4PGEB

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgnypaw
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgeB00
4OZIF 4ZMAT 4ZOEA 4YHOH 5D8JH 2NXYD 3ORJA 3RVXD 3QEGL 3FN9A 4XNZC 5A2KH 5GRJH 5T5NG 4PR5B 5DMYA 2CDFB 3G5XB 1GZPB 5E94B 3B5HA 4FZ8L 3WKMH 5FV1L 5FYKH 1G7JB 2VRAA 3IXTA 1OGTB 4FN0A 2AQ3A 3C8KB 3QQ4A 3UZVB 1CGSL 3IDNA 2EIEA 4P2QB 5IBTH 4QRQB 4I77L 1OHQA 3VXSD 3PJSB 5B39A 1G9MH 4P46B 2EE6A 1HH6B 2D03L 3OB0H 5H94A 4NQDB 4RISH 4MJIB 5D2NE 4J7RA 1RVFH 5L0QC 1C5CL 1C5DB 1CDJA 4NNPL 5JHDE 2DLFH 4OZHE 4Y5XA 1I7TA 3IB4A 4CVXB 5EWIL 3GRWA 1ZVSA 2PTTA 4YBQD 5CIPB 5HD8D 2ITCA 4QWWD 1ULVA 4P23D 4W81A 4MVBC 5DRZA 1P6AB 3V4VH 2FNBA 3BKMH 4KJPC 4ZS6C 3ARGD 1R3HB 3INUH 3MRBA 3OAZH 1MRCH 3MA7B 4NDMB 4O9HH 4G43A 2BNQD 1ZS8B 3LRSA 5E70A 1CU4H 4R4NC 4Z7UE 4U6XA 3U46B 5L2JB 1QHPA 2ZJSL 3BFOA 5BS0D 3SY0B 3D39E 1MWAH 4XGZB 4ZUSB 4F7PB 4I48A 2ZUTA 4OCXL 1H8SA 4WHCA 5DMKB 1MEXH 1AXIB 1BLNB 3FRPA 1A6ZB 3K1KC 3IJYA 3CVHH 3IU3B 3RWGB 4ZNEA 5IUSA 2XQBL 4P2OC 3H9ZA 4EN3A 4PD4K 4S1DD 5GS2H 1QKZL 1VENA 1LO0H 1X5AA 3QIUB 3HC0B 2HKFL 4UMGA 1NEZA 4KJYA 2IH1A 4GW1B 1PLGH 4RAVA 4Q6IA 3VRJA 4XNZB 3KDMB 5J12C 1WC7A 3MNZB 4HKBA 1ZGLA 1FO0B 5E2VL 4CJ0A 2ITDA 3VFSA 3GBNL 3QJFA 2AK4D 5C08D 1A9BB 2O5XH 5HHOD 2E6PA 3SKNA 1FO0L 5ADPL 5C0JB 2FHFA 4JFYA 1LE5A 4PLJC 5DS8B 1K2DA 4OF8A 1CVSC 1RY7B 4EI5C 3IFNH 3PG2A 5I1HH 3HC3H 4ODSL 3KXFB 3MRFA 1URLA 4HX1B 5F9AC 4C56E 5BMFH 5HYQA 4S0TD 3KPRE 4J6RH 4L29A 1MHHA 5E99L 4BELD 5I75C 1B0GB 5L0QB 3QUXD 4HV8B 1A6TA 2DI8A 4JO1H 5EBLA 1IQWL 4D0BA 4ZXBD 5I8OL 5SX5K 4WW2F 4NZDA 2AJVH 4OGXH 1QRNB 4M61B 1HYSC 5ECJE 1CXFA 3MRHB 1IEHA 3QEQB 2DTMH 4PR5A 2CDFA 1RHHB 3NFSL 1TTUA 1GZPA 1AC6A 1YY8B 3I9GL 4QXGH 2A73B 4EI6A 1YEGH 5C6TL 1G7JA 1OGTA 32C2A 3C8KA 4ESKA 3ZKND 4PFEA 4P2QA 4NKDB 3MLSL 4N1HB 2ZSWB 3PIQB 1EK3A 4P46A 5EFIB 1FFPB 1HH6A 4NQDA 2EH7H 5LCVH 4JJ5B 4XP5H 1CS6A 2YD5A 3IRZA 4MNHA 5SX4I 1C5DA 4OZFB 5GGSY 4P2OB 1J0JA 4LSSH 3S35L 4CVXA 4M48L 5CIPA 1D6EA 5HI3D 3RUGF 4X83A 4P99A 1Z9OA 1JGLL 3UXFA 1R3HA 4WHTB 5J12B 4J8RB 1FN4B 4M62L 4NDMA 2H2SD 4WI7A 4UTBL 2FECI 3MCLH 3GSQA 1I1AA 2R0ZL 3NIDF 3U46A 5L2JA 1VFUA 4HLJA 1B3JA 1JF1B 2G5BB 1DUYB 3O3UN 1ES0B 5C0IB 1GOGA 4NOFA 1MCPL 5H8DA 5HXMA 2KUTA 4GO6B 4F7PA 4XGZA 4ZUSA 1WIPA 4EI5B 1BLNA 5FHAH 1TZGL 1T20B 1IL1B 1A6ZA 5FYJD 3BSZL 3BGFC 3RWGA 4LLWB 3KLHD 5GQBA 1LNUB 5I75B 3NPSC 4UV4H 3S97C 3OAZK 1MF2L 4TVPD 4R4FH 4MYWB 3HC0A 5B39G 2F5AH 4LPCA 1I3UA 1P84K 2F58L 3NABL 1UKQA 3CMGA 4GW1A 3MV7E 2QADD 1AJ7H 1KJVA 2Z92B 4AK1A 3IVKA 4XX1G 1V3MA 4YDKL 2GTWB 4NRYB 3MNZA 2DM3A 3MJ9H 4POZD 1FO0A 4UDUB 4GAJL 1A9BA 4JZJC 5HI5C 5E56A 4KI5D 5D93C 5C0JA 2BXYA 1Q1JL 2R0KL 1T5XB 3FB5B 2YWZA 5HDBE 1ZANH 4WI2A 5ADOL 4NQVB 2P8PB 1MHCB 5GISH 4EXKA 4M02A 2DQFB 4XNYH 1B0GA 2UZIH 2NY0D 4HV8A 1LP9E 2YPLA 1MFCH 4TUJA 4N0UE 3WD5H 3LKRB 5C0CB 3FB8A 3FRPG 4M61A 1MHPH 4WFGE 3MRHA 4ZNCD 3RJDA 1RHHA 1YY8A 1EUTA 1NGYB 5A2LH 3BN3B 2A73A 3EYFA 4XCCH 4F37F 1GJIA 2VN4A 2QEJA 3ARGB 1MCNA 2NR6D 4LF3B 1NEZG 5B21A 3WIHL 5DVMA 5DEFB 4LCWD 1E4XL 4QY8B 2ZSWA 3PIQA 2OK0H 5EFIA 4XBPA 2NW3A 1FFPA 4X6DF 5K9QI 3VFUA 2VXTL 4Z8FL 5CZVH 4R2GD 4LARH 4JJ5A 1Z9SA 2K3TA 5I30H 5KW9H 3BGFB 3ZDYF 5CJOH 4YFDB 3OB8A 2IQAB 4JVPA 4OZFA 1RIUL 3NPSB 4P2OA 4HXAH 2HKHL 1IBGL 1VADB 3MV8E 3KWWA 1KELL 1ODAA 2D3VA 1KCUH 2HFEB 4XPFH 1E6JH 1FSKC 1U8NB 3O2VH 5B3JE 1BMGA 4WHTA 1S5HB 4J8RA 4IDLA 5ETUA 1HE7A 1I9RL 4WU5B 3BW9B 3FN0H 4LSPH 4D0DB 3HNSH 1NBQA 1FRGH 5C0BD 1JF1A 2G5BA 4JZJB 1RJZB 3LKOB 5C0IA 1ES0A 1CDCA 3QA3A 2OZ4H 3N1MC 5D93B 5TH2B 2CKBL 5C08B 1KGCE 1KPRB 5HHOB 3ESUF 1KLGB 1I9JH 1T20A 3CX2A 4PRNA 1IL1A 2DMKA 2DQTH 5I1IH 1JE6A 1CFNB 4K8RD 1VB9A 4LLWA 4JQXC 2WIIA 4P0DA 3VFGL 4AY0A 4JFFB 1A8JH 2YHGA 3SGEI 1FNEB 3QEUB 1U41A 5E6ID 5IB2A 3OXSB 1NKOA 2H6PB 4MNGE 1A64A 1C1EL 3WFDH 4BZYA 3O45B 1DLFL 2Z92A 4QXUH 1H9VA 4FOMA 4Y8AA 1EO5A 1F97A 3OG4B 2D7OA 3BD3A 4HIXL 3ILPB 4JCLA 4DGVL 4NRYA 1PG7W 4H8WL 3B5TA 4AEHH 4I5BB 2G75B 4OCMC 2HLFD 3FFCB 3W81A 3NAAH 4UDUA 3TO2B 4OLXL 1BIIB 3HG1B 2EO1A 5E9DE 3UCRA 5TPWL 4X7EC 5I1JH 2EEDA 3S36X 1J05B 4F8QA 2DQHL 4KKLC 1EMTL 3FB5A 5D71L 3HI1A 5FCUH 2J8OA 2JTDA 4M43L 5JO5B 3ZE1E 3SQOH 4PG9B 3NZHL 4K7PX 3ZHKA 1ZA3A 4OT1L 4NQVA 2DMBA 1GGBL 1FAIH 2P8PA 1MHCA 2DQFA 3CFCL 3GSOB 3QXDB 3DO3A 1IFHH 2YA2A 2CRIA 1CGUA 1WFNA 4ELMF 4P9HL 3QIBC 4M93C 3VGGA 1X4ZA 3IU4L 5C0CA 1ITBB 2EXWD 3QUZC 4NJ9L 3RWJB 1FSKB 3IJHB 4GRLD 1JNHB 3WIHA 5IGXH 2VDQL 3ULUH 1HNFA 4JLRB 3GDBA 5DEFA 4GQ9L 3ESVF 4V2BA 4QY8A 4JCMA 5JHDB 3PXHA 5D7IB 3DGGB 1KJ3L 4GXUN 2JB5L 3QHTC 5FYKD 2IQAA 3SOBH 5KJRL 4X4YA 2R1YB 3MXWH 3QJHB 4HC1H 4TTDD 5BJTB 3I3BA 5DGRA 1C08B 1LO2L 1GVIA 1J0IA 1TLKA 5BVPH 1U8NA 3BDYL 2IPTL 3T3PF 1S5HA 5DMGD 4WU5A 5EIQA 3BW9A 2WLZA 4D0DA 1QFWL 1KBGH 3WFCH 5BRZE 4JZJA 1RJZA 2LAAA 5IQ7H 1T2QL 3NCJH 3U7YL 4L3CB 2VISA 3ZT5A 2YC1B 1IQDB 1ZVYA 4GH7B 3TNMB 1BP3B 3LKPA 4BFEA 1KPRA 1VESA 4G9DB 1BM3H 3UJIH 4JRYE 4MXVE 4YHPB 4Y16C 5BV7L 1TJGH 3MODL 4PBVC 5BVJB 1QSEE 1CFNA 2F74B 4BH7B 5ITBH 4JFFA 1CL7I 