1UWFA

1.7 a resolution structure of the receptor binding domain of the fimh adhesin from uropathogenic e. coli
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH PROTEIN
publication title Receptor Binding Studies Disclose a Novel Class of High-Affinity Inhibitors of the Escherichia Coli Fimh Adhesin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 34
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2004-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1uwfA00
4X5QA 4XOEA 5FWRA 4XODA 2UY7B 3BFWA 1PDKB 5FX3A 3JWNG 4CSTA 4X5RA 2VCOA 4XO8A 3ME0B 4CA4A 4J3OH 5LNGA 4J3OF 5IQNA 2JTYA 4BUQA 4ATTA 3BFQG 4XO9A 5IQOA 4XOCA 5LNEA 4AV4A 3ZL2A 4X50A 4AUUA 4X5PA 3ZPDA 1QUNB 5FLUA 4XOBA 5JQIB 4J3OG 5F3FA 3ZL1A 1TR7A 5ABZA 5AAPA 2J2ZB 4AVJA 4AVHA 3MCYA 4XOAA 3JWNE 5AALA 3BWUF 2UY6B 2WMPB 5CGBA 5F2FA 4LOVA 4AVIA 1N12A 5AB1A 5IQMA 4AV5A 1N0LB 2XG4B 2W07B 1KIUB 4CSSA 4AUJA 3SQBB 1UWFA 1ZE3H 4AUYA 2JMRA 1KLFB 4AV0A 3RFZA 3JWNH 4AVKA 2XG5B 5FS5A
chains in the Genus database with same CATH superfamily
3LEYH 1EO7A 2CDEA 3BSHA 3BH8B 4KAQH 3QDMD 4KITB 3ZZLA 3ARPA 3PWPE 4ZMOA 5CLYA 2WB1A 5C0AB 5FW6A 5ILTL 3R7RA 1D5XA 4JQIA 2C9RA 1NDMA 1ZCRA 5JQHC 4L3CB 1A7NH 4M5YL 5H35B 1Q9KA 1J8HE 43CAA 4WTXA 2YD2A 1EERB 1HYSD 3NJLA 5KS9A 4P2QD 5DZJA 5AW6B 3QSKB 3BP5B 2EYTA 3HNSH 1UD2A 1FIEA 1RERA 5HGAA 1R5VA 2JTYA 3GQFA 1KIRB 1ZS2A 2FZ3B 4JFEA 5DJYA 3ABLB 3ZR6A 3CQFA 2CNYA 1HQ4A 5LNDA 2Z7UA 5E03A 1SBBA 2GBVA 1A7PH 4HKXB 3ARDC 4N2CA 1RFDL 1Q9KB 2X44D 2APBA 3IDMA 3MKGA 4PBXA 3MBEA 1PX3A 1T21B 1QYGL 1UGNA 3EKCA 4HU2A 1RKRA 1UVQA 4LB8A 1AZZC 2UUDK 2VXUH 1OLLA 1KN4L 1USQA 4NQDD 4OKVA 5HGAB 5A6LA 3CNKA 5C7XL 1KZYA 1RAMA 1GKEA 2PYFB 2Y5TA 2K9UA 1T5WB 3MRKB 5SWZD 4AVHA 2FQFA 3E1F1 3B34A 4LSVH 1HQ4B 4RISL 4N2FA 5E5LA 4HMDA 4GXUM 3RNKB 2OZ4H 2EICA 1T83A 3TV3H 5D93B 5SWSB 3FO0L 2A6IA 5ESAA 3IFPA 1LM8V 4IMLA 4YHOH 3RVTC 4ZFZB 5DQJA 3KPRB 3DOIA 3S2AA 1NCAL 3QXAB 4GXVH 2XBDA 1UVQB 5HYJA 3H9HA 2MPAL 3CFEA 2WOBA 3QIUC 2CHWA 1XH1A 4X8CA 2Y5TB 3T3ME 1O6VA 2XKSA 4P5TB 3BDBA 4M8RA 4O58L 5AW3B 2P4AB 4R4NC 1G0DA 1B90A 2ZWKA 1UXWA 4YL4A 5I1HH 2A6IB 1PCXA 4UZUA 1HEZA 1Q0XL 3ULUE 4FX5A 4EN3A 4XPAL 1MAML 4L0ZA 1OAZL 4MYWB 3VGDA 2F8XC 2DYPA 4RGOL 2Z92A 3LZPA 2OFQA 2Y6SD 5DJXA 5ERWB 4A7QA 5I1EL 3NBNA 2AEQL 4U1SB 3I3DA 5L2KD 1K85A 5D4QA 3MLTB 3ARED 1DSFL 1JFHA 1UCTA 4PJ9B 4Z7WB 2ITFA 2VR3A 3V6BR 1YEDB 4H8QA 2AABL 4WVRA 5C6TH 3T2LA 5JOFB 5KJ7E 3WTXA 3FCSA 1VERA 4AKPA 4ZZFA 2RHEA 4LHUD 5AVYB 5DGQA 2Y7SA 4PJAE 4E9YA 2D2CC 5IFAL 4NRYB 5FDYA 2YAQA 5IFHL 3ZE2B 2P8LA 1UZ8A 2XQYA 4LO9A 5FECB 1WICA 5CEXB 5IHBA 1AIZA 2YJQA 1JGVL 4AQ1A 1WFTA 3BZ4A 2XFXB 4MXWH 4YJZL 2Z93A 2YS4A 4DTGL 5JXED 4KPHL 3VTAA 3SSGA 2WQXA 4UQDA 2DL9A 3LKSB 1I31A 4Y1TA 2DJUA 4PJIA 4FFYH 1K8IB 3FCSB 3NPZB 1KPVA 3HHSA 3MLUH 5JW5A 4Y5YC 2IGFH 3TT3L 3WY3A 3STLB 1S8DB 5IJCC 3SN6N 1Q0EA 4DH2A 4NKMB 2HLFC 2GK0B 2Q2LA 4OJYA 1JPFA 3QS3A 1XH3A 4G6JL 4AQ1B 2E7DA 2G3XA 3OC5A 3QXVA 2BVTA 4B6ZA 1KCUH 1HFUA 3B5HA 1OB0A 1SN5A 2X7LA 3L4WA 5DK0A 2XWZA 1DBBL 1JZ2A 5D7JC 1IM9D 4MNQE 3VSVA 5D7IE 1NJ9A 2E7BA 2ZYHA 3ATBA 2NXYC 2WPGA 4UBDC 5HHXH 1SXCA 1A3QA 2BOCB 2HX8A 1CVRA 1ZVSA 5F7AA 3QI9C 3IDYB 2TRYA 5D7LB 5B1AB 4M61A 3MRCB 1KJMB 2EH7L 3ABGA 4N9GA 3FCTB 2C7UA 4TXVB 1EMTL 5GSRA 3Q7JA 4I3GA 4XPFH 5F1OB 3WSQH 3HW7A 4QTHA 3WDJA 1LE5B 1G9MH 4X80L 4Z7VE 2JK5B 3FMGL 4IBYA 3RX7A 3ILEA 2X7LB 4GUCA 2CHDA 5CBEA 2IJ0C 2BP0B 1FIGH 4NAQA 2WNGA 3IF1B 1IU1A 4KQ4H 2HKAA 3SJVB 3T2NL 3IJHA 5AZEH 1IJNA 1ZVSB 1E4WH 1LK2B 4R5XA 1ZLUH 4WWKB 1DVYA 4M61B 3C60A 1U0QA 3H56A 1HCFX 3QZWG 1IZKA 3ULSA 4XWGL 2CXKA 5JHDD 5JPNC 4PB0H 5EOCH 5I6NA 4Z7AA 3LPGA 1ADQA 3DUHA 5C92A 2V2XB 1ACCA 3C2SA 4UB0H 4XVJL 1YUHA 2WXOA 3VGEA 2QGEA 3W9DB 3GEFA 1VGEL 5J1SC 3WV0A 2MOQA 1P9MC 5IY5B 5IKCB 1NMCC 4HW6A 5FYKD 1G5AA 2GB2A 3FO1A 3QC5X 4KNTA 4JFHE 1HQRB 4L0PB 1E43A 4P9ML 2LTQB 1ET7A 1Q38A 4X5RA 5CKGA 4PR5A 5FCSH 4F57L 4JG0L 3D0VB 3K4DA 3CWGA 3VFWA 1JHKL 3T04D 3OMAB 4M5TA 1EDYA 1JF5A 2CKBH 3UGUA 1J1OH 4XXCC 1FNLA 3P4OA 5ID1A 3KYMB 3W0WD 4XO9A 4YLBA 2DKUA 2PR4H 2O5XL 5IBTH 5T5NG 5CILH 4DN3L 1CI3M 2AJVL 3GPEA 4HUXA 4HIIB 3GRWH 4WCYL 2XA3A 1NL0H 1S4IA 3PJLA 1N6QL 4HJSA 2GTWB 3ZMNA 4LCUA 5CFHA 5FYJU 4MAUH 4S2SA 3LD8C 4BDVB 3KLHD 5C71A 3C8DA 3VA6A 1UXSA 3KXFA 3N1MC 1BJMA 1GAFH 1UM5L 4MFHA 3IE4A 1MJ7H 3M45A 5JQ6L 3N1GC 5LBVA 4D8OA 3MZTA 3Q44A 5INDA 4ZJ9A 1Y7VA 2UY7A 4X5LA 4MB5A 4IBLT 5E9NA 1KCLA 5HYQB 1JVLA 1BJ8A 3C08L 2O4EA 1P84J 1FSKB 1FBIH 4GNKB 3US9A 3SPIA 3BFOA 2W59A 3ZKND 2JKRM 2W0LA 4UM8A 2ZP0T 1VSCA 1AHWB 4BFOA 3HE7A 1ZE3C 3X12A 1OP5K 2CDGA 4LGPB 4HX1B 1UXSB 3V0JA 3B2VL 2AAVA 4AV5A 1RURL 3F7VB 4AE0A 4B50A 1OCCB 5ESVB 4GS7B 1OALA 3H85A 3NGBC 5IBLD 1FO0B 5CD5D 2BY0A 4FADA 1AQHA 4B0MB 1A7QH 4O2FA 4XP1L 2HXAA 1LO0H 5HHME 3SGDH 4R3SB 3SQOL 3U4KA 1KB9K 4LVNB 1OP9A 2QLVB 3BEVA 3VYPA 3VWKD 2GI0A 4WV1C 3UO1H 2BCKA 2EAEA 5C2BH 5KBNC 3KGSA 4N8CH 1PW3A 3HE7B 3RI5F 1NIFA 3WLBB 4ZDHB 3ZDXE 1GYAA 4FQJH 1I7RB 1U33A 1WFMA 3EYVA 4MHHG 4JJ5B 4U6XB 3EFDL 2D4FA 3IFNH 2ATKA 5I18H 4W9CC 3CX2A 3Q1EA 3EYFB 