4PGEB

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgnypaw
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/peptide
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgeB00
5ECJE 4JFZL 4O2FB 2YD2A 3EYQC 4M48H 3F7RA 3T2OA 1QBLL 4JM2D 2IALA 4Y5VC 4EEEA 2AKRA 4N8CH 1K8DA 4F15B 3QYCA 3CLEL 2ADFL 4P99A 1C08B 4PJEE 3UTPE 1KJVB 4R4BA 4NCDA 1KB5L 1KPVA 2CKBH 3FFCA 5J6HB 1KCUL 3ZKXB 4FS0A 3HFMH 3MREB 3WXWL 2MOVA 2EDOA 4ENEC 4LOUC 3R8QA 5HI3D 1RY7B 3M17B 5ILTL 4S1DC 5I8OL 2VDLL 5GRUH 5IV2B 2L4OA 2EKJA 4WY7H 4JVUA 5JA8B 1CLOH 3IDJA 3PL6C 1AO7A 4JM2F 4O9HH 3SDCD 1C1EH 3O11B 3G6JE 3S37H 1QYGL 5C0CE 4XAWL 1G7IA 4OGYL 1LK2A 1UZ8B 1J18A 2VR9A 3FQTA 1ZHLA 3VXME 3EZJB 3DRQA 4MXWH 4UUJA 3OQ3B 3W39A 2VLRB 4KK6D 1JHTB 5JW4R 2J3SA 2J88H 3MLWH 2FL5A 1KT2B 3GHBH 5C08A 3SKJH 5I1DA 4X98B 4QRQB 2YD8A 5GJTH 4I1NB 3LQMA 4OCMC 3GSWB 3ZTJG 5EFIB 1T4KB 2ADJA 4TVPD 3GSRB 1JZ3A 1S7SA 2YZ1A 5D5MA 3H9ZA 5B3JF 3LQAH 1QNZH 4P2CG 4OLYL 3B43A 1D5IL 4YBLC 3T3MF 2VWEC 1M4KA 4H1LH 1NCBL 1ZT1A 1PYWA 5E9DA 4K9EH 4KUCD 3BEVB 5T3ZH 3IRZA 4WI6A 4K9EC 5FYKH 4JDTL 3VA6A 5HYIA 5F9OH 2FRGP 2QQLL 3AGVA 4IRSC 3CVHL 1YMHB 4K23H 1MWAB 3DVGA 4OLEA 1BAFH 3REWB 5IQ9B 4CKVX 4MYWB 4Z78A 5DUPH 3WFCH 3E6HB 3JWOC 1RZFL 4XXCC 4X6DB 1MJ7H 3KPOA 3LN5A 1H8SA 2LTQC 4FTVB 5IW6B 2DDQL 3H42H 5C2UB 1MY5A 1U8OA 1YEEH 5D8JL 3WLWC 1GJIA 2PUQT 2QHRH 3LKRB 4Z5RA 2YUVA 4APQC 1S3KL 1SYSB 1AO7D 1K4CA 4KFZC 3QI9C 3MFFA 1NJ9A 4PRPA 1ED3B 4OCYL 4NHUA 3RNKB 5FO8A 3FAWA 2R23A 1GC1C 3D2UB 3B5GA 1MI5D 2HT4C 3T4AB 4X5XA 3HFML 2FJHA 3LPGA 2DQGL 4KPHL 1OP3K 3QXUA 1ZLWH 4MJIE 5FOBB 4LASH 2VIRB 4NSKA 4RGNB 2HKFL 5GIRA 2VE6B 4CMMB 4KI5F 4N0CD 4NQSA 1AR1D 2XKNA 2BSSB 5EU4A 1RZ8A 1V5JA 1JWSB 4D0CA 1JPST 2XACC 4ORZC 4NNPH 5FYJH 3GMPB 3VI3E 5FYLE 1YY9D 5C07B 4XNUH 4HKZB 1AY1L 1YJDL 4HBQA 1JPSL 3NFNB 2E8ZA 1UB6B 4P9MH 1A4KA 3I84A 1F11B 1BJ1H 1HN1A 2YXMA 1X4XA 3INUH 3LV3B 3PUCA 5IEHB 1ZSDB 4XP6L 3O0RL 3VXRE 2GJZA 2HWZL 5C1MB 5IB3B 1LEGA 4MWFB 3MRDA 5F9JB 5FUZL 2VC2L 1U3YA 4TULL 4R7NB 2EH8L 4G3YL 1OWRM 4PJBA 3NCYS 1JPFA 5TPWH 1IAOB 3V6BR 1DDHB 3I75A 5JXAH 4PJFF 4R7DB 3SEPA 4HCRA 4Y4HC 5GJSH 4GRMA 1D5ZA 3KPLA 3DURB 3KNBB 1BX2B 1MF2L 2FO4A 2X1QA 3ULSA 2OZ4H 4F37K 4KRLB 3OKDA 1FJ1A 2OTWA 4U3CA 5J11B 4D0DA 3R4DA 2PTTB 5D7JA 4DVRL 5IBLD 5MEQB 3ZTNH 2ATKB 1ZLUH 2VISA 3N1FC 4GBXA 2A1WH 2DIAA 2FSEA 1OPGL 5IBUG 2R0LL 3V52H 1VGEH 4QWWC 5INDB 3TA3B 1SJEA 1TQBB 4J23A 4ZSOB 1H15B 2YPLA 4OFKA 3DROB 3TBWB 3C5SA 1JNLH 3MV9A 5CGYC 3MR9B 1LE9A 4GW5B 5C0GB 1U6AH 4TPRL 5K59E 1F13A 2EH8H 1LGVA 5J13B 5I75B 3CLFH 2PN5A 1ZT7A 2V2TA 1E6JH 1I9JH 2DQEL 1A9EA 5F7MC 1UZ6F 4P2QB 1HSBA 4ZO8A 2JELL 3DV6B 3RVTC 4U6VL 2J8HA 2F54D 3PABA 5J1SC 3PWNA 2DQGH 4TSAH 3RU8L 4PJXE 3RHWK 4JO2L 3DOSA 3VD4A 3RVWD 2IPKB 4G3YH 4GBXD 2BOBB 3NABL 3HG1B 1BVLA 2NR6D 3S97C 3LS4H 4JVWA 5I71C 3MCG1 4OZ4A 1FGVL 4OFPA 3DNKA 4UILL 3IB4A 2H1PH 3NVQA 3WIIH 3HNVH 2UUDH 4NN5B 5HHQA 3DUUA 1AXTL 3AM8A 4G7YH 4JB9H 4QRTB 4WVRA 3ZLQC 5CJOL 3GIZL 5ESVA 1QRND 1CL7L 5ALBH 5CEZE 2VDOH 2GJ6E 4BZ1L 2N1KA 3MLSL 3EGSB 5B39A 1OGTB 4MD5A 3F7VA 3PWLA 2F19H 3U83A 5DGRA 3UYRL 2P8LB 1VESA 4NQEA 1GZPA 2VLKA 2VLLB 1IC7L 1T83C 4I18A 4KROB 2AV7B 2ZPKL 4K3GA 2R69L 4XVJH 1DEDA 2OXHA 3BDBA 2YBRB 1CDYA 1OLZA 3RTQD 5DLML 4YXKH 1MIMH 3CMOH 5ALCL 2Q8BL 5ACMA 5EUOA 4MCYA 4Z95L 2ED9A 3QDJD 3QDGD 2N56A 1MQKL 4EOWH 1NCTA 4F3FB 5TDNA 5IGXL 1FLRL 4JFPA 2NXZB 3E2HC 1CFBA 4LLWB 4LCIL 4U1LB 2QADC 4P2YA 3MUJA 3VFOB 4DZ8A 1INQA 4IIQA 3RWFB 4U1JB 1LO3H 5F1NA 1EHLH 4KDVA 4O9HL 4XPAL 2D9QB 3GMOB 1S9WA 1BF8A 4JDVA 3QRGH 4NZDA 3IU4H 1ITCA 1X7QB 1EAPA 3FCTA 3H9SE 1A1NA 1G6RH 1MVFA 2OS7A 3NFSH 1UH4A 2Q7NA 5JQ6H 3KPRA 1BWWA 3TYGL 4KZDH 3CVHB 1EGJA 3BIBX 5E8DH 3L6FB 3QEGH 3TO4D 4QRRE 1CVSC 1QFUH 3QJFA 1QO3B 3UMTA 4Y0GA 2XG4A 3CLEH 5INCB 2IANE 2Y7QA 1WAAF 3BZFB 4AZ8A 4MNGE 3ARBC 4P23D 4NYLB 3WXVH 2UYLB 1I7ZB 2GY7B 1EPFA 2UV3A 4JJ5A 1K2DA 4PRHE 2FD6H 3ARZA 3LH2L 1J1XH 3MQIA 5KZCB 2H6PB 3BT2L 1MREH 4MMZC 4NO2B 1AR1C 1NGXB 3U48A 5AG9A 2EYTB 3DX6A 4XMPH 4RAUB 4NM8H 1C5DB 3VRJA 1C1EL 3SDDD 1TQCB 1RK1A 3BDXA 2HT4D 2VO5A 1ZLWK 2DBLL 5HYFA 2APWA 3X17A 1GHFH 1U8HA 2EIBA 2P5WB 5GRJH 1TXKA 4OUUB 5GRYA 5I1KL 1TETH 1ZVHA 3PF2A 3TYFA 3BGAA 2DLEA 5F21B 3LKSA 5I6XC 2HKHH 1RZIA 5EU5A 2CKBL 4NQUA 5ISZA 5EIVA 3KLSA 2JJUA 3IDXL 5HI5D 3JWDL 2RBLA 3GI9H 5E8OB 5CD3A 4F7MB 3B9KB 5FGBA 1HYSC 3Q1SH 4EXPX 2GJ6B 5E7BA 3CDGA 2EDRA 4YK4C 4P5TA 2BHUA 5IHZA 1I4FB 5CZVH 1IGFH 2VL5A 2ZNXA 5FOJA 2AXFA 2AERT 2XRAL 3V7AG 3MNZA 1G7MB 1NCCL 2HT2D 4XBEH 3FT2B 3U46B 2R29H 1G7QB 3MV7A 1J0KA 1S78D 3S36H 3VWJD 1MFDL 2BNRE 3QHFL 4GRLB 5E0QA 4OUOA 3DVNB 4U1SA 1DQDL 2AAVA 4MB5A 2B1AL 3OGOE 4P46A 3T2NH 3RZCB 5GS2H 3EOTL 1TETL 3NA9H 3ROOB 4XPTH 4FQJH 4WHTB 4XP4H 5IB4A 3SJVD 1A6UL 5IFHH 3B5HA 5D1XC 2B39A 4LHUG 3QPXH 3WKML 1JF5A 4N90E 1QKZH 5DJZA 3D85B 2BRRH 3PJSA 4YE4L 4NM8L 3PP4H 4PJ7E 4C54A 2XXCB 3UJIL 4M62H 2X9WA 4ZUVB 1GOFA 4RRPA 1FFPA 3AB0C 1E4XH 3DMMC 1M7XA 3TLRA 1X5LA 5ID0B 4OF3A 5IUSA 1VEPA 1WTGT 1KSRA 5K9JH 4HKXB 3WJJC 