2EIZB

Crystal structure of humanized hyhel-10 fv mutant(hw47y)-hen lysozyme complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
QVQLQESGPGLMKPSETLSLTCSVSGDSIRSDYWSWIRQPPGKGLEYIGYVSYSGSTYYNPSLKSRVTISVDTSKNRFSLKLNSVTAADTAVYYCARWDGDYWGQGILVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords ANTI-LYSOZYME ANTIBODY FV REGION
publication title Critical contribution of VH-VL interaction to reshaping of an antibody: the case of humanization of anti-lysozyme antibody, HyHEL-10
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2007-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eizB00
5FYJU 3ZTNH 1CFNB 4H1LA 3STZA 3RVTC 4X4YB 3IDJA 4L8BA 5KS9A 1WBZB 1E6OL 3MJ6A 1AI1H 4J7RA 5IHUL 1G7LB 2HT4C 1KXTB 5H35A 4NQED 4YGVB 1YY9D 5I1AA 4L9LB 1BZ7B 3W81A 1KT2B 5FYLH 4BSVB 1MLBB 3MMEB 4PY7B 4Q2ZB 5EU5B 5F7EH 3KPSB 3WJJC 4X9GA 1KEML 2BHYA 3CFEA 4ZXBD 5C0EB 1A7QH 1J18A 5CGMA 4Q7DA 2VO5A 4HWZB 4BFEA 1QACA 3OB0H 3PF2A 2YWYA 3KYKH 1HQ4A 3BW9A 5AZEH 3ZE0E 5J12C 3I2CL 3J8F7 3KDMB 4FQHB 3QIWC 5ADPL 2ITDB 2EDXA 3HC3L 2VDOH 3VD7A 5B38A 1UXWA 1YY8A 4ESKA 2IFFH 3QA3B 2VDLH 3H42H 5EOQL 3ARGD 4CRPA 3MGAA 5LBSL 2DBLL 5JR1L 2NMSA 5JIHA 2P5EA 5DA0B 1J10A 4GH7B 2IF7A 3JXAA 3WIFA 4I0PC 3D39B 4NM8H 1IL1B 2XKNB 4OCXL 3V5KA 2PF6A 2LABA 3S3JA 3VRIA 3C6SB 4LK4A 3B3IA 1W72B 1DBJH 4MWFA 1ZVSB 4WI7A 1TTGA 4YFLF 3C6LA 1FPTL 5HHMD 2X1XR 3C09B 2QQNL 2PNDA 4QYOB 4WW2F 5CEZE 3RDTD 4TN9A 4XP5H 1YNLL 5D5ME 4PJHE 3VXNA 3TYFA 5MEPA 4G8EB 5DHYA 3ULSA 2UWEA 3G6AA 3HLAA 5I76B 2X1PA 1LNUB 5E08H 1FDLH 1MFNA 4DVBB 4NQVB 1RUPL 3ULVE 3IGAA 5EIIB 1F45A 2LTQC 3A67L 3PWVA 3KXFB 1OAUL 3VWJD 2Q8AH 1QFWI 4JN2A 1IEHA 5KSUB 1MSPA 2BNRA 3ZT5A 1NH6A 1ZV5A 4P2QD 4PJ5A 4P57A 5KTEL 3BH9B 5TF1L 2XV6B 4EXKA 5TDNB 4WUKL 4EDXB 2RQ8A 4UQ3A 2EYSB 2X4UB 4X6EB 5FYKE 2ADIB 4HWBA 3AREA 4JFQA 1NMCC 4L3ED 1FZKA 3IDIB 3WNLA 1PGRB 2YHGA 3QUKB 4Z7WB 1LD9B 3EJZD 3Q0HA 2NX5D 1AXTH 4OZFB 5DD6A 3SGDH 2NXYC 3DX9A 3LZFL 4PJFB 5JOPD 5DMKA 5E5MB 3ARFA 4CJ0A 3V4PH 12E8H 1VADB 1U8PA 4O9HH 5ETUA 4QHNB 4OQTL 3MLUH 5T1KA 4NWTH 1NSNH 1WCBA 1I8KB 3WDHA 3MV8E 4YHZH 3NACL 3G5ZA 1DDHA 1H3XA 5EN2B 4RWHA 4BQCA 2AK1L 2WW8A 4YDIL 2ADGB 2BSSB 3WHE1 5KSVB 2BRQA 5J11C 1WZKA 1S3KL 3QEQE 4C56E 3E1F1 4X6FB 4YHIA 3P4MB 3QEGH 1NAMA 1FFQA 2XTJC 4XPHH 2MPAL 4GMSH 3VGEA 5L6YL 1JGDB 1P6AB 1P9MC 1RFDL 2PYFB 3MOAL 3OG6B 3LB6D 4JZJA 4QRRD 4E9LA 4NQDA 4DGYH 5L7XH 5F3HA 4PG2A 2ADFL 2AABH 5F9OL 1A02N 2FD6L 5TJWK 2C4FU 4H1LB 3GHBL 4XPAH 4RFOH 3STZB 5IW1A 4N8CL 1JNLL 3IDJB 3HZYA 4Z0BL 5KS9B 2R2BA 4HV8A 3BRGC 4JM2F 1JZ4A 3S4SG 2EDKA 3JTSA 3TZVC 5IMOA 5CJXC 3ULVL 4MLIA 2I25N 4PJ9C 3TFKD 1JN6A 3FTGA 4RDQF 5JHDE 2NY4C 5I1AB 4DJMA 1CE1L 4K7PX 1NCCH 1V3KA 2QSCH 1KENL 3PWPD 3QCVH 4DN3H 4JM2D 1ACZA 4Z7QF 1AD0A 3CFEB 3QHZH 5D96C 3L5IA 1HNGA 1U8KA 5E6IA 4CVZA 1M7IA 3S6CA 1MCLA 1S9XA 4DN4L 1OAYL 1CK0L 2FO1A 4HIIA 5D72L 3UTPE 1HQ4B 3BW9B 2ADJB 3SHSA 3QPQC 4P23D 5BV7L 3TM6A 3EIFA 1OHQA 4HMCA 3TO4D 3OQ3B 3QIUC 3IVKA 1LEKA 1N6QH 3SDAD 4OM0L 4Y5XC 3I3DA 2KL6A 5B38B 1UXWB 4OLWL 3RRQA 2OZ4A 4WFHE 1YY8B 4NQCE 3H9SE 3RVVD 2ZCKH 4PJBE 5C6TH 2P5EB 4Q9BA 3WIFB 2IBZX 1PY9A 3CFBA 3O0RL 2VDKL 5GS0L 4JQXA 3OGOE 2D7OA 4NKDA 3VRIB 4FFVC 1KPVB 4NO5A 3K80A 3B3IB 4MWFB 2P47B 3OTTA 4NZRH 2EIDA 3C6LB 3JV5A 2H2SC 2AEIT 5DO2D 3MLPA 1FNGB 1J1XH 4XP6L 5JZ7D 3HUJE 5I1HL 4PB0H 1R3LA 1WZMA 2WAHA 3GUTA 4PJIF 3SE4A 2AI0L 2MJWA 4O02L 3VXNB 3Q5OA 1HQRA 2YD7A 2VN4A 3D2UA 5DHYB 5C0BB 5MEPB 3TYFB 3G6AB 3HLAB 4WJ5A 3ULSB 1JYNA 4JKPL 1CLOH 4GMTH 3IGAB 3PWVB 2DQUH 4N1CA 3GB7A 5FUOH 3EOTH 4JFDA 4JN2B 4WFED 1INEH 2BNRB 3QIBB 4XXCA 4Z77A 3TT1L 1I7UB 4PJ5B 3B9KA 4P57B 4PBXA 2GI7A 4NZTH 2ITCA 3MC0A 3MBEA 4MJ6A 2B2XL 1H3GA 4C4KT 3IS0X 5I8KH 1KIQA 1KXQE 4UTBH 3QRGH 2XZQL 3AREB 4JFQB 1FZKB 3INUH 4OUUB 2Y1VA 1XF4A 4DVRL 3EYUH 1IM9D 2EDBA 5DD6B 5DJAA 4ACPA 3DX9B 3QDJE 4NO0D 5DMKB 3ARFB 5JDSA 1WICA 2NY7H 2HKFH 1U8PB 3KPQA 3QUYD 4Z5RA 5ETUB 3W11C 4QNPE 4MDJA 4H26A 2E9BA 1X5IA 2VZVA 4KK8C 5T1KB 4PJEA 1G7MA 1WCBB 1NAKH 3G5ZB 2VH5L 1Z9LA 1DDHB 5DLMH 1NCAL 4N9OB 4LRNH 5JW3L 3HB3C 1FNHA 1ZVYA 4Y2DC 3U82B 1CXIA 3MGOA 4K2UL 1VFOA 4OFYD 4G5ZH 4YHIB 1NAMB 1WZ1H 1QSFD 4LSVL 5IQ7H 4G6AC 4XNZB 2MCPH 4J23A 4JZJB 5J06A 2IH1A 1IZKA 4NQDB 1UKTA 4OLUL 5F3HB 1V3JA 1Y6NR 1HXYA 5FO9A 4S1QL 5L0QC 1NFDF 5IW1B 3VFRA 1X7QA 4M8QA 2D03L 4LIQH 2RCSH 2ZUYA 3KJ6L 3HZYB 2R2BB 2DWDA 4HV8B 5FA3A 1ZLWH 5IGXL 4CDHA 4F15C 1NBVH 4DAGL 1SBBA 3QPXL 4DCQA 5IMOB 4OSUH 3BRDA 3QAZB 3FTGB 3EYQC 4GXVL 3U79A 4MXQC 1Z0NA 3GSNL 4JGJA 3EKCA 4W68A 2R0ZH 2OMBA 5EBMA 3L5JA 3CVHH 5HBBA 1AD0B 2R4SH 1T80A 5E6IB 4CVZB 4U6YA 1M7IB 1T03H 3H7BA 3RVWC 5BRZA 1S9XB 4HIIB 1S7VA 5AYUL 1AFVH 4H88L 3ZTNL 1KNOA 4JRXB 1YEJH 2UVEA 5F8RC 4HUVA 3D3VD 1FE8H 5T3XE 1FFRA 5FM5O 1NC2D 5C3TA 2AKRA 1CTNA 4HQQL 1FO0A 4Q6IC 4Y7MA 4AZ8A 5LQBH 4BKLB 3I75B 3HG1B 4NGHL 1WEJH 5BZWA 4NQXA 3ZKXC 3VFGL 2ICWA 4MNQE 3V0WL 3IFPA 4XBGA 4G3YH 1GHFL 3CFBB 1Y6MR 1KYOK 3P0YH 1A7OH 2VWEE 4NKDB 1VACA 4K71B 4NO5B 4Z7UA 4RGNE 1VESA 4OCNC 3BGFB 4OCMC 1SJVA 1NFKA 4QGTA 1KELH 4Z7WE 3T3PF 2Q8BH 1R3LB 3CFKA 