2ROXA 1C7TA 3J7HA 3VMOA 2X4SA 4PV1C 5LAXB 1FZMB 5DD5H 1SF5A 4EZKA 4P2RD 5LGHH 3QVAA 2VDLL 1IGYA 5ID0B 4O2FB 2NY3D 1PEWA 2QQLL 4LKCB 5CEYA 4YSAA 3W5NA 2HN7A 4DKEL 2X6CA 1PDKB 3MODL 4FZ8H 2BCKB 2ED8A 5LQBL 1ZT7A 3LRHA 1YN6B 4HP5A 3FSOA 4P57B 5GGSB 4L8DB 4N2EA 5GGVL 1Z9SB 3EYVB 2MJWA 4LOFA 4ALAC 4O02L 5ICYA 3PQYE 4JVUA 3GJFH 2FHCA 2J6EL 1R17A 3K8LA 3W11D 5E8PA 5EEWA 2DB8A 3CX5K 4LLUA 1XGQB 3BGFB 2NX5A 4HH9B 3OKMA 1F1GA 2D7TH 3QDGA 4NDMB 1BBJA 1XHHA 3CVHL 4NJAL 1HYSC 3R1GH 4FCHA 2DI8A 5F6IB 2BVPA 5DJ2A 3V79C 3KYNA 2A9BA 5EHFA 5E9DA 2R0LH 4C4BA 5L9DH 1KTKE 1F86A 2DIAA 1MFVA 4KKZA 4JY4A 3LS4L 4ISVA 3ZT6A 4FTVE 4CDHA 4YHPB 1FVEB 3CFBA 2VXVH 4OIBA 4R0LA 3B2UD 4XMWA 3NCJL 4LZKA 4QRTA 1BGXH 1DQJA 2NX5B 3JZ7A 3UAJD 2JB6A 3QDGB 5C07D 3D07A 2DQCH 2EDOA 2R29H 4QCIB 2QSCH 5KVEL 1A6AA 2J8UA 4A6YA 1UC6A 3E2HC 4HWNA 1P5UA 3VFPA 4IRZH 1FNFA 4NQVA 4UUJA 3BWUF 5BZDA 4M6MH 1SM3H 4OLVL 5I1JH 4OLZH 3UX9B 3FQYA 1TO5A 1M7IA 2JKSA 4BELD 4UF7C 3ERXA 5I9QB 3MUY1 3CFBB 1UXLA 3HE6A 3IJ7A 4OD3L 2GJ6E 1XGRA 1TNNA 1BXVA 4N8VB 3ZE2F 4GW4B 1TTAA 2Y1VA 1XO8A 3QQ4A 1DQJB 5AQ0A 4JO3L 4OKDA 3X3GL 3VXMD 3W81A 1DSWA 3D09A 2I7SA 3BVTA 2Z8RA 4KWUA 4XMUA 4HIXL 1A6AB 1VFAB 4XR8C 5BVJB 2CO6A 3ARBD 2PCPB 2X4RB 1L0PA 1P5UB 2CBOA 4JCLA 4W9EC 3HZMA 1MNUH 1OHZA 3O0RH 5EORL 4KRMB 4NEHB 4JN2B 3S3DB 2WGNB 4WI5A 5DO2D 1OAKH 2PO6C 1W72H 2Z35B 4CVXA 3DTDA 1C08B 2L8AA 3K5RA 3L54A 1XGRB 5DMIL 3NCYS 5KUKA 4ZX3A 1P7KB 3NAAL 3WN5C 1MCOL 4U31A 1YYMH 5JTWA 2BW5A 2C3GA 3V4VL 5EU7E 5HYIA 4EI5A 1NC2A 3QZNA 4K3EH 1GY1A 3MRNA 4KQ3H 1WV7T 2XX1A 4CC1A 5EEYA 4N0UB 4PRBA 3G3LA 6PCYA 1QVOA 2Y6SC 1KYAA 3WEMA 4N22A 3AUWB 3KLKA 1T03H 5T1DH 3AREC 3UJTL 1A3LH 5FX3A 1WFJA 4UWQB 3GSWB 1CE6A 1QLFB 2ZNXA 1MFAL 3NDZE 4Y4KB 4FE9A 3QA3B 3NUKA 4AITA 4Z76B 1CYGA 1MFUA 1QUPA 1KV7A 4JR9H 3F5WA 3RWDA 5B8CA 1PL3A 2K6WA 2OTWB 1OARH 4MMXB 4NZRH 2C3VA 1FC1A 4KDWA 4LCYB 2H6PB 3QNYA 1J1PH 5DEJA 3LEVL 3U1PA 5EIVA 5KTEH 3ESMA 2IANA 2FJHB 3RYMA 1SLVA 5HVHB 1QABA 5CGYD 3NP3A 5D1ZB 1I1AD 3AWFA 5JXEC 2QLYA 4QXVA 2HVJA 2Y24A 3SOTA 4TULH 4I9WD 1XIWA 5FYKU 4IRSA 2H7WA 3D9AL 1BIHA 1U36A 1U6AL 3VI3F 3MA9H 1R3HB 3NCEB 5JORA 3R19A 1TPXB 3CC1A 2IH3B 4R8WL 2AQTA 3ECBB 1M53A 4Q14A 4HF5L 3HPLB 3P4MA 1ZV9A 3BRGC 4WDIA 1FFNA 4HS6A 1G9MC 1TZGL 2CK2A 3MCYA 4JM4H 2LE9A 4NZFA 4A7VA 5I6XC 4FG4A 1CF1A 4PRPE 5FKAA 2HVJB 4MJIB 4FNTA 3GS7A 3L6FB 1S2EA 2WKOF 1J1XL 3CDZA 4PRID 1NKGA 2AK1L 4YSUA 2DWXA 1GCYA 4FNQA 4YDKL 5CCJA 4M7JL 1A4CA 1T3FA 4APXA 1IO4C 2DLTA 1PPIA 2CH8A 3B3BA 4BRJA 1BQRA 3F12A 4KI5F 1NEPA 3WL9A 1CFQB 4OAWA 1KTJA 2XXFA 2WQUA 3U7AA 4PJ8A 4KO7A 3ULVD 4XN9A 1G6VK 5EA0L 3SQRA 5MEOA 4HS6B 5JW3L 5CJ5A 3AMKA 1MXGA 2AQSA 2HRPH 4LHUG 5E6UB 3CDZB 3K4ZA 1HU8A 4RDQF 4BFKA 3E9TA 2W0PA 1NCOA 1NBCA 4L4VB 3EHBB 5CMAB 1CD8A 4APXB 1MFDH 2ICWA 3HLKA 1J0IA 2LU5A 3F12B 4OM0L 5I8CB 1C5BL 1SEQH 2E27L 2F7PA 3OZ9L 1I8MA 3I50H 2P5EE 2CK0L 1SXSA 3PABA 3SGKC 5BS0E 4NHCL 3L2MA 2OMXA 3WY1A 4FRWA 3CDGB 4A7TA 2G0LA 1A5FL 4X99B 3ROOB 2DDQL 4N86A 4MZRA 2OP4L 2HKFL 5EBLB 4FYSA 2XIDA 3B2PA 4ZUVB 1DDHB 3WEXB 1RZJH 3FTGB 1S3KL 2X0UA 4TVPE 3SPVB 4CW1A 4IBWA 4HJ1A 1E5YA 4ODXB 3I6LE 4JRYD 1ZSDB 1ASPA 4PQXA 5DVPA 2EVFA 1HTYA 2CGYA 3NIDE 3VMNA 3ZTNH 4ELKA 5EC1B 4CBZA 5JHLL 1N4XH 2B39A 3QQ9C 3OAYH 3ZE1E 2ADGB 3IS1X 1I1YA 3T5WA 3RGVD 3ZE0B 4XCNA 2DICA 4PG2C 2AZAA 3PHSA 4MA8H 5MEPA 4UQ9A 3B4NA 5C3IA 1LDSA 1K4DA 1WE5A 1SEBA 3KBFA 2QPUA 3ZPDA 2GC4C 3TBTA 4YC2B 3O6KH 5IW6A 1DTUA 2CUAA 4NM4L 2X41A 4CC0A 3QEQD 3DGGB 4OM1H 1QHQA 4G8GE 3MLSL 5A6MA 1T7ZA 5E99H 2BIIA 3DNKA 2FL5B 1GSMA 4H1LH 4QF1A 3QHFL 4Y9EA 4ELKB 2OJ1A 1HS6A 4G3YL 1J7VR 2NY5H 3TJHD 5BXFB 1JZHA 3ARDA 1JMXA 3DGDA 4XOAA 4XCNB 1JD7A 3FK3A 4U1IA 4YHNA 3KLHC 2WIIA 4H8PA 1NOLA 3B8SA 2EDLA 3STZB 2D31A 4LDEB 1SEBB 4GYBA 3Q06A 2J44A 3BPLC 1MJ8H 3EIFA 4YAQB 1AFVL 5DVNA 4ZTOH 5HGDB 5IW6B 3AG1B 3IJSA 4OLEA 5T5FL 1NCIA 2OCJA 4PGDB 5KVFE 3GSVB 1TZHA 1SXZA 5FA4A 4JFXB 3TO4B 3WUZA 3BGMA 4RAHA 2QTVA 1PY4A 5A2FA 3QJQB 5L88H 1MHCA 3DSNB 2OXGA 2GUOA 3RAJH 4JL2A 4UT6L 3ZKNC 4HBCL 2R39A 4OI8A 3QJVB 2FBJH 1CC3A 3QXWA 3VD5A 4I3RL 4JE4B 5FFGA 2ZKHH 5TGBB 4HFWA 1JBJA 3HG1B 3O81A 3FTXA 1CICD 2KZKA 3L3GA 4JRXA 1JGLL 5JDSB 3HKFA 1KGYE 3QIUA 4FF9A 5IBLC 5FA4B 5CD5C 1AXTL 3NEOA 2FSEA 3O45B 2OXGB 1WO2A 2GUOB 3WNLA 4GG6E 4M8UA 1CK0L 3DRTA 4J2XA 4ZYKA 3VWKC 4XC3H 1RUQH 3W9EA 3BX7C 1ZPUA 1N8OE 3MNWB 3QHTC 3NCMA 4Z0XA 4D0DB 1AKPA 5ANMB 2O61B 1YEFL 3S48A 4EDXB 1PJWA 2BFVL 2EKSA 3DO4A 2PUQT 3K6NA 3KW7A 2XIIA 3SBWC 2VR5A 4UV4H 1YJDC 4NZTL 5IMLA 4UQIM 4KH2A 1U91A 4W9HC 4N24A 1K72A 3QUYB 3LKQA 2NY3C 4F2MA 3MRIA 4XC1H 1C16A 1ED3A 2B1HH 5ITBL 3K74B 5DHMC 3B9DA 4PJHB 3B1UA 4NSKB 2ZYIA 1M3JA 2UWEA 1F8TH 1BIIA 2X4QB 4O4YH 4Y19D 4DVRL 4BA8A 3HNTH 3RA7L 2ZP9A 1V3KA 1FRGL 5ENWB 3UMNA 4Q97A 4J39A 1YY8A 1ZGLA 3D1MC 3QRBA 4ODUA 5EUOA 3EOBB 1AD0A 2IBBA 4W1TA 4ZMZA 1U91B 3QZWA 1WAAF 3INUL 5K9KA 4LF3B 1FORL 5F21B 4MJ6A 2N56A 1MJJB 5IUCA 5EBMB 4M5YH 3V5KB 5FPIA 4R97C 4M02A 1Z3GL 4MMYA 4PJBB 4L8SC 3MCLH 2X70B 5A7BA 4N20A 2JI1A 4MTMA 4Y5YA 1PKQE 1JGDB 3B2UC 3BVNA 4W9FC 4TNEA 