1UWFA

1.7 a resolution structure of the receptor binding domain of the fimh adhesin from uropathogenic e. coli
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FIMH PROTEIN
publication title Receptor Binding Studies Disclose a Novel Class of High-Affinity Inhibitors of the Escherichia Coli Fimh Adhesin.
pubmed doi rcsb
source organism Escherichia coli
total genus 34
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2004-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1uwfA00
3ZL2A 5LNGA 5FWRA 1ZE3H 2J2ZB 4AUYA 4AV5A 5LNEA 5F3FA 4X5PA 4XODA 4AUJA 2JMRA 3BWUF 3MCYA 4AUUA 4CA4A 4AVHA 4ATTA 1TR7A 4J3OG 5IQMA 1KIUB 1UWFA 2VCOA 4J3OH 3BFWA 3JWNG 5F2FA 3JWNH 5AAPA 4XO8A 2XG5B 5FX3A 4J3OF 4AV0A 2UY7B 5JQIB 3BFQG 3ZPDA 4BUQA 2WMPB 5IQNA 4LOVA 4CSSA 4AVJA 4AV4A 5IQOA 4XOAA 2XG4B 4XOEA 4XOCA 1N0LB 3JWNE 4CSTA 4X5QA 2W07B 3SQBB 5AB1A 4AVKA 1N12A 3ME0B 1QUNB 4XOBA 4XO9A 4AVIA 5AALA 4X50A 3ZL1A 5FLUA 3RFZA 2UY6B 5FS5A 1PDKB 5ABZA 4X5RA 2JTYA 5CGBA 1KLFB
chains in the Genus database with same CATH superfamily
2QVIA 3L95A 2ZOTA 4PMFA 5DJAA 2DQUL 4PV9A 4TVPE 2X6BA 5CZVL 1CQKA 1BFOA 5I73C 4YHKL 3GFUA 2KPNA 1AGFB 1DUYB 4EKXA 2CMRL 4UM8B 1X44A 1NDMA 5BUAA 2EIZB 1D9KD 1J1XL 5IVZB 3WS3B 8FABA 4ZUVB 3QAZB 2BIHA 4XPFL 4HKBB 1AYRA 2CLRB 2X9ZA 3LNEA 3WIAA 1DLFH 5JW4Q 5E08L 4RWHA 4HAGA 2JI3A 1TZIA 4BK8A 3QEGL 2X05A 1BHGA 2IXQA 5ITBL 1MRFL 2UX6A 3MBED 2BHUA 5HHOA 4AZUA 3GXMA 3F7QA 2WCSA 1XMWA 4XHQA 4UIMB 2IBZY 4MDIB 35C8L 4PLKC 1ADWA 3GMMA 4HWUA 4NM4H 5ICUA 4PGBA 3K6IA 3BQUD 4K94C 4N22A 4K7PH 2LVCA 2NY0B 3GBDA 2DQDH 1H3PH 3GLEA 1J18A 3VI3B 1TTGA 4B9IA 4NDMB 1TO5A 4POZD 3IGAB 5IFHL 3PIQB 3DIVA 1JZEA 1G9ML 4NQCD 5CEYB 1CK0H 3B83A 5FW8A 4I18B 4O51A 4GSDH 1U93A 3QIWB 3NDZE 4ONHA 2HFGL 4AYDC 1I7ZB 1OT2A 3BZEA 2VXVL 3BVTA 3FT0A 4IK7A 2KDGA 2F7PA 4HX1A 1J8SA 5DR5H 1IFGA 2OL3L 5E6IA 5HYJD 5E4IA 3VW3H 3N42B 4LCWD 3B2VL 1XR8B 3IFPA 3VI4A 4H0IA 4IQHA 3VWKA 1C5CH 4GI9A 2DM4A 4HEMA 4D9LL 5HHMB 4WW2B 3ATAA 1QWUA 2AQRA 5IQ7L 1DUZB 4JL1A 4NKQB 5I1EL 4EF3A 4LP8A 3C8DA 1CQYA 1XF3B 2NX5A 2ESVB 3FQTB 4QO1A 2BOBA 3S3PA 3T3MB 4CMHB 4MCZA 1ILSA 1T2QL 5HYFA 1BD2B 4QXTA 4Z77A 1GGBL 1ICTA 1X5GA 1HIMH 3JT0A 1JG9A 2YQGA 3NSFA 5E1AB 3ZLQC 4LVEA 3PRZA 1VHPA 1A25A 1U58A 2R1WA 3CZUB 3D3VD 2ROYA 4GFTB 4KY2A 4EDWL 1UHVA 2Y72A 3HPLB 3L08A 3GJEA 2ZIDA 1HNFA 2OULB 5T5NG 3MCLH 5BVJA 3IDYB 3QNYA 3QXAA 3I6LD 3ESUF 2PPEA 3K91A 4XMWA 3DROB 2X41A 5I6PA 1ZLSH 2HFTA 4E9WA 2R29L 4KTEL 3MLVL 1ZDQA 3VXPB 2FYYA 1EQWA 2XXGA 1ZHLA 2IFFL 3BSGA 1SJEA 3RPIA 5SX5K 3S35H 3RBSA 3ARPA 4J8RA 1BG9A 3IF1A 2KDYA 4N8VG 4E9SA 1H15B 4OQTH 5F7UA 3KW8A 1M7DA 1N26A 1VACA 1FNFA 3K6DA 5DHMC 1HZLA 2YPLB 3OZ9H 1DCEA 1JHLH 2DWSA 3HE7D 3OXRB 4L4TB 1CI3M 1ASQA 1GXEA 5J1SC 3VGBA 2V3FA 1YDPB 3FTSA 1T5XA 5DJCB 4I9WE 4XH2A 4C54A 4W6XB 3WU1A 1CIUA 5I76A 4Z95H 4UT9A 3MBWB 4G6JH 4H4NA 2P8PB 4U1HA 5F0JB 1IILE 2R2BB 1CL7I 1Z0MA 5F6HJ 4GIPD 1KGYE 2DWEA 2H2SC 2E6JA 4G8GE 5E5MA 3RGVD 3B1UA 1NPUA 3IDNB 1HHIB 2VDKB 4NM8H 3OTTA 2XBZA 3AT9A 2VZ1A 3LJ3A 4X6FA 3SE4C 3PHSA 1DQLH 4X6DF 1HDMA 4Z7WA 1S2EA 1ODAA 4U6VH 4YBLB 3RNKA 3CFQA 2J21A 2OMXA 2IPKA 4XMUA 1BFVH 2QBWA 2DYPB 3MRKA 2ROXA 1MJUH 3DYPA 4ABWA 3H56A 4XBPB 3T6ZA 3ZE2E 2WTRA 5DC9B 2RFXA 2W9EH 3FAXA 1XCXA 3TO4B 3TWCH 3V95A 5AZUA 4HVBA 5GGRB 1WTLA 4MVBC 3GSWB 4OFDA 1M4KA 1OPGH 2GY5A 1ZXKA 1IAIH 1M9SA 4DZ8B 1Y6NR 5C0JA 4L0PB 2IALB 4IIQB 4JFZL 5EO0B 4ZYKA 3UJIH 4HP5A 5C07D 1SF3A 4G9FA 3VWJA 3D52A 4YK4B 3PWPD 2ZSWA 5D1ZI 3OR6A 1A6AA 1Z9MA 1XGRB 5F89B 1RZ7L 4B60A 3FDWA 3WFBH 4I48B 3GUTA 4ODVH 1BBDH 4WHTA 1CGSH 5I19L 4YDIH 5I24A 4HSQA 4B9CA 3TS8A 2WN3A 5DWUL 2FT6A 2KLTA 3S5YA 3JV4A 2A74B 4G1MB 5T1MB 3TZVC 3VU2A 5HVFB 4KK9D 2PWDA 3PU7A 3CMOH 1W8OA 3DGGA 1D5XA 3VSVA 3EHBD 2H6PB 4RQQB 3WDIA 3C8KA 1NGYB 1AE6L 1UATA 4U6YB 1XSJA 4EIZC 3MJGX 1IQWL 2F1AA 3VGEA 3LIZH 1BF2A 5TDPA 4MAUH 3SYPA 3SQRA 1A4KB 4FCHA 2QMKA 2C3HA 4K71B 2WGNB 5CAYB 1QO3A 3E3QE 1MFEL 2AEQH 2VIRB 4PJEF 1RL1A 4DUWA 2EH8H 2HX7A 1BD2E 4LSVH 4X4XB 1ZSDA 1MCSA 5GGSA 4MNQA 4KV5E 4PS4H 4KWUA 3LH9A 4M1GL 4UT7H 2XTJC 4OLXH 1A1OB 3RWFB 1L6ZA 2I7OA 4NZFA 4A2GA 5I1HH 3VXOB 3G04B 2FATL 2J88L 3L13A 4OCYH 1A5FH 2P8MA 3BMVA 4G7QB 4GQRA 2J1ZA 3RILA 3SPHA 4A63A 3HRZB 5ADPH 2ITEA 2PO6D 1TKWB 3BAJA 4QWWC 4YEEA 1RPKA 4DVRL 1HK6A 3O6FC 2XZQL 4KRPD 3C60A 4KTYA 4LHUB 3VMPA 5FOJA 1B0GB 4QRTB 1YYMH 4I3SL 3QFDA 4U1KA 2EH7H 5BS0D 1DEDA 5ERWA 3BD5A 4Z9KB 1UJTA 1GGIH 5HP5A 4KK5D 5KVGL 3ZZLA 3C09B 4KI5D 1ZT1B 2V8LA 1QLRB 4JKLA 1FQ9C 1LE9A 2NY7H 2OYKA 1N5AB 1AD0A 4PREA 3D34A 4XMXA 2B9BA 1KB5H 4W4NA 3TTYA 2WLYA 5KOVC 3VGGA 1NMAL 4GG6F 3MLUH 1F5WA 3IFLL 4AM0A 2P5EE 2FECI 3ARFB 3P3RA 1JK8B 2CLZA 4UNIA 4X7TA 2FEDC 5AB9A 1KLUA 4Y4HC 1A7RH 3NBNA 4MJ5A 5HI4C 4UB0L 5L9DL 2X10A 1ZA6B 4ZNEA 4J7RA 5HYSB 4N8PA 3KEDA 4FDWA 2VMJA 4LHUG 1O0VA 2DI8A 5DQJB 3S88L 4C4KT 3V10A 4NXSA 3T8VA 4B9KC 3B5HA 4OGXL 5EBLA 3MFFB 5FAAA 5TGBB 4OCWL 4F24A 4XP6L 2YMTA 1DBKH 3ROLB 1U8HA 1EAPA 2H32A 3ECBB 4QHKJ 1RPQA 4LSPL 3SY6A 4BZ1A 4XI5C 2NR6D 3JWDH 3Q2NA 5JPNB 2M2DA 2LAAA 3MBXH 3HS0A 