3B9DA 1CI5A 1D5IH 4P46A 5I1JH 3GUTB 3FRPA 5FGBC 4U6VL 3KPRE 4HBCL 2ILLA 4PRHD 1XF2A 2X9XA 3MLZH 1HQRB 3D2UB 5CKGA 4PJFE 3A0OA 4WJ5B 5E9DD 4AK1A 4XP4L 4OCWH 4OF0A 5L2KD 1FVDA 3GB7B 3MCKA 2C7UA 4JFDB 4GRWH 4Y5VC 4OB5H 4Z77B 3PDDA 3C5ZA 1YJDH 1AE6H 3B9KB 5J1TC 2ITCB 3MBEB 4MJ6B 1MQKL 5HYSA 1BIIA 4U3HA 1KIQB 1AJ7L 4XTRC 4ZO7A 5IBTH 5C08D 4GQPH 4M7JL 3BESR 5GS2H 3L1OH 3D25A 3LD8B 4GUPB 5KVFL 1II4E 1XF4B 3TPKA 1X6NA 2QKIA 2R4RH 1MFDH 3BP6A 4M1CD 1XCQA 4XP5L 5DJAB 1EFXD 4M62H 1L0QA 1OWWA 3CLEH 3CK0H 1JPTH 5JDSB 3MRFA 2X4PA 1PBYA 3KPQB 4Z5RB 4L8DA 4H26B 4GRLC 4OZIF 1VFUA 3EGSA 4PJEB 1G7MB 2DQHH 1BAFL 3A6CH 4D3CL 5KS9E 4BM7A 3RIAF 4ODVL 1KFAL 3CDYA 3UTSA 4TSAL 3T1WA 4GBXA 3VJ6B 3MGOB 1IGCH 1FLRH 3N85H 4OGZA 4KK6C 1ORQA 3DECA 4K07A 1MCHA 2DQGL 1JMXA 3NH7L 5MP6L 4LRIA 4KZDH 3T0EC 1YMHA 4NZUH 2IH1B 1U2HA 1RJZA 3HPJA 4YLQT 5GGQH 1DLFL 5C9KA 3SDCA 3ILPA 3GBNL 12E8L 2B1AH 5F9WB 1HXYB 1D9KD 1HCFX 2PXYC 2PYEE 3VFRB 1X7QB 4M8QB 4AEIL 1YPZF 1NSNL 4JRYA 1BFVL 2DWDB 2W9EH 4M61A 5JOFA 4U7SA 1T66C 5D93C 5FA3B 3ET9F 2GITA 3MV01 3IRPX 1TZGH 1MI5D 2EDNA 1MWAA 2BVYA 4DCQB 3K2UL 2CGRH 4XHQA 1DSFH 3VRJA 5ELIA 1CDGA 1D5MB 5C0AA 1MH5A 4N0YL 2H1PH 5EBMB 2P5EE 5IT2H 5FKPB 2YXFA 4G7YH 3FRUA 1OCWH 3TN0A 1IBGL 2XY2A 3KPOA 3RGVC 4RGOH 3HE6A 2Q3ZA 4Y4HD 3GO1H 5J6HA 2WV3A 4U6YB 4XX1G 4FP8L 2YPVH 5HVHB 3H7BB 2XRAH 2VLRA 5L7XL 2BSRA 4IRJA 2A6KA 3P2TA 2VDNL 5JMRA 1S7VB 2WBJA 2OX5A 4BQ9A 5BJTA 1KNOB 2FH6A 1JIBA 3U7WH 1OQOA 1HZHL 2V9QA 4N5EC 3FB8A 5DZNA 4HUVB 4Q97A 4LLQA 3AAZA 1SBSL 5DVMA 2AKRB 5FM4A 5GS3A 5DD0H 1N0LA 3O3EA 3WFEH 1FO0B 1R3IL 3ZDYF 2ZP0T 5C0BE 2IANA 3DXAE 5BZWB 4NQXB 5LJYH 2ICWB 1A6PA 3BZEA 3IFPB 4XBGB 1NCCL 4PJDF 5DJCA 1T89C 5IG7A 3MLTA 4DN3L 4UV7H 2Q76A 2VC2L 2BNRE 2DLFL 2I60H 3HAEG 3FQRA 3S35L 3KHQA 4ONFH 1VACB 4Z7UB 3TA3A 3WUWG 4I0KA 4HKZA 5D2NC 2JF1A 3V79C 2NY0B 3GMMA 5E4EC 4NM4L 4K9EL 3LEVH 2KZ1B 1QUNA 3CFKB 4P46B 2BRRH 2BSED 2NY2C 1XF2B 4R90H 4DQOL 3P11H 5E2JA 1TJIL 2HTKC 4PBVC 2J7LA 2EIEA 3SO3B 3HHRB 1OVZA 4FTVD 1FVDB 3MCKB 3PWLA 1IEBA 4M4RA 5F7MC 5C2BL 1IGML 4P9HH 4RIRA 3CZJA 3EYSH 3C5ZB 1C5BL 4JPKH 4P2CG 3C60A 2H45A 5HYSB 5C7XL 1BIIB 3QJHA 3UBXG 2Q7YA 1N3NB 2FATH 3QXAA 1EO8H 1PQZA 2YK1L 2Z92A 4GJTB 3WXVH 4PJXA 2QKIB 4PYHA 2P8MA 4MB4A 3BP6B 1OTTC 1MJUH 1XCQB 4YK4B 4M6NH 1MY5A 1OGAA 5SWZD 4NRYA 4LNVA 1GPOH 2UUDH 5C8JA 5HDQH 3MRFB 1MFEH 2X4PB 2X2YA 4L8DB 5D4QA 1MFAH 2QADB 3WKML 4YUEL 3EGSB 3OKNA 1MJJA 2HFFA 3G6JF 4J3XA 3VWKD 1INEL 3NCFB 4PRPD 1BF8A 3LRGA 1MCRA 4PGBA 1UWEH 3HI6L 3M17A 2AQ2A 1RZFL 2QQLH 3RU8H 1WWCA 3FFCA 4LQFH 5I8KL 3O11B 3CDFA 1A64A 4GBXB 3RPKA 2XG4A 3MUGA 4IMLA 1F00I 1MCOH 1I3UA 3WFBH 4EUPH 3INUL 1ORQB 3DUSA 1SVCP 1L9MA 4F9PC 2OL3H 3SJVD 4HS3A 1YMHB 4AIOA 3MLRH 5HI5C 3Q6FA 3QEHA 2W59A 1RJZB 3HPJB 3W5MA 2YUXA 4ODSL 4PJAF 3UTZA 3ILPB 1X5FA 2HKFL 3S98A 1CDBA 4X5WA 1G7PA 3TF7C 2YD1A 4DTGH 4GLRI 5D1QA 2CKBB 4HW6A 4FMFA 4JRXE 4JRYB 3I6LE 4W6WB 4Q58C 1UKSA 4JVPA 1IE5A 2A0LC 4M61B 5JOFB 4DFIA 5MERA 2XA8H 2GITB 5DURB 1T1ZA 1MWAB 5CEZH 4RMSA 1ZLVH 2RR3A 1C08A 1FGNH 3HZMB 4N68A 3IETA 3VRJB 1ZT4A 3IXAA 5C0AB 3HG1E 1MH5B 3DI3B 4HJJL 1FSKB 5J7CC 3T2OA 3W2DL 2JJVA 5BMFH 3FRUB 5IQ7L 3ULVC 4PJCF 3TN0B 3ILQC 3KPOB 4D94A 3DSNA 5J6HB 4TTGA 2GJZA 3ES6A 2VLRB 2BSRB 3MCLH 3O2VL 3LKOB 4IRJB 2RB8A 4XCFH 4RX4A 2WBJB 3MLWH 2XQYK 3ESUF 1A7RH 3FB8B 4NKIL 3BKJH 4LSPH 1HNFA 2DQTL 2DI7A 2FBOJ 3AAZB 4LLQB 2MKLC 5TQ0L 1HKLH 4WEBH 1CL7H 3O3EB 3WSQH 4OSUL 1IMHC 2IANB 3Q5YA 1MCJA 1A3RL 3O6MH 3DX8A 2R0ZL 5DJCB 5KSAC 5TPWH 5D70L 3QR2A 2NZ9C 3MLTB 3CVHL 2FX7L 4JFDE 2J5LB 2Q76B 4XAWH 5EPMA 5FYJD 2QLVB 3BZ4A 4XVJH 3FQRB 4MMZC 3VFVA 1QG3A 4F9LC 1TQBB 3TA3B 1S7SA 1AFVL 4HKZB 3SDYH 1FYTE 3ARBA 2AJVH 2YN5A 3BPCA 3JVGC 3BD4A 1MRCL 4QXGH 4U1GC 5GS0C 1FE8L 3PIQA 4N9GB 5EZOH 4DKAA 1I3VA 1JE6A 1K8DB 1PG7L 4PGEA 5M7QA 1CGYA 1GZPA 2PR4H 4LLUA 3LMJH 2I5YH 3U0PA 1UB5A 1ZVHA 3O2DL 5F6HJ 2AQ1A 3PWLB 1IEBB 4UI2A 1I9IH 3LEYH 5IJKC 1IC7L 4RIRB 4QWWD 4YHLL 3EZ8A 3H3PL 1A7OL 5ESQA 1JPSH 3C60B 2W1NA 1DQLL 3QJHB 1XAUA 4ZAKA 4CMHB 3EDFA 2Q7YB 1KBGL 3QXAB 1EEZB 4YBHA 2IC2A 1PQZB 1TNNA 2E3VA 2Z92B 3OAUH 4PJXB 1M6OA 3GKWH 2P8MB 4H8WL 1KELL 4WV1C 3SBWC 4XP1L 1UWGH 5LGKA 1NCTA 1OGAB 4NRYB 5EUOF 3HFML 3ARDA 4Z7NF 4J2XA 2MWCA 4LLWA 5C8JB 1JWUA 3SCMC 1T0MA 3JWOH 4Q9CA 1K2DB 2R9HC 5CGTA 4AG4L 5IOPA 1K5NA 1OD9A 3UJTH 3OKNB 3UC0H 5BO1H 4PLKD 1MJJB 2HFFB 4GG8A 3P9WB 1A5FL 4LEXH 1NCDL 1TTFA 3FO0L 4XCNA 1J05A 2OYPA 3VFSA 4PGBB 3SGDI 5H2BB 1AE6L 3M17B 1X5AA 4KKLC 4L3CA 3FFCB 4QRPD 3FZUD 5IBTL 3MUGB 4PV9A 4JVWA 4IMLB 1QFUL 3DUSB 5FA4A 4HS3B 3Q6FB 3QEHB 3CLEL 2FIKA 1CZ8H 4KAQL 3RZCA 5F7WC 1JPTL 3MRGA 4TSBH 3UTZB 4FXGA 4XWGH 4X4MA 3NGBC 4FQLL 2F53D 4X5WB 1G7PB 4F2MA 4Q74A 2VZ3A 3O2WL 4JANA 1ZLWK 1RZ7L 3OZ9H 4KVNH 4HK3N 4JO4L 4A6YH 5MERB 3FKUS 4TTDC 1OWRM 3Q1SL 1C08B 5J57B 3IETB 1CGXA 3TBTA 2ZUQC 1ZT4B 1HI6A 1Q9KA 3IXAB 3CAFA 3EFFA 2VOTA 3JWDL 5L2JA 3GIZL 1BM3L 3WIHH 3DYMA 2BJMH 2A2QT 2D9QB 1AGFA 4KMTH 5T1MA 2GJZB 3ES6B 3WHXA 1EJ6A 5CINL 1J12A 5GISL 5GGQL 1JBJA 4M4PA 4ZTPH 2OXGA 4Z7UE 1C5CH 3FQTA 4EBQL 4X8XA 1FIGH 4KROC 1WCQA 