3JWNE 4NM8L 3MJ9L 4E68A 3L45A 5DHVA 1ZLSH 4ZW6A 5JYMA 2PTVA 3UAJC 3VQ1C 5D96C 1AQDB 1UACH 4ONFL 4TUKH 1NOAA 1CPUA 5K59E 2ZAHA 4AVIA 3X13A 3FQNB 5D7JA 1A47A 2VJXA 5K39A 4FLHA 1M2VB 3QO1B 3QFJD 3MCKA 3QUXC 2DQTH 3GMRB 1QYGH 3O41B 2XA8L 3QI9A 4WU7B 5D1XC 4PW4A 4NC2B 4DUWA 5C7XH 4S1SL 2E7CA 1F1AA 2NTSP 3NPSB 2GJPA 2JKXA 4FEIA 4NFCA 1I1RA 1AO7D 2BNRB 1BMZA 1AS8A 2H3NB 2IMMA 3GHBH 4R7NA 5DEZA 2CHNA 2V7NB 1JWSA 3ARBC 4OLWL 3BKMH 1MIML 2I26N 5DD0H 5K39B 2HWZH 2NXYB 3FFCA 1DVXA 1IM3B 2JQAA 2WW8A 3OTTA 3LSOB 5DO2C 4JPIB 4F3FA 4GMTH 1U8LB 5FYLL 5JO5B 3L1OH 4PRNB 1T4WA 2J2ZA 3HG5A 3MUUA 1K5NA 2PF6A 5ECGA 1OCOB 3NSJA 4XODA 3BSGA 2BVEA 3GNMH 4O2CB 4U1MA 2G3ZA 3WFBL 4L8BA 4R7DA 4F37F 3A6BL 1KJVA 2DWSA 2F53B 2M1KA 3HTLX 1ZS8A 2CHXA 3IMSA 4I85A 5KVDH 4NUGL 2FT8A 2Y69B 1KENL 3HG2A 1NAMB 4APQB 1A22B 1RMFH 4F33A 4ODTH 1B6UA 1P9MA 1ZANL 3FRPG 4XMZA 4XPAH 1MAMH 3KR3H 1BM3L 1XGYL 1NGPL 3QPQD 4NQED 1VEOA 5A3ID 2HVBA 3VXUD 3F8UB 3T0VA 1MW0A 2OMTA 1VCBC 3CHPA 1EHKB 4V1DD 4XPBL 2WVVB 5JPNB 5DR5H 2ZXCA 3U82B 2KQMA 2ADFL 2EVHA 2GY7B 3TJEL 1DSFH 1RULL 3IWVA 4M1CD 4MA7L 1DFXA 2AABH 1RUPH 5FB8A 1INQB 4H7VA 5FO7A 2NCMA 2CD0A 1F2XK 3RDTD 4ADJA 5C8JB 2CLZA 1I1AC 2VL5B 4XXCA 5IFAH 4OGZA 4GQZA 4JZJB 1GGBL 5GGRY 1UUSA 4BZ2L 1E42A 2YMOA 1J0HA 4OUOA 1SJHB 1OEZW 2OMTB 3M1CA 4DTGH 5HI5D 1MI5A 4A39A 1TJGL 4PBVC 2VLKD 1FE8L 5AB2A 1QZNA 1W8NA 5FO7B 3MV9E 3OKDB 1H0DA 3WS3A 4KK8D 3AGWA 5D7EA 3IAQA 4BZ1L 5ITFA 1WA2X 4XAKE 1GXEA 3VXTA 2R56L 1OM9A 2HX9A 4BD4A 1TZAA 3B2XA 2KYIA 4K9EH 2VXSH 4AXWA 1MLCB 4XP4H 1TZ8A 4G6JH 1LEGA 4Y9BA 3GSNL 4EO5A 3HUJA 4H8UA 3DX3A 1UATA 3CLEL 1ZLWK 1BEYL 1MI5B 4WEBL 2R4RH 4XMLL 4XO3A 1DBBH 1NTDA 4DW2L 2EE6A 3E8UL 5C0BD 4N0RA 3WELA 4G8EB 5ALCL 3QUKB 4J8QA 4MLIA 4PJFB 3J2PA 4I87A 3ULVC 2V9UA 1ZIAA 3UJIL 5TTRA 5IVOA 2D0GA 3TWYA 1VFBB 3H8NA 2Q8BL 1HHJA 2IO5A 4OJFL 3NTCH 3QNXA 4IHOA 1CGWA 3VRJA 3UG5A 43C9B 5HDQL 5IB3B 3VXTB 4G8IA 1A66A 3SODB 1KB5H 2VIRA 4L4TE 5C0JA 5KVDE 1LEGB 2Z8WC 5EO9B 1RZJC 4QHNA 2YZ8A 1QSEA 1W8EA 3T3PB 2XZCH 5F7KC 3FMGH 2VMCA 1D6EA 3VXPA 4HH8A 2NY0D 1BDYA 2Z91A 2WJ5A 3UC0H 2Q9OA 3IU4L 5AOJA 2RQEA 4KTYA 2NY7H 4WV1A 5EIQA 5C0FB 3BVDB 1MJUH 3T4AB 1T0MA 1V8HA 4B9YA 4Q52A 1I3RA 4OCRH 2YK1L 2P49B 3VRJB 4M48L 1DQTA 1S5IL 4X6DA 3C5JB 3PP3K 3U9PL 3UACA 2VMEA 3KPSE 3ISRA 4D7BA 3NK3A 1LEIA 4OZIA 1GC1C 1BD2E 1LTXA 4G9FD 5EU6B 5FKPA 3H2PA 4XVJH 1Z1WA 3CPLB 4HV8A 2Z91B 4JO4H 4WU5A 3GFUA 3K1DA 4Y0GA 1YVLA 3WFEH 3WCYA 3PWUB 4WV1B 1G9NH 1VGEH 3QDMA 2Q3ZA 4HOMA 1I3RB 2FO8A 4C54A 1TYEB 3SKNB 3OF6D 5BOPA 2QZQA 2VITB 1M56B 3U25A 4JQXC 1EXUB 4NKIL 4WI0A 5TDOB 3RGVC 2EEAA 4HSAC 2VWEC 2PW1A 2ZXAA 3N40F 3WNKA 2JB5H 3SDAD 3ALWA 5D2LB 1E65A 2QMKA 3RIAK 4P2QA 4PJ7A 1I7ZB 4LL4A 4F57H 2WXIA 3FU3A 3QPKA 1DHKA 4JLRA 3VH8G 3TBCA 1QSFB 3DUUA 4PCYA 5J06A 4GOSA 3Q6GL 2ZUUA 1IC5H 4OD1L 3RL2B 1QPKA 1J9CT 2K7QA 3ZQXA 4ZMNA 2YA2A 4JHAL 4XBGA 3BKCL 4HPHA 2L0DA 4DN3H 1ZVHA 3BPNC 1I8LA 2QQKH 4B3EA 4WCYH 2QADB 5C70A 2CJ3A 3GBNH 4OCWL 1JNHB 4QPEA 3LV3B 3P3TA 5BRZB 1QWNA 2BMKA 3DUUB 4PJHF 3X3FH 4H88L 2FR4B 4NQDA 4DO5A 3NIGE 5KS9E 3L3KA 4NWTL 5JQ6H 2GAZB 1N64L 4WW1A 2APFA 4QXUH 2ORBH 1IEBA 3L1EA 4YHZH 4J28A 2AEPH 1F6LL 4TSAH 3ILPB 1CR9H 1HSAA 4JFEE 1CS6A 2JJTC 4GRWF 1GSKA 2FWOB 1F1DA 2BVQA 4QNPF 1BQSA 1CICC 3WTUA 1M57B 4I7ZC 5EF3A 4XXDB 4WI7A 2ZUVA 3B8YA 1YMMD 4PJBF 4MQTB 5KSAD 4M3JA 5SWSE 2K8MA 2JIXB 5D6CA 2DPKA 3DMMC 2E7MA 1JK9A 2ALAA 3DI3B 5DFTA 4MAYB 5LBSL 4CU8A 3P3RA 2G5BA 5E94B 2YPVH 5AD0B 3BFWA 3O3EA 3WN5A 3VW3L 5JNYB 3QHZL 1U92B 3HRZC 3RY6C 1NKRA 2BRRL 3A6CH 5E6IC 4WF7A 2L7EA 3ECUA 2EEFA 1DLFL 4L48A 4LVHC 4LCWD 5ISZD 2YSSB 3VCLA 2FNWA 3PNWA 3ECWA 4NQXA 3GI8L 2AKRA 3U0WH 5ICZA 4JHUA 2CRYA 2DRUA 4XCFH 1BFVH 1G1KA 4N9OB 5L2KA 2PXYB 3UIZA 3HAEG 2PO6B 3AREA 1AYOA 2YEVB 3AS1A 1F4YL 1OT1A 1WGOA 1XGPB 2NYZA 3QPXH 4H0LC 1P7BA 4BZYA 2PCYA 3X14B 2Y1AA 1GZPB 3O3EB 3WN5B 2HA1A 3UEQA 4L9LB 1BJ1J 1J10A 3KPQA 4LHUA 1KGJA 4NGHL 2QQLH 4FXGB 4FEMA 3KBEA 4Z7WE 1RIHL 4DKEH 5B38B 4Z78B 3PNWB 4K71C 1F58H 1OP3K 5LQBH 4P4RB 5EDSA 1OGSA 2C3HA 5GGVH 4NCDA 2OMUA 2WP3O 2AXWA 4I48B 1FI8C 4O02H 5JXEA 3F3HA 1ZA3B 4N90D 3FOMA 1EAOA 2DQFB 5IF0A 2OULB 4UTAA 3BAEH 1P1ZA 1FFQA 4RAUA 4P5MB 3Q3GA 1YEHL 5D7KE 5KYXB 3AS3A 4IM8A 1T1WA 2HP4A 2L3BA 4I13B 5FUZH 3O6LL 3IJYA 4Y2DB 3DX9B 2GFBB 4E41B 3VGAC 3IMUA 1XH2A 5IW1A 4JG9A 3TBSB 4J6RL 2EVIA 4ZNCD 1YEJL 1O6TA 5D5MA 4BWUA 5JW4Q 2ZKXA 4X7DC 3Q1SL 3DV4B 3NCJH 3JUYA 3CFCL 3KCPB 3S4SG 4FQ2H 1ZY9A 3UABA 1IM9A 1E2ZA 1U8OB 3VSUA 1NIBA 4Y7MA 1XSIA 3Q3GB 5DA4A 2COVD 1T1WB 3BLPX 1B4TA 3CDFA 2DOCA 1BQLL 3H9SB 2RACA 1NIEA 1SYSA 1X5FA 2XZQH 1P69B 2WQ8A 3QZBA 4JGNA 1M1XA 2P80D 1MF2L 2GG1A 3PWPD 4M5ZH 4P59H 4PJIE 4XO4A 3HMXL 4Y4FB 5GS3A 1ZLEA 1XTMA 2BSTA 3BJLA 1U3HB 4WK4B 5TDPB 4IRJD 3GXIA 3VFOB 4GQ9L 5GGUA 1GZQA 1CE1H 3WUWB 35C8H 4ZMXA 1IIIA 4ZMAT 1KN2L 1NMAH 1I9JL 1QFWI 5CD3B 3HR5A 1QRND 5B4MC 2C9PA 4M8QB 4JZOA 3KCWA 1FJ1A 4FQCH 4KGLA 1YNTA 1CDHA 4CVUA 1ETZA 1SYSB 3OR7A 4A7GA 3PY9A 3K72A 2VQUA 2G4EA 4X6BA 3KVDD 1CG9A 3OD3A 2OTUA 2QR0A 3SGKA 3S3BB 2CPCA 5JHDA 3MV8B 1YA5A 