1UWFA

1.7 a resolution structure of the receptor binding domain of the fimh adhesin from uropathogenic e. coli
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Receptor Binding Studies Disclose a Novel Class of High-Affinity Inhibitors of the Escherichia Coli Fimh Adhesin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords FIMH PROTEIN
total genus 34
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2004-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1uwfA00
3RFZA 1QUNB 4XOBA 3JWNG 1TR7A 4AV0A 4CA4A 2UY6B 2W07B 2XG4B 4AUJA 3ZPDA 5IQNA 5JQIB 4XOEA 3BWUF 5LNEA 1N12A 4J3OF 4XOAA 5F3FA 5FWRA 1UWFA 3JWNH 5AALA 4AV5A 5ABZA 4ATTA 1N0LB 5IQOA 1PDKB 4LOVA 3ZL2A 5IQMA 4AVHA 1KLFB 2JMRA 4X5RA 4XO8A 2J2ZB 3BFWA 3JWNE 4CSSA 4AUUA 4XO9A 4X5PA 3MCYA 5AAPA 2VCOA 4J3OH 4XOCA 4AUYA 1ZE3H 5CGBA 5F2FA 5AB1A 4AV4A 4AVKA 3ZL1A 4BUQA 4CSTA 5LNGA 2UY7B 3SQBB 2WMPB 3ME0B 2JTYA 4AVJA 1KIUB 4AVIA 5FS5A 4X5QA 5FLUA 5FX3A 3BFQG 4J3OG 4XODA 2XG5B 4X50A
chains in the Genus database with same CATH superfamily
1KPVB 3FO9B 3MV7E 4ZMZA 3SDYH 3DBXA 1FNEB 4WVRA 4ETQB 2YEZB 3SDXE 4V2CB 1FZJA 4LOEA 1W8EA 3BKCL 3NTCL 4NQED 2BNQA 2X4QB 1T80A 4P4RB 4JW3A 4XCNB 3EH1A 3ZTJG 5E9NA 5KVMC 4LRNL 3HPJB 3HLAA 4AK1A 1E40A 3PQYB 3HI1A 1YG9A 1LLAA 1SY6L 1OV8A 2JH2A 3WEAA 4GG6F 2CUAA 3K1DA 3L3KB 4UZSA 5E70A 3N9GH 1L7TH 5E2VH 4ZUVA 5T3XH 3TO4D 3GRBA 3MV9B 3HBZA 1YNLL 2PPEA 2VSKB 4YHZL 2YD1A 2OSXA 3TEZA 4ZUWA 2IANB 4E41B 4UTBL 1KJ2L 1X5KA 3EFOB 2C9AA 1NGWA 3HI6H 5LAPA 4GXVL 1AIFB 2ROYA 3TLRA 3VWKC 4FFWD 1BQHB 5JOFB 3SCMC 3WO4C 1NA8A 1X7QA 5IVXF 3RVXC 1H9VA 4R2GD 4RMVA 3HUJF 1R24B 2OCFD 2ZICA 4U1JA 5AAPA 4FXGC 2DQCL 4IIQA 2WP3O 5KANG 2WCPA 5FO9B 1EAJA 2DQFB 3BDYH 4N22A 1ZGLP 1KDJA 2AK1L 2R29A 3QAQA 3RIAF 3O6ML 5F9DC 3TEYA 4P3DB 4U1NA 1QFUH 4R0LB 4ZXBC 4E0RA 4U7KA 4OCRH 1KGIA 4M9PA 3RFZB 1SXNA 4D94A 1DFBH 2GUOA 3RUGB 4BHUA 1JPTL 2NYZA 1SJHA 2BLFA 3D4ZA 3HKFA 5D7JA 4L8CB 2CR0A 1KV3A 2G3ZA 1DQQA 4PG2C 4RBPH 5CZXD 3FUDA 3RU8L 4HWNA 4Q6KA 3ULVF 1I7TB 2FYYA 5DJAB 1PAZA 4IK6A 3ULSB 3RDTC 2GFBB 4JG0L 5JXED 2JKLA 4PJGA 5KYYA 2HFGH 1X9LA 5T5NG 4ZMQA 1OCCB 5DK0B 4ZFOB 4JE0A 4MNHA 2P5WE 5DS2A 3IDJA 4KC3B 1BBDH 5J06A 2KT6A 4AQ8A 2D3VA 2Z31C 1JK8A 2RFXB 4H1LG 4OFYD 5FCUH 4CNIB 5HP5A 2ZWLT 1OPOA 1J9RA 2VXSL 5DHVH 4ELKB 3FQ1A 1J88A 5GS1C 1U2HA 4ODVL 1CYXA 3MJ6A 2DWXA 1EO8H 2BM3A 5CU9A 2OP4H 3DRQB 3WIAA 4AYFB 2PYFA 4EUPB 1AKPA 5IHZA 3NMEA 4GI8A 3QIUA 4QCIA 4WIQA 4DPCX 1PG7H 3IGLA 1MHPH 2V0AA 