4PLJD

Hepatitis e virus e2s domain (genotype iv) in complex with a neutralizing antibody 8g12
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
216
Chain Sequence
QLQQSGPELVKPGASVKISCKASGYTFTDFNMHWVKQSHGKSLEWIGYIYPYNGITGQNQKFKSKATLTVDNSSSSAYMELRSLTSEDSAVYYCARERFGVGNNYAWFTYWGQGTLVTVSSAKTTPPSVYPLAPTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Structural basis for the neutralization of hepatitis E virus by a cross-genotype antibody
pubmed doi rcsb
source organism Hepatitis e virus
molecule tags Viral protein/immume system
total genus 41
structure length 216
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pljD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pljD02
1FLTX 1ZOXA 3QIBD 4LVHB 4NO5B 3GSOB 2X42A 4HKBA 1A6UH 3RVXD 1JHKL 1K6QH 2DQDL 1NFIB 1P84K 3NFNB 4XVTH 5GRVL 2C4XA 4JRYA 1AXTH 4FS0A 2NW3A 3ZHKA 4UINL 3D0VB 4DOHB 5J0BA 3KYNB 4DUXA 5LAXA 4YE4L 1OM3H 1NGQL 3TLRA 1JHLL 1MNUL 1E4XI 2VN4A 4CU7A 1NBVH 4KK9D 4PTUB 3KLSA 4WENB 3WDIA 2B7DT 3UX9B 5CAYB 3MODL 4OBSA 3BP6A 1UWEL 1SY6L 4DOHE 1NC2D 3LIZH 2O5ZL 1CICA 4N5ED 3QRFM 2MKWA 2D31A 4YDIL 5EZJB 5B38B 5I1IH 5CINH 1ZHBA 4PJ5A 1T22B 3BO8A 5J6HA 4UUJA 4KI5C 1N6UA 3FO1B 5DQ9B 3OJDB 2VXVL 4O2FA 2IGFL 1HHGA 1U9KA 2AJSL 2BFVH 3L7EB 3SDXA 1MI5D 3GSNL 1FN4A 1AQDA 1S8DA 3MYZA 3OGCB 5GGSB 4MA7L 4IRSB 5IQ7H 1HHJA 2VLKD 4O58H 1VGEH 4HJGA 4PRDA 3VFTB 2WQRA 3V4PH 5F6IB 4G7VL 4PJCB 1XCQA 2X4SB 2DIBA 4LAJH 1WV7T 4F37F 2YEZB 5I8OH 1A3RL 4FTVB 3VXMA 1A14H 4UQ2B 1T89A 2GFBA 3HKFA 3K7UA 3RTQA 2GK0B 4LP5A 4U6HA 4AEIH 5F9WC 4M02A 5DO2C 1LNUB 4PLKD 4QRUB 1BOGB 1ACYH 4NJ9H 1CU4L 3QISA 4PJCE 5B22A 1U42A 1S9VA 5GGQL 5K9OB 5I1JL 5I15H 1KC5L 4OLWH 5BVJB 2XG4A 5SX5K 4NNYB 1QSVA 1X5LA 5EO0A 3NH7H 4L8CB 3A6BH 3ARPA 2NX5D 3MR9A 1SMOA 1JMXA 1QLFA 1PG7H 3DHMA 4C83B 1J0YA 4JFZH 1J05A 1R24B 3MXWH 3VGEA 4XB8A 5D8JL 1CLYL 5B3NA 3IDJA 2FX9L 4LVOB 5H35B 5KS9E 1CFNB 3E0GA 2HJLB 3GNMH 3QULB 3VXSA 1N0XL 4HK0A 4OJFL 5GRZA 4AENA 3K74B 4J1UA 2R8SL 5CCKL 1A9EA 4LCWA 4U2YA 2DKSA 3ECBB 1RQ5A 5HI4D 5J4MA 1OAUL 1CQYA 4EIGB 5HY9B 3DVIA 3I2CL 3LKOA 4I1NB 4YHOL 1EFXD 5GGTH 3RPIB 1BEYL 4NO5A 2R0KL 3GSOA 2AJYH 1T6VN 3SKMB 2NY5C 2O93L 3IDNB 2DTMH 4EDXB 3GI9H 1NFIA 3RWIB 2CXGA 3NFNA 3S4SG 3EZ8A 5C0CB 1MRDL 3UTQB 1NAMH 3L3HB 3D0VA 2ATKB 3KYNA 4JN1H 1UH4A 1JNHB 4LSPL 1HKLL 3OKKB 2R2BB 4W70A 5E24E 2X70B 1HSAB 1D5BB 3B9AA 3NCJL 4GG6B 1KN2H 4PTUA 3WDHA 4ZYKB 2HH0L 2NW2B 5MP6L 1AC6A 5IFAL 4U6YB 3MACH 4XNXH 2NXZC 2Y5EA 2NXYC 1JZ4A 5EZJA 5B38A 5IK3B 1T22A 4EDWL 3UYOD 2HRPL 4G6KH 4WO4C 3THML 3M17B 1QEWB 1R0AH 4XWGH 5EIVA 2VLRE 4GG6E 7FABL 3FO1A 1ZE3C 5DQ9A 1UWXK 3OJDA 3AUVA 1VFUA 5A3IC 2LFGA 4RGMC 3L7EA 2X05A 3BP7B 3JUYA 1XZ0B 4X7CC 4M8QB 3BIKB 3GZKA 3B8YA 3TZVC 1LP9F 3OGCA 1SVCP 4XRCB 1NMBH 4IRSA 1M71A 3RP1A 5T5FL 3VFTA 4PJCA 5DLML 1JNNL 2ICCA 1ZA6B 2X4SA 1YZZA 3D48R 4A6YB 4BQ8A 4HLZG 2YEZA 1UCBL 1FBIH 4Z95H 4FTVA 4LHUB 4UQ2A 5KZCD 2GK0A 3O2DL 3TO4B 1IAMA 2I5YL 4Y16C 1LNUA 4QRUA 1BOGA 5I17B 5K9OA 1YMMD 2V2XB 3CSBA 4JHWL 5F7WC 5BVJA 1MIEH 3B2UC 4BYHA 2AERT 4NNYA 3T09A 5JW3L 4L8CA 3UDWC 5ITFB 4MX7A 1FYTB 1UKQA 1RMFH 3B3IB 4C83A 1OTUD 3G6JB 3I6GB 1PGRB 4NZRH 5C6TL 5IB1B 5D71L 4WU7B 3HE7C 2CMRL 2HJLA 3FN3A 8CGTA 3QULA 1S9XB 2F8OA 2R23B 3BKML 4R7DB 1AP2B 3MOBH 1E4WL 1FYTE 3NMEA 3SE3C 1J10A 3ECBA 3G6JE 2VDKH 5I73B 4JGMA 5HY9A 3UPCA 4JKPH 1X5FA 1LEGB 2C3VA 3BDYH 1RAMA 3NZHH 4JO4L 3RPIA 5F1OB 2WWKO 3D3VD 4DQOL 4DGIL 4YZFF 3SKMA 3IDNA 1LD9B 4EDXA 3RWIA 1FORH 3S36X 5C0CA 3T3ME 2ZUVA 3UTQA 5BJTB 5AZ2H 4OCWL 2ATKA 1JNHA 3V6FB 1BPVA 2XFXB 3OKKA 3MBED 2R2BA 5JOPD 4QRPD 3S37X 2X70A 1HSAA 1D5BA 3H9YA 4NNPL 4GG6A 1Q9LB 4ZYKA 5F8RC 2NW2A 1CFBA 2G5BB 4QRQB 4U6YA 5M7QA 3D69B 4BK4A 4OIAA 3GGWB 4YFDB 3CUPB 4QTIH 1EFQA 5IK3A 5E99H 3GSXB 1AGEB 3NABH 4X4ZA 3M17A 1QEWA 1B6UA 4J4PC 4WY7H 1GGUA 4HS3B 3RWJB 3E1F1 1KG0B 2JJWA 4D9RE 2XY1A 2QADB 2Y4SA 3BP7A 4FMKA 1WBZB 3QI9C 5CGTA 3DO7B 1XZ0A 1A3LH 5IIEB 1IVLA 4K3JL 4PJXB 3BIKA 2IH1B 2BY2A 4XRCA 4K3DH 5I18L 4I13B 3DUUB 5HDQL 1QHOA 1MVUB 1UADC 2NZ9C 2OMBA 1ZA6A 2OR7A 3V4UH 1C12B 4LIQL 4A6YA 5IM7B 3GIZL 5HGBB 2IAMD 1WCBB 2FEEL 4PJXE 3EYOB 43C9B 4GH7B 4LHUA 1WICA 4M6AA 4BFBD 1QR1A 5DD5L 3TO4A 3HS0B 1BGXH 3VFPB 5I17A 4GO6B 3IDIB 2BNQD 2IPUG 2V2XA 3U7WH 5DT1H 4MYWB 4O2EB 3DECA 1NDMB 5ITFA 4HH8A 2BC4B 5EA0L 1FYTA 3OPZL 2IAND 2F74B 3EOYG 2VXUH 3B3IA 2V5YA 1ZLSH 4U1HB 2CDFB 3EDKA 3ARED 3I6GA 3G6JA 4EQ3A 3WFBH 3CXDL 5IB1A 3GM8A 4WU7A 1BQHG 1KCUH 1BQLL 4ZS7H 1LK2B 4P2CG 4TUKL 1S9XA 2R23A 4R7DA 1AP2A 1JNLH 3PP4L 3KJ4B 2A9MH 2UZXB 1AQKL 4RMQA 1I3UA 3LQAL 1PVHA 1LEGA 4M62L 1HKFA 1RZKC 1JPGB 1PSKH 1RIVH 1LD9A 2D9QB 4XVUD 3RTQC 5E4EB 5DRNB 5BJTA 4UDTB 2GJ6B 2YS4A 3IXAB 5KBNC 3B2VL 2J3SA 2P4AB 2XFXA 3G6AB 1JWSB 4NNXB 4JREB 3GMLB 3HMXH 4XPHH 1U6AL 2Y72A 2J5LB 1Q9LA 3ILQC 5T1KD 4NC1C 4PRHB 4FFZL 2BSED 1TQBC 3ARFD 2H2SD 2G5BA 3BT2L 4AYFA 4QRQA 5CUSH 3TBWB 1OCWH 1URLA 2A0LD 5CEYB 3S35X 2GJ6E 2R69H 3GGWA 3IDXH 4ZG1A 3CUPA 5TF1H 4P46B 4I0KA 1U8KB 3GSXA 4FA8A 1KSRA 1AGEA 2QBWA 2NY4C 4XPBL 1A7QH 3T3PE 2EO9A 4OSUH 4HS3A 3Q3GA 4PRHE 3RWJA 1DVFB 