5DZJA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase 2 with carbapenem drug t206 in conformation a
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
351
structure length
351
Chain Sequence
LLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Non-classical transpeptidases yield insight into new antibacterials.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transferase
total genus 91
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5dzjA03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dzjA02
5DCCA 5D7HA 3U1QA 4Z7AA 4A1JA 5LBGA 3ZQDA 4JMXA 4QRBA 4QR7A 3ZGPA 1Y7MA 4QTFA 5E51A 4LZHA 5DZJA 4A1KA 4A52A 5E1IA 4GSRA 5DC2A 3ZG4A 5E1GA 3VYOA 4HUCA 4GSQA 4LPQA 2MTZA 4XVOA 5DUJA 5DZPA 2HKLA 1ZATA 3TX4A 3VYNA 3TURA 3U1PA 4A1IA 4QRAA 3VYPA 5DU7A 4K73A 4GSUA 5E5LA 4ZFQA 5LB1A 5DVPA 4JMNA 5K69A 4HU2A 3VAEA
chains in the Genus database with same CATH superfamily
2NT0A 1A6VL 1TPXC 3S96A 5C07E 4E41D 3CBKB 1G7HB 4OZGB 2HFGH 1P2CB 1YN7B 1ILSA 1BSIA 4WTXA 5D7SH 1MF2L 5A1AA 1TYEB 2VLJD 4WUUD 1IM3B 2VT0A 4UI2A 4ODXB 3JWNH 3CQQA 3KWVA 3BH9A 4XNMA 3QDMD 1UQSA 5GGSY 2A5UA 5SX5H 2XWTB 5IB5A 1CTOA 1WA1X 3W81A 4LVOC 4X4KA 1QLFB 4QT5A 3AUWB 3B43A 4OCYL 1OB1B 2YFNA 4DP4X 2PCFA 3IGUA 3MV7E 3R1GH 2IWKA 1CLVA 3K4ZA 1QMUA 2MOGA 4YBQD 4J8RA 4F58H 4G8GB 4JO4L 2ZUUA 1NCJA 4DGYL 1RLBA 2A9NH 1W6WA 3RPIA 1KJMB 5HI3C 2IADB 2VN4A 1A7RL 1NCHA 4AKPA 5CBAB 3H9HB 4P4KA 1MFUA 1YY9C 1GL4B 3IWVA 1EFXA 1PJ9A 3CFIC 4X9HA 4NX0A 4M7JL 4OJFH 4JCLA 4JGMA 5DD3L 3U36B 1BVZA 4AYGA 3DHMA 5EORH 1IGML 1SHWA 4OGAD 5DDHA 4EUPH 1JHLL 1S5HA 3ARGC 3H3BC 2QEJA 4PGEA 2DWEA 1UFGA 3ARTA 1V3KA 4XXWA 3WTXA 1MEXH 2W80C 4Z7WE 4ZJ9A 2JJVA 4GAYA 3MLZL 4XVTH 1GMEA 3N1FC 5T5FA 3J7HA 3LKOB 1N8ZB 1B0WA 5DS8A 4X4MA 3CFKA 1MLBB 2W1NA 3DX8A 3TBWA 1Q38A 4QKXB 5TF1H 1IQWL 1UJTA 3FK3A 2CCLA 5IG7A 3F00A 3EZ8A 3A4EA 4KVNL 3ZMRA 2DRUA 4Z3JA 3Q06A 3HB3C 3LS5H 3NJGA 5T33H 3VFNB 1YEFH 1RZQA 1EO7A 2NW3A 2DQIL 3K6SA 2G9HB 1P7KA 2CRMA 1PG7H 2LTQC 4AUJA 2B16A 4V11A 2YHGA 4OFYD 3RRQA 1WD8A 3TT3H 1M6OB 2GKIA 4JM4H 4FFYA 2B1AL 3ARFD 4WQOA 3OZLA 2I7SA 4OCWL 4QMEA 2FUTA 1HXKA 4FNRA 1XZ0B 3MRKA 1NA8A 4FTVA 3VGFA 1HCZA 3FO1A 4HKBA 4G9FB 1RH8A 4Y1AD 5C0CD 4ANKA 1NDTA 2VDRH 3MV9B 1XB8A 4EOWL 3I6GA 4M62H 4MJ5A 4EDWH 3GSRB 3B5HA 2O5XH 4P2RE 2YAFA 4J7RA 3QZLA 1PZ2A 3PGCA 4LLYA 5E9DA 4NRXB 3OR7A 4JO1H 5LAPA 2X1PA 3AS1A 5HDLA 2FT6A 1D9KB 1CVRA 3UO1H 4PW4A 1U93A 2ADFL 1DBBH 4P4KC 4XPAL 2NXZB 1ZSHA 2F7PA 3HUJE 3JWOH 3W0WA 3BH8B 3BVVA 1FFPA 1TF4A 1SMOA 1RHHA 3CUPA 4AL8L 3KS0J 1NGWA 1U8LB 1ZT7A 4OV5A 4F92B 1IBYA 5INDB 1DBKL 1B0RB 2CBQA 3D18A 3RVTD 1K85A 4XXWC 1L4IA 5IEHB 4L8CB 3L3GB 2JJUA 3BGFC 3LEYH 3NACH 1X6LA 4G7SB 4YSDA 5TDOA 1E42A 4FXLA 1WFTA 5FYLE 1NSNH 2VDQL 1X7QA 3IETB 4IRJD 2NLJB 4PTUB 4MMXA 2IH1A 1TVBB 5KJRH 2FATL 1PNCA 3ZQ9A 4BK4A 4GRLD 2AKRB 3ZE2F 4GKSB 4NPYB 1FLRH 4H25A 4A2EA 3IE4A 1CWVA 4K4KA 4DQOH 4DUWA 2EDYA 5K9JL 1AMYA 4OKDA 4PCSA 1DJIA 1MFDH 3IDYC 4HJIA 4BH7B 1HYSD 1A1MA 4FLQA 3I75A 4FNUA 4J3SA 3SGDI 1ET5A 5AYQA 1PIGA 5EF2A 4Z5RA 2CXGA 1RUAL 3HNVL 1H3UA 4EPSA 4FQ1H 5I8EB 4MX7B 4HDIB 4MZ2A 3LQAC 2QPUA 1DSYA 2WNGA 3Q0HA 3UMTA 1G43A 4NZTH 3BJLA 1SJHB 2ILLA 3JVGA 3WIFA 1E4XH 5MEPA 5EU3B 3BUYA 1II4E 2NR6D 4I2XA 4R3SA 4S0HA 4ZD3L 1Z5LA 3GD1C 5E99L 4XB3A 5CMAB 4XMKH 3T3PF 1HX0A 3S88L 1B88A 4UQAA 1R4XA 3OKLA 5CCGE 1FFOA 2PR9A 3GXFA 2RD0A 3L4ZA 4UM8A 3UGXA 3UTTA 1UEMA 4HCFA 4J2XA 1ZHKB 4WDIB 4XOCA 1SRDA 1UACH 1AAJA 1YMMA 4DTGH 2LLNA 1XH0A 2XHNA 1UM6H 3APMA 3QYCA 1YEHH 5T1MA 8PAZA 4ESKA 2R2EB 5F7YC 4PRIB 2Z92A 3P0YH 2IFFH 1VGKA 4PY7B 2FAUA 3ZL2A 1A4KA 3ARDA 3MRJA 1MHHB 4XCYB 3V0IA 2AEIT 4ZZFA 2J43A 4A7GA 2H41A 1CGSH 4PW3A 2ISDA 4MMXC 3KWWA 4N8CH 1MH5B 4WWID 2NQDA 1N59B 2EDKA 3D6GA 5EN2B 2JCCA 2AJUH 1CFTA 4X9YA 1ZA6A 3PHQA 4LCYB 3FCSA 1PZ5B 4M6OL 5GS2D 2VJXA 3WFCL 2B39A 3P2BA 2X87A 1PZDA 4YHZL 3G6AB 4OGXL 3CD4A 5FK9B 4HUWA 5DEFB 2F08A 1EFQA 3T4AB 2XZQH 1U3NA 1FP5A 4KO6A 3Q13A 1I7RB 3V79C 4YK4B 1QAWA 2BSRB 4LLUA 2N0KA 5G4OA 2Q86A 2D2OA 3AM8A 3FTWA 4P5TB 3SHSA 1Y0LB 2F8XC 3JVGC 3QRLA 1BFOA 4H7VA 4J1UA 2OMBA 1JPSL 1WZAA 1T7YA 4NN7B 3VWJD 4QRRB 3ZTDC 1FZMB 3TV8A 3CU7A 5B38G 4P5MB 3TBSB 3VFOB 5JPNA 5LNDA 3CFEA 4LCWD 2EDWA 2F2HA 2WMPB 3QK0A 3SY0B 1FNAA 3ULVF 4J6RH 3QIWA 5KVEH 2P1YA 2VDPB 3TM6A 3KPOB 5HJ3A 3FQRB 3RY6A 4FHKA 4DNLA 3D4CA 5EWIL 3ETBJ 3VGGA 1L0PA 3DHUA 2ZKMX 3EADA 3OGCA 5E7FA 1EIBA 2WTRA 4J6IA 4JHZA 4PVLA 3VXTA 2VNCA 4BZYA 4P2AA 2BC4B 1R17A 5CM1A 3KYMA 3ARDC 2NOYA 4NQEA 3ZE0B 4FTVE 4G7YL 1NEPA 1J9TA 4XP9L 2X4OA 1BCIA 2I60L 4YDZA 2CR3A 3IJEA 2AZUA 2YSSB 3N44F 5GGRB 4BCZA 3EO9L 4X6DF 2CRZA 5I2IB 1WE5A 3MRLB 5CIPA 1PDKB 5JOFB 3D2UA 2BP0A 1KYOK 4GW4B 3MBWA 3GK8H 2CDGA 4HV8A 4LPXA 1X5JA 1F4YL 2V5TA 1CI3M 2I07A 2RB8A 4MMZA 2FSDA 4PRPA 2NY0B 2OMVA 3QAQA 4BM7A 3VJ6A 5I5MA 2A77H 3HI1A 2HRHA 3TS8A 1LD9B 3W0WE 2GJ6D 1E4XI 1ZSDB 4TNWF 4ODUA 2BNRB 5HGHA 1A2YB 3QR2A 4AENB 3MXVL 1IAKB 3AM8C 1UD3A 3N2JA 2JV6A 1IU1A 2Z8VC 3ARBA 1FAIL 1NGZA 3BWSA 3LIZA 3IJ8A 5C08B 3H9YA 1Q9OB 3RTQA 3V7AG 1MNUL 2WKOF 4X6CA 1OAYL 