4I0KA 4WWID 4IKLA 1D9KB 3KYNA 4GRLA 3WKYA 2VLKB 4KJPD 4PRPB 4F9PC 5EF2A 2LR4A 2JKTM 3SY0A 4DP0X 5AKRA 2DWYA 4OGXL 4EIBA 1P1ZB 1H15A 3NJXA 5EU6A 4FL4C 2AHIA 1HINL 2PP9A 2QSVA 4DQAA 1A3LH 2UXTA 3EGXA 3P4OB 4KDTC 5DD0H 1R3LA 2VDML 2BDNH 2OTWB 5EU3B 2XYBA 2MTPA 2V5RA 3B34A 4O4YH 5IHBA 2UYLA 3D4CA 3VFSA 2UZYB 3PHOB 1PZUB 3KPMB 4JX0A 1ZS2A 4MWFB 3P0YL 5JW4N 5A1AA 3RTQD 1KEML 3SKNA 2E7CA 4LLWB 4PJ6A 3ZX1A 1WFNA 1U8HB 4XNZC 3G6JA 2LT9A 4J8RA 3UEQA 4OGZA 4LF3B 3WE1A 4HIJB 5E8PB 2LU3A 5HJDA 4PREB 2ZWZA 2YXVA 3BJ91 1U6AL 3GSXA 3OXRB 4OJDH 1FNLA 4P46D 1HE7A 3NJKA 1EHAA 4PGZA 3MNWB 4CDGC 3DYOA 3QH3A 5ESVA 4JKMA 5L9DH 3P3UA 1WGOA 1NDTA 3QQ9C 4XTRC 4PJDA 1I3RB 1G1KA 3FB6A 1MW2A 4AM0Q 4D0BB 1WUZA 1MCDA 5BZZA 2H26B 5AG9A 2YPVH 3SBRA 2VL4A 3NEEA 3SZ6A 3MQIA 4KXDA 4E36A 2P8LB 2QTVA 1Q0XL 2FSDA 2J12B 4JZOB 3ZLQC 3JV6B 3MJ9L 5C0CD 2BSRA 2AP2A 4JN1L 1QWNA 1U91A 1NGXA 2ZOUA 3LZFH 1LWHA 4PGCA 3BVNA 3MODL 2WVTA 4YMPA 4Z7OE 4AYID 3FRUB 1QO3B 2XT1B 4KI1A 3ARGC 1H8SA 3C60C 5F9JA 1TJGH 2H1PH 5EOCL 3S0PA 4IRSD 3CC5A 3FTZA 1URLA 3V6OA 5C0EA 2DW5A 5EEXA 4TSAH 1RHHB 2GTWB 1HH6B 2A9AA 1WFUA 2EDJA 1KIQB 2IFGA 2OL3A 1JRHL 2GT9A 2VC2B 2IH8A 3HE7C 1RZ8B 4QJ5B 4ERSL 1JXKA 4GRLC 5IR1B 4ISVA 4YGAB 4N68A 2W9LA 2BK8A 3HC0B 5SWZB 1PF3A 1ORQA 1TCRA 2KYIA 1A9EB 1EXUB 3HE7D 1AANA 3PXJA 4QGYA 2FHBA 4OD3H 4KDTA 1U8LB 3VSTA 1TDQA 1FBIL 4WJKB 2X4TB 4MKTA 3OF6D 1HNYA 3QDJA 5J9PA 3V10A 4PVBA 5IIEB 4PVLA 3ZQXA 3E6FA 3DOSB 3SQBB 3HHRB 2HT4D 3UGUA 1BMZA 4YSCA 1UZGA 4KITB 2CO6A 3TT1H 2R4SH 2O6DA 3CLWA 4RMTA 3NGBB 1ADQL 5DR5H 4G8GB 2H6OA 3ZYZA 2DM4A 1I9EA 2FRGP 1F1DA 4MD5A 4M8VA 1NPUA 5HI4C 4HUVA 4H8WC 4JCLA 4U33A 2JWYA 4R83A 5TPWH 4NCDA 3AAZA 4KKAC 3SCMD 2C9XA 3S48A 2V2WB 3CZLA 4QRUB 1W0YT 3KW7A 5HBBA 4JQXA 4LE8A 2LABA 1YZZA 2DAVA 1U8NB 4F37K 1BPVA 2AJ3B 5KYWB 2GITB 6PAZA 2R59A 1QWHA 4NERA 4HFUH 2D7PA 3VXOA 2CJUL 1HQ4B 4K2UL 1A7NL 3BUDA 5I71C 1H5BC 5C7XL 3AMLA 1X5FA 1BECA 4P2OC 3IJ9A 3FOMA 3FHEA 3UG5A 3CSPA 2FWOA 3AREB 2BINA 2BNRE 3C60A 3KPPB 3AUWB 3TBWB 1AD0A 4MCYA 5LBSL 2V17H 2E7LC 3K71A 1HSAA 1HWWA 5T1JA 3DO7A 2FECL 3ES6B 3VGBA 3WUWG 3KH4A 4MJ6A 1CPUA 1IAMA 3R7RA 3BAJA 3Q5YA 3P1VA 4XNYL 5IQ7L 3RVVC 1QLEB 2HKFL 2V3EA 2YKKA 4GRWH 4HALA 4MAUL 4RMBA 4IEFA 4RISH 1OD7A 1CGYA 4IOFD 1UENA 5ABZA 5FGSA 3TOPA 2FL5A 3IFPA 1LWRA 5EEVA 2OM5A 3QWOB 5DWUL 2IBZY 1JXJA 4OD2A 5F70A 1TKWA 1XB3A 4YJZL 4FHJA 4Z8FH 4HBCH 2GYSA 5DK2B 2QMJA 3QFJB 4PRHD 2AXHA 1U58B 5JW5B 1KXTA 2H6UA 2I27N 4WO4B 1OAYL 3GSNB 4KMTH 3WXWL 