3SGEH 1YEGH 4LCCC 1FORH 2FECL 1UGNA 2UZIL 3WD5L 3ZKND 1FNLA 1CFBA 5DS8B 2ZSVA 3A6OA 3GFUA 1EFQA 3IFOA 1XGPA 2VZOA 5B3JE 1X3DA 2RAMA 3HA0A 1EJOL 2GTZA 3BYTA 1MCWW 3DX8B 2A6JA 2V6HA 3HC4H 4LSQH 5JW4M 4MDIA 4KMQA 3OAZK 1CVSC 2HLFD 2IMMA 4TQEL 5EPMB 3BZ4B 1B0GA 5EFIB 2YPVL 3KPNA 3VFVB 1T22A 1LO3L 4P99A 3MRPA 5JHLL 3S36X 1S7SB 3I3EA 1KYOJ 1MHPL 4L4VD 3V0AC 5EA0L 3ARBB 3BPCB 1AP2A 4Y2OA 3NIDE 3SKOA 3HC0A 3PIQB 4LGSB 2PO6C 4PGEB 2O5XH 2B4CL 1BZQK 1GZPB 2DQIL 2V2XA 4LLUB 2CUHA 1TFHA 3WXWL 3B8SA 3U0PB 5LGJA 3ARSA 1UB5B 2CRZA 5F21B 4G80A 2Y6SC 4L8SA 4XC3H 5A16B 2OS7A 2ZPKH 4U2YA 5I30L 1N0XH 1T6WA 4Q9QH 4UV7L 1MCQA 1ES0A 3ECBA 1FH5H 3S97C 2I60L 3WIIH 4KFZC 3S9DB 1FNAA 2EIZA 4ZAKB 1IQWH 4OUOA 1J1PL 1OD7A 1MUJA 4NPYA 5DC4B 2X89D 1GGTA 4HIXH 4H0IA 4Z6AT 4WO4C 3LEVL 3DURB 4R2GD 4GAJL 3ARDB 1CXHA 4LLWB 1JWUB 3CH8A 4JDTL 1T0MB 1K6QH 3PGFH 1IKNA 3SO5A 1LK3H 2IQ9H 4MVBD 1OTSD 1DEDA 2QQKH 1K5NB 4JFFD 2EE9A 1W72H 5IQ9A 4JRYE 4JFXA 4PRBA 4GG8B 5GZOD 3ZL4H 3VFSB 4XCNB 1MCCA 1J05B 4O4YH 1T7VA 1ZHNB 5T3XH 3C09C 3SY0A 4UV4L 5TFSH 1J5OL 5T33H 4L3CB 1ZXQA 2HG5A 5CP3A 4X6CA 1IC5H 4PV9B 5ESVA 4OZFG 4GW5A 1Z9SA 1EO8L 1DBML 1RJCA 4OLXL 3MYJA 5FA4B 1TVDA 2E9IA 2WQRA 1NUFA 2OP4H 1RHFA 4OZGA 1T5WA 1I9RL 4WUUE 3TYGH 3MRGB 4JG1L 4KH2A 4X98A 1FL5A 5GHWH 2VLRE 4WW2A 3HRZA 4FXGB 4R26L 3VI3E 5SX4H 2OI9B 5FFLA 4F2MB 3MO1A 3LH2H 5CZVL 1BJ8A 2YRPA 4HS6A 1E4XH 4JANB 4B53A 2VWEC 1DBBL 4P2QA 1Q72L 1FYHB 4RGNC 2CSPA 4ZTOH 1NEZG 1O7VA 1HDMA 5CBEA 1UQSA 1QSEA 3B5TA 4BYHA 3DGCR 4P3CL 3SKNA 3OKDA 5IVXF 4L3EA 4LDOB 3TBTB 3WNKA 1HI6B 1Q9KB 2EDQA 2IANE 3MA7A 5CP7B 3EFFB 3MRJA 1G9NH 2EZ0C 5L2JB 3WFBL 3FAXA 2F8XC 4DEPC 1YEKL 1OLLA 3KPTA 5GIRA 1FAIL 2OL3L 3PG2A 1AGFB 3F58L 4RNRA 4K94H 1DVFA 5T1MB 2VSDA 1RUAH 3WHXB 1T7YA 4TULL 2R8SH 3P73A 4XC1H 2QSQA 4HUXA 5I2IA 3E2HB 1J87A 2BHUA 3FQTB 2CR3A 3NTCH 4DOHB 4DTGL 4KHXH 2UYLA 1KJ2A 4ELKA 4OKVA 1IKFH 3B6SB 4NJ9H 2A9NH 2GFBA 2ZSVB 3IFOB 1XGPB 3TJEH 1DQDL 2GTZB 1F8TL 2DJUA 5HI3C 4FS0A 4NDMA 3PV7A 4AEEA 2A6JB 5IV2A 4MDIB 5IESH 2HT3D 5I1KH 5HGGS 8FABA 1BFTA 4K8RC 5IFHH 1H5BA 1JNNL 2CH8A 4H1LH 4PLJC 1RK0A 3LQMA 5DVOA 2CO6B 4X99A 4X5LA 3I6GA 1B0GB 3KPNB 3WDJA 5AG8A 1T22B 1I7RA 2AJSH 1JVKA 3MRPB 3E8UL 4QGYA 4FQJH 1OAKL 3ARTA 1JZ8A 2W0PA 5B38G 5CCKL 1AP2B 4PJBF 1RIUH 3HC0B 1VCAA 1QEWA 3C87A 3QI9D 4HXBL 1VFAB 5EBGA 1WT5A 4Y4KA 3UTOA 1OGAE 1GGIL 3C2AL 1LO2H 4WEBL 3WSQL 2V2XB 1R5IA 1KIPA 5LGJB 2XI9A 5IVOA 5DWUH 4N8VG 3QCUL 1FP5A 5TPWL 4O2EB 2P8LB 2VKWA 2C5DC 4A2MA 1ES0B 3ECBB 3ETBF 1ZLSH 4XVJL 1KN4L 5AZ2L 4WWKD 4MD5A 3PP4H 3B8YA 4FABL 2EIZB 3RAJL 1P53A 1WZLA 3TO4A 1G6RL 1MUJB 4NPYB 1BECA 3ALPA 3SDYL 1CXLA 5JIKA 4F58L 3QJFA 2F19H 2UUDK 1JTOA 5DVKA 4G8GD 1TPXC 2AEPL 5EZOL 4V1DD 5HI4C 4X6BA 5J4MA 1EAPA 4NO2A 3LKRA 1WIUA 4L5FH 1F3RB 1U58A 4QCIB 2D7TH 4HC1A 1I4FA 2VZTA 1DE4B 5FYKU 4XI5C 3BKCL 4UOJA 4MQXC 1I9JL 2BVOA 4MA3A 5IQ9B 4JFXB 4PRBB 3WFCL 4ZPTB 1BD2A 3HTLX 5JW5A 2VR9A 3TC9A 4N8PA 3SY0B 1JPSL 2HG5B 5HHMB 3HR5A 4X6CB 2JLLA 5ESVB 1ADQA 3P3YA 4GW5B 3IJSA 3MYJB 4XNMA 3T3MF 5DFVC 1ZLUH 4IRSA 4TPRH 1KB5L 2BMKA 3V95A 3RVTD 2ARWA 1I8MA 4OZGB 1T5WB 3GHEL 4WVRA 2JCCF 3C8HA 4X98B 1JGVL 2AK4D 4WW2B 3JWOL 4OGAC 1EMTH 3QIBC 3WNPA 1RUQH 4S11A 1T0NA 3MO1B 3VD3A 1UZ8A 4PJIA 4I8DA 4HS6B 1FGVL 5L88L 4P2QB 1W2KT 4ODWA 5GRJL 3RA7H 3NZ8A 1N7ML 2EICA 4HWBH 5D1ZD 3U48A 1F4AA 1NLDL 5CBEB 2XZCH 5FYLD 1M05A 1UQSB 3AREC 3SKNB 3OKDB 4KKBC 4DK3A 4L3EB 4NOBA 5ISZD 3MA7B 3JZ7A 3MRJB 1IM9A 3OB8A 4GT7A 3X11A 4H0HB 2HH0H 3RTQD 4JCMA 4PFEA 4TNWF 5A2JH 4K3GA 4FOMA 4KUZL 5GIRB 2FECI 4H20L 3U0WL 4LSRL 4RNRB 2PCPA 15C8H 3QIWD 5IBUB 4KY1H 3P73B 2EDOA 5LVEA 2VUOA 4EQ3A 4HUXB 5I2IB 4Q0XL 2KKQA 1P7QD 3OZ9L 4KVNL 4RAVA 3IAPA 2EH7L 4PGDA 3CGTA 2UYLB 4MJIE 1KJ2B 4ELKB 1MHHA 1NAMH 1OSPL 3N1MC 3V4UL 4OKVB 1KPUA 4Q9RL 1MRFH 4I0PD 4OFYA 5D7IA 2GFBB 5HJ3A 1QSFA 1E6JL 4XNZC 4JPVL 3LQAH 4NDMB 1IRAY 5HXMA 5IV2B 1WSST 3P9MB 4ORGB 2Z8WC 3MTRA 2DQDH 5EBLA 4HWEL 8FABB 1KB9J 4ZDHA 4BUGA 3ZT7A 5BOPA 4PG2C 1H5BB 1QPPA 3O6LH 4J6RL 1RK0B 5C07D 4X99B 3BZDA 4FQCL 3I6GB 4JVUA 4KGJA 1GGCH 2HA1A 4I3SL 3IF1A 1I7RB 3QDGD 5J89A 1EAJA 4OLVH 2OJEA 2APXA 5JXED 1OP3H 1C5CL 1BQHG 4B50A 1G6VK 5SWQA 1W8OA 1OGTA 5DDHA 3QAZC 3GRWL 5HHXH 1MCBA 4YXHH 4Y4KB 4BQ6A 2GK0B 5GSVA 3BXNA 5L9DH 1NFDA 1CGWA 4XMKH 3V6FA 1R5IB 1NJ9A 1KIPB 4J3UA 2HYMA 3N06B 2CK2A 2N4IA 3GI8H 5E6IC 5F96H 3P40A 1A6TA 3QFJA 4JLRB 4I1NB 1UZ6E 1H3VA 2CRIA 1KLUA 4I0CC 4RAHA 2VLKA 2YS4A 3R8BB 4KGLA 4MD5B 3NCMA 5C0NC 2DQCH 2NXYD 2R0LH 5C0RH 5E0QA 3TO4B 2OZ4H 2NYYD 4KJQD 2B0SL 2Z31C 4P2OD 1EEQA 3SDAB 5DMYA 1IGFH 3KYOA 2GAZA 3QJFB 3ARYA 2EDDA 1JZ7A 5I6XC 4KJPD 4HH9A 7FABL 1RUMH 1U36A 4X6BB 4LSUL 1EAPB 1VPOL 4BFGA 1CXKA 4NO2B 3LKRB 1PZUB 1WFNA 5FHAL 2N56A 2YD5A 3LS5L 1S5IL 1I4FB 4X4ME 5DUPL 1CBVH 2DBJA 3MA9H 4DKEL 4XC3L 3ZDZE 1NCUA 3TT3L 5E03A 4MA3B 4WRLA 4K71C 1BD2B 1UADC 1OLZA 5JW5B 3BGFC 4J12A 4YDLC 4D8PA 4TSCH 4K3HA 4JKKA 4JHZA 2CQVA 1RURL 3HR5B 2H32A 1A7BA 2X4TA 3QO1A 3SE4C 2JTDA 3IJSB 4KKAD 3DVGA 2MQ0A 3D85D 4PRHA 4D9LH 4IRSB 1RUKL 1YMMA 2BMKB 32C2B 3STLA 3L3JA 4FXLA 1T04A 