2VM4A 4N0UA 1PYWB 2GW5A 1S7RA 3BVWA 3B4NA 4FQXC 1PKOA 1XCQB 1PKQE 4R7DB 3X13A 3K6FA 3SJVB 3O11B 4EZKA 4YHYB 1NCBL 3CZNA 4C56E 3BW9B 1RUML 2GIXA 4NJAH 4XO4A 1X5IA 3N04A 3LQZA 4W9DC 5MEPB 3EYFB 4P3DB 2D31B 1JHKH 5EEVA 2DYSB 3CQFA 3QQXA 5FC9A 4M93B 5F1NA 3CXHK 3F58H 3L5XH 4PJBA 4X8JB 3DMMC 1L4IA 2BVYA 4DGWC 3BHBA 5C0CB 4NS0A 1LVEA 5I6NA 3ZRFC 2D03L 1KJMB 2EJ1A 4LZKA 2IADA 2BCKB 1XT5A 4JL2A 4LOFA 3B2MA 3V0IA 5HDBE 5IFAL 2JJVA 3I9AA 5I26A 1I85C 3MZGB 3WTYA 1VFMA 3H1ZA 1EXHA 5EBGA 1X5JA 1PJ9A 3RX5A 2V2XB 5I1CL 4H5SB 5AZ2H 3SE6A 3BISA 3KJ6H 4KO5A 1YRKA 2HTKD 3EG9B 4KQ3L 2FK9A 2BS8A 3CZUB 3O2VL 5DRXA 1OOAA 4TLKA 3W39B 1KGUA 1N67A 1CYWA 2H5UA 5AVXB 2VRAA 4IKLA 1AQ8A 5EF3A 4Y19A 4NQDB 4H2CA 4IU2A 1SBSH 4RGNC 1J8HD 1Q1JL 3QG6B 3CDCA 1QAWA 4ZXBD 5F9WC 1BPLB 1RZFH 2UUDK 5F88B 5AW8B 1ZHLA 1GH7A 1MREL 4YWGH 4DKEL 1J0ZA 3KPMB 2OMVB 1EPFA 3INUH 1K4DA 1RK0B 3D87B 5FUOH 3BIKB 5IJVB 1U6AL 2NW3B 2VW6A 4OD1H 4QHMA 1ES0B 4A38A 1ZIBA 5E70A 3DHJA 1XAKA 5EZPA 1TZHA 3ZIYA 3FMGL 2JIXD 5IROD 1A6WL 3QYNA 3V55A 1BWMA 3PL6B 1JGLL 4XPHL 5DZOA 1CGXA 5DI8B 3ES6A 4JKPH 4BZYA 4F33B 1JXDA 3JBG7 4JVWA 1MZYA 5FA3A 1OP3K 5I16B 2ZOLA 1SXZA 3SDXE 3KNBB 1ML0A 5JHMA 3WKYA 5KJRH 2WTOA 1WBZB 2AJXL 4TULL 3QQNA 3HPJA 4XNZB 3K80A 1E4HA 3K6SB 4CSPA 4UAHA 1QR1A 3KHQA 3QEQB 4Z3JA 1SM3H 5B1JC 3ZHFA 3ZN6A 4PHZA 4AE1A 2VLLB 3F05A 4UTBH 2Z1KA 3KM1A 5L7XL 1UWXH 2FQEA 4U1NB 3MJ8B 3GSVA 1JPFB 2W07A 2CGRH 1EFXB 5IBTL 3PXLA 3MO1B 2BP8A 1TQWA 5J9PA 1G4MA 3F8UB 1TDQA 3V4PL 1N8ZB 1NFDB 4M7KH 4N3UA 5F7MC 3STBA 2UX6A 3QQ4B 5E1AB 3VTMA 3MXWH 3B37A 1B0GB 3RHWF 2YD3A 3TIDB 1AIFB 4FLSA 4Z95L 4A67A 1YY9D 4LL1A 5FXCH 4N9GA 1E67A 1FVDA 3PABB 1SEBA 4EI5A 5C07A 5E6ID 2YXMA 1KPRB 5KOMC 1JXJA 3RVTC 4NO5B 2HA1A 4QHLB 3ULVF 2OL3B 3KWXA 4G7YH 2C1PB 1KBGH 2QPDB 2BSCA 1PZ5A 2G75B 3E3QC 4M6ML 