4PLJD

Hepatitis e virus e2s domain (genotype iv) in complex with a neutralizing antibody 8g12
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
216
Chain Sequence
QLQQSGPELVKPGASVKISCKASGYTFTDFNMHWVKQSHGKSLEWIGYIYPYNGITGQNQKFKSKATLTVDNSSSSAYMELRSLTSEDSAVYYCARERFGVGNNYAWFTYWGQGTLVTVSSAKTTPPSVYPLAPTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Structural basis for the neutralization of hepatitis E virus by a cross-genotype antibody
pubmed doi rcsb
source organism Hepatitis e virus
molecule tags Viral protein/immume system
total genus 41
structure length 216
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pljD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pljD02
2VLRE 4PLNC 2YD1A 1K8IB 1FLRL 5T33H 1JGEB 5JW4M 1L0YA 3RWEB 4TNWK 5D1XD 3UEZA 1NDGA 3BW9A 5HYSB 3F7YA 4TPRH 4XWGH 1C5DB 1EO5A 4X7TA 3BPLB 3QEQE 4X9IA 3UJJL 3BUYA 2NXYB 4PPTA 4GAYB 2ICWB 4ZNCD 4GSDH 4EUPA 4IMLA 3IFOB 3DUUB 3MOBH 4CVXA 3VXMD 3GJEA 1IAOA 5FYJU 1GGTA 3AAZB 1LK3H 3O3EA 3JWDL 3MRBA 1Q9KB 1JNHB 2AK1H 1S7SB 4OLYH 2DJUA 3PWVB 3IT8D 3LN4B 1D9KB 5L2KE 4XTRD 5E8NB 4E5XB 4J4PD 2D31A 1PLGH 3HCVA 3VGDA 2UUDH 4YIQA 2ADJB 1OARH 5KSBB 4P2CG 3F65A 3U82B 5FA4A 1RZ7L 4ZPTA 4IMKC 3ZKMD 3TNMA 3UO1H 3TIDA 1DUZA 4XCFL 4XXDA 4JFHD 4PY8I 4HEME 3TC9A 3TZVC 3CLFH 1MCBA 1D6VH 4G80A 2EICA 4PRPD 3LKSB 3ROOA 3EYUH 1VKXB 1HOCB 1MCSA 5DJ0A 4LLYB 5KAQF 4F33B 3IXAB 5HBBA 3IDIA 1BQLL 3BP5B 5EUOB 4XAKE 1XF2A 1CGYA 3UP1A 4EOWL 4LRIA 2D0GA 3D1MC 3HE6C 1A8JH 3LEVL 4NM8L 2Y5EA 3U36A 5JPMA 2BXYA 3A6CL 3HMXL 3WIIH 1RZJL 5DRXA 2EC9U 3T0EB 4IJ3B 4MAYB 1JHTA 2ED8A 2QADB 4U1IB 3BN9D 1CLCA 1Z0MA 3RY4A 1NCDL 1HZHL 4KUZL 3CFDB 2Y06L 2A9ML 1MUJA 5HHQB 2F58L 5C0BB 1U8NB 2NY6B 2OK0H 1A3RL 1J0JA 4JPKH 3EDEA 4C54A 3NBNA 4HWBH 2YWYA 3IVKB 3LQZB 4HWZA 4U6XB 3EYFA 3EO9L 4BYHA 1RQ5A 3BIKA 4XHJD 1NBZB 5ECJE 2XACC 4D9QD 4ZD3L 1NC4D 5ITFB 4ORGB 3HNTH 1A7NH 4MJ5A 3D0LA 1D5BB 3HE6A 2IPUK 2DMKA 4FFZH 3FFCB 3SDYL 1P7KA 4KV5F 1T89A 4NWTH 5GJSL 3MLVH 4APQC 5FCUH 4P4KB 1FZKA 1QSVA 5D7JB 4K7FA 5CZVH 3BVNB 2MNUA 4Y19A 4K71C 5HDLA 4NHCL 1CFNB 4LOUD 3MMEA 4LSVH 2NY1C 3EYOA 4X6FB 2AXJA 3TO4A 3UXFA 1GC1H 3G5ZA 1A3LH 4DK3A 2YC1A 4J7RA 4PTUA 1R3LA 1OM3L 2BSSA 1KEMH 4G3YH 1FO0H 4PLKD 3BDXA 5FF6B 1MIMH 3BOVA 4NNPH 1JPGB 3T4YA 2W9EL 4ZQKB 4JFYA 1YY8B 3ZDZE 1HHIA 5E6ZA 1N6QL 5ABDE 3CUPB 5DFVD 3QR2A 3G08A 5E8EA 4WJ5A 1GGBL 1S3KL 2NY0B 3FCTA 3R8QA 5JOPE 1MRCH 1S7VB 5LGJB 3QEHB 2DM4A 4HS3B 2K7PA 4UT6H 2PUQT 4YR6B 4NZTL 1JNNH 3C5JB 3K8MA 4NQDA 2VH5H 1B88A 5I19H 2ZCHL 2FB4L 4K55A 2YA2A 4ZUSA 4NFBA 4R8WL 3OG4B 4HHAA 2IPKA 5IV2B 5KANG 5C0JB 4GBXB 1E0OB 4WGVB 4JKWA 1WBXA 1CBVH 3LMJH 1NAMB 2BC4A 1ITCA 2R56L 3MRRB 3UZVB 1KB5A 4JO2L 4ZUVB 5C0EB 5I17B 3GSQA 4PV8A 2IAMC 5KW9L 5E1AA 5I1LA 3WFCH 1OAUL 3MBEC 1BIIA 3HA0A 5GS2D 5DS8A 3QUYB 3NH7H 2DQFA 1BOYA 1KCRL 2D7PA 43C9A 2C7UB 3HNSL 3FQXA 3VFMB 1SJEA 1JGDB 1RJCA 5EU7C 4F7CA 4NJ9L 1B0WA 4M1CD 5HSFA 3GNML 3CMGA 3DBXB 2FATL 3I9GH 2Y7QB 4U1MA 4O2EA 5K9JH 4G6FB 4KJYA 1IAKA 1MWAH 1RUQH 3P73B 4BH8A 5IQ7H 2Y07H 1QBBA 3U30C 3LKRB 5HVHC 4ODBD 2IADB 3QQNA 3T08A 4KDWA 2DBJA 4JDVB 1IZJA 3O3BB 3W5NA 2EDDA 3DI3B 3MRJA 4HJGB 1EGJA 3EGSB 5F7HA 4ZFGL 5MEPA 2A9NH 2FSEA 4V2CB 4LLVB 4M8QA 2ED7A 3N85H 4YDLB 2MJWA 5ICXB 4DKEH 5F7DB 5H94A 4MQXC 5EUOF 1NUFA 2D7QA 1YEGL 4YBLB 5EN2B 4WUUD 1D5XB 2FNBA 2MCG1 3DROA 2VLJA 3IU4L 3N0PB 4MA1B 4AJ0A 1HH6B 3HI6H 1XGQA 1CFQA 2OXGA 4DEPC 3C9NA 3IU3A 4KJWC 4ZXBA 3DRQA 2ZOKA 2AK4D 5L7XH 2IBZY 2V5SA 2X1WL 3GI9L 1NGZA 2P24B 3MROA 4JFFB 4KMTL 5IFAL 3WXWL 3BEVA 2XKNB 4ZSOA 1KNOA 1HXMA 3RWHA 1K3ZA 4HGKC 4NC0B 5LKNA 2LAGB 4Y19E 4ONHB 2XTJE 1BBDH 4GRLD 1WWWX 3MA9L 1ETZB 3HAEA 5GGRB 1K5NB 3TGXA 3MXWL 1D6EB 2FJHA 2XPGB 3RWGB 4X80H 2FX8L 4O2CB 4M61A 4W6WB 2H2SD 2W1NA 3K74B 4HV8B 5EU6D 3S5LB 1BOGB 2O5XH 1YMHA 1CR9H 5CZXD 3BT2H 4RGND 3SKJL 5JORA 2APBA 1PZUB 2CMRH 2K9UA 4MXQD 1J0IA 3R0NA 4GW1B 4CU8A 4Q9QH 4OGXL 1U8OA 3RL2B 1R0AL 5B8CB 2GK0B 4OZFB 1R3HB 2C1OA 2ARJA 2P5EB 4XPAH 3JWOH 3PWNB 3AGVA 3EOTL 4RQQA 5CFHA 2CDGB 1SY6H 4R7DA 5IB3B 4KQ3H 1SMAA 4NC2B 1RK1B 3MJ6A 1DQQB 4NQDE 3QUZB 3V5HB 4I0PD 4UILL 4MSWA 2X4QA 3W9EA 1H3VA 1ZVSB 1JK8A 3EUUA 5I76B 5LG1A 3W5MA 3RP1A 1T0NA 3OB8A 4WV1C 2JJVA 4E9LA 5TE4H 2EH8L 3RAJH 4E41A 4QTIL 1MFEL 1AXSA 4G8GD 4H88H 1MJ8H 5GGVH 4OLXL 2HRPL 4TUKL 5I6XC 1MH5B 1WK0A 5C09A 2WNGA 3TWCH 2Y6SD 5DK0B 5IF0B 5IBLD 5A16B 1QEWB 1WV7T 4LVEA 4XH2B 3VWKB 4JKPH 4F37F 1T21A 5IW1A 2V7NB 4JLRA 5BS0B 3QDMB 2CLZB 2HAZA 1A21A 3EYVB 3BP7A 3CMOL 5DQDH 1FCGA 3X13B 3ULUL 2AEQH 4PJ8D 2ZUSA 1ZLSH 3F7QA 4P23B 1BLNA 4H1LB 1PZ5A 2ICWI 1VFUA 4WV1A 5F96H 4X4YA 3DMMA 4X7EC 4PJGB 2XZCL 3D48R 5DD6B 5D4QA 2X4SA 3KPPB 4GW5A 3SGEI 4HF5L 2B2XH 2OTUB 3RPIA 2LV4A 3ULVF 4EQ2A 1U3HC 5T1LD 4XP6H 2ATPB 1LO3L 1S7UB 1P5VA 2P8PA 1ES0B 3HE7B 1BQHB 3RWFB 2IC2A 4QRTA 1AFVH 3MCLH 4PJCB 2MQCA 4O9HL 4OFIA 4JN1H 3QZWB 4FN0A 43CAB 1YA5A 4AG4L 4QXGL 3SDAB 4GUPB 2Q1EA 5LQBL 1A9BA 2Q8AL 4LDLB 1HINL 3ISWA 2E8ZA 5D1ZA 5EU7E 2VLJE 1LNUA 4M43H 2H26A 3CXHJ 5JHDB 1FZMB 3OR6B 2IH1B 3G6DL 3I2CH 3VRLE 2BY2A 1UWXH 5BZDA 1UXWB 2V6HA 