4GMSL 3ZBMA 2BJMH 1A9VA 4L2LA 3MRNB 1R3IH 1FJ1A 1OKEA 3O3EB 3F5WA 2W60B 1SYVB 1JJUA 1UOWA 3OMAB 4U1GC 5EUKA 5CCJA 1ACXA 1S9KC 3CXDL 2B4CL 4PJGE 2C26A 1TNMA 2QADB 3DRQB 4PU2A 3V4UH 1EO8L 5CILL 3IE4A 1N6VA 5CZVH 5B39B 1Q94B 4TPRL 4XPBL 1AR1D 1L3NA 1NCNA 4OLWL 5HYSG 5KSUB 4UQ2B 5CSBA 3QJUB 4OCNC 1YMMB 1ILUA 1F6AB 2CMRH 4DIXA 4KK8C 3ZHFA 3X12A 2P45B 1E4XH 3I9GL 5DJ8B 5G4MA 4XPFH 1SQMA 3QI9A 4PUBL 3PLYA 1TIUA 3FB8B 3FT2B 3U30C 3T2LA 4F3FA 5E08H 4Y88A 2ZG3A 3TOPA 3SZKC 5EA0H 1SYSB 1MRFH 5JPMA 2X6AA 1W0WB 2Y6SD 2E8YA 35C8H 3U0TB 2IH9A 3SGKC 4PYGA 1JCVA 4Z7OF 4Z7QB 3ZKMD 2AJZB 3GSOB 2V2TA 4HKZB 5B39G 4ZUUB 5DVKA 4JQVC 1ZJBA 2XVLA 3K5SA 3RURA 4G72B 5DHYB 1JRHL 1GS6X 4HGWA 4K55A 2BNRB 4FTVB 2DTSA 4IMLA 5IFHH 5IQNA 1WFJA 1ZMYA 4K7PY 5MHSE 1G9MH 4KKAC 2O30A 3NH7H 2OMYB 3UDWA 3WMPA 3VXRB 1HSBB 1M7IB 4BCZA 2HFGH 4HBQA 3RY6A 1YNTA 2A0LC 4WK4B 5E6RB 2G4GA 1FVDB 4UCFA 3QORB 1I8KB 4HD9A 2WYZA 2IQAA 1BVLB 3PE9A 1E9QA 1T1ZB 4P4KC 4AY0A 2VLME 3LRLA 4FFWC 5IEHA 1KPUA 3B2VH 5JW3H 2YD4A 4K3EH 4NRZA 1U8QB 4QUOA 3FQ4A 1RSYA 4D9LH 5AZEL 1RZIA 2J73A 3DJZA 5D1ZB 5I1GL 5GZOD 3PABB 1MHHB 2H3NB 1ITCA 5IQ7H 2OX5B 2DPKA 3OKDA 4FTDA 5I1EH 1TTAA 2Y6TE 4NSKA 3MRFB 3DC0A 4F1ZA 2BCKA 2PNDA 2FJHB 5K9QI 2A1WL 3RPKA 4OSUL 2X53A 3MRJA 1IGTB 3V6OA 1PG7X 1D2PA 3EH2A 2MHAA 1RCYA 2VN6A 4EDWH 3DXAB 3NP4A 4MMXC 1PDKB 1IAOB 4YSPA 2QKIB 1TEYA 3IN0A 4N0RA 1X5ZA 3SY0A 1UC6A 5C0CA 3CSYB 5FM8A 4NXKA 4G80A 2OK0H 4ZUSB 4KVPA 3PAZA 1BZOA 5D4HA 2R29H 1A14L 4KTEH 1J87A 2W65B 4B9GA 3SDDB 1U8CA 1FZMA 2DQIH 2NYKA 3QQ3A 4YX2L 1X7QA 2JKTM 4OVUA 2J12B 4FQ2L 2CDGB 3T0EE 1AO7A 4GKSB 4PJIB 1E5BA 3W1ZA 1SJMA 2OSLB 3VH8A 3CZJA 1KJ2A 3GXPA 4U33A 2ZUXA 3MCYA 2MNJB 1RKRA 5FUCE 3HCVA 2E7HA 1I4FA 2E9IA 2ZXGA 3WXVL 1I7RA 4JPVH 2Y0SA 4PP2B 4R3SA 1JZ3A 2MTAA 2V5TA 2PTTB 4HJJL 4UV7L 4YWGL 3WDJA 3STLB 5KYXB 1JF1B 5JXEA 5TK4A 1OIOA 5G4OA 2DW5A 1HQRB 1P6WA 5EBWB 1HXYB 2UXTA 2GG1A 3MGOA 3BVNB 4XGZA 3VM5A 2Q0ZX 2W81C 3L4VA 5E6YA 1K85A 4JDEB 4P07A 1I1AA 2AJYL 5ECGA 2O5ZH 1CF1A 2DLHA 2XIBA 4Y1AA 3WDHA 3GF8A 3HN5A 5D96B 1JNNL 3BVXA 4ENED 3SYQA 5HJ3B 2C1OB 1AHKA 4U1IA 3FUJA 5AZ2L 3EDDA 4HCIA 4QRFA 3DX1A 5B22A 1MFMA 4POYA 1FC1A 3DETC 3P4MB 4ODWA 4PJDA 5EH1A 4Y9CA 4XOEA 4LQ1A 1CCZA 1CFQA 3KXFB 5LBSL 2Q2LA 4A04A 4YBQD 2PXYB 4ZSOA 5CGYD 3CBKB 1DFBL 3E8VA 3LDBC 1BM3L 2OR7A 1VFAB 2Q2EB 2VDNL 1ID5I 1TZGL 1VGEH 3AM8A 4JFZH 1U91B 4NKMA 1EHLL 1QLFA 3PNWA 5I6OA 1R6VA 5FEBA 1BZ7B 1DVXA 3B4NA 3BEWB 5SX4I 1RZ7H 4PJ7E 2NY2D 4YHIB 5C8JB 2GT9B 1VF5C 4GKNB 1ZANL 3V6FB 4BH7A 3HS8A 2IAND 5DWUH 1DVFD 4WI8A 1KBVA 1DQIA 2VR4A 4N86A 4GKZA 2VW4A 2DBJA 2UWEE 4OAWA 5ABZA 1AQHA 3B9AA 1OSPL 4K3JL 5DMKA 2GJRA 1U30A 3FFDB 2E27L 4JRYA 1AZNA 4X9BA 4Y5XB 1UEYA 3KWWA 5CIPB 5LNGA 4FJ6A 1J88A 3C5ZC 2O5XH 1RUKL 4LCCB 1IQWH 1FE8H 4G8EA 4Q56A 3AREA 2Z35B 4X0KA 3DKHA 3RIFF 1CBVL 4LLQA 4GUQA 4QDGA 2QTEA 4NZTL 3FT4A 5DYOB 1NCBH 1X5LA 3S7GA 1WFTA 1GZQA 5AW5B 4Z7IA 1CO1A 4Z3TA 3CG8A 3LPPA 5BO1H 2E59A 3KPRE 5IROA 3IS0X 4HKJB 4L8BB 3VXSD 4U3HA 5C3IA 5JXAL 4D8OA 4M1GH 4OJYA 4YHPB 5TE4L 5BZXA 4A7UA 1SEBB 1EEQA 1AGFA 1DUYA 1QD0A 3A6CH 1XIWA 1XZWA 3AS0A 1C7SA 1OSEA 1FNAA 5B8CC 2XSKA 4UM8A 3SBPA 2J88H 2OCCB 2Y3AA 4K8RD 4KGLA 2EIZA 5IVZA 5T1LB 3WS3A 3OGOE 3WIIH 2NUPB 3QQ9C 4ZUVA 5F8RC 4HKBA 2CLRA 2Y7MA 4ZFOB 4C56B 2BINA 2XZQH 2HMIC 3IT8D 5FO8B 2BSEA 1Y7VA 4FXGA 4DUXA 2C9XA 4I3SH 1FVEB 4UDTB 4UIMA 3FK3A 4MDIA 5JHDD 4WTZG 2HG0A 5KVGH 3SEPA 3NK3A 3TCLB 3PP4L 5CJXA 1QG3A 1UJ3B 4BBWA 1P7BA 4Y4KC 4IKJA 4QKXB 3VI3A 3NMEA 3D2TA 2PYEB 4NDMA 1NMAH 5C0ND 3IGAA 3IFLH 2APXA 3PIQA 2ATKB 5JZ7D 3ZRFC 3GZOA 4TKWA 2QZQA 3L3IB 5CEYA 3ZGHA 1A65A 1JZ6A 3B56A 3QQXA 4I18A 3V4PB 1W15A 3E8UL 2FB4L 3QIWA 4MXQC 1QX1A 2CRMA 4UB0H 5L9DH 1I7ZA 3OC5A 4NQVB 4PJFE 4MRBA 1PLCA 2MWCA 3UCQA 3V0DA 1PBYA 2DY2A 5GS0D 5BCAA 2HUHA 4OGXH 5EZLB 1XR8A 3NPSC 1B0IA 2I7SA 3FUIA 2JE8A 4OCWH 4PBVC 4XP6H 3VXQB 3PS6A 1FSKB 3TCXA 2HTLC 3BSHA 1MN4A 4DK5A 3HMXA 4WW2A 1AHWB 1GA2A 1DUZA 4EZLA 2DLTA 2CM5A 3NCJL 1XF3A 2DF3A 2ESVA 3FQTA 4PJ6A 4GMSH 3N3EA 5FO2A 4AQ1B 1QAWA 1XL6A 3CLFH 3TN0D 4ADJA 3CXDH 2B4CH 2ZD0A 1TJGL 4B9FA 1UCTA 5DHDA 5E1AA 1SEQH 4XAKE 1BEXA 1CXIA 1QNZL 3VRLF 5D7KE 2X3BA 3HPLA 3DUSB 4OLWH 1SOSA 3CBJB 1E2WA 4G7YL 5A6IA 2BIPA 3INUL 4XODA 1RP8A 3FJTA 3DROA 3FO1B 3S3BB 1NCWL 3M1BB 3EJQA 2A9NL 2C9RA 4C55A 2EDQA 1IGJB 1WO2A 2KT6A 2CXKA 1KTDB 4QXUL 3VXPA 1JWSB 4HV8B 2KL6A 3UYOD 2YARA 2ICWI 4KI5F 4LARL 1H15A 4X83A 3S3JA 3T0VA 1I9JL 4NAMA 5F7BA 3WEOA 4XN4A 1ZLUH 1F4XH 3AXIA 1MFBH 1TPXC 2YPLA 3NACL 1MZZA 4TTDD 3V9EA 1BCIA 3OXRA 1QHPA 4L4TA 4QHMB 5I2IB 4QRBA 1E5AA 1XGTB 4XP1L 1YDPA 2QVFB 4LOVA 3Q1SL 5DJCA 4PJHF 2LLNA 4TSBL 2CZNA 4GIAA 2DD8H 1BAFL 3NABL 4UBDC 5EB9A 3MBWA 2P8PA 2G3ZA 5C86A 3U1PA 4F1SA 3SKNB 2EINB 2R2BA 4NGHL 4XXWC 4WGVB 4FI6A 4G8FB 1P4IL 4RMSA 1S7VB 4XO3A 4TUOB 3IDNA 1HHIA 1AS6A 1I1FB 4YEFA 3TJPA 3EDKA 1JYWA 4XPAH 4TXVB 4YJZL 5EDSA 2DYPA 1HWGB 3PHOB 4X6CE 5AZEH 3RVWD 4F5CA 2R9HD 3UJJL 4XR8C 2RMNA 4TLTA 4XBPA 4HA1A 5DMIL 4WI3A 3TO4A 1TDQA 4FFYL 4OF0A 1SHSA 4W9GC 5GGRA 4ZTOL 3GSWA 5M94B 3QYNA 5DRWB 