1BVKB

Humanized anti-lysozyme fv complexed with lysozyme
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
116
structure length
116
Chain Sequence
QVQLQESGPGLVRPSQTLSLTCTVSGFSLTGYGVNWVRQPPGRGLEWIGMIWGDGNTDYNSALKSRVTMLKDTSKNQFSLRLSSVTAADTAVYYCARERDYRLDYWGQGSLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (humanized antibody/hydrolase)
molecule keywords HULYS11
publication title Conformational correction mechanisms aiding antigen recognition by a humanized antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 116
sequence length 116
chains with identical sequence E
ec nomenclature
pdb deposition date 1998-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bvkB00
2BDNL 1FFPA 3G5ZA 4E5XA 3AMLA 2OSLB 4RX4D 2EDBA 2BY3A 2COQA 3MFGB 2VLKB 4GUPA 4OSUL 2MSPA 4L3CA 4OCWH 2X1XR 4I3RL 4Q6IC 2A6JA 1J1OH 4NUGL 3V5HA 4CVXA 5JZ7D 2CUMA 2JLLA 5IT2H 4FQIL 4HIXH 2UZIL 3NCYP 4OLYL 4B7IA 4UI2A 2XTJE 4R7NA 2APFA 2J7LA 5D6CB 1AGEA 2ZSVB 2AJUL 1CT8B 3WLBA 1CDBA 1F4YL 2NTFA 1RJCA 4U1IA 3NA9L 3P11H 3L3DA 4Z0BL 1MJ7L 3I6LD 3O2WH 4F15C 3KPQA 4HUVB 3F62A 1SM3H 3MV7A 2V2XB 3KYKH 1A6PA 5JUEL 1DQJA 3EO9H 2HG5B 3FOMA 4XC1L 1N2RA 3V4VH 3ES6B 1G0XA 1V5JA 4JM4H 4NN6B 4JKMA 4YUEL 1IGTA 4P2YA 3OHXA 5JLZB 3BVNA 4JFED 3PL6B 4JRYB 2I26N 3W11D 5FKAA 4KY1L 3RKDC 1A3LH 1CGWA 2JB5L 2ZUQB 3AGVA 1QA9B 4PV8B 5E8EA 3QDJD 5DRXA 2Z35B 3L95A 5DJDA 3WIIL 1KGCE 2DD8H 3QJHA 3MLXH 5FHBH 1RZIB 5D1XD 3FRUB 5DRZB 3A0OA 1KIRB 4EKXA 4OZGB 2YRPA 1O5DT 4WU5A 5EB9A 4N8CL 5HYJD 1MREL 4MJ2A 3VGDA 2AXGA 5ETUA 4Z7WA 5JOFB 1K4CB 4P99A 3WSQH 5E1AA 2UWEB 4V1DE 3WHE0 4GBXB 4AIZB 4W6YB 5BQ7A 3D48R 3UJIH 2F15A 4OQTL 1S7VA 1XGYH 5CKGA 3O0RH 4K3EH 2C7UA 4L8CA 4I0PB 2R39A 5KVEL 4LEOA 1G7HB 3O8XB 4JVWA 2OJEB 2Z93B 3B5HA 4ZAKA 2ED9A 3UAJD 4ZQKA 5C0AE 4EJ1C 3TBVB 1INEH 1EAPA 3SQOL 1NEZB 1I1AA 3SEPA 5TH2B 1JPFA 4KJYB 1ZWIB 5ACMA 3ELAT 4WY7L 3DARA 4QRPA 2IALB 3ILPA 5C0RH 4XMLL 2DKMA 4IOSD 2EC9U 3QNXA 1GIGL 1WC7A 4Q9BA 2R29H 2HVJA 4IRSB 5I8OL 3BGMB 4ZODA 1IEHA 2R2EA 1N6QH 4ONHB 5GIRA 3EO0B 2XXCB 2UVEA 5H2BA 3JVGA 4LLVB 3EOAA 5E94A 4GW4B 5K59E 4CMMA 3X11A 1GL4B 2VIRB 4QRRA 3LD8B 3DVNB 4YFLI 1JGEA 4FTVB 2GK0A 5IVXB 5TDPB 2ADJB 1ZT7A 1KCSH 2A6DB 5D71H 3T2NL 4KVNH 4JFOB 5E5RB 3B3IB 3RY4A 2VLRD 3BRFA 1S7RA 2RJMA 3S37X 1R3HA 5FEBA 2JELH 3B6SB 3KPMB 3BN9D 3AB0B 3U36A 4AENA 5KJRH 5HGDA 4LHUA 5KVDH 1I1RA 4FQCL 2X9XA 3IAQA 3SBWA 1XZ0A 2W9DH 3QDJB 3G04A 5EC2B 4X4XA 2QADC 4OZFB 4NQUA 3G6AA 1VFBA 4BZ2L 2BERA 4ODHH 4UAOB 4BUGA 1MFEH 1U6AH 3LKQA 1CK0L 1WFNA 4PJCF 4YHNB 3P4NB 2OYPA 2E9WA 2AABL 4R4BB 3CDGA 3CPLB 4JJ5B 1W72L 3TVMC 1J12A 1I1FA 1Y6NR 4O9HH 5E8DH 2XZCH 4XPGL 1UWEH 3PABB 1XGRA 1B6UA 5GSRA 4W4NA 2NTSP 5C3LD 4N0FB 5HPMA 5DS8B 4ONOA 2MKLC 3J7HA 2OR9L 3LV3A 1NCBL 1JYWA 2ATKA 4LPVA 3JWOH 4NPYA 3K8KA 3FB5A 5GPRA 1UEYA 1EEZA 4DAGL 4PG9B 1F02I 1JNJA 4N0UB 3DTXA 5H35A 5BXFB 3U0PB 1X5LA 1FH5L 2WINB 3BPOC 5C0NC 1JRHI 4K7FA 5DQDH 1DBAL 3HCVB 5F1SA 4ZS6D 5C0IA 2APVA 2XZQH 3HPJB 4QXTB 5C08A 3MBEA 3PQYE 3BKJH 4ESKA 1FV1B 4HZLA 4K9EL 3IFPA 5ALCH 2ZCHH 4HC1H 4CU6A 1JWUA 2CSPA 4ETQB 5ISZD 3KLAB 5IB2A 1MIML 5HI4D 4P2RD 3B2VL 3C87A 3PGFL 1IE5A 3HI5L 4NDMA 3GSNA 4DQOL 1PZUB 2CLRB 3EOBA 5CIPH 3C60D 1U9KA 4WFGD 4OFIA 3VRIB 4WI2A 3BXNB 3CFBB 2LTQB 3CVHL 5AUMB 4UQ3A 1U92A 5F1IA 4Y89A 5FGCE 4G42B 3A6CH 5DT1L 3RWGA 3GSOA 4DZ8A 2ZCLH 3QG6A 4PJ7E 5IHZB 1U91B 3RWFA 5L0QC 3TBSB 1TTUA 5GJTL 2R8SL 2D7MA 5DJCB 1EPFA 5FGRA 2VLRB 1T20A 4BZ1L 3Q6GH 4RMRA 1NFDA 3GSVA 1BWWA 3U2SB 2AQ3A 1G6RA 5LQBL 1FYTD 1SMAA 4OQ1A 2JJWA 5ENWB 1RIHH 4WWKC 5DQ9B 4P2QE 5DMKA 4Q7DA 3MRDA 5C2BL 4K3HA 1LK3L 4LF3A 2NW3B 4HG4J 3CLEH 5HYQA 4IRJD 5D9SB 4M8VA 2Y7QB 5KZCD 1XGUB 1FSKC 3FJTA 2FJGB 1ZEAH 1R5WB 5IFHH 4HGMA 2Y06L 4N90E 4ELMA 1ZKAA 4JR9H 4KAQL 1WFUA 1WCQA 3BJLA 3GHEL 2HFGH 5E24E 2BP3A 4X7TA 4F8QA 4TPRH 2AXFB 1Z9SA 5I8EA 1RU9H 3G6DL 3KLDA 4IOFD 3KS0J 1CXHA 2GUOB 2BNQB 4JFFD 5DVKA 2F58L 2ZOKA 5FECB 1TFHA 1VCAA 2A77L 5AZ2H 5C6WH 3BAEH 1DN0B 3CH1A 3UPCA 5HHNB 5GGTA 3ULVD 3MBXH 4I5BB 4PJ5E 2LAGB 4FOMA 4ZOBA 2XKNA 3V6OA 3D3VA 4U1LA 5CJ5A 1DQDH 1URLA 4XBPA 4DWHA 4IMLA 4XPBH 2V17H 4M93B 3C60B 4OLWH 1EFXD 1J87A 1XCQA 4LLMB 4XMPL 5HGGS 1OP5K 1IBGH 3LKRB 5J1AA 5HYFA 1HXMB 3BDBA 1QSFA 4K8RL 3TT1L 2D7PA 1CFTA 2ZNWA 4N5EC 4L9LA 1IEAA 2UUDK 3E2HC 3O6KH 4PJFB 4LASL 3VH8B 3FB7A 1HINH 1AR2A 3HE6D 1A1NA 4LCIH 4QRUB 3WN5C 2NY4D 4RMQA 1EMTH 1C5BH 5TPWL 5HDLA 3GJEA 3RGVB 3OR6A 4TTDD 4LLWB 5JNYB 3MYZA 3THMH 3V5DA 1FYTB 1CCZA 2AGJL 1WIUA 5C0GA 3GMOB 3HMXH 1YN6A 2VDQH 1DBKH 3TVMA 1WZLA 4YHLL 3WHXB 5IKCB 1ES0A 1B2WL 1Q72L 5KAQF 4HH9A 5HXMA 2IQ9L 4IRZH 5C0JB 4XCFH 5FM5O 2P5WE 1H3GA 4N9GA 3Q5TA 2FEDC 4K7PH 4CW1B 3TN0D 2BXYA 1IAKB 1DL7H 1FO0A 2O5YL 3VXSE 2FX8L 5E7BA 3IDIB 4XCCL 5FKPA 1OGAA 3MLRH 1G7QB 1SJHB 3JSSA 3CFDA 5EZLB 1JN6A 3DMMD 3QUYA 5B4MC 5BV7B 2DQGH 2NXZD 5F6HI 5B3JF 5JQHC 1GHFH 3TIDB 2YN5A 5JHDA 1LP9B 2H26A 1T0NA 5D7LA 4Z76B 3HFMH 5FHAH 2LFGA 1WUNT 1BWMA 4KKBD 3P3YA 4FFVC 1JI1A 5SX4H 5L6YH 2H9GB 4ZFOB 1WCBB 3VFPA 4FP8L 3OB0K 1PQZA 4FQLH 3S4SG 4NQEE 1R5IA 1F3DJ 1KB5B 2HMID 5DDHB 3PDOA 