4UM9B 5MEOB 4MA8L 3HAEG 4JM0A 4DZ8B 4YXLH 4JREB 3HTLX 1XIWB 4UT7L 2BZDA 2VIRA 2X4QA 3GDCA 1AQMA 4OUUB 4PRIE 5JHLA 5HI3D 4AZUA 3EDDA 1EZSA 3B5HA 3M8OH 4FJZA 3W2DL 4I18B 2JNZA 2VSKB 2KLSA 2WZAA 4HFWB 5HGBB 3STZA 4Q58C 4PJCB 3FFOA 4KVNL 5C0AB 1SHMA 5C6WH 2O93L 4APXB 1GHFH 5JQ6L 2OX5B 4FF9A 4GLRH 2B1AL 3OMIB 1DDHB 2R15A 3V4VA 1NDGB 1EA9C 3PWJB 3QDJB 4FQHA 1P5UA 1PFCA 2CRMA 3HMXH 1YAIA 3CSBA 4GEIA 5GS1A 1JFQL 1RZKH 5ICYB 3GRGA 5AVSB 1WAAF 4K3GA 4OF7A 2DLHA 2HX9A 4U33A 4IOIA 2BNUA 5IVZA 4KQ4H 2VISA 5HHPA 1RFDH 4W9IC 3M1BB 1M6UA 1R5IA 4R97B 5C6TH 2RALA 4PD4J 4WAFA 3QFGA 1INDL 2ILLA 3ZR6A 4AMXA 4WGWB 3W9EA 1BWWA 1LD9A 3U30C 1PBYA 4GSDL 1MCPL 5I0ZA 1M7UA 2R56L 3AAZA 2F53E 4XCEA 4NHCL 4O2EB 4MCZA 2H41A 4CSSA 3T0BA 4FZEL 5D2NA 3VWKD 3CZEA 4UT9L 1TQCB 3DGCR 5DWUH 3VXME 4G1EA 3RWJB 3KLHC 4NXSA 3GYRA 2AQ2A 4QD2E 2P8PA 4MD0B 1A4CA 1NGXA 3BZFB 4X5WA 4A7TA 3C6SB 2VXVH 3BQUD 1NSNL 1YPZA 1ZT1B 2XWDA 3GZKA 3M1OA 5FGBC 2R69A 1E5ZA 35C8L 4PLJC 5E94B 3ASWA 4L4TA 3LRSB 4KDTC 1B2WH 3L4TA 6PCYA 4DOHE 3A6CH 4FQQA 1X5MA 1UZ8A 4CVZA 1OARH 1UD8A 3TVMD 1A7OH 2CLVB 2BWDA 1KG0B 2ZKHL 4U7MA 3UGUA 5AVRB 1HXMA 4MJ4A 3QUMB 1I53A 1XF4A 4LLYB 5IFJA 2VDQB 1IAIH 1OT1A 3WD5H 3V6BR 4YDJB 1V3MA 1WQVT 3IPBA 3VXUA 4BQCA 3L5WB 2CJUL 3QC6X 2Q6WA 1VF5C 5GHWH 4BK8A 4BA0A 4PJAE 1UXSB 2RJMA 1TZIB 1YMMA 4P2CG 1B0WA 1GTFA 2EDFA 3FQTB 4PJGA 2WINB 4N5EC 1UH2A 3Q3GA 4MZRA 3ULUD 4EEEA 3FB8B 1YEKL 1GSKA 2CO2A 1CQKA 2DWSA 1RLBA 2PPEA 1NUGA 4GRLA 1TVBA 4LP8A 1YEJL 4XCFH 1UQSB 3AROA 3BDBA 1RZ8B 3CQPA 2B59A 4U1JA 3VFGL 4F7PA 1UT1A 1IC4L 3GNMH 5EFIB 2I07B 1ZE3H 5GSVA 1TFPA 1QG3A 3P0GB 4PLKD 4Y5YA 2VE6B 2ZWZA 3WKPA 1TQBB 2UY6A 5E6SB 5EIIB 2WBJB 2EDJA 4J3OC 4K71C 1FGNL 5DFVD 3MTRA 1V7ML 5I2IB 4LCWA 4CKVX 3TURA 4ADJA 1JNLH 2E8YA 4N6RA 5I19L 3TFBA 2ARJQ 1JHLH 3DHPA 3TJHC 