4PGEB

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgnypaw
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/peptide
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgeB00
1LHZA 4F7MA 3HMXH 4OLEA 4I48A 2CLZA 3PXHA 4PRID 5IJVB 2VTFA 4N5UA 3U9UA 1ZLWH 5DHYA 1UVQA 1XZ0A 3HA0A 4MA1C 3EYSL 1PG7W 3V5DA 1F3JB 5DRNB 3V6ZB 4DGYH 2Z4QA 2MWCA 1KG0B 4PGDB 3KPMB 3IDYC 3MGTB 4P4KA 3IB4A 1CXEA 5C6PB 3UX9B 4JAMA 2F15A 5DVMA 5LQBL 5EU3B 5IW1A 5EWIH 3ROOB 3ZKQD 4DUWA 3HNSL 4RDQG 2NY3D 4HS8L 4O5LH 4PRHB 3T0AA 2FJHA 3QEGL 4L4TD 2H6PB 4X5XA 1YEHL 5GRXG 1IQWL 4UDUB 5IWLC 3S3JA 4P3DB 2QADB 5JA9A 2GCYA 4NQEA 4OJFH 3MRNB 4GG6F 3TYGH 1KJ2B 1IEBB 5EPMB 5BS0B 4OLWL 5IIEA 1INQB 2GAZB 5IK3B 4RBPH 4K8RD 2ATPB 5K93A 4R7NB 2XFXA 3DVNA 4HLZG 5FDYA 3B2VL 5LVEA 3S4SB 5D70H 1NSNL 2VLME 1FYTB 5C0JB 2DS4A 1RY7B 2OLDA 4S1RL 4JM2D 3VH8A 5DVLA 4HUWA 2NR6D 3L5WA 4UUJB 1MH5A 4BQCA 1K8DA 4EN3A 4KHXL 5F7EL 3GMNB 1CZ8H 2J1KA 5ESQB 3PWNA 4JM4L 4HCRL 1C16A 2KKQA 4PJDA 2UY7A 1Q9OA 4ONFL 5FXCH 3CUPB 3LPGA 4PY7A 5IQ7H 2DQJH 2X09A 3JV5A 3O9WA 3DV4A 3IDUA 1I1YA 1HH9A 2FGWL 4J1UB 5A43C 4GKZA 5TGBA 4KK9D 4F3FB 4BH8B 1FNGB 5HHOE 5E8DH 3CMOH 2VXQH 5ANMB 1BFOA 2D7TH 1UCBH 1DBAH 3H42H 1MJ8H 4U1SA 3FFCB 4UILL 3V6OE 2IH3A 15C8L 1FDLL 1YECL 1P9MA 2G9HA 4S1DD 3P11H 4X5WA 2G75B 4CADA 3VXNA 2VXVL 3KPRA 3SPVA 3NCFB 2AXFB 4NZJA 5BQ7A 4HEPG 2YD2A 2ZUSA 2DQGL 2ESVA 5C8JA 4E5XB 5LCVL 5JZ7C 1ZKAA 3O4LE 3C6LB 1ZT4B 3I50L 3LSOA 4JGJA 4F15C 4CMMA 1U8HB 3RDTB 3VFPB 5I8EB 4EI5D 4QOKB 3V6BR 5H8DA 4UBDC 1EGJA 1YYML 4X0KA 5KANI 1K9TA 2AJYL 4K7PH 3N1FC 3LEYL 5C0BA 3L3KA 1BFVH 3U4BL 5TDPB 5IBTL 5CD5D 1SMAA 3W0WB 5CINL 4KUCD 5HHXH 5DMJB 1ZT7B 5D1ZB 2UZIL 3PJSB 5T3ZH 5KVGH 2EDRA 2J4WH 2HTLC 2O26U 5HHNA 2DYPB 4Y16C 1TVBA 5B8CB 1MCHA 4R0LA 1J88A 3FQWB 4GXUN 3T4AA 4JKPL 4YZFF 2ZUTA 4X9HA 2EC8A 3BW9B 3PHSA 4M7ZC 4JE4B 2R0WL 3FQTA 3H9ZA 3S4SG 2MMXA 1YMHB 4PBVC 3VDBA 2IADA 5AD0B 5L8JB 1HI6A 4OZIB 2X10A 4AT6A 5J9PA 2X4NA 5GGUB 4ZXBB 3VXQB 5IFJB 2VAAA 2R8SL 2EXYD 3E8UH 1FZOA 4OGAC 4JRYD 3RGHA 4UOW0 2VMFA 4IDJL 2JJSA 3AUVA 4CJ0A 2HRPH 4KROC 1TJHH 3OJVC 2LFGA 3TBWA 2H9GA 1Q9LB 2VABA 3L5HA 4RA3A 2VKXA 4R26H 3MLTA 2M2DA 1GXEA 4PJBF 3H9HB 1Y18B 4F80A 3B9EA 3EHBD 2GK0B 5J1TC 2DM2A 1KB5H 3SKUD 1F4HA 3QFJD 4WTXA 1TENA 4YHLH 3THML 3J7HA 5FUZL 5HGGS 4YR6B 3HE6D 5K59F 4H0GA 4C56B 4OD2B 4ZFGL 3ZMRA 3LKPB 4Y2DA 1DANT 1KPVA 1TQCB 4XMLH 1RI8A 4LHJB 4XBPB 1CE6B 1S7QA 1UA6L 1TNMA 4LARL 4PJ9B 2DMCA 4FXKB 1UZ8A 1YC7A 2OR8A 4DKFL 2V5MA 3CK0L 4HLZH 2NW2B 4GXVL 1RZ7L 5EUOF 4M43H 1XF4B 1K3IA 3H7LA 1ZANH 2VXSL 3TV3H 1WQVT 2K7QA 5J57B 4WCYL 1FLRL 1MHCB 1Q1JL 3JV6A 3UBXB 3D48R 3KLDA 1DL7H 3RTQA 1LE9B 4OFIA 1NLDH 1R5WA 1H3WM 5BXFA 4URTB 5I6XC 3I6GA 4ZUSB 5CSZA 3RPIA 1T89C 2UUDH 1F58L 3MJ9H 3QNXB 2B20A 1X5GA 1CDGA 3F7YB 2OTUB 4LMQE 5DK3A 4Z0BH 3BPCA 2E6PA 3FTGB 2LAGB 4P5TD 5I1JH 1JI1A 1XGUA 2IBGA 2VDLH 3JVGC 3TIDA 2Z8RA 4IM8A 4M6AA 3S35L 2WMPA 1KN2H 1HIMH 5H35B 1KN4L 5C6TH 4Z7VE 4MD4A 5DR5H 3IVKB 1WBYB 4DQOL 3O6KH 2P48B 4M1GL 1IT9L 3JBG7 4PTUA 3MNZA 1DUYB 3HLAA 3G5XB 1FZMA 4KZDL 4QYOB 4DKEL 4O2EA 4Q6YA 3GSWA 5I1HH 3MA9L 1PW3A 4QHUA 5L2KA 4XTRD 2N7BA 2CSPA 5GGTH 3DV6B 3HI5L 1AGCB 1RFDL 3BN9D 1U9KA 5C0CB 4NJAH 4EBQL 5HYJE 4G9FD 1WBXA 1S8DB 5F1IA 1C5DB 1NPUA 2VDMH 4JO4H 5CJBA 2P5ED 1D5ZA 2UWEA 4GW4A 3AAZB 1JGEA 3PIQB 3QJHA 5AZ2H 3ARYA 1G9MC 4I5BB 4P2RD 1FO0A 4J8RB 2OTWB 4HK0B 1F4AA 4S1QL 1TETL 1IGTB 5JDSB 2APWA 1QACA 4FN0A 1CE1L 2VC2L 3KPSE 3ES6A 3P30L 3L3OB 2HT3D 5L7XH 4PJFB 3VXMB 4TPRH 5ID1B 2B4CC 3BH9B 4NUJA 1HYSC 1KJ2H 3WS3A 3WCYA 1KXQE 3BD3A 1RMFL 3SCMC 1NANH 5I30H 2XZAL 4FMKA 2OI9B 4N8CH 3PWJB 1YNKL 3NTCL 4F9PC 3K8LA 1N0XH 4ZAKB 5FHBH 1U8JA 4XVJL 3KDMB 2ERJC 2NXZC 4FQXD 3HZVB 4I1NB 3UBXG 3LPWA 4NIKB 3OKNA 4PJEA 5IHBA 3LRHA 4HXAH 3WUZA 1AFVL 4PV8B 2ZUUA 2E7LC 4PJ8B 5DQDH 3SKMA 4YWGH 2NY5C 3OWEA 3Q6GH 1MVFA 2B1HH 5DJXA 3FMGL 3QXTA 1KCSL 4HQQL 5TPWH 4IS6B 3VD9A 2VERN 3QDHA 2DLFL 3LHPL 5D1XC 4CVXB 3BDYH 2X89D 1NBZA 1ORSB 2VQ1A 5JOPD 2CKNA 4UIMB 2DLHA 3NIDE 1QUNA 1AO7E 3H9SD 3BPNC 3HMXA 3SKOB 1IRAY 3PWVB 4K3HA 2OMBA 4JZNA 3GRWL 3S36X 5ISZD 3U46B 5KJRH 4EVNB 3TH2T 1VADA 4Y5YB 2MCPL 2XWBA 2WK2A 1JNLH 2Y5TB 2XWTA 5IG7B 4NO0B 1FFRA 1Z9OA 2C3XA 5TH2B 1UKQA 3UYRH 3QT2A 1U8QA 5GS0C 3VCLB 2ZOKA 1HSBA 1ZT1B 5I0ZA 1AHWC 3AS2A 3MREA 2EICA 2DLTA 5GISL 5MEPB 1WWWX 1IGML 4GAGL 4BSVB 2X1PA 4FFWC 5JW4N 2YPLE 4UOW1 3GSQB 5C0DA 1ZSDA 1KEML 2CIIB 5ETUA 4LGRB 5K9KB 2NY1D 3G08B 1T3FB 1A5FL 1GPOL 3V0WL 1ROWA 4ODHL 5EOCH 1G7HA 1E4XI 3TFKC 5J6GA 5IESH 4OLYL 1NCDL 1T1XA 2W0FB 3BVNA 2EDDA 5F9JA 5GS2D 4YHZH 1FL3B 1JPTL 5GGSA 2B5IB 3RY6C 3D25B 4LPVA 1MCBA 5DMIH 2PYEE 3TO4B 4MYWB 4EI6B 2OBGA 5FM4A 1F6AB 5I17B 2P5WA 4Z7UE 1A4JB 2VZ3A 3MV8B 1NGYA 2X2YA 3G5YB 1DDHA 2ADJA 3B43A 3PQYB 4QHKJ 3V5HA 3VFWB 3HB3C 3MRBB 4BK4A 1SMOA 5LGJB 3T2QA 2EZ0D 2IALB 2OP4H 2EIBA 1JPGB 5BZWB 4E41D 4OUOA 2VZTA 3PGDB 3QIWA 2EIDA 5IVXE 3CD4A 4ZS7L 3VRIA 2R29L 1U8PB 3G6DL 3ILQC 3UJIH 3RWDA 3EJZC 4XCCL 3MXVL 4CJ1A 2MNUA 1BZ9B 1HQRA 1OAKL 3VXTA 