3DVGB 4JFFB 2D3VA 2FL5B 1J05B 1KEGH 4NM4H 4D0DB 1I9EA 2P5EA 3OZ9H 4HS6B 1KBGL 4MB3A 1F2XK 2NY6C 1JZ5A 5IESH 4MMXC 3NCEB 1BX2B 3GSNL 4G6MH 2BNRB 3NCFB 3H9YA 3BSZH 5IV2A 2AK4E 3QUZC 3G5XA 3GJFB 3NCYS 1PLGH 5IFJB 4YDJA 1QSEE 4ORZC 3KPPA 5IMLB 3UTZB 1MCEA 1RVFH 3QHZL 4HIJA 4MNGE 4MJIE 1NAML 1XH3B 4NM8L 4XCNA 1XR8B 5T3ZH 2NY4B 2CIKA 3TCLB 3MRRB 1XGQB 4GKSA 2EDHA 4Q97A 2N7BA 4R2GD 1MCDA 1IQWH 1NGYB 1Q38A 3N1FC 4RAUB 3DSFH 3QEHB 3UTQA 4UNTA 1EXUB 5C0DB 5FCUH 5JDSA 3S7GA 2PR4H 5IK3B 5M94B 3N50A 3ZSSA 3SE4A 4JFDD 4MDIB 4GSDL 4TUOA 3P0VH 1CFNB 4HDIA 4L5FL 1YA5A 4NOBA 1HOCA 5CBAA 4GMSH 2P1YA 4HMEA 1T21B 1QBML 1OARL 1RSFA 4J3TA 5ITBL 5DEFA 1CVSC 4PJAE 4PLJD 3T2PA 5JXEC 1A4KB 3O41B 4KGLA 1Z3GH 2AS5M 4YPJA 1RUQH 4DGYL 3BWUC 4YGVB 4CNIB 5CUSL 5GSVB 3QUXC 5EFIA 1A9BA 3RVWC 5HYSB 4S2SA 5C71A 1E6OL 2MHAB 3UTSD 2M1KA 1KENL 4O2CA 4HJ0C 3O3AA 2F19L 5E2TH 3MPCA 4LPYA 4RGNC 1QO3A 3ZDXE 2DQDL 4LARH 2ERJC 4ZFZB 1BD2B 2NNAA 1I8IB 4JRXE 3QQ3A 5A2LH 43C9B 4RMUA 3TO4C 2DQEH 1ZK9A 3BE1H 3L3HB 3QCUH 3QCTH 5GGTL 5FUZL 2EC8A 2FO1A 1AE6L 1MNUL 3ARGB 3SY0A 5F7YC 3CNKA 3F5WA 2ENYA 1ZTXH 1KN2H 3GNML 3WN5A 4EOWL 3LKPB 1ETZB 3DGCR 2EDJA 4MA3B 1NBYB 2A6IB 4S1SH 1T66D 4WI8A 1IT9H 1VFOA 1JYNA 1I1YA 3D85A 4WDIB 3OX8A 2ADFL 2CKBL 4F9PC 4M1CC 4HS8H 3VFNA 3CFJB 2LABA 3LKOB 5AAMA 5JW4M 3MXWH 4U1GC 4CUCA 4OB5L 4W6XB 1MH5B 1VDGA 2QQLL 3BP4B 3SDAC 4MAUH 1EJOH 5J13B 2V9TA 2XNAB 2WV3A 3G6JF 4LQFL 4R2GB 3MV9E 4RAHA 2E8ZA 2NPLX 3MOBH 5I1JL 5HHMB 2R2BA 3F7YA 5JPMB 5FK9A 3LEXB 1QFUL 3V8CA 3BKYL 3ZT5A 3OXRA 3KYMA 4Y2OA 4F33B 2W60A 4HWZA 2V9RA 2YD8A 5E4IA 1MRDH 4JFDB 2QKIB 2EIZA 4LSUH 1U8MB 1HHIA 4PJCA 2GEEA 2ZJSH 4WEBL 4YHZL 3U46A 5T3XL 2P45B 2V5SA 5I1EL 3EGSB 5CEYB 2F5BH 1KJ2A 1Y6MR 3HNVL 1YC8A 1UM6H 3O2VL 4HLZG 2NY2D 1UB5A 4U7MA 4C56D 4PGCB 1JGUH 4QYOA 2ZG1A 1QR4A 3EKCA 3ULUC 4ZS7L 1QRKA 1QKZL 1CFQB 1IGML 2OL3L 3W0WD 4Z77B 3R06B 1H15B 3UTSB 2MPAL 2W0KA 2DF3A 4OTXH 1QQDB 4JFQB 1AC6A 4XZUB 1YMMB 2IPTH 5DUPL 4JFXB 3LKNA 1UQSB 4LHQB 1DUZB 4EI5C 5A2KH 4LVHC 4RFOH 1DJSA 3ALWA 3O81A 5EZOH 3KYOB 3QUZA 4DZBA 3O2DH 2R1YB 1LMKA 5IJKC 1C1EL 1HH9B 1N3NA 5BVPH 3MCKA 4QCIA 2X5PA 3SE9H 5D1ZC 5I18H 2YPKA 5DTFA 4RNRB 4C4KO 1U8PB 4EN3B 5I1LB 3F7PC 1JRHH 1LE5B 4NCDA 1QFOA 3DLQR 3IJSB 4MX7A 4Q2ZB 1CYGA 4PRPA 3BDYL 1XR9B 3WS3B 3NH7H 1U3YA 3SO3C 4X5LA 3DXAD 4S11A 4XPTH 2NX5D 4P23D 3MLUH 3T0XA 1M7XA 1N59B 5L2JB 4Z7QE 3RZCD 3GMRB 4TVPD 4OD3L 1ZLVK 3FO2A 1MHPH 3IKKA 4DTGL 1NUGA 4OZ4A 2Z8SA 1L7IH 2WUBH 1YDPB 3GI8H 4LSVH 1TZGL 3G5VB 4KRPC 3LN4B 4X9HA 5IG7A 1MJUL 4ELKA 5I9QC 3FCTB 4FQQB 4YDIL 4NKIH 4NZRL 3GUTB 1HWGB 3U9PH 4KRLB 4PGDA 3O45A 3PWPE 3W9EA 2DIAA 1KB5H 4EQ2A 3HTLX 1KG0A 2W1NA 5ICZA 4TUJA 3VRLF 2NY0D 2SEBA 2IQAB 4HUUA 5TE7L 2Q87A 4CKVX 2O61B 4UIMB 4U1KB 3WS6C 1A02N 4XBEL 4P2OD 2ICCA 3M07A 5LAXA 3VFMA 3VXMA 3QFJE 4F9LA 1T1XB 1JNHB 4MD0A 3I50H 4OAWA 1ZSDB 3TO2B 1JHTB 2FR4B 5GS0C 5FO9A 1D6EA 3QO1B 5GZNC 1LK2A 3VFWA 1EO8H 3WBDA 3GJFH 4F8TA 4K23H 2DI8A 4M8QA 2NY2B 5IB4A 2VISB 4C56B 3QXAA 3VFVA 1KPVA 1MFBH 3FB8B 5JIKA 4PP1C 4GG8B 3Q1SH 5DWUH 2QR0B 2P44B 1DBJL 3ALPA 3KWWA 1FBIL 1RFDH 3ORJA 5MEOA 5GGSY 1BP3B 3PWVB 4L8DA 4BJLA 2P8MA 4ERSL 3QDGA 5DYOB 2EDKA 1T7VA 1OM3H 3KLHD 5A3IC 2EDTA 4WWID 1EBAA 3T65A 5DZOA 3BWAB 4MNQD 4LSRH 2MQ0A 1X7QB 3IDNB 2DJ4A 4MCYA 5EO0A 3QAZB 1MCNA 4HGKC 3PHOA 3CD4A 2R9HC 2EECA 4XX1E 3KXFA 5EZJA 1LE9B 5CZVL 4L4TD 3GMQB 3IDXL 4YPGB 3VDAA 4LLYB 1KTDA 4XPHH 4LBEB 4F9PA 1NCWH 1LEIB 1OQOA 4Z5RB 3FQUA 5FUCC 4HWBH 4PJIF 5T5NG 1F58L 1OSZB 3IRPX 3MXVL 3FRPA 4QGYA 4I48A 2ZUXA 3QWRA 3RTQC 2EZ0D 3UO1H 5GRUH 3QO0A 5B38G 3S34H 4NQDA 1FJ1A 1BAFH 4P23B 1CE6A 4M7KH 5F7LB 2VDML 2BC4A 4U1HB 3QULA 5JIHA 3NCJL 4OZGF 3QUMB 1F4XL 5IR1A 2XY2A 3IXAB 1ZHKA 1JWSA 1IFHL 2NQCA 3WFCL 1IGYB 4QY8A 5E5UB 2UWEF 4XNYL 8FABA 4ORGB 4K07A 4XWOD 3C9NA 5IVZB 4HLJA 1OL0A 3RNKA 4MA7L 5KSAA 3BDXA 3CXHJ 2PYFB 1KF9B 1WBYB 3FO0H 3MRPB 3NGBB 4LP4A 4NT6A 4UTBL 1A5FL 1JF5A 1OSPL 2OXGA 4XP1H 3B9KA 2NY0B 3MRFB 4PJ9B 5IROC 3PHQA 4YDLC 2QEJA 2XFXA 1HHGB 3OAZH 3KGRA 1VGKB 1A6AB 2ICWJ 4O58L 4FMFA 3DIFA 1U93B 4NFDA 4KI5D 3U6RB 1HEZB 3MJ9H 5DMIL 3QIUC 5DI8A 4KKNA 4QKXB 3NPSB 4JN1H 3OPZH 2CD0A 3MGOA 4J4PA 4QTIH 2CDEA 5CSGA 4HIEA 5F70A 4NKOB 3SJVD 1JPSL 2DMCA 1JGVH 4R97B 4L3ED 4G3YL 1CGSH 3LSOA 2OTUA 5IJKA 4QOKD 3OF6D 4H20H 5TQ0L 4LU5L 4U6XA 4WUKL 3S5LG 1LO5B 5D1ZA 1Z5LB 4NQXA 1FZKB 1T5WB 4JPKH 1NBZB 5D7SL 2HA1A 1M7IB 5IVXF 1YNKH 4KK8C 4PS4L 5T1KB 2EYRA 1EFQA 2NXYD 1OLLA 3QDMA 5IVOA 1FCGA 1P4LA 3SKJL 5I16B 3JWOC 4HFUH 4JRWA 5BS0D 5IEKB 1DVFA 3VWJA 3ZT7A 3ME0A 3RUGB 1E27A 4L4TB 2NR6C 2AJYH 3U7YH 5FYJL 3WJLC 5LGKA 1MUJA 3LMJH 4PJEB 4PY7B 6CGTA 4PGBB 5EIVA 3T3MF 1RUPL 1IAII 1RAMA 2I27N 3GEWB 1G1YA 3JWDC 3U4BL 4HJGB 4X9GA 5FYLH 4YC2B 2CLZA 4NJAH 2APXA 2YD2A 3VFGL 2WSKA 1XIWD 1KIPB 5ECJE 5IMMA 3BPCB 1FNSH 3ZKNC 4YDVA 3VGEA 3LZFL 1PGRB 3WS6A 4PP2A 3MRGA 5AD0B 4AMKL 2ORBH 2NMSA 1L7TH 4KC3B 4OV6F 4M43H 2GSIA 4FQJH 2YUZA 1QR1A 4LLDA 4LPTA 1BZ9A 3N1PC 4ELME 5IMKA 4XB7A 3VG9B 1CXKA 4G8GA 4F7CA 1Y18A 2DDQL 2DB8A 1CTNA 4JM2D 1D5MB 5BJTB 3KPSA 4WFFD 3HUJF 4PFEA 1R24B 4LIQH 