1WHOA 4WSGA 5GS2H 2J1KA 3PREA 2XI9A 4UTAH 1A1OB 1NBYB 4CU6A 2H0JA 3HHSB 1EAPA 4Y16A 2XA8H 4IRZH 2A9MH 3WMSA 2Y1ZA 2Q7YB 3PWNA 2JB6B 2PO6C 3OTTA 3RUGA 2HMID 2OR9L 4DK5A 1QFUL 4G8FB 4F20A 4PJCF 1Q72H 3T8XA 1BHGA 1KWGA 5K1NA 5BQDA 4Z7OB 2Y36L 2B1HL 3N42B 4YDIL 3QO0B 3TWCL 1DANT 2X41A 3OC5A 5C9KA 1MHHA 3FFDA 2YPLD 3FU3A 2LU7A 4MJID 4MZ2A 4JRFA 4WHTB 1R9FA 3FYIB 3NACL 2I9TB 2HTLC 2PYEA 3JZ7A 1N59A 4MJ2A 1A65A 4M1GL 4YQXH 3IKCA 2VN6A 5DJZA 1QFWH 4MA3B 4WO4C 3QORC 4FQXB 1J11A 1JSYA 4RIRB 3EDKA 4NUQA 3U0TA 3X3FL 2IWGA 4GRWH 2BMKB 4X99A 5JORB 1MXGA 5T1MA 3ILQD 1KXTA 4XWGH 3TJPA 4Z6AT 1CE1L 3HNVL 4JANA 4NDMB 1AMYA 1HC1A 4P5TA 1AQDA 3T1FA 3AU1B 4OZHB 1I7ZA 2VDKH 4CDHA 1MWAH 5A7EA 3TF4A 3CLEL 1GXEA 4B97A 4KO9A 1LP9B 3EDFA 3NFPB 3CFNA 4P2QA 1Z9MA 3ML8A 5DD1L 3O41B 1QNZH 5C3IA 1FVEA 1Q94B 2APXA 3VD7A 2W60A 4TUKH 1KB5L 1MRFL 4KXZI 1QI5A 3CN2A 8CGTA 2QDWA 3K74B 5GS0L 3DMMB 2FR4A 2NRDA 4Y4FA 1NAMB 3BPCB 4EE2A 3FU6A 4QWWD 1I75A 3MHZA 3WJLC 2C3WA 1IGYA 5E24E 1GC1C 4PJ8D 1CJYA 2VAJA 2MQCA 2Q76B 5I24A 2WSKA 5H94B 2R8SL 1T03H 3GMLB 1AJ7L 1NBVH 4XO8A 4U6YB 1H0DB 4BZ2L 3VU1A 5IFHH 4QEGA 1E42A 5DD0H 2X1WL 5D5ME 4XPFH 3QH3B 4Q9QL 3ZZQA 4XN8A 2ODHA 4Q9BA 2AHIA 5B38A 3DV4B 4PW9A 5T3XL 4RGNB 5SWZE 2R4SH 3RWGB 3RYMA 3GTNA 1NCUA 4HSCX 1P5VA 3HC0B 4FXKC 1MFEH 3KWTA 4FNUA 5F9WB 3FOLA 3SKNA 4YHZL 1BM3L 3JV4A 3QJRB 4GO9A 4RAVA 1Y6NR 2E86A 1QLEL 2VO8A 2W0FB 3BH9A 4MAYB 4XPTH 2FBOJ 3OKNB 4HH9A 4ODHH 5D1QC 2EP6A 4HWNA 2IBBA 1SHWA 1NFKA 4AYMC 3STLA 3IU4H 5E2TL 3CZKA 1TVHA 5GJSL 3L1OH 1BZQK 1YYLL 4JM4H 3RDTC 1HH6B 4LNRB 1BPVA 4HJUA 1EHLL 3LKOB 1JDAA 3FC8A 5I71C 5H35B 2AVGA 1QBML 2VDNH 3GC3A 2AS5M 5BV7L 2R1WB 2XVLA 3IJEB 2Y7LA 1G84A 5GGSY 1EMTL 1TO4A 3QUYC 3L17A 4YH6A 2GSMB 2XV3A 3D33A 1RZJL 1HL4A 4WW2C 1HYSD 3H9YA 3PHOB 1F1GA 1N5AB 7PCYA 2DKMA 1SVBA 