2QGDA 4LPTA 1GY2A 3GK8H 5D70H 5ACZB 1E4KC 4JFOA 2BSTB 4PW3A 4JFFB 1FFPB 3WEOA 1MH5A 3D2TA 1DN2A 2QTEA 2JKWA 5DMIH 4J3OH 2OL3L 1D5MA 5BV7H 3T0AA 1JN6B 4HK0B 1A4JA 5IQNA 4F24A 5I1AB 2V4LA 1W0WB 1Z9PA 5J5EA 5FV1L 2C1OB 1FJ1B 3NCBB 4GAYA 3W3BA 3ARWA 3VM7A 3QPQC 5A3IC 1ETZB 5FC9A 2ICEA 2WLIB 4BQCA 2IDFA 1TT6A 2Q5BA 2QBWA 2YZ1A 4J3BA 4PJFF 4UOW0 4MCNA 3P9LA 1QUNB 2FUQA 5E00B 5ETUB 5JHDB 1E5UI 1PD0A 4ZQTA 4UM9D 4AM0B 4DP6X 2XWTB 4M1CC 3GKWH 3INOA 4LLVA 2JWYA 4NAJA 3D4YA 3O2DH 4XZ4A 4IGBB 2CKBB 2VW7A 1L0QA 3OKLA 1IJ9A 4PG2A 1T5XA 1Z5LB 2XWRA 3RDTC 1BAGA 1J9TA 1ZSHA 3T3PF 1FFOA 4X9FA 3OKKA 3W0WA 5G55A 4KKNA 1LO4L 1TTFA 3SBQA 3TO2A 3P9LB 4F92B 2C9XA 3DIFA 1UM6L 2OSYA 3SBRA 5HI5C 3WTYA 3O11B 3Q13A 3JTSA 4TKWA 5F0MB 4AT6A 4BHUA 2IQAB 3D9AH 4M9OA 1BXXA 1U6AH 3EJPA 3OKLB 1WPCA 4G9DA 7FABH 3I6SA 4KK8C 4RA3A 1USZA 4HDIB 3P77A 3VSTA 1CFSA 2V5MA 1DEDA 4Q2ZA 2QSTA 1HN1A 1KACB 1KLGA 4FQIH 4U6VH 4D2NA 1JV5A 2ZXWB 1A0QH 1TZGH 3PDGA 2EH8L 3T6XA 3DIFB 2WYIA 4QDGA 1XF4A 4YK4C 1QKZL 1DJGA 2UVEA 3BN3B 3GJEA 2VT0A 1AXSB 4A37A 4NBZB 3M1BB 4FYTA 2VDPB 1QQDA 1TXKA 2EUXA 2DWTA 4L1BA 2DEYX 2IGTA 2R0ZL 3GMNA 3GSQA 3K2IA 5D2LF 5IVNA 2B59B 3M8OH 3P77B 5I74B 1JYWA 4A2LA 1JWUA 1ZLVK 1UYWL 2AV7B 2A6JA 4YR6B 1JV5B 1DUYB 1JGIA 4FULA 5EA0H 3OGOE 3KXFE 1L4IA 1C8QA 2FNBA 4YDVA 3ZYOA 3G5XA 1MRFL 1PD1A 1XF4B 3N9GH 3JWOL 4JFVA 2GIMA 1XR9A 1FZJA 2NY0C 1KB9J 4K7PL 4RBPH 1J18A 3VWKA 1QQDB 4KNUA 4XO8A 2OMYA 1SMDA 5J11C 3GSQB 1RHHB 3S7GA 3FB6B 1X7QA 3SYOA 1C5BH 1DQQA 1R3KB 2E27H 1CTMA 3N91A 4PV9B 5F3BA 3L5WA 4JJHA 4ZOBA 3BOVA 3WEBA 3SBWA 5CHNA 5F9OH 5EFIA 4HLJA 3T65B 1EHXA 4P2RA 2FO1A 3VD4A 5H94B 3GLDA 2CUIA 3G5XB 2ICES 2Z65C 5CGTA 3VA2C 1U8KB 4P3CL 5KVGE 4EOWH 3CZFA 4PYGA 5LB1A 1KDIA 4JN1L 4WJKB 2N7AA 3OXRA 2W1NA 5FR3A 4ELDA 3UYOD 3GJFB 3O6MH 2O5ZL 4PJXA 1ETB1 3HC4L 2YXWA 4JFZL 2X3AA 1FNGB 5EO0B 5IROD 4FI7A 4WNQA 4EXPX 4QTIL 3P2BA 4X7SH 2X5PA 4PTUA 3FRUA 1QA9A 4V2CB 4Y89A 3SDAC 4CADA 2V9TA 3H42L 3OJ2C 3BKYL 2Y1ZA 3OXSA 2AQ3A 3FSZA 2FATL 1EO5A 2H32A 1TU2B 3DETD 3FT2A 1LO5A 3CFJA 5K9JH 4L8SA 5HHPB 4QRAA 1JXGA 4OCSH 4NNPL 3CIQA 1P4LA 3R8BB 3ZR5A 2KZBA 1QHOA 1ILUA 3BUYB 5GGRA 1HZLA 1AGFA 1RZ7H 3FRPA 3MREA 5E4OA 3SCMB 4GAJL 3IMTA 5IFJA 3FRUB 3UAJA 4DP2X 3JV6B 3FONB 3D7PA 5EDXA 5C07A 3QHFH 3A21A 3CU7A 4OZGF 1MEXL 4HWZB 3OXSB 3PJSB 4P2OD 4UANA 2NX5E 4WRLA 3QUZB 1DO5A 3CFJB 3QDGE 1I7TA 4P9HH 3DVNB 3KWWB 1JL8A 4MS6A 1S6NA 1OW0C 1CXEA 2BVOB 3PDOB 3ZTDC 3TZVB 4FA7B 4M6AA 3O3BA 1AFVH 5E9DE 5GGRB 1RIUL 1TQTA 3L3HB 5ELIA 4WHYH 5T5FH 2P5WB 1AGFB 2WWKO 3DX6A 1CFNA 3I9AA 2GTZA 4NQTA 5IFJB 3VXMA 3ORJA 1NICA 5C07B 3LIUA 2UXTA 2IGLA 2AQRA 5EUKA 3P73A 4UT6H 3ARBA 1QLRA 2JXMA 4XNMB 5EU4A 4RMUA 4I3RH 5IWLC 5KSAC 4HUUB 1YEKH 4XHJD 2ZSVB 2Z64C 3I84A 3SGJC 1ES0B 1W72B 3NOIA 5B3SB 3QUXB 5KBDA 1Z9OA 4PJCB 1IE5A 5A16A 1HSBB 3G04B 2XNAA 2D7NA 4HZ1A 5D1XB 2KQNA 1ZHKA 4C56D 1LP9B 4U33A 3U9WA 3DX6B 5DC9B 1TQUA 1PQZA 3BIAX 1H5BB 5DK2A 2LVCA 1WAAE 2N0MA 2XBZA 32C2B 3P9MA 5AKSA 3HB3D 1G4RA 2ADYA 5C6PB 3PUUA 1BVLB 1CLYH 3RIKA 5J1AA 1RLWA 1WC7B 3EOTL 4CN6A 2Z1PA 3BH9A 3BUPA 4Y16B 1B2YA 1RIVL 2WWMD 1YEFH 4P3DB 1AZNA 2X1PA 2BFVH 1WBXA 4K9JA 4ZD3L 2N7BA 3U83A 3BUTA 5DT1H 3DBXA 1FZOA 5CKAA 2Q3AA 3ZZ1A 5I71B 5C0GB 1TQCC 3TH3T 4TQ8A 4OZ4B 2OCCB 3HCVA 3U0TA 3GZPA 3QEHB 5IOPA 3PWLB 5M95B 5JXAL 1PD6A 3GSOB 2VN6A 1KIPB 2XCMC 3BH9B 3RA7H 5J13C 1I1AA 3BYTA 2R69A 2H1LM 3DTXB 3HI6L 5TQ0L 3LIZL 3PWVB 5EBWA 2KZ1B 1A7BA 2VZ3A 2YA0A 3FU7B 4UQCA 3GI9H 2WUBL 2EYSB 2B4CL 2NUTA 5IHHA 5HHMD 1OB1A 1HEHC 1LWJA 1FORH 5IQLA 2Q3XA 3DXAB 4H8VA 2DLEA 3QE5A 2VR8A 1Z3GH 2Y5EA 3RTQD 3TBYA 3VD3A 2K6YA 4L8CA 1A25A 4BYHA 5EOTA 5T1MA 1UWFA 4AUYA 2WM0A 3KL5A 3MJ9H 3BQUD 4FXKB 4KHTL 1G7QA 2WQAA 5E8DL 2IANE 2L7QA 4PRIA 4I77H 4DPBX 1OB1B 5GGTA 1QG3A 2DQJL 3O4LD 3A0OA 5FUCE 4MJIE 2R2BB 1NFDB 2KUTA 3VX0A 4Z3IA 2ZSWA 3T2OA 2IH1A 3BEWA 2IDSA 3VH8A 2BSRA 3QCTL 4TL4A 5FYLD 3MGTB 3F01A 2K6ZA 4DFIA 1OCZB 1QNZL 5I23A 3OBAA 3HC3H 1BV8A 4J3OC 4IRJC 5F9WC 5FF6B 2WVUA 4UT7L 5CJOL 3KWUA 2N1KA 3C8KB 5HHQA 4ODHL 3UYRL 4JAMA 5GRJL 5IVXA 1LQBC 2VC2L 3CHSA 4TNVF 2DF3A 2JVUA 3BSZL 2HJFA 2W65A 3ZQ9A 1SY6L 2E59A 4NWUL 1TVDA 4F2EA 4L4VE 1FH5H 1O5PA 2BSRB 3WJJC 1I85C 5GGVY 2HVKB 3QGVA 4LU5H 1G7HA 3UC2A 3QUMH 1QLEB 4EE2A 3NH7L 4F8PA 3UTSD 1FC2D 3G5YA 4Q4EA 4MD5B 3BE1H 2MRYA 4QOKD 4Q6KA 3W39B 3A6BH 1XBDA 4F7KA 2QKSA 5DFVC 4HKBA 4AYDC 4D94A 4P0DA 3V5HA 4AJWA 4PSRA 3HG3A 4NUGH 4ZODA 4JRYA 3N2JA 2Q7NA 1KENH 4GRLD 3TA3D 4YHKL 1TEGA 4H1LA 3T6QC 2ID5A 1F4WH 3IDXH 5BO1H 3DOSB 1XGYH 1AOHA 1WFOA 4ZO6A 1HCVA 1CDCA 4FJYA 3C5ZD 4JQXA 2GSGB 3RGVA 5JYLA 1VADA 3GSRA 4ANXA 3K6FA 3D0AA 3VGBA 5CLZA 1RULH 2JLPA 3LRSA 1JD9A 4PUBL 2NDFA 4OSUL 5GRXG 1J48A 5AKVA 3SKOA 3WKMH 2GY5A 2UXVA 3ZE0E 3FL7A 5LWYH 3QEQA 5AL0A 2J4WL 4NI3A 4DKFL 4PIRF 8PAZA 4X6EA 4RNRA 5FHBH 5FHAL 3KH4A 3QQDA 3DO7B 2XVBA 1JJUA 1U9KA 4BZ2H 4KX7A 4HJEA 4LSSH 4U1GC 1XX9C 2AJ3A 5EN2B 1L7TL 2A83A 2VGLM 5DYOB 5MEND 3WJMB 3VXRB 1TJGH 1OTTC 3CBJB 1MSPA 5L4IA 5TF1L 1IL1B 1FV1A 2C8NA 4F7TA 2IFFL 1AJ7L 1FDLH 1BX2A 2O5YL 4DGYH 4E36A 2Z31D 