4PTTA 1U8HB 3D85B 2AJZA 3X3FH 4O5LH 4JY6B 1MFAL 1TJGH 2VXTH 3QUXA 1ORQA 4ZSOE 1VACA 1NEZB 2AEWA 5IM7A 3L5XL 5DJZB 2HFFA 5I71C 1RU9H 4OFPA 4LKXB 2J4WH 1BJ1J 1MIEH 4HWUA 1UEYA 1FLTX 3D25A 1J86A 1KJ3H 1PKQB 1B0GB 2BNRD 3RI5F 3V6OC 1C16B 3W0WA 5GGQH 3QIWC 2CGRL 4A6YL 2DMBA 3BE1L 4OF5A 3ULUD 1RZFH 2UYLB 2DI8A 2XT1B 3U9PL 3MLSL 4QXTA 3AUVA 2CIIB 5D7LD 3OKOA 1BJ8A 5T1KD 4AZ8A 4WEBL 1J05A 4FABL 1UB5B 3FOMB 4JFZL 4YE4L 4AEFA 3EDDA 2OJEB 5JMRA 3CXHK 1MJ7H 5DJ2B 2X5PA 2X70A 4PJFF 1R6VA 3HFML 1A9EA 5F9JB 2BOBB 1LEIA 4RGOL 2AXGB 3M1BA 3DGGA 3JVGA 3F7VA 5T3XE 5IKCA 1DANT 3I02B 3MRGB 4TRPH 1KSRA 3NGBB 4X6CB 4ENED 4FQQA 1DBAH 5E00A 5IVXB 4R2GC 2YKLL 5HYJA 2A6DB 2VDML 2WBJB 4E41E 1Y18B 1XCTB 3BSZL 1CXKA 4MXVE 5FM4A 4U0RC 3G6AA 5D1XC 5BCAA 5T33L 3IB4A 4K9EH 1KT2A 3BH8B 4FQXB 3D3VD 3DVFA 5C09E 4U1LA 5H2BA 2IQ9H 4TPRL 4XWGL 3TZVB 3VG9C 2KQMA 5DYOB 4O51A 4OFKA 1W2KT 4GSDL 4YX2L 4R7NA 5EOTA 4Y88A 25C8H 4PJEB 2YD7A 5GRYA 2BERA 3D2UB 1YC8A 3WBDA 4WDIA 3U79A 3C6LB 3IAPA 1LK3L 4XTRC 5DQ9A 5JW5B 4OV5A 5DJYB 2IBZX 4OLYL 4J4PC 4CVWA 4HGWB 3K46A 2XOTA 1M6OA 1CDBA 5HHME 4AIXA 4O4YL 4YHMH 4WHDA 1AD0B 2D0FA 2GUOA 1IILE 4LIQE 2ESVD 2AXHA 1OGAD 1OARL 4N8PA 4YDVA 3ZKMC 5DI8A 4HK0A 5D1XA 5D7IB 3QUKB 5KSVB 1Q9LB 4GKZA 3PGFH 5IFJB 2DJSA 3UO1L 4MB5A 3UPAA 1EERB 4PUBH 4PGDB 5A2LH 3EAKA 4Z76A 3O3UN 1MRFH 4LQFH 3SPVA 1J8HD 4AEEA 3CLFL 4TYUA 4M7KH 3U7AA 1D6VL 3VH8A 2Q7NA 3T0AA 3VXMA 4QRPD 1VA9A 1PX4A 4DUVA 2XN9A 1LK2A 5DK2A 4HK3N 1WFUA 3VE0A 4YPJA 3GMPB 4QYOB 4LNRA 1HKFA 4GAGH 4PRIA 4X98A 5KBNC 1DVFB 1D5MA 3GZKA 4PJGF 1OY3B 4APQB 1ND0B 5ID0B 4ETQB 1CD8A 1T0MB 4NKMA 2CKBB 4D0CA 4X99A 5GISH 5INCA 3WIIL 2OSLA 4OQ1A 4L3EB 3BN9C 1N3NB 2NX5D 1YEKH 2HVKA 3EJJX 5JOFB 1R5VB 3K4AA 3E2HC 2EYRA 5EO0A 5EBLA 5FGCE 3WXVH 3QAZB 4PJCF 2Q76B 2EKJA 2OK0L 3ZHKA 3O3AB 4IRSA 4PRPA 4JPKL 1KTDA 3JWDC 1JUFB 4OZGA 4XHJC 1OP3H 2CO6B 3W0WE 3STBA 4QHLA 3PHOA 4V1DB 5B38B 4HUVB 4LVHB 1KG0A 1MVFA 3ULSA 4BQBA 4FRWA 2NTSP 1A6UH 2J6EA 4OLWL 3L9RB 3HNTL 2NY5L 4E0RA 1FYTB 3MV9B 4PY8J 4FFZL 1R5IB 5K9QI 5T5NF 4UB0H 1TENA 4LSRH 3I50H 4Z78B 3SCMB 4NWTL 1E4KC 5FCUL 2X41A 3GKZA 3ARGA 3IAQA 4LHUA 3QUMH 4LOUC 1YPZA 3RY5A 3CH8A 4RWYH 3LH2L 4E42B 4YPGA 5J6HB 4PJDB 4NOFA 3ZDXE 3PIQA 3JSSA 4I3GA 1NBYA 3EYSH 5J13C 3PWPD 1I8IB 1MHHB 2NY4B 1GC1L 1K4CB 4NQXA 1A3LL 5KN5A 1NDMA 4PLKC 5HYJE 3QPQD 5ISZD 3O4OC 1NC4A 1KEML 2MTPA 1FO0L 4G3YL 5GPRA 5DUBA 4ONOA 1UZ6F 4QY8B 1MIML 5HGDB 4NNPL 3SDCD 3MV11 1KPVA 1YMMD 1RZJC 3CVHB 1N59A 2HLFD 4FZEH 3E6HB 2C1PB 2OJZH 5DFVC 4NRXA 1BECA 3BPOC 3PGCA 3SKOA 4CMHC 3VD9A 1MRCL 4ODXB 4UT6L 3KPMA 2GK2A 2GSIA 1T5XB 4QT5A 4X6CF 3NFPA 3RNQA 1IM9B 1JNNL 2R29H 5KVMC 3ABZA 4J8RA 1NFIB 3QI9B 1IL1B 5IVXF 4QCIB 5I19L 4H25A 4YLQT 3CX5K 1AXTH 4S2SA 2N56A 4OZIA 1I1YA 4OCSH 1TCMA 1HNGA 3DX6A 3SDDC 1I7TB 1CBVL 3LMJL 5E2VH 1FVCA 2YA1A 3WL9B 5L6YH 1SYSB 3PABB 4JAMB 4K3JH 4Y5XC 4WTZA 1CDGA 3E3QE 4U1GC 5GRJH 3SO3B 3WFCL 4JZJC 4RBPK 3O4LB 4PJEF 5C0DB 2UZYB 2I9TA 12E8H 3VXME 4LK4A 4HUKB 4W4NA 3NH7L 3TNNA 3OKLB 4M1CC 2XN9E 4RGMB 5GSVB 3ECBA 5F89A 4QHKI 5HHNB 4JB9H 2OYPA 5C0IA 3PWLB 5FXCH 3JV4A 1NCAH 4HIIA 5C6TH 4JN2A 4PRIE 2E6QA 3I9GL 4EJ1C 1FJ1B 1SYVB 2BSRB 4K94H 1CE6A 2ITDB 1RHHA 1NH6A 2W65B 1RUQL 1MWAL 5IQ7L 1JPFB 3LVEA 1HEZB 2Y07L 1KJ2H 4K3HA 4YO0B 1ZLVH 3P2TA 5FUZH 2VMFA 2BVPB 3NN8B 1H0DB 5SX4I 4Y5XA 3STLB 3O6FB 4PJ9A 1GH7A 2HJFA 3VCLA 5F6IC 2I26N 1JNJA 4OQTH 4PRPE 2A9NL 5MEND 3QO0A 3VFSA 5SX5H 3N85L 4XNMB 4EVNA 4KRMB 4OZGE 5F3HA 2IQAB 1J0KA 2PO6D 4WWKB 4NN6C 2V2TA 4AEHH 2VZSA 5JW4N 3MR9A 1EMTH 3REWA 5DO2D 5GGRY 1AGCB 1AJ7L 1REIA 2QLVB 2Z8SA 4MMXC 1N5AB 4IRZH 1N6VA 3KR3H 5L7XL 4QEGA 3AC0A 5DJDA 5F9WB 5HDBF 4GRLC 4K3DH 1Q0XL 1YPZE 2NPLX 3EIFA 4NHUB 1WVZA 4BZ1H 5JDSA 1BBDL 2DN7A 4ODSL 3MZGB 3S96A 2H2SC 5CIPH 5KTEH 3MJ7A 2H3NB 3O81A 4X80L 3CJJA 1JE6A 2V17L 5CZXC 2A73B 5FYKH 4NBZB 3V6FB 4ZO9A 4RGNC 1CR9L 4D9QE 5C0RH 1MFCL 1A7BA 5I6XB 3G6JA 4MD5B 3CK0L 3MTRA 3BT2L 3BMWA 2R69H 4MXQC 3WKNA 5E70A 4FNLH 1EAPB 2CQVA 2FEEI 4OCYH 4OZFG 4D3CH 2CMRL 3V7MA 1L0XA 2VXSH 3BHBB 4DFIA 1DFBL 2Y36H 4ZS7H 5T1MA 3KLAB 5B3JE 4LFHD 4KHTH 4YGVB 3BGMB 4M62H 1I9IH 1P6AB 1AY1L 2OMNA 2CJUH 4PJDF 3N1QC 3WCYA 1BZ9A 4XPAL 3JWOL 2G2RA 2ZP0T 3AFLA 1RZGA 4L8CB 3G5VA 1LO5A 3B8YA 3FB6B 2MMXA 4KQ3L 4I0PC 5JHLH 1GAFH 1K8DB 5CILH 3GMMB 7FABL 3RZCD 3DVGB 4M7ZB 3O0RH 4GXUM 1UM6H 1F11B 4JZOA 1K3IA 4M1GH 5TE4L 4OZIE 3RAJL 1WIOA 1T1WB 3V52H 3X12A 5JO5A 5GGVL 4H88L 1MJ8L 3V4VL 1RJYA 2Y6SC 2DLHA 4OLUH 3IDNB 1IVLA 1E28A 4JANA 5IBLC 4LBEB 3UZQA 3TWCL 3ZKXB 2EDJA 2WUBH 4OTXH 4OCWL 5BOPA 2YPVH 4P2YA 4RRPA 1XR8A 2VDNH 4LLQB 5EU5A 4JKPL 5DK3A 4UINH 4XI5C 1AKJB 1T6WA 3VFNB 5C9KA 5HGBB 2XQYK 3IJSB 1NGYA 5SWQA 1YEHH 5HYQB 5MEQA 1OCWH 3HPJB 2XA8H 4PJ8C 4Z7OE 1U8MB 2BVYA 4LCWD 3OKEB 3CFBB 3INUH 1ZLSL 5CUSH 2DWEB 2IALA 1UKTA 4MNHA 2DQDL 3BUTA 5F96L 4ZFZB 1QA9A 4CN6A 3LDBC 1HSAA 4NQCB 5A3ID 1P4LB 4ZUUB 3ARPA 4GOSA 1FPTH 1I1AD 2B2XL 3T1FA 4NO0D 3V0VA 3L3JA 3QZWG 4XP6L 3UTZB 1WBYB 3RDTB 4AENA 1RIUH 3QFDA 3D6GA 1AFVL 3MCLL 1KPUA 4R4BA 4JN1L 2Q86B 3D18B 1FYHB 4M7LT 3ARDD 1R5WA 5F8QC 5ADPH 