2A73B 4K9EC 3L1GA 3RZCC 5I0VA 3HZYA 1FIGH 3IMVA 5DRWA 3VCLA 4DP4X 3D4YA 1TJIL 3FOMA 2DV6A 5HY9A 4L3CA 1HCVA 3J27A 5CSZA 2YLHA 4Z7OF 1MJ8L 1JF5A 1WWWX 2W0LA 3N42F 4XODA 3B2PA 1MJ7H 3HEIB 3EJJX 3WJMB 3KR3L 3TEWA 1UJ3C 5KBDA 4LSVH 5TK4A 1QI4A 1GCFA 3TV8A 1RV6X 4JKKA 1T5XB 2PYFA 3LPWA 1AGEB 3JT2A 3SKUD 1NEZB 3WN5C 3N2JA 1K3ZA 1T6BX 4XXWC 3AABA 3Q1EA 1OTSC 1FNGB 1TQTA 2EICA 3ILPB 4OU3A 3GBDA 3MRFA 4IRSC 3IMRA 3B9KD 4L5FL 1M7DA 3KPQA 3S8FB 2C4FU 3BPLC 1DN0A 5FX3A 5CCHE 4EKXA 3AUVA 4NFBA 3KL5A 3NJKA 1MI5B 4DEWA 2BNQB 4UQCA 1A3LH 2DPKA 1TNNA 4OZHF 5B1BB 1YECH 2YUZA 4ZK8A 3WEXB 3OF6A 4OCXL 3S5YA 5IW6B 4WO0A 5J12C 3CFIC 3JVGC 2YAOA 1LP9F 4PWGA 4JDTH 4KHTL 3UTTB 1ZT7B 3NH7L 1ZLWH 1NBZA 2X2JA 5SWSD 3RWEB 5D8JH 1FNLA 3WKNA 5C0BA 5IG7A 1MY7A 2CO4A 2RBLA 4ZFFA 5HGDB 1N68A 3ZTJG 3ZYZA 2Q5BA 4HUXB 2R0ZH 4YE4H 1Q9WA 5EC1A 1T4KB 1WFIA 2X4NA 3GSUA 2R2EA 1X7QB 4OUOA 1KEGH 1L9RA 4IBTA 3QRGL 4X5PA 3DIFA 1JPEA 3PF2A 3ZKNC 1GZQB 5IJBC 1EIBA 2R2BA 2EH7H 1P4BL 5SX5H 3TBBA 5BS0D 5IQOA 1QP1A 2EDBA 5KVGL 1AZZC 1MVFA 4PJIB 2EDMA 3TBWA 4R0LA 2BSSB 3BAIA 4TUOB 1SHSA 4Q7DA 5JDSA 1ZSDA 4XP6H 4BFFA 3TH4T 4J6RL 4FQ1L 4OAWB 1AHWA 1WEJH 4IIQC 3QIUA 9PCYA 1U92A 4YHPB 3DI2B 5HXMA 3L3JA 5BRZD 1I8IA 5DXWA 5AVVB 3JV6A 1RXLA 2ESVA 3O3DB 3QEUB 4U1GC 2WAQA 1OW0C 1MFDL 3LN4A 3HUJE 4OLXL 2TAAA 1S2EA 4G8GD 4YUEH 3GSQB 1PAMA 5DZPA 5KYWA 3OD3A 4A2EA 4Z3HA 5HGHB 2IQAB 4W9KC 4P46C 1GMEA 25C8L 3N1MC 4OLEA 1G7QB 1VZHA 2WW8A 2FNBA 4RDBA 3GSNL 3QIBA 1LO4L 2YRZA 3SO3C 4BKSC 3G6JE 1HKLH 2F54B 4JVPA 4KROC 4GG6B 3MRHA 3BP6A 3CNKA 3COOA 5KN5A 1HESA 2CO6A 3OLGA 1DQDL 4R4FH 3X11A 4AIZA 2WQWA 3ZE1B 4AQ8C 1CLYH 1FZOA 1KTLA 3VFMA 1WCBB 5CMAB 4GY4A 5FYKL 4GBXA 5CZVH 3HG0A 4NAJA 3DV6A 1BZ7B 3QDAA 4HJIA 4HWZA 4RGOL 5CO1A 5D7EA 4KVCL 4WUUB 5KVFH 2ETWA 3REWA 2FDBP 4NUMA 2NW2B 5LCVA 