2EIZB

Crystal structure of humanized hyhel-10 fv mutant(hw47y)-hen lysozyme complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
QVQLQESGPGLMKPSETLSLTCSVSGDSIRSDYWSWIRQPPGKGLEYIGYVSYSGSTYYNPSLKSRVTISVDTSKNRFSLKLNSVTAADTAVYYCARWDGDYWGQGILVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-LYSOZYME ANTIBODY FV REGION
publication title Critical contribution of VH-VL interaction to reshaping of an antibody: the case of humanization of anti-lysozyme antibody, HyHEL-10
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 25
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2007-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eizB00
4G80A 1YUHB 4NM4H 3C08L 4OZHF 4Q0XH 3PDOA 1IEHA 4I5BA 4Q6IA 4M61A 3QO0B 3GMQB 2X70A 4NNPL 3Q0HA 5C70A 2BVUA 3NFPB 2WIIB 3MLUH 5SX4H 5IMKA 1SJEA 3TNNA 3L5IA 1T1ZA 4N0CC 5CZXD 1FLRL 1KB5B 4P9ML 2DQGH 3ZYOA 3NAAH 4XPAL 1F8TH 2CDFA 2VXUH 4DW2H 2YMXL 4FFWD 5SWZD 2KZ1B 2R4RL 1N5YH 2RIKA 4OZGA 3O2WL 3OGCB 3OB8A 3ZE0E 5FFLA 4M7LT 5IW1B 3BGMA 5FDWA 3WSQL 5GGTA 1WCBB 1QOKA 1TMCB 4G8FA 3TIEA 1QBML 4YE4L 2WW8A 5T1MA 4PV9A 2OTUB 1QSEE 2APBA 3QI9B 4ZUWA 1E6JH 4C83B 3U4BH 1S7QA 1RUPH 3CDYA 4L9LA 5T1KD 3V5KA 4IMLB 3DVIA 5I19L 1JWUB 4PJGE 5DMGC 5DJDB 3CZJA 7FABH 3WHE1 2IFFL 2FIRT 3GM8A 4X4YA 1KTLB 1GJIA 1JGUL 2D7PA 2GUOB 2NY4D 3C08H 2VISB 3IF1B 3QH3A 4MNGB 5ID0B 4UMGA 1F4YL 1UH4A 5TFSL 2FX8L 2EC9U 2HJKB 5CINL 3MO1B 3V6ZA 4NNPH 4R9HA 5IB4A 2Q20A 5IHBA 4X6DE 4HH9A 1VSCA 2D9CA 4CVXB 1N0XL 1CFNB 2DOCA 4Z9KB 4MA8L 1FLRH 1O7SA 4P9MH 5TGBA 1GHFL 2X4PA 3B83A 4TPRL 5B4MC 4XPAH 3CD4A 1FVDA 3MUHL 3ARYA 5C0AA 5I71B 2HJLA 4LKXB 5FGCE 3VFRB 3BISA 3BW9A 2R4RH 3FT2B 3ARFC 4L3AA 3O2WH 2H32A 1JL8A 1MHHA 3LHPH 5HI3C 4GRMB 4B5EA 3DYPA 5J7CC 5B8CB 4QRPB 1QTYT 1QBMH 4ONFL 4YE4H 1QR1B 1F3DH 1IFHL 2GFBB 3QUYB 4Y89A 3QFJB 5I19H 2X4NB 5KVMC 4JO3L 5GRXG 4OZHA 2ZOLB 5B3NA 2M8XA 2RBLA 3P40A 2IFFH 1GGUA 1JGUH 4X4XB 5TFSH 2CRIA 2FX8H 4E0RA 3OKEB 5HGAB 5CINH 5D7KE 3DXAA 1TIUA 4Z7VE 2V2TA 1MPAL 2L0DA 3UCRA 3SDCD 4KC3B 1PGRB 2I25N 3VW3L 2R0ZH 1N0XH 5DJ2A 3V6OA 3CSYA 2DQDL 4MA8H 5IVZB 1A47A 4MAYA 5FAAA 3GO1L 4JFDA 4TPRH 1UKSA 4JDZB 4UU9A 5F3HB 3OKKA 4DN4L 1MJ8H 2VZVA 3KDMB 4CJ1A 4NZTL 4HF5L 5IB2A 1S7WA 2DQFB 4WTXA 3VRIB 5EOQL 2QKIA 2X4QA 4PJ7E 3IFPA 4DAGL 5MP6L 4QO1A 3DI2B 5DK0B 1BECA 3ULVC 2PF6A 2D7MA 1FV1B 4ZG1A 1A3QA 3DOSA 2MMXA 3ARSA 4ZPTA 1I7TB 4XCYA 4Y4HA 2KBGA 3LIZL 2GAZA 4POZD 1U8KB 1XR8A 3V4PL 4BZYA 4KROB 3HE6D 1BJ8A 2Q7YA 5EU5A 1MCJA 1IFHH 1MCEA 3Q5TA 4K3GA 4M4RA 2IAMD 1RPQA 5E6ID 1KIPA 1OD9A 4NQDA 3B8YA 1FNFA 4Q58C 3MV9E 1UJ3C 1TZIA 3O2DL 1P4BL 2Y06L 4PV8B 2DWEB 4R4FL 5DMYA 1JTPA 1CK0L 4PRPD 5I75C 4HFWA 5CEZD 1X3DA 3STZB 4O2EA 2Z92B 2F58L 1MPAH 4WWKC 4NQCB 4RWYL 3VW3H 2CIKA 2EDOA 4HXAL 2DQDH 1Z6JT 4P2OA 5F7DA 3VU2A 3GO1H 4JJ5B 5CP7B 5E00A 3MA7B 4KRPB 4PRDB 4LCIL 4DN4H 1UYWH 3ES6A 4NZTH 4HF5H 5FA4B 5DJCB 5EOQH 2XTJC 4DAGH 5MP6H 2N4IA 3IKCB 4YHZL 4U31A 2AXFB 5IQ7L 5DTFB 4Y5YC 5C92A 4OZGE 3CFKB 3KPRB 2J8HA 1ZLVH 3ZDXE 3IS0X 3LIZH 1IGJA 3V4PH 5F96L 1KJ2B 4L8DA 3D18B 2X7LA 3BRGC 3O41A 4JJHA 2EYRA 1U8PB 3OKOA 1M7DB 5J57B 5B22A 2WANA 4TVSa 2LAAA 3MLTB 4S0TD 1A6TB 3O2DH 1I1AD 1P4BH 2Y06H 1NFDB 1CK0H 1UEYA 3IJHB 4U6YA 4R26L 3GIVB 1HINL 3QR2A 2F58H 4FXGA 2VZ1A 1DFBL 4JQVA 4RWYH 2AGJL 3SN6N 1KNOB 5E70A 3CX5K 3QDGB 3QPQC 1JNNL 4PLJD 3RNKB 2RGSA 2EIZB 3QUZC 4NM8L 3BZDA 3OHXA 3SEPA 2VUYA 4LCIH 2BVPA 4H5SB 4Q9CA 4WW2C 5IF0A 4LU5L 3HMWL 2W1NA 1XGUB 3PL6B 1FZJA 3WJLC 2HLFD 1H8NA 3TCLA 2BVEA 2CKBL 1FFNB 4EXPX 4U1KA 2XRAH 4Z0XB 1FSKC 1P1ZA 3VXNB 5IQ7H 5DRZB 4IRZL 2Q3AA 1J1OH 4HUWA 1C16B 3MRLA 2DI8A 3RP1A 1LD9A 5E9DB 1T0MB 4ODVL 4OLVL 5F96H 1W8NA 4PJHF 1J8HB 5ID1B 2C5DC 2UWEB 3BAEL 4AQ1B 1ZANL 3HNVL 3IXTB 2XWTA 4A2LA 2PR4L 3WEXB 4Y1AD 3FN0L 4P46B 4TN9A 4Y8AA 2JJSA 3R8QA 4FA8A 3TH2T 5J11C 4OZHE 3IDIB 4GKZB 4LSTH 1DZBA 1OLZA 5ITBL 5D7JB 1K3ZA 4OAWA 4RGNB 3SGJC 2WBJA 1U8HB 1MI5A 2DTSA 1QKZL 5TDNA 1IMHC 4XNQB 1QG3A 1MCKA 1DFBH 5BJTB 1U8MA 1U3ZA 5KOVC 3DXAE 4PB0L 4YDVB 2AGJH 5ILTL 4Q74A 3GI9L 1VPOL 5FM8A 1JNNH 4MJ6A 1E6OL 4KQ4L 4GXVL 1LK2A 4P2RB 4AT6B 1XR9A 2AJYL 5CIPA 1U8IB 3L5WB 1WWAX 3HMWH 3R06B 4JFDE 5EU6A 4F7MA 2ESVA 2B2XL 1D5BB 2CKBH 1DBJH 1RI8A 4LKCA 3I6GA 3C5ZC 1ED3B 5DUPL 4HULB 4HC1H 3EZ8A 4FQ2L 4IRZH 3SO3B 5F1IA 4M00A 3U46A 4NUJB 3MLPA 3K80A 2FX7L 5DS8B 4MNQB 4OLVH 2ICCA 5I8EB 2OX5A 3EO1B 3BAEH 2YOCA 3KG5A 3CVHA 3HNVH 5DMGD 1G7JB 1AGBA 3TZVD 2PR4H 1S7VB 1EV2E 1ORSA 5BRZA 4F33B 5ITBH 5DC4B 1EFXD 3MNVB 4NQDE 3EOTL 1D6EA 3FQNA 3KPRE 2OS7A 1FLTX 1RIUL 1AQDA 4PD4J 4MGXA 3ME0A 4J3TA 3KYKL 3VDCA 1NL0L 1CDHA 5ILTH 3ULUL 2G5RA 2ORBL 1VPOH 3HRZB 3GI9H 1DBML 2VLRB 4XP1L 4XVTL 5B4MD 4ODWA 5BVJB 1NGWB 3DMMC 4GXVH 4HAGA 4I3SL 2BY0A 4FHBD 1ND0B 3C5JB 2AJYH 4YEFA 4HGWA 1D9KB 4Y2OA 1NFDE 3ARFD 2D4FA 3PWPD 4P5KB 1JNHA 5JR1L 5HI3D 2VLMD 3CDGA 5DUPH 5E5RB 4FQ2H 1KXVC 1B4JL 1ZMYA 1N3NA 4PJHA 1WLHA 3WE6A 3O6LH 4G7VH 4TSCH 4P3DB 3QDGE 2BSRA 2FX7H 5IBTL 4PJBB 4XBGB 3FKUS 3G08A 2EDXA 3MBEA 4ETYA 3W0WB 4OT1L 4GSDL 4FQXD 1H3VA 4HDIA 4D0CA 4HKXB 1XF2A 3PWUB 3P9LA 4RIRB 1IKFL 1GAFL 