4PGEB

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgnypaw
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/peptide
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgeB00
3QWQB 4HWZA 4NM8H 3TCLB 1RZKC 5JW3H 1P53A 2AJVL 3QHFL 4YUEL 3MROA 5GGQL 1DQMH 4XNZC 1BF8A 2DKMA 2N4IA 3RHWF 1YEDA 1D5IL 1BOGA 1KTDA 1FN4B 4LARH 4G9FD 3QXVA 2UWEB 4PJFA 1CFBA 3T3MF 2E27H 4Q9QL 5ALBH 1IAIH 1SEBB 1OSZA 2FX7H 1RUPH 2FL5B 4YIQA 2OR9H 1LEIB 1IFHL 3ZE1E 3JWNC 2A0LD 5IBLC 5DWUH 3TO2A 3NCYP 2DQUL 1B0GB 3MLSL 3FONB 3V5DA 3O3AA 2C1OB 4JO2H 2BY2A 1S5IL 4E42B 2F58H 5E5MA 4OF8A 4Z8FL 1UH2A 3MJ9L 5SX4I 3WLBB 2QV2A 3WD5H 4WO4A 3L95B 4QHLA 1F13A 4HKJA 4PRHD 4KRPC 3WIHL 2QQKL 5DMGC 4WI3A 4UBDC 3GRWA 2XXMB 4KHXH 1IAMA 1TNNA 1G6RB 4WO4B 4E9LA 1AO7A 4JFFE 2XWTA 1IGJA 4RNRA 1KPUB 4NUJB 2FJFA 1KOAA 5IMOA 3QXDB 4ONFL 1P1ZB 5D7IF 2YPLE 4E42A 4Y5VB 2Y7QB 4QOKD 4Y4FB 1QBML 1EHNA 4N90D 3BRGC 1QFOA 1MCDA 5J1SC 3L5XL 4UU9B 4LVHB 5D70L 1CFVH 3TC9A 4RAVB 5DUPL 5IOPB 4QRUA 3MCKA 1I4FB 3FQTA 1CXHA 3ARYA 3MJ9H 3SDDD 2H32A 1BOGB 2D0GA 4OZFB 4NZDA 3S88H 2FHBA 1YEIL 3S34L 4FNLH 25C8H 4PLKC 5TE6L 4FQCL 4JRYE 3THML 3QT2A 4PV8B 4ZTPH 3D0LB 5DURB 1RULL 1ULVA 2HJKA 3OKDB 3VFMB 1R3HB 3ULVE 3OAUL 3U4EB 2D7PA 2HA1A 3K4AA 4G43A 3L7FA 1R3KB 3UTTB 1NCDL 4H25A 4O4YL 3LPFA 2BP3A 4ELMB 1RY7B 4N0FB 3F7VA 1FZOB 1QBMH 2VNCA 5L8KB 4H0IA 1IC7L 3L5WA 1CFTB 3HR5B 2W0FA 3C6LA 1U95A 2UWEE 3GSRA 4Q9BA 3MLXH 3V4PL 4ZSOE 1I1AC 5ACZA 2AJ3B 4D2NA 2VH5L 4GAYA 1H8NA 2N1KA 4IMLA 4R97C 4PJDF 1X5JA 3QUML 4ONGH 1D5XA 2LVEA 3QQNA 4H0GA 4WUUA 1CGSH 1CZ8L 1RZIA 4C83B 2FH8A 5F97E 3UZVB 2FJGA 3U0PB 2QHRH 1YECH 4S1RH 5K9QI 3G6DH 3HI5H 3MOBL 2GSGB 4M02A 4JFFD 3HS0A 3LEXB 1U0QA 3IU4H 5J3HD 1CD1A 1QOKA 2V9RA 2NY0C 4DVRL 1CL7H 3MYJA 2XY1A 4HUWB 5TF1L 1EFXB 4ZO9A 3EDJA 5IW6A 5I6XC 5IVZA 5F9AC 2OTWB 5ETUA 5I1DB 1OAYH 4XI5C 3L5HA 4I18A 2G75A 3MRQA 2QL1A 1NDMB 4MJ4A 1WZKA 3ZT6A 4NZRH 1A9BB 5IVXE 1XGYL 1EMTL 5HYJD 1URLA 3D0VB 3SGEH 4M5YH 3RWJA 2AERT 5IJKA 5IFJA 3RBSA 4WWKB 3DVNB 4YHIA 4PLOB 5FKPB 1AXTL 2Y36L 4M7LH 3ZDZF 3W81A 2E5EA 1WCQA 3HKFA 1U8IA 3ORJA 1L9MA 4WI4A 3MNVB 4B5EA 4EUPH 4C56A 2R0WH 4I1NB 1NGPH 2F53A 1A0QH 4ZSOB 2J6EH 2ZPKL 3LSOB 4JPWH 3AGVA 3PV7A 1S3KL 3PGFL 2HG5B 1A7PH 4OM0L 4NO5B 1J8HA 4GMTL 1X6NA 2N7BA 5D1QB 4FQCH 1NCAL 2C3VB 3CCHA 3THMH 2YXMA 4IMKA 4OGXH 5JXEA 1EO7A 3D39B 5MEOB 3MJ8A 1F90H 1AKJA 1LK2B 5J1AB 4KKCD 5SWSA 3QO0B 1A6ZB 2IG2H 3QWOB 5DJYA 4EVNB 5E8NB 2YR3A 3QA3A 1XMWA 3O9WA 3RIAF 2HH0H 3MA9H 4GUPA 4OFIA 3ZZ1A 1I8IA 4CAGA 1M7XA 3PL6D 2VLJB 1MCCA 1P4BH 1AXTH 1WISA 4JB9L 3DMMD 4ODUB 4PJXE 5CMAA 1FFNA 5GRUH 1PY4A 5I1JL 1U3HC 4U3CA 3TVMA 3SGEI 5D1XA 2E7BA 2BVOA 1XGTA 2GY5A 2Q7YA 4J12A 3BEVA 4LLUA 3MRHA 3H9YA 5F96H 1KLGB 5I8OL 1JHTA 4Z7UB 1IAII 3SKJH 5AUMB 2FBJL 5TF1H 4ODVL 1EHLH 3TBVA 1CK0H 5JIIA 1YEJH 1TFHA 5E4EB 4X83A 3CXDL 3OF6D 4R2GD 2JCCB 3QSKB 2EH8L 5D6DC 4KRPB 4F9PA 4NWTH 5D6CA 5KW9H 4OAWB 5D1ZD 1KF9B 1ZAGA 2HP4A 4BA8A 2EDJA 4PD4K 5MENA 3P0VH 1MHEB 4QXGH 3E8UH 1WC7B 4MNQB 5D7SL 2DKUA 3V5HA 3QUMA 5DRXB 3ZE0F 1KG0A 4P5KA 4NJAL 2Z31D 3U82B 2JIXD 5H35B 1A9BA 3UPRA 3VRLF 2P5ED 3REWB 3LQMA 1Z3GH 4XNQA 4NQCB 5A2LH 3KS0H 4F7EB 2EZ0C 2WANA 2KL6A 1UA6L 3OSKA 3V4VL 5IG7A 4XCFH 3J7HA 4UT6L 3P4OB 3RZCD 4JPVH 1EFXA 3HE7C 3KYOA 5HYJE 4LCUA 1HHHB 1U3HB 3G5YB 3RVVC 4I5BA 4JZNA 4POYA 3HLAB 4LCWE 3NIGF 2GFBB 4PRPE 3PG2A 1AC6A 3HG1A 3U30B 5FYLH 3DETD 3WLWC 3MV9E 4GG8A 1LK3H 4M48H 1EX0A 5I0ZA 3D3VB 3G6AA 4XCYA 4JZJB 2X4SA 2EZ0D 3O6MH 4ONHA 4OZGE 3CSPA 1S3KH 1LDSA 2OMNA 1NANH 3LKRA 3B9DA 2FWOA 3HC0A 1ETZA 1XGPA 4EUPG 3EO9H 4Q6YA 2EO1A 2Z93B 2W91A 3HZKA 3VRJB 4TUOA 4Z95H 4HG4K 1QQDB 4MHHI 2VXVH 3PV6A 3W9EA 3KJ6L 2WUBH 3REVB 1PKQA 1SMAA 4N1EA 4N1CA 4Z7QF 3U6RA 1EJOL 4HJ0D 4BFEA 2OJZH 3WHXB 4NQDE 2R0KH 1KIQA 1LO0H 3CDFA 5C3LD 3I6GB 2NY5H 2AP2A 2FCBA 1ZS8B 1IGML 2FX8H 1EEZB 5BW7C 2NX5E 1UM4L 1Z5LA 3FB6B 3LPWA 3PGCA 3VRJA 2F54A 2IALA 4P57A 4F7PA 4WFGE 3KVQA 4K07A 1MJ8H 2FECI 5C07B 3VG9C 4YH6A 5E7FA 1YNTB 3GIZL 2B39A 3LN5B 3QAZB 3BO8A 3S97C 1CS6A 5IHLB 5KZCB 5JOPD 4J7RA 1UXWB 4KUCD 3E6HA 4P2OA 4KDTA 2MTPA 4G3YL 5E9DD 2YD9A 2NY0B 1WK0A 1J5OL 1BQUA 4AL8H 3L5JA 3K1DA 5IVXA 3PWPD 5EOCH 4QRRD 5E2JA 4P0DA 4PJ9B 2P8LA 4HPOH 1HXYB 5KVGL 1A1NA 3SKOB 4AM0B 2AS5M 3NIDF 5IMOB 1DQJB 3OL2A 4FFWC 5K9OA 2AW2A 1IGJB 1GC1H 2XWTB 3V7AG 3JWOH 3SCMA 2HJLB 1NGWA 3ZYZA 4EI5C 4EI5A 2AJVH 3QHFH 3P2TA 4WV1B 3MUJA 4YWGH 3BH8A 3KPSB 1Z3GL 3LN5A 4PRAB 5DQJA 1J1XL 1XGUA 4RFEB 3PGDB 3O2DA 4J3VA 5DHYA 3S98A 3EOAA 3V6OE 5BVJA 3X3GH 4IHOB 4LCCB 3HB3C 2IALB 4P57B 4F7PB 5C9JB 4UDUA 4QTHA 1OM3L 2ENYA 1K5NB 1YMMA 2E7LA 3T0EE 1A14L 4OIIH 4HLJA 4DUWA 3MLYH 2GSIA 2C1OA 3LN9A 1CF8L 2V17L 3I3EA 5DLML 5F70A 5F7YC 4AY0A 5CGTA 4P9MH 1NCNA 1ZT1A 3OJMB 5EC1B 1LNUB 2DWEB 4H1LA 3MZGB 2BX5A 4AL8L 4FRWA 3WJLC 3B43A 3G5VB 4NQCE 1RIUH 4K71C 3T0XA 4UIKL 1KJMB 2Y72A 1OLZA 3MLVL 2UWEA 3OTTA 4XNMB 4MAYC 5I2IA 5C0GA 3O11A 1WTLA 4JN1L 1UM5L 4XXDA 2EDEA 4XPAH 4AEIL 3FFCB 5C9JA 4XP1H 5D7LE 5M7QA 3HZMB 5IJKC 5DRWA 1CD9B 5FOBB 