5I71B 3EJJX 2VABB 1KG0A 1SEQH 4PGDB 1I7RB 2RHEA 4QRRD 1T5WB 1EO8L 3DO7A 2VDOH 3BN9D 5IIEA 4PJXA 3ULVH 1HNGA 2IH1A 2D2OA 2E9WA 1AKJD 4RZCB 1CN4A 3DUUA 2EDNA 1MVUA 1TIUA 3AB0B 2R4SL 4HUMB 4RMTA 3RVVD 1C12A 2BVUA 3LEVL 1E4KA 3F7YA 4OD2A 4HJJL 5HI5C 5IM7A 5EBLB 3UC0H 5HGBA 2XQYK 2DQTH 1WCBA 3EYOA 43C9A 2FBJH 4HK3J 4ZFGH 2ILLA 3HS0A 1JL8A 2IPKB 3VFPA 1YY9C 4YHKH 5FYKE 2FD6L 3IDIA 5F96L 4R4BB 3VRIB 2VERN 4LHJB 2EYRB 2BOCB 3UAJD 4O2EA 1NDMA 2XXMB 2BC4A 1QFWH 1OSZB 1QSFB 2F74A 1TENA 1E0OB 4U1HA 2CDFA 4HLJA 2OP4H 1OY3B 1T6WA 1NSNH 5T33H 4AL8H 1EGJL 3NN8A 4HFUL 1LK2A 2CIKB 2CO6B 4UTBH 2JTDA 4X7EC 1S7UB 1EHNA 2Z9TA 1A1MB 3PWLB 3ZKND 4XVJH 4IRSC 5DA4A 2ICWJ 3IYLW 1JPGA 1UZ6E 2BVEA 4YWGH 1A02N 3E2HB 4DKDC 5DD1L 1QYGH 2R2HB 3P4OB 4ETQB 4NJAL 4ELKB 2V2TB 4KFZC 5CHNB 2C3XA 3GB7B 2YD6A 4CGTA 5DRNA 4LSRH 2BRRL 4UDTA 4M9PA 3IXAA 4OD3H 3VXRB 1OGAD 5IVXF 5CLWA 1IC7L 5AYUH 3G6AA 5FECB 1JWSA 4NNXA 2VZOA 3FRUB 3GMLA 2EXWD 4I2XB 1HE7A 3VGBA 1Q94B 3FCTB 3KWWB 4PRHA 2GSIB 1A2YB 4R90H 3G5VB 1KF9B 1L0QA 3TBWA 4QYOB 5ITBL 5CEYA 1FV1B 2KQNA 3VXRE 3ULUL 2Q20A 4NQED 5F7FA 4HEPG 4P46A 5FYKU 1JZ8A 1U8KA 5C3LD 4LVOC 5FUOH 2VL4A 4JFED 4I2XE 5E6IC 2H1PL 2V7NB 4RDQF 1GPOL 2A74B 1DVFA 3O3BB 3MGTB 3VXNB 2VABA 4PGDA 4M6ML 1I7RA 3PDGA 5C7XH 3B8SA 2NY1B 1T5WA 4NFCA 3F62A 1G9NC 3ARUA 1MPAL 5IG7B 1G6RB 4ZPVA 4KTDL 4G7YL 3L5IA 3BAEL 4RZCA 3M45A 2DM3A 1NMCB 2F53D 3WO4B 3A6CL 2XACC 3JSSA 5EBLA 1KPVB 4XP9H 3RNQB 4WWKB 3ARQA 3LKSB 2MPAL 4Y0GA 2DQIL 2IPKA 4D0CA 2J88L 3H7BB 3STBA 3DSFL 3MBXH 4HQQL 4R4BA 3VRIA 2WUBH 2EYRA 1BHGA 2X9WA 2BOCA 1M7DB 3ES6B 3PP3K 4JY6B 1R6VA 1DZBA 5E7BA 5KTEL 4MNGE 2DQUH 3M8OH 4P5MB 1OSZA 1QSFA 5DMGC 3QQ4A 3A67H 1M7XA 2MJWA 1OAZL 4YFEA 3WSQL 3HA0A 1OD9A 2YRPA 2CIKA 5AD0B 5GS0L 4H0IA 3LEYL 4KQ3H 3BKJL 1EJOH 1KACB 1HIML 2W9EL 4JDZB 1S7UA 1M1SA 3BGMB 1A1MA 2P44B 2GHWB 1KJ2A 3QDJE 4PB9L 3MRNB 3VWJB 4JZJB 4YHZH 2R2HA 3P4OA 4ETQA 4ELKA 2V2TA 5CHNA 5F70A 1FAIL 3GB7A 2FB4L 2DLTA 2Z91B 3OKEB 1EUUA 2CUMA 4I77L 3TO4C 1QFUH 1NLDH 5E1HB 3ZSTA 5FECA 4MD5B 5GJTH 3FRUA 2VRAA 1DQLL 1Q94A 2ADIB 3KWWA 1UWGL 2YPLD 2GSIA 1A2YA 1U8QB 1MCJA 3G5VA 4JM2B 1NCBH 1TETH 4CKVX 4QYOA 1KLUB 1KNOB 4Y8DC 1JHTB 1FV1A 3MSPA 4XMKH 1MFBH 3OKNB 4MXWH 1FYHB 4FQHA 2VDLL 3WD5L 1JF1B 4KI5D 2ARJB 1H5BB 1UACL 1ZT4B 1MVFA 4MJ4A 2OI9B 5IVOA 3TWCH 2V7NA 2JB6B 2A74A 1YECH 3O3BA 3VXNA 4JO3L 4HV8B 4OZGF 4X6CF 2JJSA 3O6KL 3HI5H 1NCDL 3HUJE 5IESL 4XC1H 1TCRB 5I73C 4HX1B 5IG7A 1G6RA 1OSPL 2VL5B 4LSVH 5B39B 1DQDL 4LQFH 1G7QA 2OZ4A 2XG5A 4YBLB 2CKBL 1T1XB 3D9AH 1OAKH 4M5ZH 3ZDYF 1F4YL 1PG7W 4IOSD 2BJML 3RIFK 5IW3A 3MUHL 2VDPL 1S9WB 3IDUA 1IGJB 1KPVA 1MFNA 1EV2E 5DQJA 4GS7B 4WWKA 1JPSL 3T0AA 3LKSA 5DO2D 2DI7A 3FFCE 1GIGH 3QEHB 1BAFL 2D7TL 3MLWL 3H7BA 3VI3E 1UM5H 3DSNA 5I2IB 1YYLH 2YPKB 2Y07L 1M7DA 2IG2H 3ES6A 1F2XK 1I7ZB 2C1OB 2B4CL 4P5MA 2GIYA 2M26A 3RBSA 4WTZA 5L7XL 4NT6B 4H8WC 3D39E 3ROLA 1BM3L 1VADB 5I8KH 2P5EB 2A77H 3MLYL 5TDNB 3U6RB 1C1EL 1S3KH 5KVEH 4PPTA 3M07A 1RZKH 3WNMA 5AD0A 2QADC 3JWNC 3MRQB 4QT5B 5F7LB 1VESA 4K9EL 2W0LA 4JDZA 5IV2B 3EKCA 2BOBB 4M48L 2H2PC 1CWVA 3BGMA 1L6XA 1Z3GL 2PXYC 2HRLA 2YPVL 2A9NH 1EBPA 4AQOA 2DN7A 5C86A 4GOSA 4HAGA 1MY7A 3UJIH 3C2AL 3MRNA 3VWJA 4JZJA 1CDBA 5J1TC 5A2KH 3GBNL 3ULVF 1XIWB 3SDYL 1Y6NR 1G0DA 2Z91A 1QBAA 3OKEA 1QNZL 4LSDA 4NKDA 4XPTL 3MLRL 5L0QC 4BQBA 1PLGL 3CZJA 5FXCH 5ANME 4MD5A 5HVWA 1OT2A 3G9VA 2YUZA 4XH2B 4F58H 1DBBL 1QBMH 4GAYB 2ADIA 3FAXA 4PYHA 4TQEL 1TZGH 1U8QA 4JM2A 5BW7A 4AH2B 2NXZD 2NXYD 1KLUA 1JHTA 3QEGH 1WIUA 3WNOA 1P5VA 3OKNA 3HR6A 4WO4D 2BP3A 1JF1A 2ARJA 1H5BA 4XXDB 1UH3A 1ZT4A 2XWJB 1ZANL 1RZIB 3W9EB 2JLLA 3SJVB 2JB6A 5A3ID 4MA3B 5ECJE 5K59F 5CKGA 2ED7A 4S10A 5C07B 2O5YL 1ZAGA 1MQ8A 1GRWA 1GC1C 3LH2L 1TCRA 4HX1A 2F5BL 4UB0L 4MWFB 3TZVD 2VL5A 1ZV5A 1NBYB 2Q8AH 1CK0L 3FONB 5DURB 5B39A 4XXCA 3TBSB 1T1XA 5CJQH 5HHPB 3SJVE 3MRLB 4M7KH 2M2DA 5CBEB 1S9WA 5E4EC 5F89B 3L3DB 4Y4FA 3U9PL 2VWEC 1IGJA 4O4YH 5ABDE 3F5WB 1FGVL 5DHXB 3UEZA 2E27H 4Y16D 4JREC 5IROA 3QEHA 1IC4L 4M6NH 5SWSE 3CK0H 3I50H 3WE6B 2J5LC 1ED3B 35C8H 2BHZA 3B2UD 5I2IA 2YPKA 3PL6C 1IGYB 3QQ3B 1I7ZA 1W0WB 1IGFH 3FO0H 2C1OA 4P2QD 1GGBL 2G5RA 4TNVF 4NT6A 2P8PB 1YN6B 1V7ML 4TSCL 1RULL 1VADA 5GGVH 2HTKD 2P5EA 2VLME 4WHYG 4J12A 5TDNA 3HE7D 3U6RA 1R3HB 4HZAA 1I3GH 3DV4B 2BHYA 1DVFC 5I71C 3O4LD 4R3SB 1CDHA 5I6XC 4Q9RH 4QT5A 2YXMA 4KAQL 2XA8L 4GRWE 1U8IA 2FIKB 5IV2A 1WTLA 1JTTA 1BJ1J 2BOBA 3KPMB 1KELH 1NUGA 3O3AB 3KLAB 5T1LB 4PJGF 5IWLA 2D03H 2VDMH 1R3IL 3EYSH 3VXOB 5HHMD 3AB0C 3DGGB 3VGDA 1H8NA 3QHZH 1XIWA 3BUTA 3HC4L 3RDTB 5JTWA 1CLCA 5J1SC 2FIRT 3TM6A 1HNFA 1MEXH 1HXMB 3KJ6L 1ZHNB 5E2JA 4RFNC 4XH2A 4JFFD 4OV5A 1F90L 4GAYA 1LO0L 4X6BB 4MJ5B 2C3HA 1FVCB 5EORL 1YPZE 1QZ1A 1WSST 4MJIB 5GS1B 4AH2A 3V4VL 3CSYA 2R4RL 4FP8L 3MRBB 5CILH 2DRUA 1FL5B 4YXLH 4J4PD 2QKIB 1NGPH 1F4XL 4KHTH 3SKUD 2XWJA 5BQ7B 3DMMB 1RZIA 3W9EA 4LFHG 1EXUB 1SJEB 4PY7A 3SJVA 4MA3A 3NACH 4WTXA 5FM5M 4MJIE 2EH8H 4PP2B 2F58H 1OL0A 2J8UF 3MCLL 3PV7A 3QI9D 5C07A 1MHPL 3OTTA 5F7EL 5DR5H 4MWFA 1CF8L 1NBYA 4OB5L 3FONA 1PZ5B 1N0LA 3MLXL 1DQQB 2NZ9D 2XA3A 