1YPZF 3Q1SH 2QVKA 3QUYB 3HN3A 1UXSA 1UB5A 4JO4H 2GUYA 4M9PA 4MRBA 5CJOH 5JPNC 1P0SE 4PGBB 4N3TA 4DGYH 5IQLA 3F62A 4XP4H 3D08A 4X7TA 4R5TA 1P4LB 2YLKA 4GJTB 4KY1L 4XNZC 3QIWC 1M71A 4X7SH 4KRPD 4FJZA 1VF5C 5I74B 1A7RH 4URKA 4LSUH 3RY6C 3RWFB 2XWBA 3WFZA 1WFJA 5E4EC 4OLVL 4KKZA 2FJSA 2CALA 1IE4A 4UQ2A 2H2PD 4I0CC 5C97A 2IWFA 3QEQB 4L1LA 4JO2H 4Q89A 2P43B 1QBBA 4PW9A 5KG9B 5CSZB 5CEXB 3RWGA 5JHDB 5F6HI 3NJIA 1U42A 5DZAA 5DGQA 3SY6A 1LVEA 1RUQL 4OZFA 1MFCL 5I76A 4LFHD 1S7SB 3DRQA 4MMZC 5CHNB 3WNLA 4DF9A 4U1SA 1ZGLP 3TYFB 1CDBA 4NSKB 3SDAA 2HSIA 3FFCA 3UTTE 5DJCB 4WFGE 5LHDA 4HC1H 3KPNB 2XIIA 2QLVB 3DTUB 3CNKA 1KCKA 1KB5A 1YMME 5AKSA 3KG5A 2BP8B 2XPGB 1F42A 4JANA 4PU2A 3BKCH 3FHEA 1RZKC 3BD4A 3EUUA 2WSDA 3ARBC 3BP4B 3VG9C 1IGIL 4KY2A 3KGRA 4MA8L 4HK0A 3CN3A 5DWUL 3TOPA 3FB7B 4KH2A 1KG0B 2EKJA 4GBXD 3RTQC 3QISA 1XF3A 5JHLL 5JPMA 4Z7VE 4GO6B 4QTHB 5GGVL 1TNNA 3RVXD 4WEUD 5JW5B 4Q6IB 2F19H 1T6WA 5F6HJ 2WXMA 2QR0A 5EU4A 4AWJC 5MEND 1DQJA 2OJZL 1G1KA 3O4LA 1IGFH 2JCCE 3BN3B 4NQXA 4M00A 3QI9B 3SCMB 5CEZH 2WTOA 2OW7A 3TIDB 3QC6X 3O0RH 2GUOB 2H32H 5E8OA 1CE6A 2IO5A 3W9EB 5D2NA 3HR6A 1F4AA 3WCYA 1MKFA 3UMNA 1QTSA 1M42A 4LDCA 5FCUH 4IKLA 5TDPA 3LZFL 3MJ7A 2EIBA 3MLYH 4H0HB 2HTKC 3ZGHA 5GS0D 5HJBA 4NWUL 3BKYH 1R1CA 4TQHA 1L6ZA 4KOBA 4DGIL 3MREB 3VXPA 4RWYL 4R96A 1MIEH 3G5XA 4LLDB 4OB5H 4KWUA 5GRJL 1E40A 1WRFA 4C56B 3SDAC 3ABLB 4LK4A 2DM4A 4RETB 4MA3B 4PRNB 2R39A 5K9JH 5ACMA 5I1AB 1KNOA 1MAML 2OP4L 4RFNC 3BZFA 5H4ZA 2QMJA 3WU1A 4TTDC 5F2FA 3MJ6A 2Y7NA 4B9JA 5J11C 1RFDL 5HYSG 3DGCR 2XRAL 3NP3A 4K3DH 4EZJA 2UY6B 2VWEC 5AOMA 4DZBB 1U92B 4NQEE 4Q9BA 1E3XA 4BSJA 3LB6D 1S78C 5C0EA 5JPMC 1OGAE 3BVDB 1INDL 1HL8A 3UYRL 4ZW3A 1NCDL 4R90H 5DA4A 3STZA 3EJYD 5CN2A 4J3TA 1ZT1A 4MXQC 3TEUA 2J12B 5AW4B 2WLLB 1RIUH 5L7XL 5IBTL 2OJ1A 1HINL 1ESOA 1DL7L 1HE8A 4PRPE 2BS71 3D4YA 4TSCL 1CLCA 4MD0B 5H37G 3RGVA 2RMNA 4FERA 5KVGE 1OAKL 5D2NC 4KXAA 4OCNC 2Y24A 3P4MB 4PJDF 3BVTA 3GLAA 3WUZA 3X2QB 4OF5A 4KVPA 4KAQH 4UAHA 5E94B 4HOXA 5ID0B 5FGBA 3V0VA 5BUGA 3DGDA 4ADGA 3ARZA 1V10A 2H7WA 1QWUA 3QNYB 4J3WA 4LHUA 5D71L 3TC9A 1P1ZA 5HYSB 3DHPA 3TWYA 2CLZB 5FKPB 3W38A 2XQYG 3MLRH 4Q52A 4X6CE 2NY4B 3ZRCC 3ASNB 1TFHA 2J8UA 4N2LA 5FHAH 1ETZB 2G30A 4K9EL 5IOKA 3MO1B 3F6JA 5T1KD 5IJCC 3VXNA 3HC4L 3QUMB 1JZEA 4J3OD 4ZFZB 1KTBA 4X98A 3Q05A 5IOPA 4XMLH 1AXSA 3CXDL 4MJIB 4LNVA 2CK2A 5D5MF 2JLPA 1PFOA 2ZCLL 3LPGA 5LBSA 1DQML 1TEYA 1LEIA 5DHVB 5AW3B 2MNUA 3BFOA 1MPAL 3BIAX 5ICXA 3ZVVA 1AR2A 3TA3B 1IGTB 2LFEA 3ZK0A 3S98A 1G0YR 3KPTA 4HSQA 4TTGA 5TK4A 4LSTH 5I15L 2FQEA 2EVIA 3OAZK 1W6LA 1ZVSA 4FKEA 4TMPA 5FWRA 5JYLA 3GKZA 3L5WA 1E65A 3POCA 1F58L 4RESB 4CDGC 3MRDA 5EF1A 1OARH 1KFAH 1OAQL 4JPVL 1XEDA 5DI8B 2Y36H 3UFIA 1KCVH 3F5WA 4FDWA 2VDPH 3RKDC 2AGJH 3UYPB 3ZU8A 5AB1A 3FFCE 3RGVC 2NX5B 4WGVB 3GHEL 4QXUH 1P53A 2ICEA 3H9SE 4JFPA 4BELD 4OFKA 5GSVA 5LXGL 4EI6B 4GXUN 1FORH 1N64H 2QVMA 5EWIH 2IANA 3RTLA 5FGBC 3UJJL 2CZNA 3PWPA 3PJLA 2A9DA 4BFGA 3CFDB 2AANA 5C3TA 4MAYD 1F45A 3RBGA 4XC1L 2VWEE 1E2WA 3LSOA 1IFHL 4NXKA 2L7JA 4JO5A 5GJTL 4UM9B 1AXTH 1V54B 2D7TH 1HHIB 2PXYA 2VM4A 4A2MA 5F3BB 1Y18B 2NZ9D 5G55A 1AGBA 4Y19E 1URLA 3VYNA 5LBVA 3WIHA 5E5RB 1RSYA 4LOFA 2HUHA 3O4LE 4N8VA 4K94C 5T5NF 1H9DA 5KYNA 1RI8A 4BQCA 1G9MC 1BJ1H 4PGDA 4QOKD 3L2LA 3CK0H 4NUMA 3GRWL 5D2NE 5CAYB 3HJEA 4F15C 2J2ZB 4UNUA 3REVB 1MREH 3CLFL 3QNZB 5TE4L 2I85A 2EIZA 3DJRA 1SJEA 4JGJA 1MUJA 1YDPB 2MWCA 2BVUA 5AOKA 1FC1A 5C07D 2NY5L 3SDCD 3ELAT 2CHDA 2UZPA 3NJKA 1ACYH 1OAYH 1BZ9B 4F57L 2YMOA 1AI1H 1F41A 2EZ0D 2PMZA 1EJOL 3N40P 4ODBD 3H1ZA 4UINH 5EUOF 4ZPTB 3W1ZA 4ANWA 2XZZA 3QHZL 3SEPA 3ULSB 2ICEC 4OTXL 5DMKA 3OX8A 3ZT5A 2K7PA 2EYRA 3KXFB 2F5BH 3OBAA 2RIKA 2IBGA 4XI5C 5I1CH 1RUML 2IPTL 2YARA 3MV7D 4LDOB 1LP9A 1BIIA 3KYAA 4MJ2A 2ZPKH 3G08B 3UBXG 2O61A 4PP2B 1CICB 3HZKB 1TSHA 4G8FA 2Z8SA 2APVA 2UVFA 2PXYC 4LSPH 3RGHA 3DO4A 4NS0A 3V5DB 1F1GA 2N56A 3QIUB 4TVUA 2ZXDA 3IVKA 2FDBP 5I8KH 2Y06H 1ZKAA 4WI0A 1NCGA 4IMKA 3FW6A 3DIFA 3GMPA 2MTPA 5TDNB 1GJWA 4FG2A 1AXIB 3HAEA 3WJLA 2W9LA 2VW4A 2XA3A 2OL3A 4Z95L 4RQQB 4OZHA 4YGVB 1E2VA 3V4VA 3Q6FB 1R47A 2P49B 4K8RD 1AYOA 3GBMH 1PMYA 4U1HA 5EU5A 1JV5B 4K55A 2WXPA 3TH4T 2V4LA 2NY6B 2WCGA 4Y5VA 4G8IB 4PJ7B 4L2YA 5DUML 2DMHA 3L7EB 4I7ZC 3QWOB 5AQ0A 2EUZA 4H0LC 1T21A 1CGXA 3BX7C 4OD3L 4YSPA 2J8UE 3KVQA 1DLFH 2Z7YA 4W1TA 4F7MB 3CC5B 2IOIA 2DB8A 4LARL 5ISZA 1FH2A 2A6JB 3VFWB 4RDQF 3LPFA 1DJXA 2V33A 1IM9D 1AVAA 5JUEL 2J73A 3FOMA 3O8XD 2QSTA 4PG9B 3QEUA 2CRIA 4JFDA 4WI8A 2H0JA 3NUKA 1NC4B 3TJHC 1K5NB 5CGTA 4F2MB 4GW5B 3DO7B 1NEUA 3PJNA 1BZOA 2F68X 5HYEA 3CN4A 4H44C 4GKZA 2DBLL 3B3IA 4N0FA 1OCWL 3CV5A 3D39A 3WBDA 4LB8A 5H2BB 2QADC 2D03H 2NNXA 3K8KA 4P2YA 1IC4L 1FAKT 3S36L 3DRTB 2OMUB 4L9LB 3PHOA 4CADB 4F7PB 4I48A 4O2FB 3RIFK 3DA0A 4HA1A 5DUJA 1TSRA 2VZSA 2YXMA 1NINA 7FABL 4JREB 3MACL 4EDXB 4IMKC 4ZMOA 4HSCX 1B90A 1YLBB 2IDUA 1RK1B 2OTWA 4HZ1A 1T7ZA 1U3HA 3WJLC 3MV8D 4LKXB 5C0BB 3L3JA 3U30B 2HT3C 2C1OA 2ATKB 4P0DA 1YEGL 3KDMA 5I8OH 1FDLH 1UB6B 5L4FA 4DO5A 4XBPA 2H3NB 3U4EA 2IANE 2NSMA 2P5PA 4OCXL 