3FW6A 4DN3L 4AZ8B 4WENB 2XJKA 2N7SA 4FEMA 4PGBB 2UXVA 5F8RC 1GRWA 3HE6C 1FNFA 3LPFA 1P4UA 2X89D 3VFTA 1PNCA 1AGBA 5IHZA 4ZFOA 2PNDA 4OJAA 1TEGA 4FG4A 3WFDL 3B8YA 3GMRB 3O8XC 3ZJAA 1C12B 1TZOA 3WNNA 1HWWA 3JTSA 3V8OA 2KL6A 2HWZH 1N26A 5KVEL 3G5XB 5C0CD 4FMFA 4OQTA 3VWJD 5JUEL 3VJ6A 1C5BL 1Q0XH 4OJFL 3FU0A 5L0QC 4GLRI 3SCMA 5LGJA 2VR7A 4B0MB 3V6OA 4MXQD 4KZDL 4NZJA 3GMQA 3BP7B 4K71B 3SOTA 2CNYA 5CJXA 5J1SC 4U6XB 1V3JA 4Y9CA 2FIKB 4YHKL 4EDWH 2VN4A 4HAKA 5I1IH 2WNGA 1NMCB 4FTVB 4NIYE 1IEHA 4DWHA 4CADA 1B4JH 3GIZL 3S36H 3W0WB 4NN6C 1FL3A 3EO1A 4PGEA 4YPGA 2CJ3A 5JW5B 4N0RA 4NQCB 2ZAIA 4JCWA 3VXOB 3VRIA 1Z9SB 2PO6B 2B4CH 1I7UB 4Z23A 2XVGA 2VLME 1N19A 2ARJB 2JKJA 3R06A 5JIQA 3VFNA 3WELA 1RP8A 2VC2B 1XDTT 4HKXA 3IPFA 2J88H 4KO7A 4PVLA 1MNNA 3AQXA 4NC0B 3WL9A 4W9EC 1DQLH 5IB3A 4NCDA 1MVUB 1U3YA 4MQXD 3BE1L 2NSXA 4AYDC 3HW7A 3JYCA 3VO0A 2HAZA 3A22A 4ANKA 1ZT4B 3ARZA 2LR4A 2NXYD 3PV7A 3MROB 5DRZA 1MJUL 2NY4C 5C0EB 1CWVA 1YNLH 4NKMA 2BS9A 4WO4B 3LX9A 4C4KT 3LXBA 1WTGT 4PJIF 2CU9A 1N3NB 2FO8A 3E6HB 1A0QL 5JOFB 4KRPD 3N06B 1FG9C 1I7TA 3VMOA 5DHVB 5DSCA 5LQBL 1N4XH 1A66A 2VJXA 4TN9A 3CFCL 2DF3A 3NESA 4UQAA 1BOGA 1K8IB 1IAII 3OKEB 1EFXD 1OCRB 2F7OA 5CSGA 3KPOB 3WFBH 1NUDA 3LEYH 3SYPA 4GW5B 4UIMA 1H19A 1MQKH 3L4VA 5DQJB 1MHCA 5E7FA 3QWNA 5DEJA 7FABL 3T09A 3V95A 3PGFH 3IKKA 5DZVA 2A6JA 1BBJA 3KCPB 3GSXB 4GG6F 3GMOA 2X3BA 3B1TA 4BWUA 1HILA 5IVXE 4KZ0A 1CDUA 1R19A 1F00I 3WLBB 1K6QH 3WDIA 3ZE1F 4JQIL 4JFEB 3VTAA 2MRYA 3ETSA 5DR5L 1F41A 4P5SA 3B2UC 3B7UX 5D7IE 4PJHA 3QDGA 2WKOA 2R29H 4X7SH 5L2JA 5I66B 5J4MA 3BAYA 4JKWA 2OQJA 4PTTB 5C08D 1NKGA 4LVHC 3VM5A 2VITA 5LG6A 4I1PA 4FXKB 3DIVA 2YQBA 3ZMRA 1XIWD 2XZQH 1OHQA 4RQQB 3TEZA 1OWRM 3FN3A 3H9SD 2WLLA 4ZUSA 1XCWA 5D1QB 1NAKL 1UATA 2R2HA 3GLDA 4NOFA 2V17L 4PTUB 1IBDA 2Q86A 1FJ1A 