3N85L 3GIVA 3TC9A 2JIXA 4O51A 4FXGB 3B4NA 3SJVB 4ALAH 3BP6B 1YNLL 1WZ1H 5DK2B 5DGRA 3KPRA 4XPAH 3T77B 2AEWA 4L3EB 4N0CD 3JZ7A 5IEHB 4I9WD 1F6AA 1NEUA 4UOW1 5HBBA 3BH9A 3D3VE 2VDPH 2XG5A 1V8HA 2VB5A 4X6BB 3AS0A 4CVZB 2R4SH 3KNBB 5FA3B 3DI3B 3GKWL 5SWZB 4WUUD 5JDJA 2C1OB 5D7IF 5ESQA 1J8HA 4I4WB 3GMPA 4AH2A 1GPOL 1QSFE 1OAXH 5CBEB 4ODSH 1RUKL 4UBDD 3QDAA 2CH8A 3ARBD 3KJ6L 3VXUA 5E9DA 2AEQL 1HZHL 4NN6C 4V2BA 1GH7A 4K3JH 4G8FB 2B0SL 3MRKA 4D0BB 3VDBA 1SJXA 4YX2L 2PKDA 1FG9C 4DN4H 4J3VA 5CZKA 2FD6L 2MFNA 2VLLA 1ZV5A 1RULH 4PLNC 4X0KB 2GTWA 5F7FA 1M4KA 3HHRB 4XVJH 2X4UB 1FORH 2ITCA 2ZUQC 3TH2T 4MD5A 1MAML 2VQ1B 3T0EC 4OM1L 3NABL 1OD9A 1TZHA 1U8QB 5L8LB 3NACH 3TNNA 2DLTA 4PYHA 2QHRH 2X1QA 3MTRA 1CDCA 4PREA 3G6JA 4PD4K 3SGDI 2R56H 4YQXH 2VJXA 5T3XE 1WWBX 3OKKB 3BUYA 1HH6B 5MHSD 1BF2A 4PJBF 1OGAE 2P7TB 5L9DL 3MRBB 3QIUA 5MEPA 4KQ4L 2PF6A 5DF0A 5KTEH 4YK4B 5F9OH 1WT5A 3VXQB 2PUQT 4YFLF 1IAMA 1DQLH 4YFEA 4NNXB 3X3GH 4U2ZA 3F7VB 1HHKA 3ULUL 4JFHD 3RY6C 5KSVB 1JZ8A 3ZE0F 4Y7MA 3L7EA 5ICYA 4JM2B 1CFBA 1NGQH 4M5YH 3ILQD 4I0PC 2DYPA 4LMQI 5EA0L 1AQDA 5CILH 3HG1B 3WIFB 3JBG7 3O8XC 4QT5A 2YD4A 3I3EA 4EUPG 1ROWA 3S3SA 1ORQB 4X8JA 3OKYA 1BVLB 4HFWB 1U3HD 4NO3A 1FGVH 4LK4A 4OD1H 4JFYA 3SE8H 3FTGA 5T1DH 3K1KC 2IANB 3B9EA 3BKCL 1ED3A 4WENB 4PJFF 1OQXA 3UZEA 1HE7A 4M7JH 4JY6A 2DM4A 3IVKA 4IRSC 5J3HC 4GW1B 5GGRA 2PYEB 4GS7C 4JFPB 5FB8A 4ODUA 4M6AA 1TDQA 4B5EA 3EYQC 1YUHB 5FYKE 4OCWL 4X4ZA 5BOZG 4YXKH 1VEOA 2VERN 1AR1D 4HC1A 1J1OL 3T8XA 3ARBB 5IT2L 4HIXL 1BQLH 1MFCH 3BZ4B 4I77H 1YNTB 3AB0C 4Q9CA 5CSBA 5IGXH 3TJHD 1Z6JT 1T4KB 2CIIB 3T1FA 1J0HA 5GGSA 4OFKA 4E41D 5L2KE 3P11L 5HTSA 3O2WL 2FNBA 1AH1A 3OBAA 5JO5B 1SM3L 2YSSB 5C0BB 1QFPA 3KYKL 3L3IB 3EAKA 1OAYH 5KSBA 2A73B 3EO9L 4MQTB 4BQ6A 2IF7A 1TZIA 4XT1C 3A6OA 1LP9F 2JCCE 3V4VL 1WIOA 1M71A 4JM4L 4RDQG 5JTWA 3S8WA 3QIBD 3QH3B 2RCSH 2IMMA 2DQTH 3MJ7B 4F7MA 1A3LL 2OSLA 3UBXG 1NGXB 3VI3E 1H5BB 2F53B 1R6VA 3CSYB 4RWHA 3P4MA 1JYXA 3ULVF 1T04B 2DD8L 5EO1B 3MRQA 3MLXL 5FHBL 1E4KC 4KWUA 1RZGB 3RDTD 1LILA 3V2AR 4P5TD 4TUKH 1L6XA 3G5YB 3SDCD 4TOYH 1Y6KR 4O5LH 5D6CA 1JPST 1CT8A 4PY8I 2PXYB 4Q0XH 5JXAH 1MCRA 2AQ2A 3UAJC 1U36A 2HLFD 2HJLB 3WSQL 5DJXA 1I9RH 1WBXB 4HUVA 2PN5A 5J6HB 2HG5A 3UJIL 1T22B 4M7ZC 1XGYL 1FFNB 4OUUA 3O0RL 4K3EL 5CP7A 4M61B 4ZXBA 3EIFA 3PL6A 4KHTH 4JRYA 2N56A 2LTQC 4R4NC 1GZQB 2YA1A 1A22B 5K9OB 1A7QL 1YC7A 2G5BB 4J12A 3OGCB 1HCFX 3IXTA 1OWRM 4G9FD 4MXVE 2W38A 3BO8A 2NZ9D 4PJIA 3CMOH 4YFDB 2Z35A 4BH8B 1U2HA 3CFEA 4G9DB 1NC2D 4L1DA 5C0RL 2J4WH 4X8XA 2Q6WB 3BJ91 5I76B 4LCWE 1PAMA 1RZIA 3KJ4B 4OIAA 3FRUA 5DRZA 5JA8B 2E7HA 5BVJA 1CDUA 2R29L 4HUWB 1KIRA 3U7WH 1N6QL 2KPNA 4JZOA 4OZGA 4JGMA 2ZOLB 5IBUB 3B2UD 3RNQA 5I17B 1DE4B 4KTDH 1U3JA 3VFOB 3WV0A 4ZFFA 5D5ME 5ACLA 3WDIA 5JOFA 2H2PC 2UWEA 1NL0H 3K4DA 2MQ3A 1KCSL 2BCKB 4GBXA 5D71L 1XCTB 4KVNL 4AIZA 1TPXB 1WITA 1YEKH 6FABH 1PVHA 5KOVC 3H2WA 4PRID 2JELL 3QIBB 4ONFL 5DVMA 1IM9D 4HT1H 5KJRL 4M1DH 4XVTH 1NKRA 4R7DB 3GKZA 5KVDL 5MEND 5T33H 1G7HA 2E8YA 2V9QA 3O8XA 5SWSD 4MLSA 2OJEA 3QP3A 1HN1A 2W9DL 1LHZA 4GAFB 2BVQB 4NSKB 2Z93A 3P4OB 4ODHL 3OB8A 1MFEL 2H41A 3BPLB 1U6AL 4X7CC 3VFVB 1AJ7H 4B41A 4NRZA 4QWWC 1NEZA 2WP3O 4OLUH 4WIQA 5TH2A 4KJYA 1ZWIA 3IU3B 5JA9A 1AKJD 1BIIB 3AS3A 3SDCB 3NZHH 4O9HL 5E8DL 3VG0H 2XZCL 2DQFB 4KDTA 1UWEL 3BGMA 4X6DB 4O2FB 4ONHA 5DJ6B 3EO0A 1JP5A 3JWOL 1F90H 3SE3C 4LLVA 5FYJE 4JDTH 2VIRA 3RRQA 3DVNA 4M93C 4CJ1A 1EK3A 3C60C 4X4YB 5IVXA 2HVKB 5TDPA 2ADJA 3FZUD 4JFOA 5JW3H 3PG2A 4JFEA 4LOUC 5DQDL 1GXEA 3GM8A 3KPMA 4JHWH 4ZUWB 3PGCA 1TCRB 2XZQL 1N64H 3QPQC 4BZYA 2Q20A 3BKJL 1IC1A 2Z8RA 1K6QH 5J4MA 5ALCL 2ZCHL 4HC1L 5T1LD 4QGTA 4GXVH 3EYVB 3QDJA 5D1QB 2ESVE 3K74B 4OZFA 4RRPG 3PDGA 2EIDA 2K1MA 3RGVC 1YEGH 2HKHH 4KV5E 4YHNA 1CFSA 3P4NA 3ARTA 5D1XA 4R4BA 4L3AA 2MKWA 2DQUH 3CPLA 2KL6A 2GJ6D 4JJ5A 4YHPA 2BVUA 5I1AB 1IGIH 3ARVA 1MCBA 4BUHA 3RVVD 4PBXA 1Q9KB 5C07D 5DO2C 3RJDA 3TBYA 3CAFA 3PABA 3B8YA 5HYJA 2OI9B 4N0FA 1T6VN 1ORSB 3A6CL 4Y1AD 5DS8A 1EHXA 1XAUA 5F1OB 4H1LA 2ZCLL 4ZNEA 2OXHA 3RA7H 1MPAH 4P5MA 5DJ2B 1KLGB 1RURH 4JGUA 4PRIB 3Q6GL 3EYOB 5CFHA 4XNZB 1E4KA 3C09C 2WINA 5IOPB 4RGNE 2ICEB 1YY9D 4B53A 1RIHL 3HCVA 4QXTA 1G7LB 5ID0A 1OW0C 4N8VB 2ZSWB 2W0PA 4X9FA 3KLAA 4RZCB 4HD9A 3UJJH 3CLEL 3EDDA 3IDJB 3IFLH 5KANG 3HUJA 3LB6C 4PTTB 5FF6B 1H3VA 1EGJH 3QDGE 1A7OL 1K3ZA 2CLRA 4TVSa 2Q8AH 4XVUC 12E8H 5CKAA 1HQ4B 2UZXB 1CWVA 2XA8H 3ZKMD 5IFHL 3BRDA 3HB3C 3HRPA 3VRIA 1LO2H 4JR9L 3BXNA 5BRZB 5LGHH 1KV3A 3CFBA 4XP5H 3AS1A 4U33A 3D39D 4TPRL 4G42A 5CEZD 1C7TA 4Z7OE 4NZDA 1RU9L 2W9LA 3TBSA 1RIUH 4M3JA 5DJCA 2VLRA 1SMOA 2VH5H 4JCMA 4PJGE 5CWSB 5D7IA 5JW4R 1Q9OB 4KMLB 4TYUA 3BESR 4XAKD 5AZ2L 2X4OB 1FZOB 5HY9B 3BAEL 1RPQA 3EYUH 4R96B 3MBXL 2VDKH 3OJDB 5ENWA 5I1IH 4ZSOB 1UFUA 2NY4C 3BH8B 5DQ9A 2R0KH 4Z7UF 1DQDL 3MRCB 2NW3A 1J8KA 4PRHE 4XPBL 4LVNB 1FIEA 2V17L 2YRLA 3SDDB 1SVZA 3CX5K 5FOBA 4OLWL 3WFBH 3SDYH 3T4YB 4QHNB 2HT3D 3GJFK 2Y7QA 3IKCB 5CJOH 3VMPA 1XGUA 1IBGL 1FFPB 1MHEB 2VR5A 3BHBA 4NZJA 1R5WA 4WHCA 4DOHB 1T1WB 4Y1AB 4GUPB 4JHZA 5CD5C 5F3BB 4LCIL 1HINL 3ULUE 5AWNH 1EMTL 1C5BL 