5IHZB 1E5BA 4OJDH 2OTUB 5FYLD 3PWPE 3BKJH 5J1AB 4EUPA 3P1VA 3WAKA 1ERNA 3DYPA 3D69A 4BFOA 1BVNP 2L0DA 3Q8CA 4TQPA 4Y5VC 3OAUL 4FYQA 1NAML 2W0LA 3PDDA 4CC1A 2EH7L 3U2JA 2HVKB 1INDH 3GI8L 3MUHL 3NRPA 5IZ7A 1I8KB 1NAMB 1BOYA 1MI5A 3BP5A 5HI3D 1EVUA 3QDGB 4HIEB 4NO2B 3AROA 2QGBA 1CF1A 3GDBA 1BJ1J 3VRLE 1C8PA 2OMTB 1YY9D 4XTRD 1DBJL 1TVHB 4NKDA 1Z7JA 1T1XA 1A14H 4QXVA 2CQVA 3O3BB 4TSCH 1TJHH 1G9NH 1NH6A 4LGRB 4CN6A 2EC9T 4FEIA 5JQIB 3ARGD 1KPVB 3VQLA 3D1MC 3CXFA 3B2UC 4MNGA 2FT7A 4L3EA 1EAJA 3S5ZA 4AQEB 3NABL 1W15A 1MCPL 4JCWA 4CNIA 2GIMA 3LKSB 3CX5J 2ZXEB 4P9ML 3X13A 1MRFH 5JQHC 1FNEA 4OD1L 2VQ4A 3C8KB 4A7TA 4HWEH 2R56H 3HB3D 3QUMH 3TCLB 2CUMA 4FMKA 5GHWL 3FH7A 4FHJA 3BPLB 1QKZL 2DWSA 1U3HC 4NQCB 5IQ9B 1KEML 1X6NA 4LL9A 4BSVB 4MZIA 4BSWA 3KLLA 4HWBA 3MODH 1UFUA 4FQHA 3QUZA 3RQ3A 1CL7H 4XMUA 1JGUL 1HKLL 3EBAA 3NFNA 4K5NA 3ARSA 1LP9E 3DIDA 2LV4A 3VFUA 4B27A 2UUDH 4AEHH 1QFUH 1L5GB 1GTFA 3D52A 1FRGL 4XOEA 1U58A 2VXTH 5JQ6H 4HUUB 4ZW5A 3T0DA 4LCCB 1A7OH 5JNYA 1OCRB 2Y07L 3QJXA 4P4KD 3CVCA 1NDMB 3NBNA 2Z4QB 1EFXD 1UCBL 5AW7B 2BWIA 2OCJA 4JY6B 1MWOA 4OIAA 5F7EL 2IBZX 2ADJB 3OXRA 1XVSA 1OVZA 1SJVA 2R2HA 2ZCKL 3GHEH 4H1LH 4IOIA 4S11A 5CCJA 4A2HA 1U95A 5C3LD 1MCNA 2K4WA 2KL6A 2XWRA 2K1MA 5IB1A 4OZHE 3B2VL 1GVIA 1DUZA 4QHUB 3QJQB 4XPHL 3P2TA 4KO5A 5DHXB 4BE5A 4JR9L 2EUVA 3QEGH 2O72A 4UANA 3ZDYB 1PG7W 1IV8A 1AP2A 1UXWB 2DQGH 1YO4A 2X9XA 3A6BL 1XO8A 3IAGC 2BMKB 2AQRA 3BVWA 1OF2B 3PP3H 1A7QH 1B4JH 3SO3B 3MLTA 2B7DT 1JPTH 5BVPH 2O1AA 2YEVB 5J57B 1ZMYA 2F7RA 3N3EA 1QO3A 2CO1A 3Q6GH 2JLLA 5ISZE 4PJIB 2AK4B 3ZKMC 5C9JB 1DN2A 1KC5H 5T8IA 2NNFA 1IBGH 3JWOC 3OMAB 5CKAA 2D0FA 4JFDE 3QUZC 3O6KH 4FTVD 3QBTB 3SJVB 1ROCA 5ABDE 1B9ZA 1Q8MA 1IKNA 4OM0H 4YHNA 4ANVA 3D9AH 5D4HA 4OLEA 1AOZA 4FE9A 3MLXL 2YRBA 3HMXL 5HYJB 1UVQB 3D39E 5DMJB 1Q1JH 2XG5B 4HJEA 3HG1A 5EO0B 3DKHA 5E9DD 4B9GA 1L3NA 5HJDA 5IUSA 3PNWA 4OUOA 5DT1H 2BVOA 1NCUA 2NY1B 5A16A 5TE7L 2XN9A 1E6OL 2EE0A 4N20A 1RK0A 3W0WD 1J9QA 1OP3H 1U8CA 5C2UB 4QHMB 3SOTA 5J6HA 1JRHL 3QH3B 4KQ3H 3CFJA 3EBIA 3CIAA 1JJUA 25C8H 1JXKA 2J4WH 2DF3A 1AD0B 1ZK9A 3FYIB 2O5NA 4G1EB 5J12C 1OTSC 4L1SA 5AALA 4ZXBA 4D0BB 4PJ5A 1T04B 2DD8H 1P5UB 3GMLB 1EMTL 4RISL 1AY1L 3PAYA 1HEJC 4MJ4A 4XBGA 2W60B 1H6TA 3BP6B 2IALA 3N04A 1OPGH 3W39A 2NY2C 2BSTA 5ADPH 4Y16A 1MI5E 3MHZA 1PEZA 2X5PA 3KYKL 4OM1L 2VQ1B 3RNQB 4PBVC 1CXHA 1OLLA 4FADA 1ZV2A 1NC2A 1EEQA 1CL7I 2G3NA 5DJ0A 4PRDB 4HFWB 4U2YA 3C60A 1B6UA 3KPQB 1IKFL 1C08B 4ZUWA 1MAJA 1GIGL 2JJSA 4K3EL 4PJ9A 3ATFA 1XR8B 2DQJH 1IKNC 4WCYH 4WI6A 4Z7NF 1B6DA 1D3CA 4GSDL 1ETB1 5AWNH 4MNGE 4U1NB 5MEOB 1BVLA 2VDKL 3O6LL 5E2VL 3OQ3B 1I9RH 5TD4A 2D7PA 3VFRA 1LEKB 4LP5A 2VDKB 1Z9LA 6CGTA 4AC4A 1VZHA 1D5XB 4FA8A 4TSAL 1O0VA 1G7HA 4QI3A 4OZGA 1Z9OA 3UTTD 4WFGD 2W0FB 5TFSL 1P2CA 1YN7A 3O45B 1YMMD 5D7LB 3EXLA 1LHZA 1IM3A 3QFGA 3FYEB 3BYTA 3IFLL 4ODXA 1NFDF 3W5NA 3IXAB 2HCZX 1KBVA 3FTGB 1INEH 3KPLB 4IJ3B 3T3MB 4D0CB 2M1KA 2XWTA 1FVDB 4XWGH 1UA6H 5E2WH 3ARDD 1U21A 4ZXBC 4NC0B 1QLFA 3EH3B 1QUNB 1OB1A 2JE8A 1OCWH 1YC7A 3EYUL 1EWHA 3C5ZB 2W9EL 5BCAA 4MLSA 4K0OA 1B2WL 4G8GA 2R4RL 4P3DB 3SO5A 5IQNA 4Y16C 5TQ0L 3VSUA 2PYFB 4JDTH 3SQRA 1KJMA 1GHFH 1W2KT 2IADA 1F1DA 3UP1A 5CBAA 3H9HA 1S9VB 4J23A 3C60C 4IHOB 5DF0A 3B56A 4UQIM 5FO9A 4QTFA 2JJSC 3DV4B 2VAAB 4PJ9C 3U36A 5ALCH 2QFRA 3S34H 1WBYB 2DWDB 2CGRL 5KSVB 4ZW6A 1RUPL 3L1FA 5LG6A 4WJKB 4LU5L 3THML 1G7IB 3RU8H 1IBZA 1M2VB 1NAMH 1N8ZA 3LKOA 1KJ3H 2WAHA 4K23L 4BE6A 3L1OH 1MLBA 1S5IL 3BP7A 3H0TB 4GQQA 4IBSA 4ATTA 2GJPA 3H7LA 3QIWD 3VFNA 3CZEA 2AMGA 3GXUB 4JRXB 4HG4K 4M8UA 3DBXB 2IV8A 2Z6FA 1WIUA 1XXFC 4MD5B 1F8TL 1JHKH 3PE9A 3WEXB 1CB4A 3GB7B 2JKJA 2LVCA 4NQED 5LG1A 3OHXA 2G0LA 3EDEA 1N9PA 1XZ0A 4DW2L 3R8QA 4G9FA 5HI5C 3FMGL 4A2DA 1DVSA 5IVNA 3D2UD 3HG1E 4AYSA 3GSRA 4H13C 3PP3K 3PDOB 2BRRH 4BXSV 5E7BA 3VFGL 2AJSH 4OCLC 4AMKL 1KELL 4NRXA 2HJLB 3SKNB 5AW9B 3LV3B 2XN9E 3VD5A 5DURD 3V6FB 2V2XA 2WVUA 5GGQH 1WEJL 1D9KA 1FZOB 3GLZA 3RUGF 1CFNB 3C08L 3GGWB 1NL0L 3C09B 4X0KB 4GMTH 3RL2B 5EBWB 3BH8A 1YG9A 3FT3B 3NSFA 4M6NL 3U4BH 3ARBD 1JUFB 1WAAF 1U8LA 4NZJA 3KLAB 1KCSL 5INDA 1M05B 2HG5B 1B0RA 3Q8EA 4NC1E 4OD2B 3RTQD 4DOHB 1FCGA 2N3JA 4PJ5E 5H35B 3ZE1E 5IEHA 3L3GA 5E23A 5TQ2L 3WNMA 4NM8L 5EZPA 3RJOA 1E5YA 5GGUB 1DSWA 1CJYA 2OS7A 2Y2YA 1QEWB 2E8YA 3EGDB 2OAAA 1DQLH 1TQCB 3IETA 2V9UA 3EGXB 4H5SB 2NLJA 4PTUA 2CPUA 1KCBA 1TVBA 4I3RL 2MTZA 2C5DC 4DSYA 1NCIA 5DLLA 1M3IA 2AKRA 4ONGH 4GKSA 4ZFGH 4NPYA 1OP3K 3V55A 5K1JA 4YDNA 3S48A 4Z7OE 4DQAA 5EOCH 4BH7A 1CBVL 5CZKA 3BESR 4TLTA 5FO7B 2OR7A 5KZCD 3UAEA 1LDPH 2VC2L 1V27A 3FUJA 4CC0A 3BUBA 5A2BA 4OVVA 1EHLH 3OHXC 3P77B 4UDUB 2HTKD 1YYLL 2HPOA 5E8DL 5I8EA 4MX7A 4HDIA 2VC2B 2HJFB 1NAKL 3BDYH 1KIQB 4XPHH 1AIFB 1DJGA 5DS2A 4HD5A 3KHQA 1SJHA 1GZPB 1MXDA 4P5RA 5EU3A 2CGZA 1NPJA 3S3BB 5AD0B 3RNKB 4FQCH 2FVNA 2QQLH 3APDA 4AKOA 1MFBL 3LRLA 2Q7YB 4QGYA 1H8OA 5LN8A 5CMAA 3SDAD 1UOWA 3V4UL 4PS4H 4LSVL 4KJWC 2J6EL 4OZGE 2VMCA 4NFDA 1D9KC 1J88A 1N18A 3K2IA 4UIKL 2NXZC 4TTDD 2J88L 1ZHKA 4WDIA 2ZUTA 2D73A 3QFDB 4JBSA 4QRSB 3MRPB 5F9JB 2PWEA 4MNQB 