4AH2B 4QHUA 1RURL 1KLGA 4PY7B 3LSOB 5EOCJ 1MCHA 1R5WB 3EOTH 4Y7MA 4C59B 4X7SL 5F9OH 1RIUH 4Z77B 1EZVY 1YN7B 2DBLL 5EULV 4MQTB 2DLIA 4O9HL 3KYKH 2XG4A 3C2SA 1H8SA 1NL0H 2KL6A 5F9WC 5GJTL 1WF5A 3AMKA 3G5ZB 4LOUC 3ULUH 3OBAA 4U1SA 2XYCA 2ORBH 3T4AA 2A77L 3G5XB 2RB8A 4XP1H 4XVTH 3DVGB 4LBEB 2R0KL 4Y5XC 4LCWD 3PDDA 4OD3L 2GYSA 4LCYA 4I3SH 4M7KL 2PUQT 3UXFA 1UG9A 2J5LC 4JPKL 1FFPA 3T1WA 4OGYL 1SBSL 3ULVD 4R0LA 2XN9D 3CC5B 3EYFA 1JGEB 4MD5B 1JPFB 4PP1C 5DMJB 5TE4L 4FFVC 1B4JH 4WUUD 5JLZA 1CD1B 5E8NA 5ACLA 4I77L 5C0JA 3CZFB 3EFFB 3L7FB 5IBTH 5IG7B 4FXKA 3S96A 3LV3A 1G7MA 3PIQB 2B20A 2VDRH 2VL5A 4OT1H 3FONA 1AKJA 3Q2CA 1IKFH 1GAFH 5GSRB 2YPKA 2EDTA 4LDLB 1RURH 3QNXA 1A6ZB 1T21B 2LU4A 3NIGF 4HZAA 5E2WL 3P4OB 1Z9LA 4D0DA 4Q2ZA 2Z31C 3TBTA 1OSZB 2QV2A 3VA2C 3E0GA 4X7SH 2O5YL 1BP3B 4GKOA 2NY5C 3BQUC 5GRZA 4O9HH 4J8RA 2X4TA 5HYQA 1NUGA 3ZHDA 5GJTH 1MI5E 4RX4D 5DHVH 3MRPB 4ZQKB 3QRGL 5FIEA 3RIAK 3VRLE 2R0KH 4DVBA 4ZUTB 3OJ2C 5GS1B 4OD3H 3PJSB 3QIUC 2VAAA 1EERB 5GGTL 5GS0L 4M7KH 2JE8A 3T3MF 3FQWA 4P5MA 2F9BT 2XTJD 4JPKH 4ZUUA 1P7QB 4OGYH 1SBSH 1JZ6A 1A22B 2P5EB 5ITFB 1GGIL 4MXWL 3HE7C 3SGKC 2QSQA 2XPGA 1YMMA 1CGXA 4HKZB 5TE4H 1KENL 1V7ML 1MJJA 1NUDA 3V0VA 1BVLA 3B9VA 4IMKC 1U8JB 4QGYA 3DV6B 1IAIM 4M5YL 2YRPA 5I1KL 5KW9L 4PTTB 3QA3A 5DMKB 2IBBA 5EC2B 1RK1A 2X40A 1R3LB 5EOCH 4O00A 3WNLA 3ZMRA 2CGRL 4OF7A 3QEHA 4PYHA 1CI5A 5I0DA 2ZCKL 1SY6H 4JFYA 1QFWL 3CX2A 4ZDHA 2VUOA 1G1CA 4JFQA 5FCUL 3GBNL 2ATKB 1SEQL 1CVRA 2O5YH 4JRYB 4P5TC 3GRWA 1JPGA 2AEWA 3BN3B 3RUGB 1H5BA 1V5JA 2DQTH 3V5HA 1KPRB 2GK0A 3QRGH 3BDYL 5GRWA 4HIXH 3QUZD 4XMLH 4POUB 4NC0B 4YO0B 3DV4B 4MJIA 1J0JA 3RPKA 1X5KA 1OAYL 3HI6L 1FORL 2BSTB 4WO4C 5GGTH 5GS0H 3V7AG 4X5WB 4RNRA 4PD4K 1D5MA 4P48A 2GTZB 4MXWH 5BQ7A 2FZ3A 2D7OA 3BP5B 1C1EH 1ZHLA 1KENH 3KR3L 4JPWL 2EDYA 1V7MH 3BWAA 1MEXL 2HFGL 3UAJD 3O3DA 4BELD 3O4LD 1S9VA 1OY3B 1Y6NR 2FYYA 3WD5L 3BZEA 1VESA 4YFEA 1MQKL 3ILQC 5I1KH 4PJHE 5KW9H 4H0IA 3GSXB 1FN4B 5F7KC 1A7PL 2EO1A 2PTUA 4F2MB 2CGRH 2HH0L 3TF7C 4P23B 4D8PB 4L3EB 3WN5B 5ISZB 5D6CB 5EWIH 5FCUH 3GBNH 2Y5TA 5BOZG 1SEQH 5EO9B 4M03A 4ESKA 2XQBL 1FL3A 3GMRA 4D9LL 1IC5L 4KDVA 3DTXB 3MV7D 1QO3A 5AYUH 3O9WB 3LS4L 4JY4A 3BDYH 4AEHL 2DQUL 3A0OA 1QNZL 2F74A 2H32H 3CPLB 3MCLH 1UWEL 1LDSA 1ES0A 4HZLA 1FH5L 1AQKL 1OAYH 1FORH 3BEWA 3HI6H 4UTBL 4OF5A 2CR3A 5F71A 1Z0NA 2C1OB 2GCYA 3S3JA 1ZLSL 1P2CA 1G9NL 5FYLE 3WKNA 1DCLA 5D1ZB 3QHTC 3SDYL 4YGVA 1MCCA 5J6HA 1T22A 4NBXB 1WIUA 4JPWH 3ROLA 3V7AE 4RZCA 1NBZA 1NEZA 4JCLA 1OTUC 1G0YR 2HFGH 1FZKB 5E8EA 4X9FA 3RA7L 4GG6A 3WKML 5IIEA 3WD5H 4BSVA 1KIUA 1MQKH 4QF1A 3PP3H 4KUZL 4LLVA 1J7VR 3DUHA 3ZKMC 3HCVB 3BD3A 2BOBA 3HB3C 1AXSA 3SJVB 1A7PH 3K7UA 3CGTA 1AD0A 1IGYA 1RY7B 5I6XB 2VR9A 4LSRL 4G8GD 4Z76A 5LGHL 3WO3B 1U2HA 1FVEB 3O3BA 5CP3A 1NBVL 1MHEB 3X13B 5GS3A 5F7NC 4KTDL 4KDTA 4CBPA 1A7QL 3WNOA 2LAGB 3BIAX 3KPTA 2NY6B 2GITB 2XQBH 3QDMA 1GGYA 5C08A 4D9LH 1BJMA 1IC5H 3ARUA 3PWJB 3ARWA 5D1XB 2NX5B 3MRMB 2DQUH 2R8SL 5DJAB 1QNZH 3DMMD 4JQXA 4EDXB 2O26U 5LXGL 1UWEH 3OJDA 3MRRB 3OXSA 1AQKH 4UTBH 4D3CL 5F70A 3TGXA 5GIRB 1G9NH 4M6OH 5MI0C 1FYTB 2AJZA 4O2FB 4WEUD 5DUBB 3MYZA 4JRYE 5HGHA 1ETZA 4PJ8A 1S8DA 1OWWA 3MFGB 3HZYA 4K94L 1CDIA 3KS0H 3VXQB 3IS1X 4LHJB 3WKMH 2EEDA 2MWCA 3RX8A 1WWWX 1T1XB 5FUCE 3E1F1 4XMKH 4QRQB 2VZTA 3DJ9A 3NFSL 2AQ1A 1NC4D 4F37K 5FYJE 1NDGA 5IHZA 4TTGA 5LGHH 4QOKB 5EZJB 1NBVH 1NJ9B 3X11A 2B5IB 4KTDH 4K8RH 4L9DA 1A7QH 4WHCA 3FOMA 1UQSB 5DRNB 2WAHA 1NC2D 3MJGX 2DYPD 1MVFA 1MOEA 1V3MA 5HHVL 2CR6A 4OM1L 2PW2A 5E7FA 1MJUL 5F1NA 4LCCB 3T2OA 4LOUD 3UMTA 4U49A 2Z35A 3QUMA 1PKQB 3PP3K 5DQ9A 5IK3A 1L9NA 2Q8BL 4K7PX 2DIJA 4RMWA 4Z18A 2O61B 1BFSA 5D93C 1CFQA 4PJCB 3AS2A 2J1KA 4X7TB 1RMFH 4P57B 3FT3A 5DJ0B 1L6ZA 4D3CH 4DUWA 1WZMA 2BNUB 3MX0A 4MJIE 5ISZE 3U4EB 5TH2A 1VGKB 2CDEB 4P4RA 4PP1D 4GW1B 3HZKB 3D25A 3CDCA 1F4AA 3PWVB 1NEZG 3QJHA 5ESQA 3SE3C 1PEZA 5EFIB 4K94H 4G9FA 2CRYA 5L2KA 2FJFA 3AFLA 3UTTB 3LZFH 2R15A 4R7NB 2DQJL 4L8CA 2XI9A 3TT1L 1HQRA 5ALBL 5ICZB 4HSQA 3NFSH 2WLZA 1HHIA 3GMPB 3ARBD 4ZFFA 3WUWA 5ABDE 2PW1B 1LE5A 3P9MB 5CBEB 2ITCB 3U6RA 3FB7A 2AEPL 3MROB 4JY6A 3NIGE 1LHZA 1KFAL 2Z31D 2W0PA 4XCEB 4CVWA 3MRKA 2R23B 3BQUD 1YQVL 1B2WH 1IRAY 2O5ZL 5HHVH 4OM1H 1F4WL 4KKAC 3P0GB 1TQBC 1MJUH 3VFVA 2VLKA 1EAJA 4FQJL 5TDPA 2YD1A 4LVNC 2BOCA 4JN1L 1YYML 2I07B 3QIUD 3VXSB 4WWKA 4NQTA 1I1YA 2A73B 5DQJB 5D2LF 5E95B 1EBAA 2FSEA 1GVIA 1P69B 3RPIA 5CBAB 3U48A 1DEDA 1I1RA 3DRQA 5JA8B 3HE7D 2E5EA 3REWB 1DL7L 1T7YA 1NCBL 1MLCB 4C4KO 4K7PL 1L0XA 3CVHL 1UM4L 4F7TB 3QG6B 2OXGA 1UA6L 1VFBA 2DQJH 3PV7A 4Y5VA 2EC8A 5HGBB 3SCMB 5DF0A 3TT1H 3T0EA 4WV1A 4GG6E 3HG1E 2F53D 3V6FB 2P5WB 5FKPB 1RZKL 2ZUTA 1FYTE 3RY6A 2BHZA 4HBCH 3WL9A 2OM5A 5KN5A 1U3HC 2AEPH 3OB0H 3TVMD 1KFAH 1CDUA 2WM0A 5C0IB 4APQC 1YQVH 1Q0XL 4I2XA 2O5ZH 3K8KA 4PLOB 2YSSB 2C3GA 4JDVA 3B9KB 5CIPH 4OD2B 3QDME 4FQJH 4YDIH 4X9HA 4XNMB 1BIHA 1JF1B 4OGZA 5IQ9B 1HXYB 4GW4B 4JN1H 1YYMH 4EJ1C 2ERJB 4WY7L 4WO4D 4QOKE 4ZSOB 5KVDL 3FQXB 4ZFOA 3RL2B 2EDDA 3HPLB 1R0AL 4X5XB 1BFTA 5INCB 3C6LB 3FL7A 4PG9A 1DL7H 2Z93B 3GGWB 1NCBH 4K7PH 3CVHH 2NY1C 