2ENSA 1NCUA 4JFDA 1FNEA 3QFDB 1DR9A 3BKCL 3QEUA 1JHKL 4K8RC 3D85B 3OXSA 4K3JL 3QIBB 4M93B 2H6PA 2W60B 3QFJE 3O45A 5DVOA 1T0MB 2CRMA 3QUZB 3N1GC 4IHOB 5TE4H 3DV4B 2HTKC 3EOAB 3ILPA 4KRMB 4OZFG 4I5BA 3I6GA 2G75A 3ZSSA 3FFCA 5HJ3B 4M00A 3TO2A 1BIIA 2MCPL 3HG1A 4C56B 4L5FL 4P4KD 3ULVC 1X3DA 2X1PA 2XZAL 1J05A 2NXZD 4O58H 1KN2L 1SJXA 2H32H 3BRGC 3HMXL 1BOGB 1OAQL 5IB3B 1CR9L 3EAKA 4JO2H 1KCKA 3I02B 5JO5A 4PG9A 3W2DH 2QQKL 4XHJD 4ERSL 3HHRB 3BOVA 1L7TH 5DZOA 1CBVL 2VLRE 5IEHB 1AD9B 3GSOA 3QXDA 4WWKC 3MLRH 4TVSa 3H6JA 3IETB 3V0WH 3QHZL 5FGSA 2RR3A 1OTUC 3GNMH 5FM4A 1DSFH 4TRPL 4M7LL 1HHGB 1V8HA 3RWJA 3DTXA 3IJHA 1M4KA 4NZUL 5E00A 2E5EA 1DZBA 4MX7A 3WE6A 1OPGH 4DKEL 4E42B 2IC2A 1Z3GH 2CIIB 4LIQH 3EO9H 3LS5H 4AJ0A 4ZAKD 3FAXA 2E27L 3BYYA 4JLRA 4JHAH 4X9FA 5JR1H 5F44A 3OAUL 4X7SL 5JHDA 4OZHA 3QUKA 2CO6B 3EDJA 4Q2ZB 3S4SA 1N0LA 4XRCB 3LQAH 4Y16B 1G84A 3EZ8A 1RMFH 4JQXA 4PGJA 3MRCB 4DQOH 3TT1H 1DUZB 2R1YA 4XCFH 3QJHA 3C2AH 1YEFL 1BVZA 2BSTB 1FP5A 5BJTA 1KLUA 2J3SA 4P3CH 1JPSL 1C08A 4U6YA 3F62A 4LCIL 5EBWA 5M7QA 1AI1H 4Z95L 1CVRA 4K8RL 4DK3A 2KKQA 1H3VA 4BQ8A 2R1XB 3D39A 4JKPH 1YQVL 3UTSE 4LFHD 4PJFB 1G9MC 1PQZA 3QEHB 1AHWC 4X6CB 5CILL 5CGTA 4NZRL 3DOSA 2YR3A 1MFNA 5CD3B 3QNYB 1NCCH 2OLDA 3MUJA 4L3CA 3BWAB 2YC1A 1IQDA 3X3FL 3ULVL 3I50H 5KSBE 4G9DA 2IMNA 3MNWB 1AGCB 3DWTA 4YHPA 5JA9A 1BJMA 3BMVA 3LEYL 5BVJA 1FAKT 4BH7A 2UWEF 5ANMB 3MV7B 1CK0L 4WWKB 1UJTA 2YEZB 3QFDA 4RBPH 3QCVH 3D85A 4GAGH 2AXFB 3QIBA 2W60A 1IT9H 4Q0XH 1U6AH 1QFUL 3DV4A 1NGPH 3EOAA 2WP3O 4KK8C 3IXAB 5HJ3A 3RIAK 1F4XL 3IDUA 1T0NA 1NFDF 4C56A 1NGQH 3WN5C 1YNKL 1QSFE 1I3GH 2RCSH 4OD1H 1W2KT 3U7WL 3ILQC 2Z8VC 1BOGA 3TYFB 5C7XH 5IB3A 5IW1B 4A2LA 1MCIA 3Q6GL 1UKTA 3I02A 2AGJH 1FZJB 4WY7L 1QD0A 5FYLH 2VDML 4OSUH 1AD9A 3AUVA 1MFDH 2X1WL 4YHOL 5D8JL 4KJQD 5DJZA 3UAJD 3O4LD 4U1MB 1NFIB 3JBG7 5GRJL 1K3ZA 4LHUB 1HHGA 3SKOB 3WKML 4GRMA 5FYKL 1N5AB 5MENE 4E42A 1CD8A 5JZ7C 4YDJA 3ARFD 1AHWB 5IBTL 2EYRB 4PJ8D 2V6HA 5GGTH 3MRIB 3MRMB 5C9JB 1G9ML 3PP3H 5K9KB 4HKXB 2VXSH 3CIQA 4F80A 3PWVB 2GIYA 5I1LB 1L7IH 3SJVE 4FQLH 4Q2ZA 1Q8MA 1RD6A 4RISL 4XP9H 4XRCA 1BECA 3F7YB 1RVFL 3HE7C 5BQ7B 4KK5D 3H2WA 4Y16A 2DLFL 3SDAC 3SGEH 2XA8H 3MRCA 3UBXA 2AEIT 1DUZA 5MERB 1C5BH 3FOLB 4WUUE 1JRHI 3V4VL 1Q9KB 2BSTA 2CK0H 2YPVH 3BKML 1YPZF 4PJGE 2DKSA 5CSBA 4ZG1A 3INUL 3L3HB 4A2MA 1MRCL 4BFIB 4QOKB 4O9HL 3UP1A 3DVNB 1IAIM 2R4SH 4P5TC 1CU4L 3TFKD 2R1XA 4J3VA 2C9AA 2GT9B 3CLFH 1YY9C 1MWAB 3FB7A 1UXSB 4L9LC 4PJFA 1EH9A 1MRDH 4X6CA 3H9SE 2VDLH 1MOEA 1MWAL 3U82B 4NCDA 3QNYA 2JIXB 3CVHB 3WN5B 3D25B 1MEXL 2XFXB 3ZTJG 3BWAA 4AEEA 3QBTB 2C1OB 1VEOA 2FJHB 3GMQB 4OLWH 4XP4H 3S37H 3CVHL 3SDYH 3FO0H 3MNWA 2Q76B 1AGCA 4I0PC 4LLUB 5ISZD 1P4BH 4N8CH 1XR9A 2RJMA 4MNGB 1RUPH 1LO0L 3DETC 1SYSB 1VSCA 3MV7A 1JTOA 5J9PB 1AO7B 1GC1H 2H26B 2YEZA 8FABA 4MQTB 5DEGB 1PLGL 1DBMH 2AXFA 1GHFH 3S4SG 4G7YH 3UTZB 4NRXA 1UENA 3I6KB 3LN9A 1WZKA 3MBXH 2O5XL 2HJFB 4C55A 4G8EB 5DMIH 3ARXA 4MS8D 3IFNL 2VSDA 5I1HL 2BRRH 2ESVE 3HC3L 3WYRA 3UPAA 1KIUA 3EYUH 4XXDB 1WTGT 4HIHB 5BMFL 4JY6B 2FEDD 3TYFA 1LP9A 4RFEB 4J6RL 5LBSH 4KDVA 1TETH 2FJFA 3HE7B 3GSRB 2VDPH 4HH8A 1FZJA 1KB5H 4JO1L 3SDAB 4NN5C 3B9KC 3O2DA 5EZIH 2AJVL 4OGXL 4ENEC 3BKJH 5L88H 2R9HC 4LCYB 4N90D 3I75A 1M1SA 5AD0B 5LVEA 2DTML 1CFQB 1JGVH 2BVEA 4LHUA 3W11C 4C58B 4OV5B 2HA1A 3DXAD 1CIDA 2P8LB 2CJUH 3PWNB 5T1LD 4I2XE 4QXGL 3SKOA 1YEGL 4P5TB 3RBSA 5C07E 2H2PD 5ACMA 4M6OH 3DBXB 4L9LB 2PYED 1AHWA 4YE4H 2EYRA 1CE6B 3MRIA 3N85H 3MRMA 4YLQT 5C9JA 1BQUA 1QR4A 5K9KA 4HKXA 3PWVA 3ARFC 4UAOB 2EH7L 1M71B 5LCVL 1RUQH 1FNHA 4XP5L 1D6VH 3F7YA 5CEZE 5BQ7A 4I0PB 5HPMB 5L2KB 3MV8A 1XGUA 1ZHBB 4LSSL 5KS9E 1CL7H 4KH2A 3TVMD 1QTYT 3ULUD 3EJZC 1EPFA 1EFXB 5DFVD 2RGSA 4KK5C 4Z7NF 3CFJB 4R7DA 2VLJE 4N0CD 2ADFH 3FOLA 3RX8A 1Q9KA 1S7RA 3ME0A 3L3HA 4BFIA 4QOKA 4I4WA 4JN2B 1IJ9A 3VWJC 4F3FA 1S7UB 3VD5A 4CW1B 4HUKB 4E5XB 4WFED 3MCLL 2XG4A 4NT6B 2GT9A 4K3GA 1MWAA 4QHKJ 1UXSA 5HHNB 3THMH 2AERT 3P4MB 4LDEB 5E5UB 4JEGB 3UX9B 1AR1C 2JIXA 4BK5A 2X4RB 3QRGH 1BBJB 3WN5A 3D25A 2BCKB 4F58H 4P9MH 2XFXA 5FHAL 2C1OA 1J87A 2FX9H 2FJHA 3GMQA 4YDIL 2OJEA 1ZLVH 4ACPA 3QXVA 4OLYH 1JTPA 3CZFB 3N1QC 4G6FB 3L3JA 4UV4L 3VI3E 3QFJB 4MNGA 2VXVH 3LQZA 4NCC2 4R4FL 1SYSA 4NN5B 3B9KB 4XB7A 2F5AL 1AO7A 2C3XA 2YPLD 5F1IB 5DEGA 2SEBB 4S0SD 1T7ZA 2FDBP 1AJ7L 2BVQB 3M45A 1WIUA 3U30C 3RP1A 1N8ZB 4C4KO 3HAEA 5E9DA 3UTZA 4FQXC 3I6KA 3OV6A 3MJ9L 3RU8H 3MMEB 5SWZE 3UBXG 4RSVA 2HJFA 2X4SA 1D5ZB 1NANI 3P4LA 3HUJF 4ETQB 4LSVH 4XXDA 1CLZH 3ARFB 1ZANL 1IEBB 1OAKH 4JY6A 2CRYA 1EEYB 2ZOKB 4FXKB 5GISL 4YH6A 3T77B 1ORSB 4XNYL 3QIWC 3HE7A 2UZIL 4XWOD 3GSRA 3G04B 4R3SB 2Y06H 5C3LD 4YXLH 2FEDC 3QDJD 2HLAB 4K2UH 1MFCL 4L3AA 5IM7B 3WD5L 1QLRB 5DQ9B 4LSTH 1MHPL 4LCYA 3U83A 4WI8A 1KB9J 4XNQB 5AD0A 1CFQA 1A22B 3G9VA 4OV5A 4JB9H 2P8LA 3VWJB 4RMTA 4XCCL 3IDIB 2UY6A 4P5TA 3GEWB 3KJ6H 5SV4A 3DBXA 3NCCB 4L9LA 5GSRB 1OVZA 1CE6A 2AJUH 2M2DA 2HMID 3BZEB 2OK0L 4XAKD 1AH1A 3RDTD 2VQUA 1BF2A 1MELA 3B2VH 3D69B 2NY6D 3LZFH 5CZVL 4CJ1A 