3LRMA 1ANUA 3CFDA 4MA1C 4U6TA 1R33A 4D9RD 3AJ7A 4OT1H 3SDYH 4DQAA 3HBZA 3I3BA 5IMMA 1X4YA 3RVXD 4PYHA 1U58A 4ZUTA 1X9RA 2R56H 2F7QA 3VD2A 3QQDB 3NACL 4DEPC 4HGWB 4ZUUA 3VG0L 4XOEA 3V7AE 2ADJB 4KC3B 2JKTM 3GSNH 4BV1A 4CILA 2JELL 4KKBC 3BPNB 4YSDA 2JJTA 1S7TB 1BZ7A 2BVYA 5CO1A 1OAXH 2F08A 1CDIA 4K3DL 4YQXL 1MCDA 3ESUF 3E8UH 1CICA 1FV1B 2C3WA 2WVTA 4IMKC 4F7TB 3ZTCC 2V8MA 3ATDA 3S34L 3FT3A 5I0ZA 4S0HA 3UJIH 4HKZB 3HG1E 3T77A 2B0SH 1KJ2A 3NABL 5F9JA 1DBML 3U48A 4QRPD 3B7RL 3VFSB 2FO4A 3HPJB 5DSCB 3L5IA 1JPST 3HI5H 4PJ5D 5DQDL 3N1FC 4LSTL 3LZFL 3DKHA 3S4SA 3RY6A 3HBPA 1E9PA 3HRZA 5E6IA 2I5YL 2IAAC 4K8RH 3WNNA 3P0VL 5F1IB 4E0RB 3IU4H 1XEUA 4LSPL 1CICB 2Q1EA 4I2XB 4X5PA 1NZRA 2I69A 4X4ZA 3UYPB 4GKZA 5D72L 3DMMB 2BLFA 3T2QA 5F9JB 4KY1L 1K6QL 3TNMB 3G5ZA 2ZAGA 4JRXE 3PIQA 3KLSA 2IAMD 3RVUC 4FQLL 3GUTB 2Z4QA 3MGOA 1W8OA 3CBKB 1OGAD 1E9PB 4Y19A 1MHEB 3DARA 5E6IB 1RJLA 3TS8A 3V0FA 3REWA 3S88H 3BJ91 4LVHB 2WMPB 1QP1A 3L7FB 4L37B 2AANA 3MXVL 4OV6F 4PJCF 4AEHH 3VDBA 3MV7D 3IN2A 1LP9F 4FQXB 5SV4A 3DETC 3L3JB 2FX9L 4JREC 5G4MA 3QFDA 1P7HL 2ALWA 2Z4QB 2EEXA 4DO4A 1BCIA 4ANWA 4X42A 4PGBB 4HT1L 4NOBA 1OK0A 4H20H 4TN9A 1Q0YL 5DWPA 3KPPA 2WD0A 1KG0A 1IEAB 2FQEA 4I1RA 3I02A 1OE3A 4TVSa 2UWEE 3BP6B 3C75A 2D3JA 1ZHNB 5IIEA 3VQMA 3MNDA 3MZGB 1F41A 5IHZA 5E95B 3BKCH 1AZBA 2WANA 3B9AA 3MN8A 2OAAA 2OPCA 1A9EA 2YAEA 3EF4A 3QFJA 5EUOE 1FO0L 1XGUB 1FL3A 3F7YB 3E9UA 1XDTT 2F2HA 1ZTXH 1NGYB 2DBLH 5FYJH 3WXWL 1HJCA 3BZEA 1I8KB 5IB2A 4H88H 4ZMQA 3A6OA 4OGAD 3EO0A 1G1YA 3BCFA 4C47A 3SBPA 4NWTH 4PS4L 1N64H 5DLLA 1AO7A 3V9CA 1T1ZA 1BMWA 1OSZA 4X98A 1ET8A 2B1AH 4XHJC 3E7JA 3QFJB 5E8EA 1FNAA 5E51A 3BO8A 1E5AA 3QR0A 2GW5A 4MCMA 4Y2LA 4EKXA 4XNYL 1YUKB 3CPUA 4GBXD 1FHGA 4NN6C 4X5WA 4B96A 5DRWB 1T0PB 1JTTA 4YFLF 4X2UA 5C08D 4PH8A 1E4KA 5ICXA 2WWNA 3GMOA 4HQQH 1BQHB 5MHSD 4X8XA 2X4TA 1CDUA 5LBSH 2YD4A 1T1ZB 1GL4B 4X98B 1CFVH 4ZS6D 2K8QA 3QHZH 5C0CB 2UZXB 4ZMYA 1QFWH 3FQRA 3CVIL 2WWMC 3PG2A 3IXAA 3QXUA 3D39B 4U3XA 1DLFH 1F3DJ 4XNQB 4UDUA 4BK8A 5GS0L 1NFDF 1WBZB 2VZTA 4GMSH 4NQEA 1OP5H 3L3IB 3D69A 4HCRH 5J6GA 3VXUA 4OLUH 4MZ3A 4V1DA 3U6RB 1NGWB 3NJJA 2K7PA 2Q76A 4ZW3A 4YHYB 3FFCE 3V6ZA 1FP5A 4LEXL 2DS4A 3CFMA 1SOXA 5KN5A 1K4CA 1U8CA 5J89A 3DX7B 1IGCL 4LKXB 1NPUA 2X4PB 1TDQA 1ACXA 3IPFA 1XL6A 2W0FA 3RDTA 1TENA 4AC2A 4NGHH 2I7OA 3CIAA 1PZDA 1UB6A 1CO1A 4FP8H 3RY4A 4FABL 5J6GB 3JXAA 5GHWH 1DLHA 2FHBA 1E6OL 5CWSA 2Q6WA 1L6PA 5KSVB 4FFZL 1F42A 2NOYA 5ALBL 3VXSB 4WTWA 4EUPG 3D0LB 2XQBL 3DK0A 1KB3A 1BVKA 2VLKA 1GPOL 4JRWA 3MJWA 3KNBA 1QFUL 5CSGA 3TYGH 4U1KA 4W9DC 4UQAA 2Q20A 1NMBL 1XVSA 4POUB 3KPOA 3BQUC 1UWXK 3FJTA 2YD1A 3ZTJG 4J6RH 2OS7A 4DN4L 3CH8A 5IB4B 4B9JA 1DLHB 4LESA 3NCFB 2K70A 1Z3RA 3G08A 5FWRA 5K1VA 3SDXB 2G2PA 2CRZA 4PVMA 1TYRA 2FB4L 2WO3B 1WTGT 3QJSB 1JNLL 2YEZA 3UBXG 4ELMA 5I8OL 3TF7C 5C0BA 3N41B 3U7YH 4JZNA 1CUOA 1UUNA 1ZWIB 4XZUA 1V5JA 5IG7B 4I4WB 1A2YB 1Y18A 5BCAA 1YQVL 1DBJL 1N59B 2EDBA 2I60L 1BQLH 1I8AA 1MI5E 1N0XH 1ZT1A 2WO2B 3PHOA 1KB5B 3RGHA 1JYVA 5J0BA 1MF2H 2VERN 4HIEA 1KPUA 3FCBA 1RL1A 1ZHBB 4KROD 3WFHB 4DGIL 4HCIA 5HVWA 4GQ9H 4PRHD 1N3NB 4YK4B 4UAOC 5LAPA 5LNEA 1DJHA 4KKLD 3TIDB 4NJ9L 1OAUL 2EDWA 5IVZA 3NSFA 1JNJA 3CZGA 1I9JH 2WLMA 1WHOA 1NCTA 4JZNB 3HUJE 2VLLB 5AOZA 1XF2B 5HDOA 3GLAA 3OQRA 5C0IA 3M17A 1ZT1B 1T6VN 4MJ5B 4Z0BH 5EN3A 3AGVA 3BDYL 2R51A 3MFGB 3WGVB 3KW8A 5IJVA 4GW1B 1KPUB 2WQRA 1NUNB 2NY1B 5E70A 4IU2B 2DMGA 3MRPB 5FCUL 2E46A 3H3PH 3JV4B 4G9FA 4LRIC 1ORSB 4K5LA 1QRKA 3TA3C 4GRLC 4N68A 2ZG3A 3LRLA 3SE6A 3VXNB 2DWDB 1X5IA 1JHLH 5J11B 5IV2B 1QSEE 5EU6E 3GC3A 3EO9L 3L13A 4AI7A 3OF6A 2NNAA 3C5ZC 4JFQA 3FYEB 5DD3H 5K1JA 3IEAA 2VLJD 4GFTB 3SDAA 3KVPA 2AJXL 2DQDL 4R26L 5C6WH 5DJAA 1RJZA 3MO1B 4QRUA 1S7QA 1OSYA 1ZOXA 4JFPB 4WO4B 4X6DE 5JHMA 5IT2L 3D3VB 2N7SA 4BBWA 2E8ZA 3MLRL 3TV8A 2W8CA 3WFCH 4TUOB 5FA3A 5ICUA 4YNYA 4OZIE 3OAUL 4ONOA 3T09A 2FYYB 4M03A 4G6FD 2R1XA 3T08A 3P54A 5KYYA 2R2EB 5AFAA 2QPSA 1LK3L 2YD5A 4I5BA 4WTZG 3V0AC 5GJTL 3NMEA 3PWJB 7CGTA 3CV5A 1F4XL 3VFRB 1A9BA 1RJZB 1QW8A 3JTTB 1OE2A 4AOFA 3GD1C 3V6FA 5F72S 5MP6H 3LNIA 5HDBF 1DZ0A 1ECZA 2YD7A 1KIQA 3QNZB 2Z31C 1AIFA 3MMEA 1WEJL 3GS4A 3FF7A 1KTDB 1OW0A 4MX7A 4BIKA 4PJ7E 3RVXC 5I16A 5FAAA 2ZWLT 2CR0A 2OSWA 4QHLA 4ES8A 5BRZE 2B9BA 2BNUA 1AACA 3NZ8A 3UTZB 5I30L 4OCYH 4W4NA 4Y4HD 2F54B 4AGNA 1IQWH 1S9WB 5GS1B 3WKYA 3JBG7 1Q9LA 2ZOLB 4ZK8A 4I5BB 4FKEA 1KXVC 3P30H 3MLWH 2YPLB 1CLOL 5A43C 4M29A 2RIKA 4AL8H 2DMBA 2YN5A 5LLIC 2NW3A 3NQIA 5IQ9B 1OHQA 2FEDD 4FTDA 1YMMA 3JT2A 1CD1B 1RZPA 5KSAA 5IWLA 4NNXB 3BWAA 1AIFB 3SGJA 3MLVH 5LBGA 5TE7L 2AEIT 5DLML 1S7UB 3FKUS 4NO0B 4J1UA 4EAEA 3QXDB 2A6DA 2XWBB 3HMWH 1P7QB 5DJZB 1FGNH 1H8NA 3GBMH 3NCYP 2EIEA 2NY6D 4AH2A 1BFTA 1IAIL 1O7DC 1R24B 5A40E 2NT1A 5D1ZI 4AW7A 4M7ZC 1QFWM 5IGXH 1CWVA 3REVB 3LZRA 2YRBA 3DX8A 3EAKA 3QWRD 1SGKA 2J12B 5CZXD 4LCWA 5ISZA 1N5AB 2CLVA 2BOLA 2NW3B 3ENEA 1RJYA 4ZOEA 4O02A 1NBZA 2G2RA 3TYFB 2J6EA 3EH4B 3VWJD 3ZMRA 3OJVC 4R96A 4J1UB 4UCFA 1C12A 1Z6JT 1IKFH 1MIEL 3CVHA 5CR8A 1QSVA 3OSVA 4EI0A 4AH2B 2IAMC 5CS7A 1R5IA 3VFGL 2CIIB 