3D4ZA 2R2EA 5AW6B 1RVFH 4YDMA 4PRIA 4Q9QH 2BVPB 3ESOA 3LEVL 2P47B 1Y7VA 1S78D 1EH9A 1SOQA 4PY7A 4YFLI 1G6RH 4P2QB 1MHHA 4XCYA 5E00B 4QGTA 2ZAIA 3TJEL 2W92A 4GG8B 4B9IA 2IWEA 4DT2A 1YECH 3O4LD 4MXQD 4HKZB 3S35X 3WTUA 4YDKL 5DCCA 1N59A 2XVBA 1VFBB 5EN2A 4S1RL 1QATA 4YIQB 4H8HA 4LCYA 1R5WB 1PZ5A 3U6RB 4JN2A 5DD6B 4G11A 4ES9A 4Q9CA 5C0DB 3GMNB 1YEJL 3G6AA 5FFOA 3FZUC 3L1GA 4M1GL 4NCC1 5DEFA 5FK9A 3T4AA 4AYBA 3UC0H 2AI0H 4ELMB 2UWEB 3GO1L 1TVDA 3HZYB 1I7RA 2CRYA 2QFPA 3GXMA 2EUWA 1Y0LA 4JB9H 1YNTF 2BOCB 4N2DA 4AH2B 3QEHB 4BFNA 4YFEA 3QP3A 1R3LB 5HDBF 1U6AL 4JFHD 3WLBB 3HNTL 3HNSL 3BRGC 4WFFD 5BUAA 4WTZG 3RI5F 4QRRA 4WKZB 2RQ8A 1MAKA 2WZ5A 4P5MA 3TBSA 3SOBH 3VFOA 3TCXA 2WMPA 4NZRL 4ABWA 3SY0A 1ID2A 2BK8A 4XE5B 2EXYC 2X40A 4AOFA 1K6QL 2VZOA 2PF6A 3KPOA 3GZOA 3F83A 3FQRA 3ULUL 1XL6A 2OK0L 2AW2A 1MHPL 4WFEE 5BOJA 2BOLA 3OPZH 2ZSVB 1P4BH 2M2DA 4AEIH 3CPUA 3TBCA 1FNGB 2BC4A 3WY2A 3QR0A 4XOBA 4H8WH 2BO0A 4GMSH 1BHGA 3O41B 4GYBA 4HPHA 4G9FE 4W9LC 4Z7UB 2HLAB 3NZ8B 3TNNB 3MV9E 5I1EH 2XXCB 1TLKA 1MWAH 4PY8I 2EQDA 2YSSA 4N2OA 5GGRA 3UCQA 5I2IA 4YHKH 3MRLA 1PDKA 4UYPA 1PLGL 1UHVA 4GW4A 4JKMA 4B0MB 1FHNA 3TF7C 4UAOB 3RKDD 1VCBC 3B4NA 3FRPB 1DYZA 2BSCA 4KHXH 4OLUH 2AQTA 3RGVD 5JIQA 1R34A 1WZ1L 3CZUB 3O3DB 1KN4L 1QBML 5DMIL 1D2PA 4PI2A 3T4AC 2VR5A 1LD9A 2VN5A 3BN9C 1A65A 5EO9B 4EI5B 1ZSDA 4G2AA 3WD5H 4XE0A 2BNRA 1VB9A 1A2YA 4YK4C 4X4YB 4LHUD 4AENA 4YSOA 1WFIA 2DYRB 3L4XA 1IAKA 4OF6A 2ZCZA 5C08A 2MHAB 5F0PB 1HVXA 1F4XL 5EPMA 4CDHA 1Q9OA 3TPUB 3US1A 3ABMB 1T0NB 2CGYA 4J3VA 4NN7C 1RMFL 3HVDA 1IGJB 3IN2A 4HJJH 3QUYA 1CD9B 1KT2B 4TQEH 4PWJA 5EOCJ 4BGDA 3L81A 4PGBA 2ZZUT 3PHAA 1P4LA 3RWHB 2H6PB 4LRIA 4OFQA 3FULA 4ICWA 4PJFF 5H4YA 4D8PB 4QJ5B 2GK0B 4Z3HA 3RWFA 5HHNB 1MIMH 3ATDA 2HWZH 4LRNL 2Q8AL 3CFTA 5LGJB 4K7PH 2Y3AA 3QZOA 5D72L 3MJ9H 3FFDB 3A6OA 4GAAA 3S5YA 3QEQA 2ADYA 2FJHB 4UQBA 1SF3A 4RMSA 5CSZA 5KG9A 5CEXA 3MRNB 2CBTA 5JHDA 1DSFH 3GS0A 1JAEA 3O2DH 1BYNA 3T6VA 4BKTC 1J0ZA 3A5VA 2CR0A 4P48A 5EDSA 2XBZA 1NCAH 4FN0A 1S7SA 2BJMH 5CHNA 1YY8B 3TYFA 4KO9A 5F70A 2H8PB 4NSKA 4AY0A 1I1FB 1J86A 2J44A 4GXVH 4NQVB 3KPNA 5FUZH 2IAND 4CAGA 3U25A 4U7KA 1PY4A 3PWPD 4XI5D 4DVRH 2BP8A 5I66B 1W0YT 2XPGA 1S3KH 3IGAA 2AFNA 4NKQB 4XPGH 4NO0B 3IMVA 3IS0X 4PRIE 1NFKA 3BP4A 1COBA 4JFZL 2VN3A 2WYZA 1KG0A 4IBLT 2EIMB 2ZOWA 2PXYD 2H4EA 2B5IB 4UQ3B 4HUXB 3IFNH 2V17L 4HP5A 5D1ZB 4QTHA 3QUYC 4Z1PA 5JW5A 2HT4C 4Q6IA 4X5PA 4XO3A 1S7XB 1T7WA 3RE0A 5J6SA 1A1OB 2Q8BL 1L7TH 1ZWIB 2C3VB 5AKRA 1ILUA 1RPKA 3EH4B 3HN5A 4LOVA 5E8NB 4YX2L 5JA9A 5DZOA 3SCMA 3QI9A 4LRIC 1UYWL 3VFTB 3WAJA 3JWDL 2B8OT 3BAKA 5I74C 5LGYA 3S6CA 3TIDA 3FU5A 2CJSA 2AZAA 2GUOA 3L4CA 3NJMA 1J0HA 1OP9A 4JJOA 3W9EA 5KYWB 4U31A 3U0PA 2F9BT 3MJ8B 3FH8A 3CQPA 1OPOA 1UD5A 2F18A 2AHIA 3GBLA 3HBZA 4PGCB 3U1QA 4KFZC 3MLWH 1J8SA 2YWZA 3DX4A 3FHQA 5EF3A 5D1XA 4XMVA 3H3PL 1NWOA 1NCCL 2D3JA 5I9QB 1EEYB 1O6VA 2C9PA 2ZXQA 3WTTA 4QRRE 4K2UL 5BQDA 2JB6B 4LLDA 3WTSA 1HXMA 1IEHA 3B83A 4HGWB 4C56A 4XVJH 4PMFA 4JG0H 1GGBL 2BSBA 3ELQA 3PYCA 3N85L 3LN4B 4MA3A 4NIYE 4PRNA 3RB5A 4Z3FA 5FGSA 3TJHD 5AW1B 5I1AA 1U91B 4JGNA 1TZGL 3DLQR 5F6IC 2Q6WB 1TDQA 3ULAB 2QADD 5AOZA 1PX4A 2GVYA 1BFSA 3V52L 5LGHL 4UTBH 5IK3B 3GHBL 4DZBA 1U92A 4J3OF 2Q76B 3ZE0E 2JSFA 3US0A 3C9NB 4ZTOH 5HVFB 2DQDL 4UILL 4YLCA 5T1DL 4Q6IC 3RVUC 1T03H 5IESH 2D7MA 2WLLA 3V4UH 3B8YA 3BAWA 3G5VB 4LSVH 4NKIH 1GC1L 3QI9C 4FFVD 4A1JA 3SCMC 2HT3D 4MD0A 3T2NH 1OOWA 1QNZH 4HMDA 5CCKL 2AXJA 3VB8A 2ZX5A 4AEEA 1KXQA 3K74B 2FE0A 5JOPD 1PSKL 2YBGA 3P4MA 2DQUH 2EVGA 4M93B 3IJ9A 1SQ2N 4HMEA 4RFEB 5DFTA 5E94A 3G7TA 4LEOB 2QQNL 3D4GA 5ID0A 3SGJA 1F4WH 1Q9KB 2VQUA 2R83A 5D1XC 3S3CB 5C08E 2QTVA 3K4AA 1E7UA 2DIEA 1BX2B 2VDNL 1SM3L 1OEZW 4U1LB 5HYSA 3LRKA 4XNUL 3BAYA 2CLZA 1FFQA 3KE0A 5FGCB 5FKPA 4JY5H 1JTPA 5TPWL 4XP5L 5D7HA 5ISZD 2VDNB 5LGKA 3PPSA 1B0GB 1ETZA 2DI8A 3IBEA 3VI3F 1Z3RA 3MRQB 5IHBA 1HQ4A 3MO1A 1MELA 3SN6N 3VTAA 3QUMA 5I0ZA 4UZGA 4ZFZA 4TUOB 1YZZA 3MKGA 3TV3H 4MJIA 2UXVA 2VDLL 4PJEE 2IQ9H 2O5YH 5A6LA 5AOIA 5DHVA 3B2UD 4DN3H 3HC3L 2VDLB 3D39D 2RGSA 4NCDA 3FB5B 4EIBA 3CFMA 1IGTA 3TA3A 5CN3A 3KBFA 4TL4A 3QEQE 1WS7A 4ZT1A 2VZ3A 3ZR5A 3D09A 4U6YB 3O2VL 3WKMH 4AE1A 1JG9A 5JHDE 1AHWB 1JTOA 2QSVA 3SDXF 4C4BA 4DN4L 3NAAH 1G7LB 5DZPA 5DI8A 3V7AE 1U3HD 1OB0A 3PU7A 1M1XB 4L29B 4U3CA 4KC3B 5J0BA 3EFOA 2VM3A 3UJTL 2VL5B 2MRYA 3UTQB 2OI9B 2KQNA 4GH7B 3UYPA 4ANXA 2NX5A 2ZWYA 3COOA 4WU7A 1CLZH 5CINH 3T0EE 2O30A 3LEXB 1DE4B 1PBYA 1G9NC 1VPOH 2WKGA 4ELDA 2A73B 2ENYA 3S0PA 4AIOA 2HYMA 3SGJC 3GMQB 3VW3L 2A83B 4R2GB 1QYGL 3CFDA 2D3LA 1Q0EA 2OCFD 2WGXA 2VERN 1CXIA 4PD4K 4L8BB 1MI5D 2B2XH 2PTTB 5I5RA 1HCVA 2NY4C 4UM9A 3BAEH 5IROA 1N0XH 3KL5A 1HHIA 1Y18A 3STLB 3X11B 2GHZA 2FSEB 4GG6B 1G1YA 2OFQA 2XXMB 4K9EC 3A6CL 5BV7L 2O26U 1BLIA 1WZ1H 3I9GH 4JG1H 1IGYB 1SHSA 2DQTL 2AXGB 1BOGB 4S0TD 3O6FB 3L6FB 1RERA 1OGTB 3NG5A 5DVKA 4L3ED 4EXKA 5IJKA 3GSUB 3HKZA 2VUOA 4MXVE 3REVA 5DZVA 2XV2A 1VFMA 4YHOH 3TA3C 2N1KA 1MG3C 3GRWA 4YDLB 4F8LA 3FQNA 1YDPA 1O6TA 4OI7A 1I1AA 4CW1B 2P5WA 5AZ2H 1BZ9A 4KQ4L 4OFPA 4ONHB 4W4OA 