4PLJD

Hepatitis e virus e2s domain (genotype iv) in complex with a neutralizing antibody 8g12
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
223
structure length
216
Chain Sequence
QLQQSGPELVKPGASVKISCKASGYTFTDFNMHWVKQSHGKSLEWIGYIYPYNGITGQNQKFKSKATLTVDNSSSSAYMELRSLTSEDSAVYYCARERFGVGNNYAWFTYWGQGTLVTVSSAKTTPPSVYPLAPTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immume system
molecule keywords Capsid protein
publication title Structural basis for the neutralization of hepatitis E virus by a cross-genotype antibody
pubmed doi rcsb
source organism Hepatitis e virus
total genus 41
structure length 216
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pljD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pljD02
4O58H 4JRXB 3D25A 1NBVL 3F7QA 4L4VE 2VN4A 4JG0H 4GKOA 4ALAH 5F72S 3R06A 4CJ1A 2B39A 1GAFL 1MCKA 4Z8FL 2DQHL 5KN5A 1VEMA 3MRRB 4MNHB 3T0DA 3UYRL 4N8VB 3NCFB 1BWMA 3GKZA 1DUYA 3OR6A 5CLTA 1M71A 4M7ZB 3LKQB 3T3MF 4D9LL 2AI0H 2CO6B 2NMSA 4X4MA 1B6UA 1BD2B 4R90H 3N1GC 4X4YA 2ITCB 1BZ7A 2OS7A 4RMSA 1PZ5A 1TVHA 4CW1A 3UJTH 1S78D 4LCWE 2DBLL 4L5FL 1DLHA 2JJTA 5TGBA 1HQRA 2ESVA 2VUYA 4F7PA 1KTKE 2QBWA 4JJ5A 3AAZB 2Y23A 3QQ9C 1FZMA 2Q8AL 1N5AA 2EC9U 4XP9L 1KIPB 5EBLB 2MTPA 4R4NC 3VRJA 5BXFB 3BEVB 3QA3A 2R39A 4LQ1A 1BWWA 2VLRE 1PG7X 1NCBH 5E24E 2IPKA 3RI5K 2HTLD 4YQXH 2MOVA 5C7XL 3OXSB 2VZUA 2XN9E 3B9KD 3QXTA 5SV3A 2ENSA 3MNWB 5L8JB 3BP7A 2QQKH 2J88H 4F33A 4ZUVA 1A6VL 4PJFF 4QXGL 1I8LA 4JFFB 2QKIB 4NKOA 5DXWA 4ZUSA 4PJFA 3OAYH 4X5WB 3HZKA 5F1SA 2R56H 4POYA 4XC1H 3WE6A 2VXTL 3ALXA 1C12B 3N06B 1KTDB 3PHSA 4UINL 2IGFL 4M6ML 3D0LB 3IFPB 3BZDA 1TZIA 1YPZF 1TCRB 5E56A 4JFZL 1VDGA 2N4IA 3BGAA 3QUMB 4Y2DB 5B4MC 2APBA 2BFVH 5F7EL 5IEHB 5TJWK 1I1AB 1OGAD 3ME0A 1OB1A 4HCRH 3JVGA 32C2B 4PTUA 1IT9L 3GI9H 2RFXB 3WKML 5IB1A 4X6BA 4TSBL 1HILB 5IB2A 4X8JA 4ONOA 4BQ6A 1FNSH 4P5TB 3D2UB 3L5HA 2VABB 3QHZH 5I1KH 1BLNB 1UVQB 2VIRA 1I4FB 1XGUB 3TIEA 5BV7L 4K9EL 4AMKH 3P11H 4YHNB 1M6OA 1QR4A 3MRMB 3WN5A 2OJEA 3SDDB 4N90E 1YQVL 4KY1H 4YUEL 4LGSB 3PP4H 4KK5D 2XTJB 4OFIA 1HDMB 5F8RC 5A16B 1YC7A 4PRIA 5D1QD 5EOQL 1T0PB 2WBKA 3OHXB 3RUGB 4R0LA 2YA1A 5DUML 2HVJB 4GOSA 3H7BA 1RZJC 1RMFL 5ETUB 3WNLA 3U4EA 3WHE0 4M3JA 2H2PC 4DKFH 1KN2H 2Z92A 4K71B 4GXUM 1QFOA 1KBGL 4OLUL 1KC5L 1SYVA 4FXLA 2R2CA 5SV4A 3JTSB 2FL5B 4G8GE 5CJ5A 3S37X 3LHPH 3SE3A 3BGFB 3O9WC 1CD1A 5CJQL 4G8FB 4MJIA 1FIGL 4CNIB 2GSGB 4YE4L 3HC0A 1QPPA 4N5UA 3KXFD 1BFSA 2OK0L 1F4YH 5ANMA 1SYSB 2P44B 3QXDA 3QDJA 2BHYA 4LNRB 3EZ8A 3OGCB 1AD9B 4RDQF 4BFIB 4OUOA 3H9SD 1DQML 3QEQA 4NQEE 2ZNWA 4HXBL 3MV7E 4UB0H 4LP4A 2O5XL 4H20H 4I3SH 3LB6C 5E5UB 5J3HC 4JFQA 5EU6D 3UJIL 1JZ5A 1CFSB 5JUEL 4UT9L 3IAPA 3VD7A 1G7MB 3BP4B 1FH5H 3DLQR 3PNWA 2SEBA 1KCKA 3EDEA 3EZJB 2YD6A 5HYSA 3FCTB 1AXTH 5EZJA 3P0YL 5KVMC 1SMAA 4F57L 3PWNA 4F7MA 4HS6B 3VFSA 1MRDH 4CU7A 3MOAL 1A9EA 3VXQA 2HWZL 4M6AA 5TF0A 1F6FB 2BRRH 2FECL 1EEZA 1YMMA 3QZWA 3HI1B 4WUUD 3WNMA 1P69B 4AYFA 1PBYA 2BSTB 1KXQE 2D7PA 4PJ5D 4JQIH 4OKVA 4K3EL 3TZVC 2EDRA 1P2CB 3RGHA 3EO0A 2HKFH 4J3XA 4ZFFA 3PDGA 1KEML 3GRWL 1I3VA 2VDKH 5F3BA 4FQCL 4E41A 3D87B 3DSFL 3EHBD 4EUPG 2EDEA 2VZOA 1K8DA 4WWKA 2LABA 2PCPA 1E6OL 1X5ZA 3LEXA 1GHFH 5C09E 2BNQE 4PTTA 5DVMA 3QO0B 3OAZK 3ECBA 4PREB 1I3RB 3IXAB 5CLWA 1DBJH 4QY8A 3HFML 4NM8H 4OM1L 1A64A 1UKSA 4P2OB 3MJ6A 3N1FC 1T7WA 1F5WA 3BPCB 1HH9B 3GBLA 4JM4H 2PTUA 3AFLA 5F97E 3ZTNL 1MCWM 5IMKB 2CSPA 4NIKB 3ZDZF 3BZ4B 2D3VA 2X9WA 1MCEA 2NTFA 2VJXA 5HDBF 3EAKA 1K3ZA 4JFDB 4PJ7F 1CL7L 4YBQD 5EA0L 1RU9H 4HULB 1AXSA 3DVGA 1QNZH 5GISH 1QEWA 1RJZA 5HVFB 1JI1A 4NCC1 4LPXA 1CZ8L 3BQUB 5KOVC 3O3BB 1JCKA 3O6FC 4MXQC 3C6LA 1PJ9A 1LP9B 3IDYB 4UAOB 2BOBA 3BIBX 4HIHB 3JV4A 4NBYB 2ORBH 3QT2A 1A5FL 2BRQA 2A6JA 2AERT 3GSOB 5IHZB 2NY4D 3DARA 2GTWA 2HTKD 5I76A 1MREH 2H2SD 3B43A 1VGEH 1RJLA 3IRZA 4Z7QF 1WZKA 4JEGB 6CGTA 3DRQB 3MCKB 4KGJA 4GXVL 4ONGL 4O4YH 4OD3L 2LE9A 1GGTA 4NC1C 4OF6A 1YDPB 3GSQA 2PKDA 4LHUD 4HBCL 1TVBA 3GMNA 5C07E 3TBTA 5L2KB 4AG4H 3O6KL 4I4WB 4TSAH 4BFEA 5E8PB 1ADQL 1KJVB 4BFBD 4XI5C 1F58L 4K07A 3H3PL 2XQYG 1IGYB 1IAII 2NXYB 3HCVB 2ARJB 4RFOL 3FO2B 5IROA 3NTCH 5T3XH 3WEXA 1FL3A 1A14H 4HS3B 4D0CB 3HZVA 1OAYL 1B2WH 4M61B 3E6FA 3V0WL 1BF2A 3VG9C 5BCAA 3GMLB 2YUWA 3ILQD 1D9KB 4H1LB 2AXHA 4NO3B 3D3VB 2J5LB 4Q7DA 4I48B 1GCFA 1Q0XH 3MX0A 2YKLH 4MJ6A 1CICB 4DZBA 4QHKI 5DVLA 3V0VB 2Y07H 3HMXH 1YEHL 5AYUL 3WLWC 2P8PB 2XZCH 4M8QB 3QXVA 4OQ1A 2PR4L 2G5BB 5LXGL 5E1AB 2VR5A 2X70B 3ULUL 5KANI 1JWSA 2DQCL 4XPAH 1DVFC 5EOCJ 5KS9B 3UX9B 4PG9A 3BZEA 4ZXBC 1OGAE 3WO3B 2O5ZH 4HW6A 3W11D 4WI5A 1C16B 5DI8A 1BP3B 1MFCH 4DFHA 2WBJD 1KPVA 4KJYB 4M7KH 4R4FL 4C57C 1E0OB 3H9HB 5EZIL 1FAIH 3PGFH 4WI3A 4OGXH 5FECA 2X4QA 3J8F7 3P4OB 2LU3A 3AU1B 5C8JB 3R8QA 3G6DH 3VA6A 1R5VA 2QQNL 5DLMH 3U2SB 1INEH 3T0BA 5MEND 3I02B 5F7DA 2ICWA 4FQXD 4OZFB 2ADJB 5DD5H 3OAYK 4LRIC 2NX5A 5F7NC 3PG2A 1QRNB 4XPGH 1ZKAA 4JHAH 4Z0XB 3ARDA 2BHUA 4XMLL 2F74B 1FVEB 4N0CD 4XBPB 2VTFA 3UTTA 4JM2D 4IRJC 3AXLB 3PDOB 3BP6A 5GS0H 2VDRH 3IDXL 1FNGA 2FNBA 4XCFH 3HA0A 5DQDH 2YD7A 3DGCR 1A2YA 4E9LA 1FO0H 5GRYA 1U3HB 