2BSSA 3MRIA 3SPVA 3ZR5A 4RDQF 1WC7B 3QDME 5SWSD 3WNOA 2P3YA 3AU1B 3R19A 4WTXA 2WYIA 1OAQH 4PRPE 2VITA 5FGCE 3ZUCA 3PDOB 4WHCA 4FQXC 3BYTA 4QOKD 4B7LA 1U8JB 2F54A 2OCJA 3CU1A 2VAAB 3GZOA 1BG1A 4NO0B 1ZLSL 1CFSA 1VGEH 2BSTB 3FCSB 4OZFA 4MZ2A 2UWEA 3B9EA 5T5FL 2FZ3A 3WFBH 4F2EA 1BVNP 4Y89A 5DD5L 3ZTJH 1KJ2H 3MRMB 4HH9A 3ZE2B 4ZFGH 5ACZA 3RDJA 1OE1A 1U33A 4X99A 1TU2B 1ZA3B 4LSVH 5A6IA 1ADWA 3LMJH 5FO7A 1FVDB 2G2RA 3MGOA 3BH8B 4QYAA 4LLUB 3FT2A 3HAEB 1WFJA 3QXUA 2EZ0D 4KQ4H 1BM3L 2B08A 2APFA 5ESQA 3X3FH 1A47A 5DURB 1GKEA 2Y7QA 3WENA 1W72H 2Y7NA 2XZQL 3FRPG 2PUQT 1EUUA 4CMHC 3D0VA 3MRJB 3QORB 4UOJA 4CN4A 3UYPA 5HHOD 4C4BA 2VDOB 4TRPH 3LQAL 3OLEA 4OZHA 4KK9C 3SGKA 3V52H 1T2QL 2Z0BA 2UUDH 1TZHA 4X6FA 3OKEB 3VGFA 1IU1A 3HG1B 1QNZH 1OCRB 3CXHK 3X1FA 3FONB 5E0QA 3TO4C 3O6KL 3TO2B 5HVWA 2NZ9D 1NOAA 1L9MA 3DX4A 5KS9F 3OVUB 1MN4A 1RIHH 2CDFB 4U6VL 2Z92A 5HPMB 4Q74A 1OE3A 2CHZA 3VXME 3CHRA 2R2HB 3QYMA 5BQ7B 1O6SA 2IXQA 2V37A 4LHUB 5D1ZC 4AV4A 5J11B 3RI5F 1Q1PA 1Q94B 4XNAA 4BHUI 3IS1X 4S1SH 3KMDA 4N2DA 4KZDH 4NQQA 3GSNL 4OLUL 1R5IA 3NEOA 1A3LL 4RGNC 2ZKXA 4ANKA 8FABA 4F7PB 4L37B 3DX2A 1MHCA 4M61A 2Q2LA 3B7YA 1OLLA 1EX0A 5DUPH 1KLFA 5LGYA 3AQXA 1MH5A 1QA9A 5FM8A 3WO3B 1K9TA 1N6UA 2G5UA 5F7MC 3GMQB 5DJZA 1MI5E 5KBLA 2B1HL 1UJ3C 1OAZH 4HJ1A 4I1NB 3S4SG 1I9JL 3UBGA 4M1GL 3NZHL 2Q86B 3UPAA 2FT6A 3SYCA 2X2JA 4NIYE 3O8XA 4BSWB 4OZIE 4XMWA 1ZS8B 4Z7WF 1JI1A 3H3PL 4AH2B 1F3RB 1A5FH 5KSBB 1FH2A 3B5HA 3UPRB 1CDJA 4EVNA 3UROR 4FI8A 1QSFA 1AOHA 2ZTBA 2WWMD 4ABQA 3IU3B 5HGAA 3VFNA 4GKOA 3P54A 1P6FA 1SY6A 1MY7A 1JZFA 5FA4A 3MJ9H 3WFEL 3O3EB 5HI4D 3G6AB 4XR8C 4Y5YA 3VFTB 1WA2X 1A4CA 3DSFH 4E41A 2YGVA 4LLYB 2YA1A 4D3CL 1A7PH 1UWEL 2E74C 3OR6B 4CUCA 2LAGB 3O6MH 5LDUA 4C8XA 2B5IC 4MYPA 1W2KT 2XNAB 3L4ZA 4Z18A 3UBFA 5DQJA 4BWUA 1WS8A 2D9CA 4H8QA 2CBTA 3LEVL 3G5ZA 4JLRA 4P2RE 3TWCH 4FNUA 5J1SC 1EDQA 2ZYSA 4IIQB 2XICA 1GGIL 6PCYA 4P5KB 2E27L 4BQCA 3RU8H 4CL7A 3CK0H 3Q6FA 4N0YH 1RVFL 4PAZA 4JGNA 3MUUA 2W9DL 3H7LA 3S35X 4AVJA 5KG9A 3GM8A 1B0IA 4FXKB 4M7LH 4N6RB 5EBWB 4Y2DC 4NS0A 4WGVB 4XX1G 4Y5XA 3UC2A 4P2CG 3TBSA 2NY5L 2EEBA 4NRXB 2EDLA 3IN0A 4LEEA 3V9FA 5C2UB 5E9DB 1Y18B 4F33A 1XF3A 4HKXB 3V4PH 1I3GL 4PCKA 3UPCA 3CBJB 5I1AB 1IMHC 2NX5A 1KTDA 3EDDA 1MCPH 4Q9RL 3PWUA 1DJWA 4ILDA 1P53A 3O81A 4KJQD 3BSHA 5SWZD 1AQDA 2Y69B 3GB7B 2GC4C 1F4WL 4JKPL 1XCXA 1DVFD 4FFVC 3HPLA 4HD9A 2X4SA 4AITA 4CW1B 5HYQA 2CGZA 2NXYB 4OZGA 5HHQA 4NP9A 2C9SA 4A7SA 1SGKA 4WO4D 3U2SB 4JM4L 3CX5K 5SWSB 