3EOAB 1J1PL 2QKIB 4DK6A 2XACC 1UM4H 1RI8A 3ZL4H 2XWBA 1X5AA 1TJHH 4M3KB 4W81A 4GRMA 4YX2H 1DLFH 3CFCH 5KJRL 5KN5B 2ZKHL 5IT2H 1GC1C 4ZXBB 3GIZH 2H9GB 1MLCA 1JGDB 3BZEA 3MACH 5K33A 4PJEE 5TDOB 2PXYC 2OJZL 1SEQL 2XRAL 2B4CH 4V1DB 1LO0L 1O7SA 4JY4A 1MSPA 2D0HA 4RGMC 4L9LA 1ZHBA 4LIQE 3SBWC 2DQHL 4J1UB 3L3DA 4PJAE 4HBQA 4WI9A 3VW3H 2XNAB 4U1IB 4ZPVA 1Y0LA 4FQLH 1NFDF 1PVHA 5DJZB 2NXZC 5T3XL 3VRIB 3W82A 3BPNB 4FQJH 4W6WB 3QPXH 1K2DB 5KAQG 2C3GA 5E4EC 2FATH 4J3TA 2UWEF 3MV8E 3QNXA 4LGRB 4JG0L 2DQCL 2I9LA 5GGRA 2V2TA 1J1PH 2K1MA 5T3ZE 4WHCA 4EJ1C 3BP6B 4N9OB 5E03A 1AGCA 1TDQA 5EN2B 4LLQB 4H8WC 2IANB 3K2MC 4AYFA 4AENB 4P46B 4XHQA 2MPAL 4ZSOA 1K4CB 4PRIE 4M7LT 3WHXA 1H3PL 1KIUA 2R0LH 4OLYL 1BQLH 1UJ3C 3D2UA 4YHNB 2JK5A 1IM9D 2NYYC 2NY1B 5TE4L 4CKVX 3PDGA 3CX2A 3QRFM 3HRZA 4Y4HA 4GKZB 4QHUA 5CBAA 3MBEC 5JW5A 3AY4C 4POUB 3VXSA 1PSKL 4F2MA 4MA3B 5E2WL 2A9NL 2WBJD 1T0NA 1Z9LA 4KAQH 4GRLA 1INEH 3MO1A 4WDIA 4OFYA 5D72L 5FO8B 1ZEAH 3SDDB 2ED7A 3NFSH 3HAEH 5AAMA 4M4PA 4DVBB 5LQBH 2BSSA 4QCIB 1DQML 4O2EB 4LLUB 1D9KA 1GJIA 4DZBB 3DMMA 3MRCB 1U8MB 5HYSA 2CDEB 3EHBC 4HUWA 4M5ZL 2ARJB 5ADPH 5DFTA 4L9LB 4NC2B 4FZEL 2VISA 3VE0A 5D1XD 4ODHL 4DGIH 3O8XC 3DURA 1H3WM 1KELL 1T7WA 3FAXA 4WEBH 3SDCA 2YD8A 3ILQC 2UZXB 4QHKJ 3ULUH 1DTUA 5I1KH 3TIEB 5C7XH 1JVKA 5C0AA 2P43B 1TTUA 2B0SL 2EKSB 5FB8A 4PP1C 4CW1B 2HLAB 3MV9A 1KIPB 2MOVA 1EEQA 5F7DA 4ETQB 4MB3A 5FM5M 2VXSL 3GHEL 2R4SL 3QHTC 5FYJU 4FXGB 1CLYH 3PP4L 3CFBB 5EU5A 7FABL 5T1MB 4PGDA 1YNLH 2DB8A 1MFBH 2Z35A 1A6UH 2D2OA 3RWDB 3V5HB 1TZGH 2GJ6B 3KPRB 2PO6C 3WDIA 1OD9A 4JHBA 1UKTA 3NN8B 4HIEA 2Y06L 1CTOA 3GEWB 2R29H 3SY0A 4QOKE 4H25B 1YEGH 4UILL 5C0IB 2PYED 5I19H 1PKQE 3HCVB 3ARZA 3BN3B 5C8JB 2JCCA 2VIRA 5C0AD 5F1KC 3OAZH 1F90L 2V7NA 3VFRB 1SQ2N 1ED3B 2DLTA 1FV1A 5AUMA 2DQGL 4K55A 1VACA 5ERWA 3SO3C 3JSSA 2EIZA 3CLEH 3T2NL 4XPBH 5J11B 1RZ7L 5I1EL 1MPAL 4KVCL 4DGYH 1CXFA 3MV8B 5J6HB 4G6ML 5FAAA 3TVMB 5I19L 5I1GH 2X4QB 1S7VB 1KEGH 4ZAKB 4EI6A 4PJCA 3AVEA 3UBXI 1IILE 4OM1L 4IDJL 4XPFL 4MDJA 1AR2A 5K59F 1KBGL 1A4JB 1FHGA 3QFJA 4JHAL 4S1SH 1BP3B 5DJYB 1YEGL 1CD8A 3U0WH 2RBLA 4XPGL 4G8FB 2UUDH 4U1GB 1YY9C 1MJUH 2WBKA 3MUY1 1T66D 4PJGE 5HHOE 3SGDI 3QJFA 1IEAA 4LKXA 5JHDA 4UOJA 3GSVB 3LSOA 4KK5C 2DI7A 4PJCE 4XVSH 1I3RA 3U7WL 5DT1H 2R1XA 1Z0NA 5B21A 3CFKA 3WMSA 1NFDA 5KANI 1I7UB 4HCRH 3SE3A 5CEXB 1SVZA 4NOBA 1SBSL 1T6WA 1HIMH 3QXTA 4O5LH 2HT2D 3GBLA 5DD0L 3ZYOA 4MXWL 5BRZA 3OPZL 1X4YA 2BK8A 4Y5VC 3PWVB 3QEQB 4Y4FC 4NBXB 1D5MB 4DVRH 2DM7A 2P8PA 2OBGA 1U8HA 3T65B 2FL5A 35C8H 2CUMA 3O6FA 2C1PB 1EGJL 2W38A 4LFHD 4NQDA 2L4OA 1H3TA 1OPGH 3MSPA 4UIKH 2E9BA 5I71C 1T1YA 3L6FA 1RUPL 4EDXB 1T2QL 4OZFA 1YECL 1G9NL 1JUFB 2EEBA 1GPOL 1HH6A 1MHHA 2APBA 4RBPH 5I71B 2OTWA 4MQXC 2Q3AA 4DWHA 2R9HC 2D31B 4OD2A 5D96B 1OSPH 2PXYB 3I6KA 3L1OH 3LKOB 4KU1A 1Q1JH 2A6DB 1KCRL 5GSVA 2CKBB 3UO1L 1VFUA 4PGCA 3ULVC 5IB4B 4NBYB 1PGRB 4JGUA 5CEXA 4Y5VA 3HG1B 5EU3B 5E6IA 4RMWA 5JXAL 3U1SL 3RX8A 4PJIE 3FCTA 4L8CB 2V5RA 1A9EB 2QJDA 1BGXH 2D9CA 2VLJD 3PXJA 2GI7A 3RQ3A 1INDH 1MHPL 2DL2A 1BBJB 4G9FB 3AC0A 1JWMB 3QJFB 5CILH 2ADGA 3RPIA 3VXRB 5I8EB 4LHJB 2ADFH 5F9OH 4FABL 4CJ1A 4IMLB 1YN6B 3CH1B 3O4OB 5FGCB 1SY6A 3IJHA 1XGRA 2BZDA 1JYVA 1PG7W 2XPGA 3D1MC 3F12B 1HKLH 3GI9L 3OMZA 4S11A 4OCRL 3I2CH 3U46A 4Z77A 4NKIH 4DAGH 3JVGC 2OL3L 4I8DA 3ECBA 4POZC 1B0GA 4PJBE 3ZKND 3F7VB 1A1MA 4WUUE 4W68A 1UQSA 4R7DB 2VZUA 3MLWH 1V7NH 4KY1L 4BFIB 4CRPA 5I16A 3VJ6B 4QXTB 2A2QT 3I75A 5F7HA 5GSRB 5C0BA 3JV5A 1A7OL 1DQQB 2CMRH 1GSMA 2R2EA 4GW1A 1EMTH 3GNMH 2NY3C 3D39E 3SO3B 2HVJA 2WWMD 1TQBC 4JCLA 2FSEA 2E8ZA 4JDVA 4NO0B 5F6IB 3ZL4L 1NGXA 3FHAA 3RWCB 1SHMA 2H32B 4H8WH 2ATKB 2UY7A 3RNKA 4Y1AE 4P2QE 4Y16C 3UJIL 4GRWH 4NYLB 5CIPB 3FOMB 4XBPA 1BBDL 4BM7A 3LZFH 4R96A 1R5IA 3UC0L 4UDTA 3LQZB 2VAAA 1JWMA 1T3FB 3A0OA 3HMXH 1AHWB 2A0LC 2VZ1A 3R1GH 4WNQA 2UV3A 5GS2D 3IDJB 1GGBH 4OI7A 2X4UB 3ARBC 1MFCH 2Y07H 1DQDL 4LLYB 4OFPA 3ES6A 2ESVD 4PRDB 1A14H 4OIIL 1ZA3A 5EWIH 3QUYA 4M1DL 1AI1L 3CCHB 2HVKA 2ITDB 1MFEH 3WNMA 2L7UA 5AG9A 1N64H 1ZA6B 1DVFA 1DL7H 1TLKA 2YSSA 2CRZA 2CK0H 3OKNA 4OD1L 3UJTH 4FFZL 5E2UH 5EO9A 1KT2B 1XR8B 3DOSA 3X12B 4G6FD 2AXJA 2HT4D 4C56B 1A5FL 3FQUA 4Y5YC 3ZYIA 4JRXE 3SKMB 3W0WA 2FHCA 4NQDB 2JB6A 5CEZL 4JFPA 4U1NB 3CXHJ 5A16A 2GHWB 3L5IA 1U42A 1YNKL 43C9B 5CJOH 4RGNE 1P4IL 2EKJA 4MCZB 1U3YA 3CXDH 4P9HL 3ZKXC 5IQ7H 1DJSA 1T80A 1JN6A 3GSXB 3RPKA 1R24A 2ZJSH 1RFDH 4ZOCA 1T7ZA 3MPCA 4FG6C 2D9QB 4P59L 4YHYB 1NJ9A 2ZUQC 3AS1A 2CO7B 5KW9L 4HFWB 1JNNL 3EFDH 3ZYJA 5I1HH 3ZE1F 4F2MB 1TPXB 1FNHA 1ZSDB 2VLKA 3MTRA 3SN6N 5J4MA 1SY6H 4OQTL 1W72B 2FNBA 4JO1L 5CSGA 3JBG7 1Z6JT 3MX0A 5F1NA 5IBTH 5E8DL 3UCRA 2IQAA 4G9FE 5F9WB 4NT6A 4Y16B 4KDWA 3BGMA 4ODSL 4QWWD 5GGSA 2B8OT 5IIEA 3D85D 2FIRT 2K3TA 4OCLC 1AFVL 2EIZB 3AREC 3BOVA 4ODWA 1C7SA 3RY5A 3VFPA 3B9EA 5AZEH 1QFWM 1U8KA 4U6XB 3FQNA 1AD9A 4OFKA 3O41A 2QTEA 2L7JA 4X4XB 3N9GH 1IEHA 2PTVA 2I9TA 1OAYL 3X14B 4PRHB 3WHE1 1V3MA 4KJQD 1CE1L 5BMFL 3HMXA 4J4PD 5ACZB 4XPAL 2PCPB 4AEIH 3SDYL 5F7KC 3E3QC 