1U8IA 1MCOH 2X1XR 4NJ9H 2APVA 2E6JA 2Y4SA 4N0UB 4YHOH 4Q58C 4Y19B 3NIFF 1QVOB 4WWID 2NLJA 5DD0H 4EEEA 1AJ7H 1QSFD 3SCMC 2BERA 4WGVB 1T2QL 2AK4A 1K6QL 3WIFA 1ITBB 1UB5B 2HFGL 4L8BA 5FV2A 4Q2ZB 4FXKA 4EIZC 3ILPB 4NQUA 1QACA 2FHBA 5CJOH 5J12C 2R1WB 2E9JA 1C5CH 2IBBA 3KXFE 3ARWA 1P84K 1G9NL 2CK2A 3DVNB 1MHPL 4OV5A 1AR2A 4JRWA 2K1MA 2PO6B 2PXYD 3BP5A 3H9SE 3HAEH 4Y1AB 5JHDD 2ZCKH 1CGWA 4XP6L 4IRSB 4U1SA 4WO4A 1QFPA 1K5NA 4YHZL 3B6SB 5JXAH 4J3UA 5FKPA 1XGRA 4XMPL 3UTSA 2GTZB 2VRAA 4LF3B 4PJ9D 2OTWB 4YHIB 4XNXH 3RZCD 1JYNA 1DANU 4PRNB 5DD1L 1I1YA 1N59A 3RWHA 1FNLA 3CC5B 4YXLL 1CK0L 5D5MF 1X6NA 3L5JA 1S9YB 5HI3D 5F7YC 5ESVB 3IKCB 4XVUC 4LSSL 5D5MA 4GW1B 4QT5B 3DXAA 3HG1E 5IHLB 3NZ8A 4YBLC 2G9HA 4CL7A 5FGCE 2QSCL 1C7SA 4AIZA 1OT2A 1LD9B 2D31A 4UV4H 4U1KA 4JN1L 5BZWB 4U1LA 4PJ5E 3FQUB 4Z76A 5HHMD 2MJWA 3NACH 3ZLQC 4NQCA 2VLMD 1QHOA 1RUAL 2HG5A 3U0TA 5L88H 1NLDL 3B9VA 4YNYB 1U8PB 3KJ4C 5T1LA 1FL5A 4YFLI 4FG6D 2OBGA 5DJCB 5BZDB 2YN3A 5I6XB 5C6PB 1PKQB 3KPRA 4P48A 2RBLA 2IANE 3S4SA 4F2MB 3K0WA 1LNUA 3UPRB 1R6VA 1ZLSL 3MA9H 2EDKA 4MMXC 3MJ9A 4YR6B 2OQJA 5KSBF 4S2SB 2IG2H 4J3TA 5ISZE 5KSBA 3JWDC 3VGGA 4TNVK 3X3FH 1Z9LA 3KDMB 3RDTA 3S9DB 2NTSP 1EPFA 3O6MH 3VFGL 2CKBL 3NAAH 2D0FA 1OP5H 1QYGH 1XGPA 4JFXB 5D6DC 1LE5B 3HE6A 1FFNA 3O45A 1BEYH 5BV7B 4D3CL 1DSFL 1MAML 5AWNH 3UBXB 4Y4HD 3K2MC 5DEZA 5I18H 2AJZB 2BDNH 4WW2B 2FJHA 3TH3T 2EEBA 4QHLA 5TPWL 3HB3D 4GBXD 1UWEH 1AY1H 4LARL 4PGCA 4XNMB 1YJDL 3JWOL 5CCKH 1FFQA 2C5DC 4N9OB 1RURH 4E42B 4JO1H 4TNVF 4P23B 4MWFA 3I84A 2BJML 1FC1A 1RZJL 1N4XL 1OLZA 5EC1A 4HGWA 4X9FA 3PGDA 5C2BL 1FGNL 2KKQA 5CD3A 4PJIB 3C09B 2N7BA 1Y0LA 4MJ5A 3LS5L 4QRSB 5F9OH 1HXMB 4OCRH 4UIMA 4FTVD 2GY7B 2FH8A 5DJXA 1EO8L 3O0RL 1UEYA 1ZV5A 3IYLW 2JJTC 5GGVL 1HOCB 1ZSDA 5BRZA 3C5JA 3FTGB 4KRPC 3EDJA 5ILTH 5LGHH 2V9RA 5EUOE 3VRIB 3W0WB 1N7MH 4W81A 3QQ3A 5D2NB 4LLMB 3MRGB 4X6FB 2P24A 4ORGB 4PJDB 5L2JA 3SGJC 1AO7B 2B1AL 4W6WB 4HJGA 2ERJC 1RZ7L 2BOCB 4PV9B 4K23H 1SY6H 2C4XA 1LO5B 1U3YA 4EOWH 3GJEA 4KK9C 4FZEH 3VFUA 3W9EB 1U6AH 4EI5C 1DQJA 4U2ZA 4S1SL 4XTRD 3MUGA 5HY9B 5D1XD 5HGBB 4BSVB 5HTSA 5E2UL 1J8HA 4HC1H 3O3UN 3B2UC 4Y5XA 1V7ML 1BQSA 4X7CC 3HC3H 4ZUUB 1L9NA 4EUPA 1AD0A 4UQ3B 1BIIB 2AK1L 2PF6A 3C60A 4Q9RL 3OBAA 4IOIB 2WUBH 1CIUA 1L4IA 1OPGL 2FATL 4GG6E 4PJBB 5EO9B 1HHIB 3U30C 2W65A 3MNZB 1VESA 1S9WA 1BQHB 2R0LL 5D72L 1NC2A 1MWAH 2DYPB 2YEZA 4JZJB 3QRGH 2HKHL 4ZUWA 1EERB 1QD0A 3IDJA 4QXTB 1KB9K 4NP4L 4WV1A 1VFMA 4QOKD 3EGSA 1HKFA 1SEBB 1WBZA 3DROA 3IFNL 2JCCB 1OTTD 3NIDF 4Y16B 1T03H 4FQ2L 4Z77B 1DEDA 2P48B 3I6GB 3U36A 3GUTA 4XZUA 5MENE 5ICYB 4PY8I 5E2TL 5I0DA 1MHCA 3TH4T 4RX4D 5DS8A 4ENED 3QUYD 2VISB 1CD9B 4QRRB 4KQ3H 1AKJD 2NY1B 2P7TA 1ZANL 4P4KB 2ZOKB 4KPHL 4XHQA 4JDVB 2I26N 4Y4KC 4PD4J 1E4XI 4FQLL 5DRXB 2VC2H 4KFZC 1S3KL 3AB0C 2F19L 2YBRB 4MAYA 2XKNB 5L6YL 2H32B 4XXDA 1W72H 3SDCA 2EDLA 3WJJC 3VWKA 4WY7L 4OFYD 3QDMA 3BAEL 4KKLC 3NZHL 5CGMA 1OP3H 3VFRB 5IR1B 4M00A 4NZJA 4QCIA 2EYRA 5A1AA 4WEUD 4L8DB 5AD0B 2A73A 1CXIA 3VGDA 3RGVB 1UA6L 4KUZH 2IALA 5SWSD 5GS1A 3QPXH 3OJMB 2EZ0D 1H5BB 1OAQH 5C0BD 2HLAA 3QNXA 4HJJL 4YHYC 4N68A 5F88A 3EOTH 4GRLA 4Z7VE 3EOAB 3HMXA 3SE3C 1JYWA 1YEDA 3VFTB 5J9PA 1UACH 2NXZB 3JTTB 5JHDE 3RTQB 1ORQA 3K81A 3TO4D 1JZ3A 1EUTA 4C56A 3BD4A 1TENA 2JB5L 5H37H 5HXMA 2IADB 4Y4FC 2IBZY 1CE1L 3R1GH 4ODXB 3DX7B 1H3TA 3TBSA 1K4DB 4FABH 5BVPL 1FQ9C 1CTOA 1AGDB 1A3LH 1LO2L 2F5AL 1UXSA 3QIUD 3O4LB 4N8CL 4G9DB 2OX5A 1NCCL 3QWRD 3DUSB 3LEVL 1PY4A 2DIJA 5FV1L 1CGUA 4R3SB 1JPSL 1S7QA 1F3JA 2NNAB 1ZHLB 3C5ZA 1MLBA 1JV5A 3O4OB 4RGMC 1UXWB 4FFVC 1XCQB 1NMAL 4Q74A 4IOFD 1EV2E 1UCBH 1BFOA 3GB7A 1CBVL 3NIGE 4HXAH 3BO8B 2BK8A 3KS0J 1MRCL 1QOKA 2VLME 4YC2C 4CVUA 3FFDB 1EFXA 4I3RH 4A6YH 5I1LA 2CD0A 3FO1A 1CU4H 4DN4H 4LFHD 1OF2A 4HJ0D 1HSBB 5E8EA 3RAJL 1BD2D 2R23B 3I6KA 4MSWB 1N0LA 1VGKB 2A9MH 1R5IB 3L6FA 4GRWB 5GRVK 3DJ9A 4P59L 4DN3L 1YEGL 4S1QH 2FEEL 4JZNA 4RZCB 2H8PB 3BDXA 5DHVH 2R4RH 2BC4B 3SKJH 5D7LB 1DN0B 3KPNB 3MBED 1YY9C 3BT2L 5KANG 3T1WA 4DKAA 3RWIB 2F9BT 4PJEB 1TDQA 4DGVH 4G6KL 1W0YT 2VLKA 1FSKB 1F4WH 2F58L 4NRXB 3FRPG 1I85A 5E9DE 2CLVA 1RHFA 3GZKA 3OZ9L 4YHPB 5D2LE 1AGBA 2V7HB 5J56B 2FHFA 4KI5F 2EKSA 4KJWC 4L9LA 1Q94A 5E4IA 3VCLA 1NBQA 2AJUL 2Z31B 2ATKB 4HK0A 3P4MA 3G5YB 3OKKB 4FFYH 5SX4H 3HAEA 3T2NL 4UTBH 4L4TB 2A0LD 5JW3L 1ZT7B 4YEEA 4JANA 12E8H 5EOCL 1KENL 1KXVC 4LIQE 4JFFD 4ODVH 4IMLB 1U8HB 2DIAA 2GCYA 2PTTA 4UU9B 4XC3H 5HYJA 3MOBL 1BM3L 2NR6D 3MROB 2ZKHL 4JKKA 5JOPD 1P9MA 5DJDA 3RU8H 4KKCD 4M43H 5FUZL 1ORSB 1O5DT 1YEIH 4K94H 2GJ6B 4U31A 1MUJA 3KHOA 4DVRL 2DM7A 4FTVE 1HK6A 2A2QT 3EYSL 4P46A 4Y2DD 4ZOEA 3NH7H 1D5IH 4ZUTB 2V17H 1ZA6A 3OB8A 3D85B 4YPGB 2FX7H 1OP5K 4PJXE 5DRWB 2HFEB 3KYNA 1KCRL 1GH7A 1HE7A 4ODWB 2ZUXA 1QZ1A 4ZNEE 5DHYB 3BH8B 1FGVH 1K85A 1MFNA 1G7IA 2XTLA 4P5TD 4AY0A 5H94B 1T3FA 4QTIH 3Q5OA 5IIEA 2BSSA 3FB8A 4XVSL 4XCEA 3SDYH 1I9JH 4QKXB 3BRGC 5AZ2L 1G6RL 5CGYD 4KAQL 3SDDD 1S5IH 2X4TB 4IRZL 4X4ZA 3S6CA 2R2BB 4NZTL 1T1WB 3WIIH 1MCPL 4WFEE 1JTOA 4YAQA 3MGTB 1R0AL 3QBTB 1NFKA 3QDGD 3K7UA 4DUXA 3CVHH 5I1DA 4DFIA 1BBDL 1MFBL 25C8L 4U0RC 