4HPYH 1JZ8A 1M71A 3IBOA 1QTYT 1J5OH 1RZGB 1YC7A 2NNCA 3TEYA 3ME0A 5TFSL 2GQHA 1W0VB 1F6FB 1YZZA 4Y9FA 2O5ZH 1A14H 3CU1A 1U8PA 4QI3A 3SPHA 4AYFA 2R23B 4HKJB 2DW5A 4IJ3C 4X9IA 1QI3A 1LGVA 1N10A 3B9EA 4U4BA 5L2KE 3BKYH 4YHIA 4OU3A 5DUJA 1BQUA 4DFHA 1CGYA 1PZAA 2BJMH 1HXKA 4TQIA 3JUZA 1AGEB 2EDQA 1WP6A 3JZYA 3Q43A 5FS5A 5EU3B 4U7KA 5BZWA 5CCKH 4U1NB 1BPLB 4M4RB 2IPKA 1BD2D 4W4OC 1EJOL 1SVZA 3ISYA 5I17B 2G3NA 1CFTA 3IGUA 4G8FB 4AIZB 1HHGA 3PFUA 1J8KA 1ACYL 1XSKA 4OGAC 2P80A 2OR9L 3PWPA 5AOLA 4HUVB 1QZ1A 2K3HA 2XVLA 3GMLA 3H9SE 2QEJA 2YWZA 4IRJA 1LNUB 1RIUH 3Q48A 2XN9D 3C2AH 3D87B 3AU0A 3FQWB 2LLNA 2DMHA 2Y7NA 4TSBL 1IAII 2ZJSL 5IQOA 5JPMC 2WCPA 5C0AD 3ZHDA 4C55A 1QRNA 3EGXA 4Z7IA 5EPMB 2DM2A 2FAUA 4Z9KB 2RQ8A 4MMZC 1WFIA 3RURA 2J21A 4AJYV 4GBXC 3ZK0A 1A4KA 4X4XB 5EC2A 2BPBA 5LGJB 4ZX6A 3WHXA 3WJJA 3FBKA 1I85A 3GT6A 1D2PA 2BDNL 2J7LA 3GMLB 5F9WB 3ARZA 4WW2B 5B39B 2QFRA 2CJSA 4NT6A 5BV7B 1AR1B 1JDDA 1MVUB 1QI4A 3GMQB 4G6ML 4G1MB 4HFUH 2PCFB 4W70A 3EGXB 3OKNA 4XNXH 4JFFE 4OF5A 1G1CA 2MH4A 3SDXF 2A4CA 5ADOH 4OV5A 1DFBH 2RBLA 4IU3B 2OYKA 5C3LD 1HI6A 3EOTH 1DEEB 5J56B 1PIGA 3LH9A 1IBDA 1JDAA 2F58L 2Z8VC 4UM9A 5DO8A 5BQ7A 1D5IL 1UH4A 3WTVA 5DUPH 2CBTA 2ENYA 2ZCZA 3CHOA 4AX3A 3QEUA 2PP8A 4KFZC 5HJDA 3R06B 3DYOA 1Z66A 5JHDE 2FSDA 1YO4A 25C8L 4RRPM 3OKNB 4GI8A 4S1RH 2DM4A 3X1FA 4KVPA 5SWSD 1MAJA 2WBJB 2YMXH 3TX4A 4POZD 4FZEL 2MTPA 3CN1A 3KPRD 4ZPVB 3FOLA 2YQ2A 5JXAH 2EYRA 3KVQA 4HIHB 1EANA 5AZUA 1HXYB 4KH9A 5F9DC 3RFZA 3BD3A 1D5RA 5TQ0H 3APFA 2R2HB 4N25A 3V0VA 5AAWC 4GEIA 4RGNB 3MRMB 5FYKE 1OAQL 1Y0LA 5HHNB 1T20B 4JPVL 3QEUB 3CTTA 4BUHA 4P5TD 4U1JA 1YDPB 5IB5A 2RMNA 5GXBB 5CSZA 1HH6B 1YAZA 1R34A 4QXWA 2XC8A 3I6GB 5BVPH 5GS2D 4TRPL 5JIMA 3SO3C 3MVSA 2EYRB 5IBUB 2VR7A 5DQ9A 4LOUD 5INCA 1NCCH 5F7DA 2OXHB 2W9DH 2DJMA 3HLAB 2VMDA 3W0WE 5I0WA 3LKNA 3LEXB 3UO8B 4W9JC 1VKXA 3FNKA 2CCWA 3I9GL 4F80A 4XMKH 4OCXH 4ZO9A 2ZYSA 4FGMA 1FG9C 4WEEA 1MCBA 4XNZB 3TGXA 4PJAA 2DQJH 4PJ9D 5I76A 2BZ7A 4L2YA 4MNHB 1MFCH 3P11H 2CDFA 4IMKA 1UWGL 2B1OA 1QBML 1UD6A 4WWPA 4N2DA 1XXDC 1YECH 1MG2C 1NAML 4KROC 3CN2A 5GS2H 4AZ8A 2CM6A 1TSRA 3ESPA 3PWNA 1JNNL 4LPVA 5K69A 2WBKA 3VD1A 5CJOH 3EJQA 4KKLC 3MNVB 5FGCB 1LHZA 3WMSA 1FUNA 4JANA 4X0NA 5C97A 3EJRA 2E86A 2VC2H 3IT8D 1EGJH 1WS7A 5AVVB 3MOQA 4LPYA 1QTPA 1HXMA 1NEZB 3RLSA 2HFGL 3R4RA 5I15L 1T0NA 3TPUB 2F15A 5JHLA 1OAJA 1RSYA 5DDHA 4AZ8B 3PDDA 4F7PA 5F3HB 2XPGB 4KKAD 5FO2A 1WCBA 3WIFB 2AC0A 4U3CA 5MI0C 1ASQA 2F19H 2LR4A 4UTBL 1EUTA 5EOQL 2YJLA 2LU7A 5K9OB 2VMJA 4X4YA 1T89C 1WZMA 5E2WH 2A2QT 1CIDA 1S7VA 3EDDA 1GHFL 4J2QA 1GA2A 1NBVL 1Q9WA 1T22A 4LNRB 4MZ2A 4X7TB 4JRLA 4XGZA 5AYQA 1RVFH 4LBEA 4YHKH 1C5DA 1PX8A 2VR6A 3LPWA 4LP4A 4QHKJ 2IEPA 5D7LD 3ZDZF 4YWGL 4WFED 2D7OA 5DD6A 1FYHB 1R6VA 2A7BA 1ASOA 3C6SA 1OCRB 4KJWD 2C4XA 3A4FA 3E6HA 1BFOB 1EFXB 3E6FB 4P2RE 4IOSD 3MRGA 3MRQA 3QDAA 2F5AH 5L2JA 5T5FA 1I9RL 5BW7A 3TNNB 1OZTG 3SJVD 3KL0A 4DKFH 2VXQL 2WK2A 4JPKH 1F3DH 1C5DB 4HJJL 5F88B 4RFNC 2VH5L 1CLCA 4WWKD 4UT6A 4AL8C 1FNSH 4A7UA 3B56A 4NQSA 4PJXE 4YMPA 4LCCB 5SX5H 5D8JH 4WFGD 4P2OA 1MQKL 3G6JF 4P4KB 3H6JA 4H8WH 2B5IC 1I4FA 4MXVF 3JWNG 3E6HB 2L04A 3VUAA 3QO0B 5DJCA 2KLTA 1DL7H 1MPAL 1VJSA 3CCHB 2J8OA 3MRBA 2X9ZA 1YPZA 1I8MB 1AJ7H 2XPYA 4CC4C 2RCSL 3OPUA 2R1YB 3M6DA 5KG9B 3L4VA 2OK0H 4MDJB 3IMWA 4GIPD 3JWOC 3D4ZA 1Q94B 2MWCA 5IEKB 3NACH 1MELA 1KTCA 1UH2A 1E4XI 1TQSA 1ZDSA 2F74A 4HXAH 5I2IB 1SDYA 4EUPA 4ZMTA 3KPNA 3SD2A 2FEDC 3TH4T 3D2UD 1K8DB 1O9WA 1XTLA 1HE7A 1RZ8A 3A22A 4L2LA 4HZLA 2NNFA 5C07E 4KI5D 2MCPL 4OI7A 5DJCB 1UJ3C 1IGJA 4IDLA 3FTUA 3RWCB 3MRBB 4ICXA 4KAQL 4C56A 1M42A 2NY6C 1R19A 1KYOK 1TR7A 2BSCA 2EEBA 2EIZB 2LABA 3S34H 3UBFA 3NN8A 2GITA 5DXWA 1DZBA 2MOVA 2Y2YA 3O6FC 1DBMH 3CUPA 3MNZA 3RJOA 3VGGA 1A7NL 1AOZA 3KHOA 2XV6B 2F74B 4I89A 4PY8J 5CZXC 5D1XE 1A6TA 5DQDH 1E8YA 3A67L 4Z3FA 3MPCA 3D6GA 4LSTH 1ZLWH 1AKJB 3QCVH 1HL8A 2ERJC 2NQDA 3VXME 3GTVA 1CLVA 3VWJC 3P0VH 4PWJA 2H9GB 4LP8A 3N44F 2WINA 4ZNEA 1ZHLA 3NSCA 3FFDB 4NN6B 4JUTA 4EVNB 5D72H 3BW9A 2GITB 2Q86A 4Q9RL 2QQQA 4FI8A 3FT1A 1IB5A 4YXLH 3IGAA 3UZQA 1A7PL 1O7SA 4M00A 5I5MA 1ZGLP 5F7FA 3QC6X 1KLUA 1FFRA 1WF5A 3R18A 1XFPA 4FQLH 3TM6A 4G43B 1XF1A 2JMRA 4TQHA 2XWJA 1QSZA 1SPDA 4R90L 2NUPB 3MJ9A 3QJRB 1KFAL 2BK8A 4TYUA 1LDPH 2W95A 2WINB 3WBDA 1SUJA 3CZSA 2YOCA 3QJHA 4IOIB 1JYNA 1DQDH 5L0QB 4OW6A 4A2HA 1RI8A 4K23L 2OZ4L 4H26B 1PFCA 4WW2F 4YPGA 3BUBA 3TV3L 4PV8B 2G3MA 2AXJA 2QDWA 5TK4A 1E5ZA 3RTQA 1A6UH 4KJYA 2I9LA 4YHOL 3DGCR 1DCEA 2NXZB 3CZEA 1ZXKA 4GXVL 4L5FH 4BSWA 1OTUD 3DXAE 1Q0YH 3HE7D 4I1PA 1RPQA 3BQUA 1NCUA 3B5TA 1UT1A 2VKXA 4K2UH 2Y2WA 4BFFA 1BZ8A 1GZHC 1T66D 4N6RA 1TQBB 1C5CH 3ZSTA 3BVVA 4J5VA 3L81A 3G5VB 3QJHB 4RX4D 1ZXQA 4QEGA 5F1NB 3O4LA 4WUUB 1LEKA 3T2PA 5SWQB 5IM7A 2WLNA 2WP3T 4I9WE 1HHKA 2FJGA 1EX0A 2QT6A 1BZ9A 4YPGB 4ORZC 3PV7A 1DSYA 3DVGB 5I1HL 2C1PB 2DMCA 4FERA 3WAJA 2I9LB 4Y5XC 2FJFA 3RKPA 1GGIH 4MDRA 2AV1A 3WXWH 3HNVH 1CURA 3EFFB 5E6YA 4AQAB 1MDTA 3FU5A 3KWVA 3S0PA 4AMKL 3V8OA 4N2IA 4UQ3A 1WAEA 3N50A 4MAZA 2HG5A 2L7UA 5CLXA 4E9QA 4WTZA 4WI4A 4AIOA 