5HHPA 3MRLA 4RAUB 2YA0A 1AGDB 2G75B 5F8QC 5CBEA 1IGML 1NCNA 3L3DA 3N1FC 4RSVA 3F5WA 4OI8A 4MSWB 5L88H 4ODSH 4LGRB 4HWUA 3WE6A 3OSKA 1ED3A 3NGBB 3ESUF 2XKSA 4U05A 3U1SL 1TJHL 4OI9A 1PW3A 4XNYL 1A6WL 4CU6A 1IGYA 3QQ3A 2WQ8A 4RISL 2FSEB 1W0WA 3STLB 5HYQB 3LPGA 3RWEB 1QSED 1MF2H 4PJ5D 5KVGL 2P8PA 1YN6A 1BVKB 3ZYZA 4LSQL 2EE3A 2BDNL 2FZ3B 5AZEH 1BLNB 1Q72L 3C8HA 1IC5L 2DI9A 1AI1L 1R3HA 1XT5A 3DV4A 3TH3T 4X7SH 2CLZB 2NY1C 1GGCL 5DJDB 5JA8B 2XI9A 3MFGB 2FIKA 2ZCHL 5DVKA 3NAAH 5BVPL 1KENH 3KPMA 4QXUH 5F7YC 2UWEF 3O3AA 3KLAA 5T1LA 3EJYC 3VXOA 3EOTL 4HXBH 3WO4C 3NCBB 2E5EA 2QSCH 3U46B 3UO1L 2N1KA 1EA9C 1BFTA 5CZXC 1HWHB 2VDRL 3VXMD 2RB8A 3RTQD 4ZS6C 1CXFA 3TYGH 5INDB 1A9BB 3RDTA 1T1WB 4G8IB 2FATH 3WLWC 2CK0L 5IP4A 1FGNH 2BVTA 3H3PL 3EOAB 3VXUE 4G8EA 1HXMA 3NOIA 1ZHNA 4TVPD 2DM4A 2WBJB 4N0YL 3ILQD 4J6RH 1T0NB 4Z0BL 4X6BA 1KLGB 4MJ5A 5D96B 1FVCA 4M5YH 4G6AC 4MJIA 1YEEH 5GS1A 4ORGB 3MRBA 1IBGL 1FL5A 4UIKL 5D72L 5EU6B 2NY4D 3H42H 2XTJB 2QKIA 4XPFL 3VXSD 5BQ7A 3DMMA 1EXUA 1SJEA 3U2SB 3WFCL 3QUZA 4LCWD 4POUB 3SDXF 4ALAH 1MCIA 1RIUL 1QRNE 4PP2A 1F5WA 5I30H 1HH6B 2QQNL 1LHZA 4BFIA 2BVPA 4M43L 1W0VA 2LVCA 4NQUA 2VQ1B 4YXHH 4L9LB 1PZ5A 4NKMB 4KKLC 3T0EC 4LEXH 1BWWA 1EH9A 3O6ML 1DQQA 4UOW0 4I9WE 1G7PB 1L0YA 3VWJC 2R56H 3LPWA 4JPKH 5HXMA 2AEQH 4RAUA 5FGBA 1AGDA 2FYYB 2G75A 3PHQB 3MREB 4U1KB 3HLAB 5HI5D 5E95B 3OX8B 3TV3H 3WFHB 1DN2A 4ZDHB 4MSWA 1N2RB 2ADFL 1XAUA 2DM7A 4MA1B 4ZUUB 1IL1B 1YY9D 2CJUL 5L8JB 5K93A 1RZJL 4OLYL 4KDWA 3QEUB 1B3JA 1OQXA 4JM2C 3OB0H 3QJFB 4D9LH 4GT7A 5TQ2L 3O3DB 2FSEA 2V17L 3STLA 5HYQA 1SYSB 3DHJA 5EC1B 3RWEA 4EBQL 2JKXA 4KU1A 1BVKA 2FZ3A 1H5BC 1BLNA 4EJ1C 4ZSOB 2OI9C 3T2NH 1NUDA 4M6OH 1F58L 2XWTB 3CAFA 3ZL4H 3ET9F 2WLZA 2YRZA 4HWBH 1A1OB 2CLZA 3LD8B 3QJHB 5DJDA 1JP5A 1W72B 1YEHL 3VFMB 4ZO7A 1N5AB 2VZ3A 4ZOCA 4IRSD 4D94A 1A64A 5GGRB 1H8SA 4QRTB 4QHLB 4K7PY 1FVEB 1GZQB 3U46A 3Q6GL 3OR6B 3RVTC 3QDMB 4FTVD 5JHLL 4Y4FC 4JKMA 5ELIA 3VD4A 1N5YH 5HD8C 1MCPL 5INDA 1A9BA 4GS7C 1T1WA 4G8IA 5IROC 4OLXH 3EOAA 4LLAA 2J4WH 2AQ3A 4OZFG 1I8MB 1T0NA 1OF2B 3QDME 5I1KL 3EO9L 3GRWH 4ORGA 2EYSB 3U82B 4Y5XC 5HYEA 2PNDA 5CKAA 2R9HC 4CBPA 5MHSE 1PKQB 5EU6A 1GC1H 5F9OH 3JWDL 3OBAA 5E6ID 1JZ5A 4YHYB 5GJSL 2W1NA 1RUAL 4FABL 3U2SA 1MJJB 1RUPL 4LL9A 4EOWL 1Q1JL 1ORSB 1HH6A 1MCDA 4LRNH 5IWLC 1CTNA 1OTSC 5E00B 2VQ1A 4IDJL 5E8DL 4L9LA 4NKMA 1YDPB 1KXTB 4PJCF 1G7PA 1HOCB 3B5TA 3TNMB 2DI8A 4HFWB 4L5FL 4G8GA 1INEL 1CD0A 5EZOL 4NYLB 5C0CD 3PHQA 4U1KA 3MREA 3HLAA 3WFHA 3OX8A 3U0WL 1CFQA 4OCNC 2CQVA 3EFDL 1EHAA 4ZDHA 4E42B 1A7NL 1N2RA 1YN7B 4XC3H 3VH8G 4H26B 4KROC 4MQ7B 4ZUUA 1U92A 3QDGB 1IL1A 3DOSA 3QXUA 1NFKA 5KS9F 3BWUC 2HVJB 3FQUB 3QEUA 3RJQB 4NKIH 1VCAA 3ZSSA 4QEGA 5HHOB 3QJFA 3D18A 2WMPA 1QFOA 1WWAX 3O3DA 4CMHB 1SYSA 4JPVL 5EC1A 5DMGD 4F7PB 4Z8FH 3SKJH 4CUCA 1FNEB 1T7VA 3T65B 1KTKE 5TE4L 2WINB 4ZSOA 2EDQA 4Y4KB 3Q48A 3GJFB 1PEWA 5HHOE 4OQTH 4GKSA 1A1OA 5FYKH 5SX5H 5HYFA 1T03L 1T20B 3QJHA 3V0VB 2B2XH 1JYXA 1W72A 2F54D 3VFMA 3PWNB 3FOMA 4M7ZB 4TULL 4L8BB 5GGRA 5HHXH 1CDIA 4QRTA 2YZ1A 2DQCH 2OR9L 4QHLA 1MFDH 4X5WB 1FG9C 1I1RA 4I3SL 3OR6A 3QDMA 1CTOA 4KHXL 4PFEA 2BVQB 2M1KA 4GAGH 3TO4D 1IKNA 5ILTL 4GW1B 4RFOH 4DK6A 3KAAA 1EERB 2QQKL 3QNZB 2XV6B 1FH5L 1E6OL 4GG6F 1I8MA 4XMPH 1OF2A 4K3HA 2ORBL 5L6YH 4P2RD 2QTEA 5T3ZD 4NSKB 2EYSA 5FYJD 3LDBB 1NQBA 1RUQH 1D5ZB 1PKQA 4P5TB 1JFQH 2I26N 4DKFL 1QG3A 1DL7L 4XPGL 5TQ0H 2JELH 2VMFA 1J11A 1JIBA 4HS8H 5E2UL 2EH7H 5JQHC 1MJJA 1QD0A 5EOQL 1ORSA 3OKOB 1FIGL 5FUCC 1MCSA 3PHSA 3IJYB 2NY7L 3U30B 4LAQL 3W5NA 4MD4A 5E00A 5IBLC 3O8XB 1JGUL 4OUUB 1YDPA 1GH7A 1HOCA 3TNMA 3H3BC 4HFWA 3MJ9H 5JUEH 3L9RB 5D2LB 3P11H 5EOTB 1MCQA 4NYLA 4MNHA 1JGEB 3RDTC 2D7MA 4FZEH 4KZEL 4FNLH 4M7JH 4E42A 1YN7A 4UILL 1UC6A 1YJDC 4MQ7A 1QFHA 5ADOH 3QDGA 3OAYK 4LDEB 5T3XD 1UKTA 5ADPL 1NJ9B 4KVNL 1SJHB 2HVJA 3FQUA 5D2LE 1C8PA 2EE6A 1I9RL 1U3YA 3B43A 2N7AA 5HHOA 1JV5B 1JF6A 5GS1C 2L7UA 2PW1B 3KPLB 2IJ0C 1Z9OA 1AO7D 4NQXB 1ADQA 3TC9A 4F7PA 3G6JF 2W07A 1OW0A 1FNEA 1XGYL 2VQUA 5DJ0A 4DVRL 1G6RH 3T65A 2WINA 4J3TA 3AAZB 3AS1A 2ZUTA 4Y4KA 3GJFA 3IGAB 5ID0B 3QUZC 1NANI 2QADD 3KS0H 1T20A 1C5BH 2WBKA 5DDHB 3V0VA 4KMQA 4X4MA 3T3MF 2CSPA 2H2PD 3PWNA 1CI5A 3L6FB 3S34L 5D2NE 2DQEH 2PXYD 4HC1L 4L8BA 5L2JB 1YEIL 4GXVL 4X5WA 5FGBC 5F7HA 1KOAA 3CNKA 1OLZA 3N1QC 2WUCH 3TP4A 3VDAA 4JGJA 4CADB 1CFSB 2VKWA 4FZ8H 3BGFB 4AM0B 1UA6H 4GW1A 3S36H 1WT5A 4XHJC 3QNZA 1DSFH 3NGBC 4WUKH 3BRGC 1O5DT 5TE7L 2DBLH 2ZKHL 3LAFA 3T0WA 4TOYH 4NSKA 4JLRB 1RV6X 4X9IA 5GGRY 2CGRH 1BBJA 1U2CA 3I3BA 1CD8A 3OG6B 2F19L 3FN0H 3UPAA 1D5ZA 1QACA 4HLZH 2APXA 4P5TA 5E7FA 4QHKJ 2B1AL 3DWTA 4W4OA 4U0RC 3RAJL 3DRTB 1BFVH 3VFUB 3OKOA 4WW2F 5I1AB 4F3FB 5MEPB 4PJXF 3IJYA 4V2BA 5FCSH 1P4BL 2W60B 4OUUA 1L4IA 3DBXB 3VFGL 4JVUA 1PKOA 1F4HA 3O6LL 4Q9QH 3L9RA 5D2LA 5EOTA 3HE6B 1AGBB 3BPOC 1KCVH 5F3BB 5E2TH 1JGEA 1U3HB 4HWZB 4M3JA 4JJHA 2X10A 4WJ5A 5A43C 4KH2A 5I1GL 1TNNA 3P2TA 4J3XA 3WS6C 3CVHL 5D1XB 5C0AB 1NJ9A 3MRJB 4TRPL 3UJTH 1SJHA 4MS8C 4PRHD 3OKMB 1B2WL 3PL6D 1JV5A 4OF3A 4QRSB 2PW1A 3KPLA 3EYUH 4NQXA 1QKZH 1MRFL 3O4OC 2C1PB 3S7GA 2ZPKL 