2AJVL 4HS8H 3C2AH 5JPMA 4JLRA 3TC9A 3MCLL 1G7JA 5EU5A 3VDCA 2NZ9D 3TT3L 3MRHB 3R4DA 1KJ3L 1N64L 2ICWJ 5K9KA 1ITCA 1RZIA 1NMCC 3B3IB 3I2CL 4G7YL 1P6FA 5C9KA 1U42A 1UM5H 3HN3A 3TA3A 3F6IA 3UP1A 3V8CA 4P3CH 4V1DB 1SM3H 2CRZA 4XRCB 1GJIA 4BSWB 4QOKE 1KPRB 5ALCL 3SKOA 2NW3A 1OSPL 3QXAA 3WNPA 4L3AA 5DT1H 4ZFZB 5IF0A 3KWWB 5IB3A 1N3NA 3MLVH 5GJTL 4J23A 3REWB 3ZSTA 5DO2C 2OTUA 4BUGA 2HT4C 4JHWL 3WS6C 1JPTL 1SEQL 1A4JA 5KZCB 1IBGH 2UWEB 3GMRA 4R26H 5T3ZD 1ZLWH 4IS6A 2XA8L 1NCAH 3S8WA 3EJYC 2YPLA 4G8IB 3JWDL 1F4XL 3ARDC 3EOBA 3QIBD 4L3ED 4HH9B 3V6OA 4FZ8L 2V2TA 2DQUH 4M5ZH 3GSUB 2CKBB 5EZOL 5C0AD 2X4PB 1NFIA 2VQ1B 3ARTA 2WWMC 4LAJH 4KK6D 5DFWH 3F7RA 5DMGC 4HPOH 3HZMA 4L3CB 1N6VA 5GRUL 3BWAB 3TN0C 3RA7L 4L4VA 5FYKU 1SY6A 1NLBH 4OZHB 4Q0XL 5IVZB 1F11A 3FQRB 1VADA 5SWSE 1RV6X 5CSZB 3SQOH 4KXZI 2ITDA 5C0BE 3RX8A 3W5NA 4O2EA 3W9DA 4KRMB 2UVEA 2BNUB 4I13B 5JHLH 3A6CL 4QTHA 5KVGH 3S88H 5JW4N 4HUWA 2YXFA 3RHWK 1P5VA 1UM4L 2Z4QA 5K59E 1FVCA 5ENWB 3MLUH 3MLYL 3U79A 4LCWA 2G75B 1CR9H 4Q9QL 4EI6B 4LL9A 3U9PL 1HIML 1GC1H 2FYYA 3RKDD 4M48H 2XWJA 3T77B 1P84J 5T5FH 4L1DA 3TJHC 4OGYH 1HQ4A 4BH7B 2VDML 3WS3A 1OD9A 2ATPA 1EUUA 3GJFB 1EJOL 1OP3K 3O9WB 1RUKH 1LILA 2VLRA 5ELIA 4P2OD 5ACMA 3OGOE 4UILH 2AXFA 3RWGA 2YN5A 3CUPA 1W8OA 2VE6A 3ULSB 4BA8A 3CCHA 3VH8B 4QRTA 2EO9A 1MI5B 3HRPA 5KW9L 1MRFH 5CD5C 5I8OL 5E6YA 2OZ4A 4XT1C 3SY0A 5IHUL 3MSPA 2EH8H 2Q86A 5GPRA 3BQUD 3LS4H 4YDVB 3KR3L 1HKLH 1BGXH 3OKLA 4Z7UF 4OZIB 1JNHA 1X3DA 5J1TC 1WUNT 2CGRH 4MNGB 3RZWA 1W72A 4P5MA 3OJ2C 1NAMA 1RZ8A 5B39G 1BD2E 4OCNC 3G5ZA 5ERWB 5DC9B 3UTZB 4ZSOB 3RL2A 1U8OA 5I9QB 3T8XB 3WIHL 1H3WM 3FRUA 3VFNA 4J4PD 1NGXB 3LKPB 3QUXB 4OZ4A 4LDLB 3U4BH 4FQ1H 2ARJQ 5I8CA 5CJ8A 5L2KD 1T20A 4OB5H 4MCZB 3TZVB 2XZZA 4U6YA 4D0DA 2C1PA 4U1IB 3HNTL 4OCXH 1N0XH 4G9FD 1T5XB 2ILLA 5D96C 4S0TD 4S1RL 4WUKH 3RVXD 3S36X 4HDIA 3B2VL 3HE6C 1MFDL 3O3EB 4NBZB 1ZVSA 4JFFE 4RAUB 1JZ6A 2CK0H 1D9KD 1X44A 5GSRB 1ZHNB 3KPOA 4M1DH 4I3GA 2IH3B 4LP5A 4F15B 1HEZB 3L5IA 4U1HA 1JWUB 3P4NB 3L3OA 1FFRA 3ZDXE 5JZ7C 3TVMD 5BVJB 2V5SA 5CWSA 1X4XA 3S7GA 3QI9D 1F97A 3MR9B 3L3DA 2VB5A 1XF5B 2YC1A 4LLYB 1XF3B 4NHUA 4OFDA 4XB8A 4MD0A 1ETZA 1ZOXA 4EVNA 3L3JB 4Z6AT 4LEXH 5F44A 1KYOK 4GAFB 4HKBA 2L7UA 2OCFD 3O6FB 4Z18A 3ARED 4HPYH 4LOUC 2HFFA 3EYUH 4OLZH 3LN4B 2Y5TB 3NFPB 3QG6A 1DUZA 3TYFA 4NNYA 4RBPH 2HA1A 4BZ2H 5CGTA 4XPTH 4ZQKA 3BN9D 4PLOB 2ZWLT 5T1KD 3HNSH 2F8OA 3VXRD 4JAMA 1JGVH 5F1KC 2YXMA 2W60B 2J4WH 2YZ8A 4JFED 1MHEA 4WEMB 3VXSB 4NQEA 4LHUG 1D6VH 3MV7A 3ZKSD 2APXA 3VRLE 3OAUL 1CFNB 3RX5A 4AQ1B 3PV6A 3CDGB 2YS4A 2YOCA 2DQTH 1QRND 5C86A 4WI6A 4XBGB 3ROLA 4LEOB 1QBLH 3NCYS 3CFKA 1IQWL 5FYLD 3U7WH 2OSLA 4OGAC 4ZYKA 2VH5L 2VXUH 2AJYL 5LQBL 4G42A 1F2QA 3RUGE 5I66B 2M1KA 3G6AB 1JN6A 4NZUL 2J6EL 2OP4H 4GH7B 1K2DA 5JW4R 4KU1A 1E6JH 3MCG1 4Y5XC 4I18B 5E94A 3HI5H 5FYKL 4LRNL 4I77H 1IL1A 1MJ8L 3C60C 3VG9B 3VJ6A 1UM6L 1MLCB 1D6EB 4ISVB 1R3JA 4Y19D 2V5YA 2X4SA 2D4DA 1RK1B 4P4RB 1U8MB 1SHMA 3QDAA 1G9MH 3KYKL 3P4LA 3NPZB 3D5OF 3CU1A 4PJCF 4Z5RB 1IGFL 5GRZA 5HGAA 2GJJA 1U8KA 1JRHL 1YEJL 1A7QL 5JR1L 1J5OH 5IQ9A 1FNHA 1DEEB 1KB9J 1OTSC 1OSZB 1RUPH 5C09A 1IZJA 2BNQA 2PO6D 4OFVA 4H8WH 5CBAA 4MQ7B 4Y1AD 1DVFB 1CGVA 2P8LA 4ZXBB 2WIIA 1ZHKA 2V7NA 3F7YA 5HYQA 4NO2B 5T3ZE 4MXWL 4UDUB 4KMQA 1XEDA 1E4WH 1HNGA 4JFPA 4HT1L 4JR9L 3RVWC 5GGSA 2BHZA 1Y6KR 4JKLA 4C58B 1JHLH 3GIVA 4PGDA 2FB4L 4YX2H 2IH1B 2F5BL 1BJ1H 1NGPH 3SDCC 3MRCA 1I7TA 3VWKC 4M62L 4APQC 2GITA 5CIPB 3FB7A 1BECA 5C0GA 3OG6B 3JBG7 4HQQH 4XX1E 5GRJH 4OI9A 3RVVD 4PLKC 5SWZB 4LAQH 3FKUS 1HHGB 1GIGH 3ZE1F 1KEGH 4YXHH 3V5DB 1WZ1H 4YO0B 3FT2B 5IWLC 5GS1C 5JORA 2Y72A 4IRJB 2XFXA 4P99A 4G7VL 1LMKA 4TULH 9CGTA 1WZMA 1X5YA 1LO0L 3GNML 3AGVA 4LU5H 2WUCH 4GRLC 3WUWG 2K3TA 5CEYA 1D5MA 1CFBA 3PWLA 1KFAH 2WQRA 1D5XA 4TPRH 4X83A 2G2RB 3LKSB 3LKOA 3ARFC 3KPSD 5C07A 1ZLWK 4OQTA 4ZS6C 2Q8BL 1TITA 3SCMB 4C83A 1RI8A 2W0FA 4OD1L 2K7PA 4UT6H 4P2QB 5J12B 2A74A 2EDYA 2ICEA 1LE9A 1KJMB 5ACZA 1IM3B 3T4YA 2VXVH 1PG7W 3HS0B 1FVDA 4JKPH 4R4BB 1MCDA 3N85L 3VFOA 4M3KB 2F53B 1HYRC 1G6RB 3TT1H 3GSWB 3OJVC 1A6UL 1AFVH 1LP9E 5DEGA 5EFIA 2RJMA 4CBPA 2BCKA 4LQFH 5F71A 2VZVA 3MRKB 3MRFA 4DZ8B 1DBMH 4UDTB 3X12B 2VXSH 1A7PH 5FA3B 4P23D 1EVUA 5IBUG 5GS0C 5DMIL 3CDFA 1OGAA 2X4OB 1Q9LB 4PRID 2EXYC 2X1OA 5DTFB 5JTWA 5IK3B 3P9MB 1JWMB 5L2KE 1XF4A 1R3KA 4G6FB 1CLYH 1QFUH 4PUBH 5J1AB 4NPYB 3T2QA 4O58L 3E6HB 4KTDH 1KOAA 3N1QC 4JG0L 5DJ0A 3X13A 2R9HC 4ALAL 3RVUD 2AS5M 2JJSA 3FT4A 1DQDH 3KJ4B 4JPVH 3K46A 3MV01 3DX9A 2E5EA 1AO7D 4L9LC 2AI0L 2I9LB 4R90L 2ADFH 1KJ2A 4I1NB 1XGYH 4KI5C 4H5SB 4KGLA 3UJTL 5D1QA 3OKEA 4G3YH 2ID5A 3GSVA 3STLA 2HJLA 2IAMA 3H6JA 3D3VE 4XNUH 3TEUA 4QHNA 4X7TA 4U1JB 1OAKH 1YN7A 4K55A 4D9QD 1T1ZB 1T4KB 4XH2B 3AVEA 3QEQD 3FB5A 4N0RA 5DK0B 1I9RH 1C5DB 3OKNA 3FFCB 5EN2B 3CJJA 3V95A 3DI3B 3GMOB 3VGEA 4WFHE 5F6HJ 1NCBL 4TQEH 4QHUA 4X99A 5KS9E 5IFAH 1U92B 1P7HL 3CSGA 2WINA 1IC5H 5DZNA 2AV7B 5D7IB 3P73A 4X9HA 4YQXL 1WF5A 1EMTH 4BH8A 2B20A 3FB6B 1KCVH 3QG7H 4P46C 5GJSH 2QQKL 2J88L 4MX7A 3MA7B 1JGEA 3KXFA 4GW5B 4NQXB 5EU4B 1KGCE 5JOFB 1UWGH 5B8CC 1MSPA 