4L1SA 4OSUH 2KERA 4DZ8A 2IALA 1IM9D 2A7BA 3AQDA 4IIQA 5EO0A 1A7OL 4ODTL 2IAMD 2JLPA 1EPFA 4HUKB 4OF3A 3RIKA 2A83A 1XGRA 3CDFA 3EJRA 5F89A 1MI5E 4DWHA 2OXGB 3DI2B 4I48A 4LEEA 3N1MC 1E3XA 3QFJB 5T5FH 1FNSL 2J5LB 4TVPD 4A7SA 1WA2X 1ZV5A 4LIQL 3HBGA 4CJ0A 4AGOA 1UH2A 4G3YL 4E9YA 4G1MA 5T1MA 3FRUB 2QPUA 4YX2H 4XMTA 3BLPX 5LNEA 4FQ2H 4YDJB 3SGDI 3QEQE 1NAML 2XC8A 4DO5A 2DBLL 4RQQA 1V8HA 2H6PA 2KC0A 4PJCF 2RB8A 4AUUA 1NGYA 3CCHB 4XE0A 4U6YA 4Z7NE 3GRWA 4JK0D 3V4VB 1A7QH 4HJJH 4UV7H 2EIEA 2VCOA 2PPDA 3OM3B 5D5MF 3OX8B 2VXUL 3ISRA 1A4KA 3FU5A 3L4XA 2OCFD 2Q76B 3U9PL 4B9JA 2F8IA 5FO7B 2VIRA 2WSKA 5J9PB 4F37K 4X4XA 3TVMC 5A40E 3BPOB 1H3UA 1KGXA 2VRAA 3QDMB 2AJYH 3DJSA 1HOCB 4G83A 1I8MB 5IHUL 1A1OA 3RWFA 1JNNH 1XEUA 4E5XG 3IN2A 3VXOA 3BZ4A 3JWDC 5AVZB 3WNMA 3G04A 1EX0A 3RYMA 5A6MA 4N2KA 1V7NL 4M1CC 5MENE 4JE4B 1VKXB 1XGYH 5AZ2H 2J8UF 3HRZA 4HXAL 4WY7L 1EJ8A 3II2A 3EFDL 2IGLA 3VNYA 2F53B 1CTOA 5F1NB 1TKWA 1JRHI 8CGTA 1J12A 4P5MB 2GCYB 2BS71 4OLUL 5LBSH 2B1HL 4KOBA 1B0GA 3SDYL 4E9LA 2FX9H 5EF0A 5E9DB 4QRTA 3O6ML 1DFBH 1TTCA 1QPKA 1QFPA 1E7VA 4HK0B 1ZLEA 4M6OL 3VE0A 1XX9C 4AYEC 2VDNH 5E2UL 3FQ2A 1ZT1A 1N5AA 4ZUWB 2FE0A 4RFNC 2VOTA 4OCMC 4I1NB 2HPTA 1CT8B 4FXLA 5CJQL 1BZ8A 5HVWA 3ARFA 4HS8L 4JDTL 5FR3A 4NIKB 5EU4B 1JK8A 4X6EB 4F7EB 4ZQTA 5C2UB 2DIJA 4RGOL 3F2LA 1MNNA 2BOCB 4PJXB 1MCCA 4UQ9A 4J3UA 5FLUA 1UM6H 1VGKB 1WPCA 2DEXX 4P2AA 4RMBA 1ZA6A 4JFEE 5HYSA 2XI9A 4H88L 3SDXF 2NNXA 5D2NE 1TTUA 5DQJA 5LLIC 1TQBC 3ESMA 1J7VR 1BZDA 1OSPH 4K3JH 1KJ3L 3EJYD 1FIEA 5FC9A 3UG3A 3MFFA 5DZ9A 5TGBA 1YY9C 2PUQT 4O58L 3BAKA 2E27H 3VVWA 1G9MC 4MAYC 3ROLA 1IEHA 2Z8RA 2MOQA 2ZNXA 3ECBA 5LN4A 1RUKH 5A2IH 2CBQA 3EYVB 4XNYL 1EWHA 3GM8A 5EOCL 5IQLA 5IOKA 3WNJA 4XXDB 1SFHA 4Z7VE 3WFDL 5JPNA 1CBVH 5AVVB 4M6NL 1YPZF 3MRNA 2XYCA 3O3EA 1PU0A 1SYVA 2W60A 4NKOB 3B9EA 3L3OC 4A7VA 3DRQA 1EO7A 4LHJB 5JHLA 3BP7B 3QWRA 2VZ3A 1Z3GH 3EO0B 4PWGA 5B39A 1Q94A 3WO4C 4RMRA 5JXAH 5KSUA 1EH9A 2BXZA 2OMBA 3NZ8B 5TE4H 4UQ2A 2C3XA 3D08A 4I9WD 3UTSE 1N6UA 2YD3A 4M48L 3NJMA 1YMMA 1F6AA 2EIMB 3SIKA 4DKTA 3QCTH 3Q1EA 3L6FB 3UP6A 1B4JL 1WHPA 5DJ8A 3BAYA 4MS6A 1JMXA 2BIOA 1MRDL 3MUZ1 3FT2A 5DUML 4G8GD 4D9QE 1GAFL 1WE5A 4Y2DB 3T5WA 1MDTA 1SYSA 3QZWB 1LNUB 3VFUB 3BWZA 3DJ9A 4R7LA 3BGAA 3U0TA 3BWAB 2BP5M 3FRPB 1E6JL 2ZCHL 5IVNA 2IWGA 4UQCA 2AJZA 3GK8H 3EYOB 3GSOA 3PP4H 4HKZA 2B77A 4UOQA 4DP1X 2ZZUT 4ZUUA 3TGXA 1TQTA 5GZNA 3ZRSA 5DHYA 4AEFA 4JCWA 1EO5A 3NIDB 5DWPA 4P59H 2BNRA 4FTVA 2FD6L 2FBRA 2OI9B 3RZCC 4YXHH 1WAAA 2OMYA 4RA3A 5DJXB 1O9VA 1WA0X 2FH8A 4HPYL 3ESNA 3VXRA 3E8UH 1HSBA 1M7IA 2YRPA 3QO1B 4D0CB 4B41A 2CM6A 1P0SE 4F80A 1N6QL 4JFTA 1FVDA 1GOGA 4J5VA 2CKBB 3QORA 4F92B 1I8KA 3N40P 1INDH 1DQDL 1TTBA 1BVLA 3UYPB 1T1ZA 2N3JA 3PAYA 3QZWG 3IE9A 4PN6A 3US0A 4XWOD 1U8QA 3FRPG 2P26A 1OT1A 1NEZB 2QQNL 2ZOOA 5D1ZA 3EIFA 1DN2A 4L3AA 3PABA 4AC2A 1MHHA 3MV7E 2H3NA 4DGYH 2CCLA 2CO3A 2OX5A 3GO1L 4NI3A 5DC4B 1P9MC 3ARDD 2DQJL 2XWEA 4W6YB 3MRFA 4OJEH 4KK6C 3HB3D 2FJHA 1XCQB 4A2LA 2LTQC 1G9HA 1IGTA 3FUKA 4FFZA 5JMOC 3ZO0A 2FIKB 2V0AA 4GFXA 4WWKC 3THML 4IDLA 1QNZH 2VLLB 5AYUL 5I73B 1AY1L 1KYFA 3DXAA 5MP6L 1PDKA 1IAOA 4N25A 2QKIA 3IMVA 4GP5B 4XMPH 3F6LA 4G7YH 2G5BB 4P2QE 2F5BL 3BD4A 3QZBA 5HDBF 1I8LC 3ZYJA 3CSYA 1XTLA 3WL9B 3N2JA 4I2XE 2OMZB 2MRYA 1BD2D 4PW3A 3SZ6A 3G6JF 4ZUSA 2VL5B 3P0YH 1NEZG 4LMQI 5FYJE 1NDTA 4ZTEA 1FLRL 3FCGA 4YSDA 1E5CA 4QXUH 1IC5L 5CP7B 1E9PB 4CAGA 2W65A 4BFOA 5ICZB 5E4AA 3SDDA 4NB7A 4GS7C 3FTUA 1G9EA 1YEJL 1Y07A 2CDGA 3GXNA 3ZTNL 2P3YA 4LARH 4E9RA 4PJIA 2X9YA 2XX1A 2OSLA 3OKMB 2WSPA 3NACH 4PJAF 4M9OA 4N6RB 3PGCB 4PP2A 2PTTA 4JO3L 2X38A 3STLA 1A3LL 5KYXA 1JF1A 1A3ZA 3MYZA 1YO4A 3A67H 3IYLW 3MBEC 1HQRA 4LSDA 3Q1SH 4P2RB 5EBWA 3S5LB 4TSBH 2I32A 2WXNA 3BVNA 4FJZA 4OZIB 4F33A 1DO6A 3QJFB 1BAFH 3NABH 5DI8B 2F58L 4XOAA 2HWZL 1H3WM 4NC2B 4JDEA 3BQUC 1V05A 4FQ1H 4PMEA 4ZMTA 4NGHH 3JWNE 2C4XA 1SJVA 1P4IH 4HWBA 4Q8BA 1KOAA 1AH1A 1T6WA 2P5ED 3IJEB 5HJ3A 3LN9A 3MI6A 2FAUA 3DBXB 1T03H 1MSPA 2PF6A 3VD9A 1YEEL 3MUY1 5HYIA 5HGBA 3PYCA 1VB9A 4AL8L 3N04A 3CN0A 3P4MA 1E6OL 3B7TA 2YD8A 3L4YA 4MA7L 5KS9E 3EJJX 3UJJH 3KXFA 5DMIH 1GC1L 2PXYA 2WB1A 1DBML 4FFYH 1IFHL 4ZTOH 1OGPA 2R0WL 3CFEB 3MLSL 3EJCA 2ED7A 1VFAA 4KO9A 5D7SL 4DZBB 3QJOA 2HUEA 3SPVB 4C83B 1U91A 5HDOA 4R2GD 2OMTB 1A7OH 1KXQA 2ADYA 2BNQE 1QLEL 1GJWA 1BZ7A 3BEWA 3D09A 4U0RB 3S37X 3GYRA 5C8JA 4YHIA 4XP9L 4IJ3C 2GT9A 4GKNA 3FCSB 2DN7A 3HS9A 4X7DC 1CLCA 1ERNA 2Y5QA 5GS1C 3V6FA 1FNSH 5AOZA 4HZLB 4CSZA 4U1NA 1UA3A 2P46B 3ETBF 1EZVX 1ZT7B 4HISA 1OOAA 1ASPA 3P77B 2UUDH 4G3YH 1J5HA 2ZXAA 3GB7B 1AKPA 2O6EA 3K6OA 2HA1A 1AQKH 4U1JB 4PLOB 4YHML 2DBLH 1A8ZA 3FFDA 2P47B 4HIXL 3TIDB 1EUTA 2EC9T 2MKWA 1QYGL 4Y5XA 5CIPA 3TJHD 1YVLA 4PWKA 3GBNL 4LCCA 4ZAKB 3N40F 5IBTL 2Z35A 1FDLL 3CE1A 1OCZB 2VXUH 3LY6A 2XKNB 4FCAA 5DYOA 3HNVL 4QJ3B 5E4OA 2BVUA 1X5YA 2V5YA 4WTZA 2NY3D 4YFEA 5DUPL 4BHUA 4RGNC 2X6VA 4HKJA 4L8BA 1OK0A 3LZRA 4BXSV 5H4ZA 4JQIL 3QUMH 3HE7C 1WGOA 2IC2A 1AI1H 7FABL 1GKOA 5AUMB 3UC2A 4YHPA 3ZQ9A 5GS0H 5C92A 1RUPL 5IHUH 4JFUA 1SEBA 2GTQA 2ARJQ 3UGUA 1F02I 