2E7BA 1IM3B 1VFAA 4UDUB 4M43L 3Q6FB 3AXLA 1FNGA 4X6DB 3P9LA 5T5NG 3I2CL 4UOW0 2GCYB 2G60H 2XWTA 4JFQA 4O2FA 2HRLA 4NRYB 2L7JA 3X3FL 5JW3H 3UTTB 3KYNB 2VXTL 1TJGL 1CDHA 4UNVA 3PXJA 5T1LA 3TVMB 4D8PB 4R3SB 2PXYD 1OAXH 4PRAB 2Z4QB 5EOQH 4F8TA 1OAKH 1EO8H 1RU9L 2J4WL 1HSBA 2ICWJ 5F88B 3KPRD 4OF7A 4LHQB 1Q1JH 3UBXI 1MIEL 1QOKA 3TV3H 1KJ3L 5BRZB 2LE9A 4XP4H 3ULUC 5GGQL 4U1JA 1IGTB 4GKNA 2EIDA 3G6JE 1CT8A 1RZFL 5KS9B 2DIBA 3QDAA 4JREC 4KHXH 5KSAA 4PS4H 3QO1A 1DBKH 3SJVA 3MRKA 1MCNA 1AO7A 3WE6B 3MRFA 3ZE2E 3QULA 5M95B 2LU7A 1NC2A 4XGZB 1MJ7L 1KGCE 3ESUF 2ZUTA 1C1EH 3PWUB 2NY3B 4PBWD 1FZJA 2PW1A 1ZHBA 4RZCA 2WW8A 2W0PA 2FR4A 1NSNH 5FOBB 4XMPH 4XVSH 3O3DA 4ENEC 2ARWA 4QRRA 1KLUB 3C8KB 4S0SD 4TRPL 5FYLH 3ZHLA 2BNRA 4UUJA 3HRPA 1B6DA 3MLZH 1JYWA 3MCKB 2IH3A 3SGEH 1DBAL 3AM8C 1MCLA 4MDIB 3GM0A 3CIQA 4P4RB 4RGNE 1BJMA 4OAWB 1QUNA 1ZWIB 1CCZA 5AUMA 5EC1B 1CTOA 1RIHH 1A6TB 3BZ4B 3P9MB 2V5RA 2XFXB 2ZUUA 2IQ9L 4WO4D 2F74A 1I75A 1T7VA 4OF6A 3MGTA 4OD2A 3BEWA 5IEKB 5CEZH 4C56D 3STZB 3VMPA 3MJ9H 2BRQA 2W0FB 25C8L 1I3VA 4HIEB 4XNQB 2O5YH 3TN0D 4GKOA 2LU3A 4UZGA 3WDIA 5IEHA 5C0GB 4HLZG 4KY1H 4I3SH 4HAGA 1LO4H 4WW1B 3AM8A 4YHML 4LHJB 2R2EA 4WTWA 4IDJL 2C3VB 3PNWB 3V6ZA 4PRNB 1ZT1A 4CJ1A 3BI9X 4YNYA 4OIIH 1S7QB 1NANI 1XGTB 2EDOA 1YZZA 4YBQD 4ZG1A 1X7QB 3U1SH 1M4KA 3MZTA 4Z5RA 1JRHI 3WO4B 1LD9A 2XY2A 3GBNH 4PUBL 4JDZA 4BUGA 4OI8A 4OUUB 1XF5A 5DZNA 4M7KL 1QSZA 5LCVH 1S7XB 4TSCH 4XCEB 4KDTA 2BNQD 5EULV 5ICZB 3DURA 1WEJH 1D5IH 2J88H 5M7QA 3F12A 4GAGL 3ZT6A 2EYTB 4PJBA 3ZO0A 4HPYH 1VFOA 4A6YA 2APXA 2D9QB 5FK9B 5J4MA 1CFVL 1VESA 1OGAA 2DQJH 5F97E 1S7WA 1DQTA 4X5XA 5GISL 3S8WA 3K80A 2DMCA 1Q0YH 4L3AA 3BD3A 1FV1A 5HI3D 5F6HI 3C60D 1YEKL 1ZXQA 1DBML 4GRMB 1CDJA 3WXVL 5D2LA 1J8HA 4OSUH 4NQED 1QBLH 3TA3D 3DIFB 3TH2T 3WNLA 3DYOA 4QNPE 5I1DA 4QRPA 3VFUB 5IW6A 4U1NB 5J12C 1YDPB 5EBGA 2NY2D 3MRLA 4XP9H 4ZFOB 4ODWA 2GTWA 1OOAA 1U92A 4ZO8A 4X6DF 1WGOA 4U4BA 3NZHH 3T2QA 1A6UL 2P5WB 2Y1VA 3PQYD 4R4FL 1IKFH 4KTEH 1HK6A 3T2OA 5BJTA 4KRPD 4JGJA 5LAXA 2I9LB 3SJVE 3GMOB 5IB2A 2VZOA 1AO7E 4UB0L 2JIXD 4LSRL 3I50L 1T3FB 1IT9H 2Y23A 2NX5A 3IKKA 3UTSA 5M94B 4BQ8A 1PJ9A 2MKWA 2OL3B 3QUML 3OAUH 3GSOB 4HK3J 2AQ2A 4RWYL 5I75C 5IHZB 3IDJA 3MUHL 1X9QA 3OB0K 4P46B 3MA7A 1EFQA 3DVNB 4HKBA 2AEPH 1AQDA 4I13B 4QRRE 1OW0A 3EYSL 2EDYA 1MI5D 2BNRE 4EI5A 2P42B 1IGCH 4UTBH 3SDDB 1KB9J 4HDIB 4Y5YA 5KS9F 1QQDA 4PJ7A 3KNBA 4JE4B 2PW2B 2EIZA 3ULUE 4ALAH 4NO3B 1FN4A 1FQ9C 3SDCC 4POYA 3ESVF 1P5UA 4YDJB 5FA3B 1H3UA 3VD5A 2HLFC 3JUZA 4F37K 5C07D 4WI5A 2FO1A 2ADGA 4FZEL 2OJZL 1NAMH 1B4RA 5CP7B 1Q9WA 3H3KA 3E0GA 4YFEA 4F15C 1RULL 4MHHG 1YUHB 3ULVH 1EX0A 3GSXA 5FKPB 3RY6C 5CKGA 2R29L 3T3ME 4Z7QF 5EU4B 3PWPA 1KCLA 3JBG7 2BSTA 2F54D 1TQBB 5IVZA 1HHKA 2J2ZA 1NAKH 1CQYA 4EKXA 1AXTL 1BD2D 4YHLH 1DBJH 5ISZA 3NZ8B 4CVZA 2E8YA 4MS8D 1H3PH 2G75B 3CVIH 4RA3A 1ZA6A 1M1SA 5GGSA 2NZ9D 5E2VL 4ZUTA 1FFOB 5L6YL 3LRSB 4K3JL 3IGAA 3HZMA 4ODHH 1A4KB 2NW3A 2DM3A 1QSFB 4HIHB 3C2AH 1RZKH 5C0ND 5TGBA 3PP4L 3RBGA 3Q5OA 1IEAA 4H5SA 12E8L 4XMLH 3HG1A 5HGAA 4DJMA 5CD3A 1MHCB 4PJ5A 5IMLA 1I7ZA 2WLZA 3K4DA 5EZLA 4I4WA 2YD9A 4P3DA 4PGEB 1AGFB 4JB9L 3RY6A 5DZOA 3DNKA 1F6AA 4JFXA 5FYJH 1NCAL 5C2BH 3LSOB 5C6TL 4Y89A 3FFDB 4PJBE 4K94L 8CGTA 1QO3B 2XZAL 4QRSA 4Y4FA 5C0FA 5DHYA 3O8XB 3PP3K 5CEXB 3CFCL 1OGAE 5IR1A 1KJ2L 1MVUB 3HZKA 1UENA 3PL6B 5FUZL 4YC2C 2VABB 2YN3A 4DAGL 5B39B 5EU6B 2VN7A 1BIHA 2JTDA 4RMVA 4QHUB 3SGKC 3VXTB 1GRWA 4Y4KB 2ED9A 4NPYA 4NZRH 3LIZH 5D2LE 1J8HE 5DDHB 5DEFA 4OQTL 3F6LA 4QRPE 1G6RB 3ROLB 2PO6C 1WC7B 3GK8L 2ZCLH 2VTFA 1A1MB 2CRZA 2VE6A 4XCNA 1H5BC 3CPLB 2VAAB 5DO2C 3GMQB 1O5DT 1NKOA 4P5MA 1F00I 3U7YH 1T7YA 1J0HA 1EMTL 2VDOL 1ZT4B 1N0LA 1URLA 3PV6A 3C5ZA 1UJ3A 3GMRB 1FO0A 1T22A 1FC2D 3MREB 4LMQI 3KR3L 2PYEB 4HKJB 3IKCB 2NX5E 2OTWB 3UTSE 4NKOA 3KYOB 2R1XB 1U8QA 2X9WA 4LASH 5F1IB 3Q3GB 4BZ1L 4OZFH 4OI7A 3OJDB 3KAAA 4NKDB 5AZEH 5KTEL 1E6JL 2JKXA 3H9SA 1INEH 1Q94B 1EFXD 4G5ZH 1JMZA 4U3CA 2BVUA 2HN7A 4KI5D 4L4TB 3VFPA 5FYKL 3OL2A 3Q6GH 4PJ7E 2DWDA 1OF2B 3MO1B 4D0DA 2FGWH 5C0CD 3TT1H 3V7AG 1XF4A 2R69L 3QDJD 4FNLL 4X6EB 1UZ8B 4Z0XA 1XGUB 4OCYL 4D3CL 5DC4B 2OQJB 35C8H 2VXSL 32C2B 4ZS7L 3GSRB 2DDQH 5BVPH 1HHHA 4KHTL 4Y1AA 1PAMA 1IGJA 4M62L 1S7RB 3ARBB 4GMTH 1C8PA 4R90L 1XGRB 1U95B 2C3XA 1Q8MA 5KVEH 1X5AA 1EZVY 3RZCC 2GI7A 5JHLL 4XRCB 4LLDA 3IETB 3PWPE 1G9EA 3AU1B 3R1GL 1OLZA 3K81A 3O0RL 4OT1H 3MGOA 1WFTA 4OM0H 1UM6L 2FWOB 4C83A 2UY7A 5BOZG 4M1GL 3NIFE 5ISZE 2NXZD 1T03H 4UMGA 2V5TA 4MJ6B 5AWNL 1A1OA 1RUKH 3JTSA 1XMWA 3S34H 3V52L 1VHPA 3EJYD 1A0QH 3V4PH 4DZ8B 4F2MB 4H1LH 4KRLB 4JGUA 1FAIH 1MWAA 4LPYA 4OLUL 3TT3H 4UAOB 4F7MB 5CWSA 5MHSD 4BM7A 4BK4A 2F8VA 4NC1C 2WUBL 2WSKA 4OTXL 4L4VA 2DKMA 2YPVL 3P4OA 2A83B 2YMXH 1Q38A 1MLBA 4OCLC 4D0BA 1GHFH 4HW6A 2CR6A 3HG1E 4UINL 4CW1B 4XNZC 3L5HA 4N0YH 5IJVA 3VRIB 1T4KA 4KK8D 4PJ5E 1KOAA 1CICC 5E9DA 5HPMA 3RZCA 1OCWL 3GSUB 1GZQA 2XA8L 4L3CA 4ETYA 4KC3B 3O11B 1GJIA 2D03H 3VXSD 3VWJB 5FYKD 1QSED 3QXDA 3INUL 2A6JA 4AIOA 3HS0A 3QNXA 3GMNB 5CUSL 5FHAH 1A6ZA 3O2DH 1LHZA 3MOAH 3HI5H 4K3GA 1I1AC 4OIBA 3TM6A 5J0BA 2O5ZH 