4Y16D 3EJZC 5D8JH 3VXRE 1BMGA 3H9SA 4KJPC 1A9BB 2R56L 4M9PA 4XC1L 3SO5A 1WITA 2DM2A 3PGCA 4JZOB 2LV4A 1U41A 4QRRD 3SDAD 2X4NB 3UC0H 5J4MA 2NY1D 1PZ5B 5FUCC 2EDFA 2X7LA 4TNWK 3V6FA 1YNTA 1QRNE 4P4KD 5FHAH 4LVOC 3MJ7B 5DMKB 3QHFH 1SVCP 1NKOA 3QEGH 1ZGLA 1IEAB 5CKGA 5A2IH 1PZUB 4F7PB 2FR4B 4J3VA 4OT1H 1B4JH 4RFEA 2BFVL 3O3DA 1JPGB 4ZOAA 3BH9A 4RAVA 4WHTB 4HCRL 2AJ3B 3QULB 4RAHA 4P5KA 2W9DH 3HG1A 3GI9L 1T22A 1X4YA 4I0PC 1N5YH 1CD0A 3QA3B 1JGDA 5GRWA 4S0SD 2ERJB 2NY2C 5DQJA 5CZVH 3HC4H 5J1SC 3IVKA 1FNSL 4N0UE 3C8KA 4Y19E 2IPKB 1CCZA 4PJ5A 3RJQB 3QHZL 5I1KL 4RBPK 3RGVD 1FBIH 4EI5B 5BOZG 5JNYB 1RULH 4AMKL 4P9HH 3BP7B 3P11L 4HHAA 4TNWF 3N9GH 3TFKD 4KY1L 4O2FA 3PP4L 3TA3C 3LMJH 3Q3GA 3FO0H 1QFWH 1S9VB 4PJFB 2VITA 3FOMA 5I17A 3CZFB 4HWEH 3DX6A 1AE6H 3QH3B 2ZSWB 3KVQA 2NXZD 4XWOC 1A3QA 4Y1AE 2E9BA 1WC7B 4GKNA 3U30B 3OF6D 3H42H 2ADIA 5C0JB 2A6KB 5F9JB 4FQIH 3SKMA 5ISZA 5T1DH 3QNZA 4DKFL 3SGEH 1KN2L 1S8DA 2CMRH 1AHWB 4WVRA 1YPZB 1AC6A 5DSCB 1OB1B 3O4LD 3V4VH 1RIHH 4RISH 5D9SA 4NUJA 3JV5A 3LHPL 3MJGX 4FXGA 5B38B 4ZAKD 1Z0NA 4AEHH 2ZG3A 1M7DB 4Z0BH 2AKRB 3U4AA 1F4YL 2NY6C 1RFDH 1NQBA 4F9LA 2CQVA 2MCPH 2XIDA 4Y4KB 1IEHA 3AY4A 2OJEB 4KUCD 1M05B 2PW1A 4HV8A 2PETA 3S3PA 4UB0L 4H20L 4LGRB 4FA8A 2Z91A 2QR0A 3GMPA 4I3SL 2P47B 2YUVA 5JW4Q 1FH5L 2V5MA 4NM4H 4UIKH 1PKQE 1AXTL 1EIBA 4LHUA 4AL8H 3ULUD 3MQIA 1MRDL 3GK8H 4OUUA 3LPWA 3CVIH 1G7PA 3T3PF 5GIRB 3U4EB 2AV1A 2BRRL 3VGFA 5M95B 2DWEB 3CZJA 4PRBA 5EUOF 2DDQH 5EBWA 4C4KT 3TYGH 5D7LD 3VMNA 5EUOA 2CUMA 4YHYB 3FONA 4ZS7H 5DGQA 3GEWB 3QRFM 2HMID 3U6RA 3NA9H 1AIFA 4JQIL 1UZ6E 2JB6B 2NY0B 1CD1B 3EOYG 35C8H 5AAWA 2HKFL 1KB5H 3K2UH 4F7EB 3GHBH 4JO4H 2VDKL 1AGCA 4BKLB 3BXNA 3MRPA 1ZMYA 5ALBH 1HWHB 4L4TD 4Y4FB 1RIUH 3TP4A 1WISA 2R0ZH 1REIA 1GHFL 4R7NB 4JPIB 3SKNB 1NC4B 1YQ2A 4NKIH 5FFLA 4GAYA 4PV8A 2ZNXA 4QGYA 1ZEAH 1PX4A 4JFQB 3VWJD 1A7NH 2DLFH 1DBJL 2QADC 1AR1C 5HYSB 3VU2A 4GG6A 4W70A 5EZJB 4PRHB 3GM0A 2YMXH 4PJIE 4JM4L 3VFSB 4S1DD 4HH8A 3BPNB 4RGMB 1JNNH 3NMEA 1YUHB 3MRLA 2KBGA 3WBDA 5JW4M 5DDHA 4PJ8C 1OAUH 1BX2B 4K3GA 3TBYA 2GJ6D 5MEOA 2WBJA 2EECA 4NKMA 2DQDH 5C0CD 1YNLH 3BZFA 1H8NA 1J88A 1RU9L 3AMLA 3H8NA 4N8VG 5C0DA 4CN4A 1QNZL 5GISL 1EHAA 1IC4H 4OZGB 2HLFD 4PGEB 3S96A 5B22A 3W0WE 1CLZH 1T1YB 4Y88A 1EEYA 5D2NE 5MENA 2DJSA 2ORBL 4PJDE 1LEKB 5E8NB 3D69A 3FQTB 2GEEA 3QEHB 1NKRA 1AO7E 3EDDA 4Q6IC 1NGWB 4FQXA 4QYOB 4U6HB 3V5KA 1CDUA 4GG8A 4NQVB 1CFVH 1TQBB 2IEPA 3QCUH 4GS7B 1MREL 2R69H 1VGEL 5BMFH 4CMMB 1FG2A 4JM2F 5TDOA 5IOPB 3L3GA 1FG9C 4O4YL 3LEXB 3CFEB 3DIFA 4JM2A 4KHXH 1B0RA 5FK9A 3ECBB 4KDTA 2MQ3A 4LMQI 4MA8H 5FDYA 5BQ7A 5KSVA 4AG4L 1FZKA 3V4PH 3OXRB 4TSAL 4PY7A 4OGZA 1I3GH 3FQNB 5DD6A 4NO5B 4LCYB 1R3HB 3NTCL 3BI9X 5T3XL 2VL5A 4LCCA 1JHKH 5INDA 4OIAA 4PJBE 3CH1B 3VFPB 1A14L 2EYSA 5AYQA 5TDNB 1K8IA 4OAWA 5T1MA 2BSRB 1B2WL 1QEWB 4PJ7B 1OP9A 4Z7VA 4ELKB 5AZEH 2F8XC 2JCCE 2DJUA 4OV6F 1KYOJ 1PX3A 3O2VH 2PXYA 3T0AA 2A6JB 5JHDA 3PHQB 5I2IB 1Q0XL 2PYEB 1ERNA 2YKLL 5DJ8A 1ZT1A 3P0GB 2Y07L 3HMXL 1RJLB 4QRRE 3G6JB 2XZCL 3F7VA 3PWVB 1IQDB 4PJ9A 4QRPD 5B4MD 1G0YR 3MODH 1NEZB 3DMMA 5INCB 5KZCD 3EYQC 2ZOLA 4XPAL 3GSQB 3V9FA 3TBTB 3WFHB 6FABH 3LDBC 3UBXI 4NN7C 5JOEA 5IMMA 2O5ZL 1S7TA 4KK8C 1A1NA 1CDBA 1MFCL 5IMLA 4M7KL 1NCTA 5J8OA 1FAIL 3PGFL 4OGXL 4KDWA 1F6AB 4G43A 4HWBA 3KPQA 1MCHA 5IT2H 2I25N 2EDHA 3G6DL 4GRMA 5FYJU 1F90H 1HNFA 4KTYA 1JNLH 4RMWA 3L9RB 4IM8A 5DLML 1WTLA 1INEL 2CIKA 3BSZH 2DTMH 4U1MB 1YN6A 5IM7B 3WJLA 2J12B 1OGTA 2LU7A 5DD5L 3LV3A 5TE7H 4WI7A 5CKAA 5LAXA 4I8DA 4XPGL 4JHAL 1XGQB 5D6CA 1U8JB 3LKRB 4U0RB 4ODHH 5LWYH 1AGEA 4DZBB 5F6IC 2DBJA 4UNUA 2YPVH 3UTQA 1PYWA 2FSEA 4LSPH 5GS0L 2VDNH 2VDRL 4XCFL 3ARGC 5DQDL 3F12A 3SQBA 4BJLA 4HIIB 1FO0L 1NMCB 3STBA 1MCOL 4TUKH 3WHXA 1KACB 4NJ9L 5D2LF 4K94C 4YHOL 1F8TH 3IXTB 5D2LA 2P8MB 3O4LE 4F3FA 5DD0L 1AJ7L 4Z7WF 1HHJA 3MV11 1A1MA 3KLDA 4X6DB 2UZIH 4WFFD 2CDGA 1T5WA 1DE4B 4Y4HA 2GUOB 3G9VA 5CJOL 2M2DA 5B3NA 2EDXA 3W2DH 1C5CL 4WTZG 1H3VA 1MI5D 3V7MA 1R5VB 1S7UB 3MRIA 5FUOH 1FNEB 5IB5B 2CXKA 3ZYOA 2DQGH 5FHBH 4GBXA 5HHNB 3NABH 4LLDA 2A6DB 2FECI 1SJEB 2ZCKL 4XPFH 1ZLVH 3ZZ1A 1UADC 5TQ0H 4PLJC 5JXAL 4KV5E 4LLVA 4XCYA 1ZT4A 3M1BA 5FGSA 5JW5A 1M1SA 4M7JH 5IGXH 5C3TA 1RY7B 5GRVL 4XNXL 1A6TA 1Q0YH 1NANH 4L8SA 2LAGB 2FX9H 1MCWW 3MV9D 4M7LH 3PJSA 1KLUB 1XR8A 4JFHD 5AUMB 3VE0A 3ULUE 1FNGB 3TN0B 4J2XA 4FTVA 4GRWE 4JO3H 4PJXF 4F37K 2A1WH 4I0CC 4K7PH 3G5XB 1DDHA 3QUXD 4MD4A 3D18B 3BIAX 4PJXA 4GKZA 1H3GA 1KELH 5D7LE 2CLZA 4MDJA 4PJEE 2YD8A 3TZVD 4UV4L 4ZO6A 1T83A 4C4KO 2XWTA 3WIFB 3RVTD 5FOBB 3NACL 4FXKB 2OJZH 5DYOA 3DX8A 2MQ0A 2HTLC 4P3WA 1T7YA 5L88L 1JK8B 3O8XB 1E4KA 3B9KC 4L4TE 4H0IA 3X17A 1ONQA 1LEIB 5D1XA 5F7MC 1K4CA 1WIOA 3BP5B 3QQ4B 1SJVA 2WAHA 3EYOA 3TIDA 4M6OH 4U1SB 1CL7I 1K5NB 1FL6B 3RFZC 5HHXH 2D9CA 1EA9C 3MA9L 3LH2H 4X6CF 4CN1A 2HH0H 5JXED 2IG2L 3QWOB 5DRNB 4X6CA 2IPTH 1I1YB 4QRQA 5EORH 1WTGT 4Q9BA 1MIMH 3X3FL 5E0QA 1IZKA 4G80B 5ID0A 2ZCLH 5D7JA 5CP7A 3O6ML 2GJ6E 3NAAL 3LN9A 1QYGL 3DV6A 4MAYD 3WLBA 3UPCA 1H15A 1BEYL 3F7PC 4JRYB 3JV6A 5B39B 3O6FD 4QOKA 1OAXH 4TUJB 5AWNL 3AS2A 5IFJA 1X7QA 