3FONA 4XP1L 3QQ9D 4KKLD 4K94L 4U1KB 4P46D 4OZHB 2W9EH 1JUFB 3MTRA 4WUUB 4MSWA 1WZ1L 1FL5A 1OAZH 4QXUL 5E2UH 3KJ6H 5LAXA 1XGYL 3OB0H 3VFRA 3CDCA 2VR9A 1ZA3B 1ES0A 3NFNB 4GBXA 4U0RB 5LG1A 3F12A 3UTZB 2FIKB 5IFAH 6CGTA 1M4KA 4I3RH 4HXBH 1Q0XH 3NIDF 5F89A 5I18H 3R0MA 2DQIH 1CBVH 5E00A 2FR4A 5AG8A 3SE4C 4NQVA 2P43B 4MNQA 4DGVL 4W6XB 5I19H 4YHOH 2UY6A 4IRSA 1Q38A 3GGWA 5T33L 1ZHNA 4JREC 2HLFC 3EOBA 4TSBL 2M1KA 1G0DA 2A1WL 4XZUA 1D5BB 4TRPL 3C5ZD 4LASH 3TN0A 3BD5A 5EC2A 5KVDL 1I1FB 5IR1A 5I2IA 3HE7D 4OUUB 5HDBF 3MGAA 3MLYH 5BRZD 5AWNL 3LOWA 1ZWIA 5FGCE 3OZ9H 2VLRD 1PX3A 2AXJA 4QRRD 3TJHC 3FZUC 4KVCL 3HZMB 1P7KB 3GSVB 3G5VB 2E8ZA 3HI6H 3VXSD 3IF1B 4PB0H 2JCCE 1KUMA 1DBML 1SEBB 1P4BL 5D96B 4TTDC 5F21B 4G6FD 1MJJB 4E9LA 5GJSL 1F00I 4XWGH 5MEND 5B3JF 3BQUC 4JN1H 4JPIB 2DI7A 4YDIL 3QEQA 2O5XH 4LF3B 1IEHA 5EZJB 1KEGH 2Q7YB 1ZHBB 5ERWA 4OZGA 1T1ZB 4ONOA 1K4DA 3DNKA 3O2VH 1M71B 3X11A 4WDIB 4YX2H 3REVB 1DEEB 3RX7A 3BEVA 5E2JA 4NBYB 2FYYA 4EUPB 5D7LA 1Q9KB 1OP5H 4I9WE 3G6JB 3BYYA 4WEBH 5GZOD 3OAZH 3MRJB 3LIZL 3CFJB 4G8EB 4KJPD 4M9PA 3L7EB 1KB5A 3GHEL 4CW1B 1R3JA 4NOBA 3CFDA 4I77L 5JOFA 3ARBC 1T1WB 2HFEB 4K9EC 1N6QL 1R6VA 3MJ7A 1CD9B 2A73A 5HYQB 1XF3B 5C08B 5SWQA 3V0AC 4BYHA 1NC4D 3QUYC 3OGCB 3VXUE 3LQAL 2Y07L 4HMDA 3OKDA 4MA3B 1HXYB 4GRMA 1AC6A 2Q8BL 1S5HB 3G9VA 1I1AC 4JG1H 3TZVB 2Z9TA 4JY5H 4N0CD 4TSAH 3ARPA 2ITCA 2G60H 4IEFB 3JUYA 3KLHD 1AGFB 1S9VA 1AGBB 3RAJL 2FNBA 3WLWC 3ARQA 5DSCA 5DMKA 4JFED 4X6DA 1IMHC 2VSCA 3MROA 3L3JA 4Y7MA 1FBIL 3UTSB 1XGQA 4NUGL 4LQFL 4C57C 1G0YR 1A6PA 2AKRB 2A9NL 4YK4C 3TO2B 1HSAA 2GHWB 4WFHE 1DSFL 5ICYA 4YXLL 3JV4B 3T3ME 1DFBL 3BWUC 1HEZA 2AEQH 2VDNH 4JFDD 5KAQG 1G6RB 3KYOB 4LSDA 4YFEA 1F3RB 2BNQA 1TIUA 3Q1SL 3KJ4B 2FJFB 4LCUA 4LQ1A 4OKVB 4XMPL 3MZTA 2QHLA 1NGWA 4MDIB 4FQJL 2JIXB 3QCUL 5J11B 3I9GL 4JQXA 4XAKE 3F7PC 1KJVA 2FB4H 5GGTA 3V52H 4HWZB 4M6OL 4WU5A 1RIVL 1UXWB 1P4LA 4GUPB 1T7YA 1CLZL 4C83A 1IAMA 5A2FA 2D9QB 5I75C 1QTYT 1VKXB 4W6YB 3ZHDA 5INCB 5BVPL 2D0HA 3SGDH 1KCUL 4MX7A 4KKBC 5IMKA 5DRNA 1A6WL 2X70B 3V6ZA 1DR9A 4PGDA 3H0TA 1YN7B 3KPMA 3MGTA 1N5YH 5EN2A 1AKJA 3CLEL 4EUPG 1MFDH 3QIBD 4RMVA 5EU3A 3ROOA 3LY6A 3GSNL 2DD8L 4NC1C 5HGAB 1NGZA 1ETZB 4NKIH 4WI3A 4EN3C 5E7FA 5K9JH 1OGAE 2A77H 5ADOH 3UCRA 1E0OB 2DWDB 3ZTJG 4XP5H 3IJHB 1KJ2A 3KYNB 1IEBA 3U1SL 5EPMA 2WP3T 1BZ7A 4WWKC 3W9EB 1INQA 2GAZA 3O9WC 4PJAB 2IFFH 5F1KC 3WFEL 4ACPA 5TDNB 4XP4H 3P4OB 3QO1B 5IMOA 1FYTA 5KVFL 4PJ5E 2OCFD 1B0GB 4TQEL 2BNRE 3U0TA 1BMGA 4J3OC 3SDCD 1TCRA 5JR1L 1P9MC 2ICWB 4PRHD 1MFAH 4BZ2H 4PRPB 5D71H 2RBLA 3UZEA 4ZOBA 3EOAB 3OAUH 5H94B 3B9VA 3C2SA 5EU6A 3SOBH 4G6JH 4Z6AT 3BZ4B 2GY5A 3F7VB 1EEZA 2OM5A 4HV8B 4J1UA 5E8PB 2K7PA 4FNLH 3L1OH 4BH8A 3M8OL 3MGOB 4O9HH 5HVFB 1JZ4A 1OCWL 1O7VA 1JF1A 2ZCKH 2CLVB 1NUGA 3FFCA 1FIGH 3O0RL 3LB6C 1JBJA 2XWJB 3B9KA 1J0JA 4DW2H 5T1KB 2VZSA 4Y4HA 4LRIA 2PYFA 3ZE1E 1WFUA 3QWOA 3RVUC 3NH7H 1I3GL 1AQDB 3QWRA 2HFTA 3V5KA 4R0LC 3PL6B 4E5XA 1YEJH 4WEMB 2Y06H 1TZGL 3ESVF 1CFNB 3GSXA 2EYSA 2GYSA 3M17B 3C6LA 1CXKA 3MBXL 1RURH 1JZ2A 4J23A 4R2GD 2NYYD 3DURA 1INDL 1TJGH 3RDTA 2FEDC 1KCKA 5D8JH 5I8EA 4L29B 3FQRA 5IW3A 5EC1B 2H2SD 5IM7B 1MCDA 4HT1L 4NWUL 4XC3L 5TDPA 4KQ4L 3VG0L 2C26A 3W0WA 1YC8A 4G6ML 5EZOH 1M1SA 2D03H 1ZT7A 2JJSC 3T0XA 1JRHL 5DZLA 3ZHLA 4GW1B 4ONGH 3RUGA 1AP2B 3RNKB 1U92A 2CLRA 3MA7B 2BVQB 4RWHA 4GKNB 5B8CA 1BIIB 3FQWA 4LOUC 5GRUH 3MO1B 1KTDB 3S88L 3WXWL 2FD6L 3ARDB 2YRPA 5CEYB 3BW9A 2X6MA 2AK4B 5DD0L 1QR1B 2A6IB 2KPNA 4QOKD 2P8MB 4LSVH 4HJ0D 3FN3A 5CIPB 3BKYH 4EKXA 3VXQA 1GHFH 2MKLC 3GIVA 4XCYB 2NY0C 4G3YH 5ID0A 1Q0YL 1HHIA 1J18A 1NBVH 3ABZA 1FZKB 4WI6A 3DMMB 4Z7WF 5D1ZD 1SVCP 4HWBH 3VXPA 4M7LL 5IOPB 4LK4A 1T1YB 4LIQH 1WEJL 3QUXD 4GO6B 4HS8H 3RTQC 4YFLF 4M1DL 3FQXA 3F6LA 4X9FA 1Y18A 4PGJA 2GK0A 3QEHA 2DI8A 3EJYC 5J06A 2LTQB 3ZTJH 2N1KA 1ERNA 1NMCB 3PF2A 4OLWH 4G43A 1B4JL 4XPGL 3BE1H 4LCCA 5DURD 4JCMA 5INDA 4ZXBD 4LSPH 5I1KL 4XBPA 1CE6A 5DJ6B 5EZLB 3B2VH 2X4QB 4LEXL 2WW8A 5DC0A 1MY7A 3P4LA 4GS7B 1IBGH 4AENA 1QFWM 4QNPF 2G5BB 3DXAD 1I75A 1PKOA 1MHCA 5CZXD 3MLVL 4UNTA 3MV11 2DBLL 2VXTL 4CVZB 5EA0L 4NN5B 3X17A 3VMPA 3ARFA 1KT2B 2NZIA 1LE9A 3EYOB 2K9UA 1XF2A 3LQMA 1L7TH 1KXTB 3MV7A 4S0SD 4ZUSA 1DLFL 3OKMB 4HCRH 3EJJX 5GGSY 4OLVL 2NY6C 5I71B 4ZFZB 3OJMB 3U6RB 2VDRH 4C56D 1GCFA 1WFOA 1FHGA 3FTGA 4MXVF 4JFXB 1FORL 3RVWC 3HMWL 1XF5A 4X9GA 5DGQA 4PJ9D 3QUMB 5DJDB 1DUZA 1WBYA 3L3IB 5DWUH 1K2DB 1MIMH 2EH8L 4HSQA 1WAAE 4A6YL 2A2QT 2EDYA 3NCMA 2BC4A 5DD5H 1MQKH 4HPOH 3EW3B 2X4TB 4PJXA 4EDXB 3UJTH 1BJ8A 1CFBA 1FDLH 1U36A 2XY1A 3DLQR 4ZYKA 3RZCB 3PDOA 3LEVH 1YZZA 3ULVH 2R4SH 2VXVH 4YHYC 4YXHH 5MHSE 3NZHH 4XWOD 4GG6B 1LE5A 3D3VD 3MBED 2VLKD 2X9WA 3NPSC 3VJ6B 3I50H 4NGHH 1EXUB 3ALWA 2KDGA 1D9KA 2KZWA 3AAZA 3PIQA 4KKCC 4PJIA 1MJ7H 4I5BA 1NUNB 1NCCL 4L3CB 3UZQA 3TVMD 4HK0A 4U1MB 4XNXL 5EO0A 4ZS6C 3FT2B 5GGVL 1AGDB 3L3OA 4P0DA 1IKFL 2FWOB 2GITB 4NDMB 4PJFA 5DJ2B 5ACZB 1F11B 2M8XA 1QLFA 3OTTA 4I0PB 1OY3B 1IQDB 1CTNA 1Z0NA 3T0BA 5I16A 3HR6A 1I7RB 4K7PY 3ARED 4XH2B 4HH9B 4N1EA 