4FQCH 4PY7A 2I60L 3THMH 1BZ7A 2V5MA 4ZTPH 3S36X 3ZHDA 5I8KH 2R0ZH 3JWOC 4X7TB 4JR9H 4WFED 3X14A 5KVDH 4WI3A 2N1KA 1FG2A 3ARDC 2K3TA 1GGIH 5CJQH 2ZUXA 2XWBA 1LP9A 3GJEB 3FO9A 4LLUB 4JREB 1C5BH 1HCVA 2AV7A 1QR1A 5FDWA 3LEXB 3MPCA 4PRBA 4M9OA 5ADPL 4LCWA 2J8UA 5D1QD 4BFBD 2R2BA 4FS0A 5D72H 4HZAA 2D31B 2H2PD 2G60L 3P4LA 4ZYKB 5C0AD 2CO7B 3B5GA 5JW3L 4GQ9H 2PXYC 5F9DC 5A2FA 1JGLH 4NNXB 4I5BA 4ZPTB 2ZG1A 5EBMA 1OAXL 3MRCB 5EOQL 4LF3A 1EO8L 4Y5VC 3TIDB 3QQ4A 4D9RE 2RQ8A 5DMKB 1Q1JL 2WIIA 3H9SE 1DE4A 4G80B 2UWEA 5DMIH 1CGXA 2M26A 4XP4L 4TVSa 4Y7MA 5IHUH 5C08D 3SEPA 5DJ0B 3CSGA 2BVOB 1TNMA 4KH2A 5DURD 5FECA 4LPXA 1NFDB 3LD8B 3TBVB 4PS4L 1DBKL 5SWZD 1TFHA 3U36B 4HKXA 1HH9A 1S9YB 4Y1AE 2ZG2A 4HFUH 2R9HD 5B4MD 2QQLL 4I9WD 1C1EL 2WLYA 4HWEL 1I1FA 3CU1A 2CIKA 5DMYA 2J1KA 4WWID 4P49A 1NSNL 4EXPX 4XVSL 1D3CA 4Y5VA 1FNFA 5FYLL 2EE9A 1UB6A 3TCLA 4UDTA 3NOIA 2JJTA 4HWZB 3KGRA 4L8SC 5F1OB 4RIRA 1KLGA 4PV9A 3EYFB 3Q2CA 3BIKB 5I66A 4BH7A 1HXYA 3MV7B 4M48H 5HHOA 3UTQA 1RIHL 4WO4C 2E6JA 4MJ5B 3DHMA 1U91A 1T04A 4OZ4B 2GT9B 3VRJB 3RGVD 4Y2DD 3OAZH 1AR1D 2AJUH 4L4VE 2P7TA 1SVZA 5CEZL 3DXAD 3MJ9L 3I3BA 3O2VH 5D71H 4FQ2H 3TN0C 2HJKA 1I4FA 2JE8A 5GIRA 2PTTA 4XWOD 5E9DE 1L0QA 2O5YL 4CMMA 2AERT 3MMEB 1FORH 1ZE3C 1RJZB 3EYOB 2FHFA 4N0FA 5F1NA 3KDMA 4KY1L 3TO4B 4I3SL 1W0WA 2FBJH 1LO4L 5DRZA 5TF1H 3QH3A 3N1MC 4NQSB 1FFPB 3FO2B 5CBEB 4X7SL 3SOBH 4YBQC 1OQOA 1QBMH 4PGZA 5C3LD 4I2XA 4OIIL 3P40A 2CKBH 3BPNB 3T4YB 2MKLC 3U1SL 2Z93A 1KULA 5BZWB 3R06B 1TCRA 1AD9A 3GBNL 1HHIB 3BMVA 3T4AA 3G08B 4YHNA 1IARB 5E8EB 3FCTB 3NCFB 4Z7WA 4B7LA 2NXYD 5LCVL 2B8OT 4TSCL 5H35B 3VXPB 4KJQD 3HRZB 4EN3A 1LP9E 1JHKH 1WEJL 5FYLD 1D5IL 5AEAA 1JYVA 1DLFH 5EIQA 1A3QA 3MFFB 4LCWE 1BEYH 2J8UE 3F58H 4X9FA 4HPYL 1BAFH 2NLJB 4A2MA 1F5WA 4WU7B 1WQVT 3ILQD 2IPKB 3PDOA 4K9EC 5JIKA 1D9KD 5HI3C 2DQJL 1P53A 2B4CH 3C60C 4MJIA 3MRQB 4QHNA 1EZVX 4U7SA 1OTSD 4JM4L 1Q0YL 2ATKA 3MLYH 3ZDZF 3OX8A 4LCYB 2BC4B 5GHWH 1YY9D 3G5YB 2R23B 2AKRA 4X4ZA 3TA3C 4PV8B 3VFVA 5E1AB 5CEZD 1DJSA 1ZHKA 4OSUL 1QBLL 2NY2C 1T1ZB 4UQ3B 5F7UA 3K3QA 5J3HD 1CF8H 2HG5B 2E3VA 5CD5D 4QKXB 2UWEE 4O58H 1ZHNA 4XP9L 4FQHA 2B1HL 5DS8B 1J11A 4JJHA 2DQFB 1DBBH 5K59F 43C9B 1M7IA 1TETH 4F7CB 1HILA 5KVGL 5HDOA 3NZHL 4HCRH 1ULVA 2X4OA 3DECA 4KRPC 3GJFK 5DJXB 3CDGA 1IKFL 1IAII 4KTEL 3L5WA 3EKCA 3ELAT 1IAKB 3FQRA 4BH8B 3EDJA 4PRHD 1IT9L 2IWGA 3C60A 3CVHH 6FABH 1NGWB 3IFNH 3W2DH 4PJIA 1JJUA 4MCYB 3OAUL 3S36H 3T0ED 2ZSWB 4MAYD 2VN4A 3TA3A 2QADD 2XWJB 1IGMH 1UEMA 2AEPL 4PB9H 3B9KB 1T1YB 4Z77B 3IAGC 1WF5A 4WI7A 5I1CH 3QNYA 4WRLA 2A6KB 5IMKA 5C0BD 5AG9A 2NY6D 1CU4L 5F6HJ 1CWVA 1NANH 2O61B 3ARXA 4PRDB 2D7TH 3ARTA 4YFDB 4ALAL 3BWAA 3H9HB 1JRHH 3PQYA 2RCSH 2P8LB 5HHOE 1UCTA 2DS4A 3QQ3B 4EDWH 1XGQB 1CFQB 1Z9OA 2JIXA 3C9NB 3IU3B 4ZXBB 1NAML 2ZOKB 1L4IA 3KS0J 5GGUB 2V2WA 2E7CA 3WFBH 1ZGLB 4NYLA 1NGZB 3FFCD 3NIDF 4RDQG 1KNOB 2B5IB 4P4KD 5D7JD 3BAEH 2COQA 3ULVL 1CFTB 3U46A 4NFCA 2IFGA 3R4DA 3VFGH 4RAVA 3HAEB 1MI5A 3WNPA 2FJHB 1NAKL 2JCCB 1TTUA 4MS8C 4OD3H 2YS4A 1DBJL 2XG5A 5E5MA 2YXMA 4CADA 1H3PL 2NZ9C 1YMHB 4NO5A 5GZOD 3CVIL 1OLLA 4JRXA 4HJ0D 5C07A 1YEDA 3C8DA 4X4MA 4I2XE 3L3IB 5J1TC 5IROC 5C71A 2XI9A 3M07A 4IHOB 4WCYH 5C0NC 3KS0H 5I2IB 3EFFA 3OJ2C 1U8OB 1U41A 1TZIA 1FL5A 3C2AL 4P2RA 1RZKL 1H5BB 4XMLL 2ARJB 4Z7WE 1TVDA 1RUMH 3L3KA 3TPUA 3QWOB 4YZFE 1ORSA 4R7DB 1AC0A 3BZEB 2QJDA 3OF6A 3U2SA 5FYJL 3W9DA 5C2BL 4FTVD 5K93A 4MSWB 2X4QB 3W9EB 5IMOA 1JK8B 2X9YA 4XVJH 1AE6H 3O45A 5F70A 4TUOB 3KPLA 4CNIB 5CZKA 4E41B 2ZJSH 3WJJC 4MJIE 3KLHD 1TZHA 3UJIH 4QRUB 3NIGE 5LJYH 4OZHA 4GBXD 3OXSB 2XRAH 4Q0XH 3S4SG 4IS6B 4U6TA 1A6VH 1T2XA 1JWSA 3B8SA 5FGRA 3L7EA 5IROA 3BJ91 4GG8A 4NZRL 3LIZL 5DJ6A 5IB5A 1J8KA 1S7TA 1XR9B 3ULVD 3GUTA 2ZCLL 5IW1B 3GIVA 3HLAA 2C3HA 1F3DH 3QUYD 5GRUH 2VERN 1A6AB 2VITA 3U7YL 5EA0H 1FRGH 5EFIA 4QWWD 4JRYB 3LKPA 4OGYH 3CFJA 3WNKA 3U0PB 4MZ3A 2PTUA 1PZ5B 2QHLA 5E7FA 4X4YB 3DMMB 4PG2C 4G6FD 4DGYH 5FV1L 2DL2A 4LASL 4PJIE 4GW5B 1MCHA 1J10A 3RPIB 1JF6A 2NNAB 3JUYA 4XT1C 3MBXL 5C86A 1ZTXH 5I1AA 1V7NH 4D9LL 1EXUA 1OPGH 5AZEL 4KI5C 1INEL 1NJ9A 3ARFA 4G5ZL 1PBYA 4HG4J 3LN9A 3GMLB 4JHBA 4ZNEA 4K94C 4LQ1A 2DLEA 5FYJD 3TT1L 1XCQA 1A9BB 3JTTA 5TE6H 1OTTD 3WIHH 3PQYE 3BJLA 4JM2A 2XV6B 3B6SB 1FH5H 5IB1B 3HI1A 35C8L 3BZFA 3HHRB 4OIAA 4WHYG 5BVPL 4Y4HC 4BSWA 5BZDB 3SQOH 3O41A 4PTTB 2X4UA 4PG2A 4WFHD 1MJJA 3MSPA 1CICB 4GMTL 3OKDB 4XPTH 1M7XA 4JFFD 5KVEL 4YDIH 5EB9A 5FGCB 4PFEA 2HFFB 1XZ0A 2D7NA 5D8JH 2DBLH 3L3GA 1MI5E 1EFXA 5IVNA 5TDPA 1U3JA 4PB0L 2NXZC 4OT1L 5D7KD 3D25B 3RWCB 4OM0L 1I1AB 2FH8A 3EJYC 3MRNA 3QEUB 3EOBA 5C0CA 1T03L 3FO1B 5D93C 5CAYB 5I30H 1RUKL 4NOBA 1WUNT 3V5DB 3W82A 4JRXE 1A0QL 3MRHB 5C07E 3V4PL 4HG4K 4X4ME 4OKDA 1FAIL 1PY9A 1KJ2A 4HUXA 5EOCJ 4EI6A 2W91A 1P1ZB 1L6ZA 1I8LC 3BN3B 4NBXB 2YMXL 4RNRB 5E2UL 4P2RE 3CSPA 1GHFL 4KK8C 5JNYA 2X70B 2N7AA 4F7EA 4N0YL 4OQTA 1HHGB 4WHCA 2P5ED 2JCCF 5KJRH 3M1BB 1S9WA 3DGGB 3F7VB 2OI9C 5IKCB 1X6LA 1RJLA 1UA6H 3LZFH 2D03L 5KG9A 3QA3A 2VQTA 1BPVA 3QUZD 3P9WB 5FHAL 3O2DL 5E00B 3MOAL 5HYJB 1QFWI 4NNYA 2VZVA 3H7BB 5L8LB 1KELH 1UVQA 2F9BT 