5CGMA 1UM4H 1I8KA 5EBWA 1KCKA 1OAKL 1UA6H 1FO0L 3WJLA 3DLQR 3ILQD 3GKZA 4KKNA 3G6JF 2CLRA 4KRNA 2E8ZA 3WUWG 5C0BD 4YPGA 4L4TE 4NO2B 3SE8L 3SGEI 1OAQL 2H2SC 2PN5A 1RZKH 2NLJB 5D1QB 3D6GA 3AM8C 4PG2C 3C8KB 1CDGA 4PJEB 1XGPB 5H37G 2Y25A 1JN6B 5KAQF 3UTSD 3UTTE 1QLRA 4NKMA 1BHGA 4YGAB 1BF2A 5FYLL 5ADPL 5KSAB 4LMQI 3FFDB 3QNYA 4LNVA 3RVVD 1JHTB 4LLWB 5D2LA 3SDAB 4PJXB 3LVEA 1FGNL 4NKDB 5IVXB 5KVDH 4ELMF 3GFUA 4PJ5B 5BZDA 5KZCD 4LPTA 5FYKD 3VWJB 1EVUA 1ZLWH 3DVNB 3LN5A 1JP5A 3FFCD 4OB5L 2YD2A 3D39A 3VI3E 3OB0K 2A74B 1XF4B 2F54B 1D3CA 4XHJC 1K8IB 2UZXB 5ESAA 1BFOB 4JFHE 3KPSD 1TFHA 5C09D 4ZAKA 2NZ9C 3ZKMD 5KVGL 5GISL 3IDMA 5L2KE 1CTNA 1QUNA 2L4OA 5A16B 3ARGD 1TQCB 5I18L 1XF5A 2BVQA 4UILL 2D31A 3DSFL 1MIEL 3SE8H 3HR5A 1F00I 2SEBB 1OAQH 5IT2L 4WFGE 1XH3A 2E7MA 3RJDA 5C07D 1JNJA 2PXYA 4ODUB 3U30B 3QULA 5FYLH 5ADPH 3EIFA 3VXMD 5MENB 3WNPA 4XAKE 3HZMB 1INQA 2XKUA 3VXPB 4CVZA 2CDGA 5C0CB 3IU4L 2VLKE 5HHOD 3FO1A 1FGNH 4NPYA 4JFEE 5GS2H 5JXEC 3DVFA 2HT3C 2CIIB 4V2CB 2DAVA 2UY6A 3VDAA 4OB5H 3U0PA 5KSVA 3GMMA 4MCZA 5FYJL 2VLLA 1CT8A 3PDOB 4N0YL 5F3BA 5B39B 3G6JA 3WMSA 3NCEB 1XMWA 3QXAA 2GJZB 5GGRB 1EEYA 3CDFA 4DQOL 2AJUL 2ARJB 2AK1H 5KVGH 5GISH 4HIJA 3KGRA 1KUMA 4OFDA 5DVMA 1CL7L 4ZO6A 5HJ3A 4TVPL 5I18H 4UILH 5E08L 3DSFH 3U9UA 3IDNA 2E7LC 3GRWL 3T0EE 5IT2H 2OCFD 1B3JA 1G7PB 4M02A 4ZUSB 5SWSA 3I6LD 3RVWC 3F7PC 4NP4L 1ZLWK 3RGVB 3AREC 5AG8A 5ETUB 1X5JA 3TN0B 5EOTB 2PYEA 5DO2C 1F3JB 1ZOXA 2CKNA 2A0LC 1KJ3L 1RJZA 5A3ID 1XGRB 1BX2A 4Y4FC 2QSTA 3D1MC 4I2XE 4OCXL 4HG4K 4ELMA 1D5XB 1WC7B 4Y19D 4BQ8A 1WFNA 3VFOA 5BVPL 4HQQL 3WV0A 3IU4H 1ZHKA 1Z2KA 2X6MA 3ARTA 4LLQB 5HI4C 1GL4B 3H3BC 3V5KB 5C9JA 1ZA6B 3F6IA 4PJEE 1AO7D 4J2XA 1M7IB 4NN7C 3FB6A 4Y2DC 3V2AR 5FYJH 1BVZA 5E7BA 4N0YH 5L6YL 1XCQA 5AAWA 2GHWB 5EZIL 5I73C 2HFFB 3O81A 1MVUB 1A6PA 4X99A 5F89B 4DQOH 1JWSB 2AJUH 3C5SA 4NWUL 2J7LA 4KKLC 3JWOL 4JO4L 4U1HB 2E9JA 1A2YA 1CL7H 5T1LD 2V2XB 1QACA 4TVPH 5D72H 5IVXE 5H35A 3ECBB 5E08H 4QEGA 2BNRD 4RISL 4ZYKB 5TF1L 5FO9B 4FFYH 4OZ4B 5C0AB 1R24B 2ZSWA 3EOAB 4IS6A 4U4BA 3O6KL 4YBLB 3VH8B 3O6FA 2PO6B 4Y16A 2D7NA 4X8JB 1OF2B 1MCRA 3MUZ1 4KKAD 4V1DB 2E6QA 1BZQK 1J0ZA 1KJ3H 4JKWA 4R96B 4A2MA 2GI7A 1TVDA 2VAJA 4OCXH 2D0HA 2FO4A 5BVPH 4HQQH 5EU4B 1RIVL 4PRHA 4CJ0A 4XZUB 1OGTA 4LHUA 1XGTA 1RZ7L 2IGFL 5E8PA 4L29A 1ZT4A 2JB5L 3QWOB 5D2LE 5JPMB 1WBXB 5TJWK 2C1PA 3ZTJG 1I4FA 4QHMA 4Z78B 2ZSVA 4XXCA 1JPTL 1SEBB 3NA9L 3CH1B 5L6YH 4WHTB 3OXRB 2A1WH 4GQPH 3MQIA 5K9QI 2V2TB 4ZOCA 3FZUC 5A2IH 1RUAL 4NWUH 1ORQB 3QXDB 1HSBB 2EYTB 3JWOH 4JO4H 5HYIA 4P4KB 3P4NA 3GMLB 1BQHA 4LCUB 3WFZA 1T5WA 4MLSA 5DHYB 4G6FB 2IH1B 5DRWA 5GGUA 4S1SL 3F58L 1H3XA 5GPRA 3N1GC 4RISH 5C0EA 1AGDB 2JF1A 1T6VN 4APQD 5GXBB 2EYSB 3ZT5A 4X6FB 1W0VA 1A02N 4UNTA 2MTPA 2QQLL 2OL3B 1WWBX 1AP2B 2V6HA 4LEOB 1HILB 4XCYB 4GBXB 5CGYC 1XR8B 1EA9C 3T1FA 4KJYB 1TXKA 4I0PC 3RWGA 5DFTA 1RIVH 3P73B 3VD5A 4AIZB 1IJ9A 3TBYB 2IGFH 1RZ7H 2JB5H 5EUOF 3PNWB 4U2ZA 1U42A 4DKAA 1V3JA 1A6WL 1OW0C 4O02L 4PGCA 2VLJD 3PQYE 1VFOA 1JPTH 3MODL 2R2BA 3NA9H 3PHOB 5MEQB 5FXCH 3MRNA 4LEXL 5EO1B 5H94B 2NY1D 3VG0L 3F7YA 2H8PA 1AFVL 4R7DB 5FF6B 5CD5C 1HCFX 4TTDC 3MGTB 3D3VA 4PRNA 5D5MB 1RUAH 2NY2B 3G6JE 3JUYA 5CP3H 4KI1A 1I3GL 4KVCL 4WWID 5DDHB 5TQ2H 3KYMA 3VFWB 4GJTB 4JQIL 4J23A 4MD4B 4MMZC 4LVHC 5IKCB 4JREC 4NIKB 2H2SD 4M8QA 5HYJB 1V3KA 3F58H 4U1NA 1QRNA 4ORGA 3O3EA 1IQDA 2CUHA 3OZ9L 3HPJB 4JVUA 3X14A 2UV3A 1SYVB 3ZSTA 3QUML 4U1GB 3ZHKA 5IEHA 1WIOA 5SWSE 4AYFA 5I1LA 2QQLH 1R3HA 1S3KL 2GJ6D 4ALAL 3G5YB 2PYEE 2APVA 2DLGA 2XICA 3GMNA 1T83C 3BGAA 5L0QB 3LD8B 4LNRB 3GUTA 3RWHB 3QFJD 4S10A 1QHOA 2C3XA 4JM2B 1DUYA 4GG8A 3W39B 4ELME 1ZHNA 3B8SA 4HX1B 1TCRB 1A6WH 4BM7A 3WYRA 4O02H 4W70A 2JJTC 1IAKA 2OJZL 2WV3A 3FQRB 3MODH 1L7TL 3MNWB 1DVFC 3PGDB 1ZHBB 4LEXH 3W82A 3VG0H 4IRSC 1K6QL 1BQSA 1AFVH 3BPOC 3H3KA 3ZDZF 1U3JA 3FOLA 1AI1L 2AXHA 4M7ZB 1J1XL 1Q9LA 3QHFL 2VR4A 4EI5C 4JQIH 3QPXL 2IBGA 4AL8L 3OTTA 1RZJL 2IANA 3BN9C 4IDLA 4M8VA 4RQQA 4AY0A 2OBGA 3GI8H 2ZUQB 3O8XC 5ELIA 1OGAA 2VQ1A 5DURB 4XCNA 5E5MA 4U6HB 3PP4L 1S3KH 4ALAH 1P1ZB 2IQAB 1NLDL 1MCWM 3MRIA 1Y0LA 2BJML 4EDWL 5JOEA 5EUOA 2R0WL 4DUVA 2YC1A 4NN6C 2BMKA 2MHAB 4BSWB 2HT3D 4ELKA 3SGDH 4YDKL 4YHNA 2VOTA 2YBRA 1NQBA 1KCVL 3QFDB 4PRHE 4GUPB 4X7DC 4MB4A 3QIBB 1ZSDA 2JIXA 2ADJB 4CDHA 4S2SA 3D85A 1KACB 1L7TH 3GSRB 5EBLA 5T3ZL 1A9EA 2R2EA 4JEGB 1K6QH 12E8L 5FKAA 5FM4A 5TDNB 3JSSA 3PV6A 1JMXA 4EUPG 3L3KB 2X5PA 1AI1H 1EXUB 3KXFA 3DUUB 4NNXB 1J1XH 3QHFH 1KCLA 4BFGA 3QPXH 4WW1B 3SKJL 4AL8H 1MCDA 5H37H 1PG7W 4KRPD 2OQJA 3GK8L 3BSZL 4X0KB 4JFXA 5E8DL 3RVWD 4GRLC 3ARED 1UGNA 1WT5C 1RZFL 3MTRA 4F7MB 5DO2D 5BZWB 2UYLA 2VC2L 5EBMA 5TE6L 2X05A 3BKCL 4RAUB 5BV7L 2A0LD 4G8EB 3IDJA 4ZFOL 5HHQB 1NLDH 3BMVA 3L3GB 1G6RA 4YQXL 4Y4FD 1L0QA 5SWZB 3ZO0A 4EDWH 5T3XE 4U6XA 4J4PD 5IROC 2J8UF 4C4KT 1V8HA 4EN3B 5HYJE 5HI4D 5MEPB 1BZ9A 3NBNA 3VJ6B 2F15A 3BX7C 4YDKH 1AGBB 3QCTL 1KCVH 4FFZL 4Y2DD 4HUUB 1SJHB 1LEIA 2NW3B 4C55A 1U8LB 3N1FC 3LDBC 5T3ZH 3T2PA 3ZE1E 1UB5A 1W72A 5T1KB 4WHYH 4I9WE 1N4XL 2R2CA 12E8H 4MD0B 4QXTA 5FOBA 1AQDB 1TVBB 4ODBD 2BVOB 