1KTRL 2AXFA 2FEEL 4CVXB 2VLJE 4PJBA 2ID5A 4B0MM 1VPOH 2BVEA 3THML 4PB0H 2GUOA 3FT3B 2BNQA 3C5ZB 5L8JB 3HMXL 3BISA 3CU1A 4PUBH 2VDQL 1DBKL 4P59H 4TNVK 3ROLA 4LLAA 5FECA 5J11B 4KKBC 5EU6E 2BK8A 4YIQB 4U1IB 3AS2A 4IRZL 4XCFL 5HHNA 4XNMB 3OAYK 1QBAA 4K7PL 5ISZA 3KPQB 1DL7L 3MV7B 4F57H 4KHXH 2VDOH 5C9JB 1T1ZB 3SE3A 1AY1H 3FOMB 4MJ5B 2HN7A 1I3UA 4C83B 2D31B 1P7QD 3QR2A 4RBPK 3MLRL 4KJPC 1ULVA 4M9OA 5K9KB 3C60A 2DQGL 3BVNB 5IHBA 4LLMA 4GLRH 3JTSA 1GHFL 3LKRA 4JPIB 2XPGB 5FKAB 1HXMA 1HHHA 3ARGC 3HFML 5FHAL 3BGAA 1F13A 4KK6D 5L6YL 5E8EB 4PJFA 2IBGA 2OP4H 4JDVB 3TBWB 1EIBA 2Z31B 4L1HA 4QRUA 2IH3B 2YA2A 4FQLL 4PPTA 2A83A 1GGBH 1OP9A 1FL5A 3QJHB 5HVHB 5LWYH 3U0WH 2EH8H 4OZIB 1KEGL 4NM4L 5I30H 4LLWA 5JNYA 3OZ9L 3TWCH 1INQA 2WBJC 1FYTA 4I0KA 1Q94B 2R23B 3GMOA 4WU5B 5IESL 3WHXA 1I3GH 5TE4H 3OAZK 2DQHH 4QF1B 1NGZA 5J13C 5SWQB 5C0CE 2V2TB 4G6ML 5C0JA 4CU7A 3UTTD 4Z7WB 4MWFB 4R2GC 1RJZB 1LO0H 1N0XH 3TESA 2EIEA 3BSZL 1JYVA 1IAKA 2E7LA 3JV0A 3IDIA 1PLGL 1HKLH 3O9WC 5C09D 1S7VB 2ZPKH 3DROB 1G7QA 3BZEA 5EZLA 1RVFL 1ZGLB 2C7UB 4L8CB 5J7CC 1AGFB 2BSSB 2Y5TB 5AYQA 1INDL 2D9CA 1B90A 1X3DA 3TFKD 1UJ3B 5B8CB 3TIDA 5IM7A 5DRNB 1LP9A 5T3ZL 2AK1H 2IPUG 4Z76A 2P46B 1MQKH 3R1GH 3U0TB 2H9GA 4ZFOA 3VXRD 3LQMA 3PWLB 5H37H 1IQWL 4Y16D 4BH7A 4RWYH 3DSFL 4Z7NF 5DDHA 3DVGA 4NRYA 4JFFA 1PY4A 2FL5A 5FCUL 4FRWA 1S5HB 2PR4L 3H42H 5B39A 4NHUB 4HS6A 3MLSH 5F7WC 2Z91B 1QRNB 2NY5H 3AM8C 1GYAA 3P0VL 5H2BB 5JW4Q 2WQ8A 2CUIA 5JR1H 3T4AB 3EOAB 3RUGF 3PV6B 5DGQA 4GMSL 2H6PA 1MEXH 4NQCD 2GK0B 1P7QB 1I8LC 4O4YH 1QLRA 5FUCE 2FBJH 3GJFA 4CN4A 1Z3GL 2HJKA 3FQWB 1QHPA 3VGBA 4I18B 5IFJA 1RUQL 1J8HE 2RQ8A 5DJYA 2XQYK 3D18B 3U36B 1AIFB 4AENB 1TTGA 3UTZA 2HYMA 5HGDB 5CP3H 1I7UB 1U8JB 4EN3C 1XH3A 2DL2A 1S7SB 2Y25A 1QLFA 5BO1L 2VZ1A 5E9DE 5E2TL 5GS2H 1T03H 1XR8A 5F7EH 2OZ4H 3C2SA 4F2MB 3G6AB 1JL8A 3TCLA 4X6CB 3RGHA 4HXAH 4LARL 5FDWA 1U8NB 3N1GC 3MRRA 1XGQA 1MCPH 2XIDA 3M1BB 1ZANH 5HVWA 1A14L 1MAKA 1K4DB 1NGYA 2EYSB 2DQEL 3BE1L 3QCUL 1F3RB 1I1FB 3QCTL 3QEHA 1EXUA 3O3EB 1B0RB 1H3TA 4O02H 1KJ3H 2EIBA 1Z2KA 1AI1H 1XGRB 2R2CA 1I8MB 5GSRB 5IK3A 4ZO8A 4Y4FD 4MDIA 2BRRH 3SDXB 3UTTB 1LVEA 3GBLA 1U8OB 4HWBA 4NPYB 1CFNA 1ZTXL 3FB5B 1KN2L 1R3LB 1OTSC 4S1DC 3BYYA 4BA8A 5H8DA 1EEZB 3ABZA 5HJ3B 4KI5F 1T21A 3DTXB 5I0ZA 4S1SL 1RMFH 5C09B 3E6FB 5EU5A 1IT9L 1A4KA 1TNMA 3O41A 5MEQA 4OF6A 3DMMA 5EU3A 4YGVA 4HS8L 4CNIA 5GSVA 3MXWL 4OGAD 2OTWB 1BFVH 2ADGB 4MAUL 4LDOB 1JZ3A 1F11A 2GW5A 1EJOL 5FUOH 2V5YA 1N5YH 4U1MB 3MOBL 4Y16B 1QFWI 3NOIA 4ZFZA 1BD2A 3IF1B 1OTTD 1I8IA 43C9A 1R0AH 4FMKA 1VGEH 2OMNA 1TNNA 3L3HA 2VWEC 1MRDL 2X09A 4LSUL 2BHYA 4YHKH 3ARDB 1RV6X 4M6OH 1VESA 4JJHA 5GQBA 5F1IB 2ZJSL 1DN2A 3GSOB 2F5BL 2BJMH 3QXWA 2DI9A 3T0WA 5E8OB 3ARWA 5DFVD 3LKPA 1ETZA 1EZVX 2F74B 1HYSC 3QAZC 4MA3A 1NBYA 1JGUL 2A6IA 5AYUH 1FRGH 1OTUC 1NFDB 4JO2H 2IMNA 1G6RB 5E6ZA 2C4FT 3MRNB 4WDIA 3QZWB 3GMNA 4OCNC 4Y19D 3SOBH 4OTXL 2UY7A 3LKOA 5DVOA 2XWBB 1PEZA 5DURD 4U2YA 3ZYJA 5MP6H 2IPTL 3BP4A 4XX1G 4X80H 1CICD 4XNQB 2XNAA 3NN8B 2WLZA 3G9AB 4RFOL 1YPZB 3BP5A 3DHJA 3HC3H 3O2DL 5JPMA 1TQCB 3LEXA 2I60H 2DS4A 2WMPA 5BVPL 2EXWC 4LAJH 3C6LC 3SE9L 5I18L 3NAAH 3D9AH 5TFSH 4TNWF 4F33A 3D2UD 1WFTA 4TSCH 5KSBE 1JZ2A 3RWHB 1J1PH 2XTJD 1JRHL 4JFDA 2QKIA 5D70H 1U8MA 1S78D 4QHLB 4ZO7A 4JM2F 3JUYA 3NH7L 2C26A 3EGSA 4PBVC 3MREB 2NY0C 4PJ9C 4XPTL 3MLUL 1J0JA 5DD1H 4M3KB 1KIUA 1MHPL 3E0GA 1L7IL 2VLKE 2WUBL 3GI8L 4LSVL 1CFQA 1E6JH 2A6KB 4Z77A 3R06A 3UTSA 1IJ9A 4FQHA 1QQDA 2E27H 4JO4H 2XKNB 4XZUA 4NKIL 1ONQA 4U1LB 1BQHA 3U9PL 1KB5L 1S9KC 2G2RB 1FVEA 1DUZA 3S96B 1WVZA 5HDQH 5DFWH 4R97C 3KYOA 5GISH 1WBZB 4KJQC 2R1YA 1HH9A 1P5VA 4NQSA 3VXPB 5J1AB 1KGCD 3OSKA 4JREB 3LQAC 2VNCA 1N0LA 2HWZH 4RNRA 3I50L 1IEAB 1U8PA 2Y5EA 4EN3A 4GRWE 4Z7VF 3KLHC 3R8QA 1LE5A 4JVPA 1A1NB 3JXAA 1H9VA 5T5FH 3IJSA 5IIEB 3QQNA 1EO8L 4Q2ZA 4K23L 1XR9A 2Q3AA 1MFBL 3LS4H 4JRYE 3ARRA 4V1DD 3V5DB 2E7CA 3Q1SL 5DWUL 5L2JA 3GMRA 3M17B 1YN6B 3T0EE 4G7YH 4FFZH 1YDPA 1RFDL 3FQRB 3LN4A 1WJ3A 2DIJA 3I02A 3RI5F 5F9WB 1CICB 2AQ1A 2EZ0C 4N9GB 3FCTA 4FQQA 4ZDHB 1OM3L 2OTPA 3V9FA 4YC2C 4P0DA 4OCXH 3NIFF 3K8MA 5ADPH 2BVYA 4LSRL 2GT9B 3WLWD 5IW1A 2I9TB 5FKPB 1UWXH 5C0AD 4OLXH 3TJEH 3QUYB 1VA9A 2IQAA 4PJXF 2O61A 4XPHL 4Z7UA 1NCUA 4UIMA 5JHDB 4U1KA 1NCWL 2XTJB 3WL9B 3T3PF 3W2DH 4HWBL 1T0NB 4LRIC 1KTLA 1T1XA 5DQJA 1E4XI 1JK8B 2FR4A 3DJ9A 3UO1L 4DKFH 5GRUL 3QO1A 3S34L 2Y1VA 3WIHA 2HTLD 1KIQB 2RHEA 4AIXA 1BAFL 3HLAB 3GSWB 4M7KL 4IJ3B 3KLSA 3LDBB 4C56A 3VG9C 3FB8A 4KKCD 3QNZA 3AUVA 4JKLA 1OVZA 4GG8A 3LEVH 1L0QA 3S88H 2QR0A 4GW5B 3W0WA 4P3DB 4YBQD 3IDMA 4ZUUB 3C2AH 4CL7A 3TZVD 2PTVA 3FFCE 1UWGH 3HNTL 5JHLH 4DCQA 32C2B 1GOGA 3BN3B 3MA7A 3FO0L 4DKDC 4XP1L 4QXUH 2B2XH 3BWAA 2VZUA 4EDWH 4NKQB 1X7QA 3IDNA 1YEIH 5DD0H 2WWKO 4I2XB 3RIFK 4HIJB 3EZ8A 1LE9A 5F96H 5EZIH 3GMQA 4YPGA 4LLYA 3RWEB 4LBEA 4MQXC 3MA9H 2N7AA 5IFAH 3MJ9L 1LEIA 4Z5RA 5GZOC 4FTVE 4JN1L 3OPZL 1OSZA 2CIKB 4OD2A 1F3JB 4QTIL 5CSZB 5CS7A 3P9WB 5J8OA 1NMBH 3DXAA 3I85A 1SJEB 4P23A 3TGXA 2V5RA 3RIAK 1JGVL 3MNVB 1C5CH 3UTQB 1CGSL 4S1RH 3QUMA 4GOSA 1PKQB 4H20L 3IXAA 1LEGA 