5AG8A 4GG6A 2YOCA 4WY7H 5FO9B 3BO8B 3WHE0 3VG0H 1BVKA 3G6AB 2I24N 3KJ4C 3WFDH 5EBWB 4OZHE 2MCPH 1KT2B 1I8MA 1DQJA 5DTFA 4ZTPL 3RHWK 3J8F7 3ZKND 3ARUA 3BPCA 1M7DB 4U1LB 5I8KL 4EUPG 1G9ML 1VGKB 2D4DA 2JB6B 2R0ZL 2YD4A 2LU4A 3L3HA 4JR9L 5DJCB 3NPZB 1YEFH 3P77A 4P57A 3K1KC 4KKLC 1JHLH 1I8LA 2ZUYA 1K2DB 3OXRB 1GGIL 4NUGH 5CIPA 2FEEL 4P2QA 5EOTB 3T0XA 3B9EA 4JHWH 1JTTA 1C5BL 5D1QC 1INQA 4X5WA 4DCQA 3GRWH 4R0LC 5BS0D 2AAVA 3QDMD 3VXSA 1KJVB 1QSEA 3VGFA 1G7JA 2H2PC 5D72L 5K33A 1BVLA 3A0OA 1DZBA 4MXVF 4CGTA 2BX5A 3CSYA 4LSPH 4P23D 3AVEA 2X4NA 5GRVL 1G6VK 4GQ9L 1JGLL 5E2WH 1J5OH 4Q9BA 3V0WH 4PJHA 4MNQB 1RD6A 2EDTA 2P8MA 5TPWH 3WHXA 4KUCF 4L8SB 4IOSD 3SPVB 1UXSA 2R0LH 4FQIH 3HE7D 2DQCL 4JVWA 5DMIL 5GS1C 3ALPA 5IHUL 2XN9B 4ZNEE 1FSKC 4C4KT 2NQCA 5D1QA 3VE0B 1MCWM 4R0LA 3FB5A 3SDAD 3TBYB 5I0DA 5DC0A 4PRIB 5HGGS 5D96B 5IBUB 5E1HB 1D5MB 4IIQA 1IQDB 2R9HC 5F9AC 5B4MC 1QRNB 5HPOA 5JHDD 3B3IB 5C0AA 1PYWB 4NKMB 4D0CB 1MHPH 4HFUL 5JR1L 2Q7YA 3TBTB 1SBBA 5ICYA 1NMCC 4F9LC 3D85D 4LCUA 5HJ3A 3DSFL 1H3GA 4M4PA 3RA7H 5EBLB 4JO4H 1MCJA 5I8CB 1HHJA 4NBYB 1HDMB 2AXFA 4OLEA 5AYUH 4M4RA 2UVEA 2V7HA 1ZVYA 4IRSB 4NN7C 2Q3ZA 4LNVA 5C7XH 4MD0B 1A2YA 2VUYA 5DJAA 2F15A 4OZGB 4WI2A 5C0CE 1KPRA 4PGBA 2JF1A 1KG0B 3ULSB 4BA8A 2ERJB 1UWGH 3RGVC 4Y2DC 1AR1C 5IQ9A 2EXYD 2AJUL 4JJ5B 4GW4A 3C09B 1P4IH 4KVCH 3ARGB 1HKLL 4XWOC 3O2VL 4LHUB 4WUKL 4FQ2L 3BYTA 5D71L 3GB7B 5BW7C 4TQEH 5TH2A 4NUJA 1YPZB 2ITCA 2D9CA 3RWDA 2QSQA 5BVJB 2XICA 3PJSA 2WWMD 4M6MH 4M6NH 5J06A 2FYYA 3G9AB 3V5KA 1OP5K 4JZNB 3VXNA 1F90H 2FBJL 4HS8H 5KN5B 2X10A 2YK1H 4DZBA 1DQMH 4BK5A 4J3VA 3SOBL 4GG6E 1QBML 2WBJD 4NT6A 2GJJA 2PCPA 2XG4A 5TDOA 2CKBL 4LLMB 5CEYA 3CH1B 4XBGA 1N59B 4FQXD 3BPLC 3MCG1 4JFDB 3UYOD 3TZVD 2NXYC 3DXAA 3RKPA 4KJQC 2HFEB 4WI9A 4P2QE 5BW7A 2YZ8A 3DV6B 3KPMB 1JHKL 2AJ3B 2GSIB 4QT5B 4LRNL 3IDMA 3VXOA 4OFYD 1FZOB 1DLFL 1N26A 2FCBA 3QJHA 3LY6A 3ILQC 3D2UD 3VXSE 5FYKE 3SDXB 3F58L 5JTWA 1QSEE 1UH3A 3C6LD 1E27B 1D9KC 1J88A 2MPAH 4S2SB 3T04D 4G9DB 2Q6WA 4Y16B 3O2WH 1I1YB 2BNUA 5EZJA 1HQ4A 2B4CL 1DQDH 1YY9C 4BSVB 5IP4A 1NEUA 4GLRI 1K85A 4HUUB 3H7LA 1GZPB 1MFBH 3QHTC 1K8IA 2KQNA 1FVCB 1RV6X 2BRRH 5E95B 5GHWL 1CGVA 4P59H 3RWEA 3H6JA 2YN5A 3ARWA 1ITBB 5HYSA 4WFEE 2ADFH 4PJHE 2FD6H 2DTSA 4L9LB 5J3HC 1R24B 2OL3H 5CD5C 2GFBB 4YFLF 1N64H 3KPQA 1CF8L 1YNTB 5DQJB 2ICWA 5E4EB 5I74B 5JA8B 2EDQA 1NUDA 3MLWL 1JF1B 3DUUA 1DBBL 4UNUA 5ITBL 5F89B 4RAUA 1TETL 5C0IB 1I3GH 4GO6B 5EZOH 4U2YA 4ZOAA 4HCRL 3JV4B 3QG7H 1KCKA 4XXCA 3C6SA 1S7SA 5DRWB 1F4XH 3PWVA 4K8RH 1RHHB 5E8NA 1XEDA 4E5XA 1ZSDA 1DVFD 3TFKD 1A6WH 5C0AE 2IPUG 3CVHL 1V8HA 3T0EC 2ADJA 3IFNL 5KSBA 4IJ3C 4MAYC 1RFDL 2QADC 4L3ED 5D6CA 1KBGH 4N90E 1MY5A 4YQXH 3O9WD 5ACMA 4PJ9B 2HKHL 4KKBC 3MJ9A 1IGML 1LEGB 4QHMB 3VCLB 2R0WH 2NY6C 3FL7A 2BXZA 5I1CL 3WS6C 3QO0B 3B9VA 2CK0H 3K4ZA 2OZ4L 3VFSB 1A1NA 5DVNA 3LKSA 1A14H 5IIEA 1VKXA 2D7TL 2V2TB 4PG9A 1N7ML 3T0VA 4G9FA 1JRHL 1WISA 3V8OA 2RCSL 4V1DD 3IXAA 5EWIL 3MR9B 4L1DA 3REWB 3WLWD 5EUOA 3BP5A 5C1MB 3P4NB 3BKCH 4EDWL 5IOPA 2HLAA 1FYTD 3MV9D 3KJ6L 3FT3A 4I9WE 4NSKB 3WFBL 4P4KC 3SE8L 5D7JC 5DJDB 3HAEG 4QTHB 3SCMD 4MAYA 1EHLH 3BAEL 2PKDA 4HUWB 1OGTB 3PUCA 4U1IA 3NTCL 1ZAGA 3VFGL 3U6RA 3CFDA 2X4PB 5GGTL 4OZGF 3SBWA 5C0BA 1U8NA 1FFNB 3IDYB 4OD3L 5GZOC 3IVKA 1VB9A 1H3XA 2NY4D 5JW4R 1EEUA 1FFQA 2C5DC 2Z35B 1V3LA 3WN5A 4MQTB 1MCCA 3RTQB 1G1YA 1T7ZA 2VLKA 4ZOCA 5ITFA 4NQTA 1VPOL 4DKDC 1D5BA 2X44D 4J3TA 5TFSH 3EO1B 3BWUC 4WCYL 3FFCA 5I8OH 5JXED 4KFZC 1S8DB 1YPZF 2R1WA 3DXAE 1IRAY 4P4KA 1ED3B 1S9XA 5D7JA 5FGBA 4EDXB 4RA0C 1BZ9B 3MV8B 1RUML 1VERA 5IT2H 3WDJA 1Q9OA 3BVNA 3S3SA 1IAIH 2MQ0A 4HXAH 1G6RH 2WBKA 3WKMH 4BSJA 1F4AA 1I8KB 9CGTA 5I1KH 1IM9D 4X6FA 3DYMA 5I15H 1P7QB 3QI9D 5BO1H 4JZOB 4XVJL 1CFSB 1MCIA 1AE6L 1LQSR 3WUWG 3KLHC 5AD0B 3UCRA 1U9KA 2ZJSL 4S1QL 3X12B 4GBXC 5JO5B 3UJIL 1DEEA 5FF6A 1RJYB 3NFNA 4R96B 4MB4A 1E28B 1JPGA 2XRAL 2CH8A 3BD4A 1A6VL 3WFEH 3LN5B 2HMID 3PXHA 2LQRA 4DGVH 3ULVC 4DVRH 2GKIA 3CUPA 1XR8B 1PQZA 1CZ8H 3O4LD 1S7VA 3QUYC 1AXIB 5I1GH 3UTOA 4HS3A 4C55A 1NGYB 4YR6A 3UMTA 5SWQB 2YUXA 4LSTH 4QWWC 3BGFC 4PJAA 3C5JA 1KN2H 4Y4HB 3HB3C 1FRGL 5EA0L 4OZIF 2DQEH 4OGYL 4K23H 1PEWA 4KJWD 4WEMB 1EUTA 3LAFA 4YFLI 3CFKB 2DQUH 3ZZ1A 1KLFA 3SGDI 5KSBE 4OFVA 1NAMA 3MODH 5ADOH 1GL4B 4GKSB 1AGEB 1RZKC 4ZUVA 3T1FB 5CEZE 1FC1A 5I17A 5EC2B 3V0VB 3L3JB 1ZTXL 3VXRA 1F8TH 4BZYA 1V7NL 3O6FD 3OR7A 1OPGL 4AENB 3NVQA 3MQIA 4JO3H 1KPUB 4R4BB 4HQQH 3AS0A 1OTTC 3FONB 4JKMA 4MA3A 2C7UA 4YBLC 4CJ0A 1R5WB 4WFGE 1JGDA 4WWKD 3WIHL 1IAMA 4G9FE 1XF3A 1QVOA 3BH9B 2CK2A 1V3JA 1G9NH 4MA1C 2X4RB 1FH5L 5EUOE 3T77B 2ZPKH 1JZ6A 2Y7QA 1T0PB 2A77H 2KH2B 2H45A 3SQOL 1R3JB 3GBLA 5FDYA 1CXFA 3LKRA 3S35X 4XPTL 3LB6D 5EDXA 3RUGA 4HGMA 4YDIL 5GXBB 3FRPA 3V2AR 3C08H 4JFEA 4MQSB 3O3BA 3I3DA 5D8JL 1JTPA 2DBLL 4X8JA 1HSBB 3EOYG 4HJGA 5C8JB 1VADA 5C0BE 2E9JA 4LLVA 1KN4H 5ICXA 2YHGA 4ZOEA 3M17B 5F7DA 1LWRA 4GKNB 2JLLA 5I30L 2APVA 2DRUA 4JG0H 4MQ7B 4LPCA 2LTQB 3BKMH 1FDLH 2VLKE 4YHPA 4M02A 4BFEA 4Y2OA 1JZ5A 5DVLA 3MRKB 3S4SA 1AQKH 1OTUD 1AO7B 3PHQB 3QULB 4KZEL 3FFCE 4H0HB 5B8CC 