2VXTL 4G42B 1JI1A 1QOKA 4KUCD 4POZC 2XTJC 1A6AB 2ADJB 3AAZA 3T4AB 1DVFD 1TJGH 2UYLB 3IGAA 5ID0A 3O2WH 3TCXA 3ZTNH 4XP4L 1RFDH 3CPLB 1KBGL 5DDHA 1IT9H 3HC3L 4BSVB 3VW3L 3L6FA 3AXLB 5DJAA 4N9GB 4X5XB 4L9LC 4YAQB 3PQYD 1BBDH 4PG2A 1CR9L 5F97E 5L2JA 3ZMRA 2DJSA 5HYSB 4Q97A 1L0XA 3ZT6A 3EO0B 1MREL 4HKJB 4X6FB 1BP3B 4UT7H 4CADA 1CFSA 4U4BA 4FQJH 3F8UB 3FO2B 12E8H 4AM0A 5IFHH 4MA1C 3TBTB 1C16B 1J0HA 2V5SA 2YWYA 3T3PF 2JB5H 3LKQB 4KK6C 2A83A 1WWWX 1X7QB 1QSFD 4WI6A 5E08H 4XVSH 4JLRA 4NFDA 4BQCA 2EDRA 1TVBB 4WFHD 2FX7L 5DWUH 4PUBL 3K4DA 5DZLA 3S35H 5IQ7L 4L4TB 4BUHA 3SY0B 1CLOH 3U0TB 1CZ8L 4FFYL 2DWDB 3FFDB 1CDYA 3VFUA 4MAUH 4F3FA 3REWB 4YBHA 5MEPA 4MB4A 2F8VA 1K85A 3QEQB 1IILE 2W60A 1WZMA 3RI5F 3U79A 4L4TE 3DBXA 1KIPB 2P43B 4NJ9L 4KWUA 5TFSH 2DQHH 3WN5B 2AGJH 3WXVH 3VRLE 3QUMB 3VE0B 4JHAL 1IM3B 1JRHI 5DRZB 4E41B 2AQ1A 1AR2A 3HE6A 1AGBA 1D9KB 4OZFB 4QCIB 5F3BA 1U3HA 1H8OA 4HWZA 4S1SH 1IKNC 1VPOH 3MXWL 1WUNT 1P5UA 4F7EB 4XMLL 3MA9H 5D1XA 5C0AA 3MRJA 3CGTA 1ZLVH 3OKMA 2YHGA 4PREB 4QRSA 5E5RB 3K3QA 3UTTB 2Y6SC 1N7ML 3DARA 3R1GH 1II4E 4ZNEE 2C1PA 5D7JA 4PRAB 3QCVH 4G42A 3EIFA 5C08B 1N64L 4RWYL 2WNGA 1CG9B 3SKOB 4UT9H 2X1PA 4NC0B 1CIUA 1A6AA 4JY4B 4YHYC 4HF5L 1UZ6F 2ADJA 1X5HA 3T4AA 3V6OE 2UYLA 2OL3B 2AJYL 4YQXH 1AGCA 1ERNA 2DTML 2E7BA 1H3GA 2NY1D 3CPLA 1TVHA 1GOHA 4BSVA 3CDGB 2X4RB 5C08E 4JN1L 5JXAH 3AXLA 3V7AG 3EJYD 4N9GA 4X5XA 4YAQA 3B5HA 2ESVA 3VXPB 3VH8B 3UTSD 1YEFH 1CDCA 3GIVB 4JCLA 5HYSA 2EDBA 2E3VA 5GHWH 5IEHB 1KEGH 3EO0A 5CZXD 4HKJA 4X6FA 4ZS6D 1ND0B 3MACL 4JZOB 4WWKD 5HTSA 5CGMA 5C0JB 2GY5A 3WLWD 3F7RA 4TPRH 3TBTA 1TZHB 1C16A 1DLHA 4GRWH 3WBDA 1OGTB 2Z35A 3C6LB 5FHBL 5I1CL 2COQA 1R0AL 4GBXC 5TGBB 4YFLI 3LKQA 4ZFOL 2H9GB 2J12B 4G6AD 4LSSH 1X7QA 5EWIH 5GQBA 1DQJB 1CXIA 3UTZB 4QXGL 1RSFA 1OW0C 1TVBA 4QXTB 2MNUA 4XCFH 1K9TA 4L4TA 3WKNA 1DEEB 4UT6L 4GKOA 1QLRB 3DJ9A 3HMWH 3SY0A 3U0TA 3GI8L 5EZIL 2DWDA 4NC2B 3SE9H 3FFDA 5FEBA 4K94H 1KJMA 3REWA 4M7ZC 4RFEB 4C59B 4LU5H 5D5ME 2UZIL 3QEQA 3QZWA 2EIBA 3D2UB 4ODHL 4TSAH 2GI7A 3C9NB 3KPQB 4V1DB 3T0ED 4KKLD 1KIPA 3PABA 3VWJD 3QUMA 3VE0A 1NLBH 1IM3A 5DRZA 4ZFZB 4E41A 4CW1B 1D9KA 4OZFA 4QCIA 1X5YA 1MHHB 3LMJH 4LLWB 3QXWA 4X6DB 4F33A 2VR9A 2R15A 5DJYB 4V1DE 1WT5C 4LF3B 4NZRL 4F7EA 4CVUA 5GZOC 5FYLD 3H7LA 1VFMA 4IS6B 3GHBH 3EBAA 4JANB 4XP1H 5IW1A 4JM2D 4PREA 3WNPA 3QWOB 3CJJA 5ALCH 1U93B 4X6DE 4YHLL 5LWYL 2J6EA 3UTTA 5CZVL 3LDBC 4PRAA 3UBXG 3VGHA 4P3DB 5C08A 4BH8B 4P5TC 1CG9A 3DUSB 3SKOA 4OCSL 4G80B 2P7TB 2VDNH 4W4OC 2AJUH 1AY1H 2OL3A 2Z31B 1TTFA 3TESA 4K2UL 5IJKA 3KPRB 2JE8A 3EFFB 3T8XB 5KOVC 3CDGA 2X4RA 1FJ1B 1JGVL 1K4CB 3T4YB 1YEJL 3R8BB 3VH8A 4RMVA 1P4IH 1Z2KA 3GIVA 2XOTA 3MXVH 3MFFB 1KCSH 1AFVH 5I19H 5IEHA 2HFTA 3RVTD 3GMMB 4WFEE 3KPRE 4Y4FD 5TF0A 4P3CL 4ZO9A 1ND0A 3UTPE 4JZOA 4BSJA 1DBMH 5C0JA 2A1WH 4OUOA 2PR4L 5IKCB 5E99L 5CJOH 4ZPTB 4LP4A 3ZKXC 3RL2B 1OGTA 2YWZA 1LP9A 1I7UB 2PYEB 4WY7L 5SV4A 3ARTA 5TGBA 4IRZL 4EZMA 3ZKMC 2H9GA 3VMOA 2KPNA 4JM2F 3BKYH 1NH6A 3FB6B 3HNTL 1ZGLM 1LO3L 1DQJA 4XAWH 3UTZA 3HUJF 3PWUB 3I6LD 1KB5H 1OAYH 2R9HD 2P5ED 5B8CB 4QXTA 2DIAA 2MQ0A 4K3DL 5LVEA 1DEEA 1QLRA 3PGFH 1RUKL 3V4UL 4C55A 5T1MB 1V7NH 4OGXL 3FO9B 3QQ9C 4RFEA 1OTSD 5DJZB 3D2UA 1MWAL 4V1DA 3C9NA 3KPQA 5GXBB 4NP4H 1S5IL 2OMNA 3VI3F 1IFHH 4ZFZA 5CS7A 3HNSH 4CW1A 5JIIA 1MHHA 4LLWA 4X6DA 2VC2L 4PS4H 4RRPA 1J0IA 3BRFA 3J7HA 4KROD 5DJYA 4LF3A 1U8PB 2D0FA 4N90D 43CAB 5LXGH 1R3JB 3LZFH 5I9QB 4JANA 2YRLA 1KT2B 3QWOA 3UROR 5KJRL 1JNLL 1U93A 2A9ML 2Q7YB 2HKFL 1NL0L 4P3DA 4BH8A 2R1XB 3DUSA 4G80A 5TPWL 2P7TA 5F21B 1ZVYA 4OM1H 1CGVA 2Z31A 5C07D 4JEGB 1EO7A 2YMXH 3KPRA 4HMDA 5I66B 2EC8A 3EFFA 1YA5A 3X3GL 4L1HA 1FJ1A 5DURD 1NEZG 1K4CA 1IKFH 5FM8A 1AXIB 3T4YA 1QFPA 2FGWH 3MFFA 3Q1SL 3O81A 3HE6C 4RGOH 4KRPB 1WZKA 3GMMA 3ULUE 4ZUSB 1U3HC 3BZFB 1OD7A 3WLBB 3ZE0E 3IFNL 1VFOA 1OCWL 5DEFB 3NPZB 4P9MH 4NIKB 5CP3A 5IKCA 5D1XC 4ZPTA 2AXHA 5E2WL 5DUML 4LGPB 3RL2A 1T2QH 2I25N 1I7UA 4IIQC 2PYEA 3QUKB 1BX2B 5L2KB 1A7QL 1YYML 1JYVA 1MHEB 2P45B 3AU1B 1NCTA 1I1CA 2AEPH 4KRNA 3SCMB 5JR1H 1IGIH 3FB6A 2FEEI 1G84A 5D7JC 3CLEH 5C0BD 5J06A 3PWUA 5MENB 1KJVB 2Q8BL 1DBAH 3TEUA 5B8CA 2OTUB 5L2KE 1B4RA 1G1CA 2ZCLH 5HHVL 3RKPA 4URTB 5T1MA 1MCLA 3IDYB 3FO9A 3UC0L 2OK0L 3CFCL 3MOAH 4TUJB 2BMKB 5MENE 4DGVL 1KIQB 4KZDH 5IBLD 3QFJB 3SQOL 5DJZA 4F8TA 1Q0XL 4GAJH 1KXVC 3MJ7B 2V5MA 4PV9B 4I3RL 2XYCA 3CFEB 1A47A 4PJBB 2Y5TB 3JV0A 5HYJB 5D7SH 1UJ3B 3RDTD 3BYTA 5C9KA 1N26A 3QFJE 1S9KC 1X5GA 4FXKB 3HAEB 1U8PA 4TNVK 1EAPB 43CAA 1NSNL 3N9GH 4YDLB 1R3JA 2OLDA 4FFWC 1AHWC 4PJBE 4U6XB 1FO0L 3MV01 5HYJE 1ZKAA 1KT2A 3MLSH 2EDTA 4WIQA 4OF8A 4OCXL 4HHAB 1NGZB 5I1LB 2BK8A 1OQOA 2NY5L 2Q7YA 5GISL 2L0DA 4ZXBB 4WEMB 4C56B 4P9HH 2R1XA 3JVGC 4R4FH 4KQ4L 4JR9H 5IVXB 4FQ1H 2ZOLB 2G60L 3MA7B 3QUZD 2XQBH 5DFWH 1MJUL 2KDGA 2UVFA 3IJSB 3WHE0 3TT3H 3QCUH 3H3KA 5I66A 3PUCA 4AIZA 1O0VA 4OD3L 4C56E 2HT4C 4G6FB 1BD2D 4XP6H 4MXQC 1GYAA 2ZUWA 5LGHH 1D9KC 2FJHB 4ZUSA 2AXFA 3BZFA 3WLBA 1UZ8B 3QH3B 5DEFA 3G6DH 4XHJD 4MDJB 1A7RH 1N59A 1VDGA 4PJAE 1P2CB 3QUKA 2I9TB 1BX2A 5L2KA 2A2QT 4OF6A 1MHEA 5CSGA 5DYOB 