1A6VH 2VO5A 5JW4N 4JPKL 1IGYA 4HDIB 1P6AB 5TGBB 5BMFH 3QQ9C 5E6ID 1YNKL 3PQYD 4ORGA 3Q3GA 5I8KH 2NY3D 1RK1B 5IVZA 1MCLA 5DEFB 3FAWA 4HFUL 2PYFA 2OQJB 2UVFA 4ZMAT 3MRFA 4PJ9A 1CXEA 1NGWA 4EXKA 2AJYL 3U7YL 5F7HA 4G6AD 1HHGA 3LMJL 4HWUA 4ZNEE 5T3ZE 4P2OA 1VGKA 2X4NB 1A6AA 4PJDE 1U93A 2IWGA 3K4ZA 3U6RA 1HEZA 4LAQH 4J3XA 4RIRB 1GSMA 1TITA 4N0UE 3VXNB 5FYLL 3GMLB 1BJ1J 5DMGC 1U95B 1JIBA 1FQ9C 2GKIA 4YK4C 1SYSA 1AP2B 4NJAL 1FZJB 4JY4B 1VB9A 1SY6A 1G6RH 2D7OA 4JM2C 4NNPH 3V79C 1FNSL 4X6DF 1GAFH 3P77A 4KKLD 4U7SA 4HKJA 4BQ8A 2CXKA 1T7XA 1NPUA 5E8NB 1MCJA 5HHXH 2ORBL 2DWDB 1A9EA 1NBZA 1L7TL 1OGTB 2AEIT 2EDRA 1M7IA 3BPNB 4M43L 4FQJL 3UTPE 4P2QD 2OX5A 5T1KA 1R3IH 1IC5H 4MNQA 1R3JB 2CPCA 4N0CC 4YHYB 3MO1B 4KUZH 2FLRT 2NY1C 2VDLH 3ZYOA 2EE2A 1GOFA 5IEKA 3D85B 3OX8B 4MJ6A 3RUGA 4L4TA 3VFNB 4AL8H 5I19H 3ZDZF 1AO7E 4PJEA 4PY7A 4X4MA 3SCMD 4UINH 4G80B 4LIQL 5EOCH 3MLTB 4OM0H 4PGBA 3K80A 3BEWB 4N90D 5T1MB 4HJGA 1UA6H 2HP4A 2G9HB 4ALAL 4OCYH 1EA9C 2R2BB 1HNGA 4UBDC 1WZ1L 1ZA3B 2LU4A 5FK9B 5SV4A 4XPAL 3QRGH 3HMWH 3QSKB 1KIPA 3CVIH 1H0DB 4ZPVB 4HWZB 3BPCA 2HTKD 2VDPL 1ZLWH 2ATPA 3NFSH 5EDXA 3DO7B 2R4SL 2X44D 4PJCB 4XTRC 5IBLD 5I1CH 1KLUB 4LRIA 1N7MH 1TTFA 4PJ5D 1OAXL 4PLOB 4OI8A 1HYRC 3BIKB 3WO3B 1KTKE 4NCC1 5KANI 4K3JL 1E28A 3I2CH 4DN4L 1MSPA 5DHYB 2IPKB 5BJTA 1A7BA 1RULL 5C0EB 3LN9A 3W39A 1ZMYA 1R24A 1OAZH 4XVJL 3GFUA 1FORL 3EJZC 3RWJB 1FNFA 2BNQE 5CJQH 4FXGA 2HFEB 3BQUC 5B22A 1U8HB 3SGKC 1RUAH 3OAUH 3SJVA 4NKDA 3BP6A 4PJ7B 4DZBB 3H9HB 2PW1A 3H3BC 1YQVH 3NACL 4G8EB 5DK2A 4PD4J 1T2XA 3T77A 3ARSA 4L3EA 2QHRL 1EDQA 1AGDB 1MCIA 3OF6A 1CLYH 2R56L 5ERWA 1R5VA 4WW1A 3U4EA 1RZ8A 4YQXL 4PG2C 4N1EA 1SBBA 3BZDA 4OT1H 4CVZA 1V3LA 4CMHB 5L7XH 1FO0H 2GJJA 4WW2C 5FA3A 2PXYC 4ONGH 4MMZC 3QWQB 4PRPB 4POZC 4KK9C 2FECI 4UILH 4HZAA 3VI4E 5KTEL 2C1OA 2D9QB 3UXFA 1ZHBB 5F9OL 4JVUA 4I4WA 2P5WD 2E7MA 4HKZB 5KG9B 3X3GL 3QDHA 4PGJA 5BS0A 3VXSD 5CBEA 4NBZB 5CCKH 5K9QI 5HI3D 1NGQL 1QFWH 1IQDB 1YN7A 4M5YL 2A74A 2BZDA 4G8FA 4LCYA 5IG7B 4D0BA 5EBMB 2G5RA 5CZXC 5CILL 4J3SA 1Q9WB 4X0KA 3O4LE 2XN9B 1K85A 4PGDB 4DK3A 2XWTB 4HPYH 4UNUA 2VQ1A 3L6FB 5D93C 4BSWB 1KG0B 1E4WH 1FGVL 1XIWA 4OD1L 3WUWB 4M5ZH 3SE8L 3N9GH 1U8QA 3IS1X 4NQED 4MAYD 5T1DL 3M8OH 4XI5D 3QG7H 3KJ4C 4Y4HD 3TJHC 4M7JL 1Y0LA 3VXMB 3V95A 1MHCB 2CK2A 5LG1A 1X4XA 1W0VA 3OKKA 4J8RB 5TDOB 3QQ4B 1HH6A 5DJ0B 2V2WB 2X4PB 3MRBA 4IEFB 4PJ5B 4XH2B 2F5AH 4HF5H 5IB4B 3T08A 4YXKL 3QEQB 1UVQB 1LP9E 4NNXA 5E4EC 2AK4D 3VD4A 3F7VA 3EFDH 5ANME 1P4BH 1BQLL 1H3XA 1MFCL 2Q76B 4OGYH 5KSVA 4I77L 1CIUA 1QSED 4JM2A 2FRGP 3MUHL 3MCLH 2WBKA 5IGXL 1RZKC 3NIDF 1VFAB 4MJID 5FM8A 4F37F 3WIFA 2QL1A 3MUZ1 3P73B 2HFFB 1ORQA 3NZ8B 2WIIB 1NBQA 1OAYL 1S9YB 4GAJH 2YK1H 3HAEB 2EXYC 1BVLA 4HFWA 3EFFB 4AIOA 1T0MB 5F9AC 4AEFA 3H9SD 4MSWB 2GQHA 5CLTA 2BNRE 1G7IA 2RCSL 1U8LA 2D4DA 2DMBA 3MRLA 2DQTL 3VJ6B 3HI1B 2PETA 4KUCF 1DLFH 3UZQA 3QO0B 2HLFC 1CU4H 4JFPA 4CBPA 4OZIF 2P5WB 4NQDB 1FJ1B 3ZTJH 3VFUB 2P4AB 2BC4B 3VXSB 3RHWF 2EDFA 5D72H 1CTOA 3ARBA 1S7UA 4Z7VA 1XF3A 1ZHKB 3EDEA 1JWSB 2W59A 3BZ4A 1ZAGA 2HT2C 5EU7C 1YNTA 4TUKL 4TOYL 4D9RE 4XBGB 4O5LL 1T4KA 4NQVB 1MCHA 5BZDA 2KDGA 2NY5C 4Q0XL 5JXAL 4QRQB 4G6JH 3C9NB 5KSAB 4Q9QH 4NO0D 4NT6B 4FNLH 2EDOA 2QJDA 3B9KB 2E9JA 1I9RL 4FQXD 5D1QC 5JO5A 2YSSA 5TQ2H 3L3IA 3PHQB 2YEZB 4MAYB 4N0YH 5IF0B 1FN4A 2XFXB 4ISVB 5J89A 4JRXD 4NC1C 4UDUA 2VZSA 4X7EC 4HUXB 1D9KD 4GJTB 4D3CH 1A6WH 1XMWA 2AW2A 3QH3A 4KHTL 3DWTA 3H3PH 1BBJB 3QBTB 1TJHL 2OI9C 4HIEB 4PJXA 1NGXA 4M02A 2R0LH 1H5BA 2AK4B 3CMOL 2EH7H 3CSYA 3LSOB 2OTUB 1FNAA 1QSEB 2J4WL 1T04A 4LFHG 4U6XB 4XNZC 1FLRH 4JB9H 1RZGA 4AEIH 5J9PB 1JZ4A 4MNGB 1CDHA 4MJIB 4XP4H 3U7WL 2R69H 1BD2E 5HVFB 2J1KA 3HC4L 2H3NB 3WMSA 2G60H 2PXYA 4KTDL 3MFFA 1P4LB 3PP3K 5EUOE 1E4XH 1FFRA 2HJLA 1DVFB 3MV9D 2EEBA 3VWJB 1WBXA 1NL0L 4QXWA 2HH0L 3HPLB 3LN5B 3VXTB 4P4KD 3NA4A 5EPMB 1YEKL 1I9JH 2GSGA 3H9SB 6FABL 5J6HA 2WK2A 1T22A 3TPUA 5F7DA 4HT1L 4M1DL 4XVTL 4X6CF 4WFEE 5T33L 1KJ2H 2BFVH 1ZE3C 1GZQA 2CLZB 5HDOA 3OGCA 5IMMB 3RVTD 4XP6H 1AJ7L 5C9KA 4MLIA 4OLUL 5CJBA 4YDVB 4GRLC 3SDXF 2EDYA 4OCRH 3EBAA 2Q6WA 5I76A 3NZHL 5D7JD 3VG0L 3BGFB 5HHME 4HUWA 5LGJA 4WV1B 3V5KB 4NO0B 5T5NF 3I84A 4H88H 4KMTH 2ZOLA 5I17A 3X3FH 1QR1B 1F90L 1DE4A 1KJVA 1BZ9B 4FQXB 4GXUM 2DMKA 3O6MH 4EI6B 5DK3A 4JDTL 3QI9C 5DC9B 3VFOA 4G8GB 4LVNC 3LQZB 3SDDC 1Y18B 2AJXH 4X7DC 1OAUH 3H9ZA 1XCTA 4AQOA 5JW3L 2VZ3A 1U0QA 3RFZC 3RVVC 1RD6A 5FYLE 3QIBA 4JQIH 2HT4C 1XF4B 4JHWL 1IGFH 3GIVB 1N64L 5IHUH 1K6QL 3UX9B 1IZKA 4GXVL 5CLWA 1MRFH 3QFDA 4XHJC 4ZUSB 4NSKA 3GBNH 4OI7A 3NCMA 1YEGL 35C8H 1F6AB 2HKHL 4NN5B 1MCWW 2LU7A 1YMME 1AGBB 1AD0A 1I7RB 3MQIA 5DEGA 2DQUL 4NKMB 4NRXB 3C5ZC 3RDTA 3IU3A 1IGIL 4NZUH 3CSPA 4GQ9H 1BIIA 1YY9C 3BT2H 3SDCA 1Q1JH 2DQFA 3CLFH 1U41A 4BKLB 3MV11 2W65B 3GMPB 4M4RA 4X6DA 3L7FB 3QXVA 4O2FA 3WNMA 1BVZA 1A3RH 5DJ6A 2IH1A 3TA3D 5A2FA 3MV9B 5FOJA 2ZUTA 3RA7L 1MPAL 3PWPD 1A7RH 4NYLB 3VXUB 1B9ZA 1RURL 1RUML 5I74C 2M26A 2MJWA 4X4YA 4LIQE 2HVKA 2ITDB 1FFOB 4GG6E 1LDSA 2ZZUT 3KYAA 4GAYB 1A7PH 3FT4B 1YPZF 4ZUWA 3S4SA 3QFJD 1TCRA 5EULV 4YXHH 5IW6B 1MY5A 1WZMA 