1M71A 4LARL 1EDQA 3FAWA 5I30L 5KW9L 3V79C 5CJOL 3L5WB 5HPMA 4YNYB 5L2KA 5CJQL 1EV2E 1ZHBA 4Z5RA 5KBNC 1LK3H 4HXAL 2WW8A 1U92B 4RMWA 2R0WH 1UZ8A 1EFXA 3CFJA 3BKYH 1KCUL 4FMKA 3UTSB 4XPFL 1E6JL 5BCAA 4JPIB 3O2VL 6FABH 3ULUC 3VXRE 2DM4A 3GMOB 3U30B 4JN2A 3CGTA 4X8JB 5BRZA 1S7UA 4FQXB 4XNMB 4CW1A 4E5XA 3FN0L 2B1AH 5A2FA 1PD6A 4LSPL 3HNSL 4M3KB 4NT6A 4UOW0 5HHNA 1FRGL 2XI9A 1FVEB 3CFBB 3P4MA 2OZ4L 4DK6A 3BIAX 1F42A 1GGTA 5F89B 1A1NB 1BBJA 2VKXA 4LHUG 2BCKA 3QRFM 1DFBH 1I9JL 2DQTL 4WTWA 2AVGA 4M03A 5I1IL 3CZFA 4MA3B 2D7TH 3QIWB 3CFDB 3QFJA 5EU4B 1II4E 3NBNA 5C3TA 3PHSA 3B9KA 3F58H 4X9IA 3WCYA 5LGHH 5T5FH 3CU1A 4LPWA 5F1IA 5FDWB 4HUUB 3WFDL 1KCLA 3K2UH 3P0GB 3EOYG 4QXUL 4QRSB 3JSSA 4PRPD 5IJVB 5EOCJ 4AEHL 4YFLF 3O3AB 2EDRA 1HOCB 4GKNB 1KPUB 2CLRB 3OKNB 3KPNB 3NAAL 3PV7A 3MMEA 1JGEA 3V6FB 1TQBC 1BZ7B 5I1JL 1ZLVK 4ONGH 1J1XH 1E4KA 4XBEH 2V5YA 2V7NB 5FB8B 3DPBA 2X41A 1F58H 4ETQA 1PX3A 5FCUL 3NPZB 1IEBA 3SQOL 2BP3A 3TPUB 1EEYA 1FAIL 2ZOKA 4FXKA 1FNSH 1JIBA 3T77A 3WDIA 3G04A 1IGJB 1IFHL 4R3SA 5JDJA 2W0LA 4AEIH 1NDMB 2HLAA 1BQHA 5IM7A 1JRHH 1P6FA 1YYLH 4GAYB 4JKKA 5DQ9A 4MHHG 3UTTD 5EO9A 3MROB 1JUFB 2F54D 4XNQA 3S36H 2JCCE 4WO4D 5CLTA 3RY6C 1DBJH 3VWJA 5IGXL 3ULUL 3SJVB 1J8KA 5FYLD 2HJLB 5KOVC 1IKFH 1S8DB 2ED7A 4K7PH 5CP3H 1S7TB 5GSRA 3S34H 4MAUL 2P42B 2WWKO 2FLRT 4HWNA 1EAPB 4AM0B 3BZEA 3FOMA 1J11A 4HS3B 5I8EB 4NPYB 3HAEG 3D69A 1BBDH 3O41A 2R23B 5EIIB 2MQ0A 5E8NB 5ID0B 4WUUB 3L5WA 1WICA 3MLWH 3SOBL 3FZUC 1U92A 3MXWL 1CICA 4HC1L 5I71C 3TH3T 2XY2A 4LDOB 3UTSA 5BVPL 1GOFA 4JPIA 2VAAB 1AE6H 1G1YA 1NCWH 3GMOA 2P5WD 1A0QH 4LASH 4X8JA 3OBAA 1KIQB 1CGTA 3KNBA 4YGVB 2OZ4A 1TFHA 1FL6B 1KBGL 2V5MA 1WWAX 3WFCL 1HXYB 1TQBB 5KSBA 5IQ7L 2EDNA 3NCJL 3LQAC 3BX7C 5KSUB 1GZQB 1A1NA 4DEPC 1BM3L 3UJIL 1FG2A 5GGUB 1TJGL 4QRUB 4LGRB 5ITBL 3CH1B 4MA3A 4WI6A 3QIWA 5D2LB 3SDDD 5EU4A 1FC1A 2FATH 1A1OB 5TQ2H 5KN5A 1TDQA 5FDWA 4HUUA 4R90H 2R2EB 1WCBA 5GHWH 3QDJB 3EFDH 5TE4L 3DX9B 1IM9B 4QRSA 2Q3ZA 2GQHA 4WNQB 3JUZA 5IJVA 2W0FA 4B7IA 4HWZA 5DK3A 3CMOH 3O3AA 1F11B 2CLRA 2X10A 3OKNA 3KPNA 4GKZB 2H32B 3R0MA 5AG9A 3V6FA 2EYSB 1BZ7A 5IHZA 2PXYC 5DVKA 3AC0A 4O58L 5TJWK 2V7NA 1OTTD 2IEPA 2ZPKH 5FB8A 3MRLB 2VR5A 5EOQH 4QEGA 1TJIH 4JO2L 4L8CB 1HKLH 4MD4B 3W2DL 2J8UF 3TPUA 3PHOA 1L7TL 5C09E 4JRXD 2J7LA 5GGVH 1PZ5B 1IGJA 3MLRL 1UA6H 3LN4B 1QG3A 3VW3H 3ARUA 1M7XA 1NDMA 3V0WL 2P43B 4ISVB 4I2XB 3O3DA 4YGAB 3VWKA 3GNML 4HFUH 1DSFL 1I85C 5I71B 5C07B 2EDXA 4HQQH 2WNGA 3V9FA 4RWHA 3MROA 3VMPA 1JUFA 1P53A 2YRLA 4F33B 1OPGL 4D2NA 1SYVB 5E7BA 1C7TA 3QDGD 1I1CA 1Z3GL 5L8LB 5BOPA 1P2CB 4LIQL 4LKCB 1UB6B 3WHE0 3EO9L 2V2WB 3LS5L 1N7MH 3SJVA 1T66C 3B9EA 2HJLA 1S8DA 2CUMA 1M05B 4JHAL 4GKSA 4MD5B 3SDXE 5JR1L 1S7TA 3LKNA 1QBMH 1Q94A 1E0OB 1EAPA 5DK2B 3X12B 4AM0A 4URTB 4MJ6B 5KS9B 4HS3A 5I8EA 4NPYA 4DEPB 2R56H 3LQAL 1BHGA 3LKSB 2R23A 3PWPB 5EIIA 4GG6E 5E8NA 5ID0A 4R97C 4WUUA 4F37K 1BPVA 1RMFL 4CL7A 4OGZA 4DQOL 3IFOA 1EA9C 3TT1L 4UBDD 2C26A 3RVTD 4XCFL 3C2AL 1ZXQA 3LIZH 2BNUA 4P3CL 2X4UB 4WV1C 1OY3B 4HEME 1AI1L 4HZLB 1MIMH 2VAAA 3WFBH 1LO4H 3H9SA 2IGFH 4X6BB 4JKPL 1KIQA 1OCWH 4M5YH 3IJSB 4PJXF 5ENWA 2CH8A 1BQHG 1FL6A 3K4DA 1HXYA 1ADQA 1AFVH 1NCCL 1MFEH 2PXYB 4OCWH 3G6JB 3ARPA 4Y1AE 3KPRD 3I50L 4FFYH 3AM8C 2P1YA 2DYPD 4Q6YA 5GGUA 1U3YA 2YA1A 4PJHE 3P4OB 3RJQB 3F7PC 4QRUA 3MUY1 5SWSE 3CH1A 1AKJA 1K85A 4CADB 5T1KD 2IFGA 1X5ZA 1A1OA 5TDPB 4PRAB 5IROA 3QCVL 3WFHB 1ACYH 1NDGB 4GAGL 5HGDB 2P5EB 5ICXB 1ZHKB 4L8BB 4IOFC 4GRWE 1OQXA 3VGEA 4PJ5B 5SWZB 1IT9L 1YQ2A 2N56A 3BP5B 3L5HA 3W5MA 3DX9A 4Q0XL 4YHZH 1OAYH 1U6AL 4LRIC 3O3BB 2EDYA 4WNQA 5E8EB 1NGPL 4NHUB 5AG8A 3O6LH 1OTSC 1DE4B 2ESVA 2VH5H 4GKZA 1PG7X 3O8XC 2H32A 1BGXH 1XF5A 1NGQL 4WO4B 5E7FA 1H15B 1S9VB 2EEBA 1I3GL 2RCSL 4OD1L 5C7XL 1AD0B 3NCFB 4L8CA 2DQIH 4MD4A 1GC1C 2CDEB 2AGJL 2AXHA 2EKJA 5FYLL 4R97B 4JFZH 5HHXH 3EYVB 2LU3A 3LN4A 2J88H 4IIQC 3VGHA 3QQ3B 1MFDL 4ISVA 1T2XA 4I2XA 5H37H 4OFYA 4U6HB 3IFPB 4WV1B 4Z7QE 3IDGB 5C07A 5C0NC 5IMMB 4U0QB 4F15C 1U58B 1OP5H 1A5FH 1MCCA 4F33A 3L5JA 3AMLA 1FFNB 5T1DH 1SYVA 3VXME 1QNZH 1P2CA 4LKCA 1UB6A 4FTVE 4RX4D 1F3DJ 1CGYA 5GGTL 2V9RA 3EJYD 1M05A 3T09A 4MD5A 2VXSL 1L7IL 5MHSE 3X12A 4FQLL 5KS9A 4XP9L 2WBJD 1H8OA 1R24A 1PEWA 1OD7A 1OT2A 1O7VA 3PWPA 1NC2D 3TESA 1WAAE 4PY8J 4E0RB 2X7LB 2XA8L 4OLEA 3UZQA 4LOUC 2C3VB 3MPCA 1QACA 3LSOB 1C5BL 4MA8H 2ICWJ 2CK0L 2YPVL 3S5LB 4IDJH 2X4UA 1I7UB 5DC4B 3C87A 3EYOB 1INDH 3AS0A 1XT5A 5EUOB 2R4SL 1G7LB 4PJ7B 4X6BA 1JZ8A 1I8KB 3CLFL 1MRDL 3KAAA 3IJSA 4FNLH 2G9HA 3O8XB 3G5ZB 2VDLL 1K5NB 5HHPB 1C12B 3KPSB 4TSBH 4NKOB 2PXYA 5DO2C 1ROWA 4OLWL 3DX7A 4XP4L 3BZ4B 3S37L 3SDYL 3FO0L 3ARVA 3P4OA 3RHWF 2NX5D 1P4BL 3OKDB 4N8CL 3T3MF 1BZ9B 3PXJA 3ROLB 1RUPL 3CLEH 4DZ8B 4D8PB 4CADA 2JELH 3VMOA 1GC1L 4IIQB 4K71C 5TDPA 5IVXE 1DBML 3KR3H 2FZ3A 1NDGA 4JZNB 4PIRF 4WFGD 5HGDA 2P5EA 1GHFL 2R2HB 3B4NA 1JHLH 4Z0XA 5ICXA 5TDNB 4L8BA 4G7YL 1I85A 4PJ5A 5SWZA 4JZOB 3C60A 4F15B 3JWNC 1L4IA 3O3BA 4U7KA 5E8EA 5KZCB 3MBXL 3QI9D 4NHUA 5IHBA 1TXKA 5GRXG 5A43C 1DE4A 