1I8MB 4D9QD 1JHLH 2W92A 4ZOBA 4P5TD 1ONQA 4F57H 5JA9A 1BJMA 3TZVD 5GRZA 4XXCC 1T0NB 3B9KC 1UZ8B 4PJIB 1EERB 3GJFK 3X3GH 3BVNA 3S3SA 4ODWB 4NC1E 3NZ8B 4OJFH 2YD4A 3GSUA 4FXKA 4PB9H 1M05B 4I18A 4YXKL 3THMH 2BC4A 3LD8C 3NIGE 5JQ6H 4U1IA 3RKDC 1DL7H 2VDQH 4DUXA 5T33L 4LFHD 4XHJC 3AROA 1IM9B 3X11B 4JFEA 1JI1A 1WV7T 2J6EA 4JO3L 1EHLH 4PJ9A 4X0KA 5EOCL 3FMGL 4UNVA 2MTPA 3MRLA 3QPQD 1CXEA 4MJ4A 2OP4L 2PCPB 1Q0XH 1JYXA 5BCAA 3N9GL 2YUWA 5GHWL 4M1DH 4XAKD 3UYOD 4WI5A 5C0IA 3EO0B 4LASH 1QRND 2OJZL 5TE4L 4M3JA 4KRPD 4RAVB 5E2TH 4PGDB 3NBNA 5T1DL 3CMOH 1UWXH 4ZTOL 1QHOA 1MHHB 5J12B 1KPUB 1GGBH 4NQEE 2HN7B 1LO5A 3MRDA 5EC1A 4X7SL 3VFMA 4OZIA 2OTWB 3HMWH 2X1WL 2AV1A 3QIUA 4BK5A 1I1YA 1OAZL 5HJ3B 3UTTA 7CGTA 5MENA 4Y5XA 1QSFB 3S8WA 3CPLA 3LQZA 1MAKA 3STBA 3DVIA 1XF3A 1GIGH 5AAWA 1YNKH 5EBLB 3KYNA 4ZDHB 2YWZA 3P0VL 1HHJA 3IJHB 5GGTL 4CUCA 4ZQKA 1NKOA 1W0WA 3BX7C 3CJJA 4I48A 5BVPH 3IF1B 1SYSB 2Y5TA 4OBSA 3VFUA 2OJEB 3QULA 5SWQB 2R56L 3FJTA 4KHXL 1MI5A 2QTEA 1OGTB 5DDHB 2X70A 4EI6A 4L29A 2IPUK 1Z0MA 5GSVB 3BXNB 5I1GL 2A38A 1XGRA 1IKFL 1NFDB 4S1SL 2WUCH 2DL9A 5DRNA 1YPZA 4S1DD 3V6FB 4CU8A 2O5ZL 1NJ9B 2Y36L 4IDJH 1YEIH 5HVHC 4FZEH 1A6TB 1YYMH 3QFJB 5LAXA 4Y4HA 3TP4A 1KLUB 2GY7B 1AD9A 5HHNB 3LDBB 3QUMA 5EU6A 2VLKB 3CUPA 4XVTH 4ZUSA 3A6BL 4UIKH 1F6AA 3LCYA 3O3UN 1Z9MA 2WINA 5HHME 3VMPA 1FO0H 3S3PA 4XWOC 1PYWA 3FRPG 3OJMB 3X17A 5DD1L 1H3UA 1NC2B 1CIDA 1JUFA 2GAZB 4FQ1L 3UAJC 1RZJH 4KK8D 4XPTH 2VQ1A 4HH9B 1RZJC 3RNQA 1FJ1A 3AVEA 4M6OH 3HNSL 3M07A 4TOYH 4JJHA 4R4ND 4CDGC 1RIHL 3L3OA 4JGUA 3KLAA 4RMUA 4P2QE 4EDWL 5HYSG 1TENA 5MEOA 4C57C 4QOKD 3P30L 4D8PB 2NY0C 1JHTB 3CX5J 4FRWA 4AY0A 3TWCH 4LPXA 4XVSH 4P5MA 5T3ZH 2H32B 4L3EE 2FX9L 2X4TB 4P46C 5FDWA 3QO1B 1HYSC 2G60L 4Y2DA 2NX5E 1UJ3A 3DVGB 5T5FL 4PRHB 4KXZH 4JFHD 3SO3C 3STLB 3L3JB 5JOPE 3TJHD 5E9DB 1T04B 4Y16A 3EW3B 3QHTC 3KR3H 35C8L 1B2WH 3M8OL 3QXDA 4OGYL 4QHKI 4ZS6D 2D7TL 5INDA 3C5ZC 3VD9A 4Y1AD 4O51A 1I8LA 5DD3H 3K46A 3BVNB 2JJUA 3EYQD 1DBAH 1CCZA 4NT6A 2ORBL 3GSUB 3VW3H 4WI8A 4FXKB 2EYRA 4OM1H 4I18B 1U6AL 4O5LH 5TH2A 2BC4B 2HFGH 4U1IB 3QQNA 3JWNC 4ONGL 1L6XA 2VN7A 1MREL 3O81A 1D6VL 1MPAH 4G8FB 4YK4C 1NMBH 5LG1A 3QISA 4PJ9B 4UNTA 4X0KB 1EFXB 5SWZA 4N90E 4QRRE 3MRLB 1BIHA 5FK9A 2LAGB 2QADC 2HJKB 3ZYZA 3DI2B 3OF6A 3CU7A 4MXWH 5J1AA 4JG0L 4XNUL 5D96B 3B43A 5F1OB 1UACH 3L95A 5C0IB 1ZKAA 5K9JH 3FQWA 1CF8L 3F7PC 1I3GH 1I1AD 1U92A 1V3MA 3MFGB 4HWBL 1DP0A 5GGRA 5F9AC 3WMSA 4Z95L 5GRUH 1MNUH 4MSWA 3O3AA 2DDQL 2XZCL 5EC1B 1LO5B 2CKNA 1QRKA 3IU4H 3VFMB 4OZIB 3VGAB 2AV1B 3G5XA 4NKQB 3QIUB 3UTTB 4WCYH 3RY6A 1BWMA 4Y5XB 1M4KA 3CPLB 3PWPE 4O58H 3LQZB 1C16A 4NZDA 4M8VA 4XB8A 1XF3B 3RL2A 5TQ2H 2FR4A 4ELME 1OL0A 2JE8A 4YHKL 4YC2B 2Z35A 4S1RH 4U1SA 1HHJB 4BQBA 2ID5A 2ZUWA 4ZQKB 3OKYA 3T4YA 1W0WB 5I71B 4I48B 2R1YA 1AC0A 2HJLA 2Y5TB 4CJ1A 2UY6A 1MWAH 3VFUB 1PKQA 5TE7H 1SY6A 4Z7QE 1A8JH 1RZKH 3QULB 1F11A 4G6FB 5JORA 1RZKC 4UAOC 1MI5B 5BS0A 4ETQA 4Q6YA 5I73C 2AJYL 2X70B 3U4BL 4EI6B 4L29B 4U1LA 3CZFA 4NWUH 4BZ1L 1MRFL 4KRMB 5D7LD 1XGRB 5I18L 1FSKC 5DRNB 1YPZB 3BUYA 3ZDXF 3RVUC 1EBAA 1X5LA 1RU9H 3TN0C 2X7LA 2YKLL 3MLYL 4WNQA 4PUBH 4GSDH 3CC5A 3RFZC 3CFIC 2X4SB 5LAXB 2CLVA 2BVPA 3RKPA 4Y4HB 4IRJC 5GS2D 1AD9B 3O6LL 3V9FA 4AENA 4KZEL 3QUMB 3B4NA 5EU6B 2VAJA 1EGJA 3CUPB 4XPFL 3SE3A 2DM7A 5FCSH 4ZUSB 4Y5VA 1F6AB 1QBMH 4EN3C 2WINB 1N2RA 4J3WA 5T1LA 1A1OA 4HS8L 1PYWB 4G6ML 1IEAB 4AM0A 3SDDD 4OCLC 2WSKA 4JZOA 1JUFB 4NIKB 4YXHL 2VQ1B 4G9FD 3T04D 2YUVA 4Z9KB 3RNQB 1FJ1B 2EDTA 3BHBA 3S5LG 3NZHL 4YFEA 2CO7B 1IAIM 2J5LC 3P4NA 4KUCF 3GI8L 1OARH 3L3OB 4TVSa 5F96L 1UXSB 2XQBL 4WFEE 2FEDC 4PJIE 3KLAB 3V52L 8CGTA 1TQBC 4OF7A 5J13B 4HCRL 5MEOB 1GXEA 5I75B 4LU5H 3UP1A 4PJDB 3DVFA 5DA4A 2DQCL 2X4NA 4NSKA 3OSKA 4P5MB 3F7YA 1CS6A 5C0RL 4OD1L 5FDWB 1ZLUK 3B83A 1PJ9A 1KPRA 1HILA 2AP2A 1UJ3B 4HK3J 3BEWA 5IHZA 4POZC 1IGFL 5B4MC 1OM3L 1MJ8L 3EO9H 4Y8DC 4Y16B 2HWZL 2GJ6A 3QXDB 2P5WA 3DHJA 3T0EA 2BY2A 5INDB 2O93L 2AXJA 1A0QL 1INQA 4M7LH 1DANT 4O51B 2VMFA 6FABH 5DUML 3PP3H 3ARRA 3C60C 4IMKA 4YX2L 4NT6B 5IROA 5FHBL 5EG6C 2HKHL 2EYRB 5EO0A 2P43B 1MF2L 1WTGT 1BLNA 5TH2B 4LLVA 3SE8H 3HI5H 1OW0A 1XMWA 4NUGH 2YPLD 1C1EH 2IPTH 2VITA 1QSFE 5L8JB 1EO5A 1RZ8A 3WUZA 2FRGP 3BQUC 2E8ZA 1MCNA 1U2CA 5SWZB 1P69B 4X7FC 4DUVA 2VLLB 2CDEA 1K3IA 4JHBA 1GGYA 4HIHB 4D9LL 5A3ID 1KCLA 5FK9B 1N4XH 4ODUA 4N5ED 3S88H 4PBWD 5J1AB 2G5RA 2E7HA 4LPCA 1UYWL 2VXQH 2VDRL 4MNGE 2X10A 4GAGL 3RGVA 2J8UA 3L95B 3U6RA 4LVEA 3TBWA 5EUOA 4H25B 3FQWB 4U1NA 3PXHA 2XKUA 3SQBA 1U92B 1X4ZA 3UZEA 3VXUD 1UKQA 5GGRB 3CVIL 4NFBA 4MSWB 3O3AB 3V5DA 1JFQL 3PUCA 4UUJA 3THML 1CLZH 4DKFH 5JQ6L 5J9PB 1DL7L 3G5XB 1NFDE 3TCXA 4IOFD 3OG4B 3G6JB 3DUHA 2XKSA 3WS6A 3TH2T 5C0CD 3QFDA 5IBLC 1C16B 2BCKA 4JFZH 2CXGA 1F4YH 2FR4B 4PRID 1JYVA 3QFJE 4LSTH 3D69A 1F4WL 1T21A 5ACMA 4XZUA 4L3AA 1T89A 5IEKA 4XPGH 3MNZA 2F53A 3T4YB 4EOWL 4NUJA 5IF0A 5ID1A 1J8HD 4AQ1B 2R1YB 3IFNL 5DVNA 3KLHD 1HXMA 4MS8C 1PKQB 1F11B 5JORB 3TEUA 4NN7B 3ZHDA 2JIXD 1U8NA 5BS0B 3BFOA 4ETQB 2EC9T 3RBSA 3BE1L 4M7KH 1R0AH 4GAYA 4ZS7L 2GSIA 4U1LB 5D2NA 1LDPL 4CKVX 