3AU1A 3TJEL 1PD6A 2YUWA 4OIIH 1LK3L 1F3RB 3SCMA 1TZIB 4JZNB 4YGAB 3GJFH 4PJFB 4QOKB 3H9SE 4TTDC 1CL7H 4P2YA 5MENA 1CE1L 4NHCL 2IFFH 3W2DH 3U7YH 5GGTA 2OTUA 3NTCL 3UMTA 4UV4H 4HT1H 2JJVA 2PTTA 4JG0L 5IJKC 1HWGB 4G5ZH 1ZSDB 4JFPB 4PJFE 4G6JH 4K8RC 4OLZH 4QOKE 3X3FL 3QSKB 4TUJA 2BMKA 4XP9L 4LKCB 4S2SB 3HPJB 1KIQA 1SEBB 3G5YB 3QBTB 2YBRB 3QFJA 4ZO8A 3V7AE 4MZ3A 3MJ7A 2VITB 4PV9A 2XT1B 3ABZA 3MBXL 4UV7H 3CFEA 4PJBA 2Y5TA 5HYJA 4UDUB 1UJ3A 2LQRA 4WHYH 4W4NA 4QTHB 3C09B 5BV7H 3IB4A 4M7LL 4JFQB 3V5HA 3A67L 1FL6B 4FXKA 3HAEA 3FB7B 3K2UL 4NQDE 1EAPA 4AG4H 4M4PA 4MS8D 4YX2H 1FE8L 2QLVB 4MNQD 4U6XA 1FZJB 3VG0L 4HHAA 2EXYC 1NGZA 5I1LA 2K9UA 3K8LA 5C6WH 4XCYB 4POZD 5EU6D 4UNUA 2ITDB 4ZXBA 4C56A 4LCIH 2XTJD 2VLJD 3JUZA 4U7SA 5IVXA 5EZLB 1WTGT 2ZOLA 3MYJB 4QGTA 1WGOA 3MA7A 1JRHH 4YHZL 5L9DH 4MQTB 4LASH 2YD1A 3IJSA 4P2OB 1RI8A 4HG4J 2ADGB 1SM3H 4OLEA 2ZUYA 2FX8H 5LKNA 4HGMA 1CBVL 1QFUL 4J3VA 1Y18B 3GBML 1BF8A 5GJTL 4G8GD 1IAKB 5A40E 4OLVH 1MIMH 2FJHA 1JHKH 2DQDH 1I75A 5DK0B 4JPWL 4X6CB 4UINH 1UZ8A 3QH3A 2CH8A 3MJ6A 4YDKH 1NGQH 1JHLH 4MDJA 3O9WB 3UBXB 1MNUH 1P7QA 4F7CB 1P2CA 3KPTA 2I9TA 4ONGH 2JCCB 3TWCL 5DYOA 5BOPA 3IKCB 3DRQB 4F7TB 2DDQH 2YD8A 4KK6D 5EIIB 1YECL 1UWEH 2IQ9L 4JZNA 5GRWA 4PJFA 4K3EL 15C8H 4QOKA 1U58A 4DZ8B 4XC1L 4NO2B 4NQCB 4YDIH 3BISA 4DGYH 2V2WB 3T08A 1JGLL 3EYFB 1K5NB 3SE4A 3UZQA 1BF2A 4LQFL 3QXAB 1EEZB 2JCCE 3LKPB 2Z31C 1BJMA 5HGGS 2VXVH 4N8VB 4EI5B 2AJSH 1ZSDA 1OWWA 2ITCB 2PCPB 4TUOA 5IMMB 4LPUA 4NQSB 3GSNH 3QCTL 4NQCE 4LKCA 3VG9B 4S2SA 3N0PB 3FB8B 3HPJA 1SEBA 3BP5B 2VAAB 3G5YA 5D93C 2YBRA 3KYMB 4MA7H 4ZOAA 2HJFB 2Y9RT 2VITA 4Y19B 4M4RA 3WUWB 3KNBA 2VAJA 5BXFB 3QDMD 1IZKA 2GTWB 1JCKA 2IG2L 4UDUA 2VE6B 3FRPA 3UYRL 3DO3A 1A3RH 4QTHA 4KK8D 4PD4J 4JFQA 2YUVA 1FL6A 5IMOB 3FB7A 2DLFH 4BJLA 3RGVC 1T0MB 4Y19E 3ORJA 4M7LT 3S88H 1P7KB 1OPGL 5GGQH 3U4EB 5I1JH 5KVEL 2DLEA 4JFYB 1FZJA 3VWKB 3LKNB 1RZKL 4XAKE 2FWOB 4HWNA 2Y6SD 2HWZL 4W6YB 4JJ5B 4XCYA 4Z7UE 4F2MB 3BHBB 5B8CC 3GEWB 2ITDA 1CLYH 5IHLB 5HVHC 2FX9H 5E0QA 1FNGB 4BZ1H 3IXTB 5KSAB 5EZLA 4XX1G 2CD0A 3MYJA 4HUUA 3UJIL 4WFFE 4NOFA 2GK2A 3EUUA 1AC0A 1N0XH 4OJFH 1RHHB 3MPCA 4OLUH 2P8LB 4TVPL 1MCOL 4P2OA 2R8SH 3D6GA 4OCMC 3FOLB 2ADGA 3KPOB 4XNZC 4IRJC 2GTZB 1Y18A 1X5JA 3I2CH 1I8KA 4HAFA 1B0WA 1MFEL 1I8IB 4YHOH 3AS0A 4CDHA 1ULVA 3I3DA 4PRPE 3CFBB 1BEYH 1IAKA 1B6DA 2R0KH 1D3CA 4F58L 5C92A 2EDXA 4XBEH 3BKCH 5KG9B 2XZAH 1T2JA 5HI3C 2CRYA 4RGNC 3LS5H 1FSKB 4X6CA 3C8DA 4LSPH 3QDGD 4R0LB 1HKLH 5J13B 3UBXA 4AIXA 1SJVA 4F7CA 3KS0J 4GBXD 3MTRA 3NCJH 5FO9B 1RK1B 2HH0H 3DRQA 3IKCA 4EI6B 4F7TA 5EIIA 3FQWB 5IFAH 2FNBA 1OARH 3REVB 3ELAT 4DZ8A 1MOEA 4NO2A 4NQCA 2DQGL 3WS3B 2V2WA 1XCTB 3BPNC 4EDWH 3EYFA 1K5NA 2HRPH 4GRLB 3THMH 3QXAA 1NEZB 1ZWIA 1BOYA 1EEZA 3LKPA 5CJQL 1ZLUH 4P5KB 4N8VA 5SWQA 2IALA 4EI5A 1AIFB 2PCPA 2ITCA 5IMMA 1F8TH 4NQSA 3DTXB 3ZYJA 1NKRA 3QUYA 3FB8A 5BZWB 3BP5A 2VAAA 4X7DC 3KYMA 3CMOL 5CEXB 2ENYA 3NIFE 4NQVB 3HMXA 2HJFA 1YQ2A 4Y19A 4M8VA 1A8JH 5DLMH 3WUWA 1JNNH 2NR6C 3BH8A 5BXFA 4GMSL 4EN3B 3B9EA 2GTWA 4KMTH 3CH1B 4R6UA 2DL2A 1T1ZB 2VE6A 1UCBH 1WIOA 4DN4L 3U4BL 3FO0L 4H1LG 1LO4H 5FGSA 1U8MB 4HDIB 5CJ5A 3O2DH 3ZDZE 4R2GB 4ZAKC 5IMOA 2I5YH 4QHNB 5GZOD 2ZUUA 1T0MA 3P0VL 3K1DA 1OVZA 5C09D 4LEOB 1P7KA 2NY3B 2HFFB 1I3GL 4JHWH 4JY5L 5C6PB 4JFYA 2OJZH 3LKNA 5D7IB 3RVUC 4D0BB 2JIXB 2FWOA 2A6JB 3BGAA 1I9IL 3TH4T 4XHQA 5I8CB 5GRXG 1DFBL 4GMTL 4F2MA 3BHBA 4P5TD 2NYYC 3HRPA 5C6TH 4J3OC 2MFNA 3EYSL 2ZCKL 1FNGA 3IXTA 5KSAA 2CMRH 1RZFL 5KVFH 5D7IE 5CIPH 5C71A 4NZUL 3BKMH 3WJLA 2EDOA 1E4WH 3QUMH 4O02L 2P8LA 3W82A 4WEBH 4NN7B 3FOLA 2BCKB 3KPOA 3L1OH 4OZFH 2CPCA 1J1XL 2DKUA 2GTZA 5KW9L 2A0LC 1FCGA 4X9HA 5ACZB 3LHPH 1I8IA 3RY6C 2Y1VA 3OXSB 1T2XA 4JO4H 2AK4E 1FC1A 3EW3B 4DQOH 2FO1A 4I48B 4X7TB 1UJ3C 1FFRA 5KG9A 5DD0L 1PAMA 5BRZB 1ZXQA 3MV8B 3EAKA 1D5XB 4PRID 5CILL 4R0LA 3QT2A 4YDLC 1G9NL 2XPGB 4UAOB 5FO9A 1RK1A 4NNPH 3NA9H 4EI6A 4JM4L 3ZKMD 3FQWA 2OL3H 4NGHL 2EDFA 3MV8E 4NN5B 2X1OA 1TDQA 5D7KD 1RURH 5TJWK 1S7WB 4ZXBC 1JTOA 3WS3A 4U7KA 2KZWA 4KI1A 1XCTA 3RVWC 4GRLA 3ZE2E 1QRKA 1NEZA 4C57C 3OV6A 4RQQB 3BYYA 4P5KA 3HRZB 1UM4H 1MSPA 4Q0XH 3HI1A 1E6JL 2XZCL 3HCVB 1AIFA 3QQ9D 3F7VB 3VCLA 3DTXA 3BPLC 5C0RH 5BZWA 5L88L 3P0YL 3IS1X 4ODSL 1U8LB 5K33A 5CEXA 5I18H 4NQVA 5HDQH 4PB0L 3ZHDA 3QO1B 3KG5A 4PJ9B 5KSBB 3T0BA 3SGKA 2EIZB 5D2LF 4XBGB 1JE6A 1BREA 1XEDA 5E2VL 3WO3B 4EN3A 1C7SA 3CH1A 4L9DA 3BDBA 1T1ZA 4KJQC 5HPOA 2OTPA 3CIQA 1GJIA 1SBBA 5FV2A 1U8MA 1J9CT 4HDIA 3KYKL 1Z6JT 5DD5H 3KPSB 4U1IB 3VD7A 3PJSA 4QHNA 2BX5A 1OHQA 2DIJA 1IEHA 2HFFA 1XGRB 4IHOB 1WK0A 3MCKB 4X7SL 2JIXA 2A6JA 1A6ZB 3ZTJG 2KBGA 5EA0H 3OPZH 2J1KA 4WUUE 5HBBA 4A6YL 3NAAL 2X9YA 3SE4C 4BZ2L 3CXDH 1NUFA 2HKHL 3CU1A 1YEGH 3K1KC 4OFIA 1BQLH 4OTXL 3RX5A 1LEIB 1X9QA 3ALWA 4TUKH 2P5WA 1VKXA 3PP4H 1YNLH 5CJBA 3TYGL 4HWEL 1AQKH 3SO3C 2BCKA 3MUGB 4LPTA 1HQRB 5GGUB 1FGNL 4M62H 1RUMH 5ACZA 5T3ZL 5GZNC 3OXSA 5FYJL 2HMIC 5EFIB 2PO6B 4CJ1A 3HE6D 4J6RL 3K4AA 4I48A 2GW5A 4NFBA 4X7TA 3VXTB 2CXKA 1U3HD 2OSLA 3C09C 3NBNA 3BSZL 4HGKC 4ZQKB 5BRZA 2P47B 1MCBA 3ARBB 1KXQE 5D1XD 5C0AD 