2E3VA 3RWJB 1JF6A 4NC1E 1WBZA 4PRIA 2A6JB 3QXDB 1NQBA 4U6HA 3CZFB 4MD5B 2DKUA 5LGHL 3KDMA 5CEZE 4O4YL 2DQUL 5GZND 5K9QG 1FV1B 1U3JA 4JHBA 1A1NA 1LK3H 1FCCA 1MFBL 4QHMA 1N59A 4L8DA 1RZ8B 4MNHB 2P7TA 5E03A 4YAQB 2AK1L 3GSOB 2ZJSL 2E9JA 4LLDB 1A0QL 1A3QA 3MLWL 4DZ8A 4JO3L 4LPXA 5HTSA 1E6JH 4WV1A 4ZOEA 3BKCH 1CFSB 1A7BA 4PY8J 1T04B 4Q2ZB 4V1DE 1YDPB 2I24N 4NKMA 1QZ1A 3KPLB 4CVXA 4OIBA 4YC2C 1QLRA 4XPFL 4ZAKD 2YBRB 4ZUVA 3EDJA 4UIMA 1JHKH 3F5WB 2CD0A 4AIOA 1J5OH 3VFMA 1C5CH 2ESVE 2G2RA 3CFCH 2R9HD 5KSAA 1WTGT 1IEAA 4QF1A 1R3IH 4ZO8A 4DKFH 1WIPA 4EDWL 1RZ7H 4EVNA 2YWZA 2Z0BA 2EDBA 4PJ8D 4NM4L 5E08L 2D31B 3U0PA 4JM2A 2BHZA 2WQ8A 3NCJH 1SYSB 1ZV5A 4TNVF 3NCYS 4L9LB 5GSRB 4DVRL 5A16A 2AGJH 2Y5TA 3W11D 1UACL 5C09B 1H5BA 1CDBA 1YEEL 1X5AA 5E99L 4HIXH 1LO4H 3DWTA 4JZJB 4LAQH 4NQSA 3I2CL 1JHLL 4AY0A 5DD1H 5IB3A 4LKCB 1ZE3C 3RVTD 4IBLT 2DICA 1VFUA 3H2WA 2OL3L 4NQXB 3QUZD 4TN9A 3BPLB 3IDIB 4K2UL 3GSQA 3QIWC 1VFAA 1L7IH 3RA7L 4Y89A 5EO1A 1QKZH 4TSCL 5GIRA 3MRGA 5BO1H 5JPMB 1BVLB 3MJ6A 1BVZA 1OLLA 4FQCH 2XTJB 2R4RL 2W0FA 4U31A 1B0WA 4KZDH 3SDAD 4KMQA 4EI6A 3QQ4A 1SY6H 2QHRH 1NFKA 1F6AA 4MB4A 2R0KL 3GMMB 5ENWB 3OF6A 2CKBB 1A4JA 1CLCA 3V8OA 1RFDH 3MV8A 1TFHA 1URLA 3G5YA 5DFTA 3FOLA 4GBXC 4L8BB 3VGBA 2C1OA 4NZUH 1MWAB 4YHKH 2R1YB 5JMOC 4WNQA 2EE9A 1B3JA 2IALA 5CIPH 3W2DH 4PJDF 4XC1H 5HHOB 4EI5A 1UM5L 1CK0H 1G6RL 1BOGB 1U8LB 3RJDA 1AR1D 1JZ5A 5TQ2L 1BZ9A 1TETH 4CU8A 5EU4B 2VLJA 5IKCA 4IRSC 3GKWL 5I0DA 4U1KA 5ICZA 1C12B 5BV7L 3WHXA 1JUFA 1IGFL 1MSPA 3BH8A 3TN0C 2B2XH 3RL1B 4YHNA 4TYUA 4H25B 3N06B 4J6RL 4QRTB 1CFVH 3O4LB 1MF2H 1ZA3A 3NFNA 3UTZA 2FIKA 2VXUH 3FCTB 3QDJE 5E9DD 1UM6H 3P77A 3WFDL 3VGHA 4YPGA 4WO4D 3NTCH 5KBNC 3U0WL 2VZVA 2LAAA 1QSFD 1S7TB 3JZ7A 1MFEH 2UVEA 5JIKA 4JRYA 2C7UA 5LKNA 5DRXB 5DQ9B 1D5BA 1JGLH 5GRZA 2VDQL 3WFBH 4D9LL 5DXWA 1N8ZB 3BX7C 1T22A 3MUGB 2X4OA 4MLSA 5FK9A 1I1FA 4RCAA 3PWPD 1PLGH 3QFJA 3SY0A 5DK0A 1RK1B 5E95B 1IC5L 1EEYB 3HE6A 4D94A 5E8NA 5FIEA 5L2KE 4KKNA 1N5AB 3HZMA 5MEQB 5FYLL 4RAVA 3L5XH 3G5VA 3IF1A 5L6YH 1OW0A 1MJUH 3NFSH 3L9RB 4M48H 4D3CH 1MJJA 2WINB 4IJ3C 3GRWH 4UAOB 4Q9CA 3RP1A 2HJLA 4YDLB 1FE8L 3ARGD 3VFTA 5EZJA 4F7PB 2Q7YA 3MXWH 3MV9D 3ZDXF 2IQ9H 1VGKB 4HX1A 2DOCA 3MPCA 2AJVH 4HHAA 1ACYL 1KENH 4KJYB 3N1GC 1IM3B 3LKNA 3GHBH 4J4PA 4RISH 3RWIB 1Q9KA 1CFQB 3S5LA 3G6JA 2GI7A 2OZ4L 3K3QA 2IAMB 3MRJA 4PGBB 3ULUE 2JJVA 5JOEA 3CFJA 3DRTA 5M7QA 1JHTB 1RJCA 3P0YH 5JHDE 3F58H 1EK3A 1T6VN 4CW1A 5E1AB 1FNFA 2H32B 3LKRA 2Q3ZA 1QOKA 2YPKA 5DUPL 3T8XB 4BZ1L 2FJGB 3D39D 3Q48A 3I02B 3WKMH 4TVSa 1XF3A 4NP4H 4B50A 3QDGE 4OM0L 5EBLA 1CT8A 2Z91A 1EH9A 1X9QA 3EYUL 2GJ6D 1MNUL 1VPOH 3DVIA 4YEEA 5D1QB 1S5HA 4P23D 3WN5B 1JZ8A 1UYWL 4NO2B 4G9FA 1GC1L 1JK8B 3P9LB 1QFOA 1ZLSH 3IU4L 1RZGB 3HN3A 2P5EA 3KYMB 5B38B 4JQXC 4Z7VB 3K7UA 4U6YB 4HCRA 4W6WB 5FEBA 5E70A 4P2RA 4KHTL 4ZDHB 2ENYA 3FT3B 3UTSA 5C0ND 1PFCA 3VWKA 2AKRA 3RBSA 5J13B 4ELKA 3BGFC 1X5YA 4F2MB 5DUBB 4OZ4B 1J8HD 3ZTNL 1OHQA 3VXRE 4NN6C 1JTPA 4HKJB 1A8JH 3KYOA 4AEIL 1WZ1H 1AR2A 1OTSC 2HMIC 4U6TA 3UTOA 4MWFB 5C0AE 5HYJB 1PKQA 3RKDC 1YNTA 4Z8FL 1RUMH 2JIXA 4FQIH 1NGPL 1OVZA 2DAVA 4LLQB 2A0LC 3S7GA 3D0LA 4RFNC 1MHHA 1PEWA 2E7HA 5I8OL 5DRWB 5SX4I 1CL7I 1FH5L 1MFCH 3I6LE 2WQRA 4NCC2 1UXWA 1FYHB 1FVDB 5FCSH 1K4CA 3SGEI 4FTVE 4JFZL 5E94A 4DGVH 2IQAB 3KPSB 2NXYD 3BO8A 3QI9A 3L95A 3BXNB 4MA1B 2UWEF 3BP5B 3AMKA 3MJ8B 3WD5H 2CDFA 2X70A 4OD3L 3MLPA 32C2B 5T33H 3LV3A 2J3SA 2R2EB 3PUCA 1WISA 2Q8AH 4TSBH 4LEOA 3S37L 4B7LA 3IS1X 3UDWA 3UAJC 2BY2A 2GFBA 3NN8B 4HS6A 2DM7A 1EUUA 3S96B 5E5UB 5KVDH 1R24A 1UCTA 4Y19A 4JHAL 3WIHL 1KFAL 3U4EB 5DMGD 1HDMB 5C07E 4NRZA 4QXTB 4WU7A 5EOQH 3D2UB 4MB3A 1WSST 5GRWA 4LGPB 2YKLL 4XPBL 4F7TA 1OSZA 1ZLVK 3CVIL 3W9EA 5F3BB 2ADGA 2P5WE 3K46A 1QNZH 1CCZA 2MHAB 1DBMH 3QXAB 5EO9B 4LPUA 5CMAA 2FH8A 5JQHC 5TDNA 3O2DL 3P4OA 2XZCL 2VZ1A 3IJYB 5GJSH 5E2TL 2ORBL 1B0GA 2VL5A 4YUEL 4POZD 4PJEF 2CKBH 4BM7A 1KTKE 2ICWA 3B9KC 1J05B 4P4RB 4Y4HC 3IRZA 4LRIC 5I1IL 2FX7L 5B38G 3MRLB 4PJHE 1IL1A 2Q76A 4L4JA 2CGRH 3QUML 2XRAH 3VWJD 4MJIE 1BQLL 5EU7C 2XNAB 4MDJA 4C4KO 5HPMB 5FCUL 1AO7B 4FQ2H 2ZKHL 1MCPH 1X5IA 1LK2B 2ZSVB 1RJYB 1S9WA 5FAAA 5F6HI 2D2OA 4W81A 3ARRA 1D5MB 3EYQD 3C6LC 3CFBA 4G6KH 1T2XA 3GHEH 1NMBL 4M7KL 4HV8A 3RDTC 3MGOA 1UFUA 4PJGA 1FNHA 5AZEH 4QRPE 5DJ8A 5FYLD 4HUNB 1IFHL 4G7YH 4PP1C 2CLVA 2V6HA 1VFOA 3MLUL 3MRCB 4HD9A 2Q8BH 1WWAX 3G6AA 1CICB 2X7LA 4YE4L 1AQDA 5DQJA 3IU3B 2PR4H 1NJ9A 4UQ2B 4QGYA 2YPLB 1I8KA 4NM8L 5B8CC 1V8HA 4UB0H 3AMLA 4E41A 2ICEA 1CFNA 5JW3H 2F19L 4JFFD 3M17A 1U2HA 2DLEA 5HYSB 4XXDB 4LLWA 1PDKA 5SWSD 3GMLB 4OLZL 1X5HA 3ZT7A 3NA9L 5F3HA 4M7LT 4D0BB 2GJJA 4KRPB 2X4SB 5KW9L 1DSFH 4YXLH 2PYEB 3ARWA 3O8XD 5L0QC 4K3EH 2ED7A 3ZYZA 2R0LL 1BD2B 4BFBD 1M6OA 1TITA 1H0DA 2WSKA 2P49B 3BIKB 3Q1SH 1OTUD 4LCWE 1AP2A 5FYKE 3P0VL 1QSEE 4OLUL 2YEZA 4Y16B 3QCUH 3HFML 3K81A 1T0NA 5IVXB 1BIIA 1XIWD 2CH8A 1SY6A 1BX2B 2J2ZA 1F4YH 1KTDA 5IEKB 3ARDA 2F54E 5CEYA 4M6OH 3UTPE 2P4AB 5HGDA 3OR6B 3GEWB 5ITBH 2P8MA 5D7LE 5C3TA 1U8OB 2NX5E 1SJHA 