1KEMH 5F8QC 3EOBA 1GGBL 4CBPA 4XWOD 2ICWI 3FQXA 5JHLL 4OLXL 3WXVL 5TH2B 3PGFL 3QUMA 4DQOH 4HGKC 5I74B 4ZQKB 4GBXC 3T3PE 4LPUA 4O51B 4FG6C 4KV5F 3T0EB 1I9EA 3QEGL 4JFEA 5ANME 4JKPH 4JREB 4X6EB 1UB5B 4M43L 4F7PB 3HE7D 4M5YL 4NUJB 1N6QL 3T77A 3L95A 3QRGL 4PFEA 4N0UB 3CC5A 3LMJL 1T5XB 2VXSL 3MRJA 3STBA 5KVEH 3ARGC 5E56A 4HDIB 3IFPA 3SE8H 5J9PA 5EO1B 3U1SH 4UTBH 3VG0H 3QIWA 1WIPA 3TNNA 1XMWA 1KIQB 2O5ZH 1AE6L 3STZA 5EIIA 1TVHB 1M7IA 1B6DA 3NZHH 1XF4B 3UZVB 3QNXB 1U8LB 4V1DD 2D4FA 3BEWA 5JOFB 3TIEB 1T1YB 2F74B 4P5TC 4GW4A 5CLWA 1PG7X 3VFTA 4P9HC 2I5YH 1CD1A 4JANA 1BGXH 5FYLD 4KAQL 3TVMC 5JR1L 2YN5A 5ITBL 5DJ6A 2ZUWA 3U0TB 1FNAA 2E27L 4Y8DC 5D1QC 1EZVX 1RUMH 2VTFA 4RFNB 3GB7A 5C0FA 1D9KA 2JB6B 3DX9A 5BZWB 2ITDB 3QQ3A 2BVTA 1IBGH 1FGNL 5IHUL 4WWID 4UT7L 3WD5H 5CJQL 3T1FB 4OFIA 3TT3H 2XNAA 3LN4B 1KV3A 2DIJA 3WKMH 4F7TA 1VENA 2W91A 4DW2H 3MLXH 2C26A 4Z77B 5DHYB 1RIUH 3QO0A 3RWDB 5B3JE 2HTLC 1P7HL 4HGWB 1BZ9B 4GG6F 1I9RL 1RHFA 4MNGA 4I48A 4MAUH 3OMZA 3QHFH 1NC2D 1FFQA 4LLUB 4FFWC 3HNVL 5C0NC 5EOCJ 1H0DA 3D3VB 1B90A 2F54E 3LEXA 4X6DE 1WZMA 3WJJA 5D6CB 3Q3GA 1JWMB 1YMME 1OP5H 5EZLA 1CD8A 1QBML 2EIZB 1N6VA 3VW3H 4JHBA 4YHZH 5T3ZE 3DYOA 3NABH 3WO4B 1ZVSA 2AVGA 3RWEA 3S5LB 4HT1H 4JFDD 4OZFG 1Q72L 4M7KH 3HAEB 3AS0A 4L3AA 5K59F 4OCRL 3JWDH 5C0IB 2HLFC 2EDQA 1JYNA 2OBGA 5E8DL 3EJZD 1I7RB 4YJZL 3MA7B 5GISL 3CH8A 4XPHH 1IQWL 3VI4E 1U8MA 3TF7C 4HSQA 4U0QB 5IVNA 4UOW1 5D2LE 4LDEB 4KDWA 1F2XK 1B0RB 3KWWB 4OB5L 2NLJB 1A6AA 2XZQL 4ELKB 1U6AL 4TPRH 1JF6A 4BH8A 1RMFL 5C0BD 3BKMH 4QRRD 1QLFA 1HK6A 1KEGL 5I1IH 3LEVL 4ZTPL 3O2DH 2ADIB 4Z0XB 3TWCH 2ZP0T 4KTEH 3GSUB 5C0AA 5JNYB 4G42A 5EU6E 2Y5TA 2EYSB 2XA8L 5HYJD 1CR9L 1H3TA 3KJ4B 5KW9L 4IHOA 4L29A 3D39D 1OGAD 1IGCH 2OJEB 5DHVB 4JQIL 3IJSA 3M1BB 2BVOB 2M26A 5DLMH 4PLOB 4ZNEA 2IAMA 5DFVD 2YC1B 3WFBL 5H94B 5AD0B 3CH1B 1FIGL 1N5YH 3F62A 4Y2DA 5D1ZB 3PV6B 3CIQA 4O5LL 4YLQT 1KFAH 3QG6A 2CO6B 4EI5B 4LCYA 1MWAL 3SGJC 2P5EE 1AP2A 4NQVB 4F33A 5DO2C 2AQ2A 4RGNC 4A6YL 3BGFC 3NZ8A 1K5NB 4NNXA 3QZWB 1MCJA 4WWKC 5ALBL 5A40E 3EYUH 3C8KA 4G8IA 2N4IA 1XGUB 1RJZB 1WCBA 2PO6A 4Z7VA 1U2HA 4R8WL 2F58L 4XB8A 3D2UD 3O6ML 4HUNB 1N3NA 3HMWL 4PJCA 3KS0J 5DJAA 1UFUA 2YOCA 3D0LB 1XGPB 4P2OA 3AY4A 1MQKH 4P2RB 2AI0L 3IDNB 1NFIA 4M1GL 1F4AA 1HHIB 1MFEL 5BRZE 1MVUA 4YHLH 4PS4L 5IKCB 3OX8A 2P8MA 4S1DD 3QJHA 3UPCA 3MRCA 5EN2B 4RDQF 2OTUA 5JOEA 3C6LA 3VG9B 5JHDE 4BUHA 2YPVL 4TRPL 4FTVD 3KYNB 5C0DA 5CAYB 2VQ1B 4JDZA 3MRRB 1LP9F 4OCYH 4PBWD 3WS6A 2HJKB 3AREC 5F7FA 5TE4L 4GXUM 2MNUA 3UYRH 3REVA 5F6IC 2PW2A 2QHRL 5TDOA 1FL6A 5DWUL 2VDNL 3UP1A 4Y16A 4ODWA 1XGTA 3HZKB 4DGYH 4MD0A 5CEZL 1BBDH 2YKLL 4UNTA 5DUBA 1AD9A 1MLBA 5DHXB 5J13C 1KC5H 3GHEL 4DTGL 1KEGH 3CMGA 4ONOA 4YHNA 1NFKA 1MCNA 1DANU 4XPBL 1AKJD 1BAFL 4K23L 3RI5F 1RULH 5JTWA 4LSUH 3TGXA 1OP9A 3H6JA 2IAND 2PYEB 5D7SH 4HH9A 4XGZB 5DJ0B 1WBXA 2KKQA 3DX8A 4OB5H 5GS1B 5ITFA 1TVDA 3LPFA 4XWGH 3VXUE 3DV4A 5DSCB 4PJGA 3I02A 4Z7WB 2DI9A 35C8L 3GMLB 3IKCA 1UM5H 3TP4A 3AY4C 3BHBB 5DRZA 1FIGH 1QSFB 2BY0A 4I2XA 1AI1H 5I1HH 3TO2B 2GITB 4HWZB 4N8VA 2JK5B 3PHQB 5CUSH 1QVOB 3HE6B 3MBEB 3QXVA 4N68A 4LNRA 3BQUD 3QQ4A 5KW9H 1ZHNB 1CGUA 2BZDA 3KGRA 4YHZL 1ZGLP 2JB5H 2VC2H 4F15C 5FUZH 4Y4FB 5E8NB 4MXWL 4FQLL 2GW5A 4QRPA 1T7ZA 3FRPA 3VWKA 3MV01 1X5FA 5CKAA 3VH8G 4RWHA 3P11L 3HI5H 3WDIA 1NEZA 4S0TD 5DK0B 1JI1A 3EYVB 1N64H 4AH2A 3O3DA 3L3DB 4H26A 3U2SB 4Y5XB 1AY1H 4G8EB 3HAEG 2V2XB 2AABL 3WNNA 5CILL 5MEND 3HR5A 1JYVA 1JNHB 1T04B 1TNMA 4WUUA 4P2QE 3L7EB 3EO0B 1U3JA 2DI8A 3LKQB 2V9QA 4FABH 3QT2A 5LG1A 3MJ7B 3SN6N 2BCKB 1OB1A 3UTSE 5FF6B 1A6TB 1W72A 4LLAA 3G5ZA 3WJLC 5BRZB 3S9DB 4PJ9D 3IAGC 1QSZA 1UM4L 2VNCA 1T7VA 1FC2D 3STLA 3MRPB 4WU5B 3CK0L 3VFGH 4U1HB 1UYWL 4D9QD 4E5XA 1WWAX 3DECA 1NC4A 1NBZB 3K80A 3S5LG 3JBG7 5IJVB 4OSUH 4I2XE 3HKFA 1KPRA 5KANI 2F53E 5DVLA 1A7QH 5H35B 5GHWH 4DVBB 2DQHH 5HYQA 1JTPA 4PV9B 1Q9KB 3GM0A 2VSDA 2JCCB 5C7XH 4K94L 4M6NL 4Q6IC 3K4DA 1B6UA 2E9IA 1U91A 3JTSB 3VDBA 5EU3B 4RGMC 1BQLL 1EJOL 1JNNL 4QHKI 2AGJH 4PJDE 2DB8A 5FCUH 3TT3L 2X4OB 3IJHA 5DQ9B 3SDAB 2OR8A 4XPGH 3DWTA 4EVNB 1N6QH 3ARFA 3SDYH 3VXRB 4ZUTA 2B7DT 1JZ7A 3ARBB 1A7NL 5IWLA 3QDME 3BH9A 3MMEB 3OKLA 5BV7L 3MV8A 3PHSA 4EI6A 1OGAB 3SDAD 5CEXB 2A6IB 1RUML 3GMRB 4WGWB 2E27H 1A21A 4NN6C 2CDEA 3O9WA 1DQTA 5E1HB 3OJDA 2XTJD 4XAKE 4XCCH 1N6UA 1WCQA 3P77B 3B83A 1YEIH 2ZUQB 4R96A 5IOPA 4YUEH 5FA3A 3GNMH 3KPNB 3HUJB 1MCFA 1U42A 2YPLE 2CO7B 3MROB 3MNVB 3L3JB 2EXYD 1G6RA 1LNUA 3HC0A 1FNHA 4U6XB 5DRWA 3OKMB 5IP4A 4UTBL 2CLVA 5GS0C 4HW6A 3T0XA 1RFDH 4PTTB 3S3SA 1WBYB 2A6DB 3CVHH 5E7FA 4P3DB 4YDJB 3CFKB 3VFVB 2QR0A 5D4QA 3SE4C 1SEQH 4NZTH 2P7TA 3FN0L 4YX2L 5KVMC 1MPAH 2CQVA 3DYMA 3HZVB 1XF1A 1UXSB 5B38B 5I16B 1YUHA 3B2VL 3MJ8A 5J1AA 2VDRL 1ZKAA 3UZEA 1NCWH 5E4EC 4YDIH 3UAJD 2DF3A 5TQ2H 3RFZC 4RMUA 5D93B 1OVZA 1AHWB 2XWBB 3QIBC 4PIRF 2VITA 2V5MA 3VD7A 2NY3B 3KYMA 4HJGB 4LSVH 3OR6A 2XRAH 1QSFD 2J6EL 3GHBL 4FQCL 1PGRB 4XCNB 1B4JH 4EBQH 3G9AB 3W9DB 3GSOA 4LU5H 2XPGA 1V8HA 1LP9B 4H8WH 5JW5A 2BNRA 2NNAB 4KKCC 