4HKJB 4JO8A 5C0AD 1U8CB 3WAKA 2OTUB 1YEHL 2ZKYA 5E00A 4DH2A 3TNMB 1IEAA 5C70A 3IDNA 3UMTA 4U1HB 3MYJB 5BRPA 3RDTB 2CIKB 4LLMB 4N2FA 2O5YH 4CGUB 4IK7A 4HD5A 3SDCA 5I1KL 5I71B 4KJYA 5E6UB 1U4FA 2YJLA 2NTSP 5MENE 1IJ9A 5B3JE 4FQLH 4JHZA 4M48L 4XNMA 4J3OF 1HI6B 4YBLC 4G80B 1J7VR 1QLFB 1YMHB 3L9RA 3QUYB 1R3KB 5EUOB 3V8CA 4WI0B 1SDYA 3A4FA 4WW2B 1L9MA 2J43A 1QFWI 4MS8D 3ABZA 3FQNB 4PJ7F 3SGKC 1NIFA 1ZPUA 1GTNA 4K7PX 3RZCB 2LAGB 4Y1TA 2H3NB 4F2EA 2XTSA 4ERSH 3OZKA 4PUBH 4WKZA 3MNWB 5HYEA 3GMPA 4Y9FA 4X4KA 4BSWB 3I6KB 2WBWB 1JCKA 4CW1B 3BO8A 2H0PA 3MX0B 1HOCB 4U05A 3F5WB 3AXLB 4QHUA 3T4AA 3TWYA 2ENPA 3MV9E 3X12A 5KBPA 1J9SA 1FL6B 5MP6H 3P11L 1LO3H 2IVFC 3SOBH 2XKNB 1UJ3B 4J8QA 4PB0H 5I28A 1IFHL 1KJ3H 2RFXA 3C8HA 3TJEH 4AQAA 5D7JC 1NANI 3V6FB 4R7LA 2Q8AH 3LSOA 1SJMA 2DM3A 3KMDA 2G2NA 3CH1B 2XLLA 2YFNA 3WFZA 2FHCA 3WN5B 2PW2A 5DJDA 1V10A 2FJFA 2ZX7A 3UZEC 4BK5C 2PXYA 2J7LA 5DUML 4ZS6D 5ANMB 2BW5A 4OZIB 4IRSB 1FN4B 5E1QA 1IGIH 2D0HA 1IAMA 1KTCA 3BPLB 2JK5B 4MB3A 3GWJA 4NPYA 3O0RH 1VAHA 2P45B 3Q1SH 1MUJB 4JFDE 3RTQA 3FUHA 5LXGH 3NRQA 4NQUA 2X0WA 2LVCA 2WCGA 4R3SB 4FG6D 1R3JB 5ESQA 3J8F7 4UTBA 5J12B 4JGJA 4XNYH 5J1TC 1S8DA 1RZPA 2OP4L 2B5IC 2XFGB 4FABH 2J2ZB 1REIA 3L48A 4LHUD 1WP6A 2IJ0C 5GSRB 1W16A 2XWJB 5B1AB 1IIIA 2HPTA 2BERA 1Z0MA 5HYSG 4J27A 2PN5A 1G9EA 5C3LD 4P4RB 3VXTA 5FB8B 2A74C 4L8BB 4PBWD 3UDWC 3GKWH 3VDAA 1FL5A 4XN7A 2H2SD 3N1GC 4OIFA 4OGYL 4TV3A 2O61A 1IC7L 4ZPTB 4AC4A 1SLVA 1NGPL 4NYLA 3ZGPA 3V5KA 2DWEB 1WUNT 1D5XB 2DIAA 1LO5A 3IJHA 1NIEA 3QJXA 3ISWA 2C9UA 4QXUH 5I8KL 43C9B 4ESKA 4N8VB 2LLNA 2HLAB 5TGBA 4F7EB 5EN3A 3ARPA 4GUPB 1RPKA 3LRKA 2F8IA 5E5MA 5I0XA 3G08A 4HKZA 4JJOA 3HRZA 1IAKA 4IIQB 3UIYA 1WC7A 3GBEA 2HCZX 2ICWA 2F7QA 3NYKA 4G5ZL 5EULV 3IDXL 1INQA 1D6VL 4HJ0D 4HG4J 4U1GB 4ODXB 3BH8B 1BD2A 5DEGB 4Z0BL 