3RNKB 4TVPH 2Q8BH 4J1UA 5SWSB 3QDGB 4RZCB 2FR4B 4FQ1H 5KJRL 1C7SA 5E2TH 3BX7C 5J1AB 1ETZA 4QRRB 1K5NA 3QFJB 3QUZC 1UA6L 3LZFL 2H6PB 3RWGA 1HYRC 3ZL4H 4O2CA 2DKSA 4HV8A 3DO7B 1BOGA 4LP5A 3U0TA 1FP5A 2C4FT 1YN6B 5E6IA 3FAXA 4F9PA 1QG3A 1KELL 4WY7L 3ZKNC 5AUMB 5ESVA 3VG0L 3WFDL 3ZE2F 2MCPL 4QF1B 3AREA 3VXQB 5C9JB 5B21A 1R3KB 5EZIH 3OAYH 1T1XB 5JDJA 2F74B 5GS1B 5E08H 2X9XA 3RL2A 3O6MH 1JHLL 1MCQA 1YC7A 2GK0A 5KOMC 2IANB 1X3DA 4JHZA 2VWEC 1U93A 5SWZB 4JHWL 4Z7VB 1AKJD 1KXVC 5IB3A 3H9YA 1WWBX 5D7SH 1RK1A 3KLDA 1TITA 3RVVD 3V5HA 3D39A 4GAJH 1ZVSA 2QTEA 2XXCB 4P23C 5I76A 3RRQA 3AB0C 4LSPL 2EECA 4RFNB 1XT5A 4YNYB 4NQCD 3FQTB 3VH8G 5E2WL 3QCUH 1J5OL 1MH5A 3V0WL 4Z5RB 1FNHA 3VMNA 5TPWL 2WWKO 3VXRE 1LD9B 5A16A 1QEWA 3HE7C 1U2CA 4JDZB 4QGYA 2PR4H 4X9GA 2NZIA 1XF5B 2BY0A 4FQIL 4XH2A 3RDTD 2CLVB 5TE7H 3VWKA 1QPXA 3BP4A 4RMWA 2V7NA 3QDMA 3SDAC 3DURB 3T2NH 2GAZB 3EYVA 1U58B 1EJOH 5T3ZE 3X13A 4OLVH 2EDEA 3ZLQC 2IFFH 3CNKA 4H1LA 2P47B 2NR6D 1MHPL 5D2NB 1S7WB 4X5XB 4IOFD 3PWJB 4YEEA 4HKZB 4MCZB 2YD6A 3HUJB 1F97A 2OTUA 2AQ1A 3UTTD 3RUGE 1JI2A 1ACZA 3L7FB 3RA7L 4JO4L 4JFEE 2IMMA 2JJSC 3TVMD 5D2LB 2ATPA 1B2WH 1QFWH 2A74A 1ES0A 1BQHA 3RWFA 3VFWA 3CDCA 5I1DB 2VAJA 5C7XL 5IW6B 4UOW1 4AH2B 3MGAA 3MRLB 4LSQH 5FYJE 2X89D 2EEDA 5BRZD 3MFGB 3EZ8A 1V7MH 3NABH 3SE4A 2GTWB 4B41A 5JOEA 1U92B 1FNSH 3K2UH 3O2DA 1WJ3A 2EXYC 2OP4H 1UWGL 5CSZB 3DI2B 3ZDYF 5JHDA 1FZMA 1MCRA 5BJTB 1MCPH 2IH1A 3E6FB 5LAXB 4LHUG 4NCC1 2P45B 1QP1A 4Q7DA 4WFHE 4J6RL 1W0YT 1QLRB 4MDJA 1QHOA 3L6FB 1P4IL 3UTSB 4KVCL 4JY6A 3SE3C 4D2NA 3ET9F 5HHVH 4N8VA 4TQEL 1NEZA 1IJ9A 2FH6A 2WWMC 3DTXB 2GW5A 2NY3D 2ZUVA 2E7LC 3NAAH 3MA7B 3K8LA 4LEXL 3TJHD 2JJSA 1PGRB 4LKXA 4M6ML 5D7KE 4M6NL 1G7PA 3DETD 3TO2B 4G8FB 7CGTA 3NGBC 4AEIH 4EI5B 4ZOBA 5ESAA 3VJ6A 2J5LB 1B0GA 1F90L 5D9SA 1U8IA 3KNBB 4PJ7B 2YK1L 2VDPH 1FGVH 1DQML 2EIZB 5ANMA 3N1PC 2WBJC 2NY7H 3ETBF 2Z91A 3U4BH 1BFOA 5HYFA 3EW3B 3LQMA 2DB8A 3SGJC 1N5YH 4FQXC 1SEBB 3RFZC 2CIIA 5DHVH 2EKSB 2VQ1B 4PR5B 4U7MA 3FOMA 3NPSB 4RSVA 3QHFH 2FX9H 2VLLB 5TF0A 3QIUB 1Q9WB 1QLEH 1H15B 2ZWLT 5KANI 3SE3A 3S35H 1A4JB 1QFPA 5F9JA 3HC0B 3L5IA 1B90A 4L1HA 6CGTA 2BOBA 2HT4D 3SE9H 5F7YC 2E7LA 2ZSVB 4HBCH 3C6LC 3C8HA 1NCWH 4PRHB 5I73B 3MRGA 4ZFOL 5IVZB 4G7YH 4WNQA 3D39E 1CN4A 4X6CA 4YK4B 2MPAL 1T2QH 3VI3E 2UVFA 4CVZB 3NCJH 4G7VH 4PD4J 4WTZG 3IXTA 2A6DA 4J2XA 4L8DA 4U0QB 3QWRD 1DQDL 2ZOLA 4IMKA 2YBRA 1TJHL 1MFBL 1AHWC 2BRRL 3BH8A 4P59L 3IGAB 1S78D 3TZVA 2FD6L 2NW3B 5FB8B 4XPHH 3MV01 1TVHB 1N64L 4F57L 3DHJA 4Z7VF 5DYOA 3OG6B 1IEAB 3AY4C 2VB5A 3HG1B 3T3MF 2APWA 4ACPA 5CD3B 1U3ZA 4PJ5B 5IMLB 1I7ZB 3QDME 4I4WB 3D2UA 4FXKA 4MNGB 1I3GL 5EZOL 1JN6B 4JFXB 3QG7L 2O26U 5H37H 1V5JA 4N1EA 1DVFC 1F4XL 5EU3B 3TFKC 3U4EB 1KCSL 4K8RL 4Y4FB 3D87B 3P11H 5L8JB 1IC5H 1A6WL 3TCXA 1JGVL 4M7JH 5IB4A 1AD0A 1XGPB 1OB1B 4JFPA 3HZKB 3OKKA 3O9WC 4CN1A 4PD4K 3UTPE 5D7IA 3KYMB 1RVFH 1KBGL 4YQXL 5CGYD 1JIBA 3L5JA 4OKVA 3TESA 2I27N 1Q9LA 3QAZC 2R0WL 4NPYB 4X7CC 5DEFB 4PGDA 4KROD 5IESH 2CK0L 4Z8FH 2CKNA 3B83A 5KSUB 3AY4A 1T66D 2FZ3A 1A14L 5EPMB 2IG2H 2GTZB 1WAAF 1LE9A 4LVHC 4F3FB 4KKCC 3WLWC 1NCCH 3IFLH 4QYOA 2LVCA 4P5MB 4N1HB 1NCBH 4R9HA 1BBJB 2B4CC 1FBIH 3PV6B 3BKCL 3DUHA 3C5ZB 2F5AH 1UJ3B 3LKNA 2P5WD 5JHDE 2BVQA 2HTLD 4APQA 4Q2ZB 4ETQA 1JNLH 1T0MA 3HUJF 3UBXA 2CKBA 3SCMC 3HPLA 3TLRA 2W60B 1CLYH 3AS1A 4L3EA 3OGOE 4FTVB 4RMUA 5D2LF 5JOFA 3IS1X 1R5VA 1EHLL 3U7WH 2UZIH 1JWMB 2NW2A 1Z9MA 4G6KH 3GHBH 4MA8H 5GRWA 3CDFA 1Y0LB 4P46D 3H9SB 2VDLH 4U1KB 4GLRH 1T20A 2NY4C 1WZLA 4LLWA 2DWDB 1AGBB 5ANME 3FB8B 3SDDD 2OR9H 5B38A 4HUVA 5IG7B 3V95A 4K8RD 4JPIA 1GCFA 4HMCA 3MOQA 1EHAA 4Z0XB 3L9RA 1FYTA 1XIWB 3MV9A 3QYCA 4NKQB 5JXEC 1FL6B 1ROWA 5TFSL 3QT2A 3QQ9D 1UZ6E 1J1XH 4Y1AB 5I8OL 1IGJB 3SCMA 2YD2A 2VIRA 4FZ8H 3DWTA 3FTGA 3BGFB 1ZLUK 5IT2L 2CXGA 3B43A 1IAIL 4HXAL 4E42A 1G6RL 4PJDA 5J6HA 3WKML 2VDQH 4GQPH 4K2UL 3QI9C 3JV6B 4PJ7F 5I1KL 2VISB 3QNZA 4U1HB 1WWAX 4Q6YA 3MGOB 1IFHL 4X6CE 4C83B 4HCRA 1K4CA 2HFTA 1EEYA 1A1OB 3JTSB 1N8ZB 1F58L 1NGPH 2IAMA 1B6UA 2HMIC 5HGDA 4RRPG 5CWSB 2HH0H 3CVHA 3WFEL 1LGVA 3SO3C 3E6HA 4JRWA 5C6WH 3MBEA 4L4VB 4DGVL 3P4OB 2H32B 1QSFD 1YQ2A 1TVBA 3PE9A 1A7PL 4K07A 4XPBH 2B39A 1BF8A 2DQHL 5I1GL 4ODXA 4RGMC 4Y8AA 5E9DB 5HPMB 5HY9A 2OZ4A 4LSTL 4L3CB 5DWUH 3VXUB 3NIFF 1KN2L 1NFIA 1IL1A 2GQHA 2QL1A 2DQEL 4K23L 3QXDB 2A6JB 2LABA 3FQNA 1WTGT 5ALBH 1WT5C 3O8XD 1KXQE 2VXVH 4O02H 4PY7B 5EIVA 4FXGB 1BZ7B 4PJFB 5FUCC 3IJYB 3WL9A 2DIAA 3WS3B 4MWFA 3MODL 1SYSA 3PABA 4JAMA 5D7IE 3PL6D 3O6FC 4LVOB 1F8TL 2EC9T 1UKQA 4AT6B 3X14B 5DSCB 4JQVC 5F72S 3QEQD 1GSMA 1A47A 2V9TA 4Y4KD 1TLKA 1ONQB 4CUCA 4JO3L 1VEPA 5GGTA 4HQQL 2XWBB 4WWKC 4FFWC 5GSVA 2HJLA 4PRBB 5HHNA 2E27L 3PWLA 4DVBB 4QXUH 2J8UB 3RL1B 1G9NL 1OAQH 3SKUD 2ZPKL 5LXGH 2WK2A 2R2BB 1SYVA 2HT3D 3LEYL 4U6YB 2ITDA 2A77L 3V8CA 2RIKA 1NPUA 1JPFA 4KMQA 2EE3A 1KTLA 3LB6C 4EQ3A 4YO0A 1WT5A 2WWKT 5F9WC 3MUZ1 3B5TA 2PYED 4HT1H 4L3EE 2HVJA 3NN8A 1H0DA 3STLA 5ALCH 5EBMB 1X44A 3REVB 3C08L 3G04B 4LF3B 4YXKH 4J3UA 2XXMB 2KZWA 3QQ4B 4HS6B 3KWWB 4N5ED 3OKYA 3FT4A 2WIIB 4JQVA 4NN5B 1GGCH 3BISA 