2A74A 3IDXH 4KRPD 4IRJA 1RHHB 3WFHB 3VXUA 4K8RL 3MNWB 4KY1L 5HHOA 3IDIA 3ULVL 3MLTB 4MJID 3QPXL 3CCHB 3GGWA 3RVTD 4XP9L 1XGYL 2Q3AA 2F5BL 1KYOJ 2ITCA 1BP3B 1UWGL 1IC4L 3PWPA 1ZA6A 4KKBD 3V8OA 2Z91B 3QHZH 4BFGA 3FQRA 3ARQA 3RIFK 4JPVH 4D8PA 4DKFH 3HCVB 4F57L 3V4VL 4Z8FL 3RY6C 2EIDA 1E4KA 4ONHA 5SX5H 5EIQA 1S9YB 1V7MH 1DL7L 4P23C 1QRKA 4YXLH 2FHFA 1F02I 4TQEL 4PYHA 4OM0H 4OZHA 4HFWB 4P5KA 4GAYB 4JY4B 4JO3L 5DR5L 2FCBA 2I27N 3I3BA 4WWKD 1CL7I 4P4RA 3S36X 2RFXB 5C09B 3ZE0F 3ULVH 2W9DL 3C09B 3GI9L 3D69A 4IMKA 1L9NA 1F3RB 4XNYH 5FYLL 3VFSA 2X4TA 1EUUA 3DHJA 1UG9A 5D7KD 4PV8B 4R0LA 2FIKB 3U79A 1QFWM 2ICEB 2H2SD 3C6SB 3IU3B 2R2EA 3ET9F 5SV3A 5DFVC 2IGFH 3UTSA 1CXFA 1SEQL 1X5HA 4NZTL 3TV3H 1EH9A 4LHUD 2IADA 3MX0A 1F3JA 1FZKB 1NUNB 3T2PA 4HLZG 4DAGH 3VFMB 5DMGC 5JXEA 2KZWA 1OTTC 1UGNA 4HIIB 4HS8H 4P57A 5DZLA 4F2MA 2XFXB 4WFGD 4XC3L 1HINL 1I1YB 5DJCA 4QTIL 1AQKH 2BFVH 4YHYB 4Q7DA 5J12B 4KV5E 3MGTB 1OTSC 4FXGA 1N5AA 4X7TA 3VXMD 1U8KA 3E3QC 2O5YL 4UV7L 1MPAL 2JCCF 2ADGB 4GRWB 2A73A 4L3CB 4QHMB 5IVXB 3U7WH 3VGGA 1Y18B 2W0FB 3QRFM 4JZNB 2GTWB 4O4YL 1KIPB 4HS6B 4YXKL 1M05A 4EXKA 4JG0H 3NCFB 4XC1L 3ARGA 3T0EE 1CFNB 2ESVB 4CVZB 1NGWA 3N1PC 4G80B 3WUZA 3C8DA 1BMGA 1FVEB 4AEIH 3L3KB 1RD6A 4KK9D 1QLRB 4IJ3C 4MHHG 1C12B 1RZJL 3CPLA 5JDJA 4WENB 4L9LB 2APFA 5TJWK 4ZUSA 2EXWC 4PP1D 1OTUC 3QWRD 4HKJA 2XXMB 3DUSA 1AFVL 4UAOB 3FQNB 4JFFE 1FL5B 3FMGH 3VWJB 4QHLA 1HZHL 1DSFL 4TUJB 4PJ9A 1CDJA 2LAGB 5IHLB 1VKXB 5GGUB 1MCDA 4B50A 4R4ND 2ZOLA 3BSZH 1Z3GH 1PG7H 3CD4A 1BD2E 2UWEA 2D0HA 3DI3B 4WV1A 3VXRD 1SY6L 3KLHD 2FECL 4ODXA 2H1PL 3F5WB 4X99B 4NQEE 5DRNA 3ZKSD 4O2FA 1GAFL 5E70A 3ZDYE 4M3KB 4DOHB 4M02A 3BP5A 2R15A 2X70A 1C08A 1C8PA 1KJVA 3ZHKA 5DQDH 2IEPA 3OAZH 4BELD 3OJMB 3SKNA 4PG2A 1KPVB 2VLJD 3PHOA 3FO0L 5ICYB 1FO0L 3P4MA 4JFXA 4NGHH 4B7LA 3MREA 5CLTA 2WNGA 3P2TA 1DQQA 4S1RH 2K1MA 5EUKA 4DGVL 3MOBH 1HOCA 2WSKA 1H5BC 2Y07L 3IDUA 1VGKB 5A3IC 3CFCL 3G9VA 4MA8L 4YC2C 1AO7B 1RSFA 1X5XA 4NRXA 5ID1B 4HV8A 4JFED 1A6VL 3O11A 4JB9L 4O2EB 4FQHA 1G7IB 4X6BB 5BXFA 1KTLB 1DBBH 1TCRA 3FQTB 3FQWA 4UUJB 5HPOA 3W39B 1ZLVH 1JHTA 4UV7H 5CMAB 1NAMB 1GH7A 2D7OA 1KJ3H 1NMAH 4J2XA 2X4UA 1F4WH 3N0PB 4HIJB 5C08B 5EBLB 3GJFK 5C2BL 5I1DB 2DQCL 1OAKL 1MCOH 1ZE3C 5HI4D 5EFIA 1A22B 1NC2B 4B7IA 3NBNA 2OX5A 2YN3A 3GSQB 1CFTB 4N8PA 3H9SB 4OCXL 1LE5A 1MHCB 4NN6B 4PTUA 2P49B 2ZCLL 3NACL 4MDJB 1LWRA 2IGFL 5J11C 3P11H 4BQ8A 4M7LT 5EWIH 2XTLA 3WFDL 1PYWB 4MB3A 4H5SA 2H9GB 3B9AA 4FG6D 1MLCA 1KF9B 3KPSA 1MWAA 4PR5B 4TVPE 3WN5A 5AUMA 4G6FB 1WAAA 2G5BB 4CGTA 2VWEE 2AP2A 1F4HA 3E6HA 1NCDH 2A2QT 3CDYA 3PL6A 3R1GH 2X4NB 2IBZX 3GK8L 2IBBA 3QDJB 4HIHB 3RWGB 5HHPA 2ZUYA 4NQTA 1MEXH 1OSPH 2D7NA 3DMMD 5C0RH 2B5IC 3LKRA 1OAZL 1T1WB 3QWOB 4JCMA 2NXYC 1C5BL 2VN7A 3T0ED 1ZEAH 5HYSG 3MRHB 2HKFH 3RL2A 1ED3A 3FT4A 2O61B 5IBUB 4K3DH 3RNKA 1RJYA 3MRFA 1INDL 4KDTA 5E03A 5FO8B 4KROD 4Z7WE 1VPOL 3O3BA 2AJUH 4Z7VF 1F6FB 4WI3A 4OD3H 2HMIC 1YMMA 4S1QL 3H9HB 5K9QG 1MRDL 4CN6A 3HMXH 2NY1C 4NSKB 1QZ1A 2VE6A 5I1EH 5D96C 4KI5E 3U36A 2ICWB 3C2SA 3MRMA 3BP4B 4PRNB 2Y07H 3QWRA 4D0CB 1UH2A 3MCKA 4XP6H 2VZ1A 3O6KH 4X6DF 5D7JC 1A7RL 3QSKB 3UPRB 3K1KC 2E9WA 4NBYB 1UB6A 2NY2B 3RWHB 4W6YB 2WUCH 3SGEH 1W2KT 4JCLA 5EBGA 3QIBB 3JTTB 2HT3C 1I8LC 25C8L 4C58B 5IEHA 5M94B 3SGDI 4F9PC 2GJZB 4EUPH 5IB3A 5L2JA 4R3SA 2HLAA 1Q0YH 3O6FA 2LTQB 5FGSA 2Z8WC 4P2RD 5D7IB 4R7NA 1P4IL 4YHLL 1DQMH 4U2YA 2W07A 3HI6L 4CU8A 4PJHE 4APQA 1QPXA 1QR1B 1DDHA 3I75B 4PJIA 4K7FA 1JF1B 2DQJL 5B8CB 5HHVL 1D5ZB 3KPLB 3NIDF 3F8UB 3FFCE 2FO4B 4XT1C 2JJTA 2PETA 4YX2H 5F72S 1ZTXL 3MTRA 4YHML 2PW1B 4YHOL 2KL6A 5D7JB 3HNSL 4GAJL 3T0AA 4LQFL 4JEGB 2QBWA 4OT1H 4QRPE 5D7IE 4Y1AB 2E7BA 5INDA 5E4IA 5JZ7C 3KAAA 1XR8A 1H15A 3ZTJH 1FBIH 1Q9WA 3W9EA 1AQDA 2Z8VC 4LNVA 1LE9B 4UDUA 3H3BC 5EG6C 4G9FD 5C0AE 3IXTA 1IL1B 4JQVA 4U1GB 4MDIA 3MJGX 4OV6F 1AGDA 4FFVC 3ZMRA 2PXYA 4Z7NF 2L7JA 4U1MA 5DMJB 1G6VK 1N26A 2DL2A 1JPGB 1A9EB 4P2QA 3RUGE 5GZNC 1XIWD 2Q1EA 1EZVY 3IXAB 4N9OB 3HC3L 1VA9A 2L0DA 2XWJB 1KB5H 4ZYKA 4Q6IB 1YQVH 4OI9A 1Z9SA 1F45A 4L5FH 3EYOB 4NKIL 5A2KH 1GXEA 3QUZC 5HD8D 3HG1A 1KTDA 1OGAE 4BZ2H 1ZV5A 1FZJA 3QPQC 4JFZH 1T3FB 4RBPH 4CNIA 2WUCL 1E28A 2ZOKA 2GFBB 4JRYE 5HHQB 4JN2B 4M61A 3GJEA 1KOAA 4XCEB 1J8HA 5IBLC 3QDGE 5DO2D 4YZFE 3O3UN 4OFDA 1INEH 5DK2A 1LO5B 2XZCL 2YD6A 5EOQL 4FMKA 3DUHA 4Y2DC 3ES6A 2IJ0C 1Q72H 4P4KB 5A2JH 4ZODA 4JZJA 1RIUL 5SWZA 4MD5B 4YDVA 4GJTB 1VB9A 1XAUA 1L7IL 3KDMA 3L3HA 4ZMAT 3RPKA 3WXWH 2P8LA 3KHOA 1JV5B 1TPXB 2VLLA 1JPTH 3QR2A 4I18B 3OZ9L 4GXVH 4WWKA 3EKCA 4UT7H 3WD5L 4BFBD 4IEFB 1CE1H 2YBRA 5I73B 2VL4A 2VXVH 3HI1B 4MJIA 2WBJB 5ERWA 1JGVL 3KG5A 4OLUH 1QA9A 3OKNA 5C0RL 5HDLA 3BDYH 1D5BA 2VJXA 1IE5A 5E2VH 3AS3A 1PQZA 4PJ8B 2H41A 1GZQB 3MACH 1R0AL 4ZFGL 3I2CL 4U1LA 3D6GA 4IDLA 4DZ8B 1KIRB 3HLAA 4OI8A 4Q0XH 3RVWC 2EXWD 2JCCE 4PP1C 5IQ7L 5KSBA 5C07E 2QSQA 1CIDA 2FATL 4C56E 1S9WB 4N0FA 3MLZL 4JFHE 2DJUA 1X7QA 4P9HL 3FCTB 5LXGH 3N1MC 2IPUK 4HUVB 4TSCL 3QIUB 3O6LL 3JUZA 2I9LA 1KGCD 5J6GB 5J1TC 3L6FA 5BVPH 1JWUB 4C56D 