3HR5B 4LCCC 5CIPA 1TQCC 4PTTA 4XCYA 1I3RB 3L3HB 5IB2B 4Q0XL 1WIOA 3QIUA 1NKRA 4HC1L 3C5ZA 3DMMA 5CBEB 4YHML 3FO1B 2HLAA 2W59A 4H88H 2QSCH 1I9RL 2W65B 4KVNH 1T1YA 3EO1A 4YBQC 1A3LH 1M7DA 1Z9SA 4YQXL 3ARFC 3T2NH 3SDYL 4P2OB 4M6ML 2EDNA 5IB4A 1WFNA 4XNMB 1S7WA 1OSPH 4RMUA 2AK4D 4S1SL 4HPYL 2H32H 4P57B 1RAMA 1S5IH 3NACL 1JTTA 1GGCH 1AE6L 1FZJB 1MLBB 2HRLA 3KXFE 5F88A 3JTTA 1A6TB 1HWGB 5EZLA 2SEBB 3DO3A 1IM9B 3MOAL 4N0UA 2X4QA 3GBNH 4RGMB 1Q9WB 3RU8L 2AI0H 2YUWA 2C3VB 5D2LE 5J3HD 4UTBL 4OM1L 3W9DA 1MHPH 3EUUA 5FGCB 2DB8A 4KI5C 3EYOA 5DJZB 2EYTB 2FLBT 2PTUA 4X7TA 5J12C 3EFFB 1X4XA 5HYSG 3OKMA 4K7PX 5FO8A 2DQHH 3QCVH 3RKPA 2JCCB 3EOYG 2WP3O 4ZFZA 2BNQE 4CNIB 3HS0B 1HCVA 5F70A 1AH1A 4F7CB 1N7MH 2GEEA 5FM5M 1D9KC 4GRLB 1D6VL 5DJDA 4RIRB 5AAWA 3SE9H 1K2DA 3M8OH 4NKOB 1T2QL 3CH1B 1M05B 2L7UA 1NC4A 2IPUK 4XNYH 1CR9H 1CWVA 3RI5F 5JHLL 3FRPG 2HKHL 3DO7B 4X8JA 3GRWA 2ITDA 4M5YL 3CFKB 5JNYA 1H3UA 4OZGF 1UEMA 3CXHJ 4UIKH 3MRIA 2QQNL 3AGVA 1A7PH 4KUZL 4XPTH 5T3XE 2Z93B 3KPPA 4UV4L 3VJ6A 4L5FH 3K1DA 2XPGB 3PDGA 5E1HB 2OI9C 2XN9E 1INDH 4S2SB 4WFFE 3ZKND 5TE7H 2MSPA 2QKIA 1BEYL 3VXUB 1JYXA 4DCQB 2P8PB 4NWUH 4KQ4H 3FT2A 5D5MA 4CAGA 4ZD3H 1MIEH 3OX8B 3C8DA 1LVEA 3TIEB 4J3XA 2FWOA 3RZCD 3STZB 2GITA 2HG5B 3BWAA 1JRHH 4NDMA 5DJ2A 5HI3D 4PRNA 2NY3C 4XHJD 4WV1C 1OAUL 2XQBL 3GI8H 4W4OA 2IGFL 3DETC 3MLZL 1A6ZA 3C8KB 4AL8L 2FD6H 1R5IA 1GGTA 2CPCA 1YUHA 1TNNA 3U4AA 3DX9B 3FO0H 2ERJB 1L6XA 3TP4A 4X6DF 5ILTH 3MX0A 2RHEA 2CO6B 2VE6B 5KSAC 4CUCA 1YEDB 4MNHA 4LSTH 1MI5E 5EU6E 4P49A 3ZDZF 3HRZA 3LEXB 3PGCB 4AQ1B 4G80B 3QIBA 3EO9L 4LLDA 4HUVB 2WBWB 2AJ3A 2Y23A 4JM2C 5F7YC 1F4WH 3C5JA 4I0PD 1XGRA 4OCSL 1IC7L 3AU1A 3NIGE 1FJ1A 3WE6B 5FECA 2CMRL 5E0QA 1H5BC 4G42A 5EZIH 5HI4D 2YMXL 4L4VE 4Q2ZA 3C08L 4LGSB 4JFYA 1A7NH 2BVPB 3TNMB 3HNTH 5D1XB 4R4NC 3IXAB 4MVBC 1X5JA 3S3PA 2DM3A 4XVTH 1B4JH 4PLKD 1JWUB 1WK0A 4JKLA 3N9GL 4G8GB 4XNQA 5AYUL 4V2CB 1J8KA 4JG0L 3GI9H 4M7JL 1A9BB 3QFDB 2KQMA 4H8WL 1HZHL 5DS8A 2R23A 2EXWD 1LD9A 1MREH 2BK8A 1SYSA 3G04A 1OGAB 4L9LA 4FQQB 4S1DC 4ZPTA 3F62A 3NPZB 5KSBE 1ORQB 4G8FA 3OV6A 3IDJB 5LXGH 4L1HA 2GW5A 2NNAA 2FEEI 5EBWB 1CG9B 3HC0A 3JWDH 4JZJA 1YPZA 5D72H 3RUGE 3DVFA 1A6VL 3D18B 4KTDL 4ETYA 35C8L 1S7UA 4FP8H 3PP4L 4KMTL 4EI5C 4J7RA 2D7MA 4PJ5B 5DUML 2PTTA 3ROLA 1FFOB 4UU9B 1R3HA 2BNRB 4Z7OE 1MCCA 1I1RA 1BVLA 3A67L 4Z7WB 3ORJA 3SDXA 2QV2A 3E0GA 5T1MB 2D7OA 1OL0A 3MRDB 3MRQA 4X99B 3GSRB 2BY3A 1JWSA 1H3XA 1F97A 3D6GA 3GMPA 5C09D 4OBRA 4NO3B 4E0RB 3ECBB 4RAHA 3S36L 3GK8L 3GMMA 2GTZB 3KPNB 1QLEH 3B6SA 4JRXA 3QDAA 3QDME 4U0RC 2FCBA 1MRFL 2R1YA 2RGSA 1LO0L 25C8L 5JO5A 3LD8C 3QA3B 5HHOA 3LS5L 2VLMD 4I3SH 1U58B 3QG6B 4KY1L 3EO0B 1NFIB 3L7FA 4NHUA 1BOGA 1BAFL 1AQKL 1NCCH 4HG4K 1OOAA 4F33B 2OXGA 3V6OA 4CKVX 1BVKA 2APTA 3ULSB 3QNZB 2R69H 2XTJD 5I1AB 5GGVH 7FABH 4WJ5B 3RY5A 3KYKH 3NIGF 3WLBB 3D0VA 2X5PA 4OQTL 1UWGH 5IGXH 1NCBL 5DDHB 2X1WL 2QR0A 1J0YA 3NAAL 3O4LA 3FJTA 1XH3B 4OT1L 3MMEB 2HJFB 3W5MA 2X4PB 2F5BH 1VCAA 1QO3B 1YEGH 3KNBB 3HE6C 4MAYD 5LJYH 1JTOA 5CLTA 2I5YL 2RCSL 4TVPL 1I3VA 5EG6C 1F4XL 1HHHA 1GSMA 3MV7E 43CAB 3DARA 3ILPB 1W0VA 3QPXH 3QQNA 1QR4A 3PWLB 2IBBA 3VFGH 1OW0C 1A7OL 3O6FB 5JW5B 1QVOA 5IFHH 1S7TA 2BX5A 1MCJA 1MCLA 4DN4L 4JREB 2VLLB 5DRXA 5DQ9A 3HRPA 3BKMH 3MLWH 4M61A 4RGOL 4D9RD 3K8MA 1X5XA 1H15A 2IAND 4JDZA 3MUGA 1ZHKB 2JKXA 5EBMB 2V17L 1NCTA 2IPKB 5FHAL 2QJDA 3EYVB 1E6OH 4G6AC 3QH3B 4PJXE 1MEXL 2LQRA 4J4PC 3CVHB 3T4YA 3ZE0F 4RRPA 4HAFA 2JK5A 3QBTB 1QRNE 1UADC 3RIAK 4KK6D 1N5AA 1NC2B 3CC5B 4MS8C 3CSYB 5DHVB 4RFEA 4Z7OF 1P1ZB 3O81A 3MRRA 1G7QB 3FOMA 4LKXB 5C7XH 1VESA 2WINA 4EXKA 5GGQH 4JO1L 3T09A 1BBDH 1XR8A 2ADFH 3EAKA 1SM3L 5FM5O 1XGTA 4F9LA 4F7PA 4PJIE 3D9AL 3HPJA 1NAML 5DD3L 4DVRH 3VFNB 1QFUL 4Z18A 1WGOA 3HG1D 2VNCA 1INEL 3MOBL 1YEEH 3S34L 3FO2B 3RVXD 4MXWH 1JGDB 4NT6B 3PWUA 3GSNA 5KSVB 3IDNB 2BXZA 3BN9C 5EIVA 1OARL 2PW1B 2YD8A 3RIFF 3T65B 4PGBA 3F8UB 3V4VL 1JHTA 4XPHH 1EFQA 3RA7H 4DAGL 3LS4L 8CGTA 2GSGB 3T8XA 3VWKC 3MCG1 4PRIE 4XMKH 2FJGA 5D7IA 3I02A 4YO0A 1KF9B 3CJJA 2HAZA 3M45A 4GXUM 3WV0A 1NCWL 1AXSA 1IAIH 2Z92B 2ZUWA 1L9NA 3RJQB 3V79C 3D85A 1T21B 3C9NA 4OF5A 4YDVB 1GGBL 4YXKL 4K7FA 3QCTL 4CN6A 5IMLB 2X1XR 4U3HA 2R0KH 1I1AB 3WN5A 5ALBH 3QNYA 4J3WA 2YZ1A 3MBEA 5JIHA 1T83A 2VLKA 1JK8A 2IAMD 2PCPB 3MUJA 4FG6D 2HP4A 5J11C 3T2OA 4OFDA 2Y6SC 4ODXB 1F6FB 4G5ZL 3ULVC 4L4TE 4F7MB 2XG5A 4I48B 2CLZB 4ZDHA 4NJ9H 4DKAA 2BVOA 1V7NH 3L3DA 3U9UB 5T5FH 4F2MA 3QI9C 2P44B 5DHYB 4ZQKB 1UVQB 1XZ0B 4YK4B 2OR9L 2NLJA 3V5DB 2YOCA 4JKMA 3GKWH 1A6UL 2Z4QB 2WBJD 2NY4B 2XY2A 3HUJA 1JZ7A 3UDWC 4P4KB 4DOHE 1DBKH 5D1QD 2J8UA 4JAMB 2W9DL 5IW1B 5HYJA 1MCFA 4PJXF 4OFVA 1RD6A 1CGWA 2BERA 3GZKA 3JTSB 4M62L 4YGVB 4KI5F 2FJHB 3P73A 4X5XB 5F7MC 2ZG2A 4PIRF 2GCYB 4OBSA 2BVEA 5TFSL 2DQTL 4TUKH 1SYVB 3VDAA 3WSQL 4NKDA 3H3PL 5AG9A 2F9BT 5DJYB 3WNPA 5CJQH 1DBJL 2DIJA 1QQDA 2ICCA 1FRGL 3BP5A 1PG7H 3E1F1 3MJ8A 3CU7A 4PJIF 5GQBA 3BAEH 2HJKB 5B4MC 2XFXB 3DVNB 4P9HH 2DQFA 2HTKD 4WTZG 4JKKA 4BFIB 2YN3A 3BKJH 1PSKH 3TA3D 5BOZG 1UH4A 