1KIRB 4U1KB 3VFMA 5I18L 4HD9A 2BDNL 2F54D 3M45A 3GGWA 4NWTH 3O11B 4WRLA 2EIBA 1RUMH 3D48R 1UWEL 1AY1L 3QUYA 3U0TB 1AKJA 5CHNA 5HHOB 5CCKL 5MEPA 1CDIA 1RURL 5IVOA 4JO1L 1KIQB 1R3LB 3VXSD 4DK3A 4K2UH 4YXKH 4P9MH 3KPRB 4HIEB 2NW2A 5L8LB 4KK5C 1GC1C 1LNUB 2DF3A 5F9OL 4FMFA 5H2BA 4OFYA 4XI5D 1I8MA 4OCRL 3VXTB 2BXYA 1M7IA 3IDGB 1IGCH 1UZ8A 3PWJA 3OJDA 3S35H 1NH6A 5GGVY 5JIIA 2LVCA 5D96B 4WU5B 5GZND 3RIFF 5ILTL 5LGHL 3IKKA 1N7ML 1GGIH 2R1YA 5DZOA 3QFDA 3RRQA 1KB5A 1C1EH 2ICCA 5SWSA 3HE6B 1VEPA 5K9JH 3O45B 3QPQD 4JY4B 5C0BA 1GOGA 2AGJH 4L29B 5EH1A 5DJAA 5DJ6A 4V1DE 3WUZA 1JVKA 4K23L 3BD3A 3FOLA 1SY6L 2A9NH 4JKWA 5F21B 4F8TA 5A3ID 5K59F 4EOWL 2DQFB 4WU7A 4FZEL 4DUVA 3VD4A 1U6AL 3GSNA 4PBVC 4QHLB 3QFJB 1T21A 3CMOH 1J10A 4HC1L 3KPPA 3MYZA 4GKSA 3D39D 5EOTB 1ES0A 2G60H 1QFWI 2D7NA 3HC3L 4QRPE 1EHLH 4HGWB 2WUBL 2B0SH 4XNZC 4BYHA 1EFXD 1Y18A 3QIUA 1CLOH 2UWEE 5E8OB 4UIMB 3EO1A 3MMEA 3QWRA 4OF8A 1EGJA 1MWAL 2DRUA 1LO4H 5TE6H 1NEUA 3QRGL 1T04A 3C5JB 4CVZB 3BPLB 3PWUB 2I9TA 3SE8H 3QIWC 3JUZA 2J8UB 3QQ3B 2YRLA 1JL8A 5IBTH 4B7LA 4OZFG 1T03L 2JELH 4AEEA 1G7QA 4OZHE 4HJGB 3F8UB 4TTGA 4MNHA 3U46B 4KHTH 4N8VA 1JJUA 3MRBB 4BZ1H 3MXVH 4JGMA 4KQ3L 1T1XA 5IEKA 5CS7A 2HVKB 1DQJB 3I3EA 3QAZC 3IGAB 1BD2A 2IC2A 2VC2L 2EDJA 2ITCA 4DVBB 1B9ZA 3EHBC 5I8EA 1W72L 4EJ1C 1RZKC 1T7VA 3MRQB 3C60B 2CIIA 3VI4E 2YUZA 1ZS8B 4R7DB 4DQOH 4M1CC 5FYLH 3AAZA 2C3WA 1OHQA 2C3VB 1TQCC 1KIPA 1QR1B 5EBLA 2YD4A 5BXFA 1NFDB 1N8ZA 3AS1A 4KUZL 4X9BA 1BPVA 2EICA 4WFFE 3QPXL 3T0XA 1OAQL 1L0QA 1TLKA 3OXSA 1WBZB 3DROB 1FPTH 3UAJD 3EOTL 1MI5E 3ZTJH 3OPZH 3MNWA 4NQDD 4XGZB 5D71H 3VW3H 1KTRL 4XZUB 2F53D 1WWBX 3IJHB 1UACL 1MHCB 5H8DA 2GJZA 4JFFA 2QKIA 1RD6A 2EO1A 2P7TB 1H9VA 4X5WA 2G5RA 3VI3E 3ZDXF 1KN4H 3MLTB 4OZIE 3MYJA 5CSGA 3BW9B 4MNGE 5FKAA 4F9LC 5FF6B 1C12A 1MVUB 1EXUB 2JIXB 2ZUVA 4K7PY 1BIHA 3AY4C 2NY4C 1PVHA 3R1GL 1P7KA 2HTKC 4YH6A 1G9EA 4FABL 3MV9E 1A3LL 1LEGB 2H2SC 4LPTA 4JFHE 1U2CA 4XVUD 3SDCB 4ZSOE 4ONHB 1FYTD 1P4BH 5SX5H 1NBZA 3QDMB 3QUMA 4Y2DA 4P57B 4APQB 5KSUB 1S9XA 3MGAA 2BVOB 5L7XH 1I1AA 1AC0A 2W59A 1DBBH 3BEWB 4QCIB 32C2A 5A2KH 4NYLB 3DO7B 5IJKC 5CEZL 1UJ3C 2A73B 1HILA 1MQKH 1CXFA 2IALB 1UCBL 4P5TA 3D2UA 4HXAL 2BVTA 2VABA 2P5EB 3QNXB 1BLNA 5J7CC 1UVQA 3VFWB 4HX1B 5F88B 1I4FA 1XGUA 4GRLB 3E2HC 3SO3C 4YHNA 3ZDYE 2C7UA 1D5ZB 3QHTC 5TDPB 3MRMA 3CH8A 2FBOJ 4I3RL 4D2NA 5KOMC 3SDDA 1BJ1J 3P77B 4A6YL 5ADOH 3AMKA 1ZLVK 1JF1A 1CU4L 4DN4L 3ARFB 4NOFA 5EULV 1WCQA 4LKCB 4ZO8A 4XPBH 5A16A 3UDWA 1P7QB 2A9ML 3RUGF 4H8WC 4C56B 3QDGA 3UTPD 4S1QL 4X4XA 5JLZA 3RUGA 1JGUH 2HVJA 1ODAA 2R4RL 4I2XB 3SKJL 1TXKA 1G0DA 3Q6GH 1U95B 1HINH 3W82A 4DGVL 3ET9F 1F4WL 1KTLB 3WMSA 1QLRB 3DVFA 3UBXG 4AJ0A 2H26A 4UNVA 5E08H 3TPUA 1VACA 1GGCH 3GBMH 3B8YA 1PQZB 1J1XH 4V2CB 3GMQA 5BW7A 3RWDB 3BDBA 3C2SA 3JTSA 2FL5A 3W11C 4FFYL 4UTBL 2W92A 1RK0B 2EDOA 4G8FA 4O02H 5I15H 2F54E 3UTOA 3GB7B 1IILE 2GSGA 12E8L 3NGBC 3KPMB 1SYSA 4M93C 5HHQB 4ODVL 4LNRA 1ZXQA 3NPSC 3OGCA 3K4ZA 1DQLH 1AD9A 4BFIA 4XC3L 3S5LA 2D2OA 3FO1B 3VXSE 1WT5A 4G8EA 4WTZA 1OF2B 8FABB 2ZUTA 1Q1JH 1FO0B 3CXDH 3LCYA 3RU8L 4M43L 1JGLH 1CFSA 2WMPA 1IFHH 3L6FB 3VD3A 1YEIL 4K94L 4N0CC 3THMH 3FCTA 5C0AA 4LCWD 3TJEH 3NH7L 4HS6A 1D5IL 2V17L 4IIQC 4JM2C 2FX7L 4WTWA 4KDTC 3WXWH 5E03A 4PP1D 4LSVH 2CRMA 3HI1A 3UROR 4AENB 1G1YA 1UQSA 1FGVL 5DUPH 4L9LB 1JYVA 5F1OB 1A6AB 5JMOC 2BSTA 1JNJA 1GZQA 2UZXB 1X5AA 3HAEB 1BZQK 5HPOA 4QTIL 4NHCH 4X7SH 2WWKT 4UMGA 1P2CA 4O51A 4EI5D 3SDYL 5J89A 4HUVA 1I9JL 5D1ZD 2MCG1 2XN9D 1S5IL 2IPUG 4PPTA 2ARWA 3X11B 3WIIL 3QP3A 2GCYB 2MSPA 4RNRB 1S7RB 3TO2A 2GY5A 2KZ1B 5GS3A 5IFHH 5HJ3A 5GHWH 3CVHL 3QO0A 1H3UA 1OQOA 1BQHG 4HS8L 3C2AL 3ZL4H 1Y6NR 3WDJA 1MUJB 4P2OA 3BPCA 1HH9A 1S7VB 3RZCC 1U36A 3O2DH 2XRAH 4HKXA 5D7KD 1UM5L 5IMKA 5B8CB 4P3CL 3BZ4A 1SM3L 1QSEB 4Y5YB 5I1EH 5IKCA 2AEWA 1IGIH 5IBLD 1BHGA 4X80H 3NFNB 2NYYD 3LRSB 5DT1L 3BQUA 2IJ0C 3O3BA 4JB9H 3MLVL 4IDJH 5I0ZA 3RWCB 5SWZE 4HIHA 2HRLA 3M17A 4XCEB 5IP4A 3GSOA 2BP3A 2VYRE 4CN6A 3C08H 4WDIB 5JQHC 3WJLC 4HZLA 1FFOB 4N90D 4OM0H 3AS3A 3DRQA 3MCKA 2E7LA 1IBGL 4R26L 1NCAL 2APTA 2XPGA 4FOMA 4I0PB 4FG6C 4J4PA 3CFDB 4ZTOH 4E5XA 1VERA 4NN6C 1YDPA 2DQUL 4M5ZL 4PP2A 5EC2B 5L2KA 5JPMB 1DANT 3UO1H 1II4E 3BE1H 4HPOL 5I1GH 5EU5B 1BAFH 5E8PA 1HH6A 2A77H 1IGYA 1T6WA 4OLEA 3HCVA 2ARJA 3L3KB 5K9KB 1RZIB 1NLBL 4G9FA 2D0GA 2VLLB 4P2QE 3LPFA 4PRPB 5FAAA 4ZDHA 2RR3A 3VXUB 4HAFA 3SQOL 3BKCH 4HS3A 4JPWH 3IJYB 3KS0H 5C0RH 2NY0D 5EO0B 1CGYA 4M61A 3EFFB 5JHLL 3CXHK 4G8GD 3MRDB 4I0KA 5KVGL 3S88L 5IF0B 5EO1A 1Z9OA 3IU3B 2F53E 4Q6YA 3GMLA 1G0XA 5DJYB 2DAVA 4CJ0A 5JA9A 4Y4HC 1QA9A 1D9KA 3MLUL 4H1LA 1L7IH 4QO1A 3D6GA 1CR9L 4XMKH 5HI5D 3D3VA 4I48A 4Y4FD 1GC1L 4M48L 3HB3C 4CVXB 3V0VA 5T5FL 1NC4D 4LLWA 4OGYL 4L8CB 2P8PA 1S7XB 4M8QA 4NQED 2PW2B 4O2CA 5HBBA 2O26U 3Q5YA 2ZZUT 4IS6B 3MV7D 1MCIA 2YPLB 3RWFA 1YNKH 2G5BA 5DK3A 2X70A 1RUKL 4HWNA 4X9IA 2MKLC 5KS9A 2X4UB 3I85A 4UILL 4L8SC 3DV4B 3FT3B 3CMGA 3HRZA 3T65B 3ES6B 2ZG1A 1C16A 3V6ZB 5FCUH 2VKWA 1J1OH 2VDOH 3H9HA 4L4VB 1MRFL 3OR7B 1F11B 3BKMH 2BY3A 3HPJB 3P4OA 2YRZA 1A0QH 3AU1A 5C8JA 5T1KA 2FEEI 2EH8L 