1KCRH 1EO5A 1EK3A 4UDTB 5EUOF 3BZFA 1CE6A 4YR6A 4BH7B 1QRNB 4NYLA 5IFAH 2AEQH 4L8SB 5HYJA 4G43B 1KCSH 2CIKB 4JJ5B 5GSRB 1K2DB 4HQQL 3S88L 2WIMA 9CGTA 3IS0X 2H6PA 1J8HD 4LLQA 2APVA 4RMVA 1YN6A 1NGXA 4HJ0D 2EDDA 1P9MC 1NFDB 1Y6MR 2EYTA 1UJ3B 4LP5A 4MA8H 4O58L 3QUKA 2BHYA 5E94B 3SQOH 5DWUH 2QSCH 1JZ4A 4OGXH 1OP5K 3V5DA 3EIFA 1Q38A 1RK0A 1NC4D 4QGTA 4TTDC 3TH3T 5IFHL 2AK4D 4EN3D 1QFWI 4NRYA 3V8CA 4OLXH 5EU5B 3LHPL 1ES0A 2XY1A 1YYML 4E0RB 3IETA 2Y9RT 2G5RA 5CD3B 3FOMA 3UZQA 4WI2A 2R29L 4OIBA 1BFOA 3ESVF 1EHXA 4RFNC 4P5TB 2BRRL 1I4FA 1AXSB 5DEGB 1DANT 1KCKA 4LHUA 3NIGF 4ISVB 3MNZB 3JUYA 4ZUWB 2M2DA 3OXRB 4KHTL 3P9WB 4R8WH 3WBDA 1D7FA 2BSTB 4PLJD 3FT2A 2XZAL 3T2NL 5IQ7H 3TCXA 4PJBE 1T0PB 4K94C 5IM7B 4HZLB 1MWAH 4AEHL 1WZ1L 1DBAL 3MC0A 3T65B 4NHCL 3BKJH 4LEXH 4U6YB 5CSZB 4WW1A 3HMXL 3CX2A 3D18A 5JO5A 4QHUB 4S1QH 5DDHA 3EYQD 1HKLH 3D85A 3PJSB 2BVYA 2WLZA 1I7UB 4NM4H 3T3PF 3BQUA 1BFTA 4YDLB 4ZUVA 2H26A 2YUZA 2Q7YB 3ZSTA 1DL7H 1JRHL 5GXBB 5ID0A 2GSGA 4HIXL 3M8OL 1T7YA 1S5HB 3QIWD 4HC1A 4DKFL 4G9FE 1IKNC 3EOBB 4FNLH 1J1XL 4OCWL 4TVSa 3QUMB 5BZDA 5AZ2L 5DQJB 4WEMB 3V6FB 3L3GA 5F7KC 4M8VA 1S7UB 1BECA 4NBXB 1SYVB 4PRAB 3T0EA 1OAYL 1U93B 5J4MA 5IROA 2DM7A 3Q6GH 4KKLC 3B6SB 2XIDA 1CBVL 4XHJC 5GGRA 1T1XB 2PCPB 1P5VA 2MCPL 3KYOA 1RUQH 2YD7A 3ULVF 3L5WB 4PJGF 4NUJA 2I25N 4LSSL 4LU5L 1EEYB 3L95B 3RUGF 3CC5B 1KIUA 1M1SA 5HGDB 4G8GB 3QDGA 4HK0B 4E41A 2VUYA 4TNWF 4BFIB 3RZWA 3HR6A 3TNNB 4YHPA 3RA7L 4PGCB 1LO3L 4OKVB 5EIIB 1XF4A 3FQUA 5I8KL 1FG2B 4PG9B 4HXAH 1ZLSH 3MUHL 5JOFA 1A5FH 1BREA 5C9KA 1T1YA 2F74A 1P7QB 3DXAE 3VFTB 4JANB 2ENSA 3BZ4B 3M8OH 5I9QB 3U0TA 5TF0A 1L6ZA 4K2UL 4TTDD 2NTFB 4JKLA 2E3VA 4O02L 3GB7B 4F9LA 1D9KB 2R1YB 4PRDB 3QHZL 3D48R 2R0WH 4DK3A 3KXFD 2AW2A 3QQ3B 3W81A 2CXKA 4MD4A 5IW3A 1S9VA 3T1FA 1ADQH 1DN2A 1I8IA 3PGCB 4OZHE 2D03L 2XNAB 3MRLB 1LO0L 4KC3B 4L8BB 4DGVH 3IS1X 5CBEB 1NAMH 4X8JA 4HGMA 3T09A 2D7MA 5IHUH 5FM5O 3RWDA 3NCYP 4HG4J 1WGOA 4M8QA 4HGWA 1EEZB 1OWWA 4MNGB 3NAAL 4PRIE 4DKEL 5ISZD 3I6GA 3G5VA 4D0BA 2CLZB 4FQCH 5HGAA 1QBAA 4S1SL 3D3VA 1LEKB 5CJBA 1ZS8A 2QQNL 3GO1L 2VLME 3WS3B 1S7VA 4NHCH 3BZEB 4ALAH 1HHGB 2JIXA 1DQML 1J87A 2YRPA 3SY0B 3V95A 1SY6H 4L3EE 1ZVSB 4OCSL 5IMOA 3HPLA 1HQRA 4IDJH 1L7TL 2IH3B 4R4FL 4K94H 4M6NH 5L7XH 1DSFH 1NCNA 1LDPH 2VLKE 4MXVE 2AJZB 1P2CA 4RZCA 4ACPA 2YWYA 3MA7A 1FAKT 3QEUA 4QRRA 3WUWA 1WFTA 4I0PB 3RY6A 2BY2A 3WIIL 1TJIL 3C5ZC 4PJ8C 3VH8A 2FR4B 2B2XL 2FHBA 2NLJA 2HJLB 2CSPA 4PJAE 4JKPL 3H0TB 1GSMA 4BH8B 2GCYB 3ECBA 2J12B 5A2FA 2WINB 1WF5A 2C3GA 3RL1A 5FV2A 1CT8B 4OZFB 2P4AB 5GPRA 5LCVL 5F1SA 3S8WA 1BVKB 4JO1L 5BCAA 1RVFH 3GSUA 5JNYA 4OF6A 1IGCL 3FO2B 2R2CA 2R0LH 2Y5TB 2CRYA 4U6TA 1N7MH 1T21A 1C5BH 1I1AA 2VAJA 4HD9A 4IHOB 2HVJB 1MHEB 5FGCE 2QQKH 4BSVA 1YY8A 5IIEB 2QHLA 4KTEL 4LCWB 5DJ2B 3W5NA 4NO3B 5T5NG 1A7NH 3KJ4C 1LMKA 5GS0D 1M7DA 2NTSP 3CH1A 2AK4A 1H3PL 3C2AH 5EOCL 2A6JA 4LP4A 2B5IB 3QIUD 3TA3D 5KVFH 3PWVA 3IVKA 1U92B 3QG6B 1P53A 4LCYB 1SEBB 4NO0A 3U7YH 3TN0B 1AP2B 4TULH 2BSRA 4XXCA 4ZXBA 1K5NA 4NNXB 3HAEH 2W9LA 5DVMA 3T0VA 4GS7B 4YDKH 4MAYA 4G8IB 3WFZA 2BNUB 1XCQB 1RJZA 4DWHA 2OZ4L 2VDPL 4ODUB 2DKMA 2NY4D 3BD5A 1JGDA 3WNPA 5IB2A 1BD2D 1R5IA 5F89A 2BY3A 4P2RA 3LSOB 2OSLA 1J10A 4HT1L 1MVUB 1MJ8L 2UZIH 2OI9C 1YEKH 3QJHB 4MQTB 3MRCB 1P7KA 1UWEH 2DQCH 2IH1B 5C2BH 1R3HA 2EIEA 4L3ED 4MQSB 4GMSL 3RUGB 1LEIA 1QP1A 1YEJH 1NMAL 2FYYA 1XCTB 2X1WL 4JG1L 5GZND 3V4VH 4F57H 4Z8FH 4KJQD 1B0GA 2QTEA 3G6AA 3JV4B 4J3TA 3GKWH 4G6JL 1HH6B 5CIPB 4JDZB 1U3HB 4HBCL 5EA0L 4PJXA 2CUMA 4IRJD 4LDLB 5MENA 1XGYH 1VDGA 3MODH 2ZUVA 4D9LL 1FL6B 1NEUA 3AMLA 1CXIA 4MXQC 2FDBP 1D9KD 3FZUD 3MLXL 4Y16D 5F8RC 5J56B 1XGTB 3HZKA 5MI0C 3DETD 4KKAD 5HDBE 3FTGA 3PWPD 4DN4H 2X7LB 3I6LD 5TF1H 4POZC 3TC9A 5BVJB 4RGMB 5DT1H 4FQLH 2FJGB 4YHNB 4X0KA 4X6FA 2F9BT 2JB5L 3WFCL 1EFQA 4RGOL 4X9GA 5IG7B 3OG4B 3P0GB 3LD8C 5A3ID 3OXSA 5DJ0A 2AXJA 4KUZL 1J0JA 4MJ6A 4MMXC 5EO0B 3DV4B 4CJ1A 2PKDA 1AI1L 3I02B 4GKSA 1G0DA 3IKCB 1Q9LB 3BHBA 4LCCB 1H5BA 5T1MB 4KHXL 3A67L 4PJHB 5C0EA 4MJ4A 2EC9U 2WK2A 2IFGA 3CZFB 4N8VB 3LKOB 1JZ6A 1QVOA 1S7WB 1V05A 2A83B 3HE6A 1IGTB 2Z9TA 2CIIB 3QQ4B 5GS0L 5I73C 1YEGL 4XTRC 1ZHNA 5T1LB 1AFVH 1FRGL 5GRVK 4Z7OF 1MRFH 1F90H 3MLUH 4QRPB 3SJVA 2J88L 3VWKB 3V7AE 3B4NA 1RZJH 3JWDC 4P46D 2OR9H 1A47A 4S2SA 4Z9KB 3O3DB 4HF5L 3L3DA 3MSPA 4X4XA 3RGVD 4HH8A 3U2SA 3RQ3A 5IESL 5GSVA 4YHKL 4Z7WF 4JQIH 4KROC 1DBJH 3D39A 1CG9B 3PDOB 2G60H 2EKSB 3L7EA 4X83A 3P4LA 4LIQE 1RZ7L 3MLRH 1YC7A 3LKQA 3BXNA 4GFTB 5I30L 3MUY1 1KCUH 4Y19D 3QAZB 3HI6H 5FYKD 2V17L 3TWCL 1A6TA 5J6HA 4P49A 2R4RL 4LLYB 1F90L 4NC1C 2B0SH 4YE4H 3MFGB 4HWEL 3SDXB 5C0JA 4I9WD 3JV5A 1U3ZA 3TBTA 4YHOH 3STLB 1A02N 4WU5A 4RAVB 2DLHA 1ZTXH 4U1HA 4E5XB 3LEYH 2FLRT 1NBZA 2DI7A 3QFJB 4WCYL 1ZHKA 2MHAA 2VLJA 1KPRB 2EICA 5B39G 5H35A 4LGPB 3OG6B 2HH0L 4HCRH 1XZ0A 4LKCB 2EDHA 2WUBL 4DOHE 4PV9A 4EJ1C 4KK5C 5CWSB 3QXAA 1P4IH 1ND0A 1KELH 3C08H 4AM0A 4NKOB 4JRXD 6FABH 1UYWH 1UWEL 5I6XB 5DD5L 4U1NB 1Q9OA 1WC7B 2CUIA 1AGEA 5HSFA 1U8IA 5B38G 3IJHB 4EIZC 