3RWIB 3N5AA 4A1KA 2VXTH 4FQPA 1NC2A 3I50H 1JXKA 4KZEH 5JIHA 2FSEA 4BQ8A 4E9XA 3G04B 1UWYA 3BESR 3NAAH 1MCBA 1I8KB 4WTZA 4X4YB 4XN4A 2OYMA 3FUEA 1G7HA 1HZKA 3F7RA 3VXQB 1F02I 1HHGB 4P46B 4ZZKA 2X9ZA 2HFFA 3CDFA 4I1RA 2Z8RA 3SO3B 1GKOA 3FT3A 3U48A 1WZ1H 2P43B 4KROB 2J6EH 4PRHB 4GPVA 3HMXA 3IETB 3KPSA 4B9KC 2Y6SC 1AR2A 2IAMA 4PRBB 4NUGL 4H25B 3CLFH 4NZUH 4QAWA 5EUOF 3UAJA 2AQPA 3OR7B 4HEMA 1RIVH 3EO0B 1FO0L 4FQXD 3WNPA 4M7LT 1E9PB 3WE6A 1R3HB 1UD3A 3TYFB 1G6VK 1NWPA 1B4RA 3BAKA 3UJIL 2MH4A 3ESVF 1FSKB 1Z9OA 3GUTB 4OV5B 3UG4A 2MOGA 3BCFA 2ITDA 2HT3C 2YSSA 4XVTH 3ERXA 5HJ3A 4NEHB 3WGVB 1X4XA 1F13A 1QUPA 2ITCA 3CQQA 3LZOA 5DLLA 5DHEA 3VI4B 3HE6B 2AXJA 4UT6L 5I1EL 2Z35A 1E50A 2F5BH 2NT1A 3PU7A 3F65A 3JTTB 5F7KC 2AJYL 2G2RB 4M8RA 3NCYP 4NERA 3O8XB 4EI6A 3P4LA 3VXSB 4L18A 4LBEB 3LZNA 5BJTB 4DPAX 2VMJA 4GQ9L 5JPNA 1T3FB 3DMMD 3HG1A 4UDUB 3ZE2B 5JLZA 3C2AL 5FUZL 5AALA 1IUZA 1ZWIB 3L3KA 5IB2A 1M7IA 5KANI 4AV0A 4IGBA 3ARYA 2AFNA 1EEUA 4ABVA 5L0QB 4FFYL 4QR7A 3MUUA 5EZJB 4IHOA 1RSFA 1HHHA 2JKSA 4W9CC 5CP7A 1NIAA 4OZIF 2V5TA 5CCJA 3BLPX 5IBUB 2FH8A 2P48B 4E41E 3LS4H 1K4CB 5F7EH 3WXWL 2QL1A 1PX8A 2AAVA 1M1SA 4L1LA 4J23A 3BDXA 3TV3H 4HCRL 3Q5OA 4F7MB 3NCEB 1JJUA 1P69B 3QULB 4JLRA 4JFYA 4DNLA 1F4YL 3A4AA 4BGLA 4NN6B 2BSTB 3S34L 5SX5K 3SKMA 3WKML 2EE9A 3RFZC 3LIUA 4HIJA 4Q0XH 2VLRA 4GMSH 1NGWA 2WN3A 2ZYRA 3PAUA 4CMHC 3BX7C 2JLLA 3UPCA 3VI3B 1MIMH 3ZDYF 1CR9L 5CU9A 1NCNA 3H2PA 4NIKB 2IANB 4WDIB 3EOAB 3PWVA 4M62H 3VFSA 4X9IA 3X17A 3NN8A 1O9WA 3IDMB 4AIEA 1OANA 4KTDL 1DQML 3LZQA 5DQ9B 4S0HA 3UZQA 3WSQH 2NY4B 5DK0A 4BM7A 3ULVH 5HHNB 2NMSA 5L6YH 2DD8H 1MDTA 1KT2B 4QJ3B 2DM4A 5AW4B 3TBTB 1AE6H 5FHBH 1W0WA 5IUSA 2ICES 4LPWA 1H15B 1H3XA 3I3BA 4BXSV 1J5HA 1XB8A 1LGVA 1LEKB 3NCMA 1QPPA 3EKCA 4DFHA 1J05B 3TCLA 2C5DC 3KVDD 5HVHC 1F2XK 4G43A