2ENPA 2H1LM 3VDBA 2HXAA 2ITCB 4NQSB 4C56E 2HKFH 2BS8A 3ZKMD 3B2MA 1NIEA 4CRPA 4ZPTA 1F6AB 4G70B 1U8IB 3D30A 3QUZD 2XACC 1ECZA 3ULSA 4XAWL 3UADA 5FW6A 3TX4A 1DBAL 3KXFA 1CLYL 1TIUA 3FUDA 2Y25A 4A04A 3K0YA 4PJ8B 1QA9B 4GSUA 5A2AA 2V8LA 1NCBH 3CCHB 5DVMA 3LNEA 3G08A 4ZW8A 2CM6A 3OAYH 1J5OH 1QSFB 4PP2A 4GRWB 4YUEH 1CICA 3HZKA 4GFXA 4LSSL 4FZEH 2X4QB 5IROC 3KW7A 1VESA 3J2PA 3SBRA 2OZ4L 5BZXA 3V5DA 4HPYL 2BSEA 5A3IC 3QIUA 4IIZA 5F9OH 5DR5L 2YO3A 1A9VA 2WVVA 7PAZA 3ZG4A 3F7QA 1HZHL 2ENJA 4FD0A 3RWEB 2LR4A 5C3IA 1QI3A 2XZCL 4FQ2L 4YAQB 4WWPA 3V6BR 5DRXB 2AEPH 1FVCB 2OR9L 3TZVB 1BG9A 1OTSD 4DVBB 4I18B 2V9TA 3DBSA 5IJKC 4RQQA 4CMHB 1TQWA 4YGVA 1BMZA 1VJSA 3Q6FA 4F7KA 1FE8L 1AZZC 1MCHA 2YMTA 2LU4A 2R0WL 3UPAA 1WV7T 2YD5A 4E36A 4G8IA 1EEUA 1OSPH 6PAZA 4PJ7A 5DO8A 1I1AC 3L7EA 2NY2D 3QWOA 5JIKA 3C5SB 3MOAL 2NY5C 3ENEA 4X7CC 3BPCB 4W4OC 1L9MA 5HDWA 3SBPA 1PYWB 4ANUA 3VXUE 1G7JB 1EUUA 3CC5A 3KPRB 4ZTEA 1RULL 4F7MA 2X6MA 5FF6A 2X53A 5J56B 2WXQA 1V8HA 3VFWA 5IGXL 1EXUB 2ROYA 4P46B 5D1QB 1AQDA 4MJIE 3P9LB 2PW2B 4PG9A 1AD9B 1NC4A 4Q74A 1K5NA 4G6FD 4F2MA 2HH0L 1RZ7L 2FYYB 1E90A 2GABA 3QDJB 3NSCA 3ZGPA 1GGCL 4GW5A 4Y4HB 3DO7A 1QTPA 4KPHH 2VRQA 3HG1D 3QAZB 5EEVA 3VQMA 2A6KB 3BE1L 5H2BA 1WZLA 8FABB 1LE5B 5JO5A 1CICC 4RMQA 3DRTA 2XN9D 5JXAL 4CADA 3MR9B 4L9LA 4F7PA 2ZXCA 5J13B 5DVLA 1HIML 4XCFH 2WZPA 3VUAA 5GS0L 3GZPA 4ZNEA 4Z8FL 4QD2E 5IT2H 3CN1A 3K4DA 4GOSA 1RK1A 4DPAX 4JN1L 4D8OA 4TULL 4G71B 1RJZB 3ESPA 2LLLA 4X4XA 3ZE2B 4LKXA 4XNYL 5C0BA 3B9VA 1MCOL 1ZTXL 3EFDL 2AJVL 2ATKA 4ZXBD 4PJ5D 5E1IA 4Q8BA 3WXWH 1UB6A 4KKPA 2EDMA 3WXVL 4AW7A 2OM5A 2H3NA 3I3EA 4OGQC 4AGMA 1MCKA 5IHZA 2XG4B 3IDMB 1JZ7A 2KI6A 2OTUA 2A9MH 5J1AA 2NUPB 2NY6C 3S2CA 1IO4C 3JZ7A 5F8RC 4HFUL 5B39G 4FNPA 2CE6A 3FN3A 4Q2ZB 4LLQB 1H3GA 4Y16D 3UAAA 3C2AH 2HVKA 6FABL 1FF5A 4AX3A 4ZO9A 1I8KA 1NAMA 1NC2D 2OMNA 1CU4L 4WWOA 3QDGA 4HIEA 1UGKA 1NLBL 2CJUH 2AQSA 2JQAA 3LNHA 2ZKHH 4NO2A 1E4WL 1TJIH 4NN6B 2OMTA 3C60D 5B22A 1TVHA 3T3PB 3QG7H 1O9WA 4KTEL 3O3BA 4PJ9D 4MDJB 4G9DB 1KGJA 3BMVA 1P6AB 4PJHA 2CK0H 1MW2A 3NN8B 2VLKE 2YPVL 1WD9A 2F61A 4AQEA 4JX0A 1VCAA 4JJ5B 3LKSA 5F1NB 4V2BA 2ZOKB 5EEZA 2YMXH 3KL0A 4L9LC 1NMCB 2JKSA 2Y7MA 5DUPL 3R8BB 2X4NB 5EU7E 4N5UA 1QG3A 3C8KA 5B39B 4L4VB 3ZSSA 4AYMC 3D87B 1X5MA 2FQGA 4JREC 5AW5B 1IM3D 1G94A 2ESVB 1AGFB 1EO5A 4H20L 4TNEA 1D5ZB 2J7LA 4GAFB 4NQCA 5IQ9A 3VSVA 4DCQA 3U30C 4BSVA 5T3ZH 2VDLH 4PLKC 1QLEH 2W0PA 1DVYA 5D1ZI 2VR4A 1G5AA 4RFOL 4KRLB 4XP6L 2RCSL 3UL4A 3WNNA 1CS6A 3T2QA 2E5EA 5C6TL 5IV2B 1X5LA 3KXFE 2ID5A 5HI5D 3LH9A 3PWLB 3QHTC 1XV8A 5JW3H 4KI5E 4G8GD 1ZIAA 3DROB 2G60H 2J56A 2Z31B 1L5GA 5EZOH 1UCTA 1E9OB 4TNVK 5EO1B 2W5PA 2AAVA 2BERA 3DJTA 3GI9H 3PUCA 1KENH 4OI9A 5I17B 2PETA 4LCCA 4A1IA 4WU5B 5BO1L 4DUXA 4HHWA 4AM0B 3CSTA 1NDMA 2P52A 2Z4QA 1N19A 4AGLA 2DV6A 3DTDA 3H56A 4TVPH 4JY6A 2F1EA 3JZYA 3QPQC 4OQTL 3VXSB 3ECQA 2ADJA 2V5MA 4H88H 3A24A 3MYJB 5F7NC 4LCVA 4AVIA 3F58L 3Q43A 2D2CC 3NCJH 4G6JH 4CN4A 2ZXGA 4DKEL 5I82A 2F5AH 3FU9A 1PG7X 1XTMA 3IJYB 5C7ZA 4MGXA 1QYGH 3OAYK 4IS6B 3APCA 4NJ9H 1UXWA 1R19A 2FX7L 5BVJB 5LUMA 4KHTL 1DUYB 4PJ7E 4W9IC 1OF2A 1R3IH 5IFHH 4XX5A 1ML0A 1C5BH 4DP0X 2A7BA 1AC6A 3EYOB 3EO1B 2E7CA 3BPLC 1U4EA 4LLWB 4WV1B 3HG5A 2Y1AA 4WJG3 5J89A 1A3RL 2WWNA 4PJIA 5FYKL 3HBGA 4OGYL 4AEFA 4KQ0A 2PWDA 1TT6A 2AK4A 3AG2B 4CKQA 1T3FB 4JQIL 5C9JA 5IFAH 2WAQA 2H26B 4L0YA 2WN2A 1QFPA 4HUVB 1OTUC 4LEXL 3M17B 3SJVA 4GSQA 1D7BA 4F2ME 4G9FD 4N2HA 2QV2A 1OKEA 1CDYA 2E46A 5HYJA 1UVQA 2DEYX 3FQ2A 1LK3H 1G7PB 2XKSA 2XG5A 3OJMB 5EO0A 3HMXA 3RIAK 1I1CA 4KJWD 1MCIA 4F27A 5TK2A 4LCCC 1D9KD 4QRBA 2VDOH 4M5ZH 4P9HH 4DK3A 2NXZD 3SKOB 4XNXH 1BV8A 1LWHA 1ZHNB 3GXTA 4JZNB 4QHMA 4YL9A 2AQNA 5E6IB 2D4DA 4QEGA 3QH3A 3O3UN 1JHTA 1KJVB 1BM3H 4X5LA 5KBMA 1KYUA 2BVQB 4O02L 1JK9B 4PRHE 1BBDH 5C0BE 1ZVNA 1UXMA 3EYFB 5M94B 1XTLA 1AD0A 2X41A 2HFFB 1WAPA 2B3RA 4G1EA 1TZHA 4O02B 4WW2F 3KLDA 1L7IL 4D0BA 3FQ4A 1T04A 3AVEA 1P5UA 2AVGA 4GUCA 3GMLA 4PV9B 2XKNB 5JXEA 2YAOA 2Z7ZA 4LSRL 1C5DB 4BHUA 4Z0BL 2W60A 4FMVA 4XN1A 5JHAA 3BP6A 1J7VR 3SO3C 3AQDA 3DDFA 2VR7A 2VH5H 5DEJA 2YXFA 1SBSL 5G2NA 4IRZH 4HGKC 1CFSB 3RNQA 2VQ1A 3LRGA 2E56A 2WSKA 4X9FA 2P46B 3FZUD 4A7GF 5E8EB 1PEWA 5I18L 1OE2A 2IMNA 4UNIA 4PRDA 4PWHA 2DIBA 1E43A 3WL9B 3Q9QA 2CUIA 2XZCH 4O51B 1C08A 1TO5A 4PPTA 1XR8A 4LPYA 2JCCF 4F8TA 4PG2A 4JHAL 3V4PB 4D7BA 4U1NA 5MEOA 2DM3A 1EZVY 3V0JA 3OPUA 3ZIYA 3D3VB 3U83A 1LEKA 4WNSA 1N6QH 2NY1C 1RP8A 1K8DB 5MEQB 3OTTA 1SGKA 1D5XA 4UT7L 4X5XB 4Y2NA 3I6LE 5E5UB 2EUXA 2YR3A 3QVAA 2EXYD 4W81A 4ZMNA 2W0FA 4Z7WB 2DKMA 1IEAB 3UERA 2RTTA 3UPRB 4PLNC 4KROB 5D7LA 5K59F 3LHPL 1F1AA 5G4NA 4Z78B 5L88H 4NQCE 1JYWA 1RZ8B 2J5LB 1ADQL 4PRID 3IXAA 1F0LA 3FTGA 1YAZA 4D0CA 2PO6B 3FN0H 1FVDA 4LZHA 2D7NA 3F7VB 1JFQL 1X44A 1P5UC 1QFOA 2Y69B 5JXEC 1QUNA 3TT1L 3C5ZA 3K5SA 4HIJB 4YWGL 4TV3A 4B9PA 5FB8B 1WT5A 4ALAH 3RZCB 1V3JA 3AMKA 3N9GL 4P3DA 1UWXH 3AU0A 4TN9A 2PYFA 2VITB 1THCA 3A21A 3QZPA 4HD9A 5F1SA 5FV2A 3OVUB 2OPCA 1KMGA 4YDVB 3SYAA 3PLYA 4IMLB 3BN9D 4YSAA 4P2RB 4M1DL 1S9VA 4ELKA 3IB4A 4IHOA 3H2QA 