3QH3A 3HUJA 4JQIL 3RVWC 3X13A 1VGKB 3V0AC 3P11L 4H88L 5T1MA 5GZOC 1BVLB 5E95B 3E0GA 5HGHB 1MCWW 2Z8RA 3EYOA 4OZ4B 2WM0A 5FUOL 2MJWA 3ZDXE 3DV4B 4JFOB 1WUNT 5ITBH 3S9DB 1QO3B 1FO0B 3PL6B 4M7KL 5FK9B 4CBPA 5EZJA 4YDVB 5GISH 2ZUUA 1Y18A 3S35L 1RIVH 1XCTB 4NC1E 3GJFH 3MXVH 4JN2A 4NWUL 3WEXA 4BH8A 2ORBL 1JZ5A 4KK8D 3IAGC 1FCCA 1NLBL 1OW0A 3RUGA 3WXWH 5DMYA 4KK6D 4Q9CA 1YEFL 5E56A 5EU5B 5JR1H 5ITFA 3VXUA 5HYSB 1G6RH 5I76B 3AB0B 2XFXB 3TESA 4NPYB 5C0DB 4Y16D 4G8EB 4HJJL 4GMSH 1UZ8A 1QFWL 5D7JA 4QXUL 2P47B 4QCIA 1M7IA 3LS5H 1ZWIB 4JLRA 4L8DB 5IB1B 3BDYH 4O2CB 2B1AH 1NPUA 2YBRA 4ZUVA 4GJTB 2IPKB 1NGQL 3DTXB 4HIIA 4AMKH 5TQ0H 2WLYA 3R06B 2XKNA 5DTFA 1D5BA 2JJWA 3QIWC 5B22A 1MFDH 4NO2B 1YQVH 4OLZL 3MMEA 2NY7L 5HYJA 4WFEE 5IMMB 2VR9A 2M1KA 1G6RL 4OTXL 1CDIA 3T8XA 4YLQT 4GKZA 2O26U 1A3QA 4L8SB 1A6WH 2J7LA 3T0DA 1GHFL 4P2QD 5I1LA 1DBAL 3RDTA 3WLBA 4NKDB 1FP5A 1U2HA 3CX5J 4K9EC 3IAQA 1OAUL 2OP4L 3FONA 4KUCF 4AENA 3A6CL 4Z76B 1VSCA 4OLWH 4AH2B 1Q94B 3K8LA 4OGAC 5CP3A 4KKLC 5GRXG 5DD1L 5B4MC 1EK3A 2P49B 1SEBA 4OV5B 3VWJA 4QHUB 3UZEA 4JR9L 2DD8H 3OJVC 1T83A 3BD5A 4U6VH 3JUZA 4OZGB 2AEQL 5T3XE 1E27A 2JJSC 2X4OA 2XNAA 4OGXL 4U1IA 3BZ4A 4ZPVB 3WS3B 5LAXB 4NHUB 1WEJH 3MR9A 4HKXB 1J0KA 2DQCH 5IBUB 1RURH 3ARFC 3D3VD 1W8NA 2C7UB 4IBLT 3LKSB 2D0FA 4NNPL 5IUSA 1EO8H 3IETA 1I3VA 1EZVY 5CZVH 3UDWA 1RZJH 2WBJA 4F7TA 1MH5B 1MAJA 1S7SB 1G7LA 2DQHH 5LBSL 3EZ8A 5SWZA 5MEPA 5D2NE 1BJ8A 4QF1A 1QFWI 4JVUA 1XIWA 5DK2B 2ZCLL 5LGHL 1SJEB 1CFVL 2LTQC 2X4UA 4KI5E 4I2XA 1YEKL 4L4VB 4L29B 4I0CC 4M61B 5CJ8A 3HZMA 2BDNH 3BWUC 3FFCA 4OSUH 1G9MC 1QSED 1OGAD 3HC0B 3BUYA 3CFCL 3VGBA 4ZFFB 3ULUE 4MGXA 2PYFA 5IB3A 3IKCA 4HGMA 1CFNA 1ERNA 3NACH 2DLIA 1UJ3A 3LVEA 5JORB 5FYJE 4HK3J 4GXVH 5DMKA 1FC1A 2ZOKA 1TIUA 1NH6A 4J2XA 5DEFB 5DO2C 5C09B 2J1KA 2X4NA 4WW2B 3S36L 1MFEL 2R0ZL 3GMLA 4UI2A 1C08A 3MLUL 2WBJC 5T3ZD 4RMQA 2CGRL 1IC4H 1KIRB 4AIZA 4AIOA 1U3ZA 5B38G 3TJEL 1D6VH 3LMJL 3GSWA 5C0GB 2BOBB 3F65A 4HKZB 1ZVSA 5GGTL 4PJ8D 3RVUC 3WFHB 6CGTA 2O61B 2VKXA 4K2UL 2ZOLA 1G9EA 2VXQH 3OXRA 5DLMH 2C26A 5CSZA 3SDXA 1CGWA 1BJ1H 3QNYB 2VLRD 1CGSL 3H9SD 1A1MB 1QD0A 4O51A 1U6AL 1ZT1B 4HMDA 5EC1A 1FGVH 4C56E 3VXUE 1WFNA 2R8SH 2BVYA 4HV8B 5ADPL 3EDFA 4X80H 3LMJH 1MJ8L 1OTSC 4PJ9D 2DN7A 1YA5A 4WWKD 1BBDH 2NY3B 1A7QL 1KB5L 4MQ7A 2PTUA 5D2LB 1JIBA 1F42A 1JE6A 2YKLL 4XNUL 4MQSB 1WBXB 1NMBH 3QXUA 5MP6H 5JPNA 3VXRA 3NFSL 2B2XL 5SWSE 4RIRA 1P4BL 3LIZL 1CDBA 3MFGB 4JQVC 3VFOB 5CWSA 1NBVL 3IFOA 4U3HA 2YWYA 5D6DA 2V2XB 3SPVA 3ARGA 3N06B 2OS7A 5CEZD 4UBDD 1QRNE 1FYTA 1WBZB 3G6JF 4OQTA 1MWAH 5DEFA 2ZOKB 4F7MA 2OL3H 3H6JA 3I6GA 3VXSE 1UJ3B 3QCVH 1B4RA 5EO0B 3D9AL 4J3UA 4P4KD 2R2HB 1HI6B 1FG2B 3UTQB 4IM8A 1G7QA 3VXTA 1FNSL 5EOTA 4DW2H 4XTRD 3T0ED 3PL6C 1CBVH 1TZHB 4DEPC 4LDEB 3VXPB 2R0WL 5HY9A 3QULB 5E6ID 3ILPB 3Q6FA 3Q1SH 1DBJH 1KJ3L 4XC1H 1EUTA 1S7TA 4M7ZB 1A2YA 5HHNB 4HGWA 4L8BA 3S96A 5J1AA 5KG9A 4LCIL 1BAFH 2FWOB 3DYPA 5JW4Q 5CP7A 1UM6H 2F5BL 1KXQE 3KPPA 2VE6A 4O2FB 3C5JA 1N3NB 4HMCA 2H2SC 5MHSD 1OB1B 3F7QA 4WUKL 2HN7A 2CRIA 2APFA 4NBZB 4U7MA 1A7NH 4JRYA 3BPOC 1AQKH 1Q8MA 3WXVL 1BF2A 1UC6A 2MQCA 3KYNA 3QIUC 5C0AE 3RNQA 2IFGA 3O2VH 5D7JC 2OTUA 3FO1B 3FZUD 2H2SD 3HLAA 1LQSR 1T0PB 4MA1B 2AI0L 4H0HB 3T2OA 4NJ9H 3IFLL 1GH7A 3RAJL 2BSRB 3IDIB 3DRTA 3NH7L 1FYHB 1DUYA 2OMBA 1I1FA 1TTFA 2E9JA 4P3DB 1I3UA 2QR0A 5IFHL 3GJEB 1II4E 1UB6A 4G7VL 1W72L 3B9KC 4MAUH 5KOVC 1OTTD 2P5EB 4XC3H 1OVZA 2B2XH 1F11B 4AT6A 3UP1A 2XZCH 3OKKB 4R4BB 4N8CL 3ZTNH 4NRXA 5EZIH 1KJ2B 1ORQA 5L8JB 5CD5C 3UBXB 4LQFL 1OF2A 2HFFB 3TNNA 4NQVA 5B3JE 3QUXB 2ZUWA 1WC7A 2A74B 4MNQA 4Y4KB 4U6YB 5T3ZL 4GG6A 1MCIA 4NQVB 3FQRA 1JV5A 4GKNA 4S2SA 2P8MA 3ZMRA 2BSTA 1KJ2A 3P77B 5JPMA 5EIQA 2PKDA 3O3EA 1CZ8H 3QDJA 3KS0J 5SV4A 5C0ND 1BLNA 3B2VL 4IRJD 2ICEB 1DLHA 4URTB 1F4WL 3NFPA 4PRIA 4R4FH 2VIRB 1IGFH 3JWDH 4K3JL 4C58B 4MCYB 5T33L 4L3AA 3I9GL 3V6OA 2IGFH 1Z0MA 3RWFB 3BI9X 4OM1H 4BK5A 4L9LC 3VH8G 3K7UA 1B90A 4NZUH 2DM2A 1QLEL 8FABA 3TN0C 3GSNL 2Z35B 4P46D 5BO1L 4PGDB 4M61A 3EO1A 1RZKH 3MFFA 1RUQH 1U92A 1UJTA 4JZOA 2Q76B 4M6NL 5F96L 4WFGD 1RAMA 4CVXA 4FQQA 5TF0A 1RD6A 1MVUB 4FQ1L 4A6YH 2QADB 1U8LA 3VI3F 4HBCH 5MEOA 1FVCB 1U8LB 1KPRB 1N7MH 5IQ9B 4PJIA 5KVFL 5C08D 4LCWA 3ILPA 4LRNH 3FHQA 4PJXF 1CXLA 4D8PB 1DQLH 3DUUB 1MJ7L 2F53B 3MV7B 1IGYB 4MJ6A 1G6VK 4QRUB 4ELMF 3ARBA 2FJHA 1U8MA 5FUZH 4PJBA 1FG2A 5C6TL 2EDRA 5KZCD 2BFVH 1VESA 3RJDA 5ESAB 4UUJB 1FNSH 5TPWH 3MJ8B 1AY1L 2BSSB 4OV5A 1JI2A 3MRGB 4KKCC 5IVXF 4OLWL 4LF3A 3SCMD 1JI1A 3VFTA 2CIKB 3TO4D 1MI5E 3WIHH 4NN7B 2W0KA 1A6UL 4BQ9A 5HYIA 2DJUA 4Q6IC 5JUEH 3V9FA 5DA0B 4NKOA 4L3EA 1TVHB 4RAUA 4X6DB 1BD2D 3V7MA 2LVCA 4MQTB 3VXNB 3EOTH 4AEFA 2A6IA 4PTUB 3CZFA 3GHEH 2ZUSA 4L1DA 1RIUL 3OAZK 4BFGA 1F6FB 1CGYA 2KH2B 1KGCD 2Y5TB 5D2LA 2GTZB 4KVNL 1GCFA 3MLSH 4GG6B 4YBQC 1JHLL 1RJZB 1V7ML 5JW3L 3ARBD 3TFKC 1QZ1A 5F7NC 3HE6A 3FT2A 2BCKB 5EB9A 3ZKQD 5JOFA 3UBXG 3MCLH 4P3CH 4O51B 2FD6H 4MXVF 3FOLA 5EZLB 5FHAL 4KXZH 1A4KA 3KXFA 2IC2A 3UX9B 2XZQH 5HDQL 5F6HJ 5DVMA 4M93B 4NC0B 1JPTH 