2QR0A 2G5BB 2UWEB 3HZVA 4XX1E 2YRZA 4XNMA 1OSPH 3FB7B 1BWWA 5CMAB 3D69B 4KPHH 2IQAA 4L4TD 4WWKA 3WUWA 3GI8H 1XH3B 3GSNL 3P30H 5FECB 4JG0L 1LE5A 3BKML 1FDLL 1OTUC 4I8DA 1FYTE 3GDBA 3MV9E 1VENA 4XAKD 1AQKL 2XZZA 3QIBB 4BUHA 1HH9B 3MYZA 1EBAA 4TVPL 4XI5D 2F19H 2Q8BL 3KPTA 3ARBD 2E7HA 3RU8H 2Z8WC 4NHUA 5E2TL 4PJDE 2GHWB 2FJGB 4P5TB 3LCYA 2R2HA 3ZTJG 2XQYG 2GJ6A 1RY7B 4M7ZC 3VDCA 4M1DH 3AB0B 2BOCA 3ZL4L 3MRDB 3SGDH 3RX7A 3TCLB 2G5RA 2ARJQ 4M7LH 2A73A 3HN3A 4RIRB 2CDFA 4LSSH 3WIFA 3UX9B 2H9GA 3VW3L 5I66B 4YJZL 1I7RB 1FIGH 4YAQB 4BH7B 4MD5A 3GSVA 1BREA 1HXYB 5BMFL 1W72L 2Q20A 4YHKH 1A7OH 4HWNA 1EAPA 3KPSA 3GKWH 1AIFB 2FIKA 1U91B 4OGZA 3ZKXC 1KEGL 1T04B 3BHBA 1WCBB 5BQ7B 5I16A 1SM3H 2MWCA 2R4SH 3KLAA 4TSAH 1JPSL 4X4XA 3T3PE 3U0WH 5IHBA 1QTYT 4Q74A 2RBLA 4YGVA 3LQAC 3BGMA 5E08L 3QSKB 3O6ML 3QPXH 8FABB 1YNLH 3G5XB 1Z3GH 5DT1H 4L8CA 2PTTB 4LCCB 2RR3A 4CMMB 3RVVC 5D7SL 2FRGP 4MD4A 3GMMA 4GMSH 1IEBB 5F1NB 3KDMB 5E4IA 3WIHA 1F11A 1W0WB 3VWJD 5DRZB 2EEAA 2V2XB 5AZ2H 3A67H 4I2XB 2VSCA 1U3HA 3IDNA 4NO2A 1WFNA 1IBGH 3WMSA 3QCUL 4LBEA 2QBWA 5BV7C 2EC8A 3CDYA 3BD5A 3RDTC 4WW2B 3D5OF 4ZO7A 4TVPD 1LEKB 2PR4L 1OAYH 4YHNB 4EBQH 4Z7WB 2HFGH 2HT2D 1X4XA 1AKJA 4NCC2 3T65B 5JOPD 3VFNA 4EN3B 1BM3H 4X5LA 1G1CA 1QYGH 4N8CH 3T2NL 4X7DC 4HUMB 3EFDH 5HYQA 1KIPB 4P3CH 1RIVH 1KJMB 2GY5A 1EJOL 4L4JA 4OUOA 4OLVL 2AV1A 3Q1SH 4IOIA 4POUB 3OKEA 1SBSH 1SEQH 5DJ8B 2NR6C 1WBZB 3PDOB 4IOFC 1QPPA 3BZDA 4MJIB 4QHNB 1J1OH 3HNVH 1P4LA 3OX8B 3CZFB 1BJ1H 1ZT7A 3DLQR 3TVMC 1FG9C 4L5FH 1VFMA 1ERNA 3VFVB 4R97B 3LPFA 1QFWL 2YPKB 1WBYA 3V6OA 3IDXH 3QIWA 4G42B 1JZ8A 1NGQH 5DD3L 4LSQL 2OCFD 4FQHB 5ID1A 4ZAKB 2J8UF 4XNYH 2Q86A 1V7ML 3NABL 1M7IB 4FG6D 4G8IA 3WSQH 1P69B 3ARZA 4N0CD 3F5WB 1HILB 4NM4H 4I48B 3K2UL 2OP4L 3VI4E 3ZE1F 4UDUA 3CDGB 3Q6FA 4ZTOH 1EHXA 1HQRB 1MCPL 2GCYA 4ZO6A 5LWYH 3MOBL 4NJAH 4NRYA 1FNEB 4KWUA 4XZUA 2NY3C 4J3OC 3UTTA 1E4JA 5HHVL 1P2CA 5EORH 3TJHC 3ZSTA 2AK1L 1FVEB 1C08B 4R3SA 5EIIB 3DETC 2UWEF 1KIUA 1JZ4A 2GJ6E 3A6OA 1UG9A 1PLGL 4AEIL 1CD0A 5IMKB 5BRZA 1OVZA 1M05B 1FGVL 1FVDB 1AHWB 4U3XA 1IGTA 2NY7L 4NZUH 5A2IH 3U4BL 5KS9A 1N5YL 5EO1A 3KPSE 3MV7D 5CINH 4B7IA 1K4DB 5AYQA 3UYRH 3B2UC 3WE6A 2FX9L 3A6CH 3EYUL 3V79C 1QLEL 5GGSY 3PWUA 2HT4C 5I9QB 2RB8A 2FJFB 3GIZH 4J4PA 1JPTH 1HZHH 4HBCL 5FOBA 1NCWL 2XTJD 3BDBA 3L1OH 2PNDA 4G7YL 1CG9A 1A3RH 2H8PB 4L29B 2AABH 1T2QL 4IEFB 3NCJL 3CCHA 3TO4D 4XC3H 1CL7I 3O9WB 4MDIA 4CADB 1DSFH 4P4RA 3FRUB 4JRXB 4OAWA 1XAUA 1YEDB 1ZWIA 5F8RC 1CDIA 5IMMB 1QFUH 1QACA 1S78C 4P2OB 2NTFA 5EC1A 1ZLWK 1A6TA 1N4XH 3BZ4A 5I0ZA 4Z6AT 3WO4C 4HWBL 3MYJB 3ZYOA 3EFFB 1TZIB 4KMLB 1FL5B 5GJSH 1QHPA 4P2RB 2EE6A 4X6BA 5DVKA 1DUYA 4PP1D 3L3KB 2W0FA 3L95B 1QRKA 3TPUB 4DN3H 5F3BA 4M6OH 1A7NL 1ORSB 4HIEA 4XNQA 5JMOC 3FN0H 1KTKE 5HGHB 1JCKA 4M3JA 4RMTA 3VGGA 2IF7A 3DPBA 1I1RA 2J12B 3KG5A 2FDBP 3MLVL 4W4OC 2VXUH 1OWRM 3O45B 3QWRA 2WM0A 3KPLB 2IBBA 1IC5L 4WW1A 5CZVL 4M7JL 4QOKB 5MERB 3CX5J 4ODVH 3PNWA 3VU2A 3GJFB 5CGYC 4OZHB 3WD5H 4LSVL 4WW2F 1RVFL 3OHXA 1PVHA 4GG8B 4Z7WF 4KROC 5DJ6B 1YN7B 1Z5LA 1N6QH 3V6OE 1OHQA 1T66C 3C87A 3VFTB 4Z8FL 4WTXA 1S7XA 4XCEA 3GIVB 2IG2L 4LMQE 4GS7C 1U8LA 1NCCL 3IFLL 5ELIA 2YZ1A 3MRMB 3PGDB 2VITB 1NCBL 2HTLC 2OM5A 1FBIL 2F5AL 4R8WH 1E4KA 4OCRH 3NIGF 5FK9A 1JNLL 2CUIA 4HFWB 1CLYL 3S6CA 2YRPA 3P3YA 3UTTE 2VH5L 5CBAB 1KV3A 3U7WL 4X9BA 3QG6A 4GRMA 4G6KL 4UIMB 4P46C 2RFXB 4YHOH 3GHBL 3KPOB 4MA8L 1W0VB 2BCKB 3HZYA 5L88H 1U0QA 1EXUB 2QKIA 2EXWD 3VFUA 3ARFB 3B9KD 4U1NA 3NCMA 3NFSH 5BRZE 2Z92A 4P9HH 4RBPH 4ZFOA 3I85A 2OR9L 3E1F1 4K8RC 3HNSH 1F4WH 3HMXA 1EUUA 5KS9E 5KOVC 4JM2B 3QQ9C 2FATH 3HI1B 1Y6MR 3L3DB 2ZUQB 5MEOB 3MUGB 3K1DA 2I9LA 4BSWB 4UV4H 2W0LA 4PLOB 1J1XL 5CLWA 5CHNB 1MCOH 4S11A 4ZXBD 1MJJB 3HC4H 1C12B 3RVXD 1HN1A 2CDEB 4HLJA 3GSOA 4PYHA 5IHZA 3I75A 1XZ0B 4P46A 2VDQL 4RISH 3DVNA 2P48B 3L3GB 5K9JL 2CUMA 1TQBC 5ESQB 2VJXA 4EEEA 4D94A 3SDDA 3MRNB 5B22A 4DUWA 4LFHG 3FQUA 2A6IB 4NO3A 1YEGH 4YDJA 5FA3A 1NGPL 4JFHE 1BZQK 2R2CA 2HH0L 1KJ2B 4HPOH 4JZJA 2R8SH 4OJFH 4NQUA 3WUZA 4DKEL 1EEZB 4JQXC 4PBVC 1SMOA 3BKJH 4G8EA 4AIZB 5E0QA 5JNYB 3VGHA 4XPBL 1X5LA 1YUHA 2DYPB 4UOJA 1QLFA 1P6FA 3FKUS 4PJXB 2HKFH 4ERSH 1MFDH 1BFSA 1S9WB 1E4XI 3HI6L 5DWUL 1UADC 4UBDD 5KG9B 1M71B 1U8JA 3QA3B 3DX7A 1CGUA 3O8XC 2X4TA 1I85C 2XNAB 1JTOA 5ALBL 3ES6B 1X5IA 4DOHE 1UVQB 1IGYA 4GG6B 4UT7H 4E41D 3PL6C 4BELD 2VXVL 5DFWH 3BQUB 1FFOA 2RGSA 3LRSA 1OD7A 3BPCB 3GGWB 4X0KB 1NBQA 3WEXA 1G7HB 1ZANH 3L3HB 4Y4KC 3MNWA 3U9UB 3P77B 4P57B 1UWEH 1R0AH 4JQXA 2O5XL 2OS7A 4WUUA 5DVOA 1ADQH 1BFTA 4JKKA 1MHEB 3F62A 3MUJA 5CIPB 4P2QB 4KUCD 1AGFA 2EIBA 4X5WB 2XY1A 4YDKH 3FZUD 4XCCH 4QXUL 2AK4A 2HT3C 4ODUA 3LSOA 3RGHA 1OAQL 4Q9QL 3FFDA 5LXGL 1G7JB 1NFKA 1QO3A 4W6YB 4H26A 4JRYD 1RHFA 4OZHF 1I85A 2X7LB 4GRLA 1OSZB 1T7WA 4HIXH 3DMMD 1MVUA 1SY6L 2AGJH 2VDKH 4HT1L 3PL6A 2VABA 1KF9B 4BKLA 5IW3A 4ZPVB 5B39A 5EU6A 2KBGA 4B50A 4PJHB 3F7PC 4QHUA 4N5EC 2P8MB 4YXKL 2AJSH 3FHQA 1NUNB 4FMFA 5DA0B 4KZDH 3ROLA 1G6RA 1GGCL 5IK3A 5I1HH 1KYOJ 1WC7A 1OSPL 1A1MA 4KPHL 5TQ2H 3EJZD 3CPLA 3GI8L 4YH6A 2VAAA 2FHBA 3GMQA 3P30L 1JZ7A 3CMOH 