3LKRB 4WENB 4KKLD 5D4QA 4HCRA 4K3DL 3SPVA 3WJJC 2OSLA 5I8OH 2NY4B 1RZGA 2FCBA 3BYTA 5JW5A 1HDMA 2B1AL 3SKJH 3FN3A 4X6CA 2XWJB 1UWGL 3GK8H 1NEUA 3BSZH 3O4OB 1ZT7A 5E8DH 1TNNA 2IC2A 3I75B 4HJGB 3PL6D 1RZFH 1UZ8B 1LO4L 1ERNA 2Z8VC 4HFUL 2VC2H 5TE6H 3T08A 1HNGA 3BKCH 1QEWA 5BV7H 3C2AL 4R90H 4I48A 1TZHA 1QPXA 4YQXH 2JJUA 3QUKA 5C3TA 5HVFB 4WNQB 3ZKXC 3VCLB 4NHCL 4PJIF 4F9PC 2FLBT 1GPOL 1PYWB 2R4SL 5JDSB 4G42A 5LGJB 3SDXF 3EFDH 4HLZG 4P46D 3VXRD 2DI7A 3QCTH 4XGZB 4FFZH 3MNZA 4QY8A 5C0NC 4YK4C 1I3RA 2BNQD 3AXLB 3QQ3B 3SKMB 4YHIB 4UUJB 5I8CB 4HS3B 5MEOA 5FYJU 2EDHA 3OKLA 2FX9L 1N4XH 1UXWB 3ELAT 4N90D 4NRXB 1LO5B 1MF2L 1WV7T 3FZUD 1T6WA 5ALCL 2NTFA 3P11L 1JI1A 1LK3L 4GH7B 4K3DH 3RTQD 3KPQB 5C6PB 3C60C 1JZ4A 1I7RB 1S7TA 2D2OA 1UWGH 1NCUA 5B3JE 3BWUC 3OMZA 4AM0A 1OB1B 3LQZA 4ZXBA 3SDCB 7FABL 1KJVB 4G6ML 4RFOL 5CJ8A 1FFPB 5KS9F 3UYRL 1LO4H 1G1YA 3D0LA 5IP4A 5CJXC 3SE4C 2X4SB 2FNBA 4CNIB 2IBZX 4C57C 3C2AH 4X9BA 2ZPKL 3WS6C 3GSNA 1OGAE 1GSMA 1TETL 2J8UA 2WUBH 2WQ8A 3LKOB 4LSQL 4HK0A 3TA3C 4N1CA 4B50A 5LQBL 2AABL 5JIHA 2DKUA 4I0PD 4Z7UF 4JRXA 4WEBL 4QRRD 2J12B 5BXFA 1HSAB 1IARB 4D9RD 1UFUA 2H2PC 5EUOE 1E4XI 5GGVY 3VWKC 3N9GL 1HH6A 3QRFM 4AEFA 1NGXA 3HE6B 1T3FA 3MLXL 5ESVA 3VD3A 1N2RA 1S7XA 1CE6A 5D7LD 1UXSA 4L8SA 3TBTB 1G0XA 4YNYB 2IAMB 2V7NA 5E1AB 5E6IB 4G3YL 1FG9C 1PSKL 1MF2H 5ALCH 2FHFA 3P11H 1LK3H 4J8RB 4KI5C 1BVKA 4YBQC 2Z9TA 1GGBL 5J9PB 5IW3A 2HFTA 5JNYA 3PHQA 1C5DA 4PRPB 3K8MA 1S7SA 1IM3A 3KXFE 4PFEA 4Y8DC 4NYLB 3FQWB 3O0RL 2D4DA 5HHMD 5F9JA 4RFOH 4G6MH 3W9EB 5J3HC 1YC8A 1JV5A 4UBDD 1IAOA 5MERA 4Y4KC 1FGVL 1TETH 4PJIA 3LS5L 1YN6A 4LIQE 4NO3B 4CMMA 1FL5B 5LQBH 3BP4B 2AABH 2DL9A 3D2UD 1K4DA 4FTVA 3SDXA 5JIPA 3E3QE 4MDIA 1U8QA 2YRLA 3DX9B 3TNMA 4UT6H 3WLWC 3ZTJH 4A6YB 4WEBH 3W0WD 3UDWA 3QA3B 5IFHL 3V9FA 5HYSB 3OKMB 4LLMA 3RBGA 1XIWD 3N9GH 4BA8A 1T04A 3KPNA 3NZ8B 1MCBA 3BEVB 3IU3A 2BDNL 1KIQB 3MLXH 1KN2H 4ZTOL 2R0LL 4FQHB 5IB5B 4OM0L 3TCXA 4G3YH 1FVCB 1A4KA 4BK4A 3FRPA 3ZDZE 1IKNC 1GGBH 4EI5D 3JTSB 1I1AB 3V5HB 1FFQA 1ODAA 5IJKC 3EYVB 1K5NA 3BN9D 5KS9A 4DCQB 3MLRL 1EHAA 2X89D 3O8XD 1EVTC 3R0NA 4X6CE 3BYYA 2YPLA 3UJTL 4RNRB 3QQ4B 3QEUB 4NQSA 4IRJC 2FZ3B 1FGVH 3L5JA 4Z7UA 2OI9B 3LS5H 4EBQL 1WFOA 3DX7B 1JUFA 3IJSB 1PZ5B 3HC4L 2EDKA 1CLOL 1XF1A 5HBBA 4YH6A 5C2BL 3DETC 4NZRH 4DFHA 4E42A 4WGWB 1OWRM 5IFHH 3T4YB 43C9B 3CLEL 4H1LA 1IAMA 4IM8A 1KT2B 5F88A 2P1YA 2K9UA 5EU3A 2R9HC 1F2QA 1HQ4B 4GKNA 4JHWL 4ZTOH 4OM0H 4G9DA 4ENEC 4PREA 4JZNA 4MZ3A 3RVXC 3GMRB 1CGWA 4Y1AB 1T2XA 4Z5RA 4OLWL 1HYSC 4L8BB 4OFPA 5IBUG 1YYLL 4HKJA 2F74B 3WS3A 4XP9L 2V5MA 5T3XL 4M1GL 4ZOEA 1Q94A 4GRLD 3VG9C 3T77A 2N7BA 2NY0C 3MLRH 4NQEA 5B38A 1E4WL 4R4BB 5DVNA 3TZVA 1FCCA 1K4CA 5LWYL 1SVCP 1H3GA 2P5ED 3UJTH 3GNML 3O11A 3P3YA 1FL6B 4JG0H 2X1PA 4PJDF 2H9GB 4HEME 4C56D 3D0VA 4MWFB 3VFMA 5DFVC 1N7ML 1F3RB 3HC4H 3MFFA 1CLOH 3MGOB 2J8UE 5C2BH 3DX8A 2YUXA 3KLAB 4K55A 3SKUD 2QJDA 3CFCL 1AGCA 5DRXA 5HDBF 3QIWC 3CLEH 4CL7A 3C6SB 4OJFL 3IETA 5EU7E 3WNNA 4GLRI 4Z76B 1I9RL 2CUMA 3MRGA 5INDB 3RWJA 1CFSB 4JHWH 1UM5L 1FC2D 4KXZH 4NQXA 2BC4B 2Q76B 4NO0D 3KPLB 2EH8L 3FRPG 1B0GB 4ACPA 3O45B 4PPTA 3FB8B 5L2JB 4OLWH 3BESR 1GZQB 1EFXB 3BPCA 4IHOA 4J3WA 1QQDB 4MA3A 5DK3A 4OF8A 4XP9H 5T3XH 4M1GH 2HP4A 3BH9B 1XF3B 3QBTB 4FQXA 4HWUA 3J7HA 4JB9L 5LWYH 5GQBA 3GNMH 2EH7L 1DQTA 1X5GA 4F7EA 3EHBC 4LRIC 3LN9A 4P3WA 3IGAA 4M5ZL 5IJVA 4XXDA 4BUGA 5AZ2L 2VDKL 4WHDA 2A6JA 2HA1A 3ARFB 3PWPB 1W0WB 3FAWA 2MSPA 4H1LG 4OKDA 3V95A 3TO4C 2AXGB 4P23D 1AE6H 4IOSD 4OJFH 3NCYP 4XC1L 5C0ND 3X12B 5HPMA 3U9PL 3MPCA 2J3SA 4NOBA 1I9RH 5E99L 4L3ED 3MRHB 4JO2L 2DJ4A 3E2HC 5C0FA 1BGXL 4I18C 2YA2A 3PABB 4WFEE 2EH8H 5HD8C 3L3HA 1DQDL 2HN7A 4DKEL 5J1AB 5D7IB 1QVOA 2PW2B 2HYMA 4WUUA 3WLBA 2R56L 4LMQE 3VFGL 1N5AB 5TF0A 3FT4B 3GBMH 4UT7L 3RZCA 4FNLL 3AROA 5B38G 3FJTA 3SOBL 3P0VH 5E5UB 5JO5B 5I1EL 4PJDA 4JB9H 3LKQB 5KS9E 5IB1A 2VN7A 2EH7H 3BO8A 3QO1A 2DL2A 3DRTA 4LCWB 3HNSL 2OR9L 4LSUL 1NAMA 2I9LA 1UVQA 3TA3D 3T3PE 5AZ2H 3V4VH 4G8IB 2VDKH 2MQCA 3MJ7B 4Q7DA 3UEZA 4KFZC 4XBEL 4IJ3B 3RWEB 5T33L 1KTDB 4P2QD 2XN9B 2Q86A 1NDMA 3V0WL 1ZS8B 3W81A 4GKSB 4HWZB 1FPTH 3MUJA 4XC1H 3U9PH 2ITDB 2C3VA 3EJYC 5E99H 1I85C 3S3SA 4MNHA 5T5FH 3UC0L 1PZUB 3VFNB 3WFHA 2NY6D 1LNUA 1BGXH 2WINB 4TUOA 1DQDH 2F5AL 4DKEH 5I1AA 1HH9B 4KI5D 1LGVA 1UJ3B 4YBQD 4OV5A 3NIFF 2FECI 3L7EA 4UI2A 5IWLC 1VFAA 5I75B 1B0RA 4UT9L 1DN0A 4LIQL 1Z5LB 3BPNC 5EIIA 3RKDC 4DFIA 4MXVF 3QHZL 2G9HB 4FNLH 3KWWA 1JGLH 3MV8A 3SOBH 3GSWB 1P7KA 1G6RL 1T89C 5J3HD 2H3NB 1UWXH 3B3IA 3MLYH 4Y4KD 4S11A 4Q6IC 3HNSH 2OR9H 4LSUH 3OX8B 3FTGB 1QA9B 5CWSA 2DQEL 2EZ0C 5F7YC 3IB4A 1KLUA 1VFBB 2XTJB 1F13A 3TYGL 4HLZH 3WLWD 4XBEH 4W4OA 4F3FA 2DN7A 3DSNA 5T33H 2APTA 1EPFA 4JHAL 4Y5YB 1EJOL 1W72L 4RMRA 3UPRB 3NGBC 3MBXL 4JAMA 1S9YB 4MHHI 1ZGLA 3QUXA 4OFYD 4HCRL 5DVOA 4HK3J 4RMQA 3IAQA 1PX3A 1R5IB 4X83A 1A6AA 4CADA 1U3YA 2I5YL 4MDJA 2WP3O 3P77B 3SE9L 2F5AH 4X5LA 3WXVL 2H26A 1A7NL 1E4KA 5GS0C 2VWEE 1JK8B 3PWPE 3M8OL 1A3RL 4KPHL 2Z4QB 5DEGA 2OJEB 1DVFA 1OD7A 4HK3N 4IIQA 5LCVH 1F90H 4DEPC 5HYFA 4IRSA 3ZSSA 4CGTA 4LIQH 4RWHA 2JB6B 