1QBLL 2ZUVA 3LSOB 4E42B 1GC1L 2J4WL 5JXAL 4OZHA 3IB4A 3DETD 3UJJH 2X7LB 5F7FA 2OR9H 3WCYA 3DMMD 4WNQB 5JW4R 3CC5B 3W5NA 2CLVB 2BVPB 1LP9F 3DSFH 2DMKA 3IFLH 4LHUD 4AENB 4HZAA 1FLTX 2IPUG 2K9UA 2G5BA 3TESA 1OTTD 3UJIH 4Y5VB 2DQFA 5DMGC 4LARL 5ESAB 1N2RB 2GEEA 5T1LB 1A1OB 4FQIH 4UILL 4S0TD 5L8LB 4AM0B 4DW2L 1U3JA 1SMAA 5CHNA 3BAEH 4PRHE 2WZPD 5DC0A 5E9DE 5C3LD 4KHTH 2GJJA 3BHBB 5L2KE 1KJ3L 3ARUA 4K23H 2W9DH 5JW4N 3OPZL 5E2WL 3P4NB 3T3PE 4FZ8H 1FBIH 4LPUA 2VSCA 4R4BA 4X7DC 3WO4B 3QT2A 3ROLA 1A4KB 3U9PH 4GKSA 2NLJB 2CLZA 2HJFA 4MA8L 5IB2A 3AGVA 5C08E 3ARBC 3V7MA 4YDVA 1MAMH 2X4NB 5HI5D 4L4VA 4NSKB 3F7YB 4QHKJ 1O7SA 4OQTA 2R0KH 4RWYH 5M94B 1HILB 2O5YL 3UBXA 5IHZB 3VXSD 1QFWM 4XMPL 4D9RD 2CDGA 2A0LD 2X6MA 1UCBL 4RBPH 4GG6F 1DR9A 2P5WB 2C3WA 3T0EB 4M6OL 1KCSH 1Q1JH 2JK5A 2EIBA 1I1RA 3I9GL 4YH6A 3MZTA 5CEZD 1INQB 1HINH 3E6FA 2EDFA 5HYIA 4D0BA 3V8CA 1ZANH 4PTUA 4ZAKC 1LK2A 5I9QB 1CFVL 1HYRC 5EO0B 3WFDL 1BLNB 4M43H 1MCPH 4EI5A 1NC4D 3V6OE 4OZIE 4F7EA 1NCBL 2X89A 1A6UH 5T3ZL 2VITB 4MXVF 1RZ8B 1VB9A 4WY7H 1MCDA 4JM4L 2CDEB 2B1HH 5D5MA 4M5YL 4ODUB 3DYPA 3WE6A 4YHMH 1N59A 4JFFA 5E95B 4JY5L 3RGVB 2B5IC 1V7NH 3MJ8A 2J8UB 1KGCD 4FQXD 3TBWB 3VU2A 5EUOB 5DD3L 4U1NB 3T8XA 4P0DA 1MI5E 5BZDA 5I19L 2EH8H 1OTUC 1VSCA 4X80H 5KANG 1F58H 4JQIH 3Q5TA 5C6WH 1BZ9B 1YPZE 2B39A 4KVCH 5AEAA 3QFDB 4YNYA 1FVEA 4I3RH 5I8OL 2BCKB 3QG6A 2OK0L 4YHYB 1NANI 3IDXL 1OOAA 3MJ9L 1U8QA 3D69B 1TCRA 1T21B 1J1OH 4LCWD 5IEKB 5KSAA 3MNZB 2F53B 4FFZL 2AGJH 5ID1B 5SWSD 4XMLL 4RZCA 5DR5H 4QLRA 3FQUA 3DLQR 2BX5A 2NXZB 3L3GA 1GAFL 1HXMB 1UACL 3HNTH 1EEYB 3PQYA 2DYPD 2VNCA 1U8NB 2V7HA 3MV8A 4OGXH 4YR6A 3GK8H 4RMQA 1VKXA 3BP4A 1Q0YH 4GAYB 3ZYOA 2GSIB 5D2NB 1OPGL 3TH4T 2X4OA 4Z8FH 3LHPL 4G7VL 3UYRH 1FRGH 1J0ZA 4HFUL 3QEQA 4OZHB 1BBDL 3MRQB 4LVOB 4ZNEE 2FH8A 2NY2B 3MPCA 1B90A 1F2XK 1SM3H 2EDHA 4OFIA 2FJHA 1ORSA 3L3DB 5TQ2L 5K9OA 1A6WH 5HGHB 3ZDYE 3E2HC 4M48L 5E7BA 4UMGA 2BOCA 1EX0A 4NC1C 2G5BB 5IJKA 2DD8H 2FJFA 3VA6A 2YA1A 2DQFB 1ZSDA 4PJDE 4CW1A 1HSAA 2G9HA 5C86A 5DK0A 3EBAA 4HPOL 1QSZA 1XCTA 2Y5EA 2QJDA 5CHNB 4JPWL 3OKOA 3NPZB 1BF2A 5CD3A 2IBBA 3PL6D 2F58L 4WV1A 4ZYKA 1C7TA 1RJYB 1ZS8A 1N5AA 2DQEH 3MLVL 4FTVE 1MAJA 4NC2B 5TE6H 4OCYH 5TDPA 4PUBL 2DRUA 2JB5L 1AO7D 3NA9L 4R4BB 3F8UB 5EORL 4DGIH 2ZCLH 5DYOA 1FG9C 2J12B 3ROLB 1DZBA 4GKSB 2HJFB 4DZ8A 1PLGH 5IB2B 3EFDL 1A7PH 4YDVB 2C3HA 5F1NA 4L4VB 3HNVH 3QDMD 3UPRA 1HOCA 3U1SH 4UINL 1SQ2N 1YY9C 3AMLA 4G6KL 1L7IL 2VXTH 3UO1L 5SWZE 4NRZA 1UM6H 4NQCA 2CDGB 4FHBD 1ZA3A 4RA0C 3CFJA 2F5AH 5IK3A 3H9SA 1PSKH 4TTDD 1N6VA 4O2CA 4PJBA 2JK5B 4JGMA 1B0WA 3HE7A 3E6FB 5ADOL 2BDNL 1SVZA 4HK0A 4D0BB 4PTUB 5H37H 1LK2B 4XCCL 4WWKA 3C5SA 2NY6D 3RIFK 3I6KA 1OQXA 5CILH 4YE4L 1H3PL 4EI5B 1IC4L 3K74B 4LU5L 4KTYA 4F7EB 4QXWA 3QZWG 3MODL 4PD4K 3G6JE 5JUEH 3VI4F 1F3DJ 2Y72A 2V17L 3NCYS 1ZK9A 3G08A 1IKNC 1T1WA 3WS3A 3MXWL 2WWMD 3DX7A 4TRPL 5MI0C 4OIIL 4KROD 3HKFA 2X40A 5EC2A 4MAUH 3RL1A 4XCEA 1N59B 3T2QA 4JFFB 4YBLB 4OF5A 5CJ8A 1F90H 1NBZA 4N0UA 1MOEA 1U8HA 4ZD3H 3RP1A 2VLJD 2GTWA 3GSNA 5CP3H 3T8XB 2FBJL 2WUBH 3EHBD 5SX5H 5BS0E 5BZDB 1DTUA 4AEHL 2QHRH 4PJAE 5IKCA 5EO1A 4PP1C 3GI9L 4NUGL 3GSVA 3K81A 4XBPA 3QWRD 1C1EL 2IPTL 4K3EL 2H8PA 3QG6B 1JF6A 1VGEH 3BUTA 5DQJA 5I0DA 5BV7B 3O3BA 4WW2C 3ARWA 1BQLL 1U8QB 5ALBH 1TCRB 3QDJA 3VWJC 1EUTA 3S88L 1CU4H 4MLSA 5F8QC 5KSAB 1V7MH 3V8OA 3FQUB 2VQUA 5HYQA 4U31A 3L3GB 4PJ8A 3VG9C 3KPSD 3PWUA 4X4YA 4PJCE 4JO1L 3GDBA 4YQXH 4HMEA 5D1ZA 4POUB 3PQYB 3MV8B 1G9MH 2V7HB 2JCCA 4YR6B 1VKXB 3BP4B 1G9MC 2ZSWA 1KC5L 3ZTJG 2X4OB 1PKOA 1YEDA 2VTFA 2PTVA 4S2SA 5KSBF 2PO6A 5E00A 1B6UA 3QEQB 3OGCA 1Q94B 3UDWA 3ULUL 5EU5A 2FJHB 4JFZL 4ENED 2NY3D 1ORSB 1F4YL 5K9OB 4KTDL 3MREA 4FFYL 5EDXA 4U6HA 2BOCB 2D7MA 1A1MA 4HWZA 2FJFB 2X41A 1KJ2H 2VERN 1ZSDB 3AM8C 2IADA 2AXHA 1IAKA 3UEZA 4CW1B 4TUOB 1P7QA 1HSAB 1IFHL 2G9HB 4JN1L 4MZ2A 4KQ3L 5DK0B 3KWWA 4RMRA 3KDMA 4QRSA 3NVQA 1RIVH 1A7NH 3D39D 2WIIA 2D3VA 3ZTJH 3QB7C 1UZ6F 5CD3B 1YYLH 4Z7OF 1EIBA 3IDYC 3S37L 4WV1B 4WO4A 5HHVH 3LB6C 1NMAH 1ZS8B 1N5AB 1H5BC 1F42A 1T6VN 2DJSA 4RDQG 5T3XD 1NLBH 5ALCH 3VD5A 2ICWI 3MBXH 5DYOB 1JWSB 2R23A 2NR6D 4DZ8B 3L7EA 1U9KA 4WWID 4K3DH 5EU4A 3S7GA 3UPRB 4NO3A 4Y4KC 1HOCB 3KXFD 3BRFA 1MRDH 2MQ3A 3TFKC 4LBEA 1TJHH 3OAYH 4QYOA 1JGLL 1BVLA 3C2SA 4NRZB 3GMQA 3U7YH 5C0GA 5I15L 4JM2C 2IFGA 2LV4A 4PTTA 1E4JA 1MEXL 4NQCB 1ZA3B 3CFJB 4KHTL 5IK3B 5I17A 3H9SB 4MNQA 4O2CB 4PJBB 5C0DA 4AQOA 5LWYL 5HHQA 3HE7B 5CZKA 5EUOE 4Z7NE 3NGBB 4HK0B 3GMPA 3L3KA 4MZ3A 2AVGA 4N1HB 4KXZI 3RY4A 2EZ0D 4PGCB 4WWKB 3C5SB 3U9PL 3TO4C 3I6KB 3MNWA 5D2LF 4NBXB 4JAMA 1BEYH 1BP3B 1AQKL 2E8YA 5F70A 3SDAC 1MAML 3NAAH 4P2OA 1JHKL 2AW2A 1I7ZA 5FYJL 2Y07L 1ZGLA 3B5GA 4LPWA 2RGSA 4NJAH 2R0KL 4V1DB 3RVVC 4JFPA 2ZUQB 3G08B 4HC1H 5KAQG 1T1WB 3O6KH 3WS3B 4OZFA 1EHXA 3H8NA 3KPRA 3DX7B 2P8PB 5D71L 4WTWA 4PJFA 4XNXH 1OAXL 1CGSL 3CSYA 4Z78A 5EC2B 2Z8RA 3RL1B 4OZ4A 2F53E 3UZVB 3BPNB 4QHNA 1NBZB 4N0UB 1U8HB 2FO4A 3P9LA 2GTWB 2NY1B 2YD3A 3GSNB 1CLYH 4P48A 3WN5C 1B4JH 1T5XA 1CD9B 4LKCA 2L0DA 1BHGA 1ADQH 1G0XA 5EO1B 4M43L 1MCPL 1NEZA 1QSVA 2WMPA 