2OL3H 5HYJE 3PQYE 3JVGC 4JFQA 5F3BB 2X89A 3MYJB 1P4IH 5DMIL 2C4FU 4OZIB 2QQQA 2BRRL 3QDGB 3BZFA 2Y23A 1NPUA 3EYUL 2VUOA 2Z8SA 4G8GE 4HUXB 1KB5B 1AD0A 1AXTH 4JDTH 5LBSL 2BVOB 3FO2A 1R3IH 4GT7A 1TETL 2D0FA 2VDKH 1LWRA 2VDPL 1KB5L 3MJ7B 3EYVA 1QO3B 1T21B 5EZIL 1IC1A 2YBRA 3QQ3A 4K7FB 2Y6SC 5L88L 3BKJL 4FFVD 3IFPA 3RGVD 4WV1A 1JGVL 3IDGA 5IMMA 4MB4A 1HCVA 4NO5A 1U58A 4X98A 2CJUL 5DRNB 3T3ME 4GBXA 1ZLSH 3ZSTA 3D5OF 1FFNA 4IBLT 2ID5A 5GGTA 4XI5D 4CUCA 4M6OL 2K7PA 1CFSB 3PGCB 4YE4L 3WJLC 5FGCB 3N85L 3EW3B 4EIZC 3EGSB 2BDNH 1UC6A 1QLFB 4KK9D 1ZGLM 3SPVB 2ADJA 5DUPH 2OTWB 3E3QE 1FVCB 1RUQL 1YUHB 2X9WA 1D6VL 3AM8A 1VGEH 4PJAE 3W82A 3WIIH 1CL7L 2CPCA 1OP5K 3ULSB 2X7LA 2DYPB 4FQ1H 5HYIA 2C3VA 2V2TB 3VXRA 3LSOA 2ADFL 4K71B 3DI2B 3S5LA 2NYYC 2MNUA 1PJ9A 1VFAB 1I7UA 2X05A 1ZWIB 5EUOA 4Z18A 1G7LA 4PJ7A 1RQ5A 5E4IA 3BUTA 3THML 5K9JH 2DWEB 3OR6B 1EIBA 3O8XA 3G5ZA 5HHPA 1K5NA 1G1CA 3ZKXC 2HYMA 2Q20A 2ZOLB 4EOWH 3V8OA 1QBLH 5CWSB 3QRGL 4NKOA 4B41A 1MVUB 4F58L 1P4LB 4P9ML 1XIWC 2AJ3B 2FX9L 2XTJE 4M8VA 4PYGA 2DMCA 3BZ4A 1CLYH 4OLYL 1WISA 3W39B 3OKDA 4NHCH 4RGOH 4P2RD 3ROLA 2VZ1A 2VXVL 4DZ8A 4G8IB 4D8PA 1I1YA 3KYOB 3X13B 4U1KB 4KI5F 4C54A 1Q38A 4IIQA 5CCKH 3DYMA 4PJIE 5C8JB 2G2RB 3L6FB 4JZNA 3TBVA 1U2HA 1O7SA 2R2HA 2R1WB 3WUWB 2NY5H 1OT1A 4MJ4A 3T0DA 4PB0H 1JZ2A 2JB6B 4KDWA 3RWCA 2C5DC 1B6UA 3RU8L 2EDTA 1KT2B 4KK6D 2UV3A 3UPRB 3U0TB 4PGZA 2XN9E 5F3BA 3VRLF 2FBOJ 1D5BB 3MYJA 2DN7A 4IRJC 2NTFB 3VCLB 1SBSH 1AR2A 4I9WE 4LSVL 5IOPB 4L4JA 1CLZL 1IAMA 2GITA 1OAKL 4HUXA 1KB5A 1OL0A 4XXCC 1EEZB 2BVOA 4JFEE 3VA2C 5E8OB 3I84A 4I3RH 5D7JC 3T2NH 5B4MC 2Y06L 3MJ7A 4V1DE 4YXLL 4XVUD 2KQNA 4K2UL 2NTSP 1I8IB 1QO3A 1T21A 4K7FA 1YJDH 4LSTL 1NFKA 3RWHA 1QFPA 4RGNE 4JB9L 4B50A 5MEOB 5DRNA 4HAFA 4O2FB 4OGYH 4XCYB 2PW1A 3KJ6L 4NKQB 3MOBH 4ZFOL 5BZDB 1TMCB 3PGCA 5CGYC 5HHVH 2AJUL 2ADIB 2OI9C 3ZKXB 3EGSA 1K8IB 1RIVH 4GG6B 3RUGB 4UINL 4JRYD 1QLFA 3B2VL 3SPVA 3LZFL 1MI5E 4POUB 4PJEF 1XIWB 4X0KA 1FVCA 1QSED 3QQ9C 5I8KH 1YUHA 4UU9B 3A6OA 5F3HB 5JIKA 4RAHA 1JPFB 5EORH 2GHWB 4JG1H 1LK3L 1JNLL 2R0WL 3ULSA 4I8DA 3SDCC 3GHEH 5K9QG 3QWRA 4PPTA 3MFGB 4L8DA 5D7LE 5K33A 2IAMD 2GCYB 5IBUB 6FABL 5L8JB 5KSAA 5D1XD 4Y19E 1ZWIA 2QJDA 5EU6D 2B1AL 4AEFA 2E7LC 3R8BB 1VDGA 4N8PA 2V17H 1JZ4A 2ARJQ 2HT4D 3ARSA 3OR6A 5IFHH 1G0DA 3EO0B 3TT3H 3JVGA 4ZSOB 4PJHB 2ZOLA 1EEQA 1JI1A 5CWSA 4IRJB 1MVUA 1KJ2A 1P4LA 1DVFC 1DFBL 3V6ZB 4MQXD 4XPTH 5I9QC 1BVKB 3VFRB 2VLRD 3W39A 4FG6C 3FQNB 2OJZH 2D7TL 3PGDB 2W9DH 1JK8B 4WHYH 3U4BH 5D7JB 3KGRA 5T3XE 1I1FA 4G8IA 3V6OC 3KYOA 3F58L 3X13A 5LGHL 5T5FL 4HKJB 3K2UL 4MB5A 2G2RA 3L6FA 3OSKA 4NZTH 2ATPB 4P48A 4PJEE 5E2WH 4ETYA 1PYWA 2A0LD 3WDJA 4E9LA 1IAII 3HZKA 2EECA 2N4IA 2Z8WC 3NIFE 1BREA 4J4PC 1KT2A 4WCYH 4YX2H 3LB6D 5IMKB 4ONGL 2X09A 1U8OB 1J1XL 1KN4H 4XBEL 4AQ1B 3WJLA 3S5LG 4LEOB 2OI9B 1F58L 2NTFA 5C09A 5KVDH 5A40E 5IOPA 3U6RB 5J6GB 2EC9U 3CX5K 4EDXB 1EEZA 2VIRA 1FNSL 4Y4FC 2FIRT 3CDGB 5E8OA 2FHBA 1NBVH 3GK8H 4I1NB 5J8OA 3R1GH 4UDTB 2IMMA 3HRPA 4AEIL 4UIKH 4U0RC 4GW5A 3CXDH 1I8IA 3SDCB 1JRHL 2OBGA 5C2UB 1IGCH 1CICD 4HMDA 3A67H 3BP7B 4RA0C 1WGOA 3K1DA 3O9WC 4ZUVB 3S36L 4AG4H 4X6DB 5MEOA 3RTQD 1DBJL 4O2FA 3SGJC 2FO4A 1A1MB 2UVEA 4RMUA 4XCYA 4IMLA 3OKMB 1VFOA 3RWEB 4JY4B 1IKFL 4K7PL 5BZDA 1G9EA 1FYTB 3S34L 4XNXH 4Y88A 2ADIA 1PKQE 2AK1H 3HPJB 4DGIH 1MCLA 1K8IA 4GG6A 5TDOB 3RUGA 3BPCB 2XY1A 5I15H 1DVFB 1K9TA 1BBDL 3MJ6A 1XIWA 4OAWB 5I9QB 4OFVA 4UU9A 5F3HA 1JPFA 3MLWL 2XYCA 1XF3B 1U8LB 4ZQKB 1YC8A 1S7SB 5DGQA 1WFOA 4YC2C 3EUUA 2WUBH 1LEIA 2GCYA 1CDHA 3V95A 3UTPE 2VZUA 1T04B 3IAQA 1AE6L 4PJCB 1NCWL 1A0QL 4LASL 2XACC 2VC2H 2VN7A 5F93C 1BWMA 5DDHB 3EYQD 2NY1C 4JVWA 4UOW1 4CDHA 3E3QC 5D1XC 2I60H 4BSVB 1ZV5A 5CJXC 3T0XA 1QSFD 3FFDB 2YD9A 1UZ6F 3EO0A 3WJJC 4PJHA 2HWZH 3SO5A 1KB9K 4IRJA 1RZKH 3MXVH 4NGHH 5SWSA 1S9WB 3QCUH 3JUYA 4OFIA 3V6ZA 4JHWH 2BFVH 1BVKA 3VFRA 4XXCA 1L0YA 4QHNB 1F00I 4Y4FB 3FQNA 3NCBB 3O6MH 3B2UC 3SEPA 1JK8A 2XQYK 4ZTPH 2BSED 2FATL 5DMJB 3QG7H 5TQ2L 3PL6D 4U0RB 1LVEA 4HKJA 2Y07H 2DQGH 2DBLH 2LTQC 3MRPB 4R90L 5C0AE 2ATPA 1FCGA 5GHWL 3T0EC 3EFDL 4HUWB 3VWKD 1XGYH 3O9WB 5MEND 3IDMA 1F2XK 3CXHJ 3WO3B 2YMXH 4XTRD 5MI0C 3CMOL 3T1WA 3DSFH 2EE3A 4JREC 2QSCH 2GJ6E 4JE4B 3VXNB 5C70A 3VXTB 5K9OB 5IMKA 2WM0A 1U8OA 2YZ8A 5GPRA 5J3HD 3IFLH 3FQUA 2ZPKL 1CFTB 4MAYD 4LEOA 4KKAD 5EOQL 2DLHA 1TJIL 2N1KA 1HKLL 5J6GA 4WI9A 5H35B 4PREB 5DLMH 3NTCH 3CDGA 1S7VA 5GGVL 4G42B 3U1SH 3N1FC 1UA6L 1E28A 3VW3L 4UDTA 4H1LB 1S7XB 3SDCA 3CNKA 5DF0A 1T1WB 3QPXH 4YC2B 4HFUL 3U0WH 3VXMA 4HQQL 5E24E 3BP7A 2FIKA 1CDUA 4Y5VC 5IQ9B 4ZUVA 2Z9TA 4NO2B 2I5YH 4X6DA 1S5IH 2J5LC 1CGSH 1LGVA 2D9QB 3H8NA 1A1MA 5CP3A 2A83B 4JQVC 3ZHDA 2BRQA 2IBBA 1N7ML 4YUEH 4LAQH 3C5ZD 3RWEA 4DWHA 2E7LA 4JY4A 2NY1B 4BZ2H 2BJMH 5D1XB 1FYTA 5GZND 1QBML 5EU6B 3HPJA 3IDXH 4E41B 5C0FB 2I9LA 2G5RA 1WAAA 3BPCA 1WWWX 4PRHE 1DVFA 4P2YA 3UC0H 3Q5OA 4OAWA 1EVTC 3RVVD 5EWIH 3BH8A 2UVFA 2VE6A 1OARH 2GFBA 4NP4H 1XF3A 1U8LA 5L8KB 4ZQKA 1S7SA 3K8LA 3V6OA 3LIZL 1ZT7B 1KYOJ 4J3OC 2XIDA 1DANT 