2V7HB 1QPPA 2OJEB 3EH1A 1UKTA 2MCMA 5DVOA 1Q0XL 2PCFB 1DBAH 4NBYB 2N0MA 5T1LA 5F9WC 2JELL 5KSVB 2NUPA 5D2LE 3KGTA 4JQXC 2B4CC 4HXAH 3EFDH 4WZ9A 4J3SA 2B0SL 5CXPA 3HKZA 2CUAA 2P5PA 3QH3B 1PGRB 4ZFOA 4C56A 2CRYA 4M62H 4OLUH 4HEPA 2OLDA 3QRFM 5FO8A 2XHNA 1NM9A 3SDYH 3PPEA 2VLMD 3Q5OA 1FVEA 4LSUH 4UDTA 5I1CH 3O6MH 5E2JA 4X2UA 4XPGL 2J4WH 5DJ2B 5CBAB 2H0FA 2IDFA 2WLLB 4FQJL 3TCLA 4UNVA 5I71B 3SBRA 2AJUL 1UJ3A 1MHPL 3CZKA 4KNQA 4PLNC 5AW1B 2J6EL 1QUNB 4FNRA 4AH2B 4L0ZA 5L4MA 2PYEA 4RMVA 4LHUD 2EXWD 3W0WE 5FGBC 4YL9A 2EDJA 4HS8H 2ATKA 1LL1A 4JDTH 3QG7H 3L3IA 4ONOA 4OLEA 5DVMA 2DLIA 2KPWA 3CHQA 3FULA 2D73A 4LSSL 4RGOH 1JZ8A 1I8AA 5I15L 1OK8A 3FH8A 1LK3L 2FO1A 4YHOL 3Q3GB 1P1VA 2QQQA 4NQVA 3AY4C 3F7RA 3TZVB 4Y19B 3MLPA 2YIHA 2EVHA 5B38B 1AOZA 3CX5K 4D0DB 1KCSL 1CICB 5CF3A 5EZLA 3BX7C 4YH6A 3SGEI 4RDQG 3VXQA 5D93B 3H2QA 4ZODA 5F6IB 1V27A 5GSVB 4JDZB 4R7XA 1AHWA 5EOCH 3UAAA 4M5ZL 3ZE0E 1MRCL 2VZUA 3WFDH 4IU3B 3I6GB 5E5UB 5DD0H 4M6NH 3T0ED 4JN1L 4KROC 4AQ1A 2OKMA 3I85A 4KK9C 4ZD3L 4M7KL 4TUKL 1F0LA 1BDYA 3EHBC 4JY6B 2YAQA 1IBZA 3ZDZE 4N28A 1CBJA 2ZUQC 3ABKB 3HI1B 1FYHB 4KVCL 2XTJB 3ARXA 1RZFL 4A7QA 3DUSA 1L9SA 4J39A 5LXVA 5B38G 3UJTH 2XG5B 4JGUA 4M48H 4Q6IC 4KFZC 3AXLB 3FO1A 2C9SA 1B4JH 2K78A 3M1BA 3DX8B 5B1JA 2QADD 3NIFE 5ELIA 3GXDA 1IGJA 4GUCA 2C34A 2J71A 1KTDA 1E65A 2VUYA 1JWSA 1R17A 5DUMH 3O6FB 4PLJD 2M8XA 3RTLA 4HV8A 1DHKA 5K1JA 4YDLC 2NXZB 4EI6B 3RTQD 1IIIA 5FV1L 3PGFL 1AGBB 3QUYB 1HYRC 4LHQB 5F0MB 3U6XA 1BF5A 2CR0A 3PHQA 1VRSA 1NFAA 3HKFA 5C0BB 1BJ1H 2PO6C 3G5VB 4QHMA 5I2IA 3D0VB 4IBVA 1YQVL 5E5RB 4FQIL 4KRPC 1S9VB 1XGTA 4HZAA 4UTBL 4S10A 3V6ZB 5JDSB 1HHJB 4ANXA 2WD0A 5TQ2L 3ARSA 4DW2L 4KZDL 4Y2OB 2DYSB 4TVPH 1LO4L 1ANUA 4HPYH 4Y4HB 4KI5C 4ZXBB 3SKNA 3BVWA 3OKNB 2OPCA 4IRJD 4UI2A 4G8FA 2HRGA 2EEBA 3GBLA 4RBPK 2J57A 3WBDA 1S7VA 3LS4L 7CGTA 4JM2D 4TUOA 3TURA 3H55A 1I1FA 1U3HC 1DE4B 3EBAA 4UV4L 1DQDH 1T6BX 2JCCB 1TTFA 3QJHB 3QJVB 4OR1A 3VXMB 2P43B 2QV4A 2YXMA 3KPPB 3UTOA 1OCCB 3PHOA 2QQNH 3S34L 2E6PA 1HXMB 4NHCH 4GNKB 5BW7C 4N0FB 1AZVA 2DQJH 5CU9A 4XN1A 1MAJA 1RK1B 4U1GB 4XWGL 1B88A 3ZYIA 5DVNA 5DRWA 4XMLL 4P9HL 4K7FB 4DUVA 4NJAL 2ICEC 3THMH 1T0NB 1IC4L 4MYPA 4LEOB 1CXLA 3G7TA 2NR6C 3D33A 4R4ND 4YLCA 5F3BB 3TC9A 4N2BA 1ETJA 4UAOC 2OXGA 2VDML 2F5BH 2VXTL 5JIHA 4I77L 5F21B 2RA1A 3KPRD 3AG2B 1WWBX 1MG3C 3QFJA 4BQBA 4A2DA 1RUAH 2Q1EA 3OAZK 5ICXB 1NGQL 3SE3C 4A55A 4I13B 4HGKC 3U30B 5HD8D 2YKKA 3L1EA 1NFIB 1IC5H 2JFCA 3RKDD 3FRUA 3K72B 3PG2A 4UQIM 4IBUA 5IFJB 4G7RB 2F6AA 1HCZA 1U42A 4HCRA 4IOFD 1YEJH 4YDJA 3VGFA 3ZTNH 5I75C 4X80H 5F0PB 4G82A 1T21B 4FXTA 1T0MB 3BSZA 3I75B 3R19A 5CP3A 5TQ0L 2RQEA 3ZE2F 4B96A 1PVHA 2F19L 3DVIA 3CCHA 2F0CA 1IGIL 3HMWL 4AOFA 2WVSA 3TL5A 3G9AB 3EF4A 3V4VA 1UD2A 2W88A 4JO3H 1RAMA 3BC9A 1A3LH 4A2MA 5BQDA 1NINA 2EO1A 3OX8A 4BQCA 4OH2A 1DDHB 3APMA 2Q76A 2Y6SC 2E46A 4OY9A 4YDMA 5FO7A 2F58H 5LBVA 4N5ED 3UABA 5J9PA 2HWZH 3OKYA 3WYRA 3QDMA 3RHWF 3ZKMC 1CURA 1JF5A 1NCUA 1ONQB 2BZ7A 1HOCA 1I8MA 5GJSL 4RCAA 2CSPA 2NY6D 1A66A 1YSOA 1EFXD 1G0DA 4E9VA 4KKLD 4JHVA 5DRNB 5FW7A 2PTVA 3G6AB 1VKXA 5KWYC 2WINB 1SMOA 3NG5A 2MOVA 3TV3H 4AL8H 4PJ9D 2F53A 1YQ2A 2NNAB 5F1NA 1E6OH 1B6UA 1H9DA 4MA7H 5T5NF 2J25A 4P5MA 2VC2L 2GCYA 1UWYA 3V0FA 4XX1G 1GC1H 9PCYA 5LXGH 3ULUD 4M43L 1DBMH 5E9DA 1F42A 3HG2A 3LH2L 5I30H 2C7FA 2R0WH 4W9HC 1Y1UA 3QDGB 4HK0A 5DHVB 2AXJA 2YKLL 4PRPE 2H0PA 4WVRA 1HL8A 2ZSVB 3DDGA 4X5RA 1EJ6A 2JTYA 4ZUWA 3V7MA 5K69A 4MMXB 1QLEH 2PCXA 6PCYA 4Q89A 1JZDC 5DK2B 5GRZA 1BOGB 5EU4A 1IB5A 2VMDA 4XP9H 1MCHA 4IMKC 4KV5F 4X6EA 4F7EA 4KXAA 2ITCB 5HDRA 3MOAH 5CKAA 3SDAB 1SDAB 2AJSL 1AQMA 2BOCA 4PJXA 1EBAA 1QI3A 3NP3A 1VGKA 4KDVA 4XAKD 3ZKXB 3S97C 5D7KD 4KHXL 1VFMA 3ZT5A 4MB5A 3OPZL 3WTWA 3LKOB 3H53A 5J56B 4GG8B 2EDEA 5FOBB 4OZGB 1TR7A 1J05B 2CHXA 1NIEA 2Z93B 1DJSA 3GBNH 3ILPB 1CD1B 3WGUB 4Y5VC 5IBTH 4FZEL 3EYVA 4TLKA 2A9ML 1FDLH 1IUZA 3D4CA 1WBZB 4XXDA 2MFNA 3O6KL 1EHXA 3MV01 2Z1PA 3K1KC 4NKOA 4DGIL 3HNVH 1KN4L 4FG4A 1O7VA 1U3NA 2YJLA 4WO4B 1NL0H 3NRFA 4GAFB 4X0NA 3BP7A 2LFGA 4AMWA 3EO0A 4YVUA 1KGJA 3OLIA 4IBLT 5MERB 4BRVA 3CH8A 3EOAB 3NZ8A 3JYBA 1RUPH 3KBFA 1W72H 5FKAB 4FX5A 2ZCKL 5CEXB 4QLWA 3BVVA 1Q0XH 2F7IA 2IGTA 3L6FA 4MJJA 4EN3C 3NIGE 1Q72L 3U46B 1NBQA 2FQFA 5KBKA 2RQ8A 3ZDYE 1U95B 5AW0B 2P5WB 3H7BB 4Y2DA 4YGAB 2W07B 1RD6A 3ZYOA 4ENEC 5JQHC 4L1HA 3QZWA 1LNUA 3VFUA 4H1LH 1X3DA 1QFOA 2L4OA 3D85D 3HJEA 1EFQA 1MW3A 3H3BC 3SODB 3BWAA 1WZKA 2FJFB 3D06A 3FRPA 4XPGH 3GLZA 3S6CA 5KW9L 4FQJH 4TLUA 3EYOA 2K9FB 1BXAA 3HUJE 2AJUH 4NNYB 2CR6A 1MHPH 3J27A 3KYKL 4GXVL 1TTRA 2OJZL 3O2WL 2J6EH 1FFOB 2KBGA 4PJGF 5CGYC 1BEYL 3GD1C 4CL7A 1Q0EA 4BSWB 4UIKL 1HESA 1LEKB 2ICWJ 3LVEA 5IWLA 1RMFH 3NQKA 5DJXA 4PSRA 1CN4A 4MQXD 5I15H 3B8YA 2WIMA 5JNYB 5DURD 4D0CA 2IGFL 2XRAL 3QZOA 5C70A 2VLKB 4HPHA 4KDTA 4DEUA 1ZPUA 2MQ0A 3E6HB 4QIRA 2CKBA 3DIFB 1MI5D 4NLAA 4BIKA 1A6UH 1QASA 1NANH 5T1KD 3FSVA 3UYPA 4AJWA 5C1MB 1DVYA 2NY2C 5KBLA 4H40A 1QHQA 4N90E 3UZQB 2G0KA 5CLZA 1L6PA 1T5KA 3X1GA 1NEZA 3ZL4L 4BK5A 1GTNA 1B9ZA 5AKSA 1DVFC 4MB1A 2AMUA 1GOFA 5IBUB 4HLJA 1AG0A 