4WIQA 2AXFB 4XPTL 2Y3NA 4KJQC 4XAKE 3EZJB 3DV4A 1FO0H 2J72A 2VAAA 1N7MH 2WXIA 3MUGB 1DANU 1RSFA 3E1F1 4PG2C 4ZZKA 1WITA 4WHDA 1WWCA 1JNNH 5HVWA 4R8WL 1WBYA 4ZMLA 2PLTA 1MJ8H 2DWDA 3L4VA 3MJ9A 1NJ9B 4QRRD 5KSVA 2DLIA 3MZTA 4R7DB 3ZDYE 3K2UL 2PR4H 2FJGB 1G7IA 1M2VA 4OAWB 1EHAA 1D6VH 3BZDA 4P49A 3T0AA 4M48L 4WWKB 3UROR 5I1GL 1J1XL 3QCVL 3NTCH 2W59A 5FYLL 3NCXA 3WKQA 2PWFA 4CL7A 4N2NA 1EZVX 1NGPH 2G3ZA 3OWRA 1KTDB 4JRXA 1J5IA 4PJIE 2C4FT 3DBXA 4QKTA 4X6CF 5I26A 1MY7A 1CYGA 2MQCA 3GT6A 3AG1B 4Q0XH 4RGMB 3EDKA 4IJ3C 3IDGB 3UC2A 3O2WH 1DJYA 3GB7A 1AZVA 3CIQA 4D3CH 4G6MH 3SJVE 4AG4L 3IDXL 2R29H 4NP4L 2KPNA 4RAHA 1CGWA 4HAFA 4PJDB 1UD8A 4E9VA 4XO9A 1A3QA 1NLDH 3HMWL 3MA7B 4ONFL 3C5ZC 5HYJE 2EEDA 3FUMA 5EIQA 1BZ8A 1WT5C 2J1XA 3PDOA 3QORB 3LIUA 1FN4B 2HJLA 3SKNA 4OLXL 3LV3A 3V6FA 4HF5L 2YUZA 2ZJSH 4MCMA 1FZOA 4DK5A 1CFNA 3CVIL 3GGWA 2ZUVA 2DWXA 4ZUSB 1MQ8A 4L23A 4X0KA 5HD8C 2BNRD 3X12B 4HXAH 5EBWA 3RL2A 2ED6A 5EC1B 1AJ7H 4MQ7B 4WW1B 3FT3A 3P2DA 4OCRL 4OIIL 5FV1L 1EO8H 4TUJA 1J0KA 4JFYA 2E7DA 3G6JB 1F90H 5C08D 1JUFA 4WTQA 1ZCRA 5C2BL 2R0LH 1M05A 2HG5A 4L37B 3HOGA 4OD2A 1OE3A 4PS3A 5KS9E 4NAMA 3BVXA 5H35A 3RA7H 4BQ6A 1FLTX 1URIA 2KDGA 4EN3A 2CUHA 3OF6A 3QUYD 1WYJA 1QEWA 2Z0UA 2HT4D 3EGDA 3M1BB 3LYRA 1EJ8A 4FQIH 3BT2L 5D4IA 4H5SA 3RZWA 2DQHH 3QZWB 3UP6A 1XF2B 3IE9A 1EHXA 1F2QA 1M3JA 3AG3B 3M8OL 4XPBH 2XICA 4GUPB 1W80A 3F7YB 2DTSA 1YYCA 4TKWA 4YL4A 3ULVH 5C0IA 1HHHB 3L3HB 2PCXA 4R9HA 2VSDA 1QPKA 1UJ3C 5FO7A 2UV3A 5DQDH 3QEQD 5G5DB 1HZLA 3EG9B 3P77A 4UDUA 1WFMA 2CIKB 2NY7L 5JHDD 1KIQA 1AIFA 3WY1A 3QJFB 4HS6B 4NYLB 3JUYA 3FUKA 4PCKA 5AD0A 3RNKA 5AVWB 1CZ8H 1R3JB 5E5LA 1N6UA 4LEBA 4ZFQA 2Q7YA 2QL1A 2FIKB 2DH3A 5ESAB 3CBRA 4AYID 2GIXA 3WE1A 3INOA 2GEQA 2XIBA 3CFCL 4QXGH 3C09C 1XF4B 3GBNH 5B1JA 1RIHL 2J6EA 1MFMA 2KZKA 4IKNA 5D7LE 3QFDA 5FFLA 4QRSA 15C8H 1DFXA 3MRPA 5F9JA 1RKRA 2ZOLB 4MNQA 4WO0A 5BMFH 4BV1A 3T3ME 1FPTH 3MROB 1JV2B 4FFTA 4Y8DC 4BBWA 5EA0H 1QI5A 4DP9X 2BCKB 4EN3C 1Q72L 4P2QA 4AMXA 5E00A 3H6JA 4I89A 3RVUD 4GG8A 3O6ML 5IM7B 1ACXA 4LCIL 1PCXA 3LZRA 2X05A 1AE6H 1MFNA 3TTSA 4AJWA 2EACA 4HZLB 2XN0A 3QI9D 3SCMD 1D5IH 3V5HB 2XX0A 3MI6A 1VFBA 5JIDA 5CLXA 4YIQA 5F9DC 3V0AC 5DC2A 5DLMH 1C8QA 1R5WA 3Q9PA 3A0OA 1JS4A 4N1CA 3U6RA 2XZAL 4ZODA 5DD6A 2TAAA 1AQ8A 2I69A 1HHGB 3GMNA 1W16A 1A6PA 5D70H 1PAMA 3UYOD 3IK2A 1EBAA 1HNFA 2BWDA 4ELMA 2UWEA 3HZYA 1L6PA 5D1XD 4I3SH 2OXHB 1U8QB 1FG2B 5HGGS 2OYKA 2MCPL 4APQB 3ZKNC 2BOCA 4AH2A 3QEHA 4MB3A 3BXNB 3WLBA 1AQKL 1GS8A 1T2JA 2IMMA 3OKMB 5DJ2B 3S35L 3ZZQA 3U7AA 4C56D 3PXJA 1SUHA 4WKZA 2I26N 3QO0B 5D7KD 1L0QA 1X5ZA 4N6QA 4DGVH 4D9QE 2R69L 5HYFA 4UT9L 1SBSH 3MNMA 4ODTL 2VKWA 3WMPA 1MZYA 4QRTB 2FCBA 5B1JC 2ADGB 3RWJB 1HWWA 2R9HC 1A6WH 5FC9A 2PWGA 3SE8H 2OJEB 3VQ2C 2ZSVA 3V4PH 3QYMA 1SYSB 1FNGA 3NZUA 3ZDXB 3GXNA 3S7GA 2YQ2A 4B60A 5GZOC 2XPYA 3O41A 3VFVB 2FO4B 3JQOB 4Z7UA 2HLAA 3NZ8A 1GYCA 4HXBL 5GGRY 2XYCA 3TNNA 2QKIB 4AXWB 3C87A 3GKWL 5PCYA 4LCUB 1P6WA 4G5ZL 5D55A 4XCCH 4IBTA 3VDCA 3QQNA 1KCRL 4WTZA 3BSZH 1GH7A 3FRPA 4NP9A 4Q9RH 3O3DA 2GJZB 3ZKQD 2WWMC 2M8XA 2F53B 4P06A 5GSRB 5F7FA 1LO3H 2ZWKA 3LMJL 3SE9L 5EO9A 4EI5A 5JDJA 2VZVA 4G82A 4HS3A 5AUMB 2DLFH 3VX0A 2MQGA 2XWDA 1MRCH 1QSZA 4X4YA 1PZCA 4ZO6A 1YEKH 1BQHG 2MHAA 3NEXA 1JFQH 2VKXA 4LNRB 2NY4D 1T0NA 2ED8A 1LQSR 4LAJH 4OFVA 4PCYA 5I1HH 1ET7A 1IGJA 3QB7C 5EEWA 1CD1B 1KT2A 2MFNA 3S3SA 3LNFA 4MJID 1OAXL 3K5RA 1AR1B 3VI4F 1T66C 1F11B 1T4WA 3MRRA 3RWHA 2DTMH 2H6PA 4IK7A 4D8PA 2GK0A 3FO2B 3QO1B 4F20A 1WF5A 4UOW1 1ZATA 5HHNA 1UD4A 1BD2B 5KBLA 3TA3D 3ULUC 5LGJA 8CGTA 2FLMA 3FFDA 4N8PA 3ILQC 2FK9A 5FUOL 3PXLA 2YD4A 2FJHA 4N90E 3QNXB 3MRNA 2X12A 1BQHB 4QO1B 2YLHA 4M48H 1JI1A 4UAOC 3ZTJG 3QCVH 1UWGH 1WIOA 4UT6L 2NX5D 2CBOA 4G3YH 4JCMA 2MPAL 1I3RB 5E2TH 2H8PA 3HKFA 4M6AA 3LNGA 4FP8L 4FKHA 4NQVA 3WKNA 3GMRA 2FWOB 4I77L 3FT4B 2X7LA 5E1HB 4EI5C 1AKJB 3KJ4B 1Q94B 1Q0XL 3FCUB 2EO7A 1LO4L 5I66A 1NGYB 2XFXB 4MNQE 4GXUM 3ZHKA 4NO0A 3I74A 3GSXB 1UGNA 5GRUL 1P5VB 3ISRA 4UM9D 4FYTA 2JWYA 5IROD 4UQ3A 3L16A 1S7RB 3DI2B 3HS0B 4P2QE 4HUXA 4ONFH 2CO6B 3MBEB 3B7TA 5A3ID 4C57C 1LO0H 5IMLB 3BVNB 5GGVY 3P02A 1WG3A 3OKYA 1S7XA 2Z7UA 2C3WA 3MU3A 1LP9F 1A1OA 2C3VA 1ZWIA 3TO2A 3T08A 2R7EB 5E8NA 1BZ7A 2DQCH 1MY5A 3B9EA 1T7VA 3NJLA 4R0LB 3VFTA 4EJ1C 3OG6B 1A5FL 4YGAB 1J9RA 1KIPB 5ANMB 4N8UA 5KYWA 3ORJA 4S1SH 3FUNA 2QSCH 4M8QB 1QHQA 2DLTA 2FD6H 4GKOA 4I13B 2BP3A 4AQZA 2UWEE 3IU3B 1BXUA 2JELL 1KV7A 1HH6B 4PGCA 3LN5B 4TNWK 3DJSA 4FI7A 2FEEI 4LESA 3CVDA 4I3GA 1I1AD 1TEGA 3WFEL 2P5WD 4PUBH 1PX8A 4J28A 1EJFA 3LIZL 1BBJB 5IHUL 1QZ1A 3E1ZA 3ZGIA 2E7BA 2JB6A 4TSBL 2R8SH 1XEUA 4HGWA 4CA4A 3AXLB 5EV7A 2O6DA 4OZFG 3KHOA 3RL1B 4OUUB 3KXFD 1U91A 1FFRA 3VTMA 1NBQA 1BQ5A 3L54A 2IGFL 4N2FA 5E6YA 3K80A 4FCHA 2H5UA 3MLVH 2Q6WA 1L9RA 3C5XA 3KYOA 3GXDA 4FX5A 4AKQA 4TOYH 3ULUE 1CICD 2X2UA 5IK3A 3GSOB 1JXFA 2Q76A 3QW9A 4NCC2 1BLNB 3C9NA 4Z7UE 4TM9A 1QWNA 1HHKB 4O58H 1VGEL 1WTLA 3MLUH 2IF7A 3H6AA 3G5VA 4EIZC 3N06B 3NFPB 4AGNA 4F93B 2DQMA 3JWDC 2ZYIA 3DARA 4WFHE 1CR9L 2ITFA 2BW4A 1E4HA 3ZTNH 4RFEA 4NZUH 4LEOA 2NY6D 