3NCYS 2OP4H 4PJBE 5LQBH 2LTQB 1MCWM 5HHQB 4HT1H 1MIML 3T0EB 3WFBL 1UWGH 1LO4L 5DI8B 5GRUH 5JIIA 4PJCA 2XZZA 1DJSA 1HWHB 3QDME 1OCWL 3NIGE 5MI0B 2P46B 4M5YL 5GZOD 4LLDB 3MJ8A 4XH2B 4BH8B 4N0YH 1GGYA 4JREB 1QZ1A 4J4PA 1CXIA 4BSVA 2ESVD 3FFDA 1AFVL 2DWDB 3BD5A 3VFPA 3Q0HA 1MFEL 4OCWL 4HJGB 4L3EB 2FB4H 2B2XH 4FFYL 2VKWA 4OV6F 2EH8H 2DJ4A 1S9WA 2QHLA 3CDFA 5FO8A 5IFAH 1TCRB 3HRZB 4KRNA 3WNKA 4X5XB 5JW4R 5CP7B 2OMBA 2A74B 3KLAB 4NQXA 3CCHA 2BHUA 2XKUA 2FWOB 4OI9A 1ACYL 1L0XA 5JDSB 4ONOA 2JJSC 2J1KA 4LSDA 1JV5A 1P1ZA 3PL6C 1S9XA 4OFYD 4DTGH 3BRFA 4YHZL 5HYJA 1OAYL 4Y5VB 1FV1B 3O9WA 4X7TB 5CEXB 5KANG 2MQ3A 1QFWI 3VGDA 1CFVH 5FYJU 3T4AB 2J5LB 3O6LL 2NY4C 5JOFB 3SGJA 2VH5L 3D3VE 4UUJB 3QAZC 1BGXL 5FKAA 1F6FB 1RK0B 2H8PB 1DQJB 3VXNA 5K9OA 3VXTA 3REVB 4K55A 3RTQB 4HAGA 2NZ9C 5IBUG 2EICA 1CFTA 4HUNB 4YZFE 3SE8H 5CKGA 5TQ0H 2IANB 4V1DB 1J12A 1AGFB 4M5ZH 3QG6B 5I73C 2DQIL 5H35A 4LPUA 1ZHLB 4PREA 4Y2OA 3RZCD 4NQCE 4JFZL 1OGAD 3F8UB 5HHXL 4ODUB 2VLJD 4QRRD 1RZ8B 2J88L 5T3ZH 4KKBD 1KEGH 3MNVB 4H1LA 2VDNH 3MRJB 3WNLA 1A4KB 1S7XA 4Y4HC 1T1WA 3NN8B 2VAJA 2BOCA 3I9GH 1ZT4B 3MUHL 3WIFA 1A5FL 4NNYA 1RURH 5CBEB 5IQ9A 4NO2A 4HS6B 5T1DL 2AJSH 1KIPB 1QNZL 2WSKA 2A83A 2VJXA 2AABH 4YPGA 3WHE1 4ODWB 3ZZ1A 1MI5B 4ZUUA 5CJXA 1P5UA 4MXWH 1F4AA 1J0ZA 4E41A 3WJJA 5C0FA 3DX8B 1MY5A 5HDQH 3IS1X 3ZE2E 4Q9CA 3QUYC 4J1UB 5JW4M 2CIKB 4XX1E 3LPFA 1U8MB 1KEMH 3UTQB 1XGRB 4MA8L 5TFSH 4Y19B 1ZT7A 3PABB 3ROOA 4IDJL 1EO8H 5LAXB 1INDL 1P7QB 1A7RH 4QO1A 5HHQA 1IAOB 3PL6B 3T0EA 4GG8A 5DI8A 1IAIH 1CN4A 1NGZA 5HHMD 2OQJB 4FNLL 4LLDA 2NY4B 5I74C 4XH2A 4BH8A 1YEDB 3O11A 3QAZB 2OR9H 2Z31A 4TSBL 2DWDA 4NFBA 4BSWA 5GZOC 4HJGA 4L3EA 4L4VB 4NQEE 4QRPB 5M95B 3QPQC 3VJ6B 4QCIB 5I73B 1TCRA 3FO1A 4NYLB 1BOYA 5FM5M 3HRZA 4X5XA 2P24B 3PWUB 5DA0B 5JORA 3CLEL 1RULH 5IBLD 4PJIA 4FQJH 1MFBH 2Z0BA 2A74A 4G6AD 3AREC 3KLAA 2JELL 1QR1A 3BH9B 3DI3B 1M6OB 2FWOA 2QQLH 3KR3L 1NFDB 4Y4HB 5JDSA 3KPMB 3ZYOA 1JHLL 4JFXB 3IF1B 5EOTB 2NCMA 5JOPE 1P5VA 1HHJB 2OL3B 5JXED 4X7TA 2QL1A 4D94A 4KJWC 4LNRB 3T4AA 4GBXD 2OL3L 4JQIH 4UI2A 4JQVA 1CF8H 4UUJA 1RK0A 1X4XA 1UADC 2H8PA 1P4IL 3F5WA 3REVA 4HLZG 1LILA 2XOTA 4OZGE 2IANA 2VMFA 4V1DA 1AGFA 1AXTL 4JDTL 3ZMRA 2OYPA 1R3IL 3SGKC 2VDKL 3QUYB 4ONHB 3TBTB 3ETBF 2ICCA 1KTRL 4ODUA 1RZ8A 1YEEH 2NY5C 3MNVA 1J7VR 3OX8B 1A4KA 4TUKH 3RZCC 3NN8A 3VXRD 1TZIB 1F3RB 3SE4A 1ZT4A 4KKBC 1U36A 3CD4A 4G3YH 1TJHH 5CBEA 1ZLSL 1GGCH 3HE6C 4HS6A 4DVRH 4HK3J 1F02I 1KIPA 4CN6A 4IRSA 3DMMD 3Q2CA 5I74B 1HYRC 3N1PC 4FA8A 1MI5A 1T1YB 2B20A 4P2QE 2BDNL 1H3XA 4NBXB 2HH0H 4JDZA 2PNDA 2ZNXA 3DX8A 3MACH 4RNRA 1VFBB 2BVTA 4KV5F 5DUPL 1YPZB 1UH3A 5EIVA 4J1UA 1VGEL 1RIUH 4GLRI 2Y72A 4MJIE 4XVSH 3WIIL 5ICZB 1EGJH 4UT9H 2VYRE 1YJDC 3TC9A 5D5ME 2FO1A 4FQ1L 3AREB 2EXYC 1U8QB 3TCLB 3UTQA 4H0IA 4Y19A 3PABA 4ODBD 2E9BA 3MUZ1 5IW6B 1UM5H 2Z93A 4P3WA 3P30H 2HT2C 1P7QA 4R8WH 1IAOA 2NLJA 2H9GB 3W0WE 4G9FB 4HHAB 5GSVB 5K9JL 2OQJA 3JV5A 4Q9BA 4H1LG 5FYKU 2FD6H 4EOWL 4IM8A 1QBLL 3NA4A 5KTEH 4BQ9A 3W9EB 1A2YB 5ITFB 4PRIB 3OZ9H 3TWCH 3ZDXE 1CFBA 4YDVA 4L4VA 5DD5H 4QRPA 1CLYL 3VJ6A 4JG0H 2EDLA 4QCIA 2WWMD 3F6IA 4NYLA 4Y4KC 4RDQG 2AW2A 5DD6B 4NHCL 4RGOL 2P24A 3PWUA 4L9DA 2ICES 4CU8A 1WBZB 5DVNA 5HVWA 1T0PB 3UO1H 1DLFH 3BH9A 3MV9B 4OKVB 5F9JB 1M6OA 5CCKL 1X44A 1I75A 1R5WA 3RZCB 3KPMA 5FO7B 4JFXA 4OKDA 2DM2A 1OQOA 5EOTA 3CPLB 3PGFH 2NY5L 5DA4A 5CGMA 4PB0L 2W59A 3ARBD 1HHJA 2OL3A 5ALCH 4N68A 5TE6H 3KS0J 3RL1B 1JPGB 4LNRA 3HE6B 2QR0B 5EPMB 4J3XA 2A9NH 1T4KB 1TZHB 2NY3C 3F7QA 5I1DB 1FFOA 1MLBB 4D3CH 4PJ9D 3ET9F 1XMWA 3DHJA 1SBSL 1H5BC 4OF5A 3EIFA 4JJHA 3KXFE 3MLYH 3HCVB 4TSAH 1TNMA 3GSXA 3QUYA 4JPKH 4ONHA 5E4EC 4I3RL 3T2NL 4KROC 3NVQA 5MEQB 5I0DA 1DCLA 3OX8A 1FL5B 1YJDL 2YPKA 4RWYH 4F7MB 3DO7B 2GUOB 3HB3D 1TZIA 1G7HB 1QRNE 5DC0A 4CN4A 3U36B 5LXGH 1MQ8A 3QEQE 5HVHC 4OGYL 2CD0A 4HUVB 4ZD3H 3MRRB 3MOBL 4G5ZH 2HRPH 5C6WH 3EFFB 5HHVL 5E8DH 5GGQH 5ACLA 1OF2B 4HPOH 3D2UB 1RIVL 1FZKB 1HQRB 5ESAB 4YXKH 4ORGB 3WLWC 3WNNA 3RVWC 2Y5EA 3E6HB 3SCMC 1T5WB 1YPZA 5I8KL 4HKZB 4NC1C 4Q58C 4Y4KB 2AI0H 2YOCA 5EORL 3OJDB 4JG1L 4XC3H 5DJAB 5ICZA 3QNZB 5DJXA 1KTDB 3GHEL 2DQCH 3AREA 2XWBB 1U8QA 3TCLA 1U3HD 4NIKB 2YUWA 1TVDA 5FYJH 4MMZC 5F7FA 5BZWA 5D1ZD 2QSQA 1CDYA 5IW6A 1CXKA 4MZ2A 4TVPH 4G7VH 3DARA 3GI9H 4U6TA 3JWOH 4G9FA 1KTLB 4M9OA 4HHAA 5D1QC 1UWEH 5GSVA 4TNVF 3I3EA 4X80H 2V17L 3GJFB 5IFHL 1H3WM 3KYKH 2AEPH 4UOJA 4Z7VF 5DQDH 3TT3L 2NY3B 4R96B 4QYOB 2LU4A 3WHXB 1FORH 5KG9B 5JLZB 5CD5C 1A2YA 1H5BB 5I1KH 4PRIA 5FAAA 5E03A 4XPTL 5LG1A 5BXFB 2VL4A 1NCNA 5C09D 5F7NC 1BJ1J 3SGKA 2OJZL 5E4EB 2YRPA 4P2CG 2W9DL 2YKLH 4QTHA 5DD6A 2DQDH 2K9UA 3QULB 4X6EB 3U4BL 2ZCKH 4KROB 4BFBD 1WBZA 5IR1B 5ERWA 1AXSB 5IKCB 3EOTH 4OKVA 3MV9A 5F9JA 4HG4K 5E2TH 3CFKB 5E2WL 4NZTL 1PEZA 2QSVA 5FO7A 3HUJB 3CPLA 2GJ6A 5IVZA 1PW3A 4PV9A 3RHWK 2NY2C 5HVHB 1JPGA 5GRZA 3HE6A 4MDIB 2AJXH 1RUKH 5EPMA 3UEZA 4WCYL 1JZ5A 4P4RB 4YX2L 1TZHA 1FNAA 2E8ZA 1ZEAH 4FP8H 5I1DA 1KN4L 3DUSB 1OSZA 2WZPD 2ORBH 5A2IH 4OFDA 1ACZA 3D1MC 4HCRA 1KV3A 4NQCB 