1CFTB 1Y6MR 3GIVB 4ZPVA 3GMPA 2HUEA 3OLIA 1C12A 3DO4A 4GS7B 4NGHL 4WWKD 3SDDB 5IKCA 2BJML 1G5GA 3L1EA 3R0NA 2R7EA 3NJVA 3KDMB 3H8NA 4BZ1A 3F00A 4N2NA 3UZQA 2EADA 2OSYA 4HJ0C 1RXLA 4RZCA 3WNKA 1UWGH 5AKVA 1G7LA 1IZKA 3IFLH 3QFGA 4KGLA 2EDNA 2Z4QA 5CKGA 4NBYB 4N8VG 3BDXA 1IBHA 3FZUD 1OK8A 3V0WH 2EUVA 1BEYL 2EXWC 3FSWA 3LOWA 3O41B 4GIAA 1DYZA 4FXGB 4GEJA 1XQ4A 3O0RH 4ALAH 3WV0A 1S7SB 1OAKL 5FUOH 1PX3A 4OFPA 2ICWI 2KS0A 4OF8A 1T7VA 3RUGF 2XWZA 3TBYB 3MBXH 3UG4A 5KYYB 2G0LA 4WEBL 5H37H 1G9NL 3GSQA 1YN6B 4IBSA 3VXRB 4Z3GA 4M6ML 1EJFA 3UJIH 1TOXA 1HT6A 1GS8A 1NJ9B 2BNQB 1B2WH 1A7BA 1NMCB 2FQGA 3NSCA 3PPEA 3S37L 5DVMA 1U8PB 3QEQD 2EIJB 2K7QA 1ZVYA 2R2CA 2Z7YA 3O45B 3LKRB 5DWUH 1DQDL 3OLDA 1MJ8L 3DTXA 1DQIA 5F3FA 2HXAA 2YKLL 4RAVB 1F3JA 3LB6C 4G8GE 4HIPA 1ZIBA 3NA4A 3M6DA 4M43L 4TVPH 5IVXB 3MV9A 2ESVE 1NUNB 4JZOA 4AIOA 4KK5D 3BP5B 3MVSA 2MPAH 5DZOA 3FU7A 3MV7B 1E28B 4LHUG 1W0VB 1L0YA 1FV1B 1WGVA 1MFDL 2AAAA 2W07A 4R2GB 4O2FB 3N43F 4JANB 1DJYA 2IWFA 2VLKA 1WO2A 3FU0A 3AMKA 3GKZA 1LWJA 4J4PD 1VKXB 5CLYA 4IOIA 4GFTB 4IKKA 5DC2A 4DERA 5CIPA 3S96B 5E00A 4PY8J 1P0SE 5EB9A 4YEEA 5IW3A 3ULUH 4WK4B 4KUCD 2Y2WA 4KRPC 4UINH 1H3VA 4PG9A 5BV7L 2OQJB 1T83A 3GXNA 4GKLA 3IAPA 3FRPB 3KPMA 4OB5H 3BQUC 5CCGE 5JPMA 4R9HA 2NY4D 4JY4A 4I48B 3V5DA 1CB4A 1ONQB 4HAFA 1FA4A 3BVUA 1JGLL 1AZUA 3G6JB 4G9DB 2BX5A 4JHUA 4KQ4L 3MCKA 4BZ2L 5H35A 4N26A 1LEGA 4ETQA 3SBWC 2Y6SD 1E0OB 1F02I 2GFBA 5F97E 5B1JC 2X9WA 3GMMA 2FUTA 4PUBL 3BDBA 3VFVB 2X4QA 4IBQA 5MEPB 4H2CA 5AAMA 2VL5A 5FYJH 4K8RC 4NWTL 5HHPA 2P52A 2CK2A 4DH2A 3GNML 4LHJB 3VWJB 2X6AA 5CMAB 1F90L 1G7PB 1N8ZA 4R96A 1WQVT 1WWBX 2DY2A 2EVHA 3UTQA 4R6UA 4X6CB 5FGBC 4FFVD 4U05A 3EH5B 3JWNG 1C7SA 1D5XB 3KBPA 3FYEB 4GAJL 3PNWB 3PXLA 3MUHL 3FQUA 4JREC 1MG2C 1RD6A 3KBHE 3HR5B 1DLFH 1U92B 3T3PF 4A37A 4RMRA 4EIGB 2M8XA 2WXQA 2X6VA 32C2B 2F54E 3HZKB 1HJBC 3EJRA 4CSSA 2Y5EA 3QXAA 3X13B 5ELIA 3IEAA 2JKXA 1UB6B 4U0RC 5CJQL 5IMMA 3HNTL 4DGYH 1SEBB 2XQBL 2A9NL 3PPSA 3FH8A 4Z7UB 5L2JB 2B3IA 5KVEH 4LEXH 2MQCA 4R0LA 1P7QD 5F6IB 1LE5B 2D03H 5HHME 3WFZA 4GSDH 4H5SB 5E6UB 1WT5C 2HTLD 4WUUE 4J3OC 5BVPH 1J05A 1MCKA 5I75C 5I1JL 3QIWB 4QRPE 3DMMC 5SWZA 3C60B 1TNMA 3KPPA 3PHOA 1SLXA 3EJJX 3V7AG 2WLIB 5E1GA 1MRFH 4KJYA 4XC1L 4HHAA 3US0A 3U48A 4YPGB 1OSPL 4DGIL 1OARH 3LN4B 4OY9A 1D6EB 1IEAB 5L0QB 1YNTB 5D71L 3ZTEA 3WJLA 3VQ1C 4PREA 3PJLA 3PGFL 1ZTMA 3S2AA 1U8CA 3BEVB 1CO1A 4XMZA 4XNDA 2VLLB 3QNYA 4M6NL 3IDJB 3LQAC 4NSKA 4QT5A 3MLSH 2VR9A 3O9WA 3SDAB 4WWNA 