5GRJL 1DUYB 1NBQA 3SGDH 4XI5D 1MUJB 1IM9B 2BHUA 2EYTB 3NVQA 4F3FB 4N8PA 1K4DB 3MYZA 1MFAH 1IQDA 1AI1H 5CCKL 4LAQL 1XR8A 3BMVA 5E2VH 4F7CB 3HNSH 2Z9TA 3IF1A 3C6LB 1AJ7L 4M5ZH 4MJ5A 5D7SH 1QRND 3UTPE 4ZUUA 3OXSB 2FGZA 2NW2A 3PL6A 3D85A 3CVIL 3MV7D 4G7YH 2IH3A 2NX5A 1S9VA 4S0SD 5IB5A 5HGAA 4M62H 2H1PH 1FO0H 3WSQL 1N8ZB 2VZVA 1RZIB 4MYWB 5B38A 1BREA 1PG7H 1D5XB 4ZFFA 5B8CB 4PR5B 1VFAA 3F7YB 4H8WL 3GJFB 3OKDA 2VTFA 5DGQA 1BEYH 2DAVA 3MV7E 4NN7C 4XVJH 4KI5D 5T5FL 3VD7A 5KAQF 2EIBA 1U93A 2MKLC 5DK2A 1ZKAA 1F4XH 2BVQB 5LG1A 5FYKH 4XP9L 3BQUD 4RAVA 3AS3A 3G5ZA 4PPTA 3IETB 3K3QA 4YE4L 3H0TA 3ME0A 4LSTL 3WHE0 5BVPH 5KJRH 4KJYB 4WVRA 1SJVA 3V6FA 4KXZI 4Z7VA 2NX5D 3FQNB 4ORGA 1QR1B 3D0LA 3LDBC 3BD3A 5DJ8B 1U8OB 3ARGB 1XGQA 4GAGH 3R0MA 1Q0XL 4N0YH 1F6AA 3GI8H 3VFOA 3ULVH 1KCSH 1GAFL 5FA3A 4LPUA 4YZFE 4G6AD 3PGFH 1CIUA 1DBKL 1S5HB 4DUXA 2YK1H 3MBXH 1NAMH 1GGTA 2GYSA 2R15A 4MQ7B 4NKQB 1QLFB 3ALPA 3MLTA 2F74B 4Z76A 1GIGL 1KB5B 4UQ3B 5E00A 2ZUQB 1UYWH 3IDYC 5LJYH 2A1WH 4D94A 4HEME 4XBGA 1A02N 1Q9WA 1EXUA 2ZUVA 5E00B 2FJFB 1Q1JL 3GSXA 4XCFL 1GOHA 3ISWA 3VI3E 5IFAL 2ESVB 4L8SA 4OD3L 3NZ8A 5CSZB 3CVHL 5HI3C 3VDAA 1G9NC 5DK0A 4NFCA 2KZWA 3TT3H 3ULVF 4U1NA 4JHWH 2IH1B 4S1QL 5IMMA 5CGMA 1H0DA 1BHGA 1I1RA 2H1PL 1ZLVH 1D5ZB 2GJ6E 2CJUH 3S3PA 4X7EC 2LQRA 2H26B 2I07B 4LEOA 5B3JF 4DKEL 12E8L 5D7JB 1LO5A 3FB7A 1ZT7B 3T3PF 2PYEE 2YMXL 4MDIB 1KV3A 2GUOA 4X9FA 4YNYA 1SBSH 4YIQB 5I8KL 1A5FH 4PJAA 4LHUG 3NGBC 3B9VA 3KPOB 3MRMB 4IIQB 3BN9C 2W60A 1JCKA 3B9KB 3QUMH 2Z93A 4CDGC 4R0LA 5DQ9A 4QXUH 2FBJH 4XPHL 5FGSA 2JJVA 5T1DH 4HWZB 4APQC 1CDGA 4PRPB 3BDBA 1HHIB 1RUKH 5IJVB 3BN9D 4YDKL 5HYSG 1F58L 1FAKT 1FLRH 4JZJA 2RGSA 3V6ZB 4GG8B 3B3IB 3RVTD 2IQ9H 1RZJC 3R1GL 4I4WA 1F4YH 3CFKB 2J2ZA 3MBXL 3HAEA 1JZ7A 4XVUC 2ERJB 3ULVD 1MJJA 3PQYA 2Q8BH 5DEZA 3S5LG 3KAAA 1SM3H 3MOAH 2FX9L 3QEGL 4BSJA 5I30H 3I02B 4MSWA 4P2CG 2FSEB 4M8QB 1HHHA 4QRTB 4XXCC 3HI1B 4OUOA 2HMID 3CDCA 5HGDB 5L2KD 1CDHA 4J3OC 1S7UA 2YXFA 4NNPH 5L7XL 4J3SA 4YGVA 4L4TD 3T4AA 3DXAB 3ETBF 3SGJA 5FYJH 2D03H 3JTSB 4QXTA 1LD9B 5DUBB 1GOGA 1YZZA 4X9BA 1A3LH 4XMLL 2EC9T 4PJGF 2IPTL 5KSBB 5J13B 5CBEB 1X5HA 4DCQB 1KLFA 5B8CC 2GJ6D 1VADB 4MMXC 3VFPB 1MI5B 1HKFA 1HYRC 4Y1AB 2KZ1B 2HFTA 2OTPA 3P9MA 3PWNA 1JYXA 4HIXH 4GT7A 2XTJD 4K3DL 4ZAKA 3WIIL 1AP2B 2XRAH 4GBXD 1Q0YL 3F12A 5EC2A 3MV8A 5GZNC 3WS6A 4LHUB 3TFKD 5F1NB 1S9WA 1P4IH 2J8UB 4PG2C 1ZLSL 3SQOH 5BJTA 3O3BB 1BEYL 1SM3L 5DVKA 4YK4B 1FVDB 2YD1A 2AXFA 1IAOA 2ZCKL 1WTGT 1BBJA 4G9FA 5TQ2L 4RGMB 1R24B 1U8QB 5IV2B 3LKQB 5EPMB 1DP0A 2BVTA 2CXKA 1A6WL 4ZUVB 3KPQA 4LCWD 2YN5A 1S7RB 3X11A 3WJJC 3MV8D 4PRPD 1QSFA 1R3IL 5JNYA 4Q58C 3TO4C 5ACMA 1KULA 5I66A 3PDDA 3ARWA 4HIEB 4MS8C 4W70A 5ESAA 2YMXH 3RGHA 1TENA 3MUHL 4BFBD 3GSUA 3VWKD 3JWOC 4JY5L 4J23A 1HH9A 2J3SA 4NRYB 4GUPB 4YDJB 3W39B 4GMSL 3D69A 3GMOB 3ARXA 1TCRA 4KGLA 1QBAA 3H3PH 5IP4A 2QLVB 2J8HA 1YEJL 2HLFC 2XTLA 5C09E 3LEYL 2VKWA 4AJ0A 3CZJA 3FO0L 3T65A 5D1QA 3G6JE 2EH8H 3AROA 3TGXA 1E6JH 4KZEL 3N1FC 3G5XA 3HG1D 5IV2A 4JDZA 3RY4A 1RUAH 2B7DT 4ZUWA 3FB5B 1Q9OB 3QUZB 1EHLL 1OPGL 5AYUH 1FNFA 3BGAA 2VISB 5KBNC 4P4KA 1A22B 3ULUF 2LAAA 4KVNH 3CC5A 4OJFL 5D2NA 1P7KA 3GFUA 4J8RA 1FZKB 3AREA 2ZCHH 5E7BA 4PIRF 1DSFL 1SYVB 1MOEA 3OQ3B 1T1WA 5ITBL 4NQXA 4WWKA 5HDOA 4JHAH 1NUNB 4S1SL 4I0PD 5EU6A 2BDNL 3QUKA 25C8L 1CGXA 2YUVA 4XPTH 1N6QL 3VGAB 4PB9L 4IRZH 4WTZG 1CLOH 3FQWA 1J0HA 4EXKA 3S35X 4PJ7B 4PGJA 4HCRA 1FFOA 5DJ2B 4I18B 5IB2A 1N5YH 3HPJB 2HT4C 2R2EB 1F00I 2OSLB 3SOBH 4J6RL 1VEPA 4E41D 2W07A 1JV5B 3B2UC 3OX8B 5EUKB 5LWYL 4BZ2L 2VDQL 2DD8L 3V8OA 2BY0A 1OGTA 4GAJH 4RZCA 4ZUSB 1K85A 4KV5E 3KJ4C 3GKWL 4U6TA 1PG7X 3S3SA 5GJTH 4R4BA 5ID1B 2YZ1A 3SJVE 3KYMB 4KJQC 4EQ2A 4Y7MA 3GMQB 4F58L 4P3DA 1FIEA 3QUKB 4YHLH 3AUVA 4WUUB 5JQ6L 4MAYD 4MCZA 4BH7A 1L0QA 1YN6A 3QCUH 3MLWL 4I0PC 4BUGA 1F3RB 4N68A 1CLOL 2GY7B 4GAYB 4Y4KC 4P59H 1B2WL 1WIOA 2OP4H 5D2NB 1YUHB 4J6RH 1F5WA 4XGZB 3ULUL 4O02H 1R3JA 5B39B 1HNFA 3MUZ1 4ZYKA 1PD6A 5KSUB 3V4UL 2OZ4H 4R0LC 4KK5D 5EIIB 5BW7A 3TVMD 2JB5H 3LIZH 2BC4A 3BE1H 4HIHB 5K9KB 3KR3H 1VKXA 2HWZH 3BPCA 3QIWA 5EBMB 4YDLB 2EKSA 4D0DB 4YUEH 3SDCC 4P46C 4P9HC 3QQ4B 4NC1C 3N50A 3CFIC 2HKFH 1AGEB 1F3DH 3RY6C 4LLYA 4P9ML 3TYFB 5F9JB 4WI8A 4X8JB 5BZDA 3T3PE 5JLZA 4U6HB 4RRPG 1ZGLB 1BD2B 5BXFA 2XT1B 3WNLA 4ZFGL 3SHSA 2WQRA 1FGNH 3PWLB 4XVSL 4KPHH 1J0YA 4GAFB 2P46B 1PQZB 4MHHG 1MLBA 4WY7L 3BYTA 5C0CD 4PJXA 4UV7L 5CIPA 2EICA 4PV9A 3IXTA 3O0RH 4LSRH 1I85A 2LU7A 2XN9D 2YUZA 4X6CA 4Y4FA 4PJIF 1RK0B 4KK9C 4MD5A 3W5MA 2WV3A 4ZMAT 5FA4A 5FO8A 1KLUA 1H0DB 5D4QA 4GW5A 3NIFF 4P2RE 1RZFH 3RL2A 4UNVA 4NN5C 2O5ZH 3IDGA 4ELKA 3QO1B 2X89A 4K8RH 1WBXA 3PE9A 4PBVC 4Y89A 1S78C 1Z2KA 2J88H 4P2OC 4YHLL 1A21A 5E8OA 3S4SB 1HXYA 3BW9B 3MRRB 4KK9D 1IT9H 4ORGB 5BS0E 4Y5XA 1QR1A 1FFPB 5KANG 3V6FB 1T7VA 2YEZA 4HV8A 3ABZA 4F8QA 2X4PB 3GKWH 3L5XH 3NPZB 4WW2C 5GJTL 2FDBP 1BIHA 1S9KC 3CDGB 5EA0L 1HXMA 2IBZX 4CVZB 3L9RB 2EXYC 3FAWA 1MCOH 4JPIB 4RISL 3T2QA 4ZTOL 4XC1L 1YEDB 3IAPA 1NSNH 2W65A 3LQAH 4X6DE 5I8EA 5IEHA 