2Z31C 1N5AA 3MRHB 4H0GA 3UJJL 3EYVA 5GGQH 4NBYB 4Q9RH 3IFLL 4G9FA 3NIGE 1VEPA 5D1QA 5HVHC 2IAMB 2E6PA 1EGJL 1NC2A 1MIEH 2JK5B 2Q8AL 12E8L 3WEXA 1UGNA 5D7JB 2X4SB 1NANH 5C2UB 2XA8L 2BOCA 2X4QB 5I1AA 5J57B 1LO2L 5MEPB 1Q9KA 5LGHL 3ZHDA 3DV6B 1I1AD 4XP5L 4WI5A 1JGDB 1JF1B 4LPUA 4JAMB 2IBBA 1ORSA 3HAEH 3UDWA 3RVUD 3P40A 3ARED 5GGUB 1JNLH 1BBDH 2CRZA 4JKWA 1RIUL 3L7EB 2HT3C 1OAQH 2CUHA 3DETD 2VH5L 1KLGA 1OOAA 3GMMB 1PW3A 4PRIA 3EYOA 4KROD 5EUKA 4YLQT 4K8RD 1IM9A 4U6VH 3LPGA 1UJ3C 1UKSA 5KN5A 4QT5B 5IJVB 2BOBB 4NFCA 5MENA 3EYUL 2ICEA 2VDKL 5I1IL 4W4OA 3GZKA 1H8SA 2R0KL 1G7LA 3I3DA 3E8UH 3CX5J 3HE7B 4LCUB 3H3KA 4R3SB 4PTTA 3WFBL 3SDYL 5FF6A 2AKRA 3DBXB 5GJSH 5CJOL 3EHBC 1X5FA 2R15A 3PP4H 5HI5D 1HQ4A 3ZYZA 5GGRB 3VA2C 2ENSA 3WNKA 2AJVH 3U82B 1CS6A 4NUGH 2E5EA 5AWNL 4PRDA 4FQIH 1G84A 1JUFB 5DD6B 3PWPB 3LRHA 3L5XH 4KPHH 4I8DA 4U0QB 1CG9B 2V5TA 3O4OB 1VPOL 2GYSA 4QRSB 4CN1A 1U58A 4PB0L 2GTZA 1YEHH 5CWSA 5I71B 3IDYB 4PUBL 1Q9OA 1UWXK 1UZ8B 4J6RH 4P59L 1JMXA 2JTDA 4UUJB 5F9JA 2Z8WC 3GO1H 3GSUB 4LRNH 2X4OA 1MVFA 1FZOA 5HY9A 4FFWC 2D7QA 3FN0H 3TYFB 4R96A 3RQ3A 5CEXB 3OJDA 5T1LA 4ZSOA 1IMHC 4F57L 4J1UA 1RHHB 4KHXL 2VDOL 4HIIA 1CL7I 1HDMB 1AY1L 3OKOA 3TLRA 4LGPB 3MRCA 3SDDA 4WU7B 4J3OC 1R3KB 2GJ6A 3IKCA 1OD7A 1UJTA 5J12B 1MHEA 4HS3B 4DW2H 1ZHNA 4F7MB 2JJVA 2VXVH 2WM0A 4JKPH 4MNHA 2XYCA 1PSKH 3JV4B 1T1WA 2VXSH 4HKBB 2OP4L 4Y1AA 2ZP0T 5F3BA 3AREB 2CQVA 3HR5B 2X89A 4XPFH 1PY9A 5A16A 3P4MB 1T1YA 1GGBL 5DC4B 3MRQB 1OCWH 5LWYL 4HWNA 5HDBE 3U0WL 2EH8L 5ABDE 3MRMB 5DLMH 5I1DB 4KROB 5I30L 3TWCL 3RKDD 4EXPX 3MV01 5GS1A 3FN3A 3FT3A 2VKWA 3C5ZA 3MBEC 1I3GL 5TE4L 3AVEA 2DQHL 3FL7A 1IGCH 1GGCH 4YIQA 2AV7B 1UZ6E 4XNMA 5DJXB 1LO0L 1N0XL 3QIWB 4Y16C 3KHQA 5C9JA 1T1ZA 4MJ5A 1HKLL 3CSBA 3MNZB 4C83A 2D31A 2ZPKL 1U2CA 2RFXA 5SX5H 4OUUB 5CP7B 5K9KA 1HCVA 3ROOB 4ZXBB 1I75A 5FM4A 2XXMB 4R90H 3ARDC 5GS0H 4JPIA 2XPGA 4D9QE 5F6HJ 5HHOE 2AK1L 1MQKL 3R1GL 3QPXH 4WY7H 3IXTB 4JDVA 3TBWA 3BO8B 2Z31A 3ZTNH 4PJIB 4PJEE 1QBLH 2IH3A 1QUNA 4KU1A 3CFEB 2VXTL 4RWYL 4KJWC 3LRGA 2EDWA 1E0OB 4OZIA 3OG6B 5BVJB 4AEEA 4KKAC 3H42L 3LVEA 1LD9B 3MLSL 2NY5L 4JZOB 1Q94A 2R23A 1OF2A 3RNQB 5JR1L 4Q6IB 4RCAA 2DL9A 4QF1A 3IU4H 4JANA 3BFOA 5SWQA 1JF6A 1DTUA 4ZFFB 2V2TA 1G9EA 1MEXL 4MWFA 1RJZA 4TTGA 3VA6A 4O4YL 5DEZA 1YEDB 2Y23A 2FBJL 1TQCC 3MMEB 5C0FA 2DQIH 5E08H 3DROA 3MZTA 2ADIB 5H94B 1ZGLA 1QEWB 3D3VD 1AGFA 5K59F 4F15B 1WAAE 4JPVH 2BSSA 2Y5TA 1BJ8A 1UJ3A 1D6VH 3NFPB 5B8CA 5DRNA 3OJMB 1T03L 5F7EL 2OZ4L 2XRAH 4HXAL 3RWDB 3DVIA 3U0TA 1MCPL 4NRZB 1ZANL 3PWLA 1MQ8A 3R4DA 1QSFD 3JUZA 5EU4B 4QNPF 1REIA 1FG2B 1P69B 2KZ1B 1KJ3L 4RDQF 4OGAC 3RP1A 5ILTH 1AI1L 1S5HA 2D7NA 4NHUA 2ZUSA 1OPGH 3WKMH 2Z91A 3UZVB 1QRNA 4EIGB 2BRRL 5ESAA 3DECA 4IDJH 2P42B 3V6OC 2RIKA 3T4AA 1TMCB 3PV6A 1UH3A 1EEQA 1TXKA 5HGHB 1P2CB 2MTPA 2YOCA 1RMFL 1PEWA 3TVMD 3BI9X 2UYLB 1P7QA 5SWZE 2YPLE 1NDMA 3HNSH 5D2NA 3FQWA 1WK0A 2VDNL 4I18A 3RBSA 4JFEB 1DFBH 4JREC 3BYTA 2AXJA 3D18A 3PGCB 1AIFA 3M45A 3HZKB 1FAKT 1BFVL 4L9LC 1I7UA 1U8JA 4PJHE 1HQRB 1S7SA 3OXSA 1ZLWK 4UOJA 4P46D 4BSVB 2H1PH 5FUOL 1CGUA 1OGAD 2VL4A 1N5YL 4F2MA 5DFVC 2Y6SC 3HS0B 3DI2B 4X6CA 1U8NA 1DLHB 3HR6A 1CFSB 4RQQB 3M1BA 5D1XB 5E6YA 5JOPD 3LHPH 1K4DA 1R0AL 1VGEL 4PTUB 4YHPB 2EYSA 1WFOA 2PCPB 1L6ZA 4AZ8A 4AK1A 3O3EA 1B0RA 2YD7A 1JNNH 5DT1H 1U8IA 3TBYB 4YHKL 2R1XA 4M6OL 3O3BB 1JWMA 1BJ1H 1I8MA 5HYJB 5TF1H 5F9WC 1CICC 1MWAB 4H1LB 3SDXA 2BJML 3UTTA 1U8OA 3EJYD 3W82A 4LEXH 1R3LA 4P5MB 3QCVH 5IB3B 2DTMH 5HJ3A 3P9MB 2WBWB 4H25B 5C09A 1FRGL 3QUYC 2YN3A 3GK8H 4JO2L 3E6FA 5F21B 2RBLA 2CRMA 3E6HB 2BSED 2IADB 2XTJC 4A6YB 2GITB 3SOBL 5B38A 3ECBB 3JWDH 4Y5YA 2DLFH 4PJ7F 2OJZH 2OTWA 4X98B 5ID0B 2ADGA 1QNZH 4X80L 3MV8E 3AAZB 4G43B 4U1MA 3ZL4H 3HUJB 1FE8H 4IJ3C 3T0VA 5FYKD 5E99H 3HC3L 3LDBC 4Y16A 1MCOH 3HG1E 2X40A 2I60L 4JEGB 5HHVH 3IF1A 5EN2B 3NAAL 5TFSL 5FA4B 4DK6A 4WWKD 2VZTA 5JQ6H 4TSCL 2FGWH 4M6NL 1JZ6A 5D70L 2WW8A 3ARDA 5I66A 4R4FH 2A2QT 2IANE 1A6TB 3K81A 1A6UH 1MI5D 5F89A 5L2KD 5DA4A 2DM3A 5E8OA 4RGMB 1NEZG 4CADB 5DD1L 2F74A 1IC4H 5D7IB 1UCTA 2PYEE 1BFOB 2X7LA 1QSVA 3OKLB 1E6JL 3MLWH 4H5SB 3MRNA 3QZWA 4MS8D 4P46B 1CQYA 2P24B 2XWBA 2QQNH 2E27L 4JO4L 4N1HB 1I1CA 4CDHA 1DBBH 4XNQA 3V7AE 4FABH 3H7BB 3NN8A 4QRTA 3NBNA 3MUGA 4LDEB 3S5LA 1YPZA 5HDQL 5FOBB 5EO9B 5GISL 1T6WA 4Y8AA 2OL3B 4K8RH 3DOSA 5ID1B 3I75B 2BY2A 3BHBB 1B88A 5C0BE 5J1TC 3SE4C 1XF2A 4MXWH 2FWOB 1JPGB 2GJZB 2HWZL 1A21A 3NFNB 4MQSB 2VDRH 3RWHA 4FS0A 3ZE1E 1S7WB 4Y4FA 2E9IA 5T5FL 4BQ9A 4QHLA 2CMRH 2BRQA 3MREA 4PJBB 3LS4L 1A1OB 1BVKB 2VITB 5CINH 2F54E 2FX9H 5A2IH 2DKUA 4G7YL 2R4RH 4N5ED 3ROLB 4FFZL 3T0DA 3T3PE 2F53E 4QHUB 4YEEA 2A6KA 5ISZB 4P2RB 5FYKU 4OKVB 4OCXL 3IJYB 3HN3A 3RWCB 5ADPL 2HN7B 1KPUA 3GBMH 4KK5C 2G2RA 4KKCC 1P9MC 3RVXC 5KS9E 1TETH 4MD4B 3K0WA 4OLXL 3S96A 2H2SD 4MXQD 3TJEL 4NO5A 3WE6B 4C59B 1I4FA 1WBZA 1DQQB 3JTSB 3VXPA 2W92A 3MGAA 3W2DL 5I73B 1HHHB 4LCWD 4MVBC 2VLME 3QWOB 4OF7A 2VXQH 4KQ3H 1DQMH 1ZT1B 15C8H 3BPNC 4DKFL 1MI5B 3LRSB 3TNMB 2XQBH 5IIEA 1CGXA 2A83B 3RU8H 4YHYC 1FL5B 1MELA 5B4MD 1W0WB 3RX8A 3MCG1 1INQB 3LEVL 5IB1B 1CD8A 