3V6ZB 3ILQD 4B50A 4M93B 2RB8A 2A99A 4JQVA 5LN4A 1JPTH 3MA9H 2CO3A 4DWHA 1DANU 4OLYH 3B56A 1JPST 4R5XA 2NDGA 4FGMA 4L8BA 5PAZA 2VZ3A 5EC1A 1JWUA 5HDQH 2MFNA 4PRPA 1CBVL 4JRLA 2R1WB 5FGBA 1DSWA 4MJIB 4MS8C 2LTQC 1QO3A 4NX0A 3ALPA 1KYOK 1JXGA 1XGTB 4Z5RB 1M7DB 1E5YA 1RZIA 1ZHLB 2H3XC 3PWJA 3QPXH 3Q2NA 1T5WA 4M5YL 4YHIB 5DRWB 1RVFH 4OKDA 4APQD 4U3HA 4F57L 4Q0XL 5BS0E 3MRMA 4GLRI 4HH9B 4LU5L 2Z8WC 4AJ0A 2IPUK 5E6IA 3QVAA 4G80B 3S98A 1UA6H 4JN2A 3ZE1B 2GJZB 5T3XL 4BCXA 3D34A 4C4KT 5J0BA 5E8NA 5F3BA 5DD6A 1WF5A 5JPNB 4O4YL 1JZ5A 4ODTH 3BVWA 3MNWA 3TFKD 2GSGB 1A6TA 1P7KA 1I1YB 3IGUA 3K6FA 4J1UA 2JMRA 3LRGA 1A6ZA 3QQ4A 1HINH 1WWCA 4XCCH 4X8CA 5E1QA 2VLRD 1K8IB 2APTA 4NHUA 2DICA 4PJ5D 2WNXA 2VRKA 2CM6A 3WLWC 4KFZC 4Q4IA 4OSUL 1MG3C 5GHWL 4G8GA 4M1CC 4Q9QH 4R7NA 3LB6D 3MLYH 3HG3A 5A2LH 1P4LB 4Q8BA 2GBAA 3L7FB 2OMVB 4V1DE 5DRZB 3G6DL 4QRTA 4M7JL 2G2PA 2N7SA 2JCCA 3QYNA 3APCA 4NDMA 4NXKA 3AM8C 2VITB 1I4FA 4GAYA 1A9BA 5HHNA 5HJBA 3EO1A 4ZD3H 2VAAA 1PMYA 3CVHL 3O4OB 2Q7YA 3QUZB 1CLVA 5DUPL 2DQHL 5FO8B 5ISZA 4HCRL 1I8UA 1V7MH 4FG2A 5E8DH 3OKDB 3FQYA 2XUWA 2COQA 3DHPA 3NABL 4LVNC 2JV6A 4WNSA 2NR6C 4AZUA 4XN2A 1IEBB 1PAMA 2HFEA 5J3HD 3V6BR 4RA0C 1NLBL 1I9JH 5L2KB 1B6UA 1SJMA 4OFKA 3MN8A 5T1DH 4IU3A 1MHCB 5FA3A 4TNEA 4PRDA 5LXVA 1K8DB 1LK2A 1ORSA 3D69B 4R4BA 4D0CA 3WKQA 1LM8V 1J8HB 3SJVA 4MJJA 2G2RB 3MGOB 9PCYA 4TVSa 2FX7H 2VB5A 3FB5A 4ODWA 4DQOL 3V4UH 5C07A 1AS8A 1A7QH 5EUKA 1I9IH 1RJYB 1B2YA 3ZYOA 2BY0A 1EIBA 3HB3D 3RGBA 1RUMH 3SQBA 1A7RH 1SFDA 5KVFL 3KWWA 1DQMH 3F65A 3MCG1 1CQYA 3WGUB 3CCHA 1U8KB 1GXEA 3ATFA 3EH3B 3VRIA 4GQ9H 4S10A 4C56D 1MJ8H 2R1XA 2BCMA 1JTOA 2YMXH 5C86A 2V5YA 4U1KA 2WBJC 1NCAH 1BD2A 2V33A 3RIKA 3B7UX 4OGXH 3Q8FA 1BZ7A 5D1QE 1HL8A 2F74A 4L8DA 1EZLA 5AZEL 4XXCC 4FFYA 4I2XB 5ALBH 3TJHC 1CLOL 1KXTB 4J23A 3RGHA 2B77A 4KXBA 1JTTA 2NUPA 3QWRD 3B8YA 4HJ0D 1ECZA 2DOCA 1A3RL 1O6SB 2IXQB 4LHUA 1S78C 4XXWC 3MV9D 2VLJA 1AYRA 4ZFFA 2OJZH 1XGPA 3LAFA 3L3IA 1RURH 1S4IA 2AJVL 1CXLA 3BPCA 1OGAB 2Z93A 2GSMB 4MXQD 2BS8A 3G5ZB 2YXMA 4NQEA 2DKSA 4KKZA 3TPUB 4FQ2L 2DWSA 3VFMA 2VZOA 1RKRA 5BO1L 4JUTA 4HOMA 1PZ5B 2C1OA 4OI9A 4KTDH 4KKLC 1MQKL 4HPOL 2R23A 3QAZC 2ZP8A 3RG1C 5LGJB 1MRDH 1WIUA 3WY4A 2R9HD 2K0RA 5BW7C 2IOOA 3CHPA 2X9XA 5DJZB 5ENWB 1OTTC 3BX7C 2VABB 1IGJB 3IFOA 2GIYA 4HW6A 3D39A 5IHUH 3PP4H 4PBVC 3HNVH 4IRZA 4W93A 5LBGA 4XX5A 4CAGA 1M7UA 4PB0H 3EYFA 2ADFH 4G59C 3FFOA 3MV8A 1S3KL 1A1MA 2PN5A 2JKJA 4FNQA 2E8YA 4GUCA 4ZNEE 1C1EH 3CC1A 2BWQA 1DZBA 2FB4L 