1I7TB 3FT3B 5C97A 1H8LA 1MRCH 4YE0A 4LASL 3QEQD 4KITB 1IZKA 1QABA 4ZD3H 1XCQA 4M7KH 4N87A 4XO5A 2JJSA 3H9HB 2BWDA 1IFRA 4OCLC 3NCYP 1PD6A 2FIKA 2EIBA 2J72A 3CWGA 4WW1B 1EVTC 1M1XB 2VLLA 5KN5B 4KVCH 2O5YL 1RZFH 3TH3T 4OZHB 4PS3A 1C8QA 2G5BA 2XKUA 4FQXD 1FNHA 4U7MA 2OMZA 3TBCA 1NGWB 1N5YL 2VL5A 3ILEA 4JREC 3US9A 1CB4A 3IK2A 4OF5A 4GY4A 3MR9B 5IBUG 3ULUL 1E9PA 5ICZA 1XZ0B 4YIQB 4CRPA 3NGBC 1UENA 2YAEA 5E24E 2I85A 5L4IA 4ATWA 1RPUA 3PGFH 5MEND 3OKMA 2IG2H 4L4VB 5CUSH 4OZGE 4GBXB 2LR4A 1WWAX 5C08D 4PVBA 1JGUH 4N6RA 3PGCA 5ANME 3GSNL 3KVQA 1JXKA 4Y4KB 4FQIH 1EXUB 4BDVB 5D4QA 2XN9B 4QHLB 4P2RA 3S5LA 1XH3B 5KVEL 5TQ2H 4OZIA 4KZDH 3QJFA 5DI8A 5SWSB 4K2UL 5I6KA 4NCC1 3WAKA 2AQ2A 1VIWA 1S46A 3BJLA 3PL6D 4P46D 1FORL 1ZIAA 4MHHG 1V3LA 4KMTL 3MNWB 4LPTA 1QFUL 1ND0B 3MV8E 3LS4H 2VM9A 5DFAA 4K07A 3DHJA 3IJEA 5C0NC 3DBXA 4UV4H 5AKTA 4PRDB 5DQDL 5IEKB 3NPSB 3L17A 1BZQK 2VXQL 4IKLA 5EV7A 1WYJA 2XQ0A 2WYIA 3V5DB 2NPLX 4JFED 3BP4B 3S34H 3L2MA 1M7UA 3EXLA 1PZ5B 2DKUA 2MNWA 4AQAB 5EHFA 2M83A 5GS0C 3RB5A 2XV2A 5AAMC 4H8HA 3NJNA 4XWGH 3GKWL 3CFEA 4P2OD 1NUGA 4XMLH 4P9HH 1IC7L 3BAEH 4DZBA 4FADA 25C8L 2E9WA 5IKCB 4NJAH 3UP1A 4C83A 4OZ4B 1NWOA 3APCA 2OMTA 1EUUA 3P3SA 2Y69B 5DQ9B 4EMZA 4KJQD 4NUMA 2BZCA 5AD0B 5DVLA 1EEYB 2D0GA 3QUZD 5GPRA 1KBKA 3TM6A 2VDMH 3TN0C 1NH6A 3D69B 3IJ8A 4RVBA 4I77H 2ZUWA 3JTTB 3FCSA 2IQ9L 1TSHA 3B9KD 4ANKA 4XN7A 2IO5A 4HZLA 2ZXCA 3HNTL 4WI4A 1JIBA 2PP9A 2WXPA 5AKVA 1ZT7A 1R3JB 2X3CA 5I1LB 3P77A 2Z7WA 2C5DC 3GB7A 3UTSD 1N8ZB 3QNFA 2Y7NA 2DI7A 4U1JA 3UO8B 5BVPL 2NY4B 1CC3A 1GTFA 3TIDA 4UDUB 2JJTC 2WTPA 4Z6AT 5EF1A 1TPXB 5BV7C 2C3WA 1BREA 1QTSA 5IHWA 1IGIH 2XNAB 3CFCL 4LBAA 5FYKL 3TFKD 1P7QD 1AS7A 4ZAKA 2IDSA 4D9QD 1UWGH 5E1HB 2OBGA 5DHXB 1KACB 2QFPA 1KT2B 4LGRB 2ATPB 2XKNA 3MOQA 4OZFH 4HUUB 1W80A 1CLYH 1DSFH 4TTDC 2X6UA 1JERA 2D3NA 4JM2F 1D6EB 3CHRA 4PJ7F 4U1MB 4ODUB 5AUMA 2D7MA 5E95B 3O11B 3BE1L 4MMZC 5ANHA 2V7HA 2WIIB 3EYQD 3PJLA 3SE4A 4BFIB 2APWA 3QCVL 1OCOB 2PCFA 4OZHE 3X1FA 2Q3XA 4Q6KA 5KSVA 4G5AA 2FLRT 4XP5L 3CU1A 2UWEF 4BZ2A 2LLLA 1MCDA 1PEZA 1H5BC 4QTIL 4ZW8A 3AWGA 1CTMA 3QH3A 1DJGA 3MV9B 3LX9A 1XVSA 3WKML 4JPIB 3OXSB 5DEFB 4JKWA 3KBHE 4M43H 5AG9A 2B5IC 1QSFE 4WV1C 4ONGL 1Y6MR 5DJ2A 1OGAE 2DEWX 2YKLH 3F62A 2V9QA 2WLLA 1S5HB 4Q52A 4NAQA 4X6DB 3RVWC 3MV7D 3MXVH 2R9HC 5EU6B 5HI5D 3L4UA 1WIUA 1QUNA 2R59A 4AH2A 4HWEL 1HHGB 4OGAD 4MQTB 3NVQA 3FPYA 2GUYA 2FWSA 4K9EL 4K3HA 1H3GA 1BV8A 2VISB 2AJSH 3Q3GA 3QUKB 1OD9A 3VGDA 4L3CB 2RHEA 2CA3A 2IAMC 4W9ZA 2Z92B 3TZVA 1IBFA 4Y19A 4C4BA 4ZOAA 2GPZA 3CJJA 5B38A 3MLYL 4YPJA 5F7LB 5IB2B 4D0DA 4P2QD 3VSQA 1CICA 4XNXL 4AE1A 1LJMA 2GBVA 2DQ6A 5B3SB 3LPWA 4PWJA 1K8IB 5FYJD 4ZS7L 1AQDB 3D4GA 5GSVA 4AYFB 4JDZA 1C12B 1TZHB 1TMCB 4DPAX 2NQ3A 1CDBA 2B7DT 3EFFB 2A9MH 4W4OC 3FOMB 1UWXK 3O6KH 4IU3A 1RZJH 3I6GA 4NYLB 3CVIL 2B3IA 4DGIH 1FFPB 2NYYD 4OCSL 1KN4H 3K2KA 3NN8B 4JY6A 5JO5B 4CVZB 1UACL 2FGZA 1DJIA 4K5PA 4RFEB 5CD5D 3HI1A 4LT7A 1V54B 5HSFA 1O9WA 4IRZA 2KHAA 5DT1L 3RI5F 2XG5A 2ZCKH 2JNZA 1K6QL 3H9ZA 1GPOH 3BISA 3AXLA 3HHMA 4PJFF 1EERB 3DX8A 1Q72H 3ULUF 4G1EB 2J3SA 2JKRM 4B7LA 4RMWA 5EORL 3P3TA 4PRHB 3WFZA 3O6FA 4JY4B 4PJEB 2Z4QB 1XCTA 4S0TD 4EI6A 1GGCH 4UT9L 1JZGA 1AGBA 3QUYA 1B3JA 2IWFA 2E4TA 2Z34A 3HG5A 4JZJC 1HZKA 1ZGLP 2B08A 4NKDB 3P0VL 5B3NA 3QB7C 2VR5A 4ODBD 5C0BA 1VDGA 2GB2A 1FP5A 3G5VA 4RFNB 3D0VA 2R27A 4XNAA 2BVOA 3NCEB 3O2WH 3TA3A 3AJ7A 1S9VA 2V3DA 4UTAA 5JDSA 1BEYH 3V6ZA 1HHJA 1WWWX 2BFVH 2WXKA 2NRDA 3DHMA 3H3PH 4ZW7A 4I88A 4Y2OA 1COBA 4HF5L 1WSST 2VDQB 2NY5L 2XWXA 1MWAH 4U05A 4Y4HA 4ZXBA 1SOXA 1Q0YL 3WN5C 3OKNA 3FFCB 1F11B 1H0DB 3QPXL 4LOUD 4ZTPH 2IGFH 2BNQD 2XRAH 1UTDA 5AVTB 4F2MA 1TQBB 3FTGB 1TSRA 3CXFA 3ZJAA 3U9WA 1DE4A 4YXKL 1WS7A 1B2WL 2JCCA 3QJHA 1RULL 2RBLA 4NWTL 3GXFA 3VXMA 2L3BA 4MAYB 4L23A 4GG6B 3FQ1A 3KPPA 4FXKC 4RSVA 1G7MA 3MCKB 4AMXA 1HXMA 3KH4A 4PJ8B 2BSSB 2J1WA 5AOIA 5ETUB 3DIDA 1PPIA 2AVGA 4PJ5B 3X11B 4N0FA 1BQKA 1P1ZB 1P4LB 4LASH 2XPZA 4NFCA 4OJFL 3EJYC 1RK1A 4APQD 1KCWA 4Q9QH 3S2CA 1C7TA 4K7FA 5F1SA 1VENA 3GLAA 5J3HD 3CC5B 1WLHA 4NUQA 1T0NA 4AL8C 1NWPA 2EECA 2WPGA 3WO4B 4M61B 3TPUB 2YWYA 4LEOA 2O5YH 2ZXQA 3F01A 4GI6A 4R90L 3DX9B 5PAZA 3UEQA 5F3BA 1GC1C 2UXFA 4MRCA 5LQBL 2RACA 4FF9A 5I8KL 1OP5H 5GJTL 4F9LC 4KKPA 3NJKA 4NNPL 3VFGH 3BUPA 5DK3A 1P5VB 1QACA 3TT3L 5ICXA 1RZKH 2R83A 3EBIA 3PQYB 3H8NA 1FHNA 3IDXL 1NFIA 5EIIB 1CFNA 3SD5A 3ULUH 4PI2A 2YQBA 3EYUL 3EDJA 3K72A 3M17B 5GGTH 5IFJA 2OSYA 3CN4A 3WSQH 5EMYA 4LB8A 1DVTA 4X6CF 3OL2A 4WEBL 1T21A 2JVUA 1T0MA 3I75A 4WUUB 3SGKA 3N5AA 2F54B 1BQLH 4F7PB 2YPVL 1A6ZB 4HPOL 4S1SL 3GSNH 1NBYB 2IOMA 5FXCH 1YZZA 2K1MA 1GJIA 4JB9L 2DRUA 2QLVB 2ZXEB 5DZAA 4A2HA 1D2OA 3QWQB 3KWUA 5KVEH 1DDHA 3P2DA 2AV1B 2WVTA 3RZCB 1AXSB 3AROA 2VMFA 2XA8L 4K2UH 4WAFA 4XT1C 4CC4A 1NC2B 4P8QA 4GO8A 1ONQA 3SCMD 4TSCL 5EIIG 4TM9A 2AVFA 4KMTH 1ROCA 3WUWB 1N70A 1QFUH 4Z7OB 3BFOA 3W0WD 1SXBA 4X50A 3CVHB 4GLRH 4PCSA 2CK2A 3SGJA 5DQDH 5DRNA 3G6AA 1IAMA 2WINA 4G6KH 3IM1A 3WEXB 2NNAA 4KZCA 1J0ZA 4PP1D 3CFUA 1M1SA 5J13C 4FQCH 1NCJA 3MJ6A 3OQ3B 1RJYA 1KCKA 5LO7A 