2CK2A 4ODVL 4LLVB 2X4QA 3ARFB 4L4VE 3VXRA 3Q1SL 3U9UA 1HSAB 2Q8AH 2RCSH 3OKLB 4MX7A 4CU7A 4G6KL 3MV8B 4U6VH 3TBVB 4EI6B 4YAQB 4LVNC 1ZEAL 4MJ5A 3GMRA 4YK4B 4PY7A 2CMRL 1P4BH 3O9WB 2DRUA 5D2NC 1ZLUK 4D9LH 4I0PC 3X3GH 3ULUL 5BQ7A 1HHKB 4HX1B 3B9EA 3ISWA 3O6FC 4ONFH 2F8XC 2R8SH 1B9ZA 5LGJA 3UTTE 3P73A 2OR7A 4N1EA 4Y16C 1MHPL 1X4ZA 3TPUA 4HWNA 1FNLA 2NY6B 3MOQA 2FZ3A 4Q9QL 1VGEL 1OAQL 4G7VH 4LIQH 5FKAA 4M7LH 1I85C 5FDWA 3HS0B 4MQXD 2DQUH 5LGHL 4R4BB 1MJ8H 2FLBT 3SGEI 4JQXC 3GIVB 1U36A 4QXGL 1R3IH 4FFVD 1YUHB 4FFZL 3MJ8B 5J1AB 5E5MA 1K85A 3UEZA 5IV2A 3THML 3EYFA 4YDKL 4QCIA 4XRCA 2VDQL 4WFHD 5IFJB 2XWBA 1ZLVK 5IMMB 2Z31B 4ZOCA 4P48A 3U7YL 3D9AL 1UZ8A 1DLHB 3U0WL 3MXVH 4GSDH 4Y2OA 5J57B 3VXMA 1ZHLB 1A3LL 5FHBL 3NACH 3WE6B 2R0ZH 1NCAH 1TPXC 4JREC 4QXWA 5JW5B 2E6PA 4FQXD 5EOTB 3GSRA 3MNWA 2WQRA 2QQKL 4DW2L 1FNSH 4ZAKA 4OCSH 3N1QC 3OAUH 5FO9A 1IM9D 3H9YA 1VFMA 3RX8A 1DLFH 2HYMA 2XWTB 3U6RB 3L5HA 1U58B 2C3VA 2VLKD 2Z91A 4PJ5D 5LCVH 1S78C 1P5UA 3B9DA 5DZOA 5ACZA 1FZOB 1IGYA 4ZDHA 3BKCL 4ODHL 1IEAB 2FNBA 4ZD3H 3GBNH 1YMHA 1FVCB 3DVGB 4QY8A 5IQ9A 2ZPKH 1KJ2B 1S3KH 4Z78B 1U41A 1ERNA 2Z93B 2J8UF 3J8F7 5JPNA 3KPOB 2J5LB 2EDKA 3G5YA 3LN5B 2EZ0D 2YK1H 4D3CL 4P5KB 5F93C 4GAYA 1A4JB 1A7OH 4KQ3L 2AGJL 4M1DH 2XYCA 2H32H 5LBSH 4M93B 1Z3GL 4DZBB 1I7TA 1TJHL 2W60A 3G5XA 3SDAC 1SYSA 2Q86B 1K4CB 3MJ6A 4Q6YA 2YZ8A 1RV6X 1H3XA 4PV8A 4R0LB 1CYGA 2VZVA 1A3LH 1IC1A 5T3ZL 3QA3B 2ICEA 2R23B 5M95B 5TE7L 3D2UA 1KPUA 5FK9A 4X5XB 4NJ9H 3N9GH 3TT1H 3UTSB 1WEJH 1JN6A 3SDXF 1PG7L 1F3JB 5F71A 5GIRB 5HGGS 3GBNL 4P5TD 5I0ZA 1PSKH 2NY5H 3LQAL 2BSSA 4WHCA 5EU4B 3QDHA 4P57B 3B9KC 3O2DA 2Q6WB 2BNRD 3GMPA 1I1YA 5I8CB 2Y6SC 1P4LA 3SDCC 1PVHA 4R6UA 5HD8C 1ZA3B 2R1XB 1U8KB 3ARBD 4Z76A 1A4KB 3MRIB 4X6CB 1WISA 5I15H 1HILA 1LK3H 1ZSDA 3BPOB 2XY2A 4AEFA 2UUDK 4LOUD 4JZNA 2BVPB 2P24B 2GTWA 2E9BA 4ZTPH 1M05B 3TO4C 2AABH 2VSCA 4MWFA 4WUUE 3MRDB 5F9JA 4Q9QH 3MV11 1CFNA 2XN9B 4UT6H 2CXGA 5C70A 4RDQG 4O4YH 1LILA 3O4LD 2X4RB 5D1XB 3U0WH 2QSTA 4KKCD 3D9AH 3FRPG 5GGVY 5F44A 1F2QA 3X3GL 3ULUH 1BX2A 5CS7A 5DA4A 4OCWH 2A9ML 2OTWB 1JHLH 3O4LB 4FQ1L 5BO1H 3QXTA 1R24B 4D0DB 3OHXA 1Y0LA 1NAKH 4HWBA 4KTYA 5SX4I 1GYAA 2LE9A 4PJ9B 1XR9B 1VKXA 3QUMH 1NBQA 1NCCH 4XBEL 4DEPC 4IOFD 5H37G 5GJSL 2DD8H 3MBXH 4TN9A 4HK3N 3CVIH 2X10A 3DPBA 4XPFH 2X05A 5BS0E 4IIQC 4GRWF 3C5SB 3F5WA 4X99A 2DQUL 3MV9B 1BJMA 1NFDE 5LGHH 1WEJL 4BQCA 5K9KB 1YYLH 1IVLA 4WFFE 1K8IA 3VMOA 1WZ1H 5IVOA 3MLVL 1DBML 4ELMA 1NMCB 5KVGL 2V2TB 4JO4H 4OQTH 3MCLH 4WJ5B 4UIMB 1CK0L 1HSBB 2BVUA 3TH2T 5DEFA 5GGTL 3SKNB 2FX8L 5GRVL 4P9ML 3DV6A 4V2BA 5GRJL 5KAQG 4WCYH 1Z0MA 2YHGA 5E95B 3PABB 3PWNB 4QYOA 1DQQB 5EUKB 3V4PH 5LBSL 1BBDL 3UBXA 2H2PC 2HT2C 4KQ3H 3DXAB 3VXOA 3PWPE 1DQJB 3MA9H 2BOBA 1YPZE 5I1AA 4NRXB 4H8WL 3GMMA 5HHMB 1NLDH 5I18H 4GT7A 4OZ4B 5E6YA 1CD0A 4X6BA 1BLNA 1KTLA 2D31A 1AGFB 3RY4A 4XH2B 4DGIL 3V4UH 5KAQF 1T0NB 1A1OA 3PDDA 4YC2B 4FQIH 2ZCKH 1NAMA 3DUUB 2IG2L 3NOIA 4XP9H 4F8QA 2HMID 1PJ9A 3VFRB 3NA4A 1HXMA 4QOKA 1NSNL 5IESH 3EOYG 2B4CC 5ESVB 4HF5H 3GSQA 1YPZB 3ARED 3CNKA 2A77H 1OGTA 3F7VB 1FORL 3DO3A 2C3HA 2LU4A 4Y19B 3U1SL 4NQEB 4PRIB 1MJJA 4XP1L 2VLKB 5CJOH 3IU4L 1NBVH 2AV7A 1KENL 4RISH 1MQ8A 5I1GL 5L0QC 2Q76A 1KCSL 1QOKA 3KYAA 3RIAF 2NW2B 2AJXH 4JY5L 4A6YH 2H9GA 4NOBA 1OD9A 1MLCB 2ZNWA 5AUMB 4GAGH 1NL0H 1NMCC 1KCRL 4CDGC 4MCYB 2F8OA 1WUNT 3FN9A 1YMMD 4HIHA 3RWGA 4LDOB 3GNML 5HHPB 4NZUH 3ESUF 3PNWA 1CDBA 1INQB 4IIQB 3RWFA 1T1WA 4YFLF 4Z7NE 3GSNL 2UY6A 1HIML 2D2OA 4DEPB 1UA6L 3FT4B 1RJYB 3MRFB 5HI4C 2EE6A 1NANI 1S7XA 2DM4A 5IVZB 2ZZUT 3O3BB 1DE4B 1MHHB 4HFUH 3KPRB 1YMMB 2V7HB 3H9HA 4NC1E 1HWGB 5DF0A 1EO8H 4GRLC 4D9QE 3ZYOA 4YO0A 1T7WA 4JFEE 4HJ0C 3QJFB 4ZO6A 2ESVE 5T5FH 3MRMB 5ADPL 5DTFA 3MCKB 3R8BB 4WFED 3RAJH 3P9MA 1BIHA 2CMRH 1I7ZA 3HRPA 1U0QA 5JIHA 5BVPL 1WTLA 4JG1H 1DFBL 4HJJH 2OP4H 1SBSH 3RWJA 4XMKL 5E6IA 2W9EL 1FAIL 2HLAB 3TNMA 3K0WA 4AENB 3O6FB 1OAXH 3WIHH 2XT1B 4WI5A 5C7XL 4JQVC 4UOW0 3GMNB 4JFFD 5D7LE 1U8HB 4NRZA 1KELL 4ZFOB 4K7FB 1JF1A 1JRHI 1ONQA 5B8CA 4K3EH 3TYFB 4JM4L 3U0PB 3H3PL 4H88L 3CXHK 3LKSB 4OIIH 5IK3A 2C9AA 3CK0H 1YNLL 5DZNA 3VFGL 2PW1A 4OTXH 3P9LA 4JKMA 4X6CF 5E8EB 1AIFB 5KSAA 1T83A 4I18C 3FJTA 4LRNH 2D7QA 3WNMA 3CDGB 2FECI 3QUXA 4XMKH 3QI9A 4PJ5E 3K2UH 1HKFA 5IHZB 2VL5B 4U33A 1SBSL 2AJ3A 4TTGA 5JHDA 1KN2L 1AQDB 2KPNA 1MREL 4UDUB 4KXZI 1FP5A 3JWOH 2YD9A 2LU7A 1IL1A 3IXTB 4OFYA 3UYPA 5JOPE 1UA6H 4U4BA 1AGDB 5D2LB 4M3JA 3V9FA 3GSNH 3DTXA 2NW3B 3JVGA 1JPGA 4U1SB 2GUOB 1MF2H 4P46B 2CRZA 2V5TA 3P4OA 2XZCH 3IXAA 3WHXB 4F80A 3ARUA 1J05B 4HFUL 3P0YH 3H42L 4DK6A 2Q3ZA 4CL7A 4N9GB 5HGBA 3PWUB 4YWGH 1HIMH 1WK0A 3SGKC 3E1F1 3T08A 1FZJB 2PYED 3HNTH 3VD5A 4H1LG 4AIZB 4OF5A 5D72H 1JPSH 1H3WM 4MCZA 4X9BA 5E4EB 4XNMA 1MI5E 1QBBA 4XCEA 3ZKNC 4OV5A 1GVIA 4ZQKA 4PD4K 2UVFA 5DK2B 4O51A 1MIEH 4MS8C 4WUKH 4X8XA 2BJMH 3ES6B 3UPAA 2FHCA 3PE9A 5EC1A 1KUMA 5FV1L 4M9PA 5KJRH 3CFIC 4LGSB 5CP3H 4HHAA 3L3HB 4F7PA 5DC4B 2G75B 4AEEA 3T77B 4S1SH 3VGHA 5I2IB 4JRYA 2FEDD 1UM6L 4LCUA 4LSQL 4JHAL 1NLDL 