4OD2B 4D0DA 4AC4A 4LLQA 1X5MA 4NC2B 2WSDA 2UY7A 3IF1A 3B2MA 4WZ9A 3V6FB 2AXFA 2IJ0C 3FU8A 2HT4C 1QBML 2MSPA 2ZXBA 3WI9A 3GMPB 3VI4F 5I18L 2JK5B 4FXTA 2C4FT 4OW6A 2F53E 2QLYA 4OFQA 1VHPA 4GMTL 4HJJL 1AYOA 4OIAA 3VWJD 1B6DA 4U3SB 4N9OB 2HTKD 1MJJA 3D12B 5JQIB 4ZUTA 2UVFA 3BIKA 1MDAA 2XNAA 3LNGA 2FCBA 1HTYA 1VCAA 2DQUL 1GJWA 3F04A 4U6XA 4AYDC 2FE0A 5KYNA 4GXUN 4RISL 2IGFH 2CKBB 2G3NA 4LPUA 1M57B 1MI5A 4JFFA 2XKNA 5BZWA 4WJG3 2C7UB 2ENQA 4QMEA 4YDIL 5AW8B 1TZ8A 3CN4A 4Y19A 1OY3B 1FZOA 2BSEA 1TTCA 2XTJC 2WB7A 4P2RD 3ZT5A 4N8CL 3BAXA 1KV7A 2DWTA 3FC8A 2QQNH 5G4NA 4F20A 1Z0NA 3IVKA 4QNPE 4MRCA 3JWNH 4NQVA 3BMWA 3KL5A 1KY7A 3EYVB 5HGBB 4Q6IB 2Y7QB 4JPVH 3SDXA 5K59F 3QUZD 1TIUA 2FJUB 4Y2DB 2A77L 1MLBB 1GSMA 2R0KL 4QNPF 3L1GA 3GWJA 2CIIA 4NNXA 4F8LA 1S8DB 3ZE0F 3DNKA 4JL1A 1ZAGA 4HG4K 3X3FL 4PJHF 1CFTA 3GIVA 2NUTA 4O58H 3FU5A 4Z7QE 1ZV5A 4F37F 4FFWC 2HLAA 5F96L 2EUZA 1IE5A 1SBBA 4KTYA 3T3PB 2Z92B 2BRRH 4LPWA 4Y1TA 4OLYL 1WZMA 5CN1A 3DHUA 5JHLH 4YUEL 5EWIH 1ETB1 1P9MC 3U7WH 1YEKL 3FFCD 4FXLA 1F86A 1FJ1B 3RL1A 3D5OF 3EBHA 3UTSE 3TX4A 2O61B 4YFEA 5IEHA 2I85A 2NXZD 4Y19D 4N0FA 3LTVA 2FJHB 2K7PA 4GS7C 1VB9A 5IJCC 1U3JA 4FTVD 4PG2A 5GGSA 1JGDB 1MI5D 4U4IA 5EU7E 5DZLA 2NYKA 3ESMA 1MFUA 3DROA 2WOBA 4K23H 1SHWA 3KG5A 3II1A 2XWBB 1WH0A 4Y4HB 4FI6A 4D9QD 3T0ED 4IBLT 2W0PA 3WHXA 2DYSB 2J3SA 4LSUL 1L6PA 1VJSA 1ZLUK 1UQSB 4OF7A 4I0PB 3INUH 4N2FA 2FO1A 1OT1A 1RSYA 2A38A 5JDSA 3VGEA 4OU3A 2O6PA 2UXVA 4DKFL 1P5VA 2X4PA 2VE6B 4FQLL 4WCYL 5E6ZA 2X4OB 1I7UA 2HFGL 3QDGD 3SCMA 1BVLB 1IAII 4K73A 1T04B 2A2QT 5KJ7E 3FH7A 4HIIA 1F3JB 3D2UD 5IGXL 5KEZA 2B1AH 3N42B 5JR1L 4PGJA 1Z5LA 5D7IB 1U9KA 4KX8A 3MLXL 4RNRA 4LCWB 4CC4C 1CVRA 3IETA 2PTTA 2UX7A 1VAHA 3B9DA 3MACH 3O3AB 4I85A 2AI0L 5DFTA 5CEZL 2EVFA 5T3ZD 2P5EA 1SXCA 1U92A 4C83A 3QZNA 1B3JA 4JRXB 5IWLA 1AIFA 3SE4C 5KVDE 1OAUL 2WWKT 4AJVA 4OCNC 5FM4A 3BHBB 4XNMB 2MWCA 1KULA 3ORJA 3PNRB 5DDHB 4RH4A 5I8EA 3MGAA 2ITCA 2YQBA 2E9WA 3D0LB 1NCOA 1E27A 4OLXH 1CWVA 1TQWA 4BE5A 1BQRA 3VA2C 3OMNB 4WUUB 2O5YH 2QQLL 1T03L 3UBXI 4FDWA 1U3HB 3BKJL 3FFDA 4NUPA 4LQFL 3CFCL 3OKNA 2DMCA 3CXHJ 4WFGE 4XGZB 7CGTA 4JO5A 5FGRA 4G9DA 2CD0A 2YLHA 2Z31A 4HHAB 4TYUA 3K74B 5AW3B 2DYPB 3P0YH 4HZAA 3BP4A 3KXFD 1GW6A 3VFVA 2HLEB 1YUHA 2FEDC 4MJID 4MXWH 3QEQB 5GGSY 1HS6A 2BDNL 2EDKA 1BF8A 1B9ZA 3BQUB 4GI6A 1N3NB 4PJAF 5AB0A 5KVGE 5DR5L 3RJQB 3Q5OA 5BZDB 1YMME 4KHTH 2KZWA 2WWMC 3PHSA 4X42A 4L2LA 3DVNA 4MS6A 5CCJA 5GPRA 4YHNB 4M5TA 4ZPVB 4A6YL 4XHQA 2IEPA 