4APQD 4HH8A 4UTAL 1DEDA 3BJ91 3VH8B 5F7LB 1V05A 2CXGA 4HUWB 4PB9L 3TT3H 4PJFF 1MH5B 1K8DB 3KR3H 3RWFB 4L3ED 3BDBA 3D2UA 3PWNB 5FGBA 1C16B 2VR4A 4R7DB 4DK6A 1Q9OB 4DUVA 1P2CB 3FAWA 3O9WB 3KPSD 1XGPA 2DQDH 3I6KB 4M03A 5EO9A 4IMKA 3WEXA 3GJEA 4PGCA 4GKZB 5TGBB 3IJYA 4DN3H 7CGTA 1FE8H 4TVPD 3K2MC 3PHQA 1EHXA 1PVHA 4H0HB 4GAFB 1BFOB 3QHFL 2H2PC 4ERSH 5FB8A 2V2XA 3U36B 1W2KT 2A6KA 5GRYA 5KSUA 5FM8A 2IH3B 4V1DB 1YEFH 2G9HB 1X6LA 5LBSH 2QL1A 4LLVA 3MRLA 1XR9A 4CADB 4ZMAT 3VXNB 3KPRB 3SPVB 2JLLA 4Q9QH 2O61B 4OIAA 1OAXL 2ESVB 4CU6A 1MHEB 4JGMA 1CD8A 3R06A 3QUZA 2CJUH 1QYGH 3LSOB 2V5RA 2Y36L 2ZPKH 3C8HA 3CXHK 2BNUA 4CMMB 3DI2B 4P3CH 3BYTA 3EFDL 4X0KB 1J1OL 1Z5LB 3L3KB 1B6DA 2VH5H 3UP1A 4M93B 4JFHD 5FKPB 4Y0GA 4P2QD 2A9MH 4JM2F 4JRYE 5E2VL 2Y7QB 1CICA 4TULL 1OAQL 4LU5L 1G9ML 5HHNB 3ZL4H 3K2UH 1GC1H 1AXTL 4RWYL 3T4AB 2AS5M 3MACL 3ARDC 4D0CB 1RUPH 2PO6B 3AROA 3KWWA 4ODVH 1GOFA 5T5NF 3QFJE 5DJAA 2R1XA 1S9XA 3I84A 5CZVL 1XFPA 2IADB 3P4MB 4LSUL 1RULH 4HDIA 1HI6B 2R2CA 1NKOA 5J9PB 1HOCB 2X4NB 1G6VK 1K6QL 4OGXH 4UT7H 3VH8G 1NAKH 3MYZA 3QIUC 4I2XE 3CPLB 4O58H 1RVFL 4RSVA 1HINH 3DMMC 1CDCA 4Z7UA 2Y25A 4MXQC 4AEIH 3LKQB 4NO5B 2HWZH 3TBYB 3HC4H 3TBWB 4EZMA 2VABB 3BIKA 1WUNT 5CEXA 2ICWJ 1UKSA 3RWGB 2YPLD 4NSKB 1NANI 5D9SB 4MHHG 3MLRH 5DFWH 2OSLA 5E9DA 5IVXA 5DHVH 4BA8A 1F5WA 4M3KB 5JZ7D 2EC9U 2NMSA 4WO4A 1FH5H 1ZA6A 1G9EA 1B9ZA 5L88L 3C2AH 4ZUWA 1TQBB 1CIDA 5E6IA 5JORB 3OR6A 1YJDH 5DJCA 1QSFA 1U8OA 2NY5L 4Y2DB 3IAQA 5TF0A 3HC3H 1KPVB 4LCYB 4JDTL 1I3RA 2NY0B 1PY9A 1S7QB 4RA0C 4CDHA 2WUBL 3L3HA 5IB2A 1UZ8B 3OKKA 1T66D 4FZ8L 3CDFA 3FO1A 1UQSA 4JQIL 1BD2D 2ICES 4GAJH 2IPTH 2JB5L 5CJXA 2X41A 2EH7H 2GQHA 2HTLD 3N0PB 3JV6B 4NN5C 5JW4M 4OZHF 2I9LA 3DYMA 4G7VL 3PWPA 4EXPX 4JHAH 4Y16D 3RTQB 1KFAH 2EKSA 5C92A 3CLFL 4OGYL 4MZ2A 4P2OA 4PR5A 5BXFB 3I6GB 4XNMA 1CI5A 5CSZB 3RPIB 5MP6H 5GZOC 4XPBH 3DTXA 1MUJA 4ETQA 2BMKB 1SBSL 1RIUL 5D2NE 1XGUB 4U1NB 3TIDB 4G9FE 1LNUB 4H26A 2P5EE 2XZCH 1NGQH 4OGAD 4JKWA 5GS0L 4P9ML 2Z31B 4P2RE 1A1MB 1KJ3H 4KROD 5GJTH 2C3VA 4PTUB 3MNZB 5BW7A 5IVZB 4MA8L 2RQ8A 1FZMB 1MPAL 4O2EB 3GSWB 4WHTB 5DJZA 2BJML 2D3VA 2FX7H 4GSDL 2AERT 4OB5L 2APBA 4QHUB 4JN2B 3RWHA 5L2KB 1IC1A 1O0VA 5F1NA 3B4NA 5EOTB 1GL4B 2JCCA 4KTYA 2NY6B 3FN0H 5KS9E 2EECA 4F58L 5KAQF 3U30C 1RZJH 1PKQE 3EBAA 1EFXB 5ADPL 4U05A 5F1IB 1ADQL 1QBLL 1QPXA 2H45A 3QPQD 1N6VA 1NMBH 4P59L 2UWEB 4GW4B 4GRLA 1IM9D 4RIRA 3QJHB 2XZQL 5C0RL 1FO0B 4NKOA 1J1XH 2BSRA 3CH1A 3RHWF 1E4XH 5I1GH 4W70A 5DJ0A 4FABL 2GJ6A 2V7NA 3ES6B 4ZTPH 3NABL 3MFFB 1H3PH 3GM8A 1DQJB 1HWHB 4YHYB 2OJZL 2VN7A 4WWID 2DDQH 5CILL 4W4OC 4Y1AD 3WS3B 4B41A 5JHDB 2F19H 1XT5A 4U49A 2AJUH 4GW5A 3O45B 3G6JF 4QXGH 1U8JB 3QR2A 1TDQA 1KCVL 5HDQH 5JOPE 3QDGB 3GIZH 3VXUA 1FLTX 4HUUA 4DCQA 1LO2L 3H9SE 3OKNB 3SQBA 1U8IB 3OX8A 4JHWL 3EYFA 1U95A 1RUKL 3TIEA 2V9RA 3BUYA 4HZAA 1PAMA 1X44A 2R0LH 2Y5EA 2F53D 3SKMB 5CEZH 3TJEL 3OR7B 4K94C 2FHCA 3H7BA 1A4KA 4OLUH 5DJXB 3U2SA 5J56B 4JVPA 4WI2A 1IE5A 5MI0B 3CU1A 4NQDD 1QFWL 2E7BA 1NBZB 3MLSL 3KYAA 4JJ5A 5IB5A 5DMYA 2B1AH 3MR9A 3VXRB 2J88H 4LSRL 3UBXI 1TVDA 2BSSA 1YEDA 4ZTOH 2BFVH 4JZNB 4JO2L 5HVHB 2HFGH 1RK0A 3LEXA 3PGCA 5C0AB 4HMCA 3CVHL 4QGTA 1VADB 2GY7B 3DBXA 1RU9L 2VN4A 2H1PL 3VRJA 3BGMA 2YUVA 3LN5A 4L9LC 3UTQA 1ZS8B 1HYSD 2BVTA 4PJGE 4GAYA 2XWTB 3WE6A 2V7HB 2EEBA 3SCMD 3P2TA 1U8QB 2GTWA 4GMSL 1GIGH 1HSBB 2BVYA 4JZJC 4FTVB 3TNMA 5HJ3A 3QUKA 2XT1B 2YXMA 4YC2B 1FGNL 3TH4T 3LMJL 1AE6H 3ULVF 3T1FA 4XGZA 2HA1A 1D5IL 2C3HA 2NXZD 4U7SA 3SO3B 1NMAL 5CUSL 1J9CT 3MLXH 3GBML 5C0DB 4E41E 1AXIB 5ETUB 1ZLVH 2AJXL 2OTPA 1JFQH 3E6HA 1A9BA 4RFOL 4R8WL 3GUTA 4HIJA 1SQ2N 5J6GB 2ATKB 3QJFA 2OMNA 4FQQA 3BVNB 4Y4FA 5F9JB 1OLZA 5GGSB 2JF1A 1KTLB 1VHPA 1RIHL 4Q6IA 4UT6H 3VWJA 1EZVY 5E5MB 1Z6JT 2P5WB 2V5SA 4XRCA 4GLRH 1NGYB 2VUOA 4MA7H 1A7RH 2F58H 3D18A 5H2BA 5JA8B 3WFCH 1SEQH 5JPNA 2XKUA 4G8GD 4BSWA 4PJ5A 3C5SA 2BNRA 2IBZY 4ENEC 2VSDA 4LVOC 1T03L 1MRCH 1UB5A 5DT1H 3GSUA 5I1CL 3V6OC 1HQRB 1OGAD 4NQUA 1JPSH 5T1MA 2A83A 2AEIT 2CRIA 2IMMA 3GSRA 1MCNA 4PJHB 3DRQA 1XF1A 1R5VB 4MJIB 1OP9A 4KDTA 4MSWB 3UMTA 5GS0D 1SJVA 2E9WA 3ARUA 5I15L 5LAXB 2VDOH 4NWTH 3LQAC 2DKSA 1F02I 2BRRH 1ES0B 3HI1A 4GBXB 4NHCH 3TBVA 3SE8H 4FFWD 5BRZE 5SWSA 5F89B 1TMCB 2CIKA 4O02H 4QRPB 2VLRE 1FAIH 4KH2A 5E00B 5HGHA 4NQVB 4QRRE 4XPAL 1MCWM 1A14H 3SKNA 5A40E 3TFKD 3T0DA 3VXSE 3QYCA 4KTEH 4IRSB 3GGWB 1ZHNB 3D69A 4FA8A 4WJ5A 3RRQA 5BZDA 2VQTA 2E27L 1MLCB 4XZUB 3B83A 4Z7NE 1RJZA 3TN0B 3CIQA 4HFWA 5K9OB 1OD9A 1EAPB 1S7XA 5IR1B 1XIWA 5I2IB 3O3UN 1WIUA 2BDNL 3HB3D 3MLZH 4NZTL 2HJFA 2HKFL 2VIRA 5EORH 1QO3A 3KNBA 1ZWIB 1QBMH 1CXLA 1P4IH 3Q5TA 4HMEA 3RGVB 3SGDI 4FQLL 2VAJA 5JW5A 4GMTL 5F7FA 2FBJL 1J12A 1V7ML 2OR7A 2WZPD 2R39A 3O4OB 3B5TA 4UAOC 2VLLA 2NY2C 4HIEB 4LCWB 5FOBB 1G84A 1LGVA 1FPTH 3QEQB 3HNVH 4F9LC 4PGEA 3FKUS 3UC0H 1DVFD 3QG7H 2EDKA 4HBCH 1EBAA 2HFFA 2PXYD 1K4DB 3S35X 1I9IL 2V2TA 3DGGB 2F54B 4KJWC 5DVKA 4L3AA 3MRMB 3BEVB 1B88A 5D7LB 5HYEA 2NX5B 5HHPA 4ZO7A 1NC2A 1BF2A 1NCUA 4CL7A 4WW1B 4M5ZL 3CSYA 5L9DH 