3UPRB 2ALWA 1ZE3H 3HC2A 3KYNB 1KCRL 5I0XA 1V3JA 2VLJB 4Z7NF 1WIOA 4EAEA 1AMXA 2WJ7A 3B2UC 2LTQB 3UAJD 3QDGA 1TEFA 5DHVA 1IC7H 25C8H 2WUCH 3S36X 3U4AA 1NLBL 3UG5A 1XAKA 4PGEB 4KKQA 4MMXA 3QW9A 5SWZB 1DEEB 2JJWA 3WUWG 1ZLDA 4ABQA 1JFHA 1B4TA 5DK2A 1QQDB 1BOGA 4C59B 2GEQA 2CG9X 3HB3C 2ITCA 4JFPB 3SDAA 4XO4A 2EC8A 4BZ1L 1SBSL 4ZO9A 3HNTH 4YGVB 3F7YB 1BVKB 3UXFA 4AT6B 2ADJB 3LKOA 1U2HA 5EZOL 2ITDB 4R96B 4GG8A 5FOBA 4OZGA 5AVYB 5BVPH 4EE2A 3O41B 3ARTA 1D9KB 3E3QC 3PDOB 1J05A 3LMJL 4MJ2A 4DVBB 5ISZE 4NC1C 4ZRGA 1OM3L 3IEAA 5EC2A 1JOIA 1ET7A 4CSSA 2Z93A 2ZXDA 4HG4K 1C5DB 2F8VA 1CD1A 3ILPA 5FYKH 1G1OA 2R7EB 1FWXA 2JF1A 1RHFA 3WNKA 2HSIA 3OJDA 1WBZA 4LCIL 4F8LA 3MBEB 1TMQA 4JGJA 3T4AC 1PY0A 4PJ5E 2Z7UA 3ABLB 2DL2A 1MNUH 3DSNB 1I8IB 3BAIA 4UINL 4N1EA 4WO4A 3BQUB 4WUKL 3FCTB 4HC1A 4PY7B 2MMXA 4QOKE 3V52H 5MERA 5DEZA 3EOAA 1DCLA 2PWGA 2WKLA 2WB7A 5JOEA 1A1NB 3AXHA 5FKAA 4PY8I 2IJ0C 5HTSA 2ZOWA 4YSCA 5CEXA 1R46A 3L45A 4NQCB 3P02A 3NFNB 2YLKA 4PEEA 4L2YA 8PAZA 4XP5H 2CUMA 1A6TB 2X09A 3REVB 3U46A 3FU8A 1U95A 3HI6H 3REWB 5K9OB 2P5WA 3H7BA 1M6OB 3BWSA 4LF3B 3WKMH 2W07A 4KZEL 3GPSA 3PNRB 1OARH 4R97C 3QQ4B 1WFOA 3W37A 5EUOE 3AFLA 5HYJB 5L2KE 2MCPL 1E40A 4TNWF 4LCWB 5EO1B 2OYPA 3IWUA 1XB8A 2FJFA 1FYTE 2IDTA 4Z7VF 5KJRL 4WUUE 1SHXA 1MCBA 4ZOEA 3ZY7A 4DF9A 4U4IA 4ZMXA 1FFOA 1FHGA 2PETA 3QZMA 1HYSC 1KZQA 3LRKA 4HWEH 4BSWA 2YZ8A 5ADOL 4IJ3B 4XVUC 1G94A 1LEKA 3T1WA 1ES0B 4HIQA 4MVBD 4PB9H 3WEBA 4K9EH 1S3RA 2QGBA 3U4KA 5GS1B 3NCMA 3HW7A 3APDA 3KS0J 2KUTA 1UVQB 3KLAB 5JNYA 1FZKB 4R2GC 3D3VB 1RXLA 2VLKA 1MEXL 3EYFB 4AVHA 3E6HA 1VFOA 4PB0L 3DIFA 3L3JB 5FLVA 3HTLX 1QMUA 3RWGB 1BBJB 1SMAA 4N9GB 2DMGA 2Y4SA 3MMEB 4XNXH 3UZQA 3QWNA 5GGVH 4P3WA 4X8CA 4ES8A 4U31A 4N9OB 1IT9L 1SRDA 4OGYL 1I7TA 1Z1WA 3FT3A 1DBBL 5DFTA 3WY3A 4WFFE 1KWGA 1KZYA 3CVCA 3L5JA 4JO5A 1YNKL 3U2JA 3H9HA 4DP9X 4RGNB 3JTSB 3TJHC 3BO8B 1F1GA 3KLKA 4UYPA 3B1TA 2VKWA 2YHGA 3HE7B 4JG9A 4ORZC 4WW1A 1M1XA 2CO6B 4AK2A 3F58L 5KN5A 3G08B 1X6NA 2XWDA 1KJ2L 5DT1H 1KY6A 4Y0GA 1PW3A 4JFDB 2FHCA 5A3ID 4CN4A 2VLRE 1DZ0A 2ED9A 5F9WB 1MY5A 2NY3C 3F83A 2LW3A 1P7HL 1NGWA 1OM9A 1WHOA 4P9HC 4OLZL 2UZYB 3MR9A 3IAGC 5EORH 2V17L 1XZ0A 2D7OA 4YIQA 2KH2B 5FYLD 3RGVB 4ES9A 3BAXA 1PSKL 3LRMA 5F7DB 4UT9H 3EDEA 3RDTD 3KLHC 5F44A 3L4TA 2WQSA 2QPSA 3MA9L 2K6YA 5K39B 1JXJA 1WICA 4L4VA 5EIQA 4EI5C 1XBDA 4YUEL 3P0VH 1EANA 4GBXA 1TUPA 3GMQB 4FZ8L 3VU1A 2AKRB 1G5AA 1M2OA 1WVZA 2JJUA 2ETWA 3UG4A 2MSPA 1WT5C 1HZHL 2AEPH 3QIBD 4QWWD 4Y4KA 1DQQB 2WJ5A 1EXUA 4BDVA 5I1IL 5IFAL 2XN9A 1PQZB 4QHLA 4KJPD 2ISDA 1XH3A 5KYNA 5DK0B 2VZSA 4OQTA 1TETL 3O6LL 4HF5H 5SWSA 3FTVA 1EMTH 1MG2C 4PRPD 5DD6B 5JIPA 4X42A 1Q0YH 4ZMPA 2SODB 2O6DA 5C07B 2BDNL 2BFGA 5ICYB 2CWRA 3PWPB 1E3ZA 3MNWA 5K9JL 1ND0A 5D7LE 3Q5YA 5I18H 3GTVA 3UIYA 5AW2B 4Q9RL 4YXKH 1B2WH 4PRDA 3HPJB 5IEKA 5DCCA 1RULH 4TQEH 5ESVB 1ZLVK 1IU1A 1JXFA 4ORGB 1R33A 4DFIA 3VQ1C 1N2RB 4S1RH 3V5DA 1A7NL 1F86A 3IMSA 4UILL 3WY2A 3BP4A 5HI4D 1LO5B 1PZ5A 1ID2A 1Q38A 5FHAL 1C5BH 4AQAA 3BYYA 1BM7A 2A4EA 1JD7A 5LGYA 2WBJD 1UWFA 3HE6C 4XPHL 2XIIA 3EHBB 3MJ9H 3RVTD 4UZUA 4BE5A 1HOEA 5IKCA 2A6KA 5DMGD 2D8KA 4OZ4A 5DQ9A 2VDPL 3DNKA 1HFUA 4HIPA 1J9SA 4OTXH 5AD0A 3MRBB 4R90H 4RH4A 1QI5A 1EEYA 2OR8A 3QC5X 5D1XE 5F70A 2XOTA 3T0EC 4JKMA 5K9KB 1CU4H 5IJDC 5LQBH 4Q6IB 5I8KH 5F9OL 3D69A 4HUVB 3JTTA 4NNPH 3G3LA 1CFSB 1JXDA 3TNMB 3EFOB 3TT3H 3U0WL 1QOKA 1B4LA 3C6LD 1T66D 1JS4A 1R3JA 3IDXH 5KVGE 5I1LA 1PLAA 2EDLA 1J9RA 1GY1A 3EYUH 3D3VE 1N8ZA 1MPAL 3F7VB 2NT0A 2XV3A 3C5SB 2VJ0A 1JE6A 4Y9BA 4ETQB 2ZYSA 5KS9F 4UDUA 2XZCL 1OP4A 4OI7A 3PWUB 5I16B 2WO4A 3K0YA 2XNAA 2YPVH 2PO6B 4GSXA 2FSEB 4JANB 4S1SH 4PLJC 4KRPB 4JB9H 3RVXD 1KT2A 3RTQC 1N0XL 2DKSA 2ATPA 5FDWB 3GHPA 4NQEE 5BS0B 1AG6A 1SZNA 4HXBL 1A7PL 4HUUA 2L7QA 5DRXB 2EC9U 4NN7B 5I6MA 5HDLA 3RWJB 2VO5A 1D6EA 2ZAGA 4RGNE 4XXWA 4U1MA 1JL8A 4HYTB 4ODUA 3TEZA 2XACC 3O11A 1SM3H 2CLVB 1CE1L 3S8WA 1EVUA 2P80D 2WIIA 5FS5A 4BFIA 1RZJC 4JFDE 3PFQA 3WE6B 2NYZA 5FYJH 1YYLL 2ZF8A 4PJHB 1JTPA 4DNLA 4LVOC 2AQQA 3UMNA 1D7FA 1MQKL 3TU6A 4N0YH 3O4LE 4KO7A 3FC8A 4IRJC 5F3HB 3MV9A 2DKMA 2KLSA 4GH7B 3BXNB 4JM2C 4N1HB 4JPIA 2J55A 3OXSA 2EDYA 4BKSC 1JDDA 1KCRH 4TQIA 3KLSA 4DOHB 4P4KD 4N90D 4KHTL 1ZS2A 4W81A 1QZNA 4OLYH 5FGRA 4B0MB 2AFNA 2GJ6E 1B9KA 1S5HA 1VJSA 1BFSA 1ZA3B 2ICEB 2VWEC 3BUTA 3Q6GL 4X6DA 1NLBH 4AUJA 4BJLA 4BGDA 5JW4M 1JZ7A 5EU6A 3TESA 1JWUB 5I17B 3IDUA 2X4UB 1IBHA 4PWIA 2L0DA 3MU3A 4I0PD 2OYMA 1HHGA 3BKMH 1T1WB 4UAOB 3GPEA 3HMXL 2XBTA 2JIXD 2OTPA 4LOFA 3BCFA 3C6EA 4JMXA 5GRVL 2VISA 3F84A 4PJBE 3JWNH 1T89C 2GIMA 1IVLA 2VTFA 2VDNB 3VCLB 3QUKA 1OPOA 2L7UA 5FYLL 2BVPB 2WXGA 4L3CA 3MRHB 1AR1B 3RHWK 2Z92A 2HVBA 1Z6JT 5JR1L 5D2LF 5IB2A 1MFDL 5EZOH 5I75B 4AYBA 1NA8A 2Y2YA 1EHNA 5BOPA 4NUGL 4TQ8A 1W6WA 2AEOA 1EV2E 3LMJH 1K8IA 1MFAL 1AQDA 3B9VA 4AYFA 3P9LB 1C12A 1TZHA 1X9QA 4PCKA 3C6SB 3EFFA 2OSXA 3FOMA 3RKDC 4JZNB 5GRUL 3CMGA 2AV7B 2B2XL 2NMSA 4LCIH 4NYLA 4DKDC 3LN5B 4IOFC 1S9XB 4JCMA 2A6IB 1FFPA 2TRYA 1D5MA 2R0LL 3NN8A 3ATBA 4UINH 1S7SB 2EDDA 4CVZA 5JO5A 3BRGC 4OFPA 1EZUA 4RFEA 5BRZE 