2D31A 2P24A 4A7UA 3EJTA 3GXIA 1JK8B 5LDSA 4PFEA 4OZFH 1G9MC 2NY5H 2A1WH 4EDXB 4OFYA 4IK7A 3HBPA 1U93B 4QF1B 3RWGA 4W9EC 1YN7A 2VLMD 3AB0C 3LEYH 2EKSB 4GXFA 1HYRC 3FU9A 3T3ME 4B53A 3B7RL 4HMCA 1BDYA 4UYPA 3VWJC 2QQKH 1G7MA 1SYVA 3KW8A 5IMOB 2WM0A 1DN0A 4QRFA 1AP2A 1H3PH 5EN2B 3FB8A 3FUIA 4Z7UA 4NO3A 5DHYA 3VI3B 3KPRB 3B2VL 3L45A 1CGWA 1EH9A 3RTLA 3C5JA 1RZKC 1MJUL 3K81A 3ESOA 5GZNC 4M62L 3RX9A 1GTFA 2J1WA 4NKDA 5H4YA 3TEXA 5AWNH 5CEZE 4KXAA 1OTSC 3QDJE 4F15B 3MLZL 4OZGE 2YC1A 4GO6B 4HKZA 4BBWA 5IHUL 1LO3L 2PXYA 5E5RB 1QABA 4Y2OB 4F7EB 1XIWA 1BXAA 2Q0ZX 5GZOA 1JNNL 3VXPA 4WWPA 3C09B 5AOZA 4JGMA 3CE1A 3DI3B 4PRIB 1MQKH 4HPOH 3MBED 4OLWL 1EZUA 3FU3A 4NSKB 4DW2L 2HG5A 5MERB 4PJDB 1SRDA 2Y07L 2HT2D 4K9EC 4PLNC 3MCYA 1F2QA 4CGUB 4MJHA 3RDTB 1NCCH 4HGWB 4DP1X 3G3LA 3P30H 3BP5A 5J56B 4LPCA 4PB0L 1XGRA 5DT1L 1IAKA 2DQDH 4LSRL 2FO4A 4HCRA 5AVRB 1R3HB 2Q3ZA 1JERA 3L2NA 1RMFL 1DZ0A 1H3UA 5DD3L 3US1A 4JR9H 2RCSL 3BVNB 5KVGL 1DJHA 4AGLA 3DHJA 3SHSA 4JFVA 3VFUA 1LMKA 3VXTA 1AI1H 4YIQA 3HE6D 4G8EA 3O3BB 5CP7B 3OAUH 4CC1A 4P3WA 4UTAL 2J6EL 2CDGB 5ETUA 4W9JC 4JKPH 2WLJA 3BC9A 3KYKH 3WTSA 2YHGA 4QRSA 4BGLA 4RMSA 5IR1A 4N1HB 5L88L 1NCWH 3K0WA 5IG7B 2EO9A 5JPMB 5KYXA 4B97A 3U4BH 3SJVB 2EE9A 1XSJA 4WEEA 5DQDL 1CFMA 1CXIA 3S5YA 3V5KA 1RIVL 4XP1L 4XN9A 2RGSA 4LRNH 4WWKA 5AD0B 4P07A 1MIEH 3CFBB 4YEFA 5FAAA 2VIRA 5ECJE 2Y3NA 2XQYG 2IAND 3Q2WA 3GSVA 1F6AA 4WENB 2BPBA 1R3JA 4BKLB 1J0YA 2UZIL 3D3VB 2PO6C 1X5LA 2D7OA 4C55A 5HHMB 2ED7A 5FPIA 1HCVA 2IH3B 4JFHD 4XAWL 1G0XA 5FIEA 4JRXD 5DJCA 2JTDA 4NZRH 3VXNA 4X5XB 1W15A 4OLVL 4BCYA 4XVUC 1J8KA 4ALAC 3T77A 1UT1A 4TNGA 3QZWG 3DUUB 2QPEB 1YC8A 5LHDA 2W95A 3AS3A 4GG6A 1RFDL 5DMJB 3DJTA 5C0BE 3ZY7A 3BVVA 3QPQD 4QTIH 1XGUB 1G43A 4X4KA 2J55A 4RRPG 4OJFH 4YZFF 3ASWA 1HXMB 2YUXA 2Z35B 4HBCL 4JFOB 1YA5A 2FD6H 3I6GB 5L4MA 2O6CA 1CXFA 3DX3A 1N19A 3H6JA 2N7BA 4K9EH 1RJLA 4PJFF 4YFLI 4IDJL 3R8QA 2LU5A 3V4PA 3AACA 3GXPA 4G6FB 4LARL 4E2OA 5DXWA 4ZAKD 1TFPA 2YKLH 4XOCA 4L2YA 3T2OA 1DLFL 3L3HB 1A6AB 1NAKL 3LN4A 3SIKA 2VERN 4WI4A 3RY6C 2CMRL 3MLUH 2JE8A 5KSVA 3GFUA 1GIGL 2AGJH 3SO3B 3VXUB 4MCZB 3HNTH 3NIGB 5JXAH 2ZG3A 1U8KA 1J1OH 4XAWH 3DSNA 2L0DA 3UEZA 5EEWA 4HYTB 1QATA 1D9KD 1QD0A 5E56A 4XAKE 1Y1UA 1N0LB 2KLSA 4G6JL 1FWXA 2R69L 4N2LA 5DMKA 1VACA 1JIBA 1JN6A 4Z7VA 4F1ZA 3BESR 3N1QC 4F2MA 4MGXA 5ILTH 2PO6A 4Y7MA 2VDPL 3NCWA 5DRZA 4UINL 3W5NA 1AO7A 3GSNA 5CD5C 1QKZH 1F4YH 5F7DA 4QXWA 2ZOWA 5EDXA 5DA0B 5EPMA 1YYML 2XN9A 4GP4B 1A0QL 3GHBL 1EHKB 