5KSVA 3BO8A 4PLOB 4IRSC 4XBPB 3GSVB 1NGPH 4TVPL 3WO3B 3BPOB 2PTTA 2H8PB 3ZE2F 4WFFE 2CK0H 5DQJB 1JGDA 3O3BB 4KK5D 3OX8A 4P5TA 4KKCD 3ARPA 5C1MB 3U9UA 1G0YR 4KTEH 5CIPA 5HYQB 2AJZB 4S0SD 1YA5A 4PJ8B 3MUZ1 3DYOA 3T2PA 3PWUB 2XYCA 3KNBA 5D1ZB 2LAAA 1OF2A 1LGVA 1UVQA 2JCCB 2AEQH 1DN2A 2ZSWB 3V0VB 3D18A 1YEDB 4M6MH 4OLYL 1DEEA 5DJ0B 3N1PC 2Q87A 4S2SB 5B39G 2PO6B 5E00B 1I1CA 3OGCB 1XGYH 3TIDA 2DQJL 3QUYC 3ISWA 4HUNB 1CE6A 3BT2H 3MREB 2VXUH 4OD3H 1S7WA 4U6HB 3ARXA 5B21A 1A1MB 5AWNL 3BSZL 5DR5L 4FFWD 1QLEL 4F37F 2IADB 1UM4H 2APBA 1IAKB 2L7UA 1KTLA 2PYEA 1P7QB 3LS4L 4L4VE 2ADJA 1RAMA 4LAQL 2H6PB 3KWWB 4QRSB 3NABH 4YDJA 5DJZB 4U6TA 4WFGD 2WIIB 5E8DH 4OV5A 4M9PA 5DJ6A 3RVXD 2R1XA 1EEUA 5GGVL 1FFOA 1U3ZA 4WI3A 2HVKA 3FQXB 2DLHA 3KYMA 4ZSOE 1OP5K 4GW4A 4Z8FL 1YEFH 4LSDA 2UWEF 2LVEA 4WO4B 3SGJA 3C6LD 1CR9L 4LOUC 4HXAL 4M1GL 1A14H 4KDVA 3U0TA 1B6DA 1FFPA 1H0DA 5ENWA 3T0VA 1JJUA 4EVNA 4MB3A 4OT1H 5E6YA 5EWIH 3GSOA 1EO7A 4UB0L 3RI5F 4N8VA 2R23B 3BIAX 3QDGB 3SPVA 3L7EB 3WEXA 3DRTA 1KPVA 4M6AA 3BKYH 2EDLA 2WNGA 3P4OA 2R0WH 1TVBA 2NZIA 5EU4B 1XF1A 4NO3B 5ANMA 1NL0L 4OCSH 4LLAA 2VZSA 1Q9OA 1FNGA 4LMQI 1RD6A 4LBEB 5MHSE 4Y19A 2DTMH 4PJ5D 5CJOH 1BVLB 2VR4A 4RBPK 3GMQB 5C0GB 4PTTB 5D9SA 1S7TA 4O00A 4JJ5A 2DLTA 5C0BA 4RFEA 3DXAA 3NCYP 4HUWA 5I17B 4MNQB 2VDML 1FNSL 5C0DB 1LILA 4JFFE 3LDBC 3QWOB 4PS4L 1DANU 4XNYL 5HHQB 1E4KA 5DT1H 3MJGX 3REVB 4UOW0 4UT9L 1P5UA 3GMPB 3L3KB 3QIBA 1I7UA 1IAIH 3AS2A 3ARFD 3MNWB 4OLEA 1HWGB 1MFBL 1PLGL 4JAMB 4RGNB 1U42A 3QNZA 3O4OC 4EZMA 5IFAL 3Q6GL 2ZNWA 4P2OB 3V6ZB 5T1KD 4Y88A 1I7ZB 1JTTA 4OUUA 1QYGH 1ZGLB 4KK9D 2EKSB 4PYGA 1K3ZA 4JFPB 3KPRB 4PJGF 4F7PA 2E7LC 4DEPB 1U8OB 3CSYB 4Z78B 4OCRL 3IDMA 4OZ4B 4U1HA 5D7SL 4M7ZB 1J0IA 1KCRH 3VE0A 3L5XL 2FO4B 3P9LB 4YIQA 1QKZL 1QNZH 5DJXA 2CPCA 3PQYE 2H32H 3MGTA 4QOKA 1T5XB 4LKCB 2HRPL 4KKNA 1CFTA 5E8EA 4NQDD 3F6LA 1A6VL 2IG2L 1BGXH 1NPUA 5CILL 5DRZA 2IGFL 2ZKHH 2CLRA 1NEZB 5GJTH 4G8IA 3BO8B 5EZIL 3OXSA 4OFPA 3S34H 2PTTB 4F33A 2CXKA 4FQ2L 4BZYA 3OX8B 3AC0A 4P5TB 2CIKA 2CMRL 5IVXE 2EXWD 4MAUL 1IAMA 4G6JH 4Y1AA 3U9UB 1KCVH 1IGTA 3HR6A 5CIPB 5ITBH 1F90L 2E7BA 5ILTH 4LCIL 4I18C 1HIML 3I50L 3KNBB 4I4WA 4P59L 3T2NH 1OF2B 2W65A 2EC9U 1UVQB 3U83A 1XGTA 2NTFB 3MR9A 3UCRA 2WUBL 2Q3AA 2J6EH 4ELMF 3D18B 4BFBD 4M1CC 3CFDB 4HF5H 1DEEB 2ICES 1J0HA 4KQ4H 5GGVY 4OLZH 1FN4A 3TIDB 2A1WL 3R0MA 5HHOD 5C0ND 4AL8L 3VRLE 1VGEL 2YZ8A 3UPCA 2EDWA 1CE6B 1UM5H 3T0WA 4HGWA 1S7WB 1AGEA 4LHQB 1CU4L 2Z9TA 1T3FA 3NFSH 1E28B 1V7ML 3L6FA 5IIEA 4KI1A 1RMFH 1KTLB 2PYEB 4KRPB 3MXVL 4JRXA 4BELD 1FCGA 4X6DF 5GGSY 3V6OC 5D1XA 2H3NA 4V2BA 3ELAT 4YDJB 3VGAC 4E41A 4ZFGL 4OV5B 3O2DA 1XGUB 1MCEA 1IT9H 2R1XB 5DJ6B 1DQMH 1FFOB 1BQHA 2HVKB 3GIVA 2VXSH 3KYMB 2Z31A 4U49A 3PWJA 1R3HA 1E4WL 1K4CA 4GW4B 4ODTL 3V6BR 1Z2KA 2ICWJ 4WU5A 3SKJH 4BKLA 3I75A 3HG1A 1TPXB 2C3VA 4YC2C 3LIZL 3U0TB 4QRQA 1FFPB 1H0DB 3GBLA 5ENWB 5I71C 4EVNB 3BH8A 3MRMA 3GSOB 1PW3A 3D2UD 4N8VB 3SPVB 2C1PA 1YEEH 3WEXB 3OBAA 4R7NA 3DRTB 1G7JA 3QRFM 4CADA 3P4OB 5KJRL 1TVBB 3IRZA 2P42B 5ANMB 3IJYB 5KAQF 1YEHL 1Q9OB 4JFDD 3QHFL 3B2VL 3TBVA 3GGWA 4G8GE 4HDIA 4Y19B 1FL6A 1N8ZA 4V1DE 3B9KD 4UT7H 3MBED 5EU7E 1NUDA 5D9SB 1S7TB 3U2SA 3SQOL 4JJ5B 4K3JH 4RFEB 1B0RB 3DXAB 1U3HA 4HUWB 5HHVL 3TV3L 2DL2A 1I9EA 4Y4HC 1N5YH 4CVUA 3QUMH 1G7IA 1BFSA 4R4FL 3RKDD 3JUYA 4N0UE 1OAQH 3CH1B 4PJEF 4ZO9A 4ALAL 4B7IA 5F7DA 1N64L 1UH3A 5LGHL 4B41A 3MOBH 3MBXL 3IDGA 5E7FA 1INDH 3EUUA 4IRZL 4HGMA 4GRMA 1UA6L 2QL1A 4LDLB 1ZEAH 3QNZB 3RWCB 1RZIA 4PIRF 1FYTA 4IHOA 4GUPA 1M71A 2ZOKA 4YBQC 3L3IA 4ZFFA 1DFBH 1NDGA 3O3DA 4F7PB 3IKKA 4PD4J 2R69L 1ZHBA 5GRXG 4MHHI 2ESVD 4DUWA 4M5ZH 3EJYD 3IDMB 5D7JA 4U1HB 3BP7A 3E0GA 5FM5M 1QFWH 3RHWK 3VXTA 3E6HA 3T3ME 2ZCHH 5A2FA 5J13C 4M93B 3VE0B 1ZGLM 2Y4SA 4UT6H 4M00A 4YIQB 3BN3B 5I75C 5DJXB 2HMID 4P9ML 5FCUL 3MGTB 4QOKB 2JCCE 5FYLE 1CFTB 5E8EB 5IM7A 3BGMB 4XB7A 3OR6A 2H9GA 2OR7A 3NFPA 4OFKA 5DRZB 3K1KC 3UROR 5I1CL 1UJ3C 5ISZE 2CLRB 5JIPA 4G8IB 3VJ6A 3OWEA 3N1FC 3NAAL 3OXSB 5F9DC 4Y16C 1ACYL 5DQDL 3QCTL 4HJGA 4NJAL 4F33B 1T7ZA 1F4XL 4NHCH 2CIKB 1I8LC 4Y8AA 4LP4A 3EDDA 1NCWL 4Y1AB 2Z0BA 5INCA 1IGTB 3KPLA 1Q9WA 3QG7L 1CG9A 2D0HA 5DEGA 4YAQA 4I4WB 5I8EA 2W65B 4N0FA 3BMWA 1KIUA 3IDNA 5I1EL 1XGTB 4I77H 1CDUA 3MR9B 1AKJA 1X5YA 3CVHB 3X13A 4UU9A 5FUZH 5BRZD 3WV0A 1A1NA 4LSSH 2YPLA 5CS7A 5GSRA 4JR9H 1D5MA 3FN0H 3VD4A 1FN4B 4PY8I 3C08L 1QZ1A 4BH8A 3MNVA 3ZSTA 1GCFA 5FKPA 4GXUN 5C07E 1LO0L 1MHEA 3HZKA 2A77L 4XPBL 1RQ5A 1EV2E 4HGWB 1AGEB 4KJYA 4P4KA 3QDGE 3KGRA 1T3FB 4K7PL 3VGHA 4HLJA 3L6FB 5IIEB 3DUUA 3MACH 4YHOH 1SJEB 1TQCB 1S7XA 5D1XB 2H3NB 2B8OT 1ZMYA 4E41B 4JHWH 4NNXA 1RULH 1RVFH 3RY6C 1AI1L 3M1BA 1BQHB 3GIVB 4R8WH 2Z31B 3PWJB 1R3HB 1K4CB 1FL3A 4WU5B 5C0CA 4JY6A 4F7MA 3H9ZA 5I6XB 2FGWH 4FN0A 2B7DT 2C3VB 5CJQH 3NCJH 5FYLL 4QRQB 2PTUA 5F7EL 4F7TA 2Y25A 3BH8B 1J0JA 3CIQA 1AXIB 3MRMB 4BA8A 5T3ZD 1EK3A 2VXUL 5KG9A 2IPKA 4OD3L 2CD0A 3QQ3A 3ZKMD 2EC8A 4MA1B 1A7QL 2C1PB 4LNRB 3CMGA 4NN7C 4R7NB 1G7JB 4CADB 1NGQH 2JIXA 3KYKL 2RFXA 4YDLB 5AZEL 3RNKA 3TBVB 5AUMA 3GGWB 4HDIB 1FL6B 3MV11 1N8ZB 3C5ZD 