3S88L 1I9IH 2ZKHH 3EOTH 5DFTA 3M17A 5DJ8B 3MLPA 4FFVD 4Y19A 3C2AL 2EDEA 4RA0C 1NGZB 1UWGL 2ZNXA 3FQRA 1KACB 5JHLL 1CICA 1JMZA 4ZDHA 1NUFA 4QXUL 2B2XL 4IRJB 4EDWL 2GT9A 2DBLH 2I9TA 1YEIL 4P4RB 5DD0L 4UNVA 1UB6A 5KZCB 9CGTA 2VAJA 4KTEH 3BZEB 2A1WH 2NY6D 2VAAB 4I1NB 5F96L 5EZIL 4LMQE 5M7QA 3MA9L 5IFAL 5IM7B 1GOHA 3WL9A 1YMHB 4HBQA 1RY7B 2O93L 1K8IA 1YY8B 5DHXB 1JK8A 3MLZH 3B5TA 4Y8DC 4X7FC 1NMBL 1KIQA 1FLTX 4BH7B 3IETA 3HLAA 3GSWA 2Q7YB 1CD1A 5GXBB 1C5CL 1CL7H 5FYJD 3T1WA 4G6AC 4NRYB 4S1RL 1IGJB 1UEMA 5B39B 1A6VL 4GW5A 2Q1EA 4P3DA 2OMBA 4ZUUA 5BMFL 5GRJH 3RAJH 2H6PB 4OZFH 5I8KL 2XTLA 5ITFB 4QHKI 32C2A 2AEPH 3O6FD 3TIEA 3HZMB 1QLRB 1J5OH 5INCB 3CXDH 2EDDA 2HJKB 2YRZA 2PW2A 1EFXB 2ESVD 5DJYB 4X6DE 1TVDA 3CCHB 3F7QA 1QOKA 4I2XA 3V52H 4AG4H 4LCWB 1S8DB 4L4VE 1QLFB 3RWEA 3BZFA 4AT6B 4CMHC 4LAQL 1MWAH 4H1LH 2LV4A 2AI0H 1IM3A 1FVDB 4PJAF 3HE6B 1X5HA 3PIQA 5JXED 4GKNB 5FDWB 4GQPH 3U30B 1F3JA 2NCMA 4LFHD 4NHCH 4EEEA 1CN4A 5CSZA 5EU7E 1T2QH 4QEGA 4R8WH 2RB8A 3QUXD 5FM5M 1C5DA 1G6RL 1SJEA 2JB6B 3QISA 3IAGC 3MNVA 4NNPL 1GAFL 4HCRA 3WJJA 3PXJA 2J8UE 1P5UA 4ZOAA 4A6YH 1PKQA 1NBVH 3OJVC 4HJ0D 4HBCH 2DLEA 5HHXL 1Q0XH 3ZDXF 4RGND 3RL2B 1RHFA 2H32B 4X7SH 3TN0B 5TGBA 1Z0NA 3DRQB 3VH8G 2Y36H 2JE8A 5IBTH 2P8LB 1R3IL 1IC5L 1J9CT 3F65A 3TO4D 1RK1A 5EU5B 4KUZL 5MEQB 2VDLL 1UM5H 5C0AA 1FZMB 2OQJA 2B20A 3DMMB 2NXZB 5EU3B 1WZKA 4AL8L 3QDGD 4F9LC 5I19L 4P9HH 4UINL 2X4NA 3MZGB 4IHOB 1F11B 5EOCL 3PNWB 1HILA 1KELH 2V7NB 4RIRA 3VXNA 1UA6L 3GMLA 1KXVC 4OCYL 3CDFA 4RMWA 1U95A 2YKLH 3JV6B 1AP2A 3QRGL 1FZJA 2C3XA 1J0IA 4JY4A 4E9LA 3N1QC 3CVIL 1P9MA 2CRYA 1QPPA 4W68A 5JPNA 1KC5H 1WIPA 3VFTB 2FX7H 2NZIA 3SDAD 4OF0A 3NFSL 3QWRD 5ADOH 2AJ3B 3RL1B 5C7XH 5I1CL 5E8NA 4LPCA 1T2JA 3TZVA 1QVOB 1V05A 1P6FA 4PRAB 3N06B 5DUMH 2DWDA 1NAKH 3MYJA 2EEDA 4LNRB 4LLQB 1OGTA 4Q74A 3O6FB 5BZWA 1N7ML 4APQD 4JFZH 3D25B 1FC1A 3K46A 1R3JA 3ZKXB 2RR3A 4YXLH 4MQ7B 3MO1A 4PRHD 5BRZE 4FG6C 3GMNB 1CR9H 4DVRH 2QV2A 4WCYH 3MRJB 4LSQH 3ET9F 5E8PB 1OAZL 3FQXB 4G80A 2YC1B 3MLTA 3BEWA 1NMCB 4XXCA 1ADQA 5T1MA 1IARB 1YEJH 3OR7A 3OAUL 2GCYB 2G9HA 3BP5B 3ULUD 1ZA3A 1YQVL 1JJUA 4HV8B 1HIMH 1RZFH 4DVBB 2VLJD 1CLYL 1H0DA 4ZPVA 1A0QH 1BOGB 5DK0A 5ACZB 4OT1L 3DO7A 4K55A 4WEMB 5L7XL 1FO0L 4QHMB 4ONGL 2Y72A 4EI5D 1KLUA 1T5XB 5E6IA 3SN6N 4U3XA 4LKXB 3X12A 3DGGB 4UILL 2HRLA 4S0SD 3PQYA 5EU6D 5FYKH 4BQCA 5KSAC 1EHNA 1K8DB 3X14B 3KVQA 3B9KC 2CJUH 2APTA 4HULB 4UTAH 1UACH 2CXGA 1FGNH 5CCKL 5IHLB 1PJ9A 3BIKA 1QFWL 3D0LB 3L1OH 4Y0GA 2RAMA 4WNQB 2Z9TA 4RAVB 1A1MB 4KGJA 5DHYA 2IPKA 4FQHB 1OWWA 2EICA 2X9YA 5C0EA 1ONQB 1BQHB 4J4PC 3TPKA 3ARXA 4HPYL 4Z7QF 3RWJA 2GY5A 1FVEB 2HFEA 4NNYB 5CAYB 1U8HA 4UT6H 4DJMA 3QEUB 4M00A 4M5ZL 4PJ7A 3H9HA 3N9GL 7FABH 4G8EA 4WFHE 3M8OL 4NQSB 4KRPD 2ZCKH 1KB9K 3V4PH 3QG7L 1AGDA 4PJGB 3MV7E 3HRZB 5HYSG 2BHZA 2A38A 4ENEC 4JHAH 4FZ8H 4LLUB 3QXTA 3MOAH 1CZ8H 4APQB 2MQCA 2WWMD 1LNUB 2NY7H 2F5AL 4P2QA 4HF5L 5C0CD 1ZHBA 4X5WB 3BKMH 4UT9H 1DVFC 3VWJC 4HKZA 5KG9A 4PRHB 2QHLA 3FONA 5BV7H 3CX2A 3EFDL 5I1KH 4OGYL 5C1MB 4EZMA 3KG5A 3OKNB 3MCLL 5DD5H 1IQDA 3U1SH 1JZ7A 5CMAA 2EE6A 3SCMA 5KVFH 1IVLA 3I02B 5GZND 4X5XB 5EBMA 2WLYA 4OCMC 4OFVA 1Q9WA 2GFBA 1D5IH 2XN9A 3BIAX 1SVCP 5IW1B 4PP1D 2XWTA 3L6FA 2YK1L 4BSWA 3WUWA 2VLJB 2AP2A 3IFNH 4JKKA 2GIYA 2NW2B 4Z7UB 4LSSH 1KCVH 1XGPA 4NO2B 4Z7WE 3V0AC 1WQVT 1MJ8H 3ULVH 3BGFC 1T3FB 4JLRB 1MHCA 1G7JB 1KTLB 1TJGH 3MLVH 4KDVA 5A3ID 5GGRY 1W2KT 1DLFL 5DQJB 4J8RA 5EU6B 5TDOA 3QQ4A 5DJ0A 1CU4L 2V2WA 3WDHA 4FQXC 2X4PA 4PJ5A 4XH2A 4Y88A 3WFHB 1S9XB 5D72L 3QEQA 1NFKA 1UVQA 3QNZB 4KTYA 4WHYH 3OKMB 1EEUA 2Q76A 3W0WB 3VGAC 1B6DA 3IDMB 2O5XH 1J8HD 1U3ZA 1AXSB 1CE1H 3RTQD 1Q9LB 2EO9A 1PX3A 3MLYH 5SX5K 3L3KB 4X99A 1VFAA 4AY0A 4RRPA 4DCQB 1WSST 4G6JL 4QRPE 4Q9QL 3MA7B 5E9DD 3MJ8A 4FNLL 3P73A 1XEDA 1JHLH 2HFFA 4OIIH 5DZNA 3NZ8A 5TQ2L 2WIIA 4F7EB 1TIUA 4N0YL 5JMOC 1S9YA 3A67H 1QRNE 4KRPB 5FV2A 3HAEA 2XQYG 3EFFA 2X1PA 1T0MA 3PGDA 2C3HA 5I9QB 1DEEB 5IWLA 4D3CL 1A6WL 4MSWA 4QRRE 2FJFB 3H3PL 1MFAH 3EO1B 4RISH 3VCLA 4OD2B 3VJ6A 3HI1A 4MYWB 1B3JA 4G7VH 2FJHA 2DWEA 5F3HB 4W81A 4C4KT 2P5WA 2R0LL 3DXAB 2NX5B 3VFUA 2EH7L 3VXSA 1WICA 3RZCB 3DX7B 4GO6B 1SEBB 1T83C 4HQQH 1FLRL 4WGWB 3QIUD 1LEGB 2YS4A 4JB9L 5DVLA 4AEIL 1FPTH 4POYA 3MACH 1DBMH 2R69L 1C16A 4XBGA 1EAJA 4NQVA 3UP1A 3Q3GB 2G60L 2HJFA 3WHE1 4QRQA 1E4XL 3ZE2E 3RVTC 1NGWB 2IAMC 3MC0A 4NQEA 2YEZA 4MAYA 5IF0A 1I9JL 4LL9A 5DRWB 1LWRA 3SDXE 1S7TA 1TVHA 4P2OB 4ISVA 5D7JC 1ZHLB 4IM8A 4M62H 3OGOE 4HUXA 4P48A 3WYRA 1UYWH 1KJ2L 3PDDA 2BFVL 2WANA 1W8NA 1BBJA 3EJJX 1SYSB 3AC0A 1WT5C 5HYIA 1CBVH 1JCKA 2QQKH 2NR6D 3IGAB 1PFCA 1LGVA 1G1CA 4XP6L 5C08E 1K5NB 2AK4A 4JO1H 3P77B 1T89C 4HKJB 1QSEA 4OCRL 2CRIA 1LEKB 4FQ1H 2CR3A 4O2EB 1PD6A 4BFGA 5J9PA 4U4BA 4MNGA 3U48A 2B4CH 1A9EB 4MJIA 3V6BR 4KVCH 2DQJH 4H88L 4KMTL 4L8BA 3X3FL 3GHBH 1JGLH 2H3NA 4P5KA 4MNQB 3STLB 3O6ML 4K71B 2R1WA 4MZ2A 4HX1B 3HE7C 5DXWA 2YA0A 5I8CB 2MOVA 5EWIH 4C58B 4MJ6B 3LN5A 3HPLA 1RI8A 3VXTA 1OAUL 5EPMA 1BGXH 3H9SA 3OKDA 4WI6A 1MCWM 1QPXA 1IGFL 3DNKA 5IHUL 4ELMF 4LSDA 3KPOB 1V7MH 5D7KE 1NFDE 5E5MB 1MRFL 