2VDKH 5C6TL 3ARXA 4PRIE 4BGLA 3VDCA 1WT5C 5GS0D 4HLZG 2ZE0A 3QUMB 2H3KA 5KANI 4BSVA 2JSFA 4TQEH 4H25A 3F58H 3KM1A 3DV6B 4NN7B 3ALPA 2AV1B 4QKXB 1SHMA 1M9SA 2VW6A 1GYVA 1BFSA 3UTSA 2EDEA 5BUAA 4OZHA 3UTQA 3HJEA 4D9LL 4QOKA 3ULVE 1E2VA 1MHHA 1L5GA 3GZOA 3QWNA 1S9VA 4UQ3B 4BGDA 2HG5B 1CFMA 1F02I 4LRIA 2APWA 4UAOB 4UZGA 3K71B 1BM7A 1GVIA 1IEHA 5T3XL 3MDJA 3WI9A 4TVUA 4FFYL 4O9HL 1M6OB 1M7DA 4GRLA 2X05A 3TA3A 3NFPA 4PCSA 3MLUL 5IVXE 1EH9A 2ESVB 3MOBH 3CVIH 5F6HJ 2IGFL 2H2PD 4HD5A 4P07A 4KVCL 4BZ2A 5C3TA 3FN0H 4MQXD 2B4CC 2R0KH 4I18B 4DP8X 3VU2A 1MCKA 3C5ZA 3OG6B 4PCTA 5KYWA 3UTSB 5I0YA 3LDBB 3T0EB 1KCUL 3FB5A 4KTGA 1WBYB 3D06A 4JQVC 4PN6A 5A2IH 3VNYA 4POZC 1SJXA 2DTSA 4BZ1A 2Y7OA 5DS8A 3EZ8A 3U79A 2YXFA 3GSUB 3L4XA 1XZ0B 2NNXA 4YIQB 3S9DB 1F4HA 1KGWA 1LLAA 2JF1A 4CN1A 4F7CA 3P0YL 2NZ9D 3GSNA 4JRYE 2I07B 3VD7A 2FQDA 2GIYA 1M05B 1Z2KA 1ZT4B 2BW4A 2GBTA 5AW9B 1EFQA 4P5TC 4Q7DA 4QO1A 2OCFD 2FIKB 5ALBH 3WIHH 3WSQL 4MWFB 5ANHA 3ULAB 5MENA 4JDZB 4WHCA 1G7PB 1FIGL 3LZOA 1GMIA 4KQ4L 3P3SA 2Z31A 5FDWB 2VWEE 5AZEL 4TUJB 4Z3TA 1AGBA 4HIPA 4F7EA 1E4WL 1AGDB 1R9FA 1O75A 3O3AA 4F7CB 5T33H 4U6HB 3GSNB 4DN4H 1UFUA 3QEQE 3TFKD 3TBVB 3WXVH 4MQ7A 4PB0L 1S7XB 1V55B 4QO1B 3N04A 4DP1X 1VFUA 3EW3B 1OD7A 4PJ9C 1J87A 1KXVA 4S1QH 3BWUC 4Y4KD 1JIBA 1GIGH 4AK1A 2PTUA 4I9XA 1JNLH 1E3FA 3LVTA 3B2DC 4KHXH 2G5UA 3K80A 4G80A 4H40A 3S2CA 2V2WA 3O4OB 2ARJB 4LDLB 1XR8B 1DBJH 3LXBA 4NQQA 1WITA 1GMEA 2I60H 1U93A 4F7EB 1UZ6F 1BVZA 3OMNB 3MBWA 4YXHH 3EH3B 3KBHE 4QRPA 4M1GH 5D1ZD 1N9PA 2X3CA 4PJ5A 2IXQA 3S97C 3IPBA 3HHMA 4YUEL 4FHKA 3UG4A 4MQ7B 1HIMH 1J11A 5CU9A 5AALA 1ORQA 3VI4A 4DGIH 5HI3C 3T6ZA 4DCQA 3OKEB 4PJEB 3RBSA 3LAFA 5K5YA 2NY4B 3V2AR 3LN4A 3QNFA 2YC1B 1IFHL 1RZKH 4ZSOA 1Y1DA 1JCVA 3M1OA 1FWXA 2CKBL 1BZEA 3WOVA 2V2WB 4GG8A 1VGKA 1J1OL 1FVDB 1Q1PA 1U93B 2YGNA 2XPZA 1VZHA 3MUGA 2OJEB 4ZS7H 4YDJA 5A2KH 4TV3A 2PR4L 2YRPA 3RIFK 2WLYA 4ACPA 3R7QA 4A2GA 12E8H 5CILL 4EQ3A 5B7FA 2IAMA 2A77H 4CSSA 3H54A 3GRWL 4MJID 4M7ZB 4P99A 1NL0L 1OGAA 1S5HA 4PJDA 3AUVA 4RFOH 1I7UA 5FCUH 2WJ7A 3UFIA 5LN4A 4BFIB 1IARB 2F8VA 5IUSA 3QW9A 2AQPA 2V5TA 3H2QA 4MAUL 2A5UA 4GKSB 4X6FA 4LAQL 2QV2A 1RP9A 3WN6A 3IDYC 1GAFL 3OMZA 3QWOA 2L7JA 1MJ7L 3DI2B 4M7LT 3APCA 3UEZA 3MKKA 1MLBB 1KEMH 1VF5C 3MV7A 3UZEC 1YEEH 4P5SA 5D5MF 4KJWC 1J5CA 3CHXA 1DBKH 3HBQA 1KCSH 3KYAA 4PGEA 1G0YR 2DQDH 1TITA 3B37A 4GJTB 1S9KC 1FBIL 1OGAB 1S5HB 2C3XA 4M3HA 5DFWH 5F7BA 3MV01 3WNMA 2BOBA 2LAAA 1FNEA 4L4VD 3EHBD 5DRNA 1ZAGA 2VDPL 3TFBA 3PPSA 3GXDA 4OH2A 4X7EC 5DJ0A 1L7IL 2BIPA 3OAUH 3ZRSA 1WH0A 3IS0X 4WWKC 4Y19E 4AQ8C 3RUGB 3DRQA 5K93A 3QJFA 2YXMA 4JFYB 3IE9A 5HJ3A 4OZFH 1QPXA 1U8IB 5L4MA 1E9QB 2XKUA 2IBZX 3S6CA 4W4OA 3OSKA 1LO0L 2D7QA 1ZA6B 3BAJA 3QUGA 4PGEB 2WQWA 1MHPL 3L3OB 3ZT5A 1IV8A 5AG9A 1CGUA 4FKHA 3GXPA 4N8CL 4KK5D 4FQJL 5CF3A 3D05A 5LBSA 4D8PB 3OZKA 4FQHA 4FL4B 5D2NB 3IFNL 5I18L 4Z5RA 5I30H 5TDNB 1B0RA 3TEXA 4JM2B 5DD5L 1NCWH 3EBHA 1P2CB 5JPMA 4XWOC 3NFSH 5LGHL 1HVXA 3D30A 4KI5C 1G7LB 4ZMPA 5C0DA 4MMZA 3EGSB 3ZKMD 4LASH 1UXMA 2V17H 1G43A 3G5WA 4GBXA 5D6DC 3DO3A 4UDTB 2MTAA 2RJMA 2AMGA 3QFJE 3KPTA 4J3UA 5DLMH 3N0AA 4MGXA 4ODWB 1HILB 5C08A 3VB8A 4GP5B 3PV6A 1J86A 3AROA 1H3XA 2D7TL 4BKSC 2AERT 2WWKT 2X4OB 1T0OA 1ONQB 2PLTA 1ITBB 1DP0A 2FH8A 2YGOA 3FH7A 5KJRH 4PHXA 5I8EB 1FG2B 3IU3B 3NJIA 3QEGL 1BAWA 2R0LL 3CD4A 3U2SA 4PI0A 1G7MB 3VE0A 5C0ND 1U2CA 4S0SD 5H37G 3GIVB 3DUSB 3ABMB 3FO9B 2AJZB 1JK8B 2PWGA 1MKFA 2VXVL 3D39E 4EIGB 1IGTA 1Q9OB 1R0AH 3MRRB 1BGXL 4N2OA 5EULV 2DQGL 3TO4D 2VQ1A 3K5SA 4RIRB 1I3GH 1QX1A 1EZVY 1X7TA 2R29L 2QSCL 3U9UB 2AXGA 2VDNH 2W94A 2XG5B 5I1LB 1P6AB 3RWHB 2J71A 4IRZL 1MCSA 1AHWC 1NWOA 3L4TA 3NCWA 4Z3EA 5I1JL 3VE0B 3IGFA 2BWIA 3HG1D 3V0WL 5ESQB 4DUVA 1UA7A 1NC4A 3N43B 5AWNH 5AAWA 5E1QA 3FUHA 5AVRB 4NQEE 3H7BA 4E9SA 3RFRA 3B6SA 1IC4H 2R7EB 1TLKA 2A4ZA 2J3SA 1HKLL 2HUHA 1EAQA 3MYJA 3VXSE 4LVNC 1T1XB 5FGRA 2XV0A 3CFQA 3OX8B 5D7SL 3WHE1 4AYID 4MNGB 3HMXA 4FLRA 1MNUL 1WAPA 2ZOKA 1PS3A 3BD4A 2M2DA 3CC5B 5I19H 2JCCB 2J5WA 4NQCB 4RDQG 1OAKL 1W72L 4P23B 4QGYA 3VRIB 1NC4B 1DQIA 2OMZB 3O2WH 3TIEA 4MLSA 4YPJA 2YFOA 4AUUA 5BMFH 4TSCH 3QUYD 1YYML 5BZZA 3M7OA 1EJOH 3U4EA 4BSJA 4F8NA 4KUZL 5I1DA 4X5XA 4FAAB 3AXLB 4XOBA 3SGEH 2OMWB 4K3EL 4G1EB 3PGCA 2VLKE 5LDSA 1ACYH 1OY3B 2OR9H 2DWEB 3BI9X 2I27N 4EIZC 1T03L 3WTSA 5MERA 2OL3A 3EJJX 5T1DL 1T4KA 4DP9X 4PRHA 3BGFC 1A3LL 3DC0A 1B6DA 2WSDA 4F1SA 4TSBH 2J72A 2HJLA 1JMZA 4FQQB 4JR9L 4DUXA 4F20A 5F6IC 4NZRL 5GS0C 1HOCA 2A73B 2WLJA 2OMVA 1KBGH 5GRUH 4HC1L 2IWFA 4LLWB 3RBGA 1BVNT 5I1DB 1J1PL 4TL5A 2QDVA 3Q9PA 5KTEL 5AVQB 4ELME 2F5BH 3ES6B 3II1A 4JY6B 4A68A 4PP2A 4KV5E 4WSJA 1SJMA 2EC9T 2J57A 1E9OA 5CBAB 2RALA 1MFMA 2HPOA 3HS0B 4NYLA 4XXWC 3QQ3A 3MA9L 1T89A 3HC2A 5LN8A 4QTFA 2X4NB 2H2PC 4LPXA 4GRWH 5B3JF 2HX7A 1A8JH 4MQXC 1XCTA 3C5SA 2AJUL 4JMNA 2E9BA 2WNKA 5I9QC 1U4FA 1PNDA 1IFRA 4JM4L 2VLJA 2F58H 2H0JA 2FHFA 2HH0H 4U4IA 3LKRB 3RTLA 3HZVA 3LQZA 5FW8A 3S98A 2WLZA 1LYQA 4QKTA 4NC1C 2EIDA 2ZKMX 4QT5A 4YSOA 2BNRD 6CGTA 4N0YH 2J88H 1E30A 4J8RB 1CF8L 25C8H 4PJEF 3ZYIA 1FL6A 