3LS4L 3VXRA 4I5BA 4O2EB 4P9HC 1HKLL 3ZHDA 1JPST 1BGXL 4JFEA 3KG5A 3U2SA 3HR5B 3E3QC 1XFPA 4J3OC 2CGRL 3PDDA 1T83C 3ARUA 4HUWB 5I74C 2Z4QB 2ADJA 1LK2A 1QRNA 3M07A 4HUXB 4Z0XA 3VG0H 3U7YH 1FVEA 3T0EB 4XBPA 5T5NG 1JTTA 1IAMA 1NMBH 2FYYB 3UTPE 4XTRC 2Y25A 5D1XC 4IMKC 3AXLA 1YY9D 4G6AD 4CDHA 4O9HH 3QXUA 3U4BL 4FQ1L 1MWAB 5JPNB 5SX5K 2AEPH 4NGHH 4OB5L 1U3HA 2DS4A 4MQXD 2AEQH 1CFTB 5LCVH 1MCSA 3FFCE 4N0UA 1ZAGA 4Y19A 3MV8B 2FZ3B 1MFAH 1QVOA 4OCXL 1N0XL 1CDCA 2WBWB 3CCHB 3S3JA 2ADGA 4GSDH 3CLEH 5D7IE 43C9B 1XAUA 4WUKL 3V4UH 1URLA 1UWXH 2XNAA 3I3BA 4LGPB 5DURB 4Q2ZA 4MDIB 1IGMH 5EB9A 3WSQH 2VZ1A 4LPVA 1T2JA 3DVNA 1BZ9B 2NCMA 1GVIA 3G5VB 4LVEA 3VXOB 2CK0L 1FN4B 2QADB 5I1JH 2PO6A 4JFOB 2A6IA 4M1DL 1IGTA 4H26B 4Z7UB 4Y1AA 1FZOB 2ZP0T 1W72B 1NGQH 2PYED 4P5MB 3UZVB 3IDUA 3CK0H 3B6SA 4ENEC 2P46B 3O3AB 4PJ8B 2GK2A 4QWWD 1YY8B 3G5ZB 4N0YH 1FV1A 4TUOB 4BK4A 1F2XK 2OTWA 4CVWA 4W4NA 4PRNA 2FH6A 2FO1A 4LEXL 2FWOB 3CC5A 4PGBB 3RY5A 3BJLA 4HPYL 4GW4B 5ESVA 1HZHH 1T20B 3BPOC 3WNOA 5H35A 3IKCA 5EWIH 3EYUL 5DWUH 4OLZL 4GW1A 4QT5A 3VD5A 5C07D 3LRGA 1W8NA 4QHMB 4Q6IB 4WENB 4BZ2L 2NY3C 3BUTA 4XB7A 4XPTL 5F89B 3KYAA 4EN3C 4M1GH 3HNSL 2H41A 3MLZH 1JGVL 1ZWIA 1FJ1B 2J4WL 5JO5A 5F7KC 1CTNA 1D6VL 4TTDD 3NFSH 2B2XH 1T0NB 2EZ0C 2HP4A 5DJZB 5DK2B 1H0DB 1U8NB 2V5TA 4HWZA 1ROWA 4YNYA 2WWKO 1U8PA 2DI7A 2DQTL 3LKNB 3ARYA 5KVDH 1QBLL 3WFZA 5DJCA 5BZDA 3PWPB 3U7WL 1PKQA 2VXUL 4NN5C 3I75B 3KPSA 4U1HB 1QHPA 1BVLA 3L3OB 1UYWH 4F2MA 3VMOA 3UPRA 2BVQB 3TO4C 2OP4L 2QSVA 5CWSB 3LQAH 1FZJB 4YR6A 3CX5K 1E6JL 4S2SA 5C08B 3HI5L 5ESQB 4BM7A 4I77L 4N5ED 4EVNB 1TNMA 1L9MA 1FORH 1HI6B 1YPZE 2YD1A 1IKNA 1C5BH 3WCYA 5D7KE 1XIWC 3RBSA 3QIUC 5J13C 4JFXA 4EXPX 3NCJH 1LE5A 1G9ML 5DQ9B 2YA2A 3U0PB 5KAQF 3BIKA 1V7NH 1WFTA 3FMGH 4A6YB 1J18A 4UQ2B 4DKEH 2AJZA 2HT4D 1PD6A 2H1PH 3DURB 2WP3T 2GI7A 2GSIB 4H0HB 1J5OL 5C6WH 1QQDB 4IOFC 1X5GA 3QNYB 1RUPL 4PD4K 4H8WL 1JIBA 4Y0GA 4MVBD 3PIQA 4E42A 4Z7OE 5DHVB 4P23A 1IKFH 1F00I 2DTSA 1NUDA 1EZVY 3CFKB 3IF1B 2QQQA 2I5YH 1E4WL 3L95B 4ZYKB 2JF1A 5IG7A 4PJIA 4HJ0C 4EDXB 4ZFOA 2F15A 4G42B 3V7AG 5GSVB 4QRSA 4MA3B 3MLWH 1JN6B 2FBJH 1XF2B 4JY5H 1NGZB 1JHLL 1K2DB 2ZUQC 3BOVA 2EH7H 2IAMD 1HXMA 3TN0D 4YX2L 1MCCA 3EO9H 4KC3B 1NGPL 1MIEH 5FXCH 1HOCA 5D70H 3VJ6B 3FTGA 2L0DA 1EEUA 3MBEC 1R3JB 3VRIA 3ZKMC 3AROA 4HQQL 5D2NA 5GRJL 3RWJA 3MREB 4PRDB 4LLMA 1U8QB 2UYLB 4LAQL 3MJ9H 4X6FA 5IV2B 1WIPA 3P40A 1GIGL 4L4JA 1AO7A 2RGSA 1KEGL 4YXHL 5F6IB 1WZ1L 4MQSB 2BOCA 3MACH 1PAMA 2E27H 4M6NH 1AI1H 4TULL 5HGAB 4PJCB 1WGOA 1LO5A 3ARGB 2VSCA 1OD7A 5B21A 3W9EA 2X41A 1OQXA 2WUCL 3KPLA 3O8XD 4LU5L 5HY9A 2A0LC 4DOHB 1M7XA 2BNQB 4XAWH 5CINH 5HGBA 5JDJA 1KFAL 4TPRL 4X7FC 5IW1A 5J6HB 3O41B 4YK4B 1JMXA 4B0MM 3DYMA 3J7HA 1PDKA 2V7NB 1EJ6A 3F7YB 3O2DA 4OCMC 1MFEH 2E3VA 1RVFH 4ZUUA 4UQ3A 1BIIA 4EIGB 4IOIA 4NSKB 3HE7D 3VH8G 4KZDH 3LPGA 4UT6L 2FIKB 5FYKE 4PRHE 1I8KA 1WK0A 4KKCC 5EO9A 1HHIA 3MNZA 1T7XA 1BQHA 3EUUA 5EIIB 4MHHI 1BBJB 1MH5B 2VXVL 1MY5A 3T2OA 2DYPA 5CD5D 4JZJA 2R4SH 4JKPL 4Y2DC 3DRTB 1VFAA 2JCCF 4QXTA 4JRYD 1TMCB 1OM3H 3RY6A 4OZGE 3HG1D 3U82B 3TBVB 3TT1L 4OCYH 2JCCA 4Y16A 3SN6N 3AS0A 1AFVL 4Z77A 1JPFB 3I6GA 5ICYA 4LQFL 4TVPH 5TF1H 1NBYB 1Q9WA 5JORB 4DTGH 4P5TC 2VISA 3SDAA 4QRRA 1IGJB 5CJXC 3CVHB 4P4KA 4GMTH 2ZOKA 1DBML 4GLRI 2VXSL 2MKWA 1A7PL 3SE4A 1J1PH 3X14B 2Z0BA 1QLEH 4N1CA 1D5MB 1XR9B 2CDEB 4J1UB 1LO3H 4OTXH 2YBRA 3ARSA 3SGDH 2XKNA 5E5RB 2H32A 4JQVA 4OF3A 1UEMA 4LSTH 2D9QB 4C83B 2IAND 1CLYL 4MGXA 1QFUL 4PUBL 4CKVX 2HT3D 5IR1A 5MI0C 3QB7C 2VDPH 3PF2A 4KTDL 5J57B 1LHZA 5TFSH 4NFCA 4MZ3A 3DUUB 4L8DA 5ISZD 4YHKH 2NY7H 1HYSD 1DQDL 1D7FA 3CFBB 3RGVA 3T4YB 2NZ9C 3B9KB 4KROC 4JPVL 1ZE3C 1U0QA 4EUPH 3LIZH 2JE8A 3VFOB 1H5BA 2R2EA 2HT2C 5HDBE 4PJ7E 3ARBB 4JG1H 2B1HH 1QP1A 3MXWH 5BW7C 2ADFL 1RJCA 1XGYL 4G3YL 3VFTA 4PJGE 5FGBA 5DGRA 4D0BB 1O7VA 4XNUL 2E9WA 4N9GA 3QFJD 4FP8H 2PYEE 4LPCA 1HSAB 1OAKL 3ALWA 2DL2A 3OF6A 1A6ZB 1WVZA 3G6JE 1MOEA 5D7SH 2IADA 1I9RL 2DQEH 4ODXA 1YZZA 5HI4D 1WT5C 1ADQA 1K4DA 3L7FB 1AGDA 4TQEL 3O4LA 4KMTH 5IFAL 4G9DA 3GM8A 3I50H 1R3KB 1IC5L 3ARQA 4MB4A 1EMTL 3QIBC 4ZAKA 2B4CH 1Q9OA 4R3SA 3CDYA 1OY3B 1KCVL 3QG7L 1ZHLA 5DJ0B 5GJSL 4AEFA 5DHXB 1U58B 4KK6C 4Z9KB 1QFHA 4QEGA 4KUCF 5IJVB 1UWGL 1UXWA 1CWVA 1HHHB 1UWXK 3JUYA 3TH2T 5D8JL 5CJBA 1U93A 1CQKA 2VDQH 2QQLH 1A1OA 3C9NA 3ZKXB 3BO8A 1V3JA 2Q6WA 2OR9H 3OX8B 4JN2B 4UUJB 1NL0H 4ODUB 4KKAD 3FFDA 4X8XA 1YEFH 2CUIA 3UC0L 3R0MA 5FHAL 3OKEB 3STLB 3IS0X 5DVNA 4B50A 3ULUF 5HDQH 3QHFL 4HLZG 5F7UA 2FDBP 3QEGL 4GRWF 4YDLC 2R23A 4NBXB 4MSWA 4ZOCA 1WBXA 1HXYB 1VGKA 1B4JL 4OT1L 1CXKA 1R5IA 3MRNB 5IMOB 4J7RA 4RZCA 2H8PA 2W9DL 3LY6A 3RKDC 4M5YH 1N5YL 3V52H 5D7LA 1JRHI 1DN0A 3KPNA 1UKQA 3RWIA 3HC4L 4PJEA 5CZVL 5FEBA 3LRHA 3QEUA 4NRXA 4YHPA 4PLNC 2V7HA 2W9EH 2BY2A 3M8OH 1FBIL 1OAZH 4P2OC 3RNQA 1RULL 4P9HL 1DFBH 4X6DE 3WDHA 3N9GL 3F65A 2ATKA 4MX7B 3G5YA 3OKKA 3LMJL 4L4TA 4IHOB 1OTSD 3MC0A 3FO0L 4P2CG 1QFWL 1IRAY 2YSSB 1SVZA 4HWEL 1AE6L 4PJHF 4XNZB 2WLYA 4IMLA 1UH3A 1FAKT 5E6IB 4PJHA 4PB9H 4UU9A 3RL1B 5A2FA 2WP3O 5EU6B 3VWJA 1NUNB 1XMWA 5ESAB 3H42L 3MROA 4FQIL 