3GBNL 1F4WH 4W70A 2FHFA 1S7QA 1GGIH 35C8L 1O7VA 3O4OC 4PJAA 1MLCB 5JMRA 1MF2H 2ATPB 2F9BT 5I71C 3IDYC 3GSXB 2DAVA 2C5DC 3TV3H 4NZUL 4HJJH 4GQ9L 3BT2L 2VLKD 2Z0BA 5GHWH 2D7TH 1Q1JL 3CLFL 2EDLA 4OI9A 4TQEH 4WV1A 3V5KA 4JPWH 4NO0A 1A3RL 4X6FB 2DIBA 4YE4H 4FQXA 4EI6A 1A7RL 2DKSA 1WEJH 4ODBD 5HD8D 4FZEH 3LQZA 3VRJB 1E28B 1T7ZA 4BELD 5J12C 1A7PL 1RJLB 2FEEI 3W39B 3U7AA 1IKNC 1XF4A 2W0FB 2B5IB 5CGYC 1C7SA 1P1ZB 4HUKB 3O6LH 4YXHL 3D69B 3RVUC 4D8PB 3RX7A 3AREC 4NKDB 1EZVY 5GGQL 4Q9RL 1YEEH 2PW1B 1G9MH 2J6EH 4ZUSA 5HGBA 4RFNB 5E2UH 1MIEL 1BIHA 4QOKB 4S1QH 1FP5A 4JRYD 4KROC 5ERWB 1R5VB 4WW1B 3U4EB 5BW7C 5L9DH 1RZ8B 4K8RC 1M7DA 3V6OE 1AGBA 1I7RA 4F7PB 4GMTH 4NKMA 4NRXA 4U6TA 4OCSH 4XVSH 1KN4H 4PRNB 3T0ED 4KZEH 1NH6A 2NXYB 1FNGB 4BKLA 4ZOEA 2W65A 4TULH 4XHQA 1TQBB 3VE0A 3L7FA 3QIWC 1ZS8B 5BS0B 1JNLL 1BBDL 5CIPB 3MV9A 4P2CG 1MJJB 4P4KA 1OAQL 4NYLA 1YN7B 3S9DB 1T83A 2A74B 2BY0A 4WTZG 5CHNB 5HI5C 4LCYB 4NJ9H 4ZXBC 2ITDA 1FFOA 2QBWA 4H26B 3PL6C 1EO7A 4GAYA 4U6VL 1ZLVH 4OIBA 1Q0YH 2IFGA 3P9LB 3FT4A 4EVNB 3IJHB 3WIHH 4ZO6A 2OR7A 3NPZB 3E8UL 5AEAA 5IW6A 1JFQH 1XIWB 3MRHA 3L5JA 1N4XH 3NCCB 2J2ZA 2IAMA 4I0PD 5GJSL 1Y0LB 2JK5A 3O8XD 3PP4L 1W0VB 3ARYA 5D7JA 2X4SA 1L9MA 2AJVL 2X4QA 4XRCB 3PWNB 5DSCB 3FFCD 1I85A 4F58H 3DV6A 1MFDH 1JGDA 1JF1A 4K3DH 4U31A 5BCAA 4JAMA 2YWYA 5JHDE 3MGTB 3L5XL 3HI6H 4KPHL 4OV5B 4GBXC 5D7LE 5GGUA 1KNOB 4IRSD 5J3HD 3D87B 3R0NA 2C4FU 1YEHL 1GGYA 2FB4H 1XGTB 4XCEA 1T89A 1NDGB 3GMMA 4J6RL 1KCRH 5J1SC 2WQRA 1N26A 3EYQD 4OFYA 3CVHA 3GO1L 4LRNL 1KPRA 5ALBH 3HZVB 5IJVA 2BOBA 3FN0L 4GRWB 4MB5A 1A8JH 1FVCB 2P5EE 4FTVD 4WI7A 5EOTB 1EERB 1ZLUH 2FECL 4TVPH 5D4QA 2BVTA 3EDFA 3QUMH 5JZ7C 2ZG2A 3HE7A 4LCUA 4R3SA 1G7IB 3DBXA 2IG2H 1U8LB 3L3OB 4HKXB 3S3PA 3MRLB 4KDTC 4JG0H 3T0EB 4DW2L 3ARFD 4WUUB 2J5LB 2VXVL 1J88A 4PB9H 1YYMH 4JKPL 1SHMA 1SBSH 1PSKL 4YO0A 2VXSL 4KH2A 4I2XE 2JCCF 4XAWH 2CO6B 3TA3A 4XPFL 3T2OA 5JOEA 3LD8C 1JUFA 5DD6A 3PWPA 1OCWL 1S7UB 4Z7VB 1XF3B 5DLML 1CG9A 4M6MH 4QRSA 5F88A 1OB1B 1BPVA 1WTGT 3W11C 2AAVA 3VI3F 1UZ8A 5T3ZD 4UUJA 1Z0MA 5BZDB 3QFJA 3FHQA 1IGCL 2YHGA 1GGCL 2VYRE 3GSUA 5IQ9B 3TYFA 1PKQE 5CEXA 1SY6H 3BEVA 4GKZA 1RHHA 4UAOC 2AERT 1HDMA 1FN4B 4EBQH 2AVGA 5D1XC 2KUTA 4UDUB 1JHKH 3LQAH 5C8JB 5C6PB 3KDMB 4WU7A 3RX5A 1R3KA 4R90L 3BMWA 1A7QH 3WFZA 2AJSH 5GS0L 1EHLH 4HS3A 1IKNA 4PJXB 3OL2A 3FFCB 3DX8A 3QPXL 3ZDYF 4CVUA 3JV4A 5FGSA 4HKBA 4GXUN 3ZTNL 3AREA 1QBLL 1VEMA 2HKFH 5A2JH 3HR5A 3UTPD 3MR9B 4JN2B 4OUOA 4KDWA 3INUH 1H8NA 2EKJA 4GS7B 3MRMA 1PYWB 5I1DA 1ZXQA 5BW7A 4R4ND 3SKNB 5F1NA 3DUUB 2V7HB 1AO7D 4MXVF 4R0LA 1QACA 3MFFB 3IU4L 1PG7X 5E70A 2I25N 2XG4A 4M9PA 1U3HB 2AV7A 4XGZB 3QIWA 4ONFH 1BECA 5B3NA 2FH8A 4QNPE 2GSGB 4DUWA 1MHHB 2IFFH 1WWWX 5KVMC 1CF8H 2DQIL 2VXUH 3MNZA 3TPUB 5F7DB 2B39A 5E08L 3VGFA 2XV6B 4PJ8D 4FXKA 3ARFB 3ROOA 1G6VK 4JPVL 2VTFA 4P9HC 4Q6YA 5D5MF 1D6VL 1X9QA 2H2PD 4PRBB 2XRAL 4EDXB 4BSJA 3KPLA 2CDGB 4RGMC 4UU9A 1INEL 3VXOB 3QNYB 3TH4T 3BN9C 1JTTA 1G0YR 5ILTL 1KXQE 5HSFA 1J7VR 4XCYB 5LGJB 1O0VA 4PJDB 1LD9A 4P46C 1OPGL 3WKML 4E41B 4ODTH 4ZD3H 4IDJL 1IC7H 4Q6IA 1KJVB 5EOCJ 4QWWD 4YGAB 5AG8A 3PWUB 2BX5A 2Q8BH 3VMOA 3NTCH 2BNQD 3CGTA 2X1WL 4PJCE 1YEDA 3HNSL 4HWEH 1EEYA 3GSQB 3MMEA 1DFBL 2ZUVA 4LKCB 3V7AG 5E7FA 1ZLSH 2ADIA 1OAKH 3AXLB 5H94A 1QEWA 1W0YT 4RX4A 2I9LA 2H1PL 3EJYC 3NFPA 3QFDB 4M7ZB 5TJWK 1BFSA 5I1GH 3RWDA 2FZ3B 3C5JB 3DUSB 4UOW0 1AD0B 4LOUD 5DEGB 2Q86B 2E6JA 3LHPL 1NJ9B 5EU4A 3RDTB 1NAMA 3KYNA 5ELIA 4P5TB 3GB7B 3QPQD 1FG2A 5HPOA 2OS7A 4ZS6C 1C12A 1JNNL 3B5GA 1AO7B 2A9MH 1MOEA 2BSRB 5TF1L 4NQTA 5GRYA 4OBRA 5HI4C 2DM2A 2IH1B 3RGVD 4KV5F 3O4LD 5CJXC 1S5IH 4LEXL 3WFEH 3ARPA 3QCVL 2Y07H 5HGHA 2DTML 1P2CA 2MMXA 4IS6A 4DN3H 2UYLA 3GK8L 4PJ8B 3UYRH 4PRPE 4XXDB 5DO2D 5DD3H 4TSAH 3MX0A 1J11A 2R2HB 5I73C 3ETBF 3JWDL 2DLFL 3S4SB 4OLEA 2OJZL 4KXZI 2ZUUA 2MCPH 3HZKA 1F2QA 5GS3A 1QNZL 1HQRA 1N5AB 4BSVA 1CXIA 2JJUA 1A7OH 3ZL4L 4G9FB 3D1MC 2ARJQ 1FE8L 1WLHA 5E99L 3HS0A 4OLZH 3QJFB 1MCOL 1NC2B 2V5MA 3MRIB 1UXSA 5HHVL 1DLHA 4RQQA 3WEXB 2XN9E 4HK3J 3CC5A 1EHAA 4PTUA 4MS8C 2BOCB 5JQ6L 2PCPA 3UJTH 2FGWL 3FMGH 1JV5B 4GRWH 1CLOH 4LDLB 1ITBB 3O3BA 5FO7B 4R4FL 2BNUB 3LB6D 1IAIH 1MWAA 1A6UL 2E7LC 3VXME 4K94H 3Q48A 4IRJC 4U1NB 1MVUB 4XVUD 3S36H 5IB3A 1IC4L 1FL3B 3P9MA 2X10A 4NWTH 2I5YH 4H25A 3HB3D 5EUKB 3SKUD 5BV7C 3PXHA 1U8KB 1ZVYA 1NUDA 1IM9B 2J88H 3E6HA 3MLWL 5KN5B 3GRWH 5MENB 2IADA 3QEQE 2VZOA 4A6YA 2C3VB 2GITA 5I15H 2BNRD 2GAZB 3ECBA 3MNWB 2YUWA 2HRPH 2QQNL 5SWSB 1BREA 4Z7OF 2ARWA 4X98A 1DBBL 5IBUG 3F58H 5LVEA 3AAZA 4FABL 4PJGF 43CAB 4G43A 5D2LB 4NP4H 4IOFC 1FDLH 3ZMRA 2AKRB 3TBTB 1HI6B 2CKBA 3KPNB 3EDJA 1AKJB 1W8OA 5EN2A 3O3DB 4KRMB 1ZEAL 5FA4A 1NC4D 1D5XB 4MXWL 4ZNCD 2BSTB 2CKNA 3L3JB 3ULVC 2VDRL 2WP3T 4D9RD 3KXFE 8CGTA 4PRDB 2HFGL 3O4LB 1F4HA 1QD0A 2CMRL 4OF8A 3SHSA 1A6TA 5E2VH 2FDBP 2AV1B 4Z9KB 3C5SB 2H2SC 4MXQC 4YR6B 1U58B 5EBWB 5CINL 3VGHA 1CIDA 3F6LA 3VDCA 4URTB 4CADA 2GTZB 1OP3H 3SGEI 4C55A 4J2XA 4OBSA 1BFOA 2FX9L 2R4RL 2YUXA 1T80A 3OKLA 4NQDE 5F9JB 3ULUF 1CVRA 4QXGH 5CD5D 4H5SA 1FIGH 3BIBX 4P46A 5T1LB 3W5NA 1MFNA 3HE6C 2B8OT 5EC1A