1I1CA 3IFPB 2HFGH 4MJIB 5HHME 5EO1A 5J9PB 3PGDA 1ORQB 2CDFA 2RB8A 1M7IB 4Y4HA 1N0XH 1PQZB 5FUOH 2CUHA 1CLOL 1X3DA 4Y5YB 3M07A 1A6UH 3MODL 1IKFL 2HVKA 2Z4QB 2VDLH 3F7YA 5KN5A 4G7YL 5AAMA 4KKBC 1R3LA 1ZK9A 2R0WL 1ITBB 4QNPF 5IW1B 3U9PH 5DJ8A 5I18L 5DJ6B 4EQ3A 1YEJL 3MLVH 5KSBB 3DO7B 1G9EA 3OJVC 3JXAA 4N0FB 5BZWA 1LO2H 3CSGA 4OD1H 2IG2H 5AYUL 3K4AA 3MOAH 4EI5D 4JRWA 4ESKA 5FKPB 1MEXL 1OSPL 4U3XA 3T0BA 4HUVA 3HUJF 4PGDB 4DUWA 2F58H 3LN4A 3VXPA 2I9LB 3C6LD 5DFTA 3RU8H 1CDGA 2H3NB 3KLDA 1HNFA 2VZOA 3VE0B 4ELMF 4UDTA 5GJTL 1MCHA 2ARJA 1NAKL 4OQTL 1FDLL 1BZ9A 4JO4L 4YWGL 1JP5A 1DBKL 1CE6B 3U82B 1ROWA 5BO1L 1N8ZA 4P2OD 1QRNA 1X5KA 1KG0A 2ZUXA 4LLUA 5HYJB 4PJHF 1H0DB 1H8OA 3WFDH 2VAAB 4EDXB 3SO3B 4KXZH 2XKUA 1CFVH 3JV0A 4I3RH 2NY4B 4YFLI 1JWMA 2PTVA 3AVEA 1YN6B 4LCWD 4NQXA 1EERB 3QEQA 1CDCA 2PF6A 4ORGA 1UJ3A 4KJPD 4X7SL 1P6AB 1F6AB 4LKXA 5E94A 2XTJE 2XTJB 3O8XA 4XAKD 3GI8H 1A6PA 3HAEA 2H2SC 1OHQA 5TFSH 3V5DB 3VI4F 1E6OL 5CP7A 1FV1B 1RK0B 3K81A 1NEZG 2P45B 2YPLD 1IAKA 5GGTA 4JAMB 5F7UA 3TVMD 1BM3L 5A43C 2YD3A 1ES0B 1QFPA 5B22A 3CSPA 2Y5EA 1NKOA 4RBPK 3DLQR 2VXQH 1G1CA 5LGKA 4WW2C 3QQNA 1SMOA 3G04A 3TYGH 4LVOB 1A6WL 4KH2A 5DEGA 4YFEA 4MXQD 3NFSL 3GDBA 4ISVA 3OXRA 4KVCL 1YECH 1A14H 4K3JH 4NGHL 1WFUA 3FO0H 4EDWL 4GKNB 1SMAA 4CADA 5L88H 3MV7D 1AGBB 1OW0C 5IM7A 2LFGA 4NNPL 5FYJL 5GRXG 15C8L 4YXHH 3ME0A 1A7BA 3RGVB 5AD0A 5B3NA 3T65A 4N1CA 4Y2DB 4LPCA 4KRPC 1FIEA 4XNXL 4ZXBC 3QEQE 5JO5B 1O7VA 5DDHB 4MS8D 1CZ8L 3NIFE 5T3XL 4F33B 1H3VA 4HLZH 4ODTL 4Y4FC 3S35X 2GSGB 1MNUL 3QZWA 1S5HA 1F8TL 1ACZA 4L4TD 4ZPTA 2GSIB 4OF8A 5CGMA 1XGUA 1TCMA 4C4KT 1YEFH 2PO6B 4U2ZA 1J11A 4URTB 4WV1C 4M1DL 1N3NB 4XNQA 3L3GB 3MUGA 5DJAB 3KPQA 1U8JB 3D0LA 1S7UA 1ADQL 1NFIB 1X5ZA 1SYVA 4PRAA 3OX8B 4TUKL 5HPMA 4NJAL 1JNJA 5GGRB 2OK0L 5EN2A 1T1XA 4KRPB 3EDKA 2PCPA 4KHTH 4O02H 3UTTB 1M6OB 3MBED 4CVXB 1GAFH 2HTKC 3BP7B 5DK3A 2GY5A 2C1PA 1HQ4B 3LKPA 2AEQL 4LSRH 3MRRA 2YPKB 2MCG1 3VRLF 5HGDA 1OD7A 3HUJE 4G8GA 3H7LA 4OBSA 3QDGB 5IVXF 4YIQA 1H3UA 3DYPA 3E6FB 3RVVC 4YHPB 4OKVA 4Y16B 3VG0L 1FPTH 1FG2A 2NY7H 2MFNA 3ARSA 1NCAL 2B8OT 5DUBB 1ETZA 2ARWA 3CFJA 1AD9B 1WIOA 4TSAL 2DM2A 4QF1A 3TIDB 3PGFH 1RUKL 1P7QA 5D2NB 3PQYD 1L0YA 3RNQB 3OAUL 3T1WA 3AAZB 1Q0XH 4WTZG 5A1AA 3TH4T 1I8MA 4CDHA 1OTUD 3EFFA 4PJ7F 2NTFA 3IDYB 5ITFB 4L3EB 3S34H 2R1YA 4Y7MA 5DSCA 1W0WA 3ARFC 2GJJA 4PJGB 43C9B 4MD4B 4GO6B 3TZVA 4R97C 5F9AC 5DRZB 5E9DD 4HUXA 2VQUA 4XP4L 2R8SL 3H2WA 4I2XB 4X8JB 5CSGA 3DSNA 2OZ4A 4BQBA 1O5DT 3PHQA 3Q5TA 3QP3A 2G2RB 4YXLL 3KS0H 3IJYB 3MBEA 4KQ4L 3NGBB 3OF6A 1KLUB 5IB5A 5C0ND 4OM1H 5I19H 1OTSD 4FFWD 3I6GB 3O3EA 4Y4FA 4ZO7A 2CLZA 5E8NA 5HGAB 5SX5K 1I8KA 2DJSA 3ZDXF 2SEBB 1CGSH 4QWWD 3FFCD 2MSPA 4YNYA 1S7VB 3O2VH 4G9DA 2BERA 2AJSL 5DD1L 2JIXB 4ZAKC 4AH2B 1WV7T 2FGWL 1A9BB 4HUWB 3MGOA 4H26B 3DGCR 5JDSB 3RRQA 3V5KB 5FB8B 2R4SH 4M7LL 4IS6B 3HPLB 1P4BL 2IANA 5BOZG 5SX4H 4GMTH 1R0AH 2WBWB 3OKEB 1N0LA 5LWYL 1BJ8A 4P0DA 2AJZA 4NUGH 1B4JL 1J8KA 2BCKA 4PRHD 3WUWB 5D1QD 1GHFL 4XPFL 4NKMB 3CFDA 5DMIL 2DD8L 3OTTA 5FHAL 1QD0A 2HJLA 5E2JA 2P5ED 4PRBA 1OCWL 3ECBB 4OLZL 2WINA 3ARDA 4ZSOE 3U30C 5JIPA 1JHLL 3F6LA 1NC4B 1R3JA 4IRSA 5IJVA 2RHEA 1YY9C 3D5OF 1ZGLA 1YNTB 5KS9A 4UTAL 2YR3A 2BNQE 3FO2A 5HYQB 4UNVA 3LY6A 3NPSC 3SOBH 3QUYB 1IC5H 2JCCA 3VGBA 3QQ9C 2OTPA 1MHEA 4JRXE 3RX5A 4I9WE 4BSVB 2ZJSL 2RJMA 3JTSA 3MRBB 4PP2A 5EU3A 1VFAB 4CU6A 1IARB 5EPMB 3SKOB 4KZDL 1M7DB 4H8WC 3BT2H 1R5VA 1G6RL 1AHWC 4FQQB 5KBNC 1A3RH 2YS4A 5CD5C 3ARBA 5LVEA 4I3SH 1DUYA 4WFGE 1YEHH 5DGQA 3TN0A 4PLNC 4YQXL 4BKLB 3Q48A 1EHLL 1YEGH 4NKIH 5CJXC 5FYJU 3OF6D 4YDIL 2BY1A 2P5WE 4Q58C 5BW7C 4NIKB 5HHVH 1ZWIB 1OARL 2OMBA 4WW2F 4YH6A 5FA3B 4IRZH 5C0CB 2VR4A 4KHXH 3ULUF 2NXZD 4OLYH 4GS7C 3VFPA 3MROA 4NJ9L 1I85A 5J06A 3L3JA 3GSNB 1DQLL 1PKOA 4EUPA 3L1OH 5ICZB 1XGRA 5FCUL 5I76A 4IBLT 2NX5D 4R0LC 5DRWB 1X5IA 3OKMA 4NQCB 4ELME 1P7KB 1JZ8A 2EDNA 1MFAH 3WJLA 4PTTA 3UJJH 1WZLA 2A6DA 5CHNA 3SCMD 3RUGA 1LEIB 1A3RL 4HWBL 1X4YA 4JPWH 2DIBA 3MV9E 1B0GB 4MAYC 3G6AB 1J1PH 5CIPA 3A67H 5B38A 4WI4A 2FBJL 3MACL 3X14B 3QB7C 2JJSC 3DIFB 5C6TH 4OLWL 4QXTA 1AHWA 3BKCH 3GJFA 4LVHC 5D7IF 2VITB 3FTGB 4IOSD 5ILTH 2X7LA 1NQBA 5DS8A 5T3XH 3ROLA 4L4VA 3OR6B 2VXVL 4NC0B 1MCWW 5L9DL 4NQDE 2FJGA 4G8GD 1ORSA 4X0KB 1INDH 4XNXH 4XCNA 4PJ7B 1QSEE 4PJ8D 3OGCA 3W9DA 4DN4L 4P4KD 2ADFH 5I66B 2BNRB 5FHAH 5FM5M 3GJFH 2YMXH 4HEME 4MJ6B 4MNQB 4IRJB 4ZXBD 3WFHA 5CZXD 5F1IB 5AG8A 1MFBH 4GKSB 4OZGE 3EDDA 4ZUUA 5B4MC 1Q9LA 1G0XA 3HHRB 3L3IB 4LCCA 1H5BB 5T1MA 4YDLC 1GGUA 4XP5L 3MLYH 1NCDL 5HBBA 1YECL 1J7VR 4JM4H 5JA9A 4V1DE 2F54B 3LKOA 4E42A 1S7WA 3QNYA 1IGTA 2RIKA 3VGAC 4GMSH 1A3QA 1B2WL 2DQEH 2QLVB 4D8PB 2R56L 3HCVA 3SE9L 1GGYA 3CLFL 3PXHA 5T1LA 1WZKA 5M7QA 1I1AD 1OAXL 3WIHL 2AJSH 3DMMB 3MGAA 2VXQL 2E8YA 4FQ2H 2BVQA 3VXQB 3SJVB 4UB0H 3SKMB 1OLLA 5EOCH 4JY4A 2G9HB 3QFDA 4OBRA 2IFFH 3QFJE 4FZ8H 4LVHB 5D71L 1DJSA 4JRYD 1YDPB 4P4RB 1IAMA 1JHKL 1UH3A 4X4XB 4POUB 35C8H 3WNKA 2NY3C 4L4TE 4MA1C 4NWUL 5ADOH 4QHNA 4LPXA 3D69B 4YFDB 3X11A 2CH8A 2QKIA 