2ATPA 4QXGL 4PRID 4L9LC 4WVRA 1G6RH 4R2GC 3TBVA 2ZG1A 2XT1B 1JGDB 4E41D 1T20B 2V5YA 3V52L 5K9QG 5DJZB 3QUZB 4IRJD 4LLUA 3QAZC 3CSBA 4MXQC 3IRZA 15C8H 4WW2B 1MNUL 4DK6A 4JZOA 2DQEH 5CUSL 4YFLF 1UH2A 3IDXL 5CD3A 2R2HA 3NFNA 3UJIL 2CMRL 1OL0A 3BOVA 3DETD 5E4IA 2VE6A 1FSKB 1CICD 2AK4D 3VMPA 5EPMA 4JHAH 1MUJB 1WBYA 1W72H 3X3FH 5JHDD 1GZPA 1G7HB 3MBXH 3MUGA 2DM2A 2ICWI 4JFFA 1IBGL 2VIRA 1M05A 3X17A 1MWAA 3O4LB 2VTFA 2XQYG 3ARDD 1C8PA 1UWXK 4HCRH 4RMTA 4LCWE 2BERA 4ENED 2I5YH 1X9QA 3MLWL 5IB3A 4GRWB 1S7RB 4JPIA 3SE9H 4WDIA 2G5BA 2LU3A 1IEAB 3KJ6L 1HHJB 4WEMB 3WXVH 1A7NH 4K7FA 3F5WA 5J11B 1HYSD 3LKSA 3ULVE 1DBBL 1A3RH 2XN9E 4U1MA 1DQJA 3FO0L 4OZFA 4CUCA 4YIQB 1UENA 4HIEA 3VFSA 3VXSD 4K23L 1MHCB 4WUUE 4NFBA 5HI5C 3LKNB 4QXGH 3GSNL 2D03L 3OQ3B 3U0TA 3MV7B 4XHQA 5BZDB 4OCSL 1CZ8H 4QWWC 4G8GA 5EZLA 1FNGB 3V52H 3HRPA 5KBNC 1RUKL 4PJDE 1GOHA 3GSUB 5DFVD 3ETBF 5LGKA 4TRPL 5ESAB 1T66C 3ZKND 1MNUH 4N1EA 4N5EC 1NFIA 5CUSH 3IDXH 4N8VB 3BP7A 4YDJB 1T1YA 3UJIH 2CMRH 4MX7A 4CVUA 3EW3B 3C5ZB 4OTXL 2IJ0C 3QIWD 4MAYC 2P5WD 1IBGH 3FO9B 3MRBB 1CN4A 2VMFA 1AGFA 4BQCA 5DJXA 2YK1H 3I84A 1XZ0B 3MV01 1KSRA 1K3IA 5D6DA 5TE7L 1J8KA 3BZ4B 3MLWH 4XNXL 3QDJB 4H8WL 5DJ8B 1J05B 2JJWA 3VXTB 1F6FB 3KJ6H 2XTJE 4NBZB 1QSED 2FGZA 1DBBH 4Y4HC 1G9NC 1WAAE 3FO0H 2GT9B 4CVZB 3KNBA 2OTWB 4ODXB 4K23H 3LB6C 1KTKE 3NTCL 1EUUA 4UQ3A 2KKQA 3IDYC 4QRUA 4UV4L 2ICWJ 3HZVB 1UCTA 1EZVX 3EHBD 3CFBA 2YEZA 2VITA 2VLLB 1RUKH 1FNSL 3DMMB 3T09A 1NMCC 3MOBL 5JOFB 4TRPH 4Z8FH 2ZZUT 1RZ8A 2QSCL 4MYWB 1NC2A 2BRRL 4MZ2A 1S5HA 3MZGB 5D2NA 2UZYB 4WU7B 5A40E 2EIBA 3E6FB 4HMCA 1GOGA 5J13C 3QYCA 3MRQA 3L3IA 4OTXH 3LRSA 1RIHL 4P2OC 4IOFC 1CDYA 1MCNA 3TO4D 3VRJA 3LKPA 2W65B 3GSOA 4DUXA 3D5OF 5D1QD 1AD9B 3IDNB 1OHQA 4LLAA 4KJWC 3ULUD 2DLFL 3DPBA 4FP8L 4TUJB 4YHKL 3WDHA 3DYOA 3BH8A 1OQOA 5TE7H 3CFJB 4ONHA 4XNXH 5HD8D 3H9ZA 4H8WH 1NC4B 2I9TA 1WSST 4MQSB 4GW5B 3PUCA 5KSAD 2BZDA 1I7ZB 1GOFA 3I9GL 4PY8I 5ADOL 3EYQC 1U91B 5HDLA 1HKLH 1P9MA 4O51A 5E4EB 1WICA 2AKRA 5JW4R 4OZFG 1JF5A 5KG9B 1ZVHA 4ZPVB 2YD3A 2P8LA 4YHYC 3NPSC 4YHPA 1ONQB 5K59F 3RQ3A 3H7BB 1OAUL 2DYPB 3NTCH 1WZLA 2P8PB 2XWBB 3O4LE 3MJ8B 4K94C 2CLVB 3K74B 3G9AB 4PJ5D 2W9EL 2B1HL 5JOPE 2BCKA 4UV4H 3BGFC 5F9WB 2YD7A 4OZIF 3L3JA 1TVHA 3C60A 2F54D 1UB6A 2AJ3B 4Y5XB 1R3IL 2EKSB 5T1DL 1FNSH 3MRCB 3MOBH 1AGEA 2WBKA 2QSCH 2BRRH 2J5LB 4YC2C 3BZFB 2I24N 4JQVC 2HJFB 2P49B 2ICEA 5C1MB 4R8WL 2P45B 1RIHH 3AAZB 4NWTL 3EYOA 4R6UA 2XY2A 1IT9L 5FV1L 3WIFA 5I2IA 2ILLA 4QYOB 4R97C 1URLA 1AR1C 2BX5A 4XPTL 4CRPA 2DLFH 4FP8H 4YHKH 4JFFE 3ZT7A 3BXNA 3TPUB 3RWCA 3ARBB 5JW3L 2C4FT 5MEND 3KPPA 3K46A 3I9GH 5DZLA 3NIFE 3TBWA 3U36B 1JZ7A 5FA3A 1TJGH 1R5VA 3ZDYF 2Z31B 1T7WA 2JK5A 4J3XA 4KZEH 3A6OA 3MV9D 4XNYH 1QLFA 3WCYA 3BQUB 1JRHI 2W9EH 1BJ1H 2F53A 4F8TA 5GGQL 5BCAA 3V79C 1HZHL 1CGUA 2JJSC 4HXBL 4H26B 3QEQA 2PCPA 2XNAA 1R3IH 2ZSVB 3BKYH 1X7QA 3F6LA 3QIUB 1CDBA 2WBJC 4G8GE 1HK6A 4JVWA 4H1LH 25C8L 5IV2A 5FK9A 4PY8J 2HG5B 1IVLA 1CQYA 3HE7B 3G04A 3TYFB 1VADA 4NWTH 1AXTL 3EYUH 2B7DT 4HUNB 1IT9H 2FJHB 2EICA 3HUJB 3RGVD 1MH5B 2P8MA 2VXSL 4EZMA 4G43A 4LL9A 5JW4Q 4I4WB 1UZ6E 3L6FA 1FFRA 1F6AB 3EO9L 2FJGA 2A6IA 2UZIL 2DKMA 1FFOA 2NTSP 2A2QT 3CXDH 4WJ5B 5GS0D 3H9HB 3KPMA 1LILA 1NGYA 4LPVA 2VDNL 1S9XA 3IFOA 3TVMB 5KANG 5FECB 3AVEA 3KYNA 4OZIA 1LO3L 4P5TB 4N0UB 3IVKB 1ZV5A 1F02I 3V5DB 2AW2A 4OLUH 2V9RA 5GGQH 2FGWL 4MCYB 1HZHH 1A4JB 1A9BA 4KTEL 4NO5A 3I50L 2R2BB 3NN8B 4R3SA 2GSIB 3RVTD 4WO4B 4PJGF 2H8PB 3GHEL 1SQ2N 1RZKC 1V7NL 1V05A 2A83A 1KN4L 4YHLH 5IW6A 5D2NE 2WMPA 3JTTB 1RQ5A 1AXTH 5IESL 3DECA 2X9XA 4M8QB 3TJEL 4IOIB 3RIAF 5I66A 5C0AD 4KKCC 2NW2A 1SYSA 2VXSH 3CLFH 1BOGB 1CS6A 1FG2A 4KUCD 5I17B 4OUOA 1NKOA 3B5GA 3WFBL 1U58B 4FQCL 5C0BB 2UZIH 3GSVA 4DKFH 1IEBB 1N6UA 4QLRA 3EOBB 2V7HB 43CAA 2W0FB 2VDNH 1GYAA 3RWFB 4Q9QL 1T5XB 3KPOA 5GGRY 3BPLC 4PUBH 2DTML 4M43L 2LABA 4G6KL 3UTSB 2GEEA 3MBEC 1LO3H 1F6LL 4PTUB 4NCC1 5L8JB 1NAML 2G2RB 1R3KB 4WFFE 4QWWD 4AG4H 3B2VL 2R29L 5SX4I 4KTEH 1BD2A 3I50H 3DO7A 4HV8A 2M26A 1WEJL 3DXAD 5T5NF 1TPXC 4BQ6A 4N5ED 5C07A 5DJ6A 2X41A 5IM7B 3GHEH 4BJLA 1H8OA 1V7NH 4NKOA 3VXMA 5EUKB 3FFCB 3K4DA 5JHLL 1KN4H 2W07A 4JANA 4ODTL 4MAYD 2X4UB 3QJFA 2A6DA 3GIZL 3BHBB 4JFDD 3P4MA 2UUDH 4OCWL 3SY0A 5SWQB 3F62A 3REVA 1Z3GL 1JTTA 1KB9K 5IESH 3BP6B 4BKLA 3MRDA 3FQUA 3TJEH 3KPSB 1VKXB 4RQQB 32C2B 1HXMA 5C09B 3VGFA 1C5CL 1YMHB 1LO0L 2X2YA 3DURB 3B2UC 3HC0B 3WFBH 5C0GA 4N0FB 1XGYL 4FQCH 4R0LC 3CFIC 5CMAA 1KEGH 1QZ1A 2BSSB 4NSKB 1T4KB 4PJ9A 4Q9QH 2AEIT 3MMEA 3ROOB 4KVNL 1BIIA 4QCIA 3LEXA 3ULSB 5DYOA 4FZEL 3LB6D 2DTMH 2XFXA 4M43H 2H6PA 4G6KH 3S8WA 5ICXB 2YC1B 1G7LA 1I7UA 3MA9L 3HUJE 1N0LA 1NAMH 1KCSL 1KPUB 2CK2A 3HN3A 2YBRB 4NQDD 4UV7L 5D7SL 1IGML 4DGYL 4PRBA 5E8OA 5C9KA 2F53E 5JMRA 3S5LA 2P7TA 3M17B 1WEJH 4J6RL 5HHOB 4MQXD 5EC1A 3CCHA 4P59L 4D0BA 5LG1A 3FCTA 3DROA 3U0WL 2NY2D 3VXUA 5MI0B 1HNFA 2PNDA 5JHLH 4K8RD 4F15C 4ODTH 4X80L 5J12C 5CEXB 3RDTA 4P2OD 4J1UA 3GIZH 4OCWH 5DT1L 1EO7A 2AV7B 5CSZB 1Z0MA 1Z3GH 3PWLA 4HS8H 4KJWD 1C5CH 2I26N 1HIML 1LO0H 1AO7A 3HC3L 2IADA 3L5XL 3STBA 2I60L 5C0DA 3BRDA 4U6TA 