3RIFF 2YMXH 5F89A 2VDOL 4N0RA 3U2SB 1B9ZA 1U3HB 4F8QA 4I3GA 2IFFL 2DI9A 2VDLL 3H42L 1G7IB 3O4LD 1EGJH 4NKOA 3K1DA 2JELH 1NBYA 4LHUA 1GOHA 1DJSA 3SE3C 5F7DB 2YA0A 1QO3A 5FGCB 4NM8L 3IDGB 5E5UB 2JB6B 4GRMB 3CFCH 4HUUA 4WHYG 4C58B 1REIA 2QADD 5F6HI 4FQPA 1DBJL 1N3NA 1RZIB 3DO7A 2GYSA 3SDDB 3VG0H 1FYTB 4IHOB 1M71B 2ZOKB 5KVEH 1S7QB 1TETH 3L3IB 4ZFFB 3BKMH 3I02A 1NDGB 4QRTA 2E7CA 4D9QE 4HJ0D 4MHHG 3O3DB 5D6CA 4HT1H 1ZHBB 3UTSD 5D7JB 4GBXD 5JA8B 3BP7B 5EIQA 3GKZA 3MLSH 5E08L 1FDLL 4I13B 3WO4C 3VXTB 3E6HB 2XWJA 4LVHC 2QQQA 5DD5H 4X7TA 2Q8AL 3I85A 4LL9A 4E0RA 1H8NA 4LPYA 4UTAH 5IM7B 4ERSH 3OR6B 2R15A 3SDCD 2H9GB 3NFPB 4QTIH 5HDBF 2NY5H 3O11A 4ZUUA 2NY5C 5FEBA 1P4IH 5A2IH 1MIEH 2KQMA 4MA7H 4HJGB 4OFVA 5EZLA 3EDKA 4U4BA 1MVFA 5KZCB 1P2CA 5KN5A 3BOVA 1AXTL 5FB8A 4R9HA 2F54A 1QHPA 2HVJA 2VDPH 2AQ3A 5FUCE 1SEBA 5C0AD 3FQNA 4IMKC 3V4PL 5INCB 4O9HL 1S9YB 5IROC 1KTKE 3ZE1F 5E99H 5I9QC 5DJ8A 1JNJA 3KPLB 1Q9WB 2CKBA 1CG9B 3JSSA 3MLUL 4HEME 4NWTL 5DEGB 4YAQB 3W82A 4BZ2H 2XZAH 4K7PY 5I8EB 4N0FB 1OW0C 4KDTA 3IDNB 3ZSSA 5K59F 4GG6A 3HE6D 4YHZL 1AKJB 1NC4A 3X13B 4UU9B 1A1NB 3QQ9D 3HZMA 3BIBX 2YPLB 3B9VA 2WBJD 2ZKHL 5GSRB 1E6OH 4CNIA 1CTOA 4BH8B 3QEGL 1FIEA 4F8TA 3MNVB 4XPHL 2H26A 4GMSL 4L1HA 1MHEB 3GSWA 3HZKB 3PXJA 3OB0K 1MELA 4WUUA 4KJYB 4P4KB 4DGYL 2IAND 3LKOA 4FQXA 4DZBA 3DUUB 2AABL 5E24E 4P49A 5C09D 5DK3A 4XPAL 4RFOL 1S7XB 3FZUC 5ANME 3PHSA 5EZJA 4HHAA 4ONHA 3T2NL 4NNXB 2UV3A 4TNWK 4EN3A 4Y19E 1KOAA 3M1BB 3RUGF 5F1SA 2YR3A 3WS6C 2FEDD 2VISA 4IM8A 2BNQD 2IBZY 5E94A 4CAGA 1KACB 1FL3B 5C0CB 4JY6B 4F7MB 3I2CH 5FM8A 5DI8A 3TA3D 4KI5F 4YHYC 3T4AB 5ADPH 1CDYA 4KQ4L 3HC3H 4QEGA 1ZGLP 4TUKH 5LXGH 2QSCL 1G6RA 4F7TB 3QCVL 4KDWA 3QHZL 4RSVA 3FHQA 2NXZC 5SWSA 5EOQH 2IPKB 1J8HB 5KG9B 1UT9A 3QQ3B 3BN9D 2GCYA 1V8HA 1A21A 5LBSH 3K8KA 5JR1H 1H3WM 2P48B 4KI5D 5HGDA 2DLEA 5IMLB 4Y0GA 4YEFA 2DYPA 2JIXB 5KOMC 5IP4A 2RFXB 4GFTB 3RNKB 1G9EA 4PJXF 5AUMB 2NQCA 5IVZA 1JZ2A 4N9GA 3AMKA 4C59B 1K8DA 4LVOC 1YZZA 1N6QL 5F89B 1PDKA 1FPTH 3O8XA 2QQNH 1F97A 1UC6A 4OI9A 2GT9A 3HN3A 3V4VH 1YNLH 3LPFA 2ZCKL 4NKOB 3IU3A 5C6TL 2ZOLA 1NBYB 3S5LA 4LHUB 1I3RA 4W6XB 1QO3B 2H2PD 2DLIA 5ICZA 3HAEH 1ZHLA 4QOKE 3QUXD 1RUPH 4BH7A 1BMGA 1KB5A 3A67H 3MV7A 2F74A 1T7XA 4HUUB 1YEEL 4NCDA 2FB4H 1OAUH 1CDCA 2X4RA 1PX4A 1FNEA 1WFOA 3ZKNC 5E56A 3DO7B 1LP9B 1EEZA 4NZRL 4V2CB 4YZFF 5C2UB 4W4OC 5KTEH 2EKJA 1J1XL 4HAGA 4JFHE 4XXDA 3I02B 4PB0L 4QRTB 4UT7L 4YEEA 2X44D 1MCIA 5D6CB 1A22B 1UH4A 2HLFC 3BQUA 5CKAA 3FFCD 4AMKH 4K3JL 3ULUF 4I9WD 1LVEA 1FAKT 1CLOL 1K2DA 4GMTL 4Y1AE 1AO7A 2A73A 1GL4B 2XWJB 3D9AH 4CU6A 5E6ZA 2DQUL 5FUOL 2IH3A 3EOTL 4X7TB 4E0RB 5IBLD 3NN8A 2XWBA 4LVNB 3RX8A 5H2BA 3ULUD 2OL3B 4OQTH 4ZFOL 4NZTL 5DJ2A 1A6ZA 4ZUUB 4UTBL 4UBDD 3DWTA 5BQ7A 3NACH 3QRGL 3H7LA 4NRXA 5D1QD 3G04A 2ED7A 5EZLB 2AK1H 1U95A 3EYUL 4YDIH 1P2CB 5KN5B 3HMXA 3BJ91 5FB8B 1S3KH 1WAAF 4PP2A 2F54B 4KJWD 1VEPA 3GJFA 2VZUA 1IAOA 2HVJB 2L4OA 2MPAH 1JF5A 2NY7L 1SEBB 2QSTA 3FQNB 1RFDH 1UJTA 5DJ8B 3MOAH 3N1GC 2ZCHL 3B2UD 4HMDA 4EI5C 4PY8J 2X4QA 1NAKL 4E41E 4GG6B 1DUYA 2ADFH 5F9OH 1NC4B 1PD6A 2LE9A 1VDGA 3EYVA 2FD6H 5IMKA 5DLML 3FB5A 3GHBH 4LRNL 4UAOB 4N8CH 5I73B 3MRKA 3EJJX 4Z0BH 1G7HB 2V5TA 2JJTA 1IQDA 4F7CA 4CNIB 4G5ZL 4ZG1A 2VE6A 1L7TH 3ULVH 1WZ1L 2H26B 1OTSC 3LN5A 3GSWB 4YBLC 3GRWA 2MCPL 4WUUB 1R3KA 5GZOC 3N1QC 1KENH 2Z93A 2VLJA 2XTLA 4FQXB 4DZBB 3Q3GB 5IWLA 5HY9A 2K3TA 3CSBA 3D1MC 1W0VA 4JCLA 4HEPG 2DN7A 4LIQL 2RCSL 5EZJB 5FYKH 4HHAB 2C1OA 4ONHB 3UTQA 4EN3B 4DN4H 1OAYH 1MFCH 1CK0H 4I77L 1R24A 1NBVL 5D72H 2VISB 1HH9A 3S36H 5E94B 5DS8A 4APQA 2DM2A 4LSSL 5DI8B 1KB9K 1QQDA 5BV7C 3IAQA 1RSFA 5D6DC 4OM0H 3ARBD 4OLWH 1G6RB 2ZUSA 1AQDA 2OM5A 1I85A 1EPFA 2R4SL 3VFWA 5SWSB 5FGCE 3ZDXE 1N26A 2GCYB 3QNYA 3SDXF 5EFIA 2FWOA 4JDZA 5KW9H 2OR8A 1T03L 1L4IA 3SOBH 5HGDB 3CLFH 3NPSC 4MAYA 3PWNA 2DYPB 2VDKH 5F7NC 5GS0H 1YEJL 4WW1A 4HWUA 4MJIA 5ID0A 1KLGA 5IVZB 2MHAA 1JPGA 4PPTA 3O8XB 1W8NA 5C92A 5IFJB 2IBGA 5LQBL 4XP6H 2GT9B 1S78C 1WEJL 2F15A 2R2CA 1LMKA 3IU3B 5A16A 2AI0H 1T2QH 1I8IA 2ZOLB 4LHJB 2E6JA 4G3YL 4O02H 1I3RB 3S5LB 3ZHKA 4JFYA 4JKPH 3QXTA 4AIXA 5ICZB 1ZHLB 3ARDD 4TVPD 5KSBA 4BH7B 1Y6KR 3P0YL 4OV6F 1KB5B 3MV7B 2UY7A 2F74B 2D7QA 2YD9A 3TIEA 2X4RB 1FNEB 1NGQL 5HD8D 2SEBA 3TT1H 3RJQB 5IJVA 3TVMA 1T0PB 2B2XH 4XXDB 4CVWA 2Q8BL 1G0DA 3DURA 1D5IL 5KOVC 5I1JL 2HT3C 3RPIA 3W39A 4C55A 3BQUB 3MLZL 4R6UA 3RJDA 5ERWA 4DVRH 3CU1A 1XIWD 2HFTA 3MZGB 4OCWL 2DM3A 1AO7B 2A73B 5IEHB 1WC7A 2BY1A 2IH3B 3EZJB 3QO0A 2DIAA 2EXYC 2F8VA 2HT2D 4OB5L 1EVUA 3NN8B 2XWBB 5FF6B 1YJDL 3AB0B 3NA4A 3RZCD 3T65A 1ZHNA 5DJ2B 3QI9C 3QDMB 1A6ZB 3MUJA 2IAMA 2YPLE 5BQ7B 4NRXB 3L1OL 2VH5H 3G04B 3FN3A 1NCAH 1X44A 5JW3H 1M7DA 4G42A 1U95B 2R4RL 1TETL 3WJLA 1MFDL 1FC1A 1XF5A 3RY5A 4K2UH 4PP2B 4M62L 4OIBA 3GJFB 4IOSD 1HH6A 3B5HA 3CK0L 5FOJA 4ETYA 3HE7C 1IAOB 5DUBA 1CQKA 1UEYA 4LSVH 3MLSL 2FDBP 4WWKC 4LEOA 3RQ3A 2OMNA 4AEFA 2DQHL 3VGBA 2NY6B 4OLUH 3VXUE 1NGXB 2X4QB 5BXFB 3A6CL 1DUYB 3EYVB 5IMKB 4S1QH 4JRWA 3FB5B 4B7LA 5L8KB 2D03H 3FB7A 5GGTA 1RY7B 3KJ6H 3MRKB 5C0CE 4N0CD 1QPXA 5C0JA 5CP7A 1IGCL 1FLRL 