3TH3T 3VGAC 1ZKAA 4IIQB 5D1ZD 1ZT4A 5BXFB 1CGSH 1ZV5A 1OD9A 3RVWD 5E99H 1FNLA 2PYEA 3ARBC 3IKCA 2Q7YB 3LS4H 1QZ1A 4Q6IC 2F19L 2R1XA 3WNNA 4I0PA 5JLZB 4LCUB 5DQDL 5K9OB 2Y5TB 5HJ3B 1CICD 3RU8L 5F1IA 1MJUH 3MACH 1BWMA 2AEQL 1HHJB 3OJDA 4XP5H 1O0VA 1ZEAH 1J7VR 4G8GA 4ZUWA 4HULB 2OBGA 1B0RB 4DTGH 2FO4B 1A2YB 4L4TA 5F7KC 4M7LL 1G9NC 4AG4H 1KPRB 3FT2A 3MO1A 4JM2F 1FIGL 1KYOK 4U3HA 4JCMA 1OQXA 1A7OL 4UAOC 5BV7B 4N9GB 2AI0H 3GKWL 4Z7NE 4I0CC 5IQ9B 3G6DH 32C2A 4ZDHB 1SM3L 2R4SL 2PTVA 3B5HA 4TSAL 4HJJH 2YA0A 5F1KC 3U0WL 2NCMA 4S1DD 4U6VH 1YJDH 1KIQB 1S7RA 3QPXL 3ARBA 2VR5A 1G7MB 1YNLL 2UY6A 1XGRA 1Z3GL 5TH2B 4NUJB 3EO0A 2ITCB 4PJ8A 2WINA 5DT1L 3RWDB 4RCAA 1OT1A 4NFDA 3QJFA 2D0HA 4X83A 2GITA 3N06B 3IETA 2QEJA 1GGUA 3AU1A 1JZ3A 3VWJC 4GMSL 3N50A 3DO3A 2I07A 4O5LL 4JG1H 4HD9A 4DZBB 2ADIA 1I1CA 4FXLA 5HYJD 3IDUA 3DOSA 4NT6B 4F2MA 3MLSH 3LKOA 4M6AA 4F7MA 2OMBA 3I3EA 1IBGL 3H0TA 2D2OA 4JFZH 3RPKA 5FO7A 1P7HL 2HT2C 4PJXF 1OAYL 4WUUE 4I1NB 4EBQL 3OQ3B 5L0QB 2HFGL 1CVRA 3U83A 1I3UA 3LPGA 2W38A 1MEXH 3WHE1 1QYGL 4N8CL 1D7FA 2PYFA 4JY4A 3EFDL 4P3CL 5J89A 1RIVL 3QJHB 2AK4E 3O11A 5DEGA 3VWJA 5GZND 4OB5H 4GG6F 3GSNA 3GMNA 1NKRA 1UACH 2BNUB 5EZJB 1HQ4B 2YKLH 2VDMH 3IJHA 1BHGA 1WZKA 4YHIA 3GM8A 4C59B 1J1OL 2YPLB 1GIGH 3HNVL 3HR6A 4POZD 4LVNB 5EU6E 1EV2E 4L5FL 3BXNA 3B9DA 5JXAH 4MNQD 3IDXL 3RWJB 1WCQA 3KPQB 1S9VB 1MNUH 4M9PA 1NGQL 4FG6C 4YX2H 4N0CC 4XNYL 5D7LA 4K9EL 5T1KA 3IS0X 4LLUA 4RAUB 5ERWA 5FM5O 3WSQL 1MELA 3LEXA 2XN9D 4NM4L 2R1YB 5FKAB 3C6SB 3LD8C 4LRIC 4ZTOL 3H42H 4PRID 3DX9B 2APTA 1W72A 1BX2B 1ZSDB 3QXAB 4O4YH 5LWYL 4NJAL 1QRND 4ZYKA 2PYEE 4WI4A 3H8NA 4JEGB 4PJHF 1A5FH 4EIZC 5EORL 4ZFFB 4NNXA 5D6CB 2N7BA 3MRCA 3U48A 2UUDK 5MI0B 2ICES 4L8BB 1KIRB 1RMFH 4KDVA 5DMKA 4G8GE 3ILPA 4LGPB 1A1NB 4IRSD 4L4TE 4F80A 3D3VA 1F13A 5IIEB 3CX2A 4NZUL 4PG9B 4MHHI 4G9FB 3NCYS 3CLEH 3KYKH 2BVOA 4AYFA 3PGFL 1NFDA 2VL5B 3TBVA 1UQSA 5IOPB 1X5HA 5CINL 4LQFL 1MRFL 2HLAB 3I6KB 5F7FA 1UCBH 3FO0H 4G43B 3FT3B 3UYRL 2DL9A 1L7IH 5C3TA 1S9YA 1T89C 3ZTNH 4UU9A 1V3MA 4PBXA 1ZOXA 1OWWA 4X8XA 2CLRB 5ILTH 3ARGD 3AS3A 4LHUD 2XTJC 3GIZL 1JPTL 3U6RB 1NGXA 3BP6A 3L1OL 5IGXH 4GRWB 2ESVA 3KPNA 3TO4C 2AABL 3RWIA 1HI6B 4KXZI 4XC3L 3TYFB 1DSFL 1PY4A 1DEDA 3FMGH 3OGCA 5K9KA 5AAWA 2DQIH 3WN5B 1QFUL 3MV7A 4MX7B 2VLKB 4KROB 4OLWH 3BPNC 2NY5H 3HKFA 1N4XL 3V9FA 3B4NA 4UQ2A 4OZ4A 1QR4A 2GT9A 4HC1H 3VRJA 4IRJB 3RHWF 2R1WB 2A2QT 4PP1C 2EH7H 4JFDD 1S9XB 4GS7B 4HUNB 1S5HA 4HX1A 3KXFB 4DN3L 1Q9OB 3IFPB 4M6OL 3LH2H 4LDEB 3FN0L 5CGMA 1RJZA 5LGHH 4JFOA 3B9AA 5E56A 4DN4H 3OB0H 3HR5B 2VXUL 4XCYA 2BFVH 2X05A 4I3RH 5FO8B 4NQSA 1FFPA 3FO2A 4Y16D 5CBEA 4XVTH 4I18B 3ZYIA 4Q9CA 4ODVL 1DEEB 1CDUA 3NFNB 3WD5L 2FECI 2APFA 3MNVB 4Z0BH 1A02N 5BZWA 3R06A 2X1QA 4TVPE 1U2HA 1U36A 4ELMB 2LVEA 1PQZB 5IFHH 3VXPA 1RI8A 3CAFA 5H35A 2G9HB 5D7LE 3HRZA 2F53B 4FQLH 4PJAB 3RQ3A 3MFFA 1DLHB 5K59E 3S98A 2NLJA 3QP3A 2W07A 4WU7A 3RIFK 1IC7H 1D5ZB 1E6OH 4OCRL 2Z31B 3VFRA 4BQ6A 5DD1H 1QFOA 2X1OA 1T80A 3VFOB 1QD0A 2J8HA 3MRQA 5DHVA 1NCNA 1DQLH 2C3WA 4GXVH 4LCYA 3G5YA 2R23A 3N1GC 3VD3A 1UFUA 3VXRB 4YHOL 2EXWC 3B9KC 3GHEH 1CL7H 3OR7B 4NQVB 4PJ9D 3ZT5A 5L88L 1T1ZA 2UZXB 4OCSL 4UQ3A 5EUKB 2HG5A 2E9BA 5F7MC 5HD8D 2YUZA 3NFSL 2X1PA 3SDCA 4P9HL 1YMMA 2RJMA 3D3VE 4MA3B 5IVOA 1F4WL 4QRQB 4QXWA 5A43C 1JV5A 1XF3B 1QVOB 2DM2A 3DGCR 5GRJL 3DX8B 1EVTC 2W9LA 4JQIH 1NFDE 5DJXA 2EDHA 5DRNA 4ZXBC 4UV4L 1WITA 3SY0B 5KSBF 3MLTB 4PGCA 3RVXC 3W81A 1MCOL 3HC4L 1RZ8A 1NGWA 4HWBA 1PG7X 3PP3H 2B5IC 3X11A 2CRIA 4MCYA 2KDGA 3RUGB 5FCSH 2H32H 2ZSWA 1ACYH 4JFEB 4XBEH 2XWJA 4RISL 3NIDE 4X8JB 1CD1A 3B9KA 1T1YA 4Z77A 5CCKH 1VADB 3OSKA 4LAJH 5DEZA 5ENWA 2ESVE 2A6KA 4CU7A 4LKCA 2VLRB 2O61A 5ETUB 4PRDA 1TMCB 1AGDB 1ODAA 3H9HA 5INDB 3QEQB 1G0YR 1X5XA 2P8LA 3MV7E 4LEOB 2WV3A 4YHPB 4HPOL 1AJ7H 3QQ3A 4DWHA 3RTQD 2R8SL 4OJFL 3S4SB 1DANU 2GSGA 3L3OB 2DICA 1DL7H 5GGUA 3BKJL 1ZGLA 4AEHL 1KGCD 4J1UB 3TBWB 1PDKA 4AY0A 1Q0XH 3MV8D 2HKFL 4GRWF 1MFDL 4ERSL 5L2KB 4UBDC 1CFTA 4ODSH 4YGAB 1G7LA 5KZCB 4AM0A 4R26H 4U6HA 4Z95H 4AMKH 3OKMB 4IRZL 2JCCA 1I7UB 4Z7UA 1C5CH 2V17H 1B4JH 3U0TB 1K6QH 1P7QD 2B20A 5E6IB 3VA2C 5E8OB 4K3DL 1MLCA 1E4WH 1MFCH 4UT7L 3CK0H 5ESVB 4J23A 3SGKA 3GSWB 3DRTB 1F4YH 3AREB 5MENA 3L3IA 3BKYH 3F8UB 1DFBH 2AJVH 1MCFA 1ZANL 2VKXA 4IHOA 2PO6A 2WQ8A 5I2IA 1UWEL 5HHPA 1A7RH 2FEDD 1DDHA 4BFIA 1AY1H 1ADQL 1H5BA 5C0RL 3JV5A 1U93B 1VDGA 1G7IB 3FZUC 3Q0HA 3QWOA 3VGAB 3BZEA 4YDKL 1UM4H 3LS5H 3MRPB 2Y36L 4XP1H 5GJTH 4XCCL 7FABH 2JELH 1L9NA 3D39B 4XB7A 3T0DA 4Y4HD 1I9IL 5J9PA 4XAWH 2CJUL 1VGEH 4XBPA 4TUOA 4P5KB 2CPCA 3DMMC 3MJ8B 4Q6IB 4CNIA 4M03A 3EOAA 4RWHA 1RSFA 4HIXL 4MYWB 4XNXH 3V4VH 2AGJL 2VDKL 4ISVB 4QRUA 1GAFL 1A7QH 5CILL 1HE7A 1QKZH 3OXSA 2D3VA 4ELMF 3OKNA 2ZKHH 3FN9A 4IS6A 4M93B 2AJSL 1AI1H 1VFBA 4OCWH 3OPZH 2AW2A 4KZDL 2YR3A 2OXHA 4KVNH 1XR9A 3EJZC 5I1HL 2R0KH 3LHPH 2YSSA 4PJAF 3BP4B 3I6GA 1YMME 4ODTH 1ZHLB 5TQ2L 5KAQG 1MSPA 5D1ZC 1A6AA 5JPNB 2JK5B 4KTYA 4LPWA 4OCNC 4JRYA 4NRZB 2B7DT 3RVWC 1CGSL 4WU5A 3U0PA 2VDNL 2DQDH 3A6BH 5E99L 3TIEB 1BGXH 5JZ7D 3CFEB 4RDQF 5F1SA 1E4XH 5J6GA 1YEHL