5KVDL 4Y2DD 3SCMB 4PS4H 5F8QC 3JTTB 3HCVA 3DIFB 1NBVL 3VXSE 3GK8L 1T22A 3R1GL 2HTLD 3TO4D 1RZGB 2PO6D 3NFPB 4UIKL 3CXDL 2D2OA 1A7OH 4OLZH 5IK3B 5A16A 4WFHE 1IGCL 2COQA 1EBAA 3A67L 1FL5A 3DO7A 5C0CE 4DAGH 4NO3B 1G7HA 4AG4L 2BZDA 2IG2H 3U36A 4LHQB 4BUGA 4HS8H 2R2CA 4HUVA 4FXGB 5D1QB 5FXCH 1IE5A 3G5YB 4XNXL 4R6UA 1LMKA 5C86A 3HI6H 2AK1L 1T1ZA 1OF2A 4Y1AD 4DGIL 4APQD 5ESAA 1HQRA 4ORGA 5I15L 2FJGB 3E6HA 5HYFA 1T5WA 4GMSH 3IT8D 1TTFA 3TF7C 4UQ2B 1HHIB 4KZEH 5BS0E 5DR5H 3T4YB 4Y4KA 1KCVH 3OJDA 4D9LH 5J13C 3QNZA 2HFTA 4GUPA 1P9MC 1KTDA 2D9CA 1N5YH 4AH2B 1HK6A 1MAKA 2WUBL 4C4KT 1UM6H 2BNRD 3D87B 1T83C 3QUMA 1JYXA 1KCSH 3V5HB 1BAFH 4N5ED 1U8PA 2DI9A 3DX6B 1S7QB 2LQRA 3ZDZE 2VC2L 1AQKH 4RQQB 4Z7OF 4KRPC 2NY2B 2PW2A 3DSNA 4PJDE 2EDQA 2I60L 3GJFA 5CSZB 4NQEB 1JNJA 4Z77B 4R96A 3TNNB 4QYOA 2HWZL 5KG9A 3NCEB 5JLZA 1RUAH 2E7HA 1RZKL 4IEFB 3MXVL 4NGHL 1H5BA 3QCUL 3VFMB 1D5MA 5C08E 4JHWL 5BXFA 2BFVL 5HHOE 4U33A 1VA9A 2GAZB 2ZWLT 1U95B 3O6ML 5A3ID 4ZTPL 4MJ2A 3QULA 4X6EA 3V7AG 3QG7L 2W92A 3OF6A 3UROR 1IGFH 5IR1A 3QT2A 1AXSA 1K4CA 2Y07L 4Y0GA 2DQGL 2DBLL 4JFOB 4LSQH 3B43A 3CFKA 4ELKB 1YEKH 1WUNT 1XGYL 3D3VA 3HUJA 3VXMD 1Y6NR 3TV3H 3BE1H 4HW6A 2YMXL 4OZHF 5CZXC 3MTRA 3DSFL 1KPVB 4FTVD 3O0RH 2QSCL 4LGPB 4MDIA 2K7QA 3FFCE 1NAKH 4OZGB 4P4RA 3GO1H 4OLUH 2RB8A 3ZKMC 3VD7A 3HG1E 3IFLL 3DUSA 1Z2KA 5J56B 4M6AA 4NQCA 2RQ8A 4MA1C 5CUSH 3QZWB 1RZJH 3PHQB 3SCMA 3UYPA 4Z7UF 2BC4B 5DLML 3JTTA 3NTCL 3GB7B 1KIRA 4HMEA 3DIFA 3QXAB 3U1SL 4Y5YC 3EHBC 5J13B 1RZGA 3NFPA 1MJ8H 3BQUD 3N0PB 3QPXL 4MMXC 5IK3A 5F7LB 1AY1H 3U0WL 1T1XB 3LKQB 4WTXA 2PO6C 2E3VA 5F6HI 1W0WB 1NLBH 3S6CA 4WWID 2HFGH 2I5YL 1S5IL 5DSCA 2CSPA 3VXOB 4KRPB 4FXGA 5E6YA 4WFFD 4YUEL 4LAQL 3STLB 1UQSB 1W72H 2I26N 1CG9B 1SM3H 5D1QA 4BZ2L 2BJML 3G5YA 1T3FB 4JY5H 3LMJH 3IDXL 1U0QA 1A14H 4U2YA 1WZLA 3C6SA 3P9LB 5CS7A 2FJGA 5D5MB 1XGTA 2IALB 1MCFA 5D7IE 3UC0L 3EOBB 5IHUH 4UQ2A 3VG9C 4QHMB 2CXGA 5IJKC 3T4YA 1OARL 3MFFB 1WITA 5ID1B 4NP4L 4XMKH 3T08A 4I0KA 1V7NL 4AH2A 5D70H 1H3PH 1XGQB 2FGZA 2OP4L 2XXMB 3W0WB 5LQBL 3OJVC 2YD6A 2EZ0C 5J89A 3ARDD 4ZUTB 3ZKQD 5C0RH 1Q9OB 4HT1L 4KAQH 4KDTC 1UWGL 5GRUL 7FABH 4JM2D 4Z7WB 3DX6A 2X1OA 4MLIA 1NBZB 3CAFA 1RHFA 5HYJD 3PQYD 4RQQA 2VLKB 4N0YL 3LAFA 3F65A 3TN0C 3X11B 5FK9B 2OSLB 5CSZA 4POYA 4NQEA 4Z77A 3C8DA 2FB4L 4G8GD 3R8QA 3TZVC 5EU5B 2B2XL 4XT1C 2EH8L 3DRTB 5HTSA 2KBGA 4YBLC 5IFAL 3VFMA 5HDLA 4MA1B 4N0FB 3HR6A 3RAJH 4KMTH 4TUOB 1U95A 3MOAL 4Y5YB 4OF7A 4HJJH 2EYTA 3RGHA 3RWFB 5JA8B 4JFOA 5JQ6H 4ELKA 4X4XA 4MWFA 1YMMB 2DS4A 2PO6B 4K23H 4DTGL 4FQPA 3R4DA 1IZJA 4ODTH 1CFVL 1YN6B 4F9LA 2EIDA 5ACZB 2J6EH 3HZMB 2J8UB 2R15A 1RZFH 2WWKT 1IAKB 1MNUH 2I07B 4OZGA 1ED3B 4QHUB 3H42H 2P48B 1SMAA 3SE8L 4NFDA 5TQ0L 4M5ZL 2L7UA 4KU1A 1Z5LB 3PHQA 4C83B 4YR6B 2BC4A 4AMKH 3VG9B 3GB7A 1OOAA 1GAFH 3QXAA 2DQUH 5T3ZL 1KEGL 2V5TA 2VDNL 1Z0MA 5I1GH 1P9MA 1ZK9A 5JIHA 2DI7A 3G5XA 5E94A 1T1XA 2NXYC 3RVXC 1T83A 4WHYG 3M07A 1RURL 2CMRH 1W0WA 3VXUB 4AZ8A 2AJSL 2BNRB 4QRQA 2AABL 3BGMB 1K4DB 1CTOA 3PJSA 4X9GA 1CG9A 2ED9A 2R4RH 4WRLA 5E1HB 4ZOCA 3TN0B 5BO1H 5IFJB 4MXWL 1T3FA 1NLDH 3IDYC 4MJIA 2XTJD 1JWSB 5HDQL 3TZVB 3CXHK 4DOHB 3P9LA 5D5MA 4W4OC 2IALA 4XZUB 4YBLB 5C0BE 3EOBA 2OR7A 5K59E 1KOAA 1QVOB 4QHMA 2LE9A 3P73B 2JJTC 4DUXA 1Q9LB 1KEML 3MFFA 3WO4C 4Z76B 5ID1A 3GKWH 1DBAH 3T04D 5I2IB 5TFSL 4YBQC 4HIIB 4XMPH 5HD8C 4QWWC 1XGQA 1M7IB 3MA7A 4P23C 4CMMB 3W0WA 1ZS8A 1EO8L 5HDBF 3PNWB 5FEBA 4ZUTA 1A7RL 4OCSH 5GRVK 3VXQB 4Q7DA 3ARGC 4M4RA 1IAIL 4OIBA 4Z7WA 1NBZA 3SY0A 1LP9F 2XN9D 2VLKA 4PJFE 1EZVX 4X6CE 5DMKA 4RIRB 5FK9A 2OSLA 3X11A 2OR9L 4I9WD 2JF1A 4OBRA 3ULVE 4YDIH 2RFXB 3IU3A 3OKOB 4JFED 3DRTA 4YEEA 1JZ3A 3RNKB 3K4ZA 4N0FA 2XRAH 3QIUA 3HTLX 1D3CA 2X4OB 1RULL 2EDHA 2F53B 5FHBH 4FQJL 1MFBL 1BFVH 4WI4A 1J8HB 5EO1B 5JIPA 3X14B 3QO0B 4Y5YA 4S1DC 5ANME 3STZB 4Q97A 2QQLL 2XKNB 3V4PH 4NN7C 3KDMA 5CSGA 3EDEA 4RGND 4BQ6A 2NXYB 1YMMA 4HWUA 2UZXB 4RCAA 3GRWH 4KTEH 5ACZA 2OM5A 1KJMB 4JQIL 2J8UA 4UILH 5DS8A 1CF8L 1IAKA 1KYOK 2I07A 4LGSB 4IRSD 3KXFA 4M4PA 5E8PB 4NUGH 5AUMB 4QHUA 4HX1A 4OLVH 4OBSA 1JWMB 3IDYB 5B3JF 2DKMA 1F13A 3VXSB 1F6AB 3FT4B 4KVNH 1GOHA 4NO0D 4YR6A 5C6PB 4WEUD 3QUXC 4YBHA 3WO4B 4S1QH 1YEEL 1FNFA 4H8WC 5D7LD 2FR4B 1QRNA 4ZXBC 3GJEB 5AAMA 1S7WB 4TUKL 3QEQA 1W0VB 2P4AB 4P23B 4U1NB 1XH3B 1CE1H 2D4DA 2MTPA 4G3YL 1TJHL 5FYKE 4F9PC 1GGCL 2BVYA 4KDTA 5D7KE 2V5SA 3PP4H 4DVRL 3NZ8B 3KLSA 2BNQB 3O2WH 4NKDA 5C71A 4M9PA 3V0AC 3BGMA 35C8H 1OW0C 1K4DA 1J18A 4LAJH 5L7XH 3TN0A 3ZKNC 5IFJA 5BS0B 2HH0L 4ODHH 1JWSA 2CRZA 3MACL 2VQTA 4P9HC 3TZVA 3BT2H 5F7KC 2RAMA 5CJQH 1G7IB 2W9EH 4XZUA 3I2CH 4XVSL 5GIRB 2Y9RT 5T3XD 1EGJL 1JYVA 1QVOA 4UT9L 3P73A 1Q9LA 3DYOA 3VFOB 4Z76A 2GK0B 2BY3A 5FFLA 3GMLB 4RA3A 3F12B 4G6MH 5F1OB 5I2IA 4HIIA 4MQSB 3V7MA 4NN7B 5HI3C 4CMMA 1FN4A 1UM5L 3P30L 4LLYB 3ZE1F 4DKDC 1REIA 3PNWA 4PJDB 2EC8A 2VZSA 4R8WL 4QOKE 1MLCB 2CKBB 2OX5A 4AT6B 4NKMB 2H2SC 1DUYA 4MA7H 3X3GH 2FD6L 3P3YA 4LPYA 4EI5A 2AK4B 3FT3B 4UT6H 4RIRA 4FHBD 1U93B 5KTEL 3OZ9L 2RFXA 3TWCL 