4YIQA 3O41A 2P46B 1P1ZA 5F7DA 1S3KH 4KPHH 1KB5B 1NLBH 1VB9A 5D7KD 4N8VB 1LO5A 4IJ3B 4JFEE 2L4OA 2HLFD 3CFDB 1KJMA 4JG0H 4LRNH 3TBSA 1P7QB 4XI5C 1KC5H 4H8WH 2I60H 2A73B 4N0YH 5SWQB 3ULUH 2AEPL 3IFLH 2IEPA 3VFNA 4KDWA 3B5HA 4X4YB 5F6IC 4WTZA 5B21A 1YEKL 3AY4A 4GRMB 2YD6A 4K23H 4IRJB 3FO2A 4JFDE 4LDLB 3RBGA 3WN5C 1JGDA 4JZOA 4NT6A 2R2BB 3IDNA 3KXFB 3MBEC 2ITCB 3BP6A 1T83C 1LEKB 3TJHD 1EGJL 3FZUD 4O2CA 1N4XH 3U7YL 4WGWB 3T65A 3WNNA 3BPOC 3LZFH 3PP4H 4TTDD 5SV4A 2AABL 5DUMH 1VGEH 4EQ2A 4QEGA 3WKNA 3L3JB 1XGQB 3OBAA 5BVJB 3BQUD 2XA8L 3A67H 4AEEA 2NQCA 4YFDB 2XYCA 3QEUA 3CSGA 4Y2OA 1HSAB 1FGVL 2C9AA 4NNPH 4Z7NF 1Q72L 4JHZA 3QHZH 1IC4L 3TNNA 3O2DA 4YDVA 1UT9A 1HKLL 5TF1L 2LE9A 2ADIB 2ZCLL 3ZE2E 5ALCL 2X1OA 1RPQA 5IMLA 1MCEA 3GK8H 2BNQB 3R1GH 2GUOA 4LCIH 3VFVA 2EE3A 1XCQA 2WBKA 2EC9T 4LHUD 2PCPA 1A3RL 4NQCA 5DA0B 4X6EB 1MRFH 2FHFA 4ODXA 1GAFH 1KJVB 1RV6X 2R0ZL 2ZCHL 4U1GB 1HHGA 1U3ZA 1WAAA 4WU5B 4XNZC 1P4LB 4C83B 2H8PA 1BAFH 3CFIC 3ARBD 3OJDA 3BGFB 4ZQKA 3INUL 1JNNL 4ODTL 4MX7B 5IMKB 1EHLL 3MRKA 3QUYD 1JGVH 3H0TB 3WS6A 1U3HB 1KXVC 2VDKH 4NN6B 5EN2B 1AKJB 1EJOL 5JXAH 5E4EB 1I1AD 4OTXH 4XP6L 4ZUTA 3EOTL 2LVCA 5F8QC 1EIBA 3ME0A 3JTSA 4YGVA 4JPKL 1NGZB 3O3AA 2XN9B 3WLWD 4RFNB 4AM0B 2RFXA 5GGVY 1T4KB 4N8VG 5FGBC 2I5YH 2RCSH 1KV3A 1SYVA 1BZ7B 1I8LA 1T5WB 5DJYA 3TGXA 1YPZE 5CS7A 5CGTA 4IMKC 4KFZC 4ALAH 2HJKA 4AQOA 2BOBB 3VW3H 4HF5H 1AI1L 1ONQB 3E3QE 4BFIA 5IMOB 2X9XA 5C2BL 1KLUA 2EDEA 5FF6A 5D5MF 3U0TB 3W11C 1BFTA 3DECA 2YK1L 4AEHH 1TCRB 4QXWA 2R56L 5FOJA 3SDXE 1U6AL 5FHAH 1CU4L 4XBEH 3RWFA 3OAYH 4YH6A 1MEXH 3SQOL 3P0GB 4NQED 3C6SA 4QWWD 4R7DA 5CCKH 2X4RB 4HUXB 5DVNA 2MPAL 1YQVL 4PP2A 1CF8H 3RVTC 1HILA 1P2CA 3P9MA 1C1EH 5EU6B 2D4FA 3I6KA 4JRXE 3DX8A 1ZEAH 4DGIH 1EEZB 4OLXL 4KKBD 4GQ9L 3WXVH 5JXEA 5CJOL 1IGIH 4TOYL 1NGXB 3NIFE 5F9AC 4PRBA 3ZE2F 5DLML 1S7RA 2Q3AA 1JF1B 3U36A 1BGXL 3N85L 4V1DA 4LLMB 1G7LA 3B9KB 5CKGA 4XHQA 4EN3D 4Y4HB 2CO7B 2PYFB 1YEIH 1CICC 2FEEL 3QWOB 1OM3H 1GJIA 1T6WA 1EO8H 5HGBB 2O61A 2VDPH 3MCLL 1CXFA 1MCWW 2DI9A 1FO0L 3UYOD 4WWKD 3V5KB 1MHEA 3ZDYE 5J4MA 3GSXB 4WY7H 2EYSB 5GHWL 1BQSA 4ODSH 3MFGB 3JWDC 1UWEL 3SJVD 3DURB 4B5EA 4PUBH 3TM6A 5IHUL 3K1KC 5CWSB 4QOKE 1Z5LA 5SWZD 2EE2A 1C5BL 3FQRB 4KRPC 5KSBB 2YA1A 1FSKB 3GDBA 4UV7L 1BJ1J 3K74B 2X05A 3C60A 5FKPA 1KYOK 4KQ3L 5FGSA 3RWCB 2YRLA 1GZPB 4U6VL 5F8RC 2JELL 2Y7QA 3RUGB 3ARZA 3KPRD 1I8MA 3HCVA 4OV5B 1U92B 1CDUA 1UM4H 5BJTA 2CLRB 3ZO0A 3P3YA 4KRMB 3VE0B 3MNWA 4D0CA 4WO4C 1EBPA 1N64L 1YPZF 4WW2A 2DQCL 4BUGA 2PO6A 3Q3GA 3MC0A 2YC1B 5E6IC 2AJZB 3ET9F 5E2WL 3P4MA 5FYKH 2CK0H 1HOCA 5C0BD 3GIVB 4OZIE 2OS7A 5FYJL 2FSEA 4OD1L 5ID0B 3CPLA 1HHIB 3LB6D 5L0QB 5F9OH 1MOEA 2ENSA 1S78C 4XB8A 3VXPB 3LKQA 4NO5A 3FAXA 5CJXC 3MODL 3TBYA 3CDGA 3RVUD 3DXAE 3O6ML 4MD0A 3RI5K 3OXSB 2ED9A 4M62H 3RWGA 4NSKA 5D9SA 1NFDE 3FQXB 3X3GH 3RNQA 5F96H 4P2OC 3QEHB 4UNVA 3OKLB 3KPOB 1JL8A 3ARSA 2FEDD 3QXWA 4I4WA 5JORA 4G43B 3NCBB 1N0LA 1S9YB 4LCCB 4R4FH 5FO7B 5INDB 4DGYL 4ZPVA 1H8OA 2PW2A 4LCYA 4PJCE 5GGRB 3LAFA 1I8IA 3SGKA 5C0IA 3ARTA 4OF6A 3V2AR 2C4FU 1FL6A 4RGMC 4AENB 1W72B 4F8TA 5EWIL 2IANA 4OCRH 4XVUC 2J5LC 5D7IE 1WF5A 2DL9A 5BW7C 2ZOLB 3BGAA 1LDPH 3QDJA 1NL0H 4FQPA 1MCOH 4OCWL 3ARFB 4X7SH 2I9TA 5T1LD 4LOUD 5HHVH 4OJFL 1XF2B 2Z8SA 3MV7B 5HD8C 5IF0A 3TYGL 4U7KA 1LEIA 1MRDH 3WNMA 2BMKA 4ESKA 3D3VE 4U1NA 3TPUA 2VLKE 5IHLB 5HSFA 1XF5B 5D70L 1LNUA 4GRLC 1T5XB 5E56A 1TZHA 1UWXK 1DUZB 4YBHA 2Z31A 1A1MA 1UGNA 5HHME 5IV2A 5F97E 1G7PA 2BC4B 4OF3A 3T3PE 1EMTH 4PJXB 5IVZA 4ZYKB 3RTQD 1CZ8L 4WHTA 4PREA 3PDOB 3SDDA 4JN2A 5J12B 3HUJE 3IAGC 3EJYD 3SGJA 1KCLA 5EOTA 5IQ7L 5LWYH 2DQJL 2J8UE 1LE5B 4RMTA 3MCKA 1EFXA 5DK2A 3O2WL 1QA9B 4GKSB 4N1HB 4JB9H 1D9KB 4PJIB 5E8DL 3CMOL 2VXQL 4F37K 4YHPB 2B0SH 4WIQA 1RZKL 1UCBL 5I8CA 1KGCD 1DBAL 3DYOA 1G7IA 2E6QA 3H42L 1MJ8L 5T3XH 5EO0B 3WIIH 1CFTA 5TE6L 1QRKA 3P11L 2W38A 3MFFA 1P6AB 4OFYA 12E8H 5F9WB 5L2KD 4NZDA 1QLFB 1DQJA 3IDGA 4AMKH 5IEHA 4H1LA 4QO1A 5I16B 3MSPA 2NY6D 3BIBX 5JHDA 2EDJA 1A2YA 3TCXA 2QQKH 5JUEH 4POUB 2KQNA 3LQZA 3RVWD 4YGAB 1WBZB 2ZSWA 4PRIB 3BRDA 2YZ8A 3O45A 4U6HB 4A2LA 5C6WH 4K7PL 3TWCH 5FYJU 4FXLA 1BFVL 2JB6A 1J7VR 1KLGB 3QDGA 1A1NB 4UINH 4OCYL 4QHMB 5I8KH 1N59B 4L8DB 1U8IA 5HHXL 1OF2A 2P7TB 5KVEH 5T3ZL 5KVGL 4EOWL 4Y5XA 4IHOB 2J4WL 4DZ8B 4MNGA 5CHNB 3R8BB 2NY3B 3OR7A 1T0MB 2XZZA 4WV1B 2V5TA 3MYJA 1KBGH 1EZVX 4L4TB 5BV7C 1E4JA 1Z9MA 5CGMA 5D7JD 4YJZL 4OIIH 1HXMA 4RZCA 4FFYH 4PS4H 4JFOA 1SJEA 4NKMB 1QLRB 1WVZA 5K9QI 4ZUVB 3QP3A 2BY1A 4Z7VF 1HHJA 3VXRA 4I0CC 2IBZX 3OHXB 2O5YH 3E8UL 4ZS6D 3VFMB 2G2RB 5KSAB 4DOHB 3A6BH 3N1MC 1IEAB 3KPTA 4QF1B 3TA3A 1G1CA 4K07A 1QP1A 5C0AA 1TJHL 4XAWL 4N5EC 3BSZH 3U0PB 4R26L 5J7CC 2JB5H 4JM2B 3CH8A 3UO1H 3V4UH 5CGYD 3BP7A 1ZS8A 4Y4FC 5A16B 1KPRB 4P9HC 4Z95H 3ZYIA 5FYJD 2V7HA 4X7FC 1TJIH 3QZWB 1C08A 1H5BB 2J8UF 3CLFH 4OQTA 4U6XA 1KB5L 1KELH 1NCAH 4Q6IC 5SX5K 3VWJC 4YHLL 2OQJA 3H9YA 1OTTD 4FTVA 1I1CA 3SKJH 4NQSB 5IB3B 1BIHA 5A1AA 1T80A 4XMLL 4HZLB 4I18B 2QTEA 4LDOB 1VFAB 4PV9A 4M43L 5EO1B 4Z0XB 