5EU7E 4DVBB 4HK3N 3H42L 3IFLL 3CFDA 4YFLF 4O00A 2XPGA 2CKNA 3UJJL 2UY7A 4OF5A 2R0LH 5IBUB 3BW9B 2DQJL 4EVNB 5AAWA 3JBG7 4Z7VB 4FFZH 3BT2H 3OB0K 1PZUB 3N1GC 5I30L 4LK4A 3OWEA 5D7JD 5DD6A 2IMMA 4Z6AT 1S7WA 3P0GB 3G5XB 2Z8RA 4AY0A 1NC4B 4LEXL 1TQCB 4HBCH 4RQQA 4HW6A 1X6NA 4Z7VE 5H37H 1LO2H 2QHLA 1Z9LA 4P2OC 5T3XL 3P4MB 1ZK9A 3HCVA 1B0GA 1OT1A 3X11A 1EO8H 3F7VA 1EHXA 4N1CA 4X98B 3EJZC 5FGRA 2ESVD 3OHXB 1KUMA 3VFWA 4OT1L 1U8LA 5E5MB 5FHAL 4H8WL 3QO1A 4JFHD 4PJ9A 5IBTL 3I85A 5KSBA 2EIZA 3GMNB 3QAZC 2R4SH 3HC0B 4G3YL 1P1ZB 5SX4I 4HJJH 4JRXD 2DYPB 3FZUC 1VGKB 3ARGB 1I1YB 4HJ0C 4WI9A 5ERWA 3KPSA 4U1IA 3BD4A 5TDPB 4P57B 2FD6H 2NPLX 4YUEL 2MCG1 2MWCA 4FFWD 5F96H 2LV4A 1XGRA 4PJHB 4IHOA 1TFHA 3C2SA 3MCKA 1N6VA 1NAKL 2ZWLT 4K55A 5HPMB 1A6ZA 1RIHL 3V2AR 4O51B 5F7KC 1O7SA 3DX9B 4PTTB 1HHHB 1ES0B 4Y8AA 1G7HB 3SN6N 2X7LB 4NBYB 1P4LB 5J12B 1EGJH 4ZTPL 4PJHE 1LEIA 4HFUH 1HI6B 3M1BB 2YD3A 1HH9B 4EI5C 2CDEB 1G7MB 3VA6A 1JMZA 4M00A 3U48A 1MI5E 3VG9C 1CCZA 1EZVX 3MUGA 3QUYC 1AE6H 4YIQB 3QEQD 1HQRA 5GGUA 2HT4D 3GKZA 4MD0B 4WI7A 4OF0A 4MXQD 32C2B 1EVUA 2VLKE 3GKWL 4E41D 5EFIA 2PO6A 1D9KD 1T04B 5DD1H 4JVWA 4PV8B 3GSWB 3VXTA 3SOBH 3QIWB 4N1EA 2GAZB 4ZQKA 4NZTL 1HZHH 2BRRH 3L3GB 3ARBA 4FQCL 2MKLC 1IC7H 1DE4B 5TE6L 3LKRB 3D0LB 3SO5A 4DVBA 4HG4K 4H20L 1GC1L 5F9OL 2YZ8A 1IRAY 1KCLA 5CJXC 2PTUA 2ICWI 3BW9A 4EVNA 3UTTD 3T1FB 3QG7H 3ULVC 5CMAB 5ITBH 2NX5E 4TTDD 5BS0B 3ULUH 3L5HA 1HCFX 2IBZY 4U1NA 3G5XA 1XF4B 2ZG1A 1Q38A 1YC8A 5KSAC 3TPUB 1NC4A 4Z76B 5I16B 2H1PH 1EFXB 3RI5K 1YQVH 3VRLF 4ONOA 5KS9B 4XX1E 3WJLC 2R0WH 2V5RA 4U0QB 3IETB 3P4MA 1IAOB 4K8RD 4M6MH 2PYFB 4BZYA 5BS0E 2V6HA 5C70A 1MPAH 4KTDH 4X98A 4G7YH 2VR4A 3BAEH 1WIPA 3OHXA 4FG6D 1KTRL 4I0CC 5E5MA 5CEZE 3GMNA 3L5JA 3HC0A 3IS0X 4OFPA 5F3HB 3A6CH 3EDDA 1FSKC 2DYPA 1VGKA 3HPLB 1EBAA 1U8HB 4LMQE 3ARGA 1ZEAL 4R0LC 3VD9A 1F45A 1I1YA 2MPAH 2DQIH 1XGTB 1CD9B 3SKJL 2WAHA 3R8QA 4YDJB 4RX4A 1CIDA 5TDPA 2J88H 2N7BA 3DSFH 4HQQH 1ZHLA 4N9OB 4PJHA 2FHCA 3PHOB 1LDPL 2QJDA 5HPMA 2I60L 5KTEH 2EXYD 4G6ML 4O51A 2IADB 3DX9A 1TVDA 4PTTA 5F9DC 1HHHA 2W59A 1ES0A 1G7HA 5HGHB 4PD4K 5HHXL 4F9PA 1OAZH 1GZPB 1TJIH 2X7LA 5EBMB 2YD7A 1P4LA 1HI6A 3M1BA 2UV3A 1HH9A 2VLRB 2CDEA 5GS0H 2QQQA 4QGYA 3LEYH 2CUIA 1S7XB 3RUGB 1X44A 3BKJH 4AJ0A 3V52L 2W9EH 4EUPB 4YIQA 5DMIH 4KV5E 4GAGL 3D2UD 3GHEL 4V1DD 1GXEA 4XCEB 5KZCB 1AJ7L 3C87A 1IEAB 4MD0A 4RFOL 32C2A 3SGKC 1HQ4B 3HAEH 1J5OL 4PB9H 4EN3C 4XMPL 1T04A 4NWTH 3EYVB 3GSWA 2XTLA 1U8JB 3RUGE 3QIWA 2GAZA 2ZSWB 4I77H 3L3GA 3LVEA 3TBYB 2P24B 4R2GC 5HHNB 4GG8B 1DE4A 3LKRA 3D0LA 1M7IB 4NN6B 1NPUA 5GGSA 1KJ2L 1EEYB 1BVLB 1YMME 2JELL 2K3TA 1UWGH 4L8DB 4NCC2 3T1FA 1UM6H 5CMAA 1P6AB 2JJTA 3U36B 5BS0A 5DHYB 5LCVL 4AMKH 2HLAB 3DETC 5D5MF 3VRJB 3LOWA 5JPMB 2VDLH 1XF4A 4R8WL 3WD5H 1J1OL 4U1MB 1UACH 3TPUA 3SGDH 4XPAL 4Z76A 5IB2B 2Z31D 3MV11 5I16A 3E6HB 1EFXA 3TT1L 5KS9A 3GK8L 3KPRD 4JO3H 4R96B 3O6KH 3IETA 4NN7C 3F58L 3UTPD 3SGJA 1JI2A 2PYFA 4U49A 3L3JB 2AJXH 4FZEL 5IESH 4BELD 1OSPH 3BMVA 1NCAH 4P23B 1XH3B 1R24A 1U41A 1A6TB 1U36A 1DQDH 4AEHL 4MQXC 5EU4B 2CKBH 3T2PA 3DXAB 2HTKC 4QRPB 5H35A 1F4YH 2VOTA 3GSQB 4PY8J 4X4XB 4DEPB 2BJMH 5J3HC 3SKNB 1CFNA 3D3VE 5F3HA 3CVIL 3MX0A 2VDPH 4GLRI 4X6DF 4ZTOL 3RQ3A 3HPLA 1IAIH 3E3QC 3IU4L 1U8HA 5INCB 1JPSH 5ENWB 1XGTA 3FJTA 1HYRC 1XR8B 2PYED 3LQMA 3RGVD 4AEFA 4LARL 4YDJA 1G6RL 5DK2B 3MLWH 1UENA 2W0KA 3DXAE 3GMRB 2R0ZL 4QRPE 2EDJA 5JOPE 2IF7A 1UKSA 3VA2C 2OZ4L 2XY2A 3HN3A 3PHOA 4CN4A 2ENSA 2C5DC 2FECL 4KDTA 1C5BL 4Q58C 3E8UL 1ZVHA 1FFQA 2EDHA 4N0FB 4DN3L 2IADA 1F4WH 4H88L 4JO2H 2XWBB 5FM5O 5L7XH 3L3HA 3GSUB 2Q3AA 3MNVB 1BM3H 2DQEL 4HH9B 3D87B 3FQXB 5HGHA 1JYWA 5EBMA 1JTPA 3MLYH 1C1EH 4KC3B 2VLRA 4W68A 5C0IB 2ZUQB 2WUCL 2OXGA 1IZJA 1S7XA 4LDOB 3RUGA 4K9EH 4IRJD 4EUPA 2IAMB 4M48H 4XCEA 1IEAA 2HFGL 4PJ9C 2VZ1A 4D9QE 2H32B 4E5XB 3C2AH 5DSCB 2BNQB 3WKMH 2ZOKB 2V9TA 3EYVA 1U8JA 5HI3D 1JZ6A 1JPFB 2ZNWA 4RGND 3SDYH 2EC9U 3QWRA 4ENEC 1ZLWH 2CR6A 2VKXA 1ONQB 4WW2B 1F6FB 2IANB 3TBYA 2P24A 3MLRH 1SJXA 4M8QA 5HHNA 4DW2H 1PLGH 2AI0H 4GG8A 2Z92B 3PXHA 3AREB 3FN0L 1M7IA 2MCPL 1D6VH 2IFGA 5DC4B 3Q5YA 2BNQE 4D3CL 1DBBH 4ZUWB 1EEYA 4KUZL 1BVLA 1ITCA 1R3KB 4TQEH 1BFVL 4L8DA 2HN7B 1NGYB 2IANE 3MV9B 4WGWB 3U36A 5DHYA 5IJVB 2HLAA 1G6VK 3F7QA 3VRJA 5JPMA 4MXVF 3P30L 2ERJC 4U1MA 2EKJA 5IB2A 1ZANH 4XGZB 3E6HA 2D7QA 3L3OB 4R96A 5FYLL 2O5YH 3L3JA 3S5LB 3MV9E 3LH2H 3P9LB 4LSTL 1CICC 2Q76B 3BWAB 5GGVY 2F5BH 4UB0H 3S8WA 4HIHB 4P23A 1XH3A 4KRMB 5GGSY 1CK0H 1JGDB 1A6TA 2CR3A 4LMQI 4APQB 4HULB 5EU4A 2PO6C 1RZ8B 3DXAA 2NR6D 4KVCL 4QRPA 3GSQA 4S11A 4X4XA 3SKNA 4K23L 1TCMA 4GSDH 4HIXL 4XP5L 1UGNA 3ARFB 3U9PH 1FPTL 4RMRA 1JZ3A 2J8OA 3ARBC 5KAQG 1FGVH 5INCA 5HYIA 2FGZA 5ENWA 4ZAKD 2CRIA 2QSQA 1XR8A 3EDJA 4M93C 4Y2OA 5DK2A 5JW4R 5L2KD 1IC4H 5TH2B 5FFLA 3GMRA 3QHTC 4JFXB 2KL6A 3RVUD 1FHGA 4RAVB 3O0RL 1RFDL 3HB3C 5MEND 1GGBH 4N0FA 1FLRL 1SBSH 2Z8VC 3MNWB 4QRRB 1T89C 2XWBA 1EHLL 2NYYD 3GSUA 1V7MH 3OAUH 4TSCH 1RULH 2Q3ZA 4HH9A 3FQXA 5FV1L 3V6FA 2E9BA 1BBDL 1TQCC 4P4KB 1H3TA 1D5IL 2O61B 3H8NA 1ZTXH 4KY1H 5C0IA 5DJ2B 5D1QB 3ULUF 2IPTH 