3KCPB 4N2IA 4WEUD 5L8JB 5FM5M 4PJCB 5GRVK 2DLGA 5E99H 5DZVA 4AGLA 4GAGL 3EKCA 1RLWA 5D7JD 2E7LA 3WE1A 3PDGA 4GQZA 5MEQB 3VFPB 4G1EA 3DBSA 1N3NB 1O5DT 3RZWA 4ZMAT 1OZTG 5E1IA 1YEIL 2PYFB 4PRHA 3C9NB 2P1YA 4JY4A 4PJEA 1KENL 2Z4QA 3MV8D 1IGCL 4KZEH 1QKZH 2ENQA 3ESOA 4K15A 4UT6H 3I9IA 3NCWA 4KKLC 3VFTB 4PM1A 4Y9FA 3NFSL 4XVOA 4NKDA 3A4DA 3ZE0F 1BQHG 4RA0C 4PS8A 1EAJA 4TYUA 5EFIB 5KJRH 4PJ9C 2VDKL 1F8TL 1RZKC 4B27A 3KPOB 5ESAB 2J8UB 1MF2L 4BA0A 1R5IB 3CHSA 1ZRUA 3OWEA 1AC0A 3ULUC 4EOWL 4JL2A 3ZDZF 4X4YB 2Q10A 1CS6A 4JJOA 1KXTB 1A3RH 3IKKA 4FNPA 3OGCB 3L1FA 3H1ZA 4LXFA 1RP9A 1GYVA 2D4FA 3BN3B 1M3JA 5EO9B 3FFCA 1F11A 1H0DA 5GIRB 1IBGH 2B9AA 4X8XA 2HKHH 4YSOA 4X5WB 5CCKH 2WYTA 1MEXH 3FTGA 4PB0H 5L8KB 3MREB 1E7UA 3NIFF 1L9MA 1I7UB 3LS5L 3FUFA 4M7JL 2R2HB 4R4FL 3KHOA 4MAYA 3ROOB 4GG6A 1QSZA 5E1GA 3UC0L 5H8DA 3ARGD 3MCKA 4PJ8A 3TIEB 2BSSA 4Y5VB 1I9RL 1IT9H 3CX5J 5ETUA 1WFNA 4OGYH 3NAAH 1GIGL 3X11A 4PJ5A 5IMKB 1DBBH 2VJ8A 1P1ZA 3BFQG 1CXFA 4PW4A 1P4LA 3ABGA 3L5HA 1DANT 3BKCL 2AQ3A 3SDCC 3SDXB 1OGTB 3NEOA 4U1LB 2FWLB 3MUGB 2CJTA 5JTWA 4WJKB 1YNKH 1P6FA 4NO0D 5FO9B 4LL9A 1IC1A 3VFVB 3CC5A 1BZ9B 4P99A 1IKFH 3C5ZD 1FNGB 1OZUA 3F58H 4M61A 3TPUA 3LRGA 3MZGB 3NZHL 3DX9A 3E80A 3JV0A 2AQSA 2CO7B 3P2BA 5KANG 4EBQL 2WOYA 4FNLL 1ZE3C 4NO5B 3GRWL 4Q0XL 4NZUL 3KJ6L 4EN3B 5M95B 3OJMB 2V2XB 1YPZB 5FGCE 1P5VA 3O8XD 2QPDB 3HC4L 4KNUA 1GYCA 3PQYA 3V0GA 1KC5L 5EIIA 3OF6D 2Z8SA 2AK4E 1F00I 2V17H 4GXUM 3M17A 5I0ZA 1I9IL 3FZUD 2GJPA 3MA9H 5A2AA 3GZKA 1QRNE 2WVUA 3FU9A 2ZOLB 4AEHL 4YUEH 2F54A 3ZUCA 2IBGA 4AJYV 4FZ8H 4F7PA 1CI5A 2K3HA 3MJ7B 3R06B 5F93C 1A6ZA 3CDYA 4QRRD 1KYAA 4O4YL 1NBYA 1FNEB 2VH5H 1HZHH 4GSUA 3LZNA 1UWEL 1KEGH 3GSXB 5IFAH 4N5UA 1F3RB 2DQHL 4K5NA 1ZVSB 2AV1A 1QSFD 3RZCA 1KEMH 4TNVF 1TETH 1OGAD 1ZV2A 3O6LH 2BHFA 4N2DA 2NZ9D 1NC2A 4QXWA 5FWRA 1JZFA 4A68A 2BDNH 2ENJA 1FL3B 2YXFA 5C0FA 4NWUH 2VUOA 5E8PB 3CVHA 2NY2B 4YSRA 2LLGA 1R75A 3A6BH 2OR9H 3WEXA 4X9HA 4EZKA 3N41F 4MQXC 2IANB 2O6CA 1DVFB 1U41A 3B2DC 4DEPC 2EDOA 2FVNA 4NOBA 2A3TA 4LFHG 3V55A 3UPRA 3KYNA 4D0BB 3JZ7A 2VLJA 4QRQB 3D51A 4RMUA 3WHE1 4XPHH 3MLWH 4R0LC 5G2NA 3MO1A 5C0AB 3ARRA 2OP4H 4PGEA 2HTLD 4XCCH 1MIEL 3UTZB 5F7MC 1ITBB 1DEEA 2A9CA 3EO9L 4JGMA 5SWZA 3OB8A 3QDAA 7TAAA 1QQDA 4OJDH 3ULSB 1I8LA 3D4YA 1OCWL 3D18B 5I1AB 4JFPA 3CZEA 3E1F1 5F7NC 1H8OA 3QZLA 4JREB 4LAQL 3VXSB 5JLZB 4L3FA 3U79A 3AMLA 5BOZG 4YGVA 3F7YA 1BVKA 1SHMA 3NGBB 4X4ME 4AT6A 2ADJA 4HHAB 2PN5A 1OAXL 1MPAH 3JVFC 2ITDA 4R96A 1OL0A 5JHLL 4GKOA 2YD2A 3O41A 1D9KA 3FTXA 2XZCH 3PDOA 2C4FT 3FSOA 4DVBA 3RRQA 4ZW3A 4K9EC 4DGUA 3BT0A 3VACA 4DPCX 3QUXD 5HDBB 1C5DA 1T80A 3PXJA 1GGTA 3TV8A 2R7EA 5LCVH 5BMFH 3G6JB 4Z3FA 3L3KB 5GGSY 4KNSA 3GJFH 3MBEA 2X0WA 4UM9D 1CMOA 1N0XH 3MLTB 1WWCA 2ZKMX 3DSNA 3OG4B 5KVFL 4BXVA 1Y6KR 3S5ZA 1I8IA 5JHDB 1YY8B 2G75B 3H9SE 3FW6A 4NHUB 1FGNH 3BQUA 4U7KA 2GABA 3FCTA 2D4DA 4FYSA 3TBBA 3KWVA 4MWFB 4PY7A 1NAKH 3X14B 4DN3L 5DA4A 4PJAB 4DCQB 4TL4A 1A1NA 1WP6A 1CE1H 3ATFA 4OKDA 1AJ7L 3FU7B 4MDJB 1U8JB 1F45A 5A6LA 3I3DA 1FAKT 4NQCA 3B5GA 5CGBA 3NFNA 1R3LB 5EWIL 2DDQL 3FNKA 4Q7DA 1YYLH 3HRPA 4M5YH 1A6TA 3REVA 4HUCA 1Z9NA 3PL6C 1BJ8A 1X6LA 2BHZA 4P46C 5G5DB 5A2FA 3QUMB 3REWA 5K9OA 2EIKB 5BNXD 1M6OA 4LF3A 1CFTB 2JB6B 3KPSB 4MLSA 4M8VA 3QQ4A 2X0UA 5ILTL 1YEDB 1F2XK 5HYJA 5FUOH 4LCWA 4XXCC 5EO1A 3GI8H 4KHTH 4JMNA 2V33A 5INCB 2H2PD 1J5IA 2IMMA 2V2WB 3L81A 4ZPVB 1VEMA 1X5KA 3PCYA 5AW6B 3QG6B 3MC0A 1RHHB 5IQMA 2I9TB 2RCSH 4YSUA 1XGUA 4R5XA 3WTVA 5L88L 4DETA 5CBAA 2Z6FA 1XH1A 2ZQKA 4FC3E 3TN0B 4FYTA 4HJ0D 4BFBD 3L7FB 1ES0A 4P2OC 3HMXH 3F64A 4CVUA 3QCUL 5GS1A 4YDNA 1EXHA 2VZOA 1UVQA 2D7NA 3KLAA 1FZKA 4JY5L 5L2JB 2VDRH 3D3VA 4PI0A 3TEXA 5FYLH 2O6FA 4ZFGL 3EYFA 5ITFB 3L3JA 3NIGF 3SOTA 1U8IB 3QUZC 1CLOL 1MFDH 3RWGA 4FFZL 1BBJA 4K7PX 4N9GA 3MMEA 4GRWE 3ZDYF 1MUJB 5DRZB 4NUGH 4JG0L 4ELDA 4GMTL 1KLGB 4N3TA 3SPJA 5BV7B 1RY7B 2QVTA 2YR3A 3B9KC 2VR9A 4Q4IA 1CYGA 1EGJH 1MFAH 4B9ZA 4JG1L 3IGKA 5EPMB 1DJZA 4ANVA 4V11A 1K5WA 4YLQT 1K3IA 3S3DB 2B8OT 3SSGA 3DGDA 2B15A 2G3XA 3VX0A 4EZJA 2CO2A 3HUJF 3R0NA 4OD1L 3K80A 3WNPA 4L8SB 3A6OA 2R0LH 3JTSA 4ZMNA 1DVUA 3BO8A 3WENA 1S8DB 4MZIA 2XPYA 2C9PA 3HE7A 3TFKC 2CO6A 5C0AE 1V3MA 3GHEL 3G08A 2UXGA 4MMZB 2JKNA 3L1GA 1UZGA 5F72S 3P3YA 3MXWH 2B14A 4QLRA 3ME0B 5DZLA 4KKRA 4ICWA 4JJ5B 4XRCB 3WN6A 1AXTH 4JQXA 3RAJL 3DLQR 1J8RA 1FIGL 3TVMD 3OB0H 3KLLA 1H5BB 2UZYA 2V6HA 4NEHB 2QHLA 3UROR 5ALBL 4WDIB 3RGVA 3PXHA 5F7DA 2F5AL 1WZ1L 3DI3B 4LVHC 5TDNB 3EYQC 5IJKA 3X3GL 3V9FA 1UEMA 5GS2H 4WV1B 5K39A 4FA7B 2ID5A 3CVDA 2C9VA 1HN1A 3GMQA 3T8XB 5J06A 2AKRA 3KPQB 1CF8L 4ZPTB 5K1VA 3AW5A 1HINL 5I1KH 1NC4D 5E00B 4LQFL 1F8TH 2WXHA 5FW6A 2WHVA 1DQQA 1TQUA 2GFBB 2H3KA 3ISYA 4K0OA 1PJ9A 2FDBP 4JO1L 2FGWH 3TJEL 2PR4L 1PQZA 4FKEA 4LIQE 5FFOA 5DK0A 5A2CA 1TJHL 5DD6A 3S35X 1GW6A 1U8OB 2FECL 5GISH 3II1A 1IM9B 5A16B 5C07A 4HAKA 5ICYA 5HI5C 3N1GC 1S7UB 2IAMB 3AY4A 3BYTA 1TZOA 3PWNB 3PWPA 1PD0A 3OAWA 4NJ9L 5DLML 5J4MA 2EXTA 1F58H 2LQRA 4C4UA 4PJAE 3KL5A 3HPJA 3OSVA 3JYCA 5ESVA 2FBOJ 4HT1L 4M7JH 5H35B 4ZMZA 1EZLA 4N2CA 2YGVA 1OTTD 