5DD5L 1LNUA 3OKOA 2FEEL 4JG0L 3RNKA 3MUGB 4H5SB 2X4OA 3KLHC 43CAB 1J8HA 5EO1A 1FIGH 3QUXB 3X14A 3QO0A 3UO1L 3STZA 5DUBB 1Q0XH 4ZXBB 2XKNA 4HGKC 1AO7E 3H9HB 2BVPB 4NWUH 3JWOC 1MJ7H 2GTWA 3PGFL 3MYZA 1U8IB 2QADC 1B90A 5ALCL 4PLOB 5TE6L 4S10A 5CIPH 2A9NL 1KJMA 4POZC 4L4TD 4M7JH 5BV7C 1T5XA 3DVIA 2LV4A 4D3CL 4KI5C 5E8PA 5AUMA 4TULH 5I76B 1JWMA 1XFPA 5IW3A 4QNPE 3VXSA 1F6AA 3FT4A 3D6GA 2XWTB 3MLYL 5DRXB 4TSAL 4JPKL 4W4OA 4WTZA 2GW5A 4XB8A 3BJ91 3MCKB 1B2WH 1H3TA 2JJTA 3LKRA 2NY0C 4WI5A 3VD4A 3KS0H 4XWGH 1SMOA 1YECH 5TGBB 3GJEA 1S7WA 9CGTA 4RWYL 3OGCB 4P23A 4MXVF 4U1NA 1A21A 1NGYA 1XH3A 2KZ1B 5LXGL 2YD2A 4MGXA 3HLAB 4Z0BH 3ARGA 4LF3A 4ZD3L 4BK4A 2A2QT 3NZ8A 1CZ8H 3VDAA 4G5ZL 2HRPL 4MAUH 5E8DL 5GGQL 2NR6C 4YHKH 3WDHA 4HPOL 4DN3H 4YXKL 5BS0A 3MO1B 2F15A 1I4FB 2D7QA 3VFTB 3JWDH 4S1RH 3MBED 1G7IA 4R2GC 1YEJH 2AI0L 5GIRA 2R29H 5LJYH 4XC3L 1N6VA 1VADA 4MNQD 1SVZA 5L2KE 3MGAA 1W8OA 1JF6A 3DUHA 2DQCL 3VFOA 2GK0A 2HFEA 5J1TC 3GMLA 1IZKA 5FYJL 3F12A 5C0AD 3ZKSD 3FL7A 2HT3D 4WU7B 3LPWA 3T1FB 4LLYA 1T6VN 4PJDA 4G7VL 4TVPL 3GI9L 2QADB 3V4UH 1BD2D 2CKBA 3VI4E 3JWOL 4OI7A 2GJ6D 1UG9A 4NKMA 4AT6A 1UWEL 4YO0B 3LKOA 4X80L 5TH2A 3KYKL 2AEPL 5BV7B 5DQDL 2JJWA 2AK4A 5C08A 1FORL 1KUMA 1CDBA 5HHOA 1KLGA 1U93A 3MLZH 1MCBA 5I1KL 2CUHA 2BY0A 2VITB 3KVQA 1NGXB 1AGEB 2YD1A 4JFHD 2YKLL 1JZ6A 2DQDL 4UNTA 3LHPH 4H5SA 2ZCKL 3A0OA 3BRDA 4D0CB 1R3LB 2NY0B 5JUEH 3EOTL 2VDRH 5DUBA 4ZXBA 5E2TL 5E6IC 3BXNB 4GSDH 3H9HA 2BVPA 5HYSB 3EZJB 4F7CB 5SWQB 3L95B 1U8IA 1DQLH 3O6FD 3MOQA 1SEQH 1XCTB 1RUKL 2AJXL 1YEHH 2HLFC 2AKRB 3DURB 1ZEAL 4FP8L 1OW0A 5C92A 1BJ1H 3ARWA 1U42A 2E6QA 2ORBL 5GXBB 4PRHD 4RMRA 5I76A 4LCWB 5DD3H 1U8JB 1MREH 4XHQA 4PS4L 5JPNB 4WGWB 5DRXA 2DDQH 1NC4D 1DDHB 2AJZB 4R2GB 2IADB 3FHAA 3TA3D 2FX8H 4KRLB 3UYRH 3MCKA 2GY5A 3VGBA 3VFNB 1JGDB 3HN3A 1A7OL 4OLZL 5TGBA 2AP2A 4O51B 5KSBF 5INCB 4DAGL 3QDMD 1JNHA 1IC5H 2IG2L 4HWBH 2EXWC 5HGBB 4GRLC 4O5LH 2EE2A 3HLAA 4HS8L 1FGVH 3L7FB 4OGAD 1YZZA 2ATKB 3C6LD 4YAQB 2Z8RA 3H7BB 3HI6L 1RZJC 5D7IA 4CN1A 5C0BB 1YMHB 3DGGA 5DJ0B 5IB4B 3VFWB 2MPAH 4GMSL 1I4FA 4KZEL 3VFTA 5DR5L 2XTLA 4JVUA 1KCVL 4R7NB 3C8HA 3TP4A 3UMTA 4D9LL 1FFRA 1UWXH 1N5YL 5SV3A 3ARZA 4LP5A 4PGEB 1UM6L 4LLVB 4TTDC 5E6IB 1KCSL 4HK3N 4WU7A 4HBCH 4U7MA 1BAFL 4DN4H 1SHMA 5B38B 4PUBH 3J8F7 3J7HA 4WTZG 4NM8H 3BP4B 2GI7A 1AQKL 2KDGA 3ZE0F 2GJJA 4YO0A 5DMGC 2IJ0C 2C7UB 1X6NA 1ZVHA 4R26H 3TNMA 4J3TA 2F9BT 1D9KD 1EVUA 1RUAL 4QGYA 5F7YC 2O5YH 2HJKB 5FO9B 4L4TB 2F74A 2VITA 3G6DH 1NGXA 1AGEA 2E7MA 5KANI 2DJSA 4QT5B 2O26U 2QQNH 4O00A 4D0CA 3S3SA 1IGFL 1R3LA 1S3KH 3B6SB 4H88L 4LSQL 4WI3A 2XICA 1T0MA 3QUZA 4IHOA 3BXNA 3RPIB 1A6WH 1YEKL 5HYSA 4KKCD 1CWVA 4F7CA 1E27B 4LBEB 2B0SH 3L95A 4LDLB 5SWQA 3TV3L 4MLSA 3BE1L 5DJ8B 4GRLB 3O0RL 3RWIB 3HMXA 1XCTA 1CGVA 4JFPB 3AXLB 2XNAB 1NAKL 2AKRA 3FN3A 3GO1L 4JKWA 4N90E 4OLUL 3O6FC 3DURA 3OHXB 5DJCB 4PJGF 4CDGC 4P4KC 2Y4SA 2NXZC 4LCWA 1BFSA 3ZYJA 4PV8B 5CUSL 1RZJL 1U8JA 2PYEE 2ZUQC 3ZE0E 5IEHA 3HS0B 1DDHA 2AJZA 3WS3B 4XHJC 3IETA 1MCHA 4LLQB 1ZHNB 1MJ8L 3VFNA 1JGDA 1AY1L 4XNUH 2H45A 4O51A 1M7DB 4MNQB 5INCA 3VFVB 1NLBL 2L4OA 2HFGL 1W72B 5EC2B 2CIIA 5HGBA 3ULUE 5DUMH 1DN2A 1UVQB 3L7FA 1W72L 1SM3L 3D0LB 2VUYA 1MAMH 3MC0A 5DURD 2ATKA 3H7BA 4JY5L 3LMJL 1HCFX 3GUTB 4ZAKC 1SJEB 4CRPA 5C0BA 1A14L 1YMHA 4GQPH 4OGAC 3WLBB 5DJ0A 3AS2A 5IB4A 3T0WA 3VFWA 2YXFA 1FNGB 5FA3B 5IHUL 4OZ4B 5HI4D 1V5JA 4EN3D 3LV3B 3OKKB 5KAQF 1ERNA 4XMKL 4XP6H 5GGRB 4FFWD 4EEEA 4ZPVB 5D70L 1H3PL 2DF3A 3C9NB 4L8SC 1NMAH 4KUCF 4FQIH 5JOPD 1A7BA 1Q72H 5E6IA 1A7NH 3ZO0A 3BEWB 5C0RL 4Y89A 4KAQL 5B38A 5I8CB 7FABL 4H26B 3OR7B 3QEHA 3BP4A 2Y36H 5CD3A 5EULV 3MA9H 4UAOC 1KF9B 2C7UA 2K1MA 3SO3C 3O6FB 4BUHA 1WT5C 3ZTJH 4P4KB 2IBGA 3V6BR 4KTDH 2NXZB 3L7EB 1UWXK 2HJKA 5FO9A 2AXGB 2X9XA 3TIEB 4V2CB 5ANMA 2ZUQB 5DHXB 1N2RB 3RAJL 4KMTL 4WWKA 5DD1H 1I7RB 4QT5A 4TNVK 2C1PB 1SVCP 4HJJL 4H25B 5IESH 5D2LE 1WVZA 2VLME 3B6SA 2F8OA 5JQ6L 1FBIH 1U9KA 3RPIA 2APWA 4K23L 4KUZH 1WQVT 1E27A 4LBEA 3IXAA 2WINB 3L3GB 3QDJE 4ODTL 5ESQB 3JV4B 3R06B 2Q7YB 5KS9F 4GRLA 2J6EL 4L1HA 1FC2D 1RZFL 1J5OH 3RWIA 4JFPA 3AXLA 1MNUL 4P2QD 2XNAA 3WFZA 4FFZH 3OHXA 5DJCA 3H42L 4P46D 4ZAKB 3TBWB 5IW1A 3S98A 4NQDD 5HY9B 3WXVH 4PV8A 4JN1H 1MAJA 4AMKL 1G0XA 5J11C 1GAFL 2DQUL 3WS3A 3CFIC 4LLQA 1S9YB 2BOBB 5LGJB 4XAKE 4U1MA 1NFIA 3O3EB 5I1GL 1PAMA 1ORQB 4L8SB 1LD9B 4KJQC 4OI8A 3UAJC 1M7DA 1N5AA 2CMRL 3VFVA 3BDXA 3ZYIA 1W72A 3VI3F 4LIQE 1I1AD 4D9QE 5F7WC 4YHYC 3U7AA 1OLZA 2A38A 1UVQA 3W9DB 2MKLC 3D0LA 2R4RL 3Q5TA 3EDDA 5BO1L 5I1LA 1LDPH 2HRLA 5CZKA 5IIEB 1NLDL 4PJ8C 3SO3B 4OF6A 1SJHB 5HYSG 4X5LA 1F6LL 2WV3A 3OKLB 4JO3H 2V7HB 1FNGA 4PP1D 3MLVH 3T0VA 4OZ4A 1GSMA 4YK4C 4KMQA 3OKKA 3PWPE 1AP2B 5MERA 1N6QH 3GKWL 1DBAL 5GGRA 5HI4C 4XMPL 3BZDA 3C9NA 3DVNA 1OAXH 1EXUB 5EG6C 4OCSL 2JE8A 3FONB 5GJSH 5A1AA 3GIZH 5I8CA 5GGVY 1MQKH 1F8TH 4H26A 3OR7A 4Q6IC 2I24N 2F5BH 3QYCA 1RV6X 3TFKC 3SBWC 4MCYB 2YSSB 2EKSB 4RMVA 3CVHA 3G9AB 1X5FA 1RPQA 2VLLB 4P4KA 3QQ4B 4LLUA 2Q76A 3IDNB 3G6JE 1YYMH 1SJVA 1FLRH 