5E1AB 2E9IA 4KAQH 5JXEA 2XA8H 1T7YA 4QRRE 1L6ZA 5E8EB 4FQJL 3D69A 1N3NB 2IAMA 12E8L 2AVGA 4BQ9A 5IFHL 1GAFH 2VYRE 2CK2A 1JBJA 1R3IH 1H3VA 3FT4B 2EO1A 3KR3L 4K71B 2H32A 4E5XA 5DSCA 5HYJD 1QUNA 2ZOKA 4HIJB 1FCCA 1JPFA 4WW1B 2N56A 1Z0MA 4R97B 3ARGC 4NCDA 3DVNB 1WBZA 3GMQB 2YD4A 6CGTA 4WW2A 2IANA 4U7MA 4DFIA 2F5AL 2YKLL 4YGVB 2ZP0T 2Z92A 3AREA 2IH3B 3KJ6H 3BEVB 3SGEI 3V5KB 4CN6A 1UYWH 1CLOL 4FQLL 2LU4A 4LVHC 1RZ7H 4HWBA 1ZLVK 1F90H 1R3KA 5EORH 4XWOD 2HN7A 3V4VH 5IGXL 1NGYA 2QV2A 3MV9A 1X4YA 4ZXBD 4C56D 5IJVA 1KTDB 3RVWD 1NGXB 5F9JB 4P49A 3F12B 1U91B 2DQHL 4XGZA 4RIRB 2X4UB 1AGFB 4DJMA 1RK0B 4N0UE 3L3OA 3SEPA 4U31A 1MFCH 3S5LA 3P9LA 1MHPH 5F7EH 2Q76A 3BWAA 4P3WA 1ORQB 4G6FD 3S97C 4PJIB 4HIHA 4OB5H 3NCMA 2Z4QB 5DUBB 1JGDA 2DL9A 3MA9L 4M1GL 5EOCJ 4APQA 5IOPB 4C4KT 1CXLA 1MCWM 1RZ8A 3MGOB 2H45A 5IHBA 4PJBF 1MRCL 3QIWC 5J89A 3GRWA 1IGMH 4KJQD 2KZ1B 5I1HL 3R1GL 4PJIE 5JZ7D 1P7QD 4NQEB 3FL7A 1OGAE 2BSTB 5TH2A 1BQUA 3BIBX 5F6IC 1IGCL 5D6DA 4JFXA 5EIQA 3U1SH 2HFEB 4XNYH 4QOKD 4RAVA 5F7DB 2JJTC 3W11C 1NFDE 4NM8H 5FKAB 3MNWA 4QRRA 5KVGH 3LRGA 4NQEE 5I76B 3G5ZB 2GJ6A 2BDNH 2CRZA 3RWGB 1Q72H 1WAAE 1L7IH 4P4KA 1RJCA 4JFEE 4NUGH 3VGAB 2O61A 2HT3C 5GHWL 4HXAL 2Z8SA 3NPSB 5DJ2A 5D1QA 3SGJC 5SX4H 4K7PL 4LOUC 4P59H 3WIIH 4DTGH 5E8EA 2ZCHH 1NGWB 5BVPH 1KCKA 1N3NA 4X6EB 3AROA 4TTGA 4GFTB 4TPRL 3ZT5A 2I27N 5GZND 4BFGA 4PJAF 3FT4A 4UBDC 2HMID 3EOTH 2EDEA 3UO1H 2F53E 4EKXA 2XZQL 3W81A 1R5WB 3F6IA 1JWUB 2BY3A 2VDRH 2RJMA 4HIJA 4JO1L 5KSVB 4LSSL 4WW1A 5F88B 1MWAB 5DQDH 3ZO0A 3DVNA 3GMQA 3HZYB 5CD3B 2FBOJ 3O2VL 2CK0H 4YGVA 3S4SB 3WNNA 3CX2A 1N6QL 2AK1L 2IH3A 3BEVA 1IQWL 1I7TB 3V5KA 4N0YH 1C7TA 4MHHG 1E4XH 4R26L 4OQTA 4KDTC 4R4NC 3BVNB 4PJFF 1A7PL 1MAMH 4I0PB 4PGBB 3OQ3B 3VD3A 1W2KT 4JDTH 4MNGB 1IBGH 4LU5L 1KTDA 1X4ZA 4LVEA 4UIKH 1NGXA 5F9JA 2IBBA 3QDHA 4Z7OE 4X8XA 3F12A 1U91A 1YJDL 4XPFH 4R9HA 4RIRA 2BHUA 2X4UA 1AGFA 4R7NB 4P2OD 1RIUH 4M43H 3EJZD 1ORQA 4DK3A 2NZIA 4G9FD 4PJIA 1UVQB 1S7TB 2Z4QA 5DUBA 3O6MH 3QDJB 3MGOA 4KPHL 3PWPB 4XP1L 4Z7NE 3FZUD 2YPLB 2XIDA 2LAGB 4HJ0D 1FFNB 4NN6C 3PWLA 4OZHB 1WAAA 2BSTA 2CJUH 4OLYH 1XF5B 1AY1L 3PWPE 3OF6A 2YUXA 4CMMB 2HFEA 2OTWB 4XNUH 2YPLE 5F7DA 2VDQL 2V17H 4AZ8A 5B38G 5FKAA 3WJJA 5I76A 3G5ZA 2IEPA 3VXRA 4OZHE 3RWGA 2MQ3A 3ZDXE 4EXKA 1KGCD 4KI5E 3MJ9A 4OGAC 5I19L 1QO3B 4EI5D 3CDYA 1AD0B 4I2XA 5IFJB 3S96B 2B0SL 3KPNB 3FCTA 3QUYD 4Y4HB 3UZVB 2X40A 1DBML 5E6ZA 2A1WL 4P23C 4X6EA 3HUJB 4O9HL 5KSUB 4I4WB 3RZWA 1RU9L 4Y19D 3ZE1E 2X41A 3LRHA 1UH2A 4DEPC 2WBWB 4WFGD 1KV3A 5JHLH 5KSVA 3BKYL 3MGTA 1WFTA 5F88A 1MWAA 3GUTB 3HZYA 1TLKA 5CD3A 4PJDB 3S4SA 1RHFA 2LU7A 2FCBA 1JYNA 3FFCB 3BMWA 4XB7A 1I7TA 2JCCF 3PGFL 5I1KH 3KYAA 3BVNA 3ULVD 3C08L 4I0PA 4PGBA 4DUWA 3QIUB 4PJDE 4AK1A 3RNQA 4MNGA 2B1HL 3N85L 1HHIB 3R4DA 3QXTA 5KSAD 3IT8D 3D39B 2YD9A 1EIBA 4NP4L 5GJSH 1HHKB 1OOAA 2ZUQC 4FABH 2C7UB 4R7NA 5C2BL 1RUPH 4EOWH 1Q1JH 1RJLB 5JXEC 2CLRB 5JOFB 4HPYH 4JY6A 5I75B 1NCCL 4HCRA 1J87A 2B8OT 3ETBF 1UVQA 4IDJH 1S7TA 1RJYB 5E8DH 1A0QH 5DRWB 1DUZB 4F57L 5LXGL 1OB1B 2X1QA 3QDJA 1FP5A 5ACLA 5T5NF 4L5FH 1I1AB 4RMUA 4X80H 4CVWA 2X4TB 3PWPA 1INEH 1HEZB 5EZOH 3TNNB 4MAYB 1NCWH 3U0WH 2YPLA 3EFDH 1CGSH 3CX5J 4WW2C 1A7NH 1S7QB 5LBSL 2NXZB 2YC1B 4Z7UF 1FFNA 1HN1A 3RJDA 2EEAA 3SE8H 4OZHA 2W0PA 1KTLB 1XF5A 5ANMB 3J8F7 1E4KC 4CMMA 2OTWA 2GUOB 4LSUL 4RGMB 3ULSB 5DD3L 1GOGA 4C4KO 4B53A 1JUFB 2DQFB 4FOMA 3TZVB 2EYTB 3HG1D 4QHUB 1DLFL 1WFNA 4MQSB 1WZ1L 2YOCA 2FGWL 1QO3A 1AD0A 5IFJA 3S96A 1N8ZB 2GSGB 1BQHB 3KPNA 3L5WB 1T03H 4JQIL 1A7OL 4GLRH 4Y4HA 1VFBB 4YO0B 4P9ML 1KNOA 2VXSH 4TULH 3HUJA 4PJGE 4I4WA 5KSUA 4APQC 1ZVSB 3DIFB 1T2QL 4Y16B 2OR9H 4KKBC 4J3WA 4MLSA 5JQ6L 4EN3D 2HJKB 5C0EB 3WYRA 4I3SH 3BESR 4OM0L 5ISZB 3ARDB 4UTAL 1BZ7B 3P4LA 3V6ZB 1BZ9B 5DJXB 3KJ4C 1T21B 4HV8A 2QL1A 3GUTA 5LGJB 4R2GD 5ILTH 1W72L 3DX8B 1J1PL 1YC7A 5D6DC 1BECA 4K7FB 1FH5H 3FFCA 1E6OH 3TVMB 5SWSB 2JIXD 3MRIB 2ZCLL 5ISZE 3EO1B 4ZUTB 2A6DB 3QIUA 4BSWB 3DETD 5DMKB 3VFVB 2EEDA 4NWUL 1HHIA 4MMXC 4N68A 2FLRT 4P4KC 2LTQB 3WFZA 3D39A 3NIFF 4DKFH 4J3SA 1DL7H 2JK5B 4XPGH 2P5WD 1HHKA 5DFTA 5D1QC 1MCKA 2C7UA 1JPST 5E8PB 1YEKL 1RJLA 1EO5A 1FZMB 2CLRA 2J8UE 5EO9B 3NFSH 5JOFA 3JV4B 1PJ9A 2DOCA 2NY7H 3AS3A 5ALBH 4LAQH 4GRWB 2E7MA 5E5UB 4P46C 3ZDZF 1JGUH 4BFEA 4MQXD 5KOMC 5DRWA 4K71C 1DUZA 3GSVB 1OB1A 5HHME 2VIRB 2VH5H 3PV6B 5J3HD 1I1AA 2X4TA 1HEZA 4JFFB 3TNNA 5BRZD 3VDBA 4MAYA 2APWA 3MRQA 5EC2B 1G9MC 1CXKA 4U6VH 1S7QA 2YC1A 4ODTH 3WIHA 1WFUA 4UMGA 2YK1L 4JR9L 5DS8B 4FQ1L 1KTLA 4KVNH 4F9LA 3TF7C 5ANMA 1I9RH 1OTTC 4JFFE 5D7IF 3GJFK 5CEZH 3TT3L 3QCUL 3ULSA 1YPZB 4YDVB 1JUFA 2FDBP 2DQFA 4Y7MA 4M61B 2RGSA 1XGYH 2EDKA 3TZVA 4DVRH 2AKRB 3L5XL 3WDJA 2EYTA 4QHUA 5CFHA 4NO3B 5BMFH 2YA1A 5TDOB 5IHUH 5LGHL 2ICES 1CFVL 1N8ZA 2R1YB 2GSGA 5JW4Q 2W9DL 1BQHA 3L5WA 2VLLB 4POYA 1VFBA 4YO0A 2D4DA 3S34H 3PF2A 5CSZB 4Z5RB 4HC1H 1K2DB 1ZVSA 3FHAA 1ADQL 1MJ8H 3DIFA 4PJ9D 4RBPH 2KUTA 2HJKA 1MFAL 4XXDA 5MEOB 1UCTA 4OIIL 3Q2CA 3VGFA 1KJ3H 3ARDA 5ISZA 1BZ7A 3V6ZA 1BZ9A 5DJXA 4BUGA 3QPXH 1T21A 1SVZA 4ENED 2J8HA 1CL7L 5LGJA 3KPSD 1QSEB 1X5AA 2IFFL 2BXZA 