3VFSB 1SJHA 2X4TB 2EDLA 4DVRH 4XCFL 4DFHA 4YPGA 4X7DC 3PDOA 4UAOC 3W11D 2FIKA 2ICCA 1EO8L 1JNLL 1KN4L 1WITA 3QUZB 4N0RA 3O45A 3RGHA 5SWSA 2MTPA 1KB5B 1NPUA 2IADB 4U0RC 1FZKA 1FBIL 1F97A 1FE8H 3E8UH 4WFEE 4JKKA 3VFMA 3SDXA 2E6JA 3EO9L 2EYRA 4J3XA 1Q94B 4G6KH 3PXJA 4FXGB 3NIGE 1N5AB 1EFXB 3RVVD 4X7TB 3VDCA 3UCRA 4ZOBA 4DKAA 4QHMA 1XZ0B 1NLBH 4LKCA 5CBAA 4FOMA 1KIPA 3QXAB 4HS6A 4KRNA 4CMHC 1MCOL 4GAGL 2EH7L 3LB6D 2ORBH 1WC7A 3BUYB 1PFCA 1TQCC 5FFLA 2HWZH 1U8IB 4JR9H 4L8DA 1Q8MA 1JVKA 3CUPB 4KPHH 3C87A 3VJ6B 2HH0H 1U9KA 3BRGC 1HE7A 4L9LA 5T1DH 3TFKD 3ARDD 5JHDD 4ODSL 3TBVA 3OKKB 4YAQA 4HKJB 3DUSB 3FQNA 1P84K 1A1MB 2E7MA 2R9HD 3TO4B 2C7UB 1IZJA 3SDDB 1IAII 4LRIA 3S96A 1AGCA 1NSNH 1SM3H 5BQ7B 1HHKA 3VFWA 2ZOLB 3O4OC 2UWEB 2W0PA 4WV1B 4PJ5A 3ZKMD 3VGAB 4JKWA 4DUVA 5LGJB 4ODXB 3SBWA 4OZFH 1J1OL 1RQ5A 2DYPB 5L2KD 3UJJL 3WFBH 3OKYA 4PB0L 3E0GA 3NTCL 2C4FT 5EU6A 4P23B 2NY2C 5FKAB 2FGZA 2CRIA 5FYKL 5T3XE 4FRWA 4UT9L 5KVDL 3BP5B 5BOPA 5LJYH 3CXDH 2FEDC 1JIBA 1V7NH 2X70B 4KI5C 3L1OL 4FQXA 5D5MF 4MA1B 1NMBL 4M00A 2AI0H 1RU9H 3GIVA 4H1LA 5ICYA 3P4MB 4JFXB 4KTDL 1ZLSL 5T33L 3UO1H 1VGKA 3BJ91 3BN9C 3BKML 1BIIB 4ZG1A 3M45A 1T03L 4C59B 3ZKND 5ID1A 3F65A 1B3JA 4JDTH 5ESAA 3BMWA 1CICD 4PY8J 1V3LA 2Z31A 2NQCA 4LPTA 5SWSD 5BXFB 1DLHA 5FECB 1KFAL 3QEHA 4CW1B 3VXMB 4UQ2B 1CFSA 1RUPH 5MERA 5CMAA 4J12A 3KPMB 2X4UB 1KB9J 1RUQL 4LRIC 1MCRA 1X5AA 4TVPH 3RWIB 3I50L 5H2BB 4HPOH 2UZXB 1MCQA 1DUZB 1JGEB 4KRMB 5ABDE 5HDQH 4W81A 2OL3L 4G6AD 1S7TA 3GKZA 1Z0NA 4Z18A 5HGHB 4N5ED 5HJ3B 2YA0A 5FO9B 3H9SA 1LE5B 1JBJA 5F88A 5E00A 3DJ9A 8FABB 4MDJA 1J0YA 2WIIA 5JMOC 1KXQE 3U6RA 2CDGA 1P69B 1U58A 1FH5H 3BW9B 3NN8A 4KKLD 1QYGH 5ACZB 1FZOA 2CJUH 4H5SB 3TZVD 4ZDHB 4N8CL 4AQ1B 4X7SH 2VZ3A 3KPSB 4NC2B 2F5AH 5F3BB 5F7HA 4JFQB 2PTUA 2Z93A 5JPNB 3WHE0 4WEBH 4D9RE 1CU4H 3CFCH 2I60L 5AZ2H 4R4NC 3KLAB 4QNPE 5C08E 4ONGL 1EGJL 1A4JA 4FXKA 3X12B 3MOBL 5CP3A 4PLKC 1G84A 1HEZB 1I7TB 4K8RH 3DGGB 2M1KA 1IBGL 3CFBA 1LHZA 2XKSA 4RQQB 3B9VA 1AJ7L 1XFPA 3QWOA 3DSFL 4HC1L 5T1LD 2Q86A 4WNQA 4BFEA 5C6PB 3GSXB 4EIGB 1UACH 3VCLB 1UKQA 1BPVA 2EE2A 3AREA 3U4EA 1ZXQA 4JRXA 2O61A 4UIKH 1XT5A 2BRQA 5JMRA 3QA3A 4KK9C 5FK9B 3T4YB 2VUOA 4LPYA 2ENYA 4P3WA 4WGVB 3BVNB 1JN6B 5EORL 4K7PX 1V7ML 3ZT7A 1R5WB 4JPIA 1KLFA 3QQ9D 5TE7H 2F53B 2VXUH 3IFOA 2RR3A 3U36B 4UT9H 1TQBC 5FGBC 4LCCC 1DVFA 2DOCA 2R2BB 1I1FB 2DMBA 3WFEL 4TSBH 2J8UB 5L2KA 1UWGH 3QCTL 2YUWA 1I1AC 2A6KA 1DEEB 5F97E 3BFOA 2F5BH 12E8H 1ZA3A 3LD8B 4HS3B 4Z76B 1PZ5B 4NPYA 4NQED 3JTTA 1KJMB 1HILB 4P59H 4OGXL 3EO1A 1GGCH 2BVPA 3T2QA 4AG4H 5TE6L 1AH1A 1T2JA 1P1ZA 5L2JB 1RI8A 1G9NL 4K3HA 3QDMB 2HFGL 3BPLB 2DTMH 3ILPB 4NP4H 5C3TA 1N7ML 2APTA 4JLRA 2DQDL 1FC1A 4EN3B 3HZMA 3WN5C 4KMLB 3UTZA 1QR1A 5D1XA 5GS1C 4PJIB 1RUKH 1RPQA 1RJLA 4A2MA 5DD3L 1ULVA 4P4KC 5JHLH 1QFWL 3O4LA 4J3OC 1R24A 4Y5VA 1KYOK 1CLZL 1LD9A 1MIEL 4WUKL 1MJUL 2BK8A 1AQKL 2BFVL 5I1LB 3BPLC 1TZGL 1AE6H 4HUUB 1EXUA 2IPTL 1ZANL 3G6JF 2ARJQ 3NGBC 3LHPH 1JGUH 4Y1AA 1YNKH 4R90H 2I9TB 2NXYB 1XR8B 1HI6A 4IJ3B 4P59L 1Q9WB 3W9EB 3ALWA 5K9KA 1GPOH 1K8IB 4R26L 1RZKL 4QT5A 5L7XL 3ZYJA 5IMLB 4U1MB 5T3ZD 3KHQA 1RUAL 2DQHL 2VDQH 4PJFB 1G9NC 2YRLA 1UJTA 3WCYA 4KK5D 2WANA 3SGJA 4HQQH 4QYOB 5DHVH 4JFFA 3BAEL 4W4OC 3UBXB 4JO3H 3V0AC 4XCCL 3D3VD 3VXOB 4DGIH 1HHJB 3RVXD 3FB6A 2XN9E 4G6FD 5CGTA 1DVFC 1CE1L 1PLGH 5JORB 3BE1L 3MLPA 3ULUD 2EEDA 1AGFA 3GFUA 2F53D 5C09D 3IAPA 2AQ3A 4FABL 3BGMB 1T22B 2HKHL 1T0NA 5E2UL 2XOTA 1MAMH 4X7CC 1CU4L 1F3DH 4NT6A 3RVXC 3VFRA 1HXMB 3MO1A 5KANG 1LO5A 3LN9A 5GRZA 1FVDA 3GBMH 2PR4L 1DQDH 1NUGA 1JCKA 3DBXB 1YPZA 1MFDH 3W0WA 1XF3A 2BVEA 4AMKH 4OZIF 1UVQB 5EO9B 1F4XH 4YDVB 3KDMB 1O0VA 3VRLE 4HZAA 4DCQB 1JV5A 4PRIA 2DQTL 4BUGA 4L9DA 2DWDB 3BKYH 5JIKA 1NGQL 4NO5A 5DJYA 2Q76B 5FXCH 4KMTL 4HXAL 1OAUL 4MA7L 4KJWD 1S7RB 3HI1A 4NCC1 5DURB 2WBJA 2W9EH 2EXYC 1QA9B 3OKNB 2BMKB 2XICA 5SWQA 4OZGB 1QFUL 3ABZA 1INEL 3S6CA 2XA3A 2BXYA 43CAB 1MSPA 1GZQA 2VDRH 4L4VD 1WT5A 3B2VH 2RGSA 3QPQD 3PWJA 5GRWA 4Y4FD 5HI5C 1TZHB 3LQZB 1I3GL 3QCUH 1GIGH 1KIRA 3HLAB 3C5ZD 3T0WA 2MCPH 3AC0A 2EC9T 4UU9A 4Y4HD 3BH8A 4OKDA 3D25B 2NY5C 3IDMA 3QUYD 3I50H 4XMPL 5IVZA 3V6OA 3UTQA 3PQYA 1KC5L 1NANH 2COQA 3ARPA 3TJEL 1JUFA 2JJSA 4K7PH 2ZG1A 1XIWC 2V7HA 2X2YA 4ZS7L 3T8XB 4TNVK 5GGSY 3QIUA 3SE4A 5D93C 3KXFB 5J6GA 2DL9A 1JWUA 3Q0HA 2W1NA 4WTWA 2G60L 4QOKD 2I26N 3CXDL 2ZUTA 5KVDH 1YN7A 1NKRA 3RVUD 1D9KC 3P9MB 4U7SA 4L8SA 4RX4A 2CIKA 4IRJC 5JW4M 3VXSE 1RU9L 3AU1B 3B9KD 5E6IB 3RP1A 1NFDA 5D70L 4I0CC 3MLUL 3N85L 1HH9A 1CGWA 3TNMB 4KJQC 1MFEH 4M1GH 3LRGA 1E4WL 4S0SD 2VDOL 3TCLA 4YQXH 3NTCH 1N59B 4J7RA 4B0MM 3GMNA 1FL3B 4I3SL 2XZAH 4M7JH 3HA0A 5L2KE 4XVTL 5J7CC 4K8RD 4ZFZB 1AXTH 4BSWB 3QI9D 4NRYB 4KTDH 2VDKH 2NY4C 5IK3B 3FL7A 5IMKB 1OT1A 4ERSH 3HRZB 4PGBB 2OQJB 4E0RA 2KQMA 1PKQB 3IETB 2ED7A 1Z9OA 1GC1H 3CMOL 1MIML 3AM8C 3H7BB 5F6HI 1BFOB 2V6HA 3QIBD 3QUXB 4UTAH 1Y6KR 3CXHJ 4XCYA 2HG5B 4LHUB 5AEAA 4IRSD 2YA2A 4LARH 4ZUWA 1QSVA 3KPTA 1IC7H 2XZZA 2D4DA 2BSTA 4PJIF 3U7AA 2FB4L 3OV6A 4M7ZB 5D2LA 