1XGYH 1BWMA 1LEKA 1T03H 1VEMA 2LTQC 2CPCA 5FUCC 3UZEA 4P0DA 3OKDA 1OT1A 5KSBB 2HKHL 1Y18A 4KVNH 2I27N 2G75B 1UM6L 5CILL 5K59E 2CLZB 3MA9H 2UUDK 4IDJL 4NHUB 3U83A 1CXFA 1Q38A 1VDGA 1KCSH 4NN5C 4LDOB 3ZDXF 2RR3A 3H9SA 4UV7H 4OZIE 1ZVSB 5D7SH 3B9AA 4NBYB 1IGMH 4DGYH 4Y19B 5D93B 5C0BE 3U7WL 3NA4A 4J6RH 1D5ZB 1WZKA 2VSCA 3ILPB 4P59H 1N8ZA 4JZJA 4XH2A 1FNLA 4MB3A 2QR0B 2ARWA 4QXTB 3U0WH 4UTAL 4GMSL 3KAAA 1MWAL 2WP3T 4MQ7B 4X80H 3SDDA 1Q1JL 1JFQL 3GJFB 3OAZH 4XC3L 5AAMA 1H15B 3JUZA 4NQUA 5DT1H 1IM9A 2FEEI 2WIMA 5AYQA 5LAXB 3ABZA 1AR1D 1DQQB 5BS0B 2J88H 4KKBC 3IT8D 1AXIB 1IGTB 1YUHA 1P4LB 4BQBA 3HC3H 2ZJSH 3L5XH 2I60H 5T1LB 3EJZD 2XZCL 3HAEB 3QO0A 5FYKE 4X6BB 3GMQA 2BNRB 3NFPA 1I85A 4JKLA 2WIIA 2HKHH 3ZDYE 2M2DA 1F45A 4PJFB 1A21A 1IZKA 4HJJL 2XQYK 4X98B 5CILH 1KBGL 1DLFL 1KB5A 2Z8SA 1X6LA 4F80A 3S3PA 1CDCA 1TQBB 5AUMB 1KYOJ 5DSCB 3QIBD 1MHPH 4LVNB 4QY8B 4TOYL 1WGOA 1FC1A 3INUL 3JWOC 3TLRA 2QEJA 2WBJD 2EEAA 3U7WH 3OGCA 3QZWB 1MI5D 2YS4A 5IW1A 1T89A 1F3DJ 4HWNA 3S98A 1IQWL 5DGQA 5GZNC 2GY7B 1P7HL 1BD2E 4UTAH 4GMSH 1NANI 1WCBA 1MWAH 1A1OB 5I30L 4KDWA 5C07E 2F19L 1HHHB 3U79A 4HHAB 4YWGL 1Q1JH 1JFQH 2OTUA 1VHPA 2CSPA 4XC3H 3QI9A 3VXME 2VB5A 3HS0B 4C83A 5DGRA 4YXLL 1T2JA 4IMLA 4ISVB 2HVKB 1FIGL 3FO2B 4NRZB 5DJDA 5EU6D 1SM3L 3BD5A 2ESVD 4AK1A 1KTLA 2A6KB 2GUOA 3IF1A 3D0LB 5ID0A 1FJ1B 2VISA 4OZFH 2OLDA 2HJKA 2DMKA 1EO5A 3MO1A 1HHKB 4G5ZL 3EO0B 4LSPL 4QTIL 1NGQH 1U3HB 2FWOB 1BLNB 4APQB 4EN3D 4HJJH 4CVXA 1CFNA 3I6KB 4LLDB 5J0BA 3OAZK 2FL5B 1DLFH 8FABB 2EO9A 1H0DB 5DZNA 3ZKQD 3CFEB 5J8OA 5T5NG 3S97C 2HAZA 2VYRE 1HH6B 2DD8H 4YXHL 2DLEA 5BRZD 3ESVF 4LKXA 1T80A 3HLAB 4U1JB 3INUH 1CU4L 3FT2A 4KDTC 4WU5B 1RULL 4PGJA 3DBXB 4UQ2B 3OPZL 4XPGL 2WNGA 5GGSB 3I6LE 3CX5J 4GRMA 1GRWA 1IQWH 3UYPA 2P44B 2V5SA 5B8CA 5I76B 4F58L 1MCQA 5I30H 1TENA 2VLJB 2HTLC 5L88L 4QRPA 4NCDA 4YWGH 1QR1A 4OLZL 3VXUE 4YUEL 2NY1B 3QUYA 2GFBA 4JQXC 3QFJA 4YXLH 2X4NA 4KKCD 3LRGA 4UAOC 1FIGH 2ZOLA 1A7BA 3KLHC 1FZOB 1SM3H 3P4LA 3LPFA 4X4XA 3OKEA 5HGAA 4PJ8C 1AO7E 3E6HB 3MREB 4G5ZH 3CIQA 2YMXH 4LSPH 4PJIB 5KTEL 4QTIH 1HHGA 1YN6B 1NFDF 1A6UL 1RHHB 1I9JL 4CU6A 5MHSD 4FTVB 4TNVF 1IC1A 2C7UB 4OUUB 1A1MB 5E03A 1MFEL 4X7EC 5IVZA 3WSQH 2GJ6B 3IFLL 1ACYL 4NT6B 2AV1B 4OKVB 4JDZA 3RBSA 3T0AA 5F3HA 3MUY1 3PGCB 1YEFL 3AMLA 3MCKB 2IMNA 2DQFA 3VRIA 1OTSD 1EMTL 4RFEA 1CU4H 5DEFB 3H9SE 1RULH 1UKTA 3OPZH 1OSPL 4XPGH 5DK0A 1Z9SA 5I15L 3B5HA 5K9JL 1FV1A 4BSJA 1QFPA 3QNZB 4QNPE 1LE9B 1I7TA 4PJFE 5DD1L 5FGBA 5DWUL 1K2DB 3RY5A 1U8KA 1F4YH 2XIDA 5L88H 5DD0L 4HUMB 2Q1EA 3BIKB 4Q9RL 3KYAA 3MLZL 4OLZH 3JV4B 4YUEH 4MSWB 1FP5A 1LP9B 5DD3L 4HUVB 1KJMB 5DK2A 5HHXL 2UWEF 2VABA 4DOHE 3B2UD 3THML 3RHWF 5HGDB 4MS8C 1GHFH 2ICWB 5EDXA 2F8VA 4PV8A 2DWEA 4ZUVB 4LPCA 5GS2D 3U7YL 4XTRC 4C58B 3STZA 5KTEH 5IR1B 4JM4L 4O2CB 4XWOC 1JPST 1A6UH 4NQCA 2GSGB 4OGAC 3HNTL 1CCZA 1OTTC 1MFEH 5CSBA 1BPVA 4MHHG 5DD5L 1AKJD 4JJ5A 3SKNB 5CP7A 1ACYH 3MA7A 3OL2A 4PRDA 4JY5L 1YEFH 4DGIL 4ONFH 4QRSB 5HVGB 5FA4A 4AZ8A 5DJCA 3ALWA 4POYA 5I15H 4JO3H 5K9JH 4FQ1L 1RZJC 3IKCA 4XI5C 1OOAA 2AXFA 5I16B 5DTFA 1YY8B 3CFKA 3KPRA 4F8QA 5DD1H 4EIGB 2Z0BA 5DWUH 1JHLL 4DN3L 5DD0H 1KJ2A 4Q9RH 1KYOK 4J4PA 3MLZH 3D18A 1FZMB 4L1HA 4LPUA 5DD3H 1U8PA 3GDBA 1M7DA 1Q94B 3UPCA 5HHXH 5EH1A 2K7PA 3MLTA 3THMH 1PY9A 2ZUXA 1A6TA 4G7YL 5DVLA 3VRLF 1NFDA 1YMMD 3IJHA 1IC4L 4MNGE 1Z9MA 3MRFB 2VLJE 4JM4H 4KK6C 3AREB 4CAGA 4M7JL 3D87B 4KAQL 5FYJD 3UO1L 4Y5VC 1F2XK 2QHLA 1KELL 4AEIL 3T0EC 3QDGA 4WV1C 2EC9T 3RNKA 5DD5H 2EIZA 2FH8A 2NPLX 1D6VL 3C6LC 1JHKL 4JY5H 4Y4FB 4H5SA 3RY6C 3GHBL 1XGUA 3PL6A 1FAIL 5IOPB 4TVPD 1A7RL 1FFNA 4Z0XA 4FQ1H 4XWGL 3VXNA 5K93A 3QG7L 5C2UB 4NRYB 5DRZA 1U93B 4JGMA 4XVSL 3WFDL 4RFNC 4NN7B 3GJEB 4Y2DB 3VFPB 1C16A 1JHLH 4R4FH 5H2BB 4DN3H 5E9DA 1T0MA 2XKNB 5JPNB 4QHLB 5IBLC 3KLSA 5I73B 3BPCB 4IHOB 1J8HA 2X09A 2UWEA 5BV7C 4K3EL 4QRPE 3IXTA 4OF3A 3FHAA 4ODSL 5F6HI 3WEXA 1MFBL 4FG6C 6FABL 5F9DC 1G7IB 3QFJE 5FGRA 1U8NB 2H41A 4HXAH 3T04D 3IDIA 4GKZA 4G7YH 1YDPB 5D7JA 2FR4B 1U8HA 1IC4H 1F97A 1TCMA 1C5BL 4XNQA 4W6WB 4HLJA 4ZMAT 2AJSL 4M7JH 4KAQH 1RUML 2A6JB 5BJTA 1J88A 2R1YB 3OAUL 3UO1H 1ZAGA 4YDVA 1KELH 3VWJC 4YHZH 4AEIH 1N26A 3N85L 3U82B 2P48B 4JN2B 3V8CA 1D6VH 2MCPL 2NY3C 1JHKH 2QQKL 3UTQB 4P2RA 3UBXB 4N8CL 1U8IA 3GHBH 3L5WA 1M7XA 3R06A 4EVNB 1QSFB 1FAIH 4NZDA 3S4SB 1A7RH 1D5BA 4LGRB 5BO1L 4CU8A 2EDLA 4XWGH 4GXUN 5GZND 2AEQL 1ED3A 3QG7H 1HWHB 3VXRB 2HWZL 4XVSH 3MCG1 1MCOL 4HMEA 1QVOB 4NUJA 1ZGLP 2BNQB 5DS8A 4MNQA 4J3VA 4R26H 5I8EA 1HINH 2EIEA 3EO1A 4K3EH 1YQ2A 2OP4L 2YUVA 1G7JA 4L4VB 2C4XA 4N0CD 5HPOA 1S7VA 1MFBH 2BVYA 6FABH 1G0DA 3LRHA 4YR6B 3RTQB 5F7HA 5IB1B 2J2ZA 4RAVB 4F33A 3WIIL 1MLBB 3BO8B 4NM8H 3MNVA 2MJWA 4JFOB 3EJJX 4OD1L 1RD6A 1C5BH 3L9RB 4LU5H 5F93C 1FBIL 4LVOC 2AJSH 4Z7WB 1RUMH 3OAUH 4ZAKC 3HTLX 3OR6B 5TDOA 3N85H 3HRZA 2VLRA 4NQCE 5BVJA 2MCPH 4NQVB 1MCSA 4XRCB 1ND0A 3C5JA 4ODVH 3V4UL 5F6HJ 1D9KA 3EUUA 4I0PB 3UYOD 1P84K 2OYPA 1ZANH 4P5KA 3Q3GB 4QRRB 4F9LA 1Q72L 1HN1A 3QDMD 2PXYC 2AEQH 4RCAA 3H2WA 5C08D 3FN0H 2HWZH 1MCOH 2YD9A 4F7CB 3QSKB 1O0VA 3BKJL 3TJHC 4XBGA 1QKZH 