3U7YL 3DX8A 3ZE2F 1L7TL 2GT9B 3K8KA 4NZDA 3TVMA 3TBSA 5SWSA 4UV4L 3MRIA 3E2HC 4IJ3B 3EO1A 4JRYD 2CIIB 2ZKHH 2O5XL 3WJJC 5F89A 3GBLA 1I3RB 4ZUTA 2A6DA 3SE3A 5DMKA 4BSWA 1QSEE 4PJ5E 1IC1A 3VFVA 4EUPH 4OFDA 2Q86B 1WC7B 2F9BT 5C0GB 4PLJC 2HTLC 2JK5A 4KKNA 4UV7L 2P46B 4H1LH 2P42B 3RAJH 3MLUH 5E8PA 2NY0B 2FHBA 3OB8A 4HUKB 5EO9A 4DCQB 1CICD 3JV4A 1MCHA 3HFML 3RRQA 1P4BH 4YPJA 2LABA 2VB5A 1QQDB 2AJZB 3PGCB 3VFGH 2PO6D 3IJHB 2X44D 3GSVA 3T77B 5KSBF 3O6LH 2VIRA 5C0FB 3PV6A 2QQLL 4MCZB 4JFFA 4WWID 4R3SA 2JJSC 2WWKT 4U2ZA 4X99B 5EN2B 3VXME 1T66C 3T2OA 1QLFB 2GEEA 5EC2A 3ARBD 1KB5B 1DQMH 3KDMB 5I1GH 3R06B 4LCIL 3CVHH 4TRPH 2NY4B 5DFVC 2QR0B 4TVPE 1NMCC 5F6HJ 5GRJL 3VXUB 1F97A 1W8OA 3A0OA 1B2WH 1DBKH 3DGGA 4NC1E 4Q2ZB 5DK3A 4I0PC 3HB3D 5FA4B 3W9DB 4ODVH 3N1MC 5JW4M 4GRMB 1MRFH 1YPZA 4YDVA 1C08B 1V05A 3AS2A 2EDYA 4WWKC 3OKYA 4M61A 2AKRA 1NC4D 1UB6B 3IF1B 1LGVA 1XF1A 5EU5B 5TDOA 3VXSE 4OLVL 3ZKSD 3JWOC 1MIML 5A2LH 4J2XA 2R1YA 4GQPH 4XP4H 1XF2B 5LQBL 2VLLA 1KBGH 4LCWE 4MJ6B 3HC3H 3LN4B 4PGCB 4BQ6A 2GY7B 3VW3H 3BP4B 1QRNB 3ZT7A 1XMWA 3BIAX 4NKQB 5CSZA 4Z5RA 4YDKL 1K2DA 1CR9H 4LPWA 3ZYOA 4ONGL 2AS5M 4JE4B 4NRZB 5MEOA 1MREH 2DDQL 2W91A 5EOCL 4GKNB 2DYPD 3OG4B 3BPCB 3QYCA 2DD8L 15C8L 1NMAL 3ARGD 1IGTB 5IHZB 2YA2A 4S1QH 1F11B 4N8PA 4DGYL 5GPRA 4PRNB 1QSEA 4RX4D 4G43B 1J86A 1PYWB 4CNIB 1OP9A 1DQTA 2GT9A 4ZFFB 1JWMB 4JZJC 4Z7VF 4LGSB 2CIIA 5IT2L 3RWCB 4HKZB 1I3RA 1KEML 3S3JA 3VU2A 1N4XL 2FX7H 5F1IB 4PUBH 1LDSA 2Q86A 2H41A 3CFKB 2F8XC 1M71B 1WC7A 5GIRB 5C2UB 4YC2B 5C0GA 3OKDB 2E8YA 4LLQB 1CZ8H 4FFYH 3WFEL 4AIOA 1PEZA 2H32H 25C8L 4Y4HC 5BW7C 4DCQA 1EVTC 2EKSB 1T4KB 4MGXA 3OZ9L 4TYUA 3VFSB 4A2MA 5J1AB 3ZTJH 2DLFL 1QQDA 2AJZA 3PGCA 3IJHA 3S88L 3T77A 4JHAH 5C0FA 1KB9J 4S1DC 3QIWD 3RZCB 5J9PB 4MCZA 4JN2B 4MDIB 4HS6B 4MX7B 4OV6F 4FTVE 5EN2A 4X99A 5CBAB 3I9GL 4J7RA 1KB5A 3KDMA 5C8JB 3QP3A 3R06A 4ZD3H 4XMLH 1A5FL 5BCAA 4XXCC 4WVRA 1GHFH 2QR0A 4YBLC 3VXUA 4BZ1L 1EK3A 1MELA 4PJHF 5E6IB 5EUKB 1KYOJ 3RWDB 4Q2ZA 4OLUL 5FA4A 3QRGH 3W9DA 5BS0D 5KVDH 3W11D 3QIUC 3QXDB 4JKLA 1N7MH 4GRMA 4F15B 1FNLA 1C08A 3MRFB 4FQIL 4RWYH 1N64H 2C3VB 1UB6A 2DMCA 2J2ZA 1JJUA 4HF5H 3IF1A 5IR1B 1ZLUK 5CEZD 5EU5A 2HT3D 2WBJA 4XBEL 3BKCL 2XZAL 1XF2A 1KLGA 4ERSL 4MJ6A 4LOUD 5I75C 3LS5L 2OM5A 3LN4A 4PGCA 5JMOC 4P0DA 3BP4A 1QRNA 1HYSC 3SPVB 1U0QA 3CXHK 4WHCA 1T7ZA 4UBDD 5JPNB 2ATPB 2EIEA 1I1AC 4PIRF 3C5ZB 4NRZA 2X6MA 1Z9MA 4MAYC 4GKNA 3EOBB 4JG1H 3BPCA 5C0CE 1OARL 2YSSB 1IGTA 5IHZA 5F93C 1F11A 4YHML 4PRNA 2XRAL 3PE9A 1BIIB 4G43A 4CNIA 1PYWA 5I1CH 5FHBH 1GGIL 4F9LC 2VQTA 4ZFFA 1JWMA 3HNVH 4R4ND 2OS7A 4WTZG 4O2CB 4WDIB 4JRWA 5FAAA 5DJCB 5HVFB 1F8TL 1XIWC 2FYYA 2QHRL 4QXGH 3RWCA 4HKZA 4LRIA 4ONFL 5F1IA 2F54B 3RBGA 2CLVB 4GUPB 2OJEB 2WIIB 4HKXB 3CFKA 5GIRA 4UT6H 3OKDA 5MEQB 4LLQA 2VLRD 4CJ0A 4JKWA 3EZJB 3GI8H 2GJJA 3K2MC 5EZIH 4HD9A 4KMTL 1VEPA 3D1MC 1MCEA 3CLFH 2A6IB 2EKSA 2F54E 1LO4L 1T4KA 2UZIH 3Q6FB 3VFSA 1QR1B 4ODHH 5J1AA 1A6VL 1G9MH 3HHRB 1DBJL 2D3VA 1LWRA 3U9UB 4UNVA 2LE9A 5J9PA 3ARDC 3RZCA 5M95B 2OJZL 4JN2A 2XWTA 4MDIA 4HS6A 3QWRD 5CBAA 4P2RB 4MHHI 3LSOB 2Y06L 5A16B 5C8JA 5K9JH 1N5AA 3P9WB 3RWHB 1FG2B 3TVMC 3IU3B 4WCYH 5E6IA 5KVFL 1FVEA 1GZQA 1IE5A 5EUKA 4S1RL 3RWDA 3HI6L 3QUML 3UCRA 4JHBA 4P2RE 4YHLH 4AQ1B 5LWYH 4WEBL 1S9YB 3QXDA 4JKKA 5CZVH 4OCYH 5T3ZE 3L1OL 4LHUD 4N8CL 4KV5F 5A2FA 3MRFA 5FYJE 2LTQC 5EBWB 4OCSH 4X9FA 3LHPL 4KJPC 3CX5K 4OGAD 5IR1A 3G04B 2D4FA 3SDCB 2EE9A 4KTEL 1EAJA 3D25B 4NM4H 4HUVB 3WFDH 4YXKH 1F3JB 4K2UH 5BV7B 3RUGF 1ZHKB 4FFVC 1FYTD 5AG9A 1MH5B 1U3ZA 4Z7WB 2V5TA 4P23D 3SPVA 5B39G 1JGVH 3RU8L 2WLYA 2J6EL 3RHWF 5HHQB 1YEJH 3ARXA 1PX4A 3DXAD 5IB3B 1U2HA 4U3XA 5JPNA 2ATPA 1AD9B 5JHDB 1J8KA 1WWBX 3NA9L 3C5ZA 2EECA 4W81A 4L3AA 1OLLA 3EOBA 2OL3L 4P3CH 1T0PB 2YSSA 3NVQA 2VISB 4Z7WE 1CE6B 1RURL 1RY7B 2P49B 1AO7B 4U1SB 5DZNA 1JPTL 2PR4H 3GO1L 1P9MA 4K8RL 1BIIA 4P4RB 1Q9WB 5DUPL 3H6JA 3ME0A 5T3XE 5JHDE 4IRZH 1MCFA 1UM4L 3Q3GB 4L8SB 1KFAL 3PDDA 1MJ7L 4K94C 4Q0XL 2Z93B 1YUHB 4O2CA 1QR4A 4WDIA 3HNTH 5DJCA 1LO3H 5IVNA 3INUL 1AO7E 5C0RL 2F54A 4WRLA 2CLVA 4GUPA 2OJEA 2WIIA 4HKXA 4H26A 2PXYB 4D9QD 2E6QA 5MEQA 2ARJQ 3U4AA 4OCRL 1RUKH 1CS6A 3F7YB 5JXED 4OD2B 4OGXH 4D9RD 5FYJU 3RA7L 4MJ2A 2A6IA 5GRUH 4HMCA 3Q6FA 3QA3B 1MWAH 1CLZH 5L0QB 5AWNH 4CRPA 5E70A 5D2NB 3FQNB 1SQ2N 4L4VB 5JIHA 1S5IH 5T1DH 3U9UA 5KVMC 3B83A 1MQKH 4DKEL 4MA8L 3DMMC 1C5CH 2AEWA 1I9JL 3KGRA 1V3JA 3LS4H 2VC2H 4P2RA 5IB4B 2HVKB 3LSOA 2WP3T 5A16A 2ZJSL 2VR5A 4L4VE 1YEGL 3RWHA 5D70L 1FG2A 3IU3A 3NN8B 1OP3H 3DYMA 5F1NB 4IJ3C 3MLVH 5I1EL 5KJRH 3GSNB 4KJYB 4HUNB 2VZSA 1YNLL 3MV9D 1S9YA 1H3UA 3JWOH 1XR9B 2HKFH 1NL0H 3C60B 2BVQA 4X83A 4LCUB 5EBWA 4HCRH 2VXQH 1RUML 2I9LB 2NCMA 5TPWH 4H0GA 3G04A 3SDCA 2XQYG 1EMTL 3FMGL 3K81A 3WIFB 4HUVA 3D25A 1HINL 3QR2A 2NY0C 6FABL 1F3JA 5BO1L 4U1GB 3S37H 1ZHKA 1MH5A 5F1KC 4Z7WA 3X3GH 2PETA 1GGTA 5JOEA 4YH6A 4APQD 1BVZA 2RCSL 5HHQA 4U33A 5IB3A 4KKBD 1I8LA 1AD9A 3Q1SH 2R0LL 3TO2B 5JHDA 2ZUSA 5JW4N 3LQZB 1ZGLP 3IFNH 3PL6B 3OXRB 2VISA 2VWEE 5FUZL 1CE6A 1F4AA 1AO7A 1BFSA 4U1SA 5E2WH 5DUMH 1L9NA 4P4RA 1S7VB 1Q9WA