4E5XB 4DKAA 4FMFA 1ZGLM 4JFZH 1PYWA 3MRLB 2O5ZL 3GI9H 1ZS8A 3CVHA 4FZ8H 4U1JB 4Y5YB 3SDCD 3P9LA 3QDJE 3HAEB 1P5UA 4X6EA 1VFAB 4GH7B 3WN5C 4OZHA 3WS6C 1S8DB 1WEJL 5C0IA 3RKDC 1T21B 2R69H 5FF6B 3TN0B 4CN6A 1N8ZA 3UJJH 1RJYA 2DTSA 4WGVB 5H2BA 5EZOH 4JVPA 2X1XR 5E1AB 2AJYH 4JPKH 4BK4A 3K8MA 3LPGA 2P5WE 3OZ9H 4ZODA 3TYGL 4PY8I 1OQXA 3H9SB 1NL0L 1B0RB 4LKCA 4Q74A 1CD0A 1OP5H 4X7SH 5IF0A 1LE9B 1IGFL 1Q9KA 5IESL 1PX3A 1JF1A 4FQXA 1H5BB 4Z7WB 1JUFA 2R1YA 4XXDB 3PABB 1WAAA 4R9HA 1XZ0B 5T1KB 4OI8A 4P2YA 1EHXA 3LKRB 3QDAA 3K1KC 4GRLD 1IGCH 3OJDB 3MRMA 3WKMH 2RCSH 4OZHE 3G08B 4PJAB 2ENSA 4X4MA 5GGVL 1RIHL 4D3CL 1TZIA 4HZAA 3QEQA 3DARA 5DMGD 4LQFH 3A6CH 1QRKA 4JFDA 3S8WA 4M8VA 1L6XA 1FORH 4JGJA 4D9RD 3LKSA 1XF2B 5I8KH 3DO7A 4EZMA 4WEUD 5HGBB 2WINA 5AEAA 5JA8B 1ORSA 5GHWL 1WBYA 4FTVA 1JPGB 3S35H 4C56D 4QRQB 4JQVA 2VUOA 4HCRL 5L9DL 3OG6B 1AKJD 2Y5TA 1I9JH 4KTYA 4X7FC 3U36B 5DD0H 4NQSB 1FCGA 1ZT4B 2GW5A 5GS1A 3VFSB 2IBGA 4UINH 2AJZA 4X4ME 5EBLA 4EI5B 2ICCA 3UYRH 1MCBA 1FORL 4XNQB 1AQDB 3TNMB 1LEKA 5EZLA 1EVUA 1BVKB 3NCJL 4B53A 4NKOB 1P9MA 3FN3A 1EXUB 3SKOA 4PRNA 1IJ9A 4AM0A 5CEYB 4TTDC 5ALCL 1IC5L 1JWUB 1CE6A 2CIKA 5IFAH 2X44D 2YD3A 5DT1L 2PYEA 1MHEA 4JHWL 1AQKL 2N7AA 1S9YA 2ARJQ 2DQFA 3QO1A 1FJ1B 1PX4A 4HC1A 5J6HA 2F8XC 1UT9A 3O2VL 4YFLF 4PJ7F 2UZIL 4GKSA 3QIBB 2YPLB 4GQ9L 3SDAA 3RA7H 2VDQH 1VACB 4EOWL 1KPVB 3K2UH 3QDMD 1L0YA 1Z5LB 3FB6A 3PGCB 2ZG2A 2NZ9C 3TZVA 3WFCH 4KVCH 4CU8A 1QSEE 4WFFE 2I27N 4G6MH 4LGPB 5BQ7A 4R97B 1GL4B 2XZAH 3S36X 1UZ6F 3GMRB 5EU4B 1TVBA 3DYMA 4N0YL 2EDHA 2Q6WA 2NY6B 4UT9H 3VRIA 3BSZL 5DEGA 4QNPF 3EJZC 4FQIL 4MD0A 3JV4B 1JHKL 3MLRH 1Y0LB 3H7LA 3IDNA 3ARDA 1JZ8A 4HS6A 1DLFL 4B41A 3QUYD 2QHLA 3HI6L 4LSDA 1HWHB 3WFCL 1B2WH 4N0CC 1EGJA 8FABB 4PJ5B 4KKNA 3DV6B 4HS8L 4KK8C 1HYSC 4XHJC 4OLEA 1U8JA 3SEPA 1BWWA 2B4CL 3CDYA 5ID0B 4QXWA 15C8L 5DRNB 1DUZA 3QIWB 5EBMA 1N6QH 2FR4B 1NSNL 3LQAL 5C07E 5M94B 4JCMA 5ENWB 3DV4A 2AXGB 5HYQA 2VABB 5CJBA 2X5PA 4BSWA 3KPMA 2IH3B 2NX5B 2PNDA 3O6LH 4YX2L 2NW2B 1F4XL 3BXNB 2HJFA 1CFSA 3QJHB 1TETL 1QFHA 1W0WB 5KS9E 4DGVL 2AJXL 4JFFB 4MD4A 4PTTB 4XGZA 1JGLL 2DTML 1JGUL 5FYKD 4S2SB 4R26H 1VHPA 2FEEI 4I5BB 4KTEL 2FEDC 3K74B 4MLSA 1BX2A 4NN6C 4OIBA 4J4PC 1OF2B 4MCYA 4OFVA 1LO2L 4X7TA 4UB0H 1AD0B 2EDFA 1I1YB 4X0KB 4HS3A 3LEYH 4NQCA 4M00A 5L6YL 1FRGH 3DPBA 4L4JA 5T1KA 5C7XL 3MNZA 5EG6C 4ERSL 1YEEL 4LARL 4RMRA 5HHQA 1QSEB 3QQ3A 4QHNA 4KHTL 5I1CH 3MO1B 4G9DB 3DRTB 5D8JH 5E2VL 3KG5A 4HF5L 1BX2B 1RU9H 2XZQL 5HDQH 4E0RB 4U1GC 5MENB 1I85C 3VWJD 3BGMB 3P73B 2NXYD 3FT3B 1ORQB 1WT5C 4YGAB 4ZOEA 2BNUB 3F7PC 5KSAA 3D2UB 2CDGB 2KDGA 1KCVL 4U2YA 4WTXA 5I8CA 1DL7L 2FYYA 3OG4B 5ELIA 2F53D 2XZZA 3BP7B 1U41A 3RVVD 3WKML 2FJGB 3U0PA 2WP3O 4HPOL 4OCSL 1H9VA 1S9XA 3SKNA 4FQPA 4LDLB 4HS8H 4YPJA 1WFTA 1MIEH 4KDTC 3QEUA 2Q1EA 1JNLL 4NFBA 1U3JA 2VUYA 3MRHB 3QIBC 1T1XA 3QI9B 1S7TB 4KGJA 4XC3L 3AREB 1UVQB 4PY7B 4JQIH 1YY8B 4U1LA 5CUSL 5FO9A 1TPXC 5F9DC 3RNQB 1IQWL 2H8PB 2O5XH 1V7NL 5EO9B 1QTYT 4Z0BH 4HG4J 1VFBB 3SJVA 3MBED 4K23L 4OCMC 2HN7B 2YC1A 4PGZA 3OAYK 3T0VA 1KIQB 4MD0B 3BZEB 2DLFL 2NYYD 1P2CB 1QEWB 2XQYK 3G5XB 3DVGB 4FFYL 5F88B 3VFMA 3HFMH 1NMCB 4QKXB 2BFVL 3IDGB 5F6HI 2C3VA 3TV3L 4EDWL 5DD1H 3TZVB 4NO5A 3MRNA 2J5LC 4OCSH 3I3BA 2WUCH 3ES6B 1OTUC 3O2WH 4DN3L 2GQHA 3WFDL 3D69B 1FQ9C 3VGHA 1J9CT 2WWKT 4ZFOB 5FA4B 2VL4A 4U0RB 1RK0A 4HXAH 4UNTA 4DAGL 5MENE 1S9YB 4X6CB 4R96B 4ZS6D 4LVEA 4HAGA 4K94C 4RGND 3VI4F 5C6PB 3TV3H 2YN3A 3B83A 4U1KA 1MHCA 4TNWK 3D3VA 3NPSC 1K6QH 5DJXB 5DZOA 1IARB 1KJ2L 1S7RA 4Y5XC 3PUCA 3DUHA 1RUQL 4M7JL 2QQKH 5DWUL 3NFPB 1BD2A 5KSVA 4YHPB 5CEZH 5SWZD 3IJSA 5J57B 1FRGL 5ICZB 5A2FA 5L7XH 1JK8A 2EECA 5ECJE 4WHDA 3IVKA 2SEBA 2YHGA 3A67L 3VFSA 3TH2T 1FVDA 3EGSA 1E4WL 2O61A 4S1RL 2EDBA 4F9LC 2I26N 3HUJF 1FIGH 2A9ML 4S10A 5DI8B 1JPTL 5GRJH 2BXYA 2VAJA 4PD4J 1FL6B 3UTPD 5JXAH 3MGTB 5ISZD 4XWOD 4NHCL 1TJIH 4UV7H 2MKWA 3HNVH 2OCFD 3OKLB 3OHXB 3V0VB 1NCCL 4QRPB 3DIFA 3C08L 4IRSC 1FBIH 2VZOA 4JM2F 1BJMA 2PW2B 4KMTH 5FV1L 3VWKC 1CI5A 5LGJA 3V52H 1AXIB 2XYCA 1AGDB 4RA3A 4XWOC 5FGBC 1GGBL 1NLBH 3WXWL 1EAPB 3L3OA 1I8MA 1DQDH 3LS4H 4EN3B 5IMLA 2BOBA 1DBBH 2Y25A 43CAB 5J7CC 3BISA 1T7XA 3QZWG 1AIFA 3VU2A 5C07A 5C0EA 2YRZA 3TCLA 5E2WH 2NW3B 1J8KA 7CGTA 1AGFA 4UTAL 3KYNB 3ARPA 5TE6H 3OGOE 2AV7A 3QUXD 4HMEA 4NNYA 1JHTB 4FQ2H 2D7TL 4CVWA 2A6KA 4HFUL 3D39D 1UWEH 4WTWA 1G7JA 4NDMB 1ZHKA 1T0MB 2BVOB 3W11C 3WNKA 4OZHB 2P5WD 3S37H 5C0RL 2AEPL 4JDTL 5D5MA 3P9LB 2OI9C 4RBPK 4DZ8B 4GLRH 4WU7B 2Z91A 4ZS6C 5EO1A 1U58B 4ZOBA 4GMTH 2IAMC 3T0EC 2VDLH 3QULA 3BZ4B 3QA3B 1C5BL 2AEWA 2IAMD 5TJWK 3TT3L 3DBXA 3WJLA 4RX4A 4JFZL 3L9RA 1SYSA 5C07D 5GJSL 4N9GB 2G5BB 4Y19A 3GSQA 1MCEA 4XBEH 2GUOB 4ZFZA 3TO4B 4UV4L 4L4VE 4AH2A 4HKBB 3S88L 4PJEA 5ILTH 2FYYB 3MRPA 5ISZE 2E6JA 5CLTA 1BECA 4GAJL 3EYQC 1RFDL 4HXBH 1KPUA 4NUJA 2OXGA 4DW2L 4LLMA 4FFYH 4CMMB 4E41B 4X8XA 1UM5H 1U8IB 4ELKB 3WO3B 1U3HA 1IKFH 4G8IB 3TVMC 4YPGA 5L2KB 1ND0A 3GI8L 4MNQD 2NY6C 4IRZL 1LE5A 2GCYA 5CINL 2KQNA 4R4NC 5GPRA 3GK8L 3PQYE 4HEPG 