4R26H 3T6XA 1Q9KA 3Q48A 2P24B 2QBWA 1YYML 4I9WE 4PBWD 3H9SB 1JPFB 1Q9WB 3HRZB 4IBYA 1BX2A 4PREB 1BZQK 1NCWH 2DEXX 4U1LA 5I9QC 3QCUH 5DFVC 4KFMA 3VGHA 5LQBH 1P4IH 2FYVA 4X5WB 1B0GA 2QZ5A 2MEJB 3MRQA 4U4BA 3KJ6H 4YXKL 4ZMAT 1UG9A 1N12A 5F97E 3QQ3B 4HJ1A 3NCBB 1QQDB 1XSJA 4Y89A 3NA9L 1NBZB 1NC4D 4HKJA 4EVNB 3VD2A 1NDGB 2Q2EB 5AVVB 3VMNA 1QFWL 1MW1A 2BNQB 3GINA 5I1IL 5I24A 4DKFH 4ZFFB 2CJ3A 5CKGA 4HBCL 3T65B 1IGCL 3NJHA 4LQFH 1XZWA 3FB5A 1C5CH 3F7KA 3IWUA 5I19H 3EYSL 1RJLB 3FUHA 4JO3L 1EQWA 1BF5A 2WGNB 3NJXA 1ID5I 3DHJA 4U6YA 2WZPD 4V1DB 1FH5H 4JM2B 4PB0H 4S1QL 4HALA 1AHWA 1U8PB 4L5FH 3H42H 1PCSA 3N41B 3RILA 3K72B 4NNXB 4OLYH 3TH3T 1G7LA 5IMKB 5F89B 2VGLM 1UKSA 5HHQB 2G9KA 1M1XA 2CO7A 2YAMA 4L29A 5DYFA 5C0BD 4KKCC 1MCFA 2VL5A 4PLKD 4R5VA 3UTQA 2MIZA 1GC1C 2Q7AA 2VXUH 3P4NB 3V0WL 3DV6B 3NSDA 3EF7A 3LEXA 1DE4A 4M93C 5CR1A 5IF0B 2H1PL 2A73A 3I2CL 4YHMH 4JHWH 2R0ZH 3GMQA 2W38A 2A83A 1BQRA 2E8ZA 3QHFH 4B97A 5HGDB 1MCEA 1JWUB 3QDGD 3FS9A 3IMBA 2FX8L 2BHZA 2FT8A 3BLBA 4Z3IA 4ZMWA 3STLA 4ETYA 3X11A 4YEFA 2FSEA 4F1SA 1HH9B 2CD0A 2HA1A 4GG6A 3MLSH 3QPQD 2I9LB 4OZIB 5A40E 5KJ4A 3TWCH 1IGYA 5FECB 2P9RA 2AXGA 1BOGA 2JB5L 1V7ML 3O6FA 1AIZA 3GFUA 3L6FA 4NT6B 1OGTA 1Z3GH 1CF8H 1MCJA 5IJBC 3IU4L 3JTBA 4R4FH 5E4OA 3GSUA 4BUHA 4JFQB 3BFWA 5DJXB 3OGOE 3KPMB 3VFSB 1RJYB 3WIAA 3UTPE 4NUQA 1B9KA 4UF7C 4RGOH 1E4KA 1A9BB 1KBGH 4LO9A 3X3GL 1AHWC 3VU1A 4CW1A 5C0AA 4ONHA 3N91A 4MCYB 2RBLA 1CFVL 2G5UA 4NQCD 3IDJB 2ITCA 5FLUA 3ZPDA 5KTEH 4NQSA 4MA7L 1I8UA 3UBGA 2OI9C 3TXAA 1W72L 4GW1B 1F6AA 3B7UX 3WSQH 1X9LA 1MFAH 1IBHA 1OTUD 4XMZA 1OXYA 4GLRH 2ZX6A 2CCVA 4K94L 1W72B 4KRMB 3FL7A 5HY9B 7CGTA 4OBSA 3HCVB 3BSGA 3D85B 5AZEL 4TUKH 3NJFA 1F3JB 4XVSH 1RUKH 4R2GC 4PJ8A 1QA9A 3IRCA 1AZNA 3CCHA 1ZV5A 1IT9L 2VB5A 3DURB 2YKLH 4QHKI 1QSFA 5I1JL 5DJ8B 4ODSL 2X4QA 3NFSL 3PPEA 4XVUC 1H5BB 5C0RL 3FO0L 1A66A 1CMOA 4JAMB 3NCMA 2BZDA 2D3VA 3IKCB 4YXHL 3NSYA 3WFBH 2WYIA 4LF3B 1TTFA 1S7TB 3C8HA 3HI6L 2OZ4A 4AIZB 1J9CT 3QS2A 5GGTH 5ADOL 3BAXA 4KKBC 3OB0H 3RWEA 4B9CA 1GCYA 2X6UA 3II2A 2PW1B 4WSJA 4CVXB 3LRMA 4ATWA 3O6FC 3ZDZF 4YAQA 5BV7C 4W9EC 5DRXA 4D9LL 5DVPA 1FVCA 1FI8C 3TZVA 4DVBA 5GRXG 4YN3A 1G4RA 4I18A 3VSQA 1S3RA 4UNTA 2B59B 4OJAA 1EA9C 2AABH 3FSZA 3VO0A 2CG9X 2WK2A 4B3VA 4YDLC 4PJCF 5E8PB 4FABH 1P7QB 3MA9H 4KVCH 1E4KC 5I6XB 1MCDA 4X6FB 5D4JA 3Q8FA 5DQ9B 5EBLB 3UZQB 1NEZG 4M5YH 1CGYA 5T3XH 4QHKJ 5IMOB 2JKWA 5FGCE 2VMEA 4BKSC 3C5SA 3BPCA 1PYWA 2EDOA 3ZE1F 2DYPB 1LWJA 3KPRA 3ZTJH 2AK4D 4OSUL 1QABA 3S4SG 2VUKA 3QR1A 2FJUB 4JRYB 1EXUA 3U2SB 3CDCA 3HR5B 4P46A 4CGTA 5D1QA 2PPAA 3SJVD 1AHKA 1SYVB 3P9LA 2PW2A 4J3XA 3FQYA 1GPOL 1QZNA 2X6CA 3CZGA 1AD9A 2NCEA 2O5ZL 3PGFL 5T3ZE 1KBKA 2FYYA 3BIBX 1OT4A 3QDJA 5HYJD 3N43B 1M2OA 2P45B 3EJUA 4Y4HA 2LW3A 4Z7OF 4PJ8C 3HG2A 1SMDA 3U7WH 4LP4A 3SIKA 3BAIA 4ADIA 4KZDH 8FABA 4FQJH 1HSAB 1J87A 1SHMA 1LE5A 2NY1D 4WHYG 3GNML 1SOSA 3VE0B 3MR9A 1E8YA 5J7CC 1ZPUA 1E8XA 1GTNA 1NEZB 3INUL 1TKWB 3K6IA 1NBVL 1O5PA 4KZEH 4BINA 5KSAB 1RJZA 1SQMA 3B37A 4DP2X 2NUTB 1TITA 3S4SB 4BUGA 2HG0A 2AJXH 4TVPE 1JK8B 3IDIB 2V3DA 4I18C 4BCYA 1MJ7L 4IDJH 4CMHC 3BJ91 4I87A 4OZGF 5L4IA 2WD0A 1EX0A 5JXED 3LKNB 5FS5A 3N1QC 2XG4A 3IDMA 2AEQL 3SE6A 2NUPA 2ARWA 2ETWA 1XWVA 4U3HA 1TOXA 4KITB 3PL6B 4Q2ZA 2VR3A 4LLQA 1BZEA 1BAFH 4PMEA 3CZFB 1CXFA 5CWSB 3SDYH 1RL1A 4NEHB 3O9WB 4GLRI 1RIVH 1EJ6A 3U6XA 2HKHH 4G72B 4AE0A 2VDMH 3H2WA 4GG6E 2BVEA 4Z6AT 2NZ1A 4JEGB 4FLHA 5DVNA 3ZUCA 4HVBA 4MCZB 5D1QC 4HS8H 4KJQD 5C6WH 4A1RA 4XOAA 4MDJA 4G9DA 3EKCA 1JDCA 3OKDA 4MMYB 3NN8A 1C12B 4LHJB 2VRKA 4O00A 3WIIL 2YEZB 1JZHA 1H15B 2OA9A 3VAEA 3QAZC 1RZJH 3JWNG 2OL3L 4H4NA 3G5WA 5DQJB 4PVBA 2GTWB 4JJ5A 3CSBA 5F1NA 2EVFA 2ZOKA 3P3TA 5J13C 4A52A 1PNDA 2X4NA 2K4AA 5AFAA 5B39A 5KYXB 4L4VA 4MAUH 5L8LB 1FNSH 1YJDL 5D7LD 2Z7WA 3RAJL 4U7MA 1T5KA 4MKTA 2ESVA 35C8H 4JLRB 3F05A 2OMXB 4S10A 2EYTB 1F3RB 2X3AA 1MXGA 1D5ZA 3E6HB 2WP3O 3HE6A 4KDWA 2VXVH 1QFWH 4YHIB 5DTFB 2WNKA 2HFGL 1RK7A 3GZKA 3CSFA 4FRWA 4Z7IA 3DUHA 5D7SL 5IV2A 4FFWC 4MBOA 3C5ZD 3E9TA 4J3UA 5D6DA 3PWLA 4YXLH 3JV6B 3CN0A 2DMGA 2V5SA 2VOTA 4H8UA 1TNMA 4A68A 2Z31A 1E9OA 1T1ZB 4XN9A 4EUPG 5EO1A 1W0WB 1YNTB 5F1IB 4QHNB 5I17A 1WA0X 4AGPA 4WU5A 5JHMA 4HGMA 4AM0A 4NN6C 1GR7A 1E6JH 3F2LA 4KMTH 5HD8D 2BP5M 2Y6TE 3R1GL 2DM2A 5EU6B 3MLPA 3QQDB 1OQXA 3VXSA 5E1QA 4JFXB 3CMOH 4P23B 3MYJA 2A9NL 3LS4H 1A0QH 1KGXA 4I1NB 3V0WH 5BRZB 1T0OA 1ULVA 4RAUA 4MLIA 3QUHA 5FYKU 1CTMA 4UQ9A 4H2AA 2PCPB 3QC5X 1Q4NX 3IJYA 3S37H 3ZYOA 4OJFL 3DXAB 4IS6A 4HIIB 4HULB 1NMCC 4D9QD 2R2BB 5BVJA 1VEPA 1DUYA 3MJGX 2FZ3B 4FMFA 4TYUA 5EORL 3BWZA 4Z18A 1NCOA 4Q14A 9PCYA 5F0LB 2GY7B 1JZ5A 1R0AH 4KRPB 4JRXD 1H3XA 2GC4C 1MEXL 3EO1A 3EYOA 3KEHA 3P73B 4LLWA 4WV1A 4XVTL 3V9EA 3BGAA 4ZAKB 3GQFA 1CXEA 3LXAA 3OSVA 4HWUA 1E3FA 1ZLEA 2CXKA 3VD7A 1UZ6F 1JMZA 4RMTA 2Z65C 3HE6C 3T6QC 1T3FA 5D1QE 5TF1L 4DPBX 4JY4B 2H26A 5I6NA 1ADWA 1URZA 3KCWA 4UU9B 3LS5L 3MRGB 4HUVA 5T33L 2ZAHA 1YEFL 3M17A 1G1CA 3QJOA 4JQIA 5LO7A 2VISB 1AFVH 3QDJE 1JYNA 5D6DC 4Z23A 1PG7L 3NZHH 4YDIH 3B5TA 2DY2A 3TT3L 2Z31C 4JM4L 1G7PA 