1QTYT 3LKNA 5GS2D 1MAKA 3DTXB 4RMRA 4BZ1H 3OWEA 4HPYH 2WQ8A 3GRWH 4HZLA 3R0MA 3GIZH 3P4OB 3VXSD 1E0OB 4MVBC 3IFLL 4YHIB 4MA3A 3VD3A 3ZT5A 5CSZA 2FX9H 2FX8H 3P4NA 2C4XA 4FQPA 1CGTA 1WIUA 3D18B 2X4SB 1KCLA 1E4WH 1IEBA 4HAFA 2OL3B 5I8EA 4LMQE 1I7UA 2WV3A 4N9GA 3FONA 3BQUB 1EEQA 5ANMB 3F58L 2H26B 5HYSB 3LZFH 3S3JA 2J4WH 3ARXA 5ADOL 1YEKL 1WWCA 1XF5A 1IAIM 3Q5YA 5D5ME 4POYA 5A16B 2IPUG 4MCZB 5KSAC 4HEPG 4XNMB 3NCCB 1EDQA 4GOSA 4XXDB 5DQJA 5I1HL 3GK8H 3QUZD 5I1CH 2IQAA 4TNWK 2AJYH 5JW3H 4V1DB 1DN0A 3TPKA 3VFUA 3B6SA 3C5ZB 2VMFA 4IOIB 4X7EC 2R56H 1AKJB 4L9LC 3KYOB 1I9IH 1F4WL 4HHAB 4RIRA 3LEVH 2DQIL 2G75A 2R2HA 1T0MB 4OCLC 4UB0L 2D7TH 2IWGA 4HK0A 4QRUB 4CVWA 1A6VH 4S10A 1UEMA 1MFBL 1ORQA 2P1YA 4YPJA 3X3FH 4U1IA 5CINL 1OPGH 4PGCA 3EOAB 4PJXF 5CGYD 3VFNA 4X4YB 1TMCB 5ENWA 4GG6A 3SBWC 1B2WH 1EX0A 4Y4HB 3FQUB 1RZGB 4NWUH 1OAKH 3WUWG 3ZKMC 4PG9A 4Y5YA 2HVKB 1L0XA 1FO0H 3W2DH 1OTTD 5I1CL 3HTLX 1R3LB 4OCXH 5IW1A 3BZ4A 5DC0A 4FQ2L 2LV4A 1HDMA 5DJ8B 2R0KL 1TVBB 3DO7A 4WFHE 1MCEA 1NBYA 3C60A 5E08H 3S35H 5GGSA 1S9VB 1KBGL 2AEIT 4PGDA 1UWXH 3MRLA 1IM9A 3RAJL 5CBEA 5HY9A 2WZPD 2H3NA 2O5ZL 1DP0A 1JMXA 5DVNA 3VE0A 5B8CC 1MFAL 2XN9D 4M8QB 4NO0D 4BZ2L 1OF2A 4M4PA 4MNHA 1KG0B 3ALPA 2X44D 2EDYA 5F3HA 3WIHA 4NKDB 2VAAA 5D70H 4EDXA 3MJ9H 4PB9H 4FP8L 1TJGH 3BZEA 1RZJC 4NN5C 4XZUA 2P44B 4F7EA 2FWOB 1FZMB 2AJVL 4ORGB 4MAYD 1T89A 4LKXB 5IMOB 5FUCC 3O8XB 1J9CT 2IH3A 4PY8I 3EUUA 4PJDA 3FT3A 2VDML 3V6ZB 3U4BL 3I3DA 3NIFF 1FV1A 4XX1G 1P2CB 3RKDD 1GGBH 2AV1B 5K9JL 2NXYD 3QEUB 4QRRB 4JAMA 1KNOA 2NY3D 5IVXE 1OARH 4I0PA 4YXHL 3BD4A 4QTIH 2P5WD 4P5MA 3VH8B 1VACB 4KGLA 2GAZA 3EDEA 3DX7A 3SDXE 3H0TA 1FRGH 2X9YA 2GCYA 3HNSH 3BN3B 4OLVL 4K3JL 5I75C 3GSVB 4YHMH 2NR6C 5IT2H 4PJIE 3K4ZA 4M5YH 1QFOA 1BVKA 5F7LB 3OPZH 5DC9B 4LF3A 3VMPA 4L8CB 3F12A 1T21B 1WWWX 1FYHB 4GKNA 1I1AB 2K7PA 4XC3H 5C0BB 3LCYA 4CADB 1ZHBB 1BBJB 2DKSA 4RFEA 1YY8B 5IIEA 4ZS6C 5JW4Q 5DJ2A 2PYFB 5I74C 1ZVYA 2HN7B 3GM8A 4ODBD 2ED8A 3RGVA 2HAZA 1IZKA 2HRLA 5E99L 1F42A 1MI5B 2O5YH 3HE6C 4X7FC 1JYWA 4OM0L 3FB7B 2A6JB 4I5BB 3P0VH 5DD6B 1QQDB 1QBMH 1T20B 4ZS7H 3RDTA 3FHAA 2DQTH 1I3UA 1SEBA 4PJAB 3JV6B 5AWNH 1IRAY 3EJYC 4ZXBB 4XNYL 5FYLH 3WMSA 1FNGB 5KSUB 3J7HA 4OD2B 1HXYB 2Z92B 3IF1B 4ZPTB 3V4PL 4W6XB 3R06B 3GBML 2RQ8A 2BNUA 5GRUL 2L7UA 4RGND 3TEUA 1ACYL 2FBOJ 4TQEH 1JGDB 3EHBC 5IB2B 1K3ZA 1K3IA 1CCZA 1R5IB 3KPQB 5F89B 3LSOA 4WO4D 5IEKA 2DMCA 3MV8E 3BPNC 1FDLH 5LQBH 5CEZD 1RIHL 2XQYK 1TITA 2IH1A 2HFFA 1EBAA 5D7LA 4CJ0A 4H0GA 3UTTA 4DFIA 4QLRA 2UZIL 3BP7A 1OOAA 1FFOA 1M71A 2C1PB 3K3QA 1IGFL 4XBGA 3V0WL 4BA8A 1HH6A 1SHMA 4M1CD 2YPKA 1U3HA 5JPMB 5E9DE 3BO8A 3QCVL 5FAAA 4NCC2 4PJXB 3QUML 4YIQB 4CUCA 4XBPA 4HMEA 2PYEE 1AJ7H 4Z7UF 2IF7A 3C08L 2I24N 2ZUUA 2QL1A 3FAXA 4NZJA 4I77L 2Q20A 3MYJB 4MB4A 5EZJA 4OJFL 1ETZB 3CFJB 4C55A 1BOYA 1UXWB 4QF1B 3TIDA 5KZCD 4NDMB 4JN1L 5BVJA 1DZBA 1EUTA 5E5UB 3WIFB 3JWNC 4X6FB 2R9HC 1NDMA 2F5AL 3K8LA 3QXDB 1A0QL 5D9SB 1T2XA 5IG7A 3EFFB 3FFDA 3OXSB 1XEDA 2HRPH 1T2QL 2H2PD 4L3EA 3GMQA 5EO0A 3K8MA 3SO3C 1W0WB 4AIOA 2EDJA 4ZTOH 1Q0XL 4KQ4H 1CLZH 3HG1D 2XQBH 1MCKA 3KR3L 3BGFB 4MVBD 1IMHC 1KJ3L 3BZDA 4HUXB 4GW1A 4YUEL 1C16B 3NCMA 1PZUB 5F7DB 1IJ9A 1IT9L 1DBJL 4A6YB 5JLZA 1PD6A 2VABA 4Z7UA 5FCSH 1FN4A 2CIIA 2BX5A 4U7MA 1U8QB 3FO9A 1IM3B 5IB5B 1T5WA 3SDCB 3BP6A 2APXA 3CFEA 3O3EB 4N0YL 7FABH 1I8KB 2VH5L 4LSTH 4AG4L 4W4NA 2O26U 5FYKU 3FN0H 4G9DB 4Y88A 4G8FA 4OAWB 4JZJC 5ETUA 2C4FU 4GRLD 5FO7B 1GL4B 1JZ5A 3MGOB 2W59A 1RFDL 2ZG2A 4UV4H 5JDSA 1VERA 3MBEC 2VN4A 4A2LA 4Z0BH 2IANB 1T6WA 1TZGH 2CGRH 1NDGA 5CJ5A 5MEOB 3X13A 4QRSB 3D39B 1I1RA 1CG9A 2EKSA 3OKEA 3S36L 1Z9MA 1UCTA 1A7OL 4NQDA 1PY4A 1MH5A 3PP3H 3B8SA 1BOGB 2BDNH 1FGVH 5L8KB 3VXSB 1YEIL 3SDDC 4HKBA 4LLDA 4NKMA 1EVTC 4ODHH 5C0JB 2FATH 4LPWA 3LPWA 4WO4B 3PIQA 1WT5C 2OJZL 5ELIA 4Y8AA 2ZWLT 3TJHC 2WWMC 4U7KA 3W2DL 2APBA 2EO1A 4IRSB 1ZHKB 1GGCL 1SVZA 3LDBB 3I2CH 1W72L 4ZFGH 1VCAA 1YNTA 3K2UL 2BNQA 3P30H 5C8JB 1SJXA 5TQ0L 3LRSA 3NPZB 4UI2A 5DJDA 4AEIL 5CWSA 5CILH 3X3FL 4AM0B 5C07D 2MJWA 3B2UD 1G7LB 4YBLB 5BJTB 2GTZA 4MQ7A 4U1NA 3ZSSA 4JFOA 4Y4KC 5T5NF 1YNLH 1AGEB 5EPMA 1N64L 2EDEA 3RIAK 3U7WL 4KVCH 1R5VB 2DQIH 2X4QB 4UILH 4I3GA 2BP3A 3OZ9H 4GXVL 2ORBL 1QEWA 2GK0B 2OI9B 2R0KH 4GG8A 1HINH 4PY7B 2QADD 1KTKE 5MENE 5ESQB 3BRFA 2I07A 4FFZH 4JFYA 3SPVB 3CDCA 1W8OA 1ZWIA 4J4PA 4HX1A 4D94A 1P84J 2XQYG 3TV3L 5C0CA 1W0VA 1J12A 3P73B 1CFVL 1JTOA 1HHHA 1RUPL 3TPUB 3ARDC 1X6LA 4GKZA 5ICZA 4ONGH 2FZ3B 4JHWH 5BMFH 2H45A 3NCEB 5J3HD 4J1UB 3TN0C 4NQCA 3HE6D 5FDWB 2EEAA 4PJAF 3HS0A 3ZE0E 2FH8A 1IQDA 5CHNB 4XPAH 2HTKD 5KVFL 1CFQA 3TBSB 4M6ML 5BW7A 3C2AL 3CAFA 2Y06H 5AZEH 2BSED 3VWJC 1YJDH 1U3HD 3L3OB 1JK8B 5L8LB 4GUPA 3X14A 4OD1L 3WHE1 5E5MB 4EOWL 4FNLL 1KXVC 2J5LC 3FOLA 4I4WA 3KXFE 1MCPH 3EYFB 2ERJB 4QCIB 3W82A 1MCIA 4XRCB 4JJHA 3LQAC 4QXTB 2F8VA 3BISA 5IFJA 3GJFB 5IMMA 1BFVH 4Z7QE 4WW2B 4NM4L 5DS8B 4C56A 3O41A 4UOJA 2YEZB 3SJVE 3VXTA 2DN7A 3MOAL 4JZOB 3HG1E 5MHSD 1QSEA 3WE6A 3QDJE 2IQ9L 5DD5H 3UJTH 4DJMA 3HE7B 4WDIA 1R3KA