1SLXA 3Q8BA 2BS8A 1T04B 3D3VE 3NJGA 4CMMA 4LLAA 2NXYD 2H41A 1IM3D 3GWJA 2LVEA 2DMKA 4MCZA 4BK5C 2AJSH 4DP5X 4NZJA 1NH6A 3FB8B 2HRPL 4BINA 2QHRH 3L5HA 2G5RA 4YZFE 1NA8A 1SYVB 1KTLB 1U8MA 3S37X 5JHAA 2F53D 4YFEA 4J6IA 2XQ0A 1MFDL 2YKLH 3H1ZA 3UBHA 2P52A 4HHAA 1SEQL 4GKOA 4APQD 3LHPL 3QISA 3VD0A 4Y4HA 2R1WA 3BAKA 3CFKA 4N4YB 3TFKC 4K5OA 4BKLB 4PG9A 5GGSY 2VAAB 3ZL1A 4RFNB 3V52H 1RZKC 2N4IA 3LQAL 2NMSA 1EBAA 1T2XA 3LHAA 1QLEL 2PPAA 4X0KB 1G9EA 4E9WA 4DKTA 1S9XB 3VXQB 1EZUA 3BHBA 2XICA 3NIFB 1OQOA 4FNPA 3TBWB 3C6LD 1RZJL 1WSST 2GHZA 2D03L 3G6AA 3FH8A 3TPKA 2HRHA 3CH1B 2G60H 1E50A 5HVHC 2JQMA 4TNGA 2XX0A 2ZAIA 5D1ZC 4M43H 3QAZC 4M6OH 4N8VG 5E1AB 5FW7A 2XYBA 3H0TA 3QRLA 1WJ3A 4TNFA 3KLQA 4YHML 1PZCA 3RUGF 3GXUB 3UZVA 3QWRA 1PSKH 3ATAA 2CALA 1E4XH 1OSEA 3WTWA 5EG6C 3C9NB 4MA8L 4DETA 1TPXC 5DMYA 5CXPA 2UVFA 1BOGB 2XU9A 3I75A 4AW4A 1QR1A 2MHAB 2PW2A 3VWJA 3KDMB 3O6KL 5MEQB 2OBGA 2H26B 4UOZA 1UJ3B 5EV7A 3ZJAA 3VFTA 1V7ML 3T1WA 4OM1L 1R75A 2HJKA 1PAMA 1OD9A 1YMME 2VO5A 4UTAL 1LD9B 2HFEA 4YFLI 2XYCA 5GRYA 5LCVH 4AM0Q 1XGTA 3P3YA 1T1YA 2AK4D 5AEAA 3O6FB 3U36A 3UZVB 2NY5L 5J6HB 3E3QC 5EZJB 4X6CB 3HN5A 4JM2F 4L4JA 2GT9B 4B7IA 1X5YA 2I9TA 5CN2A 1GJWA 1GHFH 4PHZA 1IVLA 1I1FA 5E5RB 1NBVH 3TT1L 5E6RB 2PW2B 1MJ8L 3C09B 4GRMA 5FV2A 3L4CA 2ARWA 5DZNA 1SUHA 1JUFA 1FYTB 5KWYC 2DH2A 3ZKQD 2HJKB 1E28A 4YWGH 4YXKH 5IESH 5L88L 1XGTB 2BSSA 1OXYA 2B77A 2GEEA 3RAJL 1T1YB 4MD0A 3G7TA 4MDIA 4JUSA 3ESOA 2K4WA 3DIVA 3VJ6A 2FBJL 1CB4A 3IKCA 4X8JB 3MRHA 3EHBC 3RB5A 2ZKHL 2BSED 2F0CA 3RPBA 5GRVL 4CUCA 1ZLUK 2A9DA 5DI8B 5HY9A 1I9RH 1PMYA 3SY0A 4DK3A 5KVFH 1W6WA 4YO0A 4AK2A 4L18A 5M7QA 2ZUQC 4JDEA 2VXQH 3O3DA 4JKLA 1J9QA 1GZHA 4F58L 5CP3H 1BD2A 2FECI 2ZX8A 2X6VA 4HJGA 4N90E 1U8JB 4MD0B 3U1SH 3QIBC 1QOKA 2UZYA 4XC3L 3RJQB 1XCQA 1NLDL 2DEWX 1UGKA 3BCDA 3BPCB 3BMVA 3F7PC 1UEYA 3MRHB 4KK5C 4ZMLA 2XKNB 1XXFC 4NO2A 5EU6D 2CO4A 5CCGE 4Y5XA 4ODVL 3VMPA 2SEBB 1MPAH 5IMKA 5HY9B 4HYTB 3CZNA 4DEWA 1FCGA 4OBRA 3BH8A 2H8PB 2WNXA 2XN9A 1MCWW 4YO0B 2NY2B 1B3IA 3EDFA 1FLRL 2NYKA 4WFHD 5C0AA 3HS9A 5E2TH 3N43F 4HJGB 4L3CA 2B1HL 2Y3NA 4U6YA 1A65A 5H35A 3RX5A 3ZKMC 3BQVA 5T8IA 4F8LA 4K15A 4RVBA 2VZOA 1A6ZB 5L8KB 1F8TL 3OKYA 1WT5A 3EO1B 1B0GB 2TRHA 4O4YL 3MX0B 4JKWA 5K9QI 3TESA 4Y5XB 4LLMA 2ZPKH 1QSFD 4XVTH 2QV4A 3Q6FB 4A2DA 3IDIB 1F5WA 3VTMA 1RJCA 2XN9B 1KIRA 2FZ3A 3FFOA 5KZCB 5TQ2L 2JCCF 3GXMA 1D5ZB 1HJBC 5L6YH 1YEGL 3WEAA 4MBRA 1EZVX 4HKXA 3JV0A 4U6YB 2EUWA 1QATA 3A67H 2YD9A 4HISA 4KDVA 5C0NC 3MCLL 3AU1A 1T21A 2QADD 3AQXA 3QAQA 4E5XB 4P2YA 4WY7H 3LIZA 4ZFGH 1QRNE 2ZD0A 5BRZD 4LLMB 3QR2A 2WLKA 2EE2A 4V2BA 4EIBA 1ZLSL 1NANH 1PYWB 3TO4C 4N0CD 2PYFA 5IR1B 2BC4B 3TN0B 3BXNB 5KBMA 1T5WA 1UACL 2GJZB 3MRKA 4UNVA 4Q9RH 3BWZA 4DSYA 1EEYB 4TUKL 1X5LA 2IV8A 4CSZA 1AP2B 1GYWA 3VGFA 5CP7B 3RNKA 3HFMH 4UV7L 3IMRA 4JQVA 2LOEA 5SWSA 1LILA 4JFDB 4Y5VB 4ZFZA 2WY3B 3GUFA 3KPRA 2DQTL 3AU1B 3G6DH 3H3KA 3QXAA 4R90H 3VFVB 5EIIB 3BLBA 1KFAH 2CBPA 4EKJA 2PNDA 5H2BA 1F13A 5JLZA 3HVDA 1AH1A 2JIXD 2GSIB 1Z0MA 2FX7L 3EOAA 2WXKA 2DQIH 4Q0XL 4QAWA 1SRDA 5E5UB 4P5TA 4FA8A 3X11B 2X1QA 3BP7B 4MAYD 3GHBL 2W38A 4YDIL 4K23H 3M07A 3BKML 2DKSA 5A1AA 1D3CA 4NFDA 1SDAB 5DD0L 3QJOA 3S5YA 3BIBX 2HWZL 2YAMA 1JXDA 4JRFA 3T8VA 4QRBA 1LWHA 1OQXA 5D4JA 3G9VA 1IFGA 4GMTL 3ZUCA 3L1OL 5H2BB 1VA9A 5JLZB 5AB9A 1A1MB 2XXCB 5ERWA 2LFGA 3GNML 4U1SA 3EOAB 3QUYC 2OJZH 1V27A 2PXYD 2ZCHH 3BSZA 2PO6D 5I26A 3MLTA 1SJVA 4GW5B 2E47A 4PJ9A 2GPZA 4Z7WA 1SY6A 1YEDA 2XHNA 3D33A 5JOFA 5KVDL 1H19A 3D12B 1B9KA 4WJ5A 3VD9A 2XFGB 3W1ZA 4RWHA 1RMFL 4ODTL 1SJEA 3V7AG 4NRYA 2VQTA 3ZHKA 2Z1KA 3KR3L 1NIDA 4G7VL 5DD1H 5FECA 5CEXA 3DHJA 2OX5B 2AJYH 2XFXA 3UPRB 2VJ0A 2VLRB 3QJTB 4EF3A 1JHTB 2VC2B 2WAQA 2E7HA 4GY4A 4AMKH 4HG4J 3LZQA 3R0NA 5DR5L 3TVMC 3K2MC 5T3XD 1A1OA 1JWMA 2XG4B 3HZKB 4JPQA 4F5CE 5FGCE 3VRLF 3LKSA 2VABB 1RUPL 2A4EA 1KBVA 1K8IA 4WJ5B 2JJVA 4Z7UB 2DEXX 4OD2B 4Y2DD 4E41D 2IALB 3STLA 1S8DA 1OKEA 5DYFA 1HH9B 1SJEB 5FO9B 4TTGA 4OFIA 3KGUA 1ZVYA 4LLDB 4NS0A 4NKMA 1R3JA 2GK0A 4LAJH 4LLYB 1PEZA 3FQTB 1UOVA 1RZIA 4D9LH 4JGMA 1G94A 3TXAA 4IBTA 4UTCA 1A1OB 1MCEA 1JWMB 3PU7A 1HE8A 1E2WA 2PTTB 3UTTB 5T3XH 4C4KO 4J23A 4O9HH 3RGBA 3PS6A 2BOCA 4Q6YA 3W82A 3NIFF 4I0PB 1MVYA 2OQJB 3H9SD 5D7LA 2EIBA 4KVCH 4OJDH 3MRCA 1KJMA 3ARQA 1R3JB 3FCTA 1JPGB 4K9EL 2VXSL 4Z3JA 4NO3B 4Y4FD 4XP4L 7PAZA 1E27B 3UZEA 2JTDA 3NPSC 1U3HD 1RZIB 1LE5A 4R5VA 5E5MB 2JK5A 4IOSA 2R4RL 1YN7A 3OG4B 5LNGA 3L9YA 2PPEA 4B5ZA 4RMBA 4WI2A 1OM3H 2BP0A 2ZWSA 3GINA 4DGVL 5F8RC 4PJ6A 3W5MA 3IF1A 2HTKC 3SJVA 4XPGL 3LXCA 1L3NA 2B08A 1LK2A 1JF6A 2MKLC 3NTCL 4WWKA 2BNQB 3CFIC 2FEEL 4U0RB 5H37A 5I6OA 2EC9U 3P0YH 5J8OA 5DF0A 1KB5L 3MV8D 2XTSA 4LK4A 3VI3A 4PWFA 3EFOB 5FOBB 2V2XA 2V7HB 4JFFD 3A3YB 2O26U 5D4IA 5DVKA 3QCUL 1FNHA 1G87A 2XZCL 3DOHA 3NZSA 1YN7B 3UC0L 5CIPH 4X6CF 3W9DA 2NY7L 4APQC 1MJUL 4XP6H 3X1BA 4OCRL 4M5SA 4U7MA 4LLQB 5IKCA 4JB9L 2WUCL 2WKOA 1AHKA 2CIKB 1L9NA 1Y6NR 4ZXBB 3K0YA 4Y1AB 1DVTA 1HQRA 2I25N 1D6VH 3VI3B 4EZJA 3D2UA 1DVFB 4IK7A 3C6LC 1M9WA 3D0VA 3IXTB 3J8F7 1G7JB 5CZRA 1A1NA 4IGBD 4DPCX