2DIBA 1ZGLB 2EIZB 2M8XA 5T1DL 1OW0A 1JUFA 3FQXB 2CMRL 3HZYB 4PJAF 4RFEB 3O3DB 1ORSA 3QIWB 3BH9B 2GJ6A 4PJAA 3V4VL 1A6PA 1DN2A 1RIHL 1T22B 4RISL 5C0CA 1CN4A 2O5YH 4ZUTA 1GGYA 4WUUB 4OLWH 3D85A 3OTTA 4RGNB 4YPGA 3IVKB 3KLHD 5DRWA 4AEHL 2VWEC 4ODWA 4Z0BL 1PEZA 2W1NA 5DC0A 1RFDL 5DHYA 3BH8A 3TWCH 2QHLA 3B8SA 2MCPL 3QAZB 5J6GA 4NDMB 3OKOA 2KDGA 5H94A 2EIEA 1ND0B 1JHTB 2P5ED 1OWRM 1CFQB 1A7OH 2VZTA 3L3IB 3RVXC 3DX6B 5J0BA 1TVDA 2Y6SD 4NM4L 4UIKL 2R2BA 3WFEH 1T1WA 4RA3A 4AL8L 1TQCB 3B9DA 3MGTA 3CXHJ 3GK8L 3TESA 3CVIL 3SKMB 1L0YA 1RIVH 5JQ6H 4WI2A 3QNZB 2D7QA 2PTVA 1AP2B 2DDQL 3TYGL 3MNVB 3DETD 3TVMC 1G6VK 3MRHA 1ZLUH 3QI9C 4ZS7L 1SMOA 4P2RD 3DMMD 3FQWA 1V3LA 3NA9L 1U91B 1XH3B 5HD8D 3B3IA 35C8L 1JF5A 4I9WD 4U1NB 4V1DA 3DTXB 4XRCA 4JRYE 3AREC 1KB5L 3K2UL 4X6EA 1KPRA 3GHBL 4JO4L 3IDIA 1FP5A 2OXHA 3E0GA 5KVFH 2NQCA 1IJ9A 5ALBL 4JDZA 3N1PC 4ODSH 1PGRB 2R1XB 4NKDB 4ZFZA 1RIUL 1DBKH 3QQNA 4KRNA 2PW1B 4RCAA 3REWA 2R0ZL 3CPLB 3BN9C 1HCFX 4NKIL 3WFCH 2UV3A 5HHOE 3N50A 4QRPA 1ZEAL 3DPBA 1A7NL 2DLFL 2UWEF 3P0VH 2YMXL 5C2UB 2UWEA 2DL9A 1UJ3B 1JNNL 1G7PB 3MLRH 5EZLB 1OAUL 4YBHA 4HH9A 4D8PA 3GSUA 2CKBA 1HHKB 5FM5M 2X4PA 2DQDL 3IS1X 5GGUB 1YNLL 2R9HD 2I27N 5EBWB 3SE9H 4OI8A 1W0VB 1IC4L 5F1NB 2ICWI 2J8HA 2CLRA 1P1ZB 2PN5A 3BWAA 2GAZA 3E2HB 3SO3B 5T33H 4B5EA 1CLZL 1YC8A 4OZHA 2X9XA 5IVZA 2JJUA 3RKPA 3FQRA 2XKUA 3GBNH 3HUJB 1WFOA 5CSZA 5E9DD 3MBXH 1DZBA 2XT1B 1J0YA 1G84A 4WCYH 1B0GB 1NDMB 2O93L 2FLBT 3TNNB 3GIZH 3T09A 1CFVL 3LN5B 4D9RD 3QCUL 3L5WB 2R69L 5BMFL 1HN1A 3LSOB 2EDNA 4PG2A 4ZFGH 5FA4B 5I30H 5DZLA 2AXGB 5ENWA 4KHXL 3QFJE 5GGTH 2VAJA 1JZ2A 1IAOB 1VFBB 2G75A 3VI4F 4GAYB 1XCTA 3BD5A 4ELMB 4MA8L 1PG7H 3RBGA 4WI8A 3V4PL 4OJFH 4FQQA 2DLTA 2Z9TA 1PY9A 1I3GL 2GT9B 1JFQH 2Y5EA 3GJFA 4ESKA 1LVEA 3O9WA 3V8OA 1JHKL 5CBEA 5FO8B 5E8DH 1DCLA 2YRPA 3OG4B 4NRZB 1GGBH 1A47A 5C0DB 5AAMA 3NGBB 1E4JA 4M93B 3VH8A 1PSKH 2MHAA 3EJZD 1QSED 4J3WA 1MI5A 3S96B 3ZT5A 3NPSB 5AZEL 2J8UE 4GUPB 4PS4H 3WD5H 1EEYB 1R3IH 3LQZB 3A0OA 1S7SA 5MENB 4DAGH 5LGJA 4ZPTA 4EXKA 3VI3F 1KNOB 1W0WA 4OZIF 4RSVA 4K3HA 4YDVA 1A22B 5KSAB 4OZIA 3RVVC 15C8H 4WNQA 4KI1A 5IVXE 2VAAB 3MODL 3DIFB 4IIQB 3MV9A 5ERWA 1RZFH 4ZSOA 4OLVH 3QUZD 4EZMA 6FABL 5BQ7B 3T8XA 1NGXA 3LKPA 5GGRB 1I8LC 3QUXA 4WFED 2XZQH 4OCLC 4YHLH 1CE6B 1CG9A 2LAAA 4MCZA 1BOGB 5IT2L 1QSFB 3TZVA 1CQYA 2Z8VC 4IBLT 1F90L 1R5WA 3ULVD 1J11A 1NFDE 1JNLL 1JYXA 1JI2A 4OAWB 4MHHG 5GQBA 2B7DT 1B0WA 3H3BC 3T4AB 7CGTA 2VDLH 3BSZL 3CX5J 5I1IH 1E28B 2DTML 3FN9A 4PRPD 3UMTA 3VXUD 5D7JD 4B7IA 1T5XA 3TGXA 2QEJA 5IW6A 5TE7L 1GRWA 5C0IB 5F3HB 3NCMA 3JVGC 3O3EA 1WZLA 4ODHL 5LWYL 1ZHBA 4LVNC 2JJVA 5I73C 4RAUA 5GSRA 3EFDH 2YPVL 3IFLH 4LSPL 4KVCH 2VDNL 5JXEA 1EK3A 4KVNH 4QNPE 4JHZA 3RZCB 1HEZA 1SBSH 1JWUA 2XQYK 3P4NA 4TUKL 2OZ4H 2ZOLB 5BVJA 3BKYH 4K8RD 2OYPA 1I8IA 2VERN 3S37H 3BDYH 3CAFA 3MR9A 5B38G 1F8TL 3WN5C 3HKFA 2JLLA 1XF3A 2BY0A 4PBXA 5FYJD 4HFWB 3L3JA 3QDME 5E5MA 5T3XE 1TFHA 1MHHB 2UZIL 1LWRA 3O6FA 4PRAA 3BGMB 4Y5VA 1NAMH 3VXMB 3LN4A 5F70A 43CAB 1XT5A 2Y5TA 3NFPA 3W2DL 4R0LC 2F54A 5L0QC 5DFVC 5HHMB 1U3JA 5FUOL 1R24B 3CSYA 2DQGL 5FHBL 1N6UA 3NABL 3RVUC 3JXAA 2P5EE 4R97C 4XPFL 5EG6C 5TQ0L 5D2NC 3BUYB 3VXSA 4AIXA 2YD5A 5C0FB 4YPJA 2JK5B 4NN6B 1U9KA 4M7JL 5IGXL 2H6PB 5DEFB 1CFNA 3IJSB 3SJVB 1Q0YL 3CDGA 7FABH 3MJ8B 4DK6A 4XBGA 4GAJH 2FX9L 4LEOA 4M7LL 4LLQB 2WNGA 4RIRB 3BVNB 3BN3B 3F12B 3T0ED 3VDAA 4C56E 5JDSA 3E8UH 4JO3L 3RNKB 4AH2B 4WJ5B 2A1WL 4K7PL 5I66A 5IB4B 2AQ3A 1QO3B 4I2XE 2X1PA 5F7LB 2V9QA 4FQHB 1KELL 1OWWA 4I18A 1MPAH 5E1HB 4XNQA 1F3RB 4P2RE 1HCVA 1A1MB 4MA1B 4AZ8A 5KG9B 4HWUA 1D6EA 2H9GB 4ISVA 4Z7WB 3MV8D 4I9WE 3GSRA 2OJZL 3PL6D 2V2XA 1YMHB 4P4RA 2W0KA 1U8MA 2D7TH 3P30H 2ZUSA 3QR2A 4XWGH 4RDQG 2BNRD 1VPOH 4G6MH 2W0LA 4Z5RA 3UYPA 4RMRA 5CEXB 3Q2CA 4LLDB 4JRXD 3RY6C 4M6OL 2ED8A 3D39A 1RHHB 5HYSG 4ZODA 4LPYA 1OSZA 5HHXL 3O2WH 3M1BB 5MERA 3LH2L 3TBWB 1GZPB 1A7BA 2HH0L 4MQ7A 1M4KA 1N2RA 3W5MA 3PHOB 5FO7A 4L8SB 3UZEA 3BRFA 3IRPX 2IPTL 5C6TH 3PJSB 5EORL 3SDAC 2EDDA 2HJFB 1MIML 3B5HA 4NO2A 1KPUB 1V3KA 4OSUH 4UDUA 1IAIH 2ZCLL 2VLJB 4MB3A 3C6SB 4MD4B 1ZLUK 4GKZB 4WWKC 2IH1A 2UY7A 1OAXL 4JQVC 3OKDB 4YIQB 1O0VA 2WANA 2X4RB 5CIPA 4NWTL 5I74B 2FJFB 3PQYB 3VFVB 4LRIA 1SJHA 5ITBH 1RUML 4KI5E 1BVZA 1HHGA 2DWDB 3RX7A 5BS0B 3WNKA 2EXWD 4D9RE 5DJ2B 1MCLA 3V5DA 4HFUH 4YO0A 3C5SB 3FT2A 4U7MA 5D1XB 4BQCA 4K2UL 4YXKL 2RAMA 4P9ML 2P42B 4RA0C 4KJQD 1TZHB 3B83A 5MEQA 3PWPD 4HAGA 1XF1A 3KNBB 2X2YA 3T1FB 1RJYA 2G2RA 3LKSA 5FGBC 1IGCL 3ZYZA 2Z8RA 3C6LC 4X6CB 3S35L 4R2GC 1ZA3A 1A7RH 4YHMH 4CU8A 4ONFH 2MFNA 5C08D 5CP7B 1GGIL 2IQAA 5CZXD 5CEZD 4LDEB 2ZCHH 1C1EL 4LCUB 3LD8C 5K9JL 2YD2A 4NNXB 4XP4H 3UYOD 4NNPH 3JV6B 1KJMA 2AGJL 4RQQA 3DYOA 1IM3A 4YGAB 3HS0A 1QSEE 2EDBA 4JO2H 4KTEH 2FX8H 3CFJA 2A9NL 1A4KA 1I1AD 4NQDA 2H3NB 4R4BA 4MCYB 3VFMB 1I7ZB 3KYOA 2F53A 4ZAKC 1G6RA 2NPLX 3KPTA 5I19H 4PR5B 2E9IA 5CHNB 3CMOL 5FUCE 4NRYB 3G08B 1NEZG 2OL3H 5DUBB 3D2UD 3QO1B 2G60L 5IROC 4JDTH 1EHLL 4X5XA 4BQ9A 5C0EB 1CXLA 4GQPH 4DZ8A 2RCSH 1DQQB 2B0SL 3X12A 3BPOB 1NCWH 2Q1EA 4HK3J 1CLOL 4HGKC 1FYTA 5EBGA 4U33A 1INDH 