1QSFE 4P5TA 3DX7B 1GZPA 1R0AH 3KYMA 5CD3B 1GRWA 3KDMB 4D0BA 4YDJA 4X0KA 3W39A 4R8WH 5K93A 4Z7QE 4TTGA 5ETUB 2GTWA 3STZB 5HHOB 4NPYA 1BFVH 2BNQA 3EYSL 3ARDC 3X3GL 3BVNA 1LHZA 5E6ZA 3L3KB 4YHYC 3FT4A 3N85H 4XCEA 3TBTA 3ZE2E 4XVJL 1PFCA 2APWA 1ZVSB 2JTDA 4JM4H 3ZDZE 3CPLB 2HWZL 2RB8A 2VOTA 3LEXA 4UIMB 3FTGB 1FV1B 5ICXA 2Q3ZA 3BXNA 3PWPB 5FHBH 4LASH 4WU5B 4JM2A 1WAAE 2I60L 1EAJA 5H37G 5DYOB 5IFHH 5HDLA 4Z6AT 3O45A 3V5KA 2W9LA 1MRFL 2WK2A 2X4NB 4WW2A 4MVBD 4Z7UA 4P5TC 4HUKB 3TH4T 4OIAA 4V2CB 4HUXA 1SBBA 1MNUH 3RFZC 4M7JH 1EV2E 4KUZL 1CICC 5D1XB 4XH2A 5INDA 3NIDE 4J8RB 1JGUH 3NCMA 3KWWB 1JZ6A 3BUYB 1YPZF 3HC4L 3BKYL 4LASL 3HMWH 1NAMB 1YUHA 1T22A 2R0ZH 1VFMA 4QRPE 4S1DD 4HJJH 1OAKH 3C60B 4PLJC 5FUCE 4IOSD 4NSKA 5DVLA 4RDQG 2P45B 3HC3L 3IDNB 3S6CA 3T4YB 4PUBL 2B1HL 5B8CA 4MMZC 5F1IB 3NMEA 2DJSA 5F71A 4CU6A 1CXKA 5F7DB 5DRZB 4ETQA 2VYRE 2ID5A 4YEFA 1EERB 5D71H 5T5NF 4JM2B 5GGSY 1LO4L 5C0NC 1DQTA 4Z7WE 3X13B 4EDWH 3VXQA 5CGYD 1KN4L 1JZ4A 1XF3A 4MJ5B 5DC4B 3QDGE 5CZVL 3ILQD 3VD4A 4XX1E 5LBSH 5H94A 2QQNH 5IBLD 3VMNA 4L1HA 3KLAB 4WUUD 4PP2B 3BPLC 1E0OB 4H20L 3UJJL 2UVEA 3QIUA 4JPKL 1E28A 3S34H 1CDJA 2A83B 1UFUA 1TQBB 3IRZA 5C0JB 2FIKB 4UNUA 2VDKL 4PRPA 1MCJA 4JR9H 1JRHL 4WW2F 2Y23A 3HE6B 3WUWA 1J05A 4LPWA 4JGMA 5INDB 1XR9B 4XH2B 2J12B 5D7IB 2GTZA 1MJ7H 4RQQA 3LRSB 3H7BA 3LRHA 3C9NB 2F54D 5A2IH 1WCBB 1NBYB 1ZT7A 3V5KB 3U4BH 3MLPA 2Z31B 3P9WB 1M7DA 1D5BB 5E6YA 1I1AA 3TP4A 1MCQA 5F7WC 2P24B 1TJIL 3TO2B 4WHYG 1DVFB 4I3SL 2AK4E 1D5ZA 3MNWA 3EFFA 4I13B 3TPKA 3VFWB 4KV5F 1JZ2A 5E9DA 1MY7A 1Q9LB 2ADJB 5L88H 3HC3H 1A6AB 2XFXA 5DDHB 3BVNB 2JB5L 1G7MB 2NY4D 4LHQB 1K9TA 1J86A 4JY6B 3IU4L 4IS6A 2H32H 2FHFA 2NY7H 3DECA 3J8F7 6FABL 4FQXB 4R2GB 1WZ1H 4TUKL 3L3GB 4TUJA 1U58A 5EO1B 4ESKA 1JWSB 4D0CA 5TDOA 4NKMA 2WLZA 4U3XA 5CGYC 1ZLUK 1K6QL 3T09A 3ULUD 5D96C 3WIFA 3FOMA 1P7HL 4P3CL 3IDUA 1X9QA 1PZ5B 1RJYB 4HH9A 2WIIB 4NQEB 3RWHA 1I7ZA 1NFIB 3GHBL 4M43H 4A2MA 3I3DA 2H6PA 3TZVD 3VFUA 4U7KA 5GS1C 4GXUN 1U8QA 5F1OB 4NSKB 1FE8L 1JL8A 5GZOD 2R1WA 1G7HA 1T3FA 3UTOA 3JV0A 1T7YA 5IEHB 4BZ1L 5TGBA 2G5RA 2OZ4L 3HUJB 2M2DA 4JPIA 4LHUA 4ZTPL 5DJCB 5EZIL 2F15A 3O6KH 5D1QD 4XP5L 1NC2A 2ZUYA 1BIIA 1MRCL 3EAKA 4TVSa 2DLFH 5D5MF 1IGIL 1VEMA 5CJQL 3BH9B 1TXKA 5F7MC 2F8OA 5I1AB 5LXGL 3M17B 2DQGH 4WU5A 1MREH 5DZLA 1A7PL 4OM0H 2DOCA 2VITA 4HULB 1O7VA 3D25B 3HI6H 4M1GL 3V2AR 3ROOA 3QPXL 4QTHB 4YZFF 2CLVA 3DXAA 5HD8D 1HOCA 1KNOA 3D18B 5EUOE 1A6VH 5D1ZA 1VGEL 4RWYH 4XP5H 3UTTD 3PGDA 3FO9A 3WKNA 3K8KA 2NTFB 3RZCC 1G7JB 3QUXA 3QCUL 3MA7B 1S9VB 5J6GA 3E6FB 4NKMB 4PLNC 4P3WA 1ADQA 1B88A 4FTVD 2ICWI 2VR4A 2P5EA 2B1HH 2NW3A 1OAXH 5KVDL 1C1EL 4PJBF 2XPGB 4JKPH 4F33A 43CAA 4J3XA 4OFDA 3UTSA 2UZIH 3F62A 1DBJL 1KJ3H 5DDHA 4FQ1H 1IVLA 3IT8D 2B0SH 4ODSH 1ONQB 3PHQB 4HSQA 3FRPA 3SE4C 3SKMA 4ZAKD 1N5YL 1A9EA 3SDAC 3FO1A 1P6FA 1RUKL 4PJ5D 5F8QC 3CSYA 4RDQF 3F6LA 1RVFL 3DGCR 4CN4A 5I75C 5DD6B 1CLZH 4LRIA 4M62L 4YXLH 4ALAH 1JYNA 2E9WA 5D1ZC 1OP5K 1ZXQA 4N90E 3SGKC 2VDRH 3PWVA 5DD5H 1LK3L 1MF2H 2CIIB 1MCRA 3MODH 3TA3A 4HWNA 1SYSB 2DL9A 3BKML 3PHOA 5L9DH 1U3HD 3IXAA 4TN9A 4TSBH 1U93B 4BELD 3IDJA 2LU3A 2YWZA 4Y8DC 3O2DH 2V7HA 3VXPA 4LLWB 3BYYA 5MP6L 2A73A 4PREB 3TBWB 1ITCA 1IC4L 3N1PC 2VDRL 4RFNC 1I8LC 2G9HB 4TSCL 1CFQB 1T0MA 1BM3H 3ARGC 3U4BL 2H3NA 5HGAB 3WFEH 3FO0H 3HN3A 5HJ3A 2DM3A 3D85B 1JHLH 2H41A 2R1XB 5C92A 2F74A 1NCWL 1XF5B 2AJYL 3RWCA 5E94A 3VXRE 2NY5C 3QP3A 4DKFL 3EOBA 1AIFB 5FIEA 5DR5H 5TE7H 1MFNA 4RMSA 4O5LL 3UPAA 1C1EH 4BQ6A 5GSRA 4YXKH 5C0BB 4YDIL 4P2QA 4HK0B 3GSOB 2XA3A 3LH2L 3UZQA 3ZDXF 1XF4A 3CMOH 2Q76A 5F7UA 3C60A 1UM6L 4P5KB 4JRXA 1I7RA 2P7TB 4FMKA 1K8IA 3FT2B 1AD0A 1EJOH 4GSDH 1BFSA 3OKOA 5EUOA 4N8VA 3QNYA 5ANME 3RZCB 4ODXA 5F7LB 3Q3GA 5E2TL 3AMLA 5ABDE 2Z0BA 1CICA 4G8GD 3PWUB 4G42B 2Q87A 2W0PA 3RWFA 3BAEL 2P5WB 2ADGB 4OB5H 3QHZL 4JFFA 1NEUA 1G7HB 1DBAH 3HFML 3O45B 1PG7L 3CZFB 3RBGA 3OB8A 1KCLA 3K0WA 3AS0A 4H26B 4NGHH 1NKOA 2VQUA 4OUUA 3CFBA 5J13C 4HFUH 4OF7A 2GAZA 4M6NH 5IROC 3CFEB 2OL3A 1NC4A 4LBEA 3WIFB 3AXLA 4JDTH 5DRNA 3PWUA 4G42A 4HQQL 5F9OL 2Q7YB 5JXEC 4J3WA 3RVWD 5AZ2L 2D7NA 4WI2A 1KCRH 2GITB 4WFED 2PETA 2KKQA 4I3RL 2EDOA 4IS6B 1C12A 2EO9A 4Y4HD 5DHVB 2ICWA 5CZKA 4JM4L 1MIEL 3L6FB 1K4DA 4FXGA 3V7AE 2QQQA 3HE6D 4HS3B 4XWGL 4DZBA 4YQXL 4MNHA 3SDXE 3GMRA 1M05A 4ZS7L 5J1TC 2H2PD 1JZ3A 1MCWM 2DQTL 2G2RA 3D2UD 2LFGA 4UINL 4WDIB 1U92B 4JZOB 1XH3A 1TTGA 1RPQA 3QIBA 3NCJH 4G5ZH 4PJHB 5FO9B 4YWGL 4QWWC 5D7LB 1F6LL 3OB0H 3LEVL 3L7EB 4QYOA 3MNVA 4P4RB 4D9LH 4DQOH 4ZFZB 4I3RH 2PYEB 5ADOH 1X7QB 4GS7C 3GBNL 3WUWB 5GGRY 1T03H 1KELH 2YA1A 3GK8H 3F8UB 5D1QC 2ILLA 2NY4B 3TT1L 3QI9D 3CFJA 4RAUB 1ADQH 3SDXF 4LSUL 3UC0H 4D9RE 4R4ND 3MLUH 2NPLX 1ZHLB 2RCSL 4W4OA 5FYKE 3VXSB 4P23B 1FH5H 1IE5A 4XZUB 4WU7A 4JKLA 4PP2A 4HS6B 4HX1B 1WZLA 4QYOB 1HQ4A 3SQOL 4OKDA 3FQRB 1SMOA 1F8TH 4M8QA 2WINB 4YHMH 1R5WA 4GO6B 2X6MA 5HHMD 3MMEB 3Q1SL 2AV7B 2QQLL 4BQBA 3VH8B 4KY1H 3VW3L 4OCXL 1IBGL 4XNYH 3CSYB 3B2UD 4U7SA 1D3CA 4V1DE 5EULV 1YEIH 5JIKA 3LD8C 3NIGE 4HXBL 5HPMB 