5D7LB 1PX4A 3ZE2F 1NGZB 1RFDL 2OP4H 4UDUB 3KLHD 4HKXA 3PWUA 4PB0H 4RIRA 1QSVA 3QXUA 4AH2A 4KK9C 4KZDL 1FRGL 1XGQB 4PY7A 1E6OH 3LSOA 3WIIH 4LVHB 5HHNB 1B6DA 4KQ4H 4JREB 4PJ8D 1R5WA 3EDFA 1YPZB 3OF6A 5GRVL 4Z77A 1YN7A 1BBJB 5EO0B 3F65A 5HHMB 2B2XH 5FB8B 3G5ZA 5EB9A 5CJQL 1KG0B 3RWDB 2OXHA 3G5XA 2IPKB 3DVGA 4X4ZA 4LBEA 3RUGF 4JLRA 3OKNA 2DWDB 4FXLA 1M4KA 5DLML 4X6EB 1MCLA 3V4UH 3D2UB 4M7LL 2LE9A 1A14L 3W5NA 5HHPB 4QT5B 5E2TL 4LSSL 5JA9A 2X1OA 3CC5A 1Q72H 4UIKL 4YX2L 1JGEA 4YJZL 4MD5A 1JPFA 1FO0A 2E8YA 1XIWB 3SO5A 1CD1A 3L3DB 1DLHB 3CZFA 5DEGB 3EFFA 3L7FA 2ED7A 5IG7A 3BKJH 4FQPA 4IRSB 3PIQA 3VE0B 3BPOB 5DC9B 1NAKL 2NZIA 4HS6B 5E9DE 1RFDH 1CD0A 3G6AB 4H0GA 1IGFL 1RZIB 1J8HE 4LFHD 2UWEE 4MS8D 4KZDH 4EI5B 1FRGH 1R3JB 1DBMH 4JFHD 1A6ZA 1T21A 1CXIA 3I3BA 3P4OA 5K9KA 4ZNEA 1KB5L 1OSZA 4G9FD 5FUOL 4U2YA 4XWOD 4QRTB 2C9AA 4FQQB 4RGNE 3O8XB 4B41A 1ZWIB 5HY9B 5J06A 2VSDA 5DUML 5JR1H 3MRPA 1OTTD 4ZQKA 3VA6A 3JWDC 5CJQH 4N90E 4DZBB 1YEDB 5I1DA 4ZUTA 1RJLA 3CXHK 5GS1A 3PJSA 4TUKL 1ZA3B 3MUGB 1K85A 4M7LH 1A14H 1P7QA 5DQDL 3O6FC 4NN6B 4P2RE 2PYFB 4WI5A 5E2TH 1CBVL 2P5EA 4LSSH 4GSDH 4Y16C 4XI5D 5ITFA 4XAKD 1BREA 4UIKH 4HKZA 4OBSA 4J12A 3TH3T 1DBKL 5M94B 5I1HL 4LRNL 3F5WB 3EYSL 1U8JA 3DV6A 4U1MB 1VB9A 3OG6B 5AG9A 4PTTA 1DE4B 3CSGA 4ONGL 4WWKD 3GB7B 5EC2A 2DBLH 1R3LA 4MNQE 2IH3B 3LQAL 1I8MB 5KJRL 2EDQA 1VACB 2MQ3A 2ZNXA 3W2DL 2A77H 4LQFL 4D9RE 2W60B 3UP1A 5F6IC 4XXCC 3RL1B 1KB5H 3MJ9A 4U0QB 3AS3A 3IYLW 2ATKA 5FUOH 5J6GB 1JZ5A 4KK6D 4GRLB 5FHAL 4EI6B 3A67L 4JRYA 4MLIA 2H1PL 3RUGA 1P53A 3BP7B 5DUMH 3M1BB 3T0ED 5F7FA 5T3ZD 1KPRA 3BUYB 5E94B 3HI1B 2ZG2A 2GIYA 4YO0A 3DV4A 5ENWB 4C56B 3TV3L 1NFKA 4TUKH 2P4AB 4I77H 2BSTA 2VLRE 5C8JB 4X5WA 2R1XA 4K9EL 1H9VA 5IFJB 4GG6F 5JZ7C 1GCFA 5M7QA 2GTZA 4TSAL 1U8OB 3KYOB 3BP5A 1DBKH 5GRVK 3D48R 4ZS6C 5ICYB 5I1HH 4LRNH 1WZ1L 5E2WH 4MAUL 1M1SA 3LDBB 1NBQA 3GSXA 4MVBC 1FN4A 3FN9A 4NO0B 4ONGH 3ESUF 4Z0BL 1SVZA 1WBZB 2NXZC 2UY7A 4PJBE 1TJHL 5KJRH 4F2MA 3QPQD 3W0WE 4P23A 3VGGA 5IMOB 3H0TB 4LQFH 1KPVA 4M93C 5AWNL 3U2SB 4D8PA 4BH8B 1DDHB 3P0YL 3WN5A 4NDMB 2DM7A 5ISZA 2RJMA 4LHQB 5D6CA 4ETQA 2LU7A 5EO9A 3UPAA 5FHAH 4N5UA 3A67H 4PGBB 2NXYC 1DTUA 3B6SB 3DTXA 1J10A 1A64A 2D0FA 1VERA 3IXAB 1GGIH 1IAIL 1U95B 2DB8A 3O9WA 2CJUL 3AY4A 3VGHA 2NY3D 3L95A 3CPLA 5CS7A 3LKPB 2DF3A 4JCMA 1WFUA 4HUXB 3QQ9C 3ZKXB 4M5YH 1CG9B 2C1OA 4PJCF 4K9EH 2EE6A 4U7KA 3KS0J 4N1HB 5D1ZA 1QBLL 4KGLA 1JVKA 4E5XB 4TSAH 3VMNA 4NC1C 1J9CT 2XKSA 5F8QC 3QDAA 1JGVL 2L7JA 3CNKA 1JZ2A 4JO1L 4HIIB 2WWKO 1FZKA 4YK4B 1B6UA 2ZCKH 1WZ1H 1QFWH 3O3AB 4KK5C 1I8IB 3QXVA 3SJVA 1JCKA 4FOMA 4F7PB 5K33A 3ZT6A 1TJHH 5AD0B 1FNEB 2Y07L 1EDQA 1FVEA 3D39D 1MHEA 4MJ5B 3L3JB 3X13A 3C60B 4WRLA 2FBJL 3P0YH 4XNUL 1DUZA 2IFGA 3DX6B 4L5FL 1T7VA 2GITA 4ZNEE 4ZAKD 5CCKL 4PJAB 3PWJA 5D1XA 3VI3F 1IAIH 3C5ZD 3TO2A 2NX5A 3MRMA 2CJUH 3KR3H 5DJAA 2BY1A 2RAMA 1RK0B 4EDXA 3GZKA 1MEXH 3TA3B 1SJXA 3MRRA 1T0NB 2HLAB 3HG1A 5DJYB 3RIFF 4DZ8B 5GIRA 5K9OB 1FYTA 4O2FA 3ZTNL 5DUBA 4P2QB 1KJ2L 2FH6A 3QDJD 1S9WB 4WFHD 3RWIA 3VWKB 1JGVH 2HH0H 2MKLC 1RAMA 2P5EE 4GT7A 1ZTXL 2FIKB 1KF9B 1YEIL 1DQLL 3UTZB 3RU8L 3TJHD 1T1XA 4FS0A 5ANMB 4QRQA 5D96C 1A0QL 5GSVB 3ZE2E 2YUWA 6CGTA 5CZVL 2Y07H 3LS4H 4PR5B 2C3WA 4QOKA 1JYWA 5EZJA 4AEHH 1NJ9A 2QADC 3STLB 4XNUH 3SKOB 1UQSA 5DRNA 1FH5H 4KMTL 4L5FH 5GJSL 1A5FL 2HT2C 5GGVL 1ZLSH 3BJ91 1TTUA 5CCKH 4NFCA 4U7MA 4LCCA 1G7QB 3DO3A 4GMTL 3SDYH 1PKQA 3Q6FB 4Y4KB 5C0RL 3AGVA 2O61A 3RUGE 4O58L 1MFAL 4PJCA 1N6VA 4U1IB 4X7TA 3RA7H 1F11B 5FM5M 5SWSD 3MRJB 3D9AL 4P57A 1EAPB 3AU1B 4KUZH 4L4TA 1A1NB 5DJ0A 4HW6A 4RSVA 1OAZL 1JZ8A 2BNUA 5GHWL 1NGPL 2IPTL 3U4EA 3EGSB 3ZTNH 2DS4A 1VGKA 2CDEA 2D3VA 4GW1A 3HZKA 3PWVA 4N9GB 4LSRH 5EFIA 3UROR 2EDRA 3E3QC 4QHNB 3UTTA 1YNKL 2YUZA 4M6ML 1ZTXH 1YEIH 4DTGL 2X4OB 2KH2B 1DQLH 2XXCB 3O4OC 4R7NA 3RU8H 3BRFA 4HJ0C 1NH6A 3Q5YA 1YNTB 4H25B 5ICZA 1A0QH 4OI7A 3CJJA 1EEQA 3GMPA 1HOCB 5CLWA 4X7CC 3RNQB 5CZVH 3G9VA 3ZKSD 3P9MA 4DKDC 2HFEB 3IJYB 5CBEA 2R8SH 1BEYL 2ZUWA 3MROA 3NCCB 4TSBL 2ZCHL 5LXGH 4XCEA 3R1GL 4HT1L 2HMIC 2BXZA 3FB5B 1A5FH 1OAXL 2R23A 3VXOA 4PRIB 5CGTA 5GGVH 4JKKA 4PJEF 1J0YA 4L3EE 1G84A 3GSQB 4UOW0 4UIMB 4GAYB 4E41B 4GMTH 3IKKA 4IRJB 2A9NL 5C0RH 4FFVD 5JORB 1C08B 2I07A 4O58H 1MFAH 1GGCL 1KV3A 3VXSA 5L8KB 2ZWLT 2VQTA 2A73A 3OAYH 3D9AH 5DQJA 2P46B 4XB7A 5KSUA 1KIRA 4PJXF 1B4RA 4YBHA 2V2WB 1KGCD 3O6FD 5CBAA 3WFCL 4OLYL 5GHWH 3PWNB 1NGPH 2VXVL 5F44A 5IVXF 1CICB 2AK4B 4WUKL 2X44D 3REWA 4RMSA 5SX5H 1JRHL 4FQLL 4WI8A 5JHDB 1MLCA 1Q9OB 1KCRL 1YNKH 3NCJL 4F7TA 1G9ML 1SJVA 3D69B 3QG6A 4DTGH 4KHTL 3ARDB 4LGSB 4J7RA 3U7AA 4XBPB 5HGBA 3SCMA 3L5HA 4LHUD 1X5XA 4QTHB 1O5DT 4UDTB 3V6FA 2P5WA 3N1QC 5FKPA 5HDQL 1MAML 4JFEA 3SJVE 3DGGB 4AENB 4P2QE 2Q6WB 2Q8BH 5F7WC 3I02B 5SV4A 1U36A 2CKBB 5CHNB 4TSBH 1ZKAA 2ZCHH 5C0IA 1PFCA 3R1GH 4HT1H 1DJSA 2OK0L 3S7GA 1OAXH 2NY0B 1YEHL 2YSSA 4XAWL 3B9KA 1INDL 3F12B 4OD2A 5IMMB 2GW5A 4JDTL 4XNMA 3PGFL 2A9NH 1JF1A 4POZC 4ZOBA 1HXYA 3R4DA 4GW4A 1CFBA 2X4RB 1GGCH 4OI9A 4HIHB 1XT5A 4TNVK 4ZSOA 2NX5E 3FQXA 4XP4L 3L3OB 3RL2A 3HPLA 4ZXBC 5E24E 3LN4A 5JZ7D 