2XTJD 3ALPA 4X98B 1M7IB 3CX2A 2X4OA 1Q9LA 3OJDB 1FRGH 2NY3B 4LBEB 4JY6B 4AK1A 1LO4L 5EPMA 5TE6L 1RZGB 5DTFA 4WHYG 5IK3A 4OIIH 4EN3B 3P9MA 1JWMA 3QISA 3E1F1 3SE8L 2VQUA 5J1AA 1MVFA 1OTUD 4NPYA 1CGXA 1P53A 1XGTA 1KB5B 3E6HA 5IBTL 1CDYA 5CILH 3ZE2F 3ISWA 3ULVE 3IFOB 4EDWH 1OARH 2JELL 4OCSH 3QUKB 3VXUE 4PRPE 4OQTH 5HVWA 4KHTL 3FOLB 4EKXA 4BZ1L 1FSKC 3MXVL 2HMIC 4WI9A 5GGTA 1EFQA 5DRZB 4X0KB 2EDWA 1Z3GH 4WU7B 3CDCA 3DSNA 4NN5B 3IDMA 3REVB 3VDBA 4QXUH 3TO4B 3NVQA 2ZPKH 3ARGD 1DL7H 3G04B 1CDHA 1KXTB 4R9HA 2IBZX 1FHGA 2Y06H 1X6LA 4LKXB 4TVSa 1F3DH 1U8LB 3IETB 4U1JA 5EBMB 1Z6JT 2CRIA 4DQOL 5HHVH 2YK1H 3L3HB 5FYLL 1J9CT 1TETH 1XIWB 4XH2A 5TQ2H 5HGDA 5DK0A 5D6DA 3VWJC 3OQ3B 4OLXH 4NQSB 5EN2A 1JZ4A 3GMOA 1GSMA 2QSTA 5FYJE 1OW0C 1T04B 2IBGA 1H3PH 4S1DC 4WGWB 2AV7A 5D7IA 2FRGP 4XCNB 1EAPB 1FPTL 3BYYA 3OPZL 5BJTB 5CMAA 3FB6A 5D71L 2VR9A 1G7QB 3IB4A 3VW3L 1I1FB 3MA7A 4GW5A 4NQXA 5EU4A 2HLFC 4PLJD 3UJJH 5JOFA 4XNYH 1X5FA 4LSQH 1NJ9B 2P5WB 1T1XB 5IEKB 4G6JH 5AEAA 1KN4L 1FDLH 1A9BA 1TTFA 4OCWH 5F96H 3W39B 1G9NC 5IVNA 4JZOA 4KKBD 5I16B 2X4NA 4OBSA 2ZUQB 4MQTB 4LLAA 5I8EB 3MJ7A 5DMKA 3JSSA 4HSQA 3T0EE 1KCUH 1IEAA 1P4BL 5F9AC 2VN7A 2CIIB 4POZC 2FR4A 3LQAC 2NZIA 5TE4H 5L7XL 1JPGA 2AVGA 3MBEB 3MRJB 4YWGH 4WHTA 1DBBL 2AJ3A 4TOYH 3CD4A 1KJ2H 3QULA 5F6HI 2PUQT 3SGJA 3WFBH 1IC7H 4JREC 1MQKL 3P9LB 4H25B 1N8ZB 4WO4C 3EYFA 1KG0B 4G5ZH 4K7FB 1ACYH 1V8HA 4WTXA 1J86A 5FB8B 5I1HH 3MV8E 3QJHA 2V5RA 4NT6B 1A6WH 1H8SA 3DBXA 3MTRA 1LDSA 3U83A 4EI5A 5JNYA 5D1ZA 2Y7QB 2BNRE 2XN9A 3K74B 5ADOL 4R96B 3ARBD 4JFDD 2GJZB 3BESR 4UV7H 5ICXB 4JRXE 2AABH 4XPBL 1IM9B 1S9VA 1D5BB 3QJFB 3GMMA 2O61B 2GYSA 4BFGA 5E00B 3CZFA 3MYJB 3F5WA 5FKAB 3QH3A 2ZSWA 3Q0HA 3MLSH 4Z7UE 3WIHA 1JGUL 1WC7A 1P7KB 1X4ZA 1ED3B 3TNMB 4XCCH 3NN8B 3OV6A 1T89A 5I8KH 5C0JA 4ERSH 3Q6GL 2A6KA 5F9JA 1HINL 5IW3A 4GQ9H 4MNQB 5CP3H 4YDJB 3RI5F 1NBZB 1AHWA 1S9XB 2UY6A 4MD5A 5E08L 1YPZA 1GGCL 3GBML 5DSCA 1J1XL 2J3SA 3STZA 4XHJD 5KVEH 4HIJB 1WAAE 5B3JE 1RQ5A 5M7QA 5B38A 4MS8D 4O02L 4F7CB 5I15L 3OKMA 3PXHA 1M7DA 2CDFA 2AKRA 2EC8A 2MPAH 2NXYD 2R0KH 5E99H 1NGYA 2Q87A 1QBMH 4Y4KA 2C7UB 2IMMA 1DQLL 4Z7OF 3S4SG 3TV3H 3RDTC 1M05A 3MZGB 4XBEH 1JF1B 1UH2A 5ITFB 5C9JB 3EYVB 1Q1JL 2VUOA 3CXDL 5SWQB 2VOTA 3WJJA 4WW1B 2FO4A 1JGLL 3H3KA 1IFHL 1YJDC 3JWOC 2XXMB 3DHMA 5TH2B 3QDGB 1MF2H 2C3XA 3PABB 2MQCA 5MI0B 3PWPE 3THML 4X4XB 5JLZB 5I1AB 2C1OB 4PG2C 2C4FU 3L1OH 3TJEL 2DQIH 4NC0B 2ZJSH 3KYMA 3D3VD 4M9OA 4Y8DC 5GIRA 1CICD 2Z35B 4KROB 1J05B 1WCBB 3WXWL 1RZKH 2DWEA 5C08E 4ZFOL 4LSVL 3A67H 2H26B 2VSDA 3TPUB 1VACB 5CEZE 1JZ8A 4F7TB 4ZPVB 5GGSY 5DUPL 3GMQB 3DYPA 3FN0H 3Q5TA 2X1QA 4ACPA 4WFHD 1A21A 2DQJH 4OD2B 2B5IC 3MPCA 3KLAB 2JB6A 4P3DB 4NHCL 4X7SL 2DMBA 4G8GA 1C08A 1CXEA 1UJTA 3WFDH 3C8DA 2Q7YB 4F7EA 2HN7B 4BKLA 3H0TB 4Y4FA 1E4XH 1KGCD 4HEME 3S5LB 3B5TA 4G8EB 1Q72H 4R7NA 4URTB 4JPIA 3SKNA 1MJJB 1NC4A 1XZ0B 3NCYP 5GHWL 5C3LD 5IFHL 5K9OB 5E6ID 1MCRA 1EHNA 1BVKB 2DKMA 1YYLH 2J6EA 2R2HB 3UCRA 4O5LH 1FFPB 5EU3B 3ZL4L 3QIBB 4L3EB 1IAKA 1YA5A 4UOW1 2XTJE 5C0AB 4PRHA 2XWBA 3DUHA 2P49B 3O2DL 1YUHA 3QIWD 2D03H 2XRAL 4UI2A 4DGIH 1MY7A 1BX2A 3VGAC 3T2PA 3LZFH 5I1EL 2D4FA 4OZGF 5I9QC 2ENYA 3WL9B 1IGIL 1NDGB 2GFBB 2VMFA 4U05A 4FQJH 1UQSB 4OZGA 3QUXC 4JQXA 4RGND 3RWEB 4X80L 1CGSH 4PGEA 5IUSA 1NPUA 3F58H 1U3HD 2UVFA 4UTAH 4UT7H 4JB9L 3Q1SH 1GZQB 4N1HB 1T1YA 2CO7B 4IDJL 5EIVA 5FDWB 1AQDB 1UB6B 4O51B 3AUVA 3K8KA 5E8NA 1LEKA 5HHPB 4HUVB 5FM5O 3VGHA 3FQTA 3QEHA 3B4NA 3K4AA 4YDLB 1AQKH 3LOWA 1NGWA 4QYOA 4U6HA 3RVTC 3OL2A 3C08L 4AQOA 2BVPB 1QUNA 4NQVA 5FOJA 2WSKA 4CMMA 3MO1B 4PJCE 4OM0L 3FRPA 1F13A 5IOPA 1IMHC 3GDBA 1BFVH 3LVEA 3K80A 3TO2B 3ZO0A 2GK0A 4LASH 4ZTOL 3CFEA 4WV1C 4M1CD 4DOHE 2JJWA 5HJ3B 1FLRH 3SDXB 2KH2B 5FO9B 1P6AB 4HF5H 5JIHA 3MGOB 2OM5A 2R0WH 3UO1L 2KUTA 2BMKB 3OXRA 5A43C 3BE1L 5I1GL 1KULA 1BAFL 4IRSD 2A77L 5JXEC 2IQ9H 1S5HA 1ZGLM 1I9IH 4F15C 4YGVB 3FQNA 3DECA 5BO1H 4NO5A 4LCYA 1R3HA 4HKXB 5LVEA 3SPVA 2V2WB 3CH1A 2Q76B 5CZKA 4HUUA 2B4CC 3BKCL 3VFPA 2I07B 5IKCB 2XV6B 4JPWL 4N0FB 5GGQH 5C0RL 2HFTA 5TDNA 2BSRA 3FO9B 4LSRH 4MAYC 4PJ7A 3IDNB 2OL3A 4F58H 4F80A 4Y5VC 4NO0B 4PJGF 4ELKA 2BVUA 4ODBD 1GGUA 1L7IL 4LPWA 4PJGA 2I60H 3M17B 4XMKL 2DMKA 3MUY1 2AW2A 3PHQA 5I2IA 2PYEA 1T2XA 3G6JF 4Y2OA 2RHEA 1A3RH 3ZE1E 5FM8A 4HZLB 1INQB 2VL4A 3G6JA 2AQ2A 3UPAA 4JGJA 3PWVA 1IQDA 5ADPH 4XVTH 3Q6FB 2XPGB 3FJTA 1YNKL 4E5XB 2HJKB 1NEZA 5INCA 4AT6B 3ZE0E 4PP2B 3WFHA 2EDTA 4HG4K 2CKNA 5FCUL 1J1OL 1HH6B 2FJGB 2VDOL 3L7EA 2FEDD 3ROOB 3N0PB 1F6AA 4G9FB 3BKML 4ZDHB 3U48A 1A0QL 1BQLH 1DBAH 5GZNC 4I18C 2BSED 3L9RA 3P9WB 1GL4B 1KCSH 4DGYH 4U1MA 2FCBA 5IM7A 3QPQC 3V0AC 5EO1B 5F1IA 4JFDE 1QA9B 3VG0L 5A3IC 3FZUD 1XGQA 3U7YL 3MFFB 1U8JA 3PUCA 3LKRA 4AM0B 2Z8WC 3EIFA 3C5ZC 4U6XB 1NMBL 4PB0H 3D0VB 1E27B 2CR3A 2ZG2A 3HLAB 4IDLA 4QF1B 2W0PA 2EDQA 5SX4I 4LLWB 3TVMB 4NFBA 4O9HL 2LTQC 3QI9B 4X9GA 4O2CB 1ZTXH 2AEPL 4NGHL 3RWFB 4HIIA 2AEQL 5HYIA 5LCVL 5IQ7H 2BXZA 3D1MC 3MLXH 3AREB 1MCFA 4WEBH 1MFAL 3HRZB 3IXTA 4X6DF 2P8MA 3GSXB 4YBLB 4YFLF 4GSDL 3CLEL 2OTPA 2Z93A 4HKJA 1CT8A 4X6DA 3V4UL 1DE4A 1CLCA 2GUOA <