3TV3L 5GIRB 3MRGB 4JPVH 3RFZC 4LSSH 4P9MH 4Z78A 2QSQA 2AXHA 3EDFA 2ATKA 4OCNC 1Z9LA 4IDLA 1DL7L 1G1YA 5C07A 4O2FA 1KLFA 1NLDL 1BLNA 4OB5H 1KTLA 4KDTC 3LKSA 3QQ4B 4AG4H 5IVOA 1J11A 4BELD 5E5MA 3MJ9L 4MCYA 4Z0BL 3RQ3A 2VISB 3FOLB 4F58H 5I1JL 5CJ5A 1T20B 2C1OB 2VDLL 1P84K 4GRWE 5GRVL 3A0OA 4WNQB 1KN2L 4KWUA 1HIML 1X6NA 5C6TL 5E9DE 4EI5B 5D93C 5DR5L 4RMSA 3O6KL 1YYLH 4MQXC 3FFDA 5HI5C 4HKBA 5C0RH 4FFZH 2OYPA 2W9LA 4GQPH 2H3NA 5FKAA 5DVOA 2VLJB 5IKCB 2IFGA 1QSFE 4PLJC 4PJHA 1FP5A 4P2QA 5ICZB 3Q6FA 3M1BB 1UKTA 1R5VA 4MJIA 1RJLA 4YBLB 3TYFB 3WHXB 4M8QB 5GGTL 3BH8B 1OTUC 2X4UA 1AY1H 2C4XA 4YHNB 4HWEH 3D5OF 1MCIA 2DRUA 1OPGH 5CILH 4NJAL 3OJ2C 2V2WA 1EPFA 4NNYA 4KAQL 5C0FB 2WNGA 1YNLH 3R4DA 2VDML 4JO4L 2F5AH 2F74B 3O3DA 3TBTA 4QRUB 3LD8B 3PWPE 3P77B 1R3KA 3QIWD 4YPGB 4QRPA 1GC1C 4N90D 3P40A 3U9PH 1W72H 3O6FC 4OI7A 3CZJA 1E4WH 4MAUH 1LO3H 3OB0K 4JRYB 3DX7B 2C7UB 5L7XL 2R1WA 3JV0A 5I76B 3QZWG 2GJZA 4BFGA 4TNWK 6FABH 1MLCA 4TPRL 1RZFL 1HQ4A 2YR3A 5TE4H 4XNUH 2EE6A 4M1CC 3IYLW 1KJ2L 5J6HB 4MJ2A 1OT2A 1T22B 5K9OA 1CLYH 1RUQH 2X4OB 3MV9E 5F71A 1EAPA 3BOVA 5FK9B 1JZ6A 5T5NG 4Q9RH 5I30L 1ZGLB 2AQ2A 3DSFL 3QXUA 3QFJB 4N8CL 3SY0B 3JWNC 5DK0B 1FNSH 5SX4H 1CL7H 1TTFA 5FHBL 3HE6B 3X3FL 2IH1A 5E8NB 4C4KT 4KK8D 3MLSH 3RGVA 5CKAA 4RAVB 4MNQD 4I2XB 4BFEA 4UT9L 2EDWA 1YMMA 2HJLB 2NY7H 1YJDC 3UTTA 4HIEA 4LCWA 5FOBA 3IT8D 5DQDL 4G9DB 3N1PC 2YA2A 4YWGL 1QSEA 3VFTB 3D39E 2B1HL 5F1OB 1ZOXA 4Y4KA 2P42B 5TPWL 4HX1B 3DGGA 4Z7UF 1WCBA 2F54A 4HHAB 4R3SB 3T0ED 3MRMA 3AY4C 2YD3A 3LKNB 5T3ZD 2GJ6E 4RAUB 4GMSH 4UI2A 1CDYA 2J12B 3BDYL 3REWA 3VFSA 2NX5A 3F7QA 3S5LB 1EVUA 5IVXF 1YY9C 4WW1A 5MEOA 4LDEB 3BHBA 3DRTB 1CIUA 5BCAA 4N8VA 4DVBB 5KJRL 3LKRB 1G9NH 1NUDA 2YPKB 1D5XA 5EUKA 2COQA 5FA4A 1P7QA 3DUSA 3QEQD 4HGMA 4P5MB 3BZDA 1X5KA 4IRZH 3F6IA 1JNLL 3MJGX 4X4YA 5EBLB 1J8HE 3UYRL 1CT8B 2Z91B 1LP9A 4J3TA 1A1OA 5IBLC 2H26A 4IRJA 2VWEE 4KXZI 4U3CA 1BBJA 2R2BA 1BF8A 3KXFA 5D2NB 1JMZA 1DQMH 1LEKA 3X13A 4G9FB 4KU1A 4CRPA 2P5EB 2FO1A 4P2RB 2D4DA 4CMHB 5EOCL 1RZJC 5D2LA 3VWKB 5BVJA 1B6UA 3S8WA 4ELKB 2O5ZH 3B3IB 3BZEA 5IESL 5ABDE 3K4DA 2VITA 4HUKB 3RVVC 5DYOA 1F90H 3GO1H 3ZYOA 1F8TH 3WS6C 2NY4C 2UV3A 2V5YA 3PE9A 5DMIL 2ADIA 4H20H 4HK3J 4P4KC 5HDOA 5KS9B 5DD6A 4IIQA 1OGTA 2BCKA 3IDXL 3UXFA 1PKQB 5F93C 3VXOA 4GOSA 1BZQK 1U42A 1YNTB 2OP4L 4NC0B 3IFNL 4K8RH 4X6EA 1KPUA 2NTFB 5HHQA 3D0LB 1MHHB 2APFA 2DQEL 2BSTA 1M7IA 2JCCF 3UJIL 1K4CB 3QAZB 4WHCA 1I8LC 4FQXB 5E94B 3QI9B 3BO8B 3L95B 2WV3A 4M6NH 2C4FT 5IP4A 2I25N 2CDFB 4LLYB 1X5ZA 3V4PH 2W9EL 2Y72A 3LV3B 1U3HA 4FXGB 4LEOB 2QSVA 2F53A 4KK5C 5DRZB 4RGND 1OAZL 5E2UL 2GFBB 3FL7A 4HS6B 1ND0B 3S5LG 1IAIM 5IFAL 1R24B 4AK1A 4Y19B 3PGFH 4I3RL 4NZTH 4OAWA 2XN9A 5IQ9A 4HXBL 4KV5E 1Q0XL 5T1DH 4NRZB 4WU7B 4AM0A 4NQDA 5I18L 1T4KA 2WWKT 3IGAA 5CJ8A 1ED3A 1EO5A 4F7TB 1OSZB 2BHUA 2FX9L 2CXKA 2ADGB 3H9SB 1T5WA 5I19L 2FBJH 4PJAE 5CMAB 4OFKA 5JXEC 2Z35A 1EAJA 4PJ7E 2BOBA 1ONQA 2XI9A 2YD4A 4LASL 2VL5B 3BEWB 5FYLE 3W39A 1PZUB 2W0LA 3RKDD 3AS3A 5J89A 3MLYL 2A0LD 5F7NC 3OZ9L 5IJKA 1YQ2A 1J10A 3EDEA 1IL1B 1Y0LB 2Q76B 2QADD 3FT4B 5I1LA 4MDJB 2MQ3A 3UPAA 2X4RA 4HUXA 4AH2A 4BKLB 5I1DA 1S9WB 3NOIA 3HI6L 5BS0D 4PB0L 1MI5A 2AW2A 1OP3K 3CFBB 3BJLA 1CLOH 4JFFE 2NY1B 1FIEA 4XWGL 4JN1L 4X8XA 3FO9A 4OFPA 3EZ8A 2O5XL 1B0RB 5IROA 3T3MF 1NGXA 2CQVA 2QQLH 1KEGL 4LMQI 4KZEL 3UAJD 5SWSE 1FYTD 1VSCA 4PJGB 5DJ8B 2AXGA 3O2VL 4M93C 5F1SA 2PF6A 3OKEA 2B7DT 3BT2H 3C60C 3IETA 4YX2L 4L4VA 4LLMA 2PTVA 5HBBA 3G6AB 2X7LB 5HGBA 4OSUH 4ONHA 5FUOH 3CXDL 5DQJB 3LKOB 1NJ9B 3O3BA 1I8KB 3U7YH 3NFPB 4E41B 5KTEL 5EU6D 2ICEB 2AJSH 3UJJH 4WW2C 3LH2H 1ZK9A 2YHGA 1FQ9C 2PO6C 2HH0H 4LLWB 2Q6WA 1DQLH 3Q5YA 2WANA 4HFUH 1UZ6E 5CWSA 5F3HB 3JWOH 5KSBA 3FFCD 1HKLH 4JPWH 2XA3A 3N1QC 3RWCA 4F57H 1E27A 1U41A 5FUCE 4Y4HD 1GZPA 4JY5L 1M6OB 1H0DB 4TSAL 4ODUA 2G60L 4C58B 4Y5VB 4OV5A 2BSED 1PG7X 3QWRD 4JR9H 2CRZA 2YEZB 1T0NB 3VE0A 5FO9A 3BFOA 1EX0A 3C6LD 4WI9A 5IBUB 5HGDB 1TQBC 2YC1A 3RDTD 2AK4E 2AJZA 4Y88A 1VDGA 4ISVB 1SJHB 4Y2DC 4RQQA 4UZGA 3EYSH 3CX5J 1JJUA 4PTTB 1MFNA 4PP1D 1EHLH 3SGKC 4OI9A 3W0WD 2VDNL 3QIUB 4XCFL 4XX1E 3C5ZB 3U83A 1EJOH 2HLAB 5LQBH 3QDMA 3HNSH 2XXCB 3EO1B 5E8EA 2DYPD 1BPVA 3OXSA 3HE7B 1GZQA 1M7DB 4JPKH 1UH2A 5EIIA 5AUMA 3QEGH 5CSGA 1NEUA 2EYRA 3H3BC 1YEHH 5JMRA 2FB4L 1IQWH 3V52L 1HH6A 2VLRB 5IB4B 4XP9L 1S7WB 3OKLA 4KK6C 2YSSA 3KPOA 5I74B 1UH3A 2HN7B 1JNJA 3VXSB 3CDYA 3W81A 3L3GA 2A74A 1ITCA 1S9YA 1Q94A 5F88B 5FO7A 1OD7A 3JTTB 5CP3H 1OWRM 2W0PA 5GGRA 1N5YL 4XCNA 4X83A 2HT4C 4N0UB 2N4IA 5DHXB 1NSNH 1MFDL 1DVFA 1W72A 2Z31C 1HNFA 2VB5A 4J3UA 4D9QD 5I9QC 4M3JA 2PXYA 4ZFFA 3ZE1F 4S1RH 4NKIL 2ZOLA 3W9DB 2K1MA 2R56H 5K9JL 1S9KC 2A77L 5ADOL 3SDDC 4KHXH 4FOMA 2ILLA 5F7EH 3R8QA 4X7TB 4XP5L 5IT2L 3SQOH 4JM4H 1VACB 3SGJC 5FO8B 1LEGA 4BQBA 4ONFH 4FRWA 2IFFL 2V9QA 1P69B 1UZ6F 4XP4L 4Z7QE 2FGWH 4NQCE 2XKNA 1T5XA 3MUHL 5CD3A 5IHZA 1NC4B 3NMEA 4TUJA 2VQUA 4ZFOA 1CQYA 1JGUL 4UILH 4X8JB 4CVWA 1MFAL 2DKMA 15C8H 2ITDB 1YECH 3L6FA 4BZ2L 1RZIB 3ARFD 5D71L 5JNYB 4H8WC 1LQSR 