5EU7C 1IQDB 3N85L 4F7CB 2ZNXA 1EA9C 4PRIE 1RI8A 2VE6B 3QPXH 5D2LA 5C71A 1LO4H 2AJ3A 3NIFF 4KZDL 3BP5A 3HRPA 3BPNC 2P4AB 3LN5B 4UNUA 5CD5D 4GXVH 2C26A 1A3LH 3QUZD 4NZUL 1J8HE 3GSNH 1R3KB 2NY1C 2Z93B 5GQBA 2VLJB 1T20A 5HY9B 2B1AL 1W0VB 5DEFA 1JZ5A 2C1OB 4JEGB 3MV9A 1QLRA 4BZ2L 3BDXA 2HRLA 2VYRE 3UTQB 2W9EL 1TZHA 1EUUA 1R24B 1TZGL 5AYUH 4H88H 4HIEA 2EDEA 1HH9B 3BPOC 3B6SA 3MQIA 2OCFD 4APQB 2CGRL 2M8XA 1DSFL 1QQDB 3R0NA 4W4NA 5IVNA 5J3HD 3WFZA 4HQQH 4JQVA 3UX9B 2H1PL 1AQDB 5IT2L 4G7YL 1JGEA 2YOCA 3VFWB 1OCWL 1EVTC 4NGHH 4PJ8C 4RGOL 1J7VR 3T0XA 3VFGH 2GK2A 3QNYB 3V0WH 3GO1L 2FWOB 4JDZB 5D1ZC 2XRAL 3MRNA 4IIQA 1PEWA 1GHFH 1CDHA 3PWNB 4MAYB 2E5EA 1IGYA 4P2RD 4RA3A 1JZ3A 4Y4FD 1VEOA 1M7XA 1LP9E 3U7WL 1Q9LA 1URLA 1WFTA 4WW1B 2BVUA 4MJIB 4UQ2A 4FNLH 5T5NF 3KLDA 5ID0B 1KLGB 2MHAB 3KLSA 2IEPA 1VFAA 3RTQC 4NQEA 1JPGB 2L7JA 2EO1A 2KH2B 4YHNA 5BW7C 5DD0L 3UDWC 3WFEL 4CGTA 1MIMH 1IVLA 3OJVC 2P1YA 1JCKA 3MJ7A 4S10A 3EOYG 2NY3B 3WBDA 4FQQB 4B5EA 3L5HA 4TUKL 4HBCH 4U6VH 5LXGL 1I8IB 1D5ZA 4ZXBA 4O2EA 4JFYB 2P8LA 4XP9H 1CICD 4XP4H 5KSBB 3TNNA 5M95B 2Q1EA 3HZVA 3TIEB 3RHWF 5EU3A 2X05A 4ONFL 4P3DA 4X6CF 1YNTA 2SEBB 3X12A 5IJVB 1TJGH 3TVMB 3VXSE 4X5XA 2DB8A 1MQKH 2QHLA 3AY4A 3VMOA 1GSMA 1AJ7H 4D9RE 1JK8A 2APWA 4M7JH 3T09A 2BRRL 3RPIB 5J8OA 4OZGF 2XACC 3CSPA 4N5UA 3W39B 4R90L 2F54E 2XG5A 3P11L 3ARGA 2V5YA 5KVFH 4WDIA 2FCBA 5ERWB 4QCIA 1TTUA 1DE4A 3V4VL 1WC7B 4PP1D 5F7KC 3CX5K 3QO0B 5JXEC 4XBEH 4ZPTA 4P9HL 3OKKA 2B5IB 3EYSL 4GG6E 1AR1D 5D7KE 3T65B 4JPKL 5I16A 2FB4L 43C9A 3J7HA 2IAMB 2OLDA 4NBZB 1BAFH 1J88A 4D3CH 2FATL 4U7KA 4ODVH 3RDTA 1HHHA 3WXVL 1KTDA 1M7DB 3VXOA 2GY5A 4G42B 3WDIA 3QZWA 4EIZC 1KFAH 5HTSA 5J0BA 4TSAH 1MJUL 1XF5B 2D4DA 1TVHA 1QSED 4M6NL 1GPOL 5HPMA 3Q48A 3SKMA 1HH6B 5HDQL 4AMKL 5DUBB 1RHHB 2BP3A 1MFEL 1MHCA 4M03A 4MXVE 2XWTB 2DQGH 3NH7H 4MJ2A 4ZODA 5MP6H 1KGCE 3VWJA 4LEOB 1MFAL 2N7AA 3D9AL 1SJHA 3U4EA 5ABDE 2NYYC 1DLFH 4KJQC 1U91A 1YN6A 3GBNH 3RX5A 2FJGA 1DVFD 4P2OC 3WLBA 3RWJA 1UWEL 1A9BA 3O6FD 1RV6X 4RRPA 4AEIH 3FB7B 4KJPC 2QQLL 4OZFH 3RU8L 4LQFL 1BFVH 3DRQA 5C0JB 3T0DA 1U93B 2NX5A 2MKWA 1MCOL 2ATKA 5D2LB 4JHAH 3K2UH 2AJ3B 4M7ZC 3BP5B 4LCWE 4OAWA 4U3XA 2XOTA 3MLRL 5SWSE 4K55A 2EYTA 4CU7A 1OB1A 4N0YH 3AU1A 3ZT6A 1W0YT 4EKXA 1T20B 3PJSA 4G9DA 2E7MA 1IBGH 4N90D 4PJGA 4LDEB 5DEFB 1ERNA 4FP8H 4LFHG 3MV9B 1QLRB 3AM8A 1TZHB 2VDNH 2WIMA 2XA8L 4KKAC 3VRLF 4HIEB 5CEZL 2I27N 1HZHH 5EULV 1FGNL 1MVUA 1A47A 3QH3A 2X1OA 2WLZA 4L8BB 3ZKSD 1VFMA 2FNBA 4PREA 5DJYA 4P5TC 1ZOXA 1SBSH 2G2RA 4LF3A 2XQYG 4K8RH 3P9MA 4ORGA 1L7TL 3VXRD 1R3IH 2C9AA 4QRRA 5CIPH 5H35B 4JE4B 4Y4KD 5BMFL 1JGEB 5CZXD 5KVDH 4J4PD 5H94A 3PDOA 3MV7E 3MCLL 3O9WD 3MRNB 4IIQB 1HEZA 1IGYB 4XCFL 2VC2H 3MLWL 4LQ1A 4MGXA 1Q9LB 2CJUH 2DLFH 5IW6A 5FYKL 1A7RL 4UQ2B 3BKJL 3V7AE 3S35H 2NTSP 3BEVA 3EYOA 4LSPL 4NQEB 1MFCL 5I1LA 1P1ZA 1YQ2A 2GK0A 4YHNB 1HKLL 3K7UA 1CL7L 3S36L 4HCRA 4WGVB 1U3YA 4NM4H 4K9EH 5HHOA 1C12A 4U0QB 3PWPA 3MJ7B 1CFQA 4X4ZA 4JM2A 4K9EC 1LE5A 4QT5A 1AO7E 3O6ML 4ELMA 1D5ZB 4ZXBB 4DQOH 3KJ4B 4JLRA 5FUCC 2VLMD 3FFDA 3KYAA 1TJIH 4ZMAT 5JO5A 1F2QA 4XAWL 4KRPC 3TNNB 3HZVB 5KW9L 4P23A 3QDME 3SOBL 5EU3B 5C2BH 1IGMH 3CLFL 4P3DB 3L9RA 1YNTB 5DGRA 1C5BH 3X12B 3V5KB 3SDAA 4X5XB 2AJVL 1BD2D 4QXGL 3SGJC 4WU7A 5AAMA 5C7XH 1JK8B 3OKLA 5ICYA 5TF0A 2I24N 1X5GA 2PR4L 3ARGB 3LMJL 4J3TA 2I5YL 2YK1H 4WDIB 1ZE3C 4X6DA 4Z18A 5DXWA 1J86A 1D5XA 5MI0B 2HTLD 4MNHA 3U4AA 1T2QL 4IRSD 1XFPA 3VDBA 1I9IL 3LEYL 2UWEB 2Y7QA 3OKKB 5GPRA 5JIIA 3D5OF 3H0TA 2EEBA 5DRXA 3WKMH 4YUEH 2CUMA 1KSRA 5I16B 3OR7A 3WN5A 43C9B 1QP1A 4PGZA 3NMEA 5DZLA 3B9EA 4S1DC 4FG6C 3RDTB 1HHHB 2BOBA 3HI6H 2OSLA 1KTDB 3OAUL 3VXOB 3GKWL 5FKAA 1RZFH 3QZWB 1UWGL 2NCMA 32C2A 5GRVL 4UQ3B 1TVHB 4MQSB 5HPMB 3SKMB 3G5YA 1E4KC 5F71A 1MHCB 2HT4D 3S96A 3VI4E 2VLJE 3VWJB 5CUSH 4HKJA 1SJHB 3U4EB 3UJTL 3UC0L 5BO1L 1WTLA 1ZLVK 1U91B 4ODSH 4D2NA 4LGRB 4LEXL 1YN6B 2FJGB 3WLBB 3SGKA 4LPTA 3VG9B 3RWJB 4R0LA 1A9BB 2C4XA 5J56B 1NGWA 5D7IF 3FO2A 3DRQB 1JYWA 4L1DA 2NW3A 3BWAA 2ENYA 5A2KH 2NX5B 4ZFZA 4X7EC 3MLXH 2ATKB 4R4NC 2ESVA 4NO0A 4OAWB 4M93C 1CZ8L 2EYTB 3QUYA 4HJJH 1OB1B 2A74A 3AU1B 4WTXA 4TSBL 3W2DH 4XWGL 4NN5B 3KPSE 3PJSB 1AXSA 3EO0A 4G9DB 4QO1A 4Z7VF 3VXMD 5JNYA 4PJGB 4FMKA 3H9HA 1X9QA 4LOUD 2Q86A 2YD2A 4GS7C 4R96A 3O2VH 4A6YL 2BNUA 2HN7A 4WENB 2OTWA 4CMMA 1P7HL 3JV0A 1MVUB 3TJHC 3QH3B 4NKIH 2MMXA 1JZ6A 4PREB 5DJYB 2DQTH 4GOSA 2FLBT 2G2RB 5TQ0H 4LF3B 3IDYB 4WTZA 3F7QA 4ZS6C 5B39A 3JTSB 4HIJA 3WIHL 3EDJA 4QRRB 1LO4L 2BJML 3HS0A 4KMTL 1JN6B 1PFCA 1T1XA 3IJHA 5H94B 3F65A 5KSBE 1A3LL 1A3RH 3GMOA 3PDOB 4MNGA 5D70H 3BISA 2WBKA 1SYSA 1KCUH 1HEZB 2FX7H 4ZTPL 4QY8A 1A4JA 1K8IA 2V9RA 1U8KB 3D39E 3QFJD 1I75A 5HSFA 3LY6A 5IW6B 1FIGL 2NPLX 1YEGL 3BEVB 3EYOB 1FORL 1DQTA 2VLKD 1P1ZB 5I1LB 4L4JA 1UFUA 4NHUA 5DMJB 1CXFA 3QDHA 4YPGA 5K9KA 1MRCH 5HHOB 1C12B 1WFUA 3PWPB 4W81A 1CFQB 3IVKB 4JM2B 3CXHK 1LEKB 1K85A 1PG7H 4QT5B 1LE5B 3O45A 3HC4L 4LSQL 4ELMB 1T1YA 3FFDB 1QFOA 4Z7OE 5JO5B 5HHNA 1I1AC 1TQCC 3S35X 2J8HA 3O2DH 5D1XC 1CGTA 4P23B 1IC7H 3KXFE 5HGAA 1CLCA 3ALXA 1JMZA 3D3VA 3L9RB