4OLYH 2ZKHL 5ALBH 2W9LA 2VXVH 4L3CB 4WUKH 4X5XA 1XCTB 3C6LA 3CSPA 2EE2A 3C9NB 3QIWB 4NGHL 4FQLH 1QFUL 4TULL 5T3XD 4HG4J 3IDGB 2Z93A 3GGWA 4ZS6D 2YKLL 1KCRH 3NCJH 1G9MH 4KHTH 2Y7QB 4JG1L 4MVBD 3VFTB 4BFEA 4P5TD 3WO4B 2H6PB 2R1WB 3NOIA 1I7UB 1F4WH 2NXZD 1AJ7L 5EU7C 4NO2A 4PGDB 5I1GL 1QSEB 4KK8C 3OAYK 1MAMH 3G5VB 4OFIA 2NLJA 3QWQB 4MJ2A 4X9IA 1K8DB 4I9WD 2XZQL 5CEYB 4PBWD 2PETA 3C8KA 3MR9B 4PJGB 4PJEA 1XGPA 2NR6C 4OLXL 2VDQL 1JN6A 5SX5K 2YZ8A 4WTZA 1CL7I 1PG7X 4L8SC 2NXYD 2IG2L 1MCIA 3RHWK 1YEHH 3D3VD 1DEEB 5KSAA 1INDH 3FFDA 1AH1A 1JHTA 3DIFB 3FQTA 4JDTH 3JXAA 2ADIB 3AS0A 4LLWA 4X6DB 3SDAA 4PJXA 1U2CA 1P4IL 1HEZB 4H8WC 1PKQE 4PP2B 1QRND 4NKDA 5IVXA 4XP4H 4PJ5A 4XX1G 3VWJA 3N50A 3DVNA 4PJCE 4XNZC 1C12B 5JUEL 2JCCB 2A74A 1DSFL 1E28B 1XF4A 4U1LB 3H3PL 5F7LB 1K8IA 4NGHH 5FGCB 1QFUH 4TULH 3TO4B 4PS4L 5FO8B 4R4NC 1FNHA 2YKLH 1BFOA 2ADGB 3W9DB 3MGAA 1U92B 5A2KH 4KK5D 3MLUL 4JG1H 3E2HB 4I18B 3T0BA 4HKBB 3QWRA 2X1WL 1Q0XH 3GMOB 2BHYA 3UDWC 5A16A 4NKQB 4GS7C 1AJ7H 1Q9WA 3T8XB 5I1GH 5EN2B 2SEBA 1M71B 3T65B 4UOW1 2XZQH 3VFUB 1NKRA 4OLXH 5JHDE 2VDQH 4WY7H 2HLFC 4KHXL 1A7OL 2XA3A 1N59B 2IG2H 1R0AH 3RAJL 1OQXA 3JV6B 4KMQA 5MENA 5A1AA 2ZOKB 3HZMA 4Z7VB 1MELA 5SV3A 1ZT1B 2VZUA 3VXPA 1K9TA 5I0ZA 1OTUD 5C0CA 5DI8B 4OI8A 2IAND 1OAKH 1FO0H 2YXMA 5E6ZA 2CIIA 4YAQB 1I75A 1PG7L 3HB3D 2P24B 3MLVL 3VXSE 1OGAD 1J18A 1E27B 4CW1A 5JUEH 4PGEB 1DSFH 3TH4T 2Q3ZA 3H3PH 3TIDB 1FYHB 3RI5F 5B39A 4PJ7B 3N1PC 1I1FB 4PS4H 4XX1E 2HVJB 4RGMC 1DBAL 2EDFA 1TNMA 2GJZA 4LLYB 5GGRA 1LDPL 5DHVB 2GTWB 2ARJA 2DQIL 5DD6B 1SY6A 3DUSB 1BOYA 3MJ9L 2ID5A 1AIFB 4LPWA 4W68A 1G7PA 4ZUSA 2FB4L 2BP3A 3WHXB 2JIXD 2QADD 3NCYS 3LPGA 3RGVA 3F7VB 3D85D 4M3KB 5ETUA 2P5WE 5EOTA 1WISA 3BPNB 3TN0A 4LSDA 4WTZG 4QHKI 1Q0YL 5ACZA 3MV9B 1F3JA 2HT2D 4XB8A 1CFTB 1A7OH 3PQYA 4KHXH 3LHPL 3OR7B 4G80B 3RAJH 2RQ8A 3KXFD 1XGRA 1Q9KA 1ZEAL 3AB0C 4I5BB 1D5XA 1WC7A 4Q6IB 4M61B 8CGTA 3DHMA 2X70B 4LLQA 1OVZA 5IMKB 3RKPA 1ZA6A 1SJEB 3TNNB 1PG7H 4JE4B 3MLVH 3TZVC 1T1ZB 1M7IA 1T2QL 4ZSOE 4MA1C 3NGBB 1MIEH 2AJVL 4ZOAA 3TBSA 2HFFA 2CDFB 3PG2A 4OF0A 3B9DA 1DBAH 3LEVL 1MVUA 5F89A 4HJ0D 1JWSA 1LDPH 2VXQL 2W0LA 2DQIH 4OZGB 4FMKA 4U1HA 2R0ZL 4ZD3L 4D2NA 1DN2A 2V2XA 3BGMB 3J8F7 3MJ9H 5D5MF 3ECBA 5FDWB 5C3LD 4JFZL 4G8FB 4UINL 4ZYKA 5FO9A 2FB4H 1MJ8L 2E9IA 2JCCE 3TIEB 4OZ4A 4DEPB 5T1MB 1R24A 2Y36L 3EOAA 4PV9B 4UZGA 3VH8A 3MXWL 3WNKA 3E8UL 4ZFGL 5ACMA 2V9QA 2HMID 4ZUWB 2P47B 2PO6A 1Q0YH 2FEEL 4X8JA 1S7QB 1OF2A 4L9LB 2VWEC 5F21B 4M1CC 5FEBA 1BAFL 4R2GB 4V1DA 3ULUE 1BZ7A 2Z8RA 4X4YB 4R96A 1JE6A 3QH3B 3QAZB 1ROWA 1ZEAH 3ZE1F 2NYYC 5D9SA 1FDLL 2P42B 1S7UA 5EU4A 3V6ZB 2DJSA 4XZUA 5DHXB 4WCYL 5IB4B 3QWOA 4DJMA 5BS0D 5JPMA 4PJXE 1WBXA 3LPWA 4FQXC 5HDOA 4HH9B 4D9QD 2ZG3A 4JM2F 1T2QH 5B39G 4Z78A 5TGBB 2X4PB 4N8PA 4PJ5E 1SEBA 3CH1A 4QHKJ 4WHTA 4XVUC 3OXRA 2GJJA 3GRWH 2AJVH 4W6YB 1FVDB 2DKSA 4KY1L 4NP4H 3JZ7A 5CKAA 3LEVH 2F54E 2HJLB 3SGDI 1TITA 1HHGB 3JBG7 1YY9C 2EIDA 2VXQH 3BW9B 4LK4A 1ORQA 3QXDA 1HSBA 2EYTA 2H32B 4P4KA 1MHHB 3MC0A 4ZD3H 3GMLA 4LCUA 5DHYA 3PXHA 2IH1A 4JFZH 1KTRL 4UINH 2AQ2A 1AGDA 2ZUSA 2Y36H 1UYWL 4ZFGH 3MXWH 3E8UH 2EYSA 4RFEB 4X6FA 4IJ3C 4OZHB 2X1XR 2OL3A 1BAFH 1ZK9A 1AP2A 2EXYC 4LEOA 3CFDA 3S6CA 1HILA 4GBXA 2DI9A 3IAGC 2IALA 4E0RB 4KJYA 5EZIH 1FDLH 5MENE 4XMPL 2WWKT 3DXAB 3P2TA 3P73A 4AIZA 2Y5EA 5HVWA 3RZCC 3TBYA 4WCYH 3PNWA 4ZXBD 4M6AA 5DK2B 5C0CE 2D7TL 2VABB 3KHQA 5DJ2B 3CSYB 5I9QC 4MAYB 4JFDB 3PHOA 2CXKA 4XP6L 5B3JF 5MEQA 4UU9B 5EO1A 5H94A 4M48L 1CIUA 5TF1H 4ORZC 3OKKB 4KY1H 1U3HD 4R7DA 5FF6A 1WJ3A 3O6KH 5IB2B 1S7WB 3MGTA 3MLSL 4P9HL 2QKIB 2X4QB 5D5MA 4JRXD 3IFPB 3BDXA 2A9ML 5DDHA 2XOTA 3VFWA 4MD4A 1WTGT 5IKCA 3MYJA 4KK8D 3EOYG 4C54A 1NANH 4ZPTB 5HYJA 4Y4HB 3VH8G 4PLKC 2GAZB 3HPJA 1CGTA 1LWRA 2NR6D 1SYVA 2Q7YB 5EU5B 3VGDA 4LSVL 3IDYB 4RDQF 2XRAL 1KIPB 3G5YA 4NQDB 1DANT 2QBWA 1J1OL 1TZIB 4LNRA 1IGIL 4OQ1A 4HFWB 3A6CL 1NMCB 3RWHA 4XMPH 4O2EB 1F4HA 2FBOJ 2W9DL 4JM2A 4Q9BA 3W39A 4HX1A 2D7TH 1TCRA 1X5LA 5J13B 2CIKB 1SMOA 2LVCA 4EUPA 3EDKA 4P2OB 2EXWC 5F7DB 4LSTL 3FQRA 3MNWA 4XP6H 4S1SH 5E00B 3PGDA 1ZHBA 2IWGA 4R4ND 3VDBA 4M48H 2B0SL 4OCLC 2C3HA 3ES6B 3WDJA 4FTVD 3MLSH 4P9HH 2A9MH 2RCSL 4W4OC 4V2BA 4LAJH 1X5AA 2BFVL 4PYGA 2O93L 1IGJB 1NCTA 1F58L 2DLHA 4WFED 4YHYB 3NPSB 4WIQA 3FMGL 3QUXC 5B21A 4L8DB 2X7LB 1MCPL 3MOAL 5E6YA 3ARQA 3O41B 2EYRB 2Y6SC 3OKOB 4LSVH 4Z7QF 1DBJL 5C0AE 4U6HA 3BGFB 4YEEA 4HC1L 3BMWA 2IQAA 1E4KC 4XHJD 3UAJC 4GXUM 4V1DE 4IIQC 1IGIH 4U6YB 3A6CH 5I74C 4Y0GA 4CMHC 1IL1A 1MFNA 2DLTA 3HA0A 2MHAA 2W9DH 4BSWA 2NZ9D 1Y6KR 4YC2B 3QQNA 4FXGB 2E7BA 1MSPA 4KJPC 3QFDA 4GUPA 4KVCH 1I3GH 1MAJA 2YPLD 3QIBA 2ADJA 3GSRA 4GAJL 4RA0C 2P43B 3OHXB 3OZ9H 2BVPB 5IF0B 4R97B 2B0SH 1EH9A 4X6CF 5GGSY 3QUMH 3EKCA 1FZJB 5EA0L 3K2MC 1ZLVK 1JYXA 4JHZA 3L3KA 2RCSH 3TCLB 1EXUA 3DUUA 4U1KB 4NNXA 4WW1A 2BFVH 4HUWB 2HRLA 4X0KA 3MRLB 2F8OA 1U41A 3C09C 4RRPA 3V6OE 1F58H 1LD9B 2YA0A 3FMGH 1MCPH 3MOAH 5BZWA 5JXED 2DIBA 3P9WB 5F7EL 2E9WA 4RAUA 1EUTA 2XWTB 4F57L 4G8EA 5A2FA 5HHQA 3L3GA 2CO6B 3O6LL 2BHUA 3MACL 4G7VL 2OJZH 4TSCL 5SWZA 4OAWB 4PBVC 2WBJB 4EN3A 1MI5