4QCIB 1QRNA 3MRIB 3S6CA 3OAUL 4W68A 2M26A 4U1JA 1KOAA 4HKZA 3ULUC 5IBUG 3MCLH 1U8MB 3U82B 1V3LA 3SOBL 2UZYB 4G6JL 2DQGH 3U30B 3CFEA 1LILA 5LCVH 3KPPB 5GHWH 1IGCL 4FNLL 1QA9A 2QQQA 1NH6A 3PG2A 4GKSA 3BQUA 4YHPA 4O9HL 1BQHA 4OCXL 5IHUH 1YYMH 2AJYH 1VFBA 2QKIB 2ZCKL 1C5BH 1EDQA 1GGIL 3LEYH 3U4BH 4UV7H 5D5MB 5IBTH 2D0GA 4X4MA 4DW2L 4JFDB 5CINH 4KQ3H 3BWAB 4KI5D 2UZIH 3NH7L 4Y5XC 4ZOCA 3CMGA 3B8SA 4PRNB 4QHLA 2E7MA 5DEFA 1YEJL 1QSVA 2Y06L 4X98A 5C0CD 3VG9B 1RURL 1A6ZB 3IFPB 4JKPH 1TJGL 1R5IB 5MI0C 4MJ5A 2R0WH 3WUWA 1YUHB 4DZBB 1X4YA 1QG3A 4OZFH 1KLGA 3QUYA 2ID5A 4MZ3A 2R8SH 4ZO9A 5HPOA 3TT1L 4F8QA 3W82A 5HVHC 2D03L 1VENA 3DI3B 3HRZB 4ONGL 1FFQA 3QIBB 4IDJH 1ZMYA 1EO7A 4PG9B 3VXMD 4IHOA 2AJ3B 2YS4A 3O6MH 5CHNA 3C5JB 1T0MA 1XGRB 1U91A 3AU1B 5B22A 1FJ1B 4L4TA 4IOFD 5GRUL 5FECB 3V7MA 4G42B 1I7TA 1NBYA 5ACMA 4JFYB 3THMH 4GKOA 4HBQA 4LSVL 5FUZH 4Z7QF 5GXBB 3OXRA 4X6CA 2W60A 3BKYL 3OPZL 1GHFL 4ZFGH 3SO3C 4G3YL 1I85A 1M7XA 3OHXA 3FB8A 1WAAF 5GS2H 4XNQB 1NBVL 1UA6H 4LARH 3MRPA 3CK0H 3WL9A 4HWBL 4GXVH 2VXSH 5DS8B 2R23B 4WCYH 1LD9B 1FLRH 3SDCB 1FFNA 3G04B 4LIQL 1Q1JH 4LNRB 1KPRA 4ZPTB 1W0WA 3SBWA 5GSVA 3QZWA 1REIA 4OCWH 3DETD 4DEPB 4G8FB 4GJTB 5C09E 2NNAB 3MOQA 1FFPB 3HC0B 1YPZB 1F58H 5EULV 4YZFE 2B39A 4PBWD 5FDWA 5H37H 1BWMA 1JIBA 3BE1L 4LSPL 1Q8MA 4HZLA 4R97B 1S7UB 4I18A 3S35H 5KSAD 1I7ZA 4WRLA 4MQTB 2PTTB 1KN4H 4Z0XA 1IBGL 3ROLB 1R3HB 2FRGP 1U8KA 4DQOH 3IXTA 4M1GH 1R0AL 2NZ9C 1IT9H 3SDXB 3QQ3B 4ZSOA 4Z5RB 2P24A 3WFHA 3MRQB 5GS1B 1JWSB 2XTJE 4NO0D 4U7MA 4HIIB 5D6DA 4DKEH 3GMPB 1L7TL 4CGTA 3MA9H 1I3UA 3C87A 4PJBE 3HI5H 2VDRL 2EIZA 3B6SB 4JFPB 2KBGA 4WWKA 4JRXB 4R4ND 2VISA 1AIFB 1QPPA 1T20A 4MVBD 4U4BA 3VI3E 4EBQH 5CFHA 1CXHA 4IMLA 4R2GB 3SJVA 5JO5B 5K59E 3OSKA 4ODWA 3O2WH 5DWUL 1MIML 3L7FB 4NHUB 4V2BA 4LVHB 3U79A 5SWZA 4LVOB 1RZKH 4NPYB 5I73C 4G8IA 4ZUUB 5DD5L 1IAII 1MQKL 4S1QH 4HPOL 4QTIL 3T0WA 4OCMC 1BVKB 5EUOE 1CE1H 3UJTL 1FG2A 2VC2H 4QY8A 5TE6H 4QHKI 3P30H 2K3TA 5E6ZA 3B2UC 3LEVL 3M1BA 4L8SA 3KPQA 3TYFA 3ULVL 3D0VB 2R4SL 4M8QA 3TO4D 5JQ6L 4YXHL 3ZLQC 1RUAL 3OF6D 3NZHL 4D9RE 2QR0B 3MV8D 1G7JB 4J12A 2IANE 1L0XA 3PQYD 5C0FA 1RMFH 3GB7B 1ZVSA 1FN4B 3DIFB 5FV1L 4JANA 2F74A 2C1PB 4NGHL 2XZAH 4QRUA 2HVKB 1MJ7L 4LAJH 1YNKH 5D4QA 4XVJH 1HHHB 3RGVC 1W0VB 1QVOB 4OCYH 2VLJD 1OQXA 1T66C 3DX7A 3O4OC 2EDLA 5I76A 2DLGA 4QT5B 2Q20A 1AFVH 4JY6B 2C3GA 4WFED 4EOWH 4WUUD 1CGTA 4M61B 1H15B 5J6HA 1PYWB 3QUXB 1CTOA 4JDZB 4Y4KC 4AYFA 3UEZA 3P4NB 3FMGH 4BH7A 1KCSH 4HQQH 2AEWA 1ZGLA 2VJXA 3HG1E 2JTDA 3AC0A 1D3CA 3BZFA 3T4YB 1BWWA 2DLFH 5IUSA 3LHPH 2JK5B 1IGJB 4Q7DA 4KRNA 5DURB 3T2PA 5D7SL 1LK3L 1N3NB 4RFEB 4I2XA 3MRRB 1F42A 3FOMB 4WW2F 5CZKA 3VGAC 2ARJA 2P8LA 4FHBD 3J8F7 3DXAB 1XR8B 2BXYA 2NY2B 2UYLA 3OB8A 4G9DA 4XAWH 3QSKB 1XGTB 2MCPH 4OV6F 1E6JL 3AXLB 2RIKA 3BKCL 1NFDB 3HPJB 4FMFA 1A6AA 2D7PA 5T1LA 1CGYA 4NZRL 4DUXA 3VGFA 4R3SA 2WIMA 4IRJC 4RAUA 3VI3F 5AAMA 3PWUB 3GSNB 1JHKL 1JNHA 4P5TA 4PJCB 5GISH 4H0IA 3QO0A 1J5OL 3QPQC 1IGMH 1C5CL 3CFCL 4GAGH 4ZOAA 5HVWA 2F8OA 1R3IL 1EHAA 1KEMH 2WUCL 4DVBA 1PZ5A 4I0KA 3DGCR 4YFLI 1A5FH 1GPOH 5D7IB 3V0WH 1GRWA 3NCJL 4ODHH 4YO0B 4P5MA 5CP3A 2AGJL 1AXSB 3O3EB 4OLYH 1NCDH 1QD0A 1UWXH 3D85B 5DO2C 3C9NB 4H5SB 5F6IB 1BJMA 1JPTH 3QRGL 3ZKXB 2CDGA 3C09B 4HIXL 4K7FB 3WJJA 4G6AD 1LO4L 4LAQL 4IIQC 4J4PD 1DBBL 4XBGB 5DD1L 3QNYB 3E6FB 2FZ3B 3D3VB 5D2NA 2QSTA 3MBEB 2ZNXA 4MNGE 1MQ8A 2VLKB 1FVEA 4MS8D 1L7IL 3FB5A 3VRLE 3BPOB 1QKZL 4U1GC 2NCMA 2FATL 5BO1L 5HHMB 2BVOB 4ZS7H 2R29H 3TVMB 3L3DB 3G6DH 2OX5A 3B3IA 4AZ8A 4XCCH 3MXVH 4FQCL 4M4RA 2NLJB 1OAKH 4U1HA 5C08D 4XP1H 1U3YA 4K94H 4R6UA 1U3HC 1F3DH 3HUJB 1SY6L 2QHRL 2IJ0C 5E4EC 1EEUA 3K4ZA 1CYGA 5KS9A 2J8UB 4RRPG 4QXUH 3TZVD 5LGKA 3S97C 1KIQB 4RMQA 4HG4J 1XGYH 5TDOA 5EFIA 3CX5K 3AREB 4NZUL 4KAQH 5I66B 4YHKL 3P73B 3W2DL 4XC1L 3AVEA 4KJQC 2NTFA 5HXMA 1CK0L 4L3EE 1K5NA 4BUHA 1QFWI 4XNZB 3UTSD 1GOGA 3VWKD 4NKDB 2ZG1A 4FQXA 1CGXA 1QQDB 1UB6B 2YWYA 4HGWA 5DEZA 5DI8A 4LLYA 1C7SA 4N0FA 1SBBA 2DQFB 4FXGA 2A1WH 5DRZA 2B2XL 4TRPH 1RZFH 4TVPE 5CBAA 5GGRY 3STLA 5DZOA 1CFVL 1ND0A 2Q86B 1MF2L 5D7JA 4U0QB 2VXUL 2JIXD 3F7RA 4MCZB 4HWNA 1UM6L 3DSFH 1KCRL 2Y6SD 5KG9A 1T7ZA 3HZYA 5IJKC 3ULVD 43C9A 3ULUF 5AWNH 4BSJA 4QRSA 3ELAT 2X89A 3X3FH 3ZYJA 2G5RA 5F72S 4KVCH 3H9SA 2ARJQ 3QI9D 1MFEL 1XGPB 4M8VA 1P4BH 1K3ZA 3WEXB 3LRSA 5ISZA 4UT9H 3GJEB 4PGCB 4ELMA 1JGLL 3FB6A 5IROC 3PHQB 3WFBL 4YDIH 4OZFA 4UMGA 4ORGA 2FDBP 1R3LA 3BEWA 5FB8B 2V2XB 4WUKL 1H8SA 2A6KB 5KSUB 4Y19D 1PLGL 4NRXB 1JI2A 4JFHE 1RHHB 4LLVB 5ESAA 1XR9B 2Q1EA 4P2QE 3EGSA 1Y0LA 3FT4A 3VRLF 2EDQA 4Z76A 3L5XL 4BKLA 5L6YL 5SX5H 1MJUL 3R06B 3LIZH 3QUZB 3NFSL 3ZKMC 4X7DC 1NDGA 4M48L 4D3CL 4IOIA 1EEQA 1ZHLB 2BNUB 4J3SA 5B4MD 1DLHA 4I77H 4OI8A 1B0RA 4O51B 1U93A 3MXWL 1N6QH 4LVNC 1I4FA 5JLZA 2IQ9L 2AVGA 1FSKC 5MERA 5ITFB 3SDAB 3KLAA 2AJVL 4ZNEE 1KENL 3CAFA 1PY4A 3LQAH 2Y07H 3IDMA 3GHBL 1G7MA 4RISL 4PRPD 4B7IA 3X12A 2B8OT 5EBGA 3MUZ1 2I27N 3MRFA 4QHNA 5E4IA 5HDBE 4K55A 3LKOA 2VL4A 3NFPA 3RAJH 3P0YL 3F58L 4FFVC 2BVUA 3KWWB