3KDMB 4ORGA 1Z5LB 1N2RA 5D70H 3UC0H 4JRFA 2JSFA 1E50A 3C60C 4J4PD 1HE8A 4P5TD 1LO5A 3SD2A 1BPLB 1GIGH 3DPBB 3UERA 3NSDA 1RUQL 5HHXL 4MZRA 2JK5B 3BKCH 3P40A 3FH7A 3KPSE 3LPOA 2TSBA 4NQDE 4EXKA 3O81A 4M8UA 4WSGA 5SV3A 5ISZD 1NEUA 1SLWA 3CGTA 3FTWA 1MW1A 1VPOL 2B3RA 4DTGL 1VA9A 3F65A 3MRBA 1CG9B 3E2HC 4JO8A 1FL6A 3NZHH 4OM0L 4Q9BA 1KY7A 4WTWA 2G30A 1L0PA 4GP4B 5K9KA 4Q6IA 4TVSa 3P30H 2WNWA 4KQ4H 3G5WA 3GRWH 3H4HA 4MNGE 4HLZH 1DQVA 4Q0XH 5CWSB 4HUVA 3IGFA 4KRLB 1U8MA 2EIJB 3EFOA 3TNMA 3HC4H 3UMTA 2EO7A 2FRGP 1TYRA 4QOKD 4HH9B 4UF7C 4WI9A 2BRRH 1OLLA 1ZTXL 1KC5H 4MQSB 1FPTH 3VVVA 5I23A 3KZ8A 3F7PC 3FU0A 3P4NB 3QJRB 1N12A 2MQ3A 4U6TA 3F7VA 3GLDA 3T3PE 4Z8FL 1I9IH 2FWOB 3C5SA 3VTAA 4HWNA 4I1RA 3WHXB 4LKXB 1QHOA 4ETQA 1PZDA 2Z4TA 2K6WA 4AEHH 3CSBA 3PWUA 5I16A 1WC7B 5T5FA 4A7GF 5T1JA 3JWNC 2PO6A 2FSEA 4JANA 3I2CH 2NXYD 4PRBB 3HS0C 4NZJA 3FH5A 2BK8A 1UWEH 4P23D 2PCPB 1LGVA 5KSBE 1AC6A 4F8TA 2RIKA 2CHNA 5BS0A 5FDWA 2DQHH 5E70A 5IVXE 3WEAA 4AKOA 5L2KD 2FJGB 4RRPG 1J48A 1R5VB 5DRXA 2YXVA 5D72H 1FYTD 1OAZL 4BUHA 4CN1A 2YRLA 3FL7A 4F57L 4WUUD 1OP3H 3RWJA 4YSSA 4B53A 3CLEL 2BVQB 3WN5B 4PSPA 3UEZA 2J2ZB 4PPTA 5FCUH 1KCUL 1YYCA 2CLVA 3SKJL 3QRLA 3U0PB 1UD8A 4YHNB 1AP2B 4RMQA 2EDWA 5IVOA 3WE6A 2W9LA 1S3KH 3ZR6A 4PJHA 4FXKB 1P7KB 4CA4A 5EEVA 1BQRA 3IAQA 5ESQB 2BIMA 1FZOB 1J8HE 5F3HA 1GRWA 4LU5H 1ACYL 2W9DL 5BW7A 3BXNA 5CLXA 4KQ0A 4KX8A 1WF5A 4K3DL 4Z0XB 2IMNA 2QSCL 3TWYA 4EQ3A 4PY8J 5BZWB 1ZA3A 4V2CB 1EZVY 2ICEA 1H19A 3KL0A 2K8QA 3GM0A 1QBBA 1MIEH 1JWUA 5I17A 1X5JA 2X4UA 4QNPE 3BEVB 2NR6A 3BI9X 4WFFD 2DTML 3EO9H 4P3CL 2QFRA 3EOTL 3TF7C 1JPEA 1MELA 1T1WA 2ICCA 1KCLA 3UDWC 2R23B 4APQC 1ZS8B 2DJUA 4NP4H 2ZKHH 1OCWH 3NSJA 1TZAA 3HZYB 1IM3D 2VDLB 2Z91B 2YD0A 3SE3A 4LAQH 2PR9A 3VCLA 4G5ZL 2D2CC 5HPMB 1JPSL 1WDAA 3FS9A 4WWKD 4OZHF 2AS5M 2BVPA 4KKBC 3MRHA 1MAML 3DK0A 5KSAD 1OAXH 3Q43A 3U6RB 3U82B 1E2VA 1DVQA 3MYJB 2NNRA 2VLRD 5E6ZA 3TA4D 2O72A 2Z7ZA 3TYGL 4ZK8A 4HKXB 1A8JH 3P9LA 3DMMD 2QGCA 4G8GB 3HA0A 4OFQA 5JUEL 9CGTA 3C6SA 3VD2A 1DFXA 4JZNA 3U6XS 5HXMA 2AV7A 3DRTB 1ZCRA 4GW5B 3LN5A 4JFOB 3S8FB 5C6WH 1D7CA 1FO0L 1LDSA 1S9XA 2A6IA 5KVFH 1S7SA 3N06B 4F8PA 2MPAH 4IOSD 2JCWA 1HU8A 1T22B 2W38A 1T7VA 2WZPD 3ZE2B 4PJCA 1L0XA 2AEWA 2BY2A 4MJHA 1D7BA 3QIUD 1HILB 1CL7H 2PWHA 1GMEA 3BPLC 1FLTX 4CC1A 1AJ7H 1U2YA 3PAVA 3PWLB 3DGCR 4J3BA 3BUYB 4J6RL 1E8XA 3KLQA 4OCXL 5D5MA 5EWIH 3WTXA 2WLZA 5MEQA 2WNXA 3VFPA 5F97E 3L4CA 1N3NA 5J13B 4F15C 2D0FA 2E47A 2PYFA 4RX4D 3C9NA 5D9SB 3SCMC 5D7LD 2Z0BA 1O5PA 2XQYG 3C12A 3BAWA 2DQGL 3VXTB 1W72B 5ILTH 5E8NB 3VFTA 5E1QA 4CMMB 3H0TB 2J7LA 1LK2B 3G5ZB 5JHBA 1F6LL 3ISWA 2VR6A 2BMKB 4PP1C 3WKQA 5GZOA 3TEUA 3KPOA 5ESAA 2J8UA 1R5IA 3MTRA 1JI1A 4DHLA 3ARDB 4IRSD 4ODSH 4X4YA 1PF3A 1B4RA 3Q01A 1KXTA 3HB3B 4Z3EA 4IMKA 2YOAA 3P0GB 3UAJC 1NFDE 4H1LB 2VRQA 3OGCA 3KWXA 1MIMH 2BS9A 3GQFA 3QCUH 2COVD 4O5LH 1RUMH 1T7YA 1WA1X 3UZEC 5EO9A 1JK9B 5GIRA 2ARJB 4JY5H 1UM5H 1LMIA 4X5WA 4Y5YC 3OKEB 4XBMA 4ZFGH 5D1XD 1IAKB 1OANA 6FABL 1CLOH 3VNZA 3MREA 1I3RA 4FFZH 4KDWA 4AX3A 3B3IB 2ZWSA 1I7UA 4N8VB 2DL9A 1NFKA 2R2HA 4L1BA 1AXIB 3ROOA 1A9BB 1A9EB 1D5BB 1EEZB 4GMTH 1ETB1 5IESL 1IKNA 2QT6A 3P11L 4JJHA 1WFMA 2ZYRA 3TIEA 4Y5VA 1GYWA 5DS2A 3DHPA 3SE6A 5IMKA 4R6UA 4G11A 4CVXB 2N7AA 3SJVE 4GQPH 3T4AB 4RZCB 4M03A 5C6PB 1HKFA 4XN2A 3SDXA 1OGTA 2Z8WC 3QQDB 2Y06H 2I24N 3MUGA 4U1LA 5EOQL 4OD1H 2ZX8A 1N64L 1QUPA 3AM8C 2JKJA 4H1LG 4TNWK 5FO9A 2DQMA 1NBCA 2A9DA 2CRZA 3VFVA 1BZ9A 2X4RB 1FNGA 4HCRL 2BCMA 2Q7NA 3MODH 1U8LB 3VXUE 3HJ0A 3BSZL 3GUFA 5CEZL 1CE6B 2BRQA 1XTMA 2CO7A 4BFRA 3PP3H 1TQSA 4NQED 2OQJB 5C09E 4NO5A 2VQUA 2LGNA 3L7EB 3LPGA 2WXQA 2O4EA 1TQVA 1Z0NA 3QXDB 2V2XA 1YPZA 1PLBA 3OQRA 5D7IF 3RAJH 4RGND 1JTTA 2WV3A 3LXCA 1WV7T 4JBSA 2AJXL 2XZAL 4XVSL 2JXMB 1G84A 2G2RB 4KAQL 5ALBH 3VFNB 2P5EB 1WZ1H 2Q6WB 4QD2E 4R97B 3X3GH 4JFDD 3JUZA 4IHBA 2ZOLA 1FAIL 2GK0B 3TNNB 5B3JF 4U49A 5EU3B 2Y24A 3TBVB 3VFRB 3FO0L 3MJ7A 1CF8H 1FG2B 3O4LD 3R06A 4HOZA 1HINH 1OTSC 1RIUL 4LQFH 1FNEA 1TQCC 2W95A 4MQ7B 2ZWNA 3FT1A 1E9OB 2IIJA 3GSXA 4E2OA 3TJEH 3GHBL 1XBRA 3NCFB 2PR4H 4MXVE 4LPCA 1W0VB 5F3FA 4FA8A 4PRIE 5JYMA 1ZVSA 2CHDA 4GEJA 1CFVL 1A4CA 3JQOB 4U3CA 3SO3C 5IROC 4F91B 1TJHH 5EZJB 3U2IA 2GJ6D 2OZ4A 4XPTL 3STZB 5T8IA 5D7EA 4FNQA 4YFLF 3AUVA 3MRRB 1B2YA 5IB5B 3L5XL 2CNZA 4R2GB 1KIUB 4BFGA 5A1AA 1PZ2A 2KLRA 2V7NB 3GNMH 1EAQA 1FL3A 4NJ9H 1XIWC 5H4YA 4N0UE 1CDJA 3KGSA 3KEHA 5E8PA 4JKNA 3NJHA 3D87B 2V5SA 2WZ5A 3MSPA 4M6ML 4PJGB 2EKSB 2GY7B 5GGRY 1JI2A 2NTSP 1OAUL 4YDZA 2IANA 4B50A 1SQ2N 1DVFA 1IJNA 3LN4B 1OAYL 1A22B 4GW4B 3SBWC 1PG7W 3UGXA 1H8SA 1RZGB 2EDBA 4FXGC 4L3EE 1FVCB 1A2YB 3PF2A 3EGXB 1RUQH 4D0BA 1SUJA 3OAYK 5HHXH 2HAZA 1Q1JL 1G9NL 1SXAA 4QRQA 5CINL 3D2UD 2EUWA 3M07A 2NY0C 3M8OH 3S3SA 3UCRA 3UTTE 3ZRCC 4X6BB 1FF5A 3UTZA 3F8UB 1OQOA 3TH2T 2IPUG 4BINA 3BDYH 3LEYH 1EJOL 3F00A 1ZSHA 3ULSA 4KROD 1MW2A 3AU0A 3QIWC 5ES4B 3D18A 2NY3B 1OF0A 5I1AA 4BSJA 3VXSA 5BRZD 5JLZA 2H0JA 2YXWA 1SNRA 3OLGA 4JHUA 1SY6A 4NC0B 1F4WH 4KJWD 4HHAA 4Z8FH 1V55B 2DM3A 3IU4L 4NRXA 5JOFB 3JVGC 4V1DE 5A3IC 2CH8A