1MJJB 4WVRA 3RKPA 2AXGA 5B39B 3TIEA 2XRAL 2C3GA 2HN7B 1N2RA 2UY7A 5J9PA 5FHBL 5J11B 1BFVL 2H26A 2ARJB 1I7RA 1DQTA 1UJ3C 3D18B 2C1PA 2O93L 4KQ4H 4H25A 3V4PL 3ARTA 4Y5XB 4MVBD 1I7TB 1BVLB 1QRND 3BAEH 4KJPD 4UZGA 2P5EE 4ZS6D 43C9B 1I9IH 3C08H 1UEMA 1CXEA 2ITCB 2J6EA 3O4LB 4WEBH 3DV6B 4PJ5E 4C59B 2WINA 3KHQA 3L3GA 3GRWL 4KTEL 2YS4A 3JV4A 5ESQA 4R4ND 1JHTB 2Q7YA 4GW4B 4YHYB 4UILL 4G8EA 5F7DB 3HZVB 4G43B 4ZFGH 4W6YB 3LRSB 2OMNA 1OWWA 4NUGL 2F54E 4HIHA 4OLVL 3CSGA 4ZAKA 4PJ8B 4RFEA 3TBWA 3DJ9A 4MS8C 5B38G 4KVNL 5HY9A 4ZTOH 5DURB 1JFQH 1QYGH 3SDAA 3T0AA 1PSKH 5FYLE 2CGRH 3QDAA 4P2OD 5IT2H 4YK4B 3WS6C 4U1IB 2D0HA 4S1QL 3IJYB 5LGJA 1S9YA 2BOBA 3OTTA 1JNNH 3O3EA 3L3OB 4B7LA 1ORQA 1X9QA 1MSPA 4L8SA 1LD9A 5E2JA 3PWNA 2MSPA 3OGOE 1CE1L 4CMHC 5FUOH 5CMAB 3PP4L 4ZOAA 4Q6IB 3O2WL 3OWEA 1XAUA 35C8L 1MUJB 2H2PC 5L7XL 4UINH 2EDBA 1ZGLB 1U8KB 1WFTA 1I1AC 3LS4H 2N7AA 4PLJD 3WFEH 3PDDA 4TNWF 1FPTH 5IIEA 4ODHL 4EI5D 1F90H 3U0PB 1SJHA 1WT5A 2P5WE 4GOSA 3OKLA 4JHBA 3BT2L 4Q9QH 1RFDH 4I0PA 4KGJA 1BQLH 4PB9H 1LE5B 2W9EL 3T65B 3I2CL 1JNLH 1WBXB 3VDCA 1X5GA 3OMZA 4C57C 5ISZB 2GSIB 2MKWA 5F8RC 1UJ3B 3TVMC 1EUUA 4G6ML 1A3LL 1A7QH 5J1AB 1TVHB 3P0YH 4YHLH 5DFVC 1X5IA 4N0CC 3QH3B 4NQSB 1HYSD 5EZJB 1EXUA 3FONA 4LCUB 2CK2A 5EUOE 4WIQA 3P11H 3O2DH 4LHJB 4PJ7E 4MA7L 3X3GL 3AGVA 5EDXA 4MCYA 2YSSA 2EKSA 4NZJA 2X4RA 3L3IB 4UT6L 1DP0A 4LPTA 4EI6B 1AIFB 3JWDC 2VLLA 4I13B 1GIGH 3KPSE 32C2B 4NJAH 2JCCF 1MJJA 1J1OH 2CKNA 1XR8B 2ERJC 4LVNC 1LK2B 2HN7A 2EO9A 2AEQH 2ARJA 3D18A 1FIGL 4OFKA 2ZZUT 4WFHD 2SEBA 2WANA 1Q0XL 2BVQA 3MJ9A 4MNHB 5C0CD 1UH4A 1N8ZA 4NWUL 1BVLA 1MJ7L 1FGNH 43C9A 3C5SB 4JPVH 1D6EB 4JRXE 4KHXH 4CMHB 3O4LA 1NH6A 3DV6A 3S37X 5CJ5A 3DXAB 1JHTA 2IQ9H 4GW4A 5T1LB 4F57H 4M7JL 5F7DA 1LO3H 1D5ZA 3HZVA 3X17A 2PYEB 4IJ3C 3GSQB 4TULL 1I1AB 3ARFA 3B8YA 5I6XC 1IILE 4OZIE 4WHDA 4PJ8A 1BX2B 3QDGE 1CTNA 1ORSA 1MIEH 4N5UA 2GJZB 2HFFB 4ZO8A 1G9NH 1EERB 5EA0H 1B2WL 1BWWA 2XA3A 1FH5H 4XWOC 4U1IA 1QLRA 4XWGL 1YECL 3TVMB 3B5GA 3L3OA 1WTLA 4J3UA 4EIGB 3IDIA 4JRWA 4ZO9A 5CMAA 4Z0BL 4PGDB 4UTAH 3SE3C 1CZ8L 4JDVB 1KJVB 3IVKB 1VEPA 1MUJA 2C4FT 1PVHA 5HI5D 3SBWA 3NACH 4YHKL 4I3SH 1U8KA 4DN3L 5FGCE 5F7UA 1QFHA 3U0PA 3HAEH 2HMIC 2J4WH 2VXQH 2VO5A 4YNYA 3JWDL 4IMKC 3RDTC 4S1RL 5F9DC 3T65A 2NY6C 2X42A 5CKAA 1YEJL 1WBXA 2R29L 2ERJB 4JFFD 4LVNB 1JYNA 3K46A 5JW4N 4JFDD 5ISZA 2GSIA 1ZTXH 1UJ3A 3WEXB 2A1WH 5J1AA 1TVHA 1G0YR 2ZUWA 1C7SA 3QH3A 2YPLB 4NQSA 4FQXA 4XNMA 5EZJA 4J2XA 4TUJB 3V4UL 2X4PB 3N9GH 3FB8B 1FVEA 4LCUA 3CFBA 3T8XB 4BQCA 3FFCD 3P40A 1UCTA 2DQEH 3HG1D 3H3KA 4Y7MA 5F89A 3L3IA 1J0KA 1CQKA 3EYFB 1AIFA 3MLZL 4IJ3B 5I6XB 2HG5B 4LMQI 1NEUA 5F6IC 3BP6B 1ZLWH 3CFDA 8CGTA 2X1QA 1XR8A 3U4EB 4EBQH 3LHPL 1LK2A 4XBPB 2NW3B 3K4AA 2M1KA 3VFUB 4LFHG 2V2XB 3DUUB 3SDXF 3WNMA 5JUEL 3WS6A 2VDRL 2YRZA 1FE8H 4GSDL 1I1RA 5FM5O 2LVEA 1DQLL 1HOCA 2MOVA 1KPUA 3C5SA 4GKNA 4LK4A 2ENYA 4GG6F 2QKIB 3KWWB 1SEQL 2EIBA 1BF8A 3DXAA 1YEHL 2NMSA 4LRNH 5T1LA 1NCDH 3D9AH 3MV01 3PWJB 5ETUB 4GXVH 2PYEA 3JTSB 2XT1B 2VQ1B 3BEVB 4J12A 5JHDD 3OB0K 1VERA 5DD3L 1BX2A 1MREL 3IKCB 1LE9B 3QA3B 1H3GA 1ONQB 2PETA 4KXZH 1DBBH 2DDQL 3RDTB 3QWQB 2GJZA 2VABB 4X7DC 3OKYA 2NY6B 5HBBA 2E8YA 2HFFA 1O0VA 2FX8L 3UYRL 2Q6WB 4PRNB 4QHKI 4PLNC 3FKUS 4GAYA 4XMLH 2MJWA 3P9MB 4AIZB 3ALPA 4OTXH 4OM1H 3TVMA 2WIIB 1HDMB 4HFWB 2D7MA 1IC5L 1PKOA 4HWBL 4PJHF 5F21B 5IB2B 2VZVA 4PRBB 4O5LL 3D39D 2AJYH 5KVFH 4PGDA 1FGVL 1RZIB 4WO4C 1DN0B 5J6HB 4JDVA 5B8CC 1GGIH 1DQMH 2H1PH 5I19H 4GRWF 4KVCH 1AQDB 4KKLD 1JF5A 4JKLA 2C3WA 2MPAL 3RUGE 2ZCLH 4HC1A 3TLRA 4QF1B 5F6IB 1J88A 1JBJA 1HN1A 4G80B 5JMOC 4MQ7B 3HI1B 4NQUA 1A6PA 1ZA3B 2X1XR 3D85D 3NIDE 3WEXA 3WXWH 3QIBD 4Z7VB 3TBYB 1HZHH 1AC0A 4DN4L 4HBCL 2NX5E 2H3NB 2DOCA 1NCAH 1BFOB 4PUBL 3QUZD 1T7YA 4QGTA 3GHBH 5HGAB 4BZ1H 1IGIH 4NM8L 1F4YH 4YGVA 5D7SH 5J4MA 3U2SB 3FTGB 2X4PA 1R0AH 3LD8C 3DGCR 4WGVB 3T8XA 4XVTH 4JGJA 4PRPB 4C56D 4NN6C 5CHNB 5KSUA 4R26L 3WV0A 1GZQA 3VMNA 1PX4A 4Z7QF 2ZG3A 2APTA 4ZSOE 2O5YL 4LPXA 2HG5A 3G6DL 1EJOH 5IMOB 3BP6A 3QDHA 5D2LA 2LVCA 3U4EA 2ZCHH 2QQNL 4CU6A 2V2XA 1MCDA 3DUUA 5T33H 3SDDC 1S3KL 2R2EA 1RJLB 3QDJA 3OL2A 1IM9A 1A6WL 4X4YB 1FZOB 1HNGA 5IWLC 1LEGB 1K6QH 2B0SL 3RY6A 5HPOA 1F11A 3UTTB 2EDJA 2QKIA 1WAAF 2F54B 2EYSA 4HZAA 3SE3A 2VTFA 1JPTH 4DJMA 5B8CB 4M1CD 3PWJA 3MRLA 1ZLWK 3JTSA 4ODVH 1ZKAA 2VQ1A 1R5IB 3BEVA 4JKMA 4M6MH 1OTTC 3DHMA 3B83A 3IKCA 5D2NC 1LE9A 1ONQA 4Y16D 1PZ5A 4MJ5B 4IMKA 3RDTA 2VISB 2VABA 3LKPB 4PJCF 2Q6WA 5I16B 2DICA 4B0MM 3P9MA 4ZUWB 4AIZA 4XNUL 4HWBA 4TPRH 1HDMA 2DIJA 4HFWA 3O81A 2MQCA 4JFDB 1HILB 4PRBA 5I1EH 2V2WA 5DUML 2HTKD 5E1AB 4X6DE 1VHPA 3GMPB 3LD8B 1RZIA 4M1GH 1DN0A 5J6HA 2P5WB 1MAML 5IVXF 1KFAH 3ARQA 3REWB 5DZLA 3AU1B 5DK2A 3ZDYE 3ULVD 4NN6B 2H41A 4BA8A 4MJ6A 4K9EH 1JZ7A 1FYTE 3I6GB 5DTFB 4HULB 1AQDA 2DKUA 2EC9T 2VZOA 3LKSA 3GGWB 5DJYB 2P45B 3E1F1 1F2QA 3Q3GB 4JM2F 4QF1A 4DW2H 2MFNA 1N4XH 3LQMA 4G80A 4MQ7A 3MV7D 4XP6L 1KTKE 4WWKD 2VWEE 4OIAA 4UBDC 3SDDB 1NMAL 3RVTC 1EX0A 2VXUH 5FGBC 3VGFA 3V6OE 4FQIL 4Z7VA