3V6OA 2HRPH 2MKWA 4ZUVB 4B53A 1P7HL 1G87A 4LIQH 5L2JB 1TZOA 5CLWA 1WHPA 3L5JA 4M43H 2DBJA 2VDRL 3SKOA 4NGHH 5CZXC 5E6IA 1ZHNA 4JZNA 4XMPL 4EDWL 2Y7LA 2DAVA 5KAQG 2O5XL 4APXB 4Z7QF 1GYWA 3T5WA 4ZFOL 3A67H 1KJVA 3PAZA 3ROOB 3TO4A 2IAAC 1S9XB 2BVQA 3ZE2E 1JK9A 3NVQA 1NIAA 3EYFA 1RU9H 4JO1L 4KJYB 3CVBA 4XBMA 2WLJA 2HFFA 3UO1L 1U41A 4O02A 4GBXB 2ICWI 1DBBL 4A39A 4EN3D 3OF6D 1M7IB 3BUDA 3GJFB 3JWOL 4OT1H 4OKVB 3D0LB 1HJCA 4PV9A 1KZQA 2XKNA 2YFOA 4M7KH 2Y7QB 1WAEA 3L4UA 5CS7A 1C5DA 1EHNA 3L13A 5T1LB 3L2MA 1OZUA 3BH4A 4U7SA 1MCWW 2EC9U 4FAAB 32C2B 3CLEH 1QFWI 4WLCA 1G0XA 1GRWA 1CFSA 3LEYL 4WV1C 3NACL 4KGLA 1OCOB 3NIGB 2FBRA 4QLWA 3HZMB 1NSNL 5E8EA 2FGZA 4ODVH 3HG3A 1MVUB 3T3PE 4A2LA 4PN6A 3L3DB 2F7IA 3RHWK 3WL9A 1E27B 5KJRL 3EJQA 4RRPA 4KKAC 1B3IA 4O51A 4O9HH 3VSTA 1FLRL 3RIFF 2RFXB 5DZ9A 3GSNH 5FUCC 3ZKND 4DQOL 5L2KB 1TTRA 1LDSA 1MFDL 2CMRH 3V4PA 1AH1A 2X42A 2ICWJ 1GYAA 3QGVA 2TSAA 3CH1B 3V6OC 3WN5B 4WSGA 1TJMA 3D3VA 1T0MB 4FQ1L 4PR5B 3UZVB 3D0AA 5MEQA 1K8DA 1JCVA 2FL5B 1A47A 4QNPE 4X5XA 4NZTL 4L4VE 4FXGB 4BZ2H 1E4XL 4Z7WA 1FZJB 5E6IC 2R9HD 6PCYA 2COQA 1IEAA 1V7NH 2ESVE 1U2YA 3UPRA 2NXYC 5CEYB 1EAQA 5I6LA 4MNQD 4Z78A 3M6DA 3TO4C 5C0FB 1RZ8A 4XMKL 1OAZH 1DANT 3EOBB 1S7UB 2PO6A 4HCGA 2IOMA 2E76C 5GZOD 1ADQA 3AZUA 3F7VA 1VZIA 3PGFH 4P2QD 1H8LA 2DJMA 4WEBH 1S7WB 1UACL 1MRDH 1SY6H 4DTGL 4KXCA 5DRNB 1UM6L 3VA2C 2X44D 1YEHL 1XCTB 4ZUTB 3OJ2C 2AV7B 4HIJA 2YXVA 1I1RA 5KSBB 3MRMB 5FB8A 2IDCA 3P0YL 2IFFL 3U4KA 2FR4B 3RZCA 3L17A 5KSUA 3UTSB 1A1NB 2VITA 4MWFB 1ZLVH 5M7QA 2DMKA 4G6KH 2CKBL 2WWMD 2V5RA 1WO2A 3PIQB 4YDVA 4Z77B 1CGSL 4IMLA 1YSOA 4AZUA 1SLUA 4AYDC 4P2RA 4N8CL 4XP1H 2CKBB 3VXSE 2AXFA 2G2RB 2QHRH 3WS6A 5I16B 3RJDA 1EZUA 3TIEB 2AJUL 3VMPA 5AYUL 3MUGA 1USZA 3ES6B 3P0VH 4I85A 5A2CA 3P3UA 4NUPA 4P99A 1UOKA 1V5JA 3QIBB 4XMXA 2AEQH 1NJ9A 1F18A 5F0JB 3REWB 4EXPX 3QUGA 4R7DA 4Y2LA 5DD0H 2FJGA 4NJAH 3U46B 3AY4A 5T1KB 4OAWA 4ZK8A 1ZLUH 4YS4A 4KUCD 1XGUB 4WWKA 1T66D 5ITBH 1TZIB 3FU6A 5BQ7B 2XJLA 3VCLB 5JW4Q 5EOQH 3CN2A 4UOW0 4KROC 4WSKA 1N4XH 4FFZH 1KTDA 3FF8A 2K7QA 3LNIA 3SQBB 2R0KH 2ZWNA 3FRUB 2J5LC 4JM0A 1T89A 4R84A 3EJTA 3D07A 3AMLA 3ULUD 3OXSB 5FYKE 1U8JB 3ILQD 1Z1WA 4J6RL 2C7UB 1A7PH 5DC0A 4BZ1H 5KVEL 3JUZA 4PJDA 3ETSA 4PYGA 1MCQA 4WZ9A 2J5WA 2VW6A 2WNXA 1ORSB 2E27H 4Y2DB 1KIUB 3V6OE 3HLAB 3V9FA 1IILE 3RZCC 3QORA 3FU8A 1OSYA 3T1FB 1FN4A 1G6VK 4ELME 4MB1A 4BQ9A 4UMSA 4ZTPH 4J3BA 5ACLA 1NICA 4WFHD 1QHOA 1YPZE 4EI5D 4F3FB 1GKOA 2ZNWA 3VI3B 3ARUA 3P54A 1E0OB 4ZUSA 1EEZB 4JKNA 4G80B 3X12A 2X38A 4FJ6A 3WS6C 5EC1A 3GK8L 4MQ7A 4WW1A 4D94A 5DHYB 3G6JA 4I9WD 4FA7B 4N2IA 1E5AA 4NIKB 3CDGB 5EULV 5BZWB 2A77L 1QPPA 4UOJA 2BIHA 4JPKH 4L37A 3T2PA 4BYHA 1ZLSH 4JZJB 3AY4C 4WY7H 2WKLA 3M1BA 2ARJA 3M46A 4XNQB 4WWKC 4Q97A 1IB5A 1GCFA 1OF0A 4K7PX 2EDHA 4I4WB 3FCBA 2H45A 4NBZB 3BVUA 1I4FB 3QZWA 4WI4A 4F9PA 1XF2A 3Q2WA 4YLQT 2ZSWB 1H6EA 4U0QB 5D7JB 1FZKA 4OR1A 1FYTB 4PJAF 4QOKB 3BW9B 4FLRA 4GUPA 3GTTA 4N2BA 1T89C 3F7YA 3Q1SL 1N5YH 4PRBB 5F88B 5CJOL 4DWHA 4RGMC 1HHHA 2R15A 3L3HA 5JTWA 1R3HB 4FXKB 4XP4L 2J71A 5G5DA 4GI9A 1OW0A 1A64A 1HI6B 1TZ8A 2YOAA 3EG9A 4NN5B 4X7SL 2CO4A 3P11H 2CIKA 3FU0A 1TETH 3SYPA 3P3RA 3SDCB 4GS7C 4LSUL 3EYQC 1CXKA 3B9KB 5B1CA 1A6ZB 4XTRC 2HT2C 3QJFA 3DC0A 4HS6A 4NYLA 4NHUB 3CAFA 3D3VE 3L3IB 4OIBA 3OMZA 3VXMB 3QORC 1R3JA 4I88A 5I30H 2EO1A 4MXVF 4MJ6B 1CBJA 1EHKB 4ZS6C 4JO2L 1WZKA 3CJJA 4JZOB 2WYHA 1J1PH 2FIKA 5CGBA 1QRNB 5L8JB 5KOMC 1TZAA 3D5OF 1U2CA 1XF4A 2GCYB 1ODAA 4KTYA 3RLSA 1M9SA 4NO0D 3M1OA 1JN6B 2ZOLA 4A6YB 1QW9A 3ILEA 4B50A 4BFEA 5AVUB 1IC5H 1JV2A 2WLMA 5D8JH 2FQFA 1MJUH 1EXHA 4HC1L 3ALXA 2BCKA 3R19A 2OSYA 1YNLH 1HK6A 3CXHJ 3MUZ1 4RNRB 3UH8A 3RWIB 1BQLH 2MMXA 4G43B 3C12A 5ENWB 2XV3A 3BKCL 1ETJA 2V9QA 5IM7A 2XIDA 1ZHLB 3GMMB 3QZBA 4F9PC 1KXVA 4YQXL 4NAQA 4HZLA 3V5HA 3PREA 4RGNB 1JPEA 5EOTB 1VSCA 3O4OB 5ALBH 3MMEB 3SYQA 1CTNA 2KZ1B 3ECUA 5I5IA 4XMPH 2ZWZA 1MCWM 4NM4L 4ZMXA 1HU8A 2DQFB 2HX8A 2F19L 5A2JH 3AADB 3FQWB 1NGQH 5EC2B 3DJ9A 5CGYC 2YGNA 1IGFL 5BRPA 5CEZL 4PHZA 1QASA 3GJFH 4JFWA 5CFAA 2XI9A 3SD2A 1TYJA 2OXHA 3O0RL 4HKXB 1YCSA 5JMRA 4APQA 2AJ3B 2JI3A 2WC7A 1OWWA 3PY9A 5DFVD 3OKEB 4PGJA 2VLMD 1H8SA 1JVKA 3BXNA 2H32B 4A7VA 1P9MA 5FCUL 5DJ2A 3OKMA 2YA1A 2WOYA 4CBZA 4K7FB 3QO0A 2LE9A 3B5GA 5IW6B 3MLYL 3MCLH 4QIRA 2OKMA 3BKYL 3QA3B 1ZLVK 3NDZE 3CE1A 4QRTA 5HGAB 5FPIA 2NY3B 2R69A 2ADGA 4NHCH 3RWJA 4UT9A 3MUUA 1E28B 1X7SA 1MIEL 3IJSA 4OB5L 3CVHH 2EKSB 5DFWH 4AIEA 4WHTB 5GS1B 2X1WL 5IBUG 3BQVA 2GSIB 1FUNA 5HHXH 3I9IA 5H94A 4FZ8H 3PWUB 2WCSA 1SYSA 1PFCA 5IIEB 4X99B 1FIGH 4PJDE 12E8H 1P7BA 4B9KC 3VFVA 1KFGA 2DL9A 2FO4A 4HWNA 5J6GB 2FHCA 2QKIA 4AXWA 2XWEA 1KXVC 4DP5X 4K3DL 4LCUA 1IAIH 4V2CB 4AQOA 3UTZB 2YQ3A 3DIVA 4KKCD 2E6JA 2W07B 4G59C 2EC8A 5KUMA 1J8HB 1Q1PA 4H2CA 1YMHB 2GJZA 3EDDA 3CHQA 3GDCA 4R90L 2F53A 5KANG 5GSRA 1F13A 4LDLB 4YZFF 1LNUB 5ECJE 5AUMA 1RIUL 1JF1B 4QYAA 1EV2E 3G6JE 2HN7B 1K3IA 1BJ8A 1T2QH 4APQC 5F7HA 1WQVT 4EZLA 1OT1A 4LNRA 5IBUB 3TPKA 1T0PB 2BY0A 1P9MC 3L08A 4KAQL 1U3JA 2EYSB 2HZHA 2MQ0A 5L0QB 4BA8A 2JF1A 1U8MA 1HILB