4F15C 5I1GL 3I2CL 2MNUA 3KGRA 1I3GH 4XP6H 1MVUA 5C86A 4Z9KB 1G84A 4Z7WA 3DIFB 5EIVA 4XBEL 1JHKH 1FG9C 3S5LA 4EIZC 1QHOA 2W9EH 5DJDB 4NRZA 1CQKA 2YPKB 2X40A 1B0RA 2DIBA 3MBEB 2Q7NA 3V0WH 4Z18A 4JRYB 4HLZH 1I75A 1TCMA 2FX9H 3MOAL 3QEGH 1MWAL 5E9DE 3GMMB 4G43B 1NMCC 4K8RD 4OZ4A 4X6CE 1GYAA 1ZT4A 3FO9B 3EJYD 3K2UL 4L4VD 5FYLD 3MRIA 1HN1A 1DE4B 1T04A 4M6AA 4KQ4H 3EO0A 4G6FB 4K3JH 4OJFH 1CLYL 2DBLH 3TT1H 1OGAE 5I18H 3EHBD 1H8OA 4M6MH 3ZSTA 5DHYB 4JJ5A 2PCPA 5JW4N 4HJGA 2VDMH 1HXMB 4FS0A 3GMMA 3X14A 3LHPH 2X9XA 3HMXL 4ODHH 5FDWA 1PAMA 4O2EA 3GGWA 1FZJB 1ROWA 5C2UB 2VLMD 3DX7A 3JTTB 1S7WA 1XF4B 3PDOB 4OLZH 1NUFA 4UDUB 3EYVA 3TPUA 4DTGL 4Z7NE 4ONGL 35C8L 1AR1D 1NCUA 2NY2C 5E1HB 5L6YH 1G0DA 2FECL 4TYUA 1K8DB 3O3DA 5ESQA 1J0IA 5L2KA 4MLIA 3LHPL 3VFUB 4RWHA 5FA3B 4JREC 12E8H 3AMKA 4LPCA 4XCCH 4CMMA 3EOBB 1EO5A 2APTA 3CXHK 5FM4A 4U31A 2C7UA 2LE9A 4LRIC 5I17B 4JG1H 5I1IH 2WBWB 3QB7C 4YQXH 4NUGL 1BQHB 3GGWB 4DK3A 2H8PA 1OB1A 4KMQA 1IMHC 4PRBA 1D9KC 5GGRB 1CG9B 2MPAH 1BVZA 3AU1A 1CFQA 5J8OA 3O6LL 5IW1B 4JO4L 5A3ID 3NAAL 4PREA 3TBWA 3U36A 3VWJB 1J1OL 3SKNB 1CG9A 1DANU 1ZHLA 3L3DB 4J1UA 3DGGB 2F54B 3EOTL 4MWFB 3MXWL 4M6OH 3QHZH 4LQ1A 3QDJD 4K3EH 2CD0A 3U7YH 2CR6A 3C6LC 4Q6IB 4X6FB 1ZLVK 5JDSB 5CUSH 1KFAH 4X98B 3F5WA 3HE7A 3B9AA 3G9AB 1DFBH 1MAMH 4L3CB 4CMHB 4QT5A 5HVHB 4L5FL 4IDLA 4ZXBC 4ENEC 2BNUA 5EO0A 1UACH 1G7IA 2A6KB 3L7EA 2HYMA 2UZYB 3IGAA 2IBZY 5JORA 3C8KA 3RKPA 4KROB 2J6EL 4ZPTB 2EH7H 2XI9A 3RL2B 4UV4H 5C09D 2QKIA 4RFNB 4LSPH 4XCNA 1QBBA 1HINH 1ZLWH 1QSEA 2WUCL 1JTPA 4WJ5A 4LEXL 1JGEB 5EBGA 5I2IB 2IPKA 3AM8C 1F8TL 1FZJA 4XNXL 1E28B 1GPOH 4JFHE 2IF7A 5FCUL 3BEWB 4P5MA 3WYRA 5DMJB 3EUUA 3HC4H 4PG2A 2NLJB 3B4NA 4OQTH 3VXUB 5ITFB 1T21A 4UT6H 3TN0A 5FF6A 1F02I 4F37K 3IU3A 1F2XK 4L3ED 4R6UA 1TQCC 2HT3D 4HKXA 4XP4L 2B4CC 4JDVB 4NO0A 1DEDA 3W9DA 1ES0B 2BY3A 3ESUF 2FZ3A 4NJAH 3P40A 4LPXA 1KXTB 1OGAB 1VB9A 1JFQL 1X3DA 2DMBA 4G5ZL 3RP1A 5GGQH 3HB3D 3WDHA 3LS5L 4HX1A 2BJML 4M1CD 4RGOL 4IOIB 3CFEA 3CIQA 2NXYC 4JE4B 3LEVH 1HSAA 4F7EA 2DI8A 3UJTL 1NCBL 1IAIL 3N85L 5I18L 5J56B 4Z7UE 1BM3L 4ZYKB 5LQBL 2DRUA 4R3SB 3RHWK 1HIML 1OAZH 3VG0L 4FFWD 4FA8A 3C6SB 3DV6A 4M1DH 4IOFC 2VDML 2CJUL 2P5WA 3MRRA 2NY4C 3QQ9D 2H45A 2AJUH 5C08A 2PF6A 1MHCB 3FL7A 4LLVB 5I1CL 1IKNC 4OI9A 5HYFA 1H8SA 2YPVH 1CR9L 4L4TA 5DQDH 1UXWA 3V8CA 1CTNA 2LABA 1T2JA 5D9SB 1HSBA 2HFGL 2XXCB 4HWBA 4XP4H 2IADB 2Q86A 4ZUTB 3DUUA 1J12A 5KTEL 4OLXL 4Q7DA 1V7MH 1UG9A 3WO4B 3D48R 1BZ7A 2G2RB 3FCTB 4L8CA 5ID1A 3FTGA 5E6IB 3IDXH 2XWJA 2VWEE 2XOTA 1HE7A 1R5WB 3D39A 1CXIA 4PV9B 1UZ8B 2NY3D 3B5TA 2QSTA 3KPLB 5IIEB 4H5SB 3HZYB 2BNQB 1NUGA 3REVA 1QVOA 2VC2H 2ZG1A 5DHVA 1UH4A 4TULH 1JGLH 2DTMH 1GGIH 3ELAT 3QXAA 4OFYD 3JVGA 1Q0XH 2GTWB 3STZA 3AY4A 3QNZA 3KXFD 4HFWA 1EH9A 4LIQH 4LNVA 4JY6A 5ILTL 1QLRA 4LCIH 5CSBA 1WIUA 1AGEA 2FEEL 4P5TB 1TVDA 5FGRA 3N9GL 1OP3H 1ZVHA 3QQ4A 1JJUA 3QUYC 4KI5F 1NC4B 4LBEB 3GNML 3EFFB 3VFWA 2AV1B 43C9A 1BZ9B 1IM3B 4K7FA 5GS1B 1SYVA 1GGIL 4HC1H 4YPGB 4PJ8A 3SOBL 2X4SB 4ONFH 1SVCP 2J4WH 4O58L 4H26A 2VWEC 3AB0C 4Z8FH 4HPYH 1WVZA 1VGKA 4LLAA 1HILB 4L5FH 4G6JH 5FDYA 2HKHL 1EVTC 1XF2A 3FT3A 2HRPH 5IVZB 3MRKB 3NABL 1YQVL 5FOJA 3S37L 4GBXC 2DQIH 4JKMA 3Q5OA 1FL3B 4K7FB 1AP2A 3FMGL 5C6WH 3H9HA 5LXGH 5IM7A 2HVKB 2ZPKH 3UTSE 4PJHF 4MNHB 5DD6A 1YDPA 1U8NA 2X70B 2NXZD 3GM0A 2BRRL 1D6VL 3WUZA 1RZGB 3MNZB 1NEZG 3MLVH 5CHNB 2QR0B 1H15B 1CL7I 3QIUB 4Z78B 2W9DH 4PGBA 3MLYL 1DSFH 2PXYD 1QVOB 4LAQH 5EUKA 3EOYG 2YA0A 3HZYA 1R3LA 1QSFD 4OCYL 2D7QA 3HI1A 4JPVL 4I0KA 5E2UL 1U95B 2DM4A 3BKCH 3RL1B 3RWGB 1ZOXA 1MNUL 1YEFH 1W2KT 3HPJA 4M7ZC 3JWOL 2WZPD 2R56L 4Y5YA 4NHCH 5AYQA 4BSWB 3MA7A 2KBGA 5EU7E 5JHLL 3C5JB 4JKWA 2EDKA 3BUTA 2XA8L 4E5XA 2AXFB 3P11H 4G3YH 1T1ZA 3H3PL 3T4YA 4PJGA 4NJ9L 5AZ2H 1OTSD 5KS9A 1XCQB 5HGGS 4OF6A 5ISZB 5MERA 4DGIL 4M6ML 4S1QH 5DHVH 1VA9A 5C08B 4K71B 5C71A 2A6JB 5D2LF 1WT5A 1U91A 3P9MB 4JKPL 4Z5RA 3OKLA 1DEEA 4EUPB 5GS3A 3RWDA 5EOTB 2ICES 3WXVH 3QUZA 1L7TL 1NLDL 1Q9OA 3KPOA 5EU6E 4U1HB 1VADA 4NO3B 4PS4H 5GRZA 4HUXB 4LSTH 1S7QB 1BD2E 4JB9H 3RGVC 5E8OB 5CJ5A 5INCB 2EDDA 5BV7H 5I1JH 3QISA 5DI8A 2CK2A 5FKAB 1J7VR 3PWJA 3EGSB 3SPVB 2I5YL 2CRMA 1T5XB 3ROLB 5ICXB 1CGUA 3ZKXB 2H26A 1HHGA 1CT8B 4D9QD 4ODWB 3BFOA 3SDCB 3UYOD 3T0AA 4G6KL 5E94B 3PHQA 1Q0YH 4RIRB 5IBTL 2VDKH 3MA9L 1L4IA 2HH0L 2VJXA 3ZLQC 2F5BH 2X7LB 2IH1A 3HPLA 4LOUD 4ZD3H 3MV01 5IB4A 5HDBE 3V6ZA 3UTSB 5SX5H 5I66B 1I8LA 4ZO8A 4K3GA 4RWYL 4MS8D 4U1KB 5I73C 2DYPB 3MRDB 5KSBE 4JN1H 2QQNL 1QSFB 2B5IC 4R4FL 5I0DA 4XBGB 2CPCA 1WLHA 4OLVL 1EO8L 1ZE3C 4JFYB 3QXDA 4QGYA 3WD5L 4ZTOH 5HHMB 2C9AA 2VZTA 1J0ZA 1G6RA 1FNLA 3VG9B 4X5WA 4GRLB 4X9IA 3SDXB 2WW8A 1G7PA 3VGDA 4G6AC 1IAOB 1T5XA 3QEQD 3ROLA 4HIJA 3WFEL 4PP1D 4NQED 5I6XB 4HHAB 1HOCB 1KNOB 3D18A 3L95A 5EA0H 3W2DH 3MNWB 1KCVH 5DF0A 1G7IB 2VMFA 3NFNA 1KENH 5ALCH 3MZTA 4RCAA 4UT7L 1OSPL 4AIZB 1P69B 1LO5B 4LIQL 5F1SA 4NO3A 3PNWA 1NFKA 3RU8H 3T3ME 3NCYS 4M03A 4PJEB 1T20B 1NFDB 3NA9H 2GSGA 1ZA6A 3FN0H 3RJQB 2AQ2A 4HJ0C 5I75B 1UCBL 3U0TB 4LFHG 4DTGH 5CD5D 5IMKB 5BS0D 1W72H 4MAUL 4MZ3A 1WIPA 3AU1B 1FAIL 1WV7T 2R8SL 5L88L 4QRTA 1S9XB 2VLKD 3ZTNL 3QZWB 1AHWA 4KMLB 4WNQB 1BQHA 1KCKA 4K2UH 2OR9L 4AEHL 4YBLC 5JR1L 3ZDYF 5FO7A 1PEZA 5C2BH 5I8CB 4L4TE 3DSFH 5GRYA 2I60H 4OV6F 3KLSA 1S7SA 3U79A 1QYGH 2CKBA 4YC2C 3I6KB 5EBWB 1IC7H 3W0WE 1S5HA 2CSPA 1NCTA 4KPHL 5HI4C 1M6OB 5TFSH 1JWSA 4OD2B 5KVDH 4NCC1 1PYWB 2CLVB 4NN5B 4G9DA 5F72S 2BMKA 4JFEA 1F6AB 1W0VA 3EYUL 4YHOH 3S36H 2NR6C 3QQ3B 1F3JA 5DJ6A 1J1XH 2HKFL 2J8UF 2AGJH 4FN0A 4NZTL 1G7MA 3FQTB 4GOSA 1VCAA 3VJ6A 4Y4KD 1TNMA 2VR5A 3KPNB 1RZ7H 1A6VL 5DSCB 5F3BA 5FUOH 1N0XL 5CIPH 1YMME 1JTTA 4HIXL 2BNQE 4YFEA 3CC5B 1T22B 5D70H 3KYKL 3KWWA 4MJID 3BAEH 1PDKA 5JQ6H 3RDTB 1AO7B 1WAAF 3C2SA 4OCXH 3GJFA 4LCCA 4YHZL 3UDWC 5BVJB 3BQUB 4XNYL 1KYOK 1QP1A 2EDYA 4AZ8A 1XGUB 2SEBB 4ZFOL 1KIPA 3MACL 3OB0K 3T0EB 2NY1C 3ESVF 2DIAA 4PBXA 2AGJL 1KTLB 3UTZB 3VWKB 1FLRL 1OT1A 2Y06H 2K7QA 3C87A 4MD5B 2AAVA 4KKAD 3QFJB 4NRZB 4PJ9A 3BT2H 1ZWIA 4PJ5A 5JHDD 2RIKA 1KB5A 4EN3C 4F7CA 5BV7L 2DYPA 3MRDA 1M4KA 4KKBD 4NQEE 1MLBB 2PXYA 3KLAA 3E6HB 4P2OB 4YXKL 4JVWA 3MGAA 4XP9H 2R4RH 2X4QA 4KHXL 5D2NC 1DN0A 1HCVA 1YEHH 3O81A 1A8JH 1XEDA 2IBBA 4LSUH 4EIGB 3QRGH 3GM8A 2YKLH 4D8PA 3M07A 1C16A 2YA2A 3U9UA 2XZCL 1AE6H 4AG4L 4I77L 1X5LA 2P24A 4WCYH 5E99L 5FK9A 1L6ZA 3UTZA 1ZV5A 3DX8A 4D0DA 3SDDA 3T0EA 3G6DL 3ZT5A 3ARVA 1T2QH 4WY7H 4HIHA 4Z0XA 3C5ZA 1OP9A 5HGHA 1Y6NR 1OY3B 3MRKA 1YMHB 2FX7L 1BFVL 3VFNA 1T89C 5GRVK 3QDMA 4LPVA 1Q72L 4Y1AA 3GSVA 3CMGA 1A47A 4O9HH 3NBNA 5I73B 5DSCA 2V2TB 3VCLA 3BIBX 4Y19B 3STBA 4ODVH 2ZNXA 5B3NA 4AQOA 1JRHI 1B9ZA 1OW0C 3CX5K 1ZEAL 4U0RC 4YGVB 3T4AB 5EOCL 4P23C 3O4LE 5D8JL 4X6CF 3GMQA 1CVSC 3CVHH 3BD4A 1QLRB 3G6AB 3DXAE 5SWQB 4PJBB 2VZSA 1JMXA 3NH7H 4ZUUB 4IIQC 3MV7A 5GS0D 4JFEB 3RWGA 5HPOA 4PJCB 5D5MB 5D7LD 1NDGA 2XKUA 3SKUD 3TBSB 4YJZL 3WV0A 4HUUA 3GMNB 4I4WB 2ARJA 4QGTA 5JTWA 3NZHH 2NLJA 4H88H 3QUXC 1F4AA 5DRZA 1TZIB 2XTJC 4PGBB 5DS8B 3UJIH 2AI0H 1N2RA 1ZSDA 2VN4A 5T3XH 5IJVA 5J3HC 5HHQB 5DUML 3PABA 2EH7L 2JELH 4HC1L 1JNHB 1U8NB 2X70A 4QRSA 5IBUG 4G80A 3RA7L 3L3IB 2J4WL 4O58H 4XVTL 3IDYB 3Q0HA 4Y2DA 3DROA 1LE9A 1A1OB 3SY0B 1RJZA 4MXVE 4WIQA 2DMCA 3FN9A 4LOUC 3GMPB 4MA8H 1VGEH 4OZIB 3EJZD 1F58H 3LB6C 5AD0B 3P30H 2R2BB 4PG9B 2IJ0C 4AEEA 3MLRL 3INUL 4PRIB 3BRDA 4TRPH 2DLHA 5EN2A 1BLNB 2GSIB 4PJ8B 1T03L 1I1CA 4MZ2A 1Y6KR 3T1WA 1V3JA 4YDIH 5AG8A 2HLAA 3LCYA 4B7IA 2G5BA 1EIBA 2F19H 4PRDA 2JJUA 3MLZL 4JFXB 3MRFA 3ZKNC 1A2YB 2QBWA 5HHNA 5BZWA 2FZ3B 5HVFB 3GKZA 1HHJB 4Y2DD 1MCPL 2IPUK 4YHPA 3QWRD 4PRBB 1YNKH 5GHWH 1IBGH 1YY9D 1ZLUH 3L1OL 5IQ7L 4FQXD 4DEPB 1OLLA 3GSUB 4QRPD 1NGZB 3O9WD 1GGCL 2UYLB 3SE3C 1A64A 1T4KB 5FCSH 1CF8H 2V17H 3OKEB 4I48B 3BEWA 4BJLA 4XXCA 1FVCA 1V3LA 4P2QB 2A77H 2MQ3A 4O9HL 4LSQH 4F7MB 1YJDC 1ND0B 4LNRA 3L3JB 5GGVY 1MF2L 3VWJC 4RGOH 3JWDC 1QPPA 1UA6H 1U8PB 3N1MC 1FVEA 4XPGH 3UTTE 4N8CH 4E41A 2LV4A 5FOBA 3PXHA 1TJGH 2JLLA 4DFIA 1GGCH 3HNTH 3TPUB 5BOPA 4TQEH 3MLZH 3OPZH 5DFWH 3BJ91 4WWID 3FFCE 3V6OC 1EEZA 5BJTB 3QCTH 1I8MB 1EAPA 3ZHKA 4QTIL 3E2HC 3P4MB 4L4TB 2A1WL 3H0TB 2JK5B 2VDPL 4I48A 2QADD 2Z92B 3OKEA 4B0MM 4HAFA 3PJSB 3ULSA 4PB0L 4FQXC 1ZTXH 2AABL 4KQ4L 1QG3A 3VMOA 4DOHB 5TDNB 2QSCH 3DBXB 3O9WC 4CDHA 3BP6A 2V7HB 3QDGA 4QNPE 4U1LB 4XNXH 3A6BL 2CLRB 3Q5YA 5MERB 1OARL 3JTSA 4ZO6A 1CIDA 1IGTA 2F8VA 3OKMB 5JPMB 3MRFB 1K2DA 4QY8A 5I1DA 5IGXL 3GBML 3WFDH 1NUDA 5B38B 4M4RA 1QBLH 4TOYL 4U6YA 4WV1A 4FQJL 1T83C 2CR3A 3KPRE 1KIRA 1INQA 5F9WC 1DQLL 3STLA 3DO7B 3VMPA 1FL5A 2JIXA 1YYMH 3IU3B 2Y5EA 4F58H 4LPYA 4ZQKB 1OARH 3JUYA 3CMOL 3B3IA 2GKIA 4Y0GA 5KSAB 1KCSL 3S5LB 3U7YL 4ZDHB 5IVXB 4NQDD 5CWSB 4K7PH 4P5MB 4WEMB 5EOCJ 4GG6E 3G5YA 3AAZB 3DJ9A 5KVFH 2XWBB 2BNQD 3O3DB 1UWEL 5DUMH 4WJ5B 1MHHB 5IKCA 4CL7A 4QRSB 2AEPH 4PJ5E 3C5SA 4L4VA 1SY6L 4KK6C 5D7KE 3W5NA 3REWA 1EEYA 3MRNB 5JOFB 1S7XA 2J5LB 5A3IC 2JIXB 1QBLL 1FFRA 1YDPB 3O6FB 2YUWA 5ANMA 4YNYB 3PJSA 1A6TA 2D4DA 4JO4H 3K81A 3TEUA 5F8RC 2X1WL 2AJSH 3EJYC 2VE6B 2WQ8A 3MRBA 2ZCHL 2ARWA 4JAMA 4FTVE 2DYPD 5GZND 2EC9U 4M5YL 3OKMA 3CNKA 4ELME 1NMBL 3QG7H 3DGGA 2BNRD 4CUCA 5T5NG 2P42B 3KPMB 3X3FH 2GJZB 3MREA 4TTDD 1MCNA 3CFJB 3NPSB 1CCZA 3L3JA 5LCVL 1BIIB 5JHLH 1X5XA 1A3RL 5C2BL 3K80A 1EJ6A 1YQ2A 5K9OB 1CL7L 2C5DC 1Q9WB 2YPKA 4XCYB 1FZKA 3NA4A 2UYLA 1FIGL 3NABH 3ZTJG 3N1QC 3TH3T 5CLWA 2YD6A 3BX7C 1EBAA 1I8IB 1LVEA 1QNZH 3I6LE 1A3RH 1PZUB 5FHBL 4MA7L 2X89D 2HMIC 3SE4A 2RR3A 4NNXA 5IVOA 5J0BA 3C5ZB 4UAOC 2V5SA 1G7LB 2PTTA 5C0BD 1PY9A 5FEBA 4K7PY 3U7WH 3O8XD 3CUPA 3EYVB 4XAKE 4QLRA 4PJAF 1Z9OA 3SDDC 5H35A 3MV11 1C12B 1W0YT 2VLLA 5TQ2H 4LMQE 4LSVL 2Q8AL 4TUJB 2JELL 1YYLH 5FGCE 4BZ2H 2QSQA 3CH8A 3QI9C 1LEIA 4XAKD 3QI9A 1XFPA 4KKBC 4FP8H 5C9KA 1KB9J 3KLHD 3EKCA 1MPAH 4JJ5B 5E8PA 3RUGB 4BKLA 3LV3B 1QQDA 1N0LA 2IPTH 2E6PA 5D6CB 4U6HA 3HZKB 1CE1H 3X11B 4FZ8L 4XRCA 1QRNB 1JNNH 3NIFE 1SJXA 3D3VE 2I25N 3VI4E 1J1OH 5C08E 1T6VN 4PR5A 2VABA 5EBLB 1UADC 2IAMB 1EBPA 2ZWLT 4PY8J 4P4RA 1FC2D 32C2B 2BSTB 2OQJB 4EQ3A 1OGAA 4LSVH 2Q8AH 3IKCB 5IB3B 5B39A 3T8XB 4PJHA 4YHKL