3ZDYE 3TWCL 1V10A 4U4BA 4XBGB 1JWMA 3HFFA 2ISDA 2VMJA 2CUHA 4NOFA 4N8CH 2Z93B 3KBFA 2Q7YB 1ZANL 2EYTB 5FO8A 3GKWH 5JR1H 1S9YA 4Z7AA 4NQTA 1T5WB 1HXKA 3STLA 4G7VH 2NXYD 1T6BX 1TZIA 3D48R 1I75A 2G3XA 3L5WA 4L4VB 1SEQL 4U0QB 1LMIA 4JFZL 3RTQC 4ADIA 1RK1A 1M56B 3A6OA 2DQMA 2WKOA 1NL0L 2BO0A 2X3CA 2WJ5A 5CILL 4HDIB 3WNJA 4S1QL 1NGYB 3FO1B 3IWVA 3MRLB 5LUMA 4OGQC 2YPLD 3A22A 4ZFOL 3PABB 3S36X 1F4XL 3FB7A 4J7RA 1IC7L 2IV9A 4QO1A 5I71B 4XPHH 1WITA 3JV5A 5KUMA 3GBNL 4G8IA 5E7BA 5DYOB 1ZTXL 2XIIA 1FYTB 2CIIB 2KL6A 2I60L 3N85L 5BO0D 5ANME 2QPSA 1NFDB 3NCYS 5GSVA 4OJEH 4GKSA 1TQBB 3KXFB 2RBLA 2X0UA 3VTTA 2MNJB 3BRGC 3TJPA 3N04A 2AQ3A 5HYSG 3TO2A 2ZXDA 3AQDA 3VXSA 3H9YA 4XH2B 2NMSA 4KJWC 1XX9C 3RPKA 3WSQH 5I1IH 1IAIL 4JFTA 1GVIA 2ZUYA 3CLFH 4U6XB 3PWPE 4GT0A 2OTUA 2BFGA 1OGAD 5TE6L 4YK4C 5IB3B 5E1HB 5E8OB 1YJDH 5CHNA 1U0QA 2K1MA 5JMRA 3WNMA 1UXMA 1MY5A 4PJIA 4MZIA 3D2TA 2YSSA 1KJVB 1XTMA 3P69A 1NUGA 2PYED 4NQCD 4AYGA 1KLFB 4JFUA 2N0MA 3BW9B 4X6DA 1DL7L 3DA0A 3WHXB 3KL0A 4K7FA 3ZE2F 4W81A 4MTMA 2BVOA 4Z23A 1KCSL 4OV6F 4MJ5B 1RCYA 3B2UC 2BNRD 1I53A 4MNGA 2DQTH 3HE6A 4XP4L 3ESVF 3FBKA 3VGAC 2I5YL 1I8MA 2VE6A 5KSBA 1H0DA 1TF4A 2OBGA 3F7QA 1NBQA 1TEYA 5DU7A 1JPGA 3S2CA 3W1ZA 5EOQL 4GJTB 4NKIL 3GIZH 1D6VH 5INDA 3TGXA 5IF0B 3B83A 5E4IA 1BFVH 5KVFH 1ZVHA 2EXTA 2F7PA 3OHXC 2Y22A 2FEEL 3JVGA 3WL9A 5CBAB 2QPUA 2NNAA 4J4PC 1FYTE 4LCWA 4U1GC 1WRFA 4HSQA 2NDFA 2DQDL 3ZKQD 3C5XA 5E6ID 3V4UL 4CMHB 2YMXL 1BZQK 5ICZA 3TEUA 4I3SH 5B4MD 3FW6A 4OZFG 3OR6A 1ZK5A 3Q3GB 1KUMA 3BIKB 3U46B 2R8SH 4DZ8B 2ZOLA 5BUGA 1KTLB 3SKMA 3ULUC 4KVCL 3TN0C 3BWUC 1AS7A 1TENA 2IWEA 2YUVA 3H7BA 5DJXB 2V5SA 3F6IA 3VNYA 2P45B 2VM4A 1HXYA 1AY1L 3EJUA 4W9DC 3ETTA 3US9A 1S7WA 4FERA 4N0UB 5IJKC 3V0FA 2O72A 2F19L 4DKDC 4Z7QB 4AWJC 4FQQA 2K9UA 4TTDD 5D1ZB 5FOBA 3BT2L 4M8QA 1KB9J 5J1AB 1AKJA 3HRZC 1FRGH 3TYGH 5F0LB 3G9VA 2PPFA 2OMNA 3DYPA 1BEYH 1KTBA 5DS8A 5IMKA 4L0YA 3H53A 2CUIA 4PJFB 2AKRA 1OAXH 1MPAL 3LKSA 4HKXA 1U8OA 4P46C 5ISZD 3ZDYB 4YBQD 1T2JA 1MWAB 5MP6H 2IOMA 3MJ7B 4U7SA 1TJMA 3ZL4L 1VZGA 4JDEB 4NO5B 4S0HA 5FUCC 2QVTA 1YEGH 4EI5A 3I6KA 4HXAL 4XMPH 2JCWA 3EGSA 4I4WA 5FLUA 1DEEB 2E76C 2A74C 1TZGL 4NO0D 3ABLB 5MEOB 1KGXA 4WFEE 3KJ6L 4XOBA 3V9CA 3IETB 3QDGE 4KDVA 4EDXA 2AQNA 4TVPL 4XCYB 4ENEC 3T6QC 3PY9A 2VZUA 1K5WA 5AFAA 5M95B 4M4RA 1RI8A 3II3A 2EC8A 4HS8L 4TUJB 3C8KB 1FJ1A 2QKIA 1P6AB 2YLKA 4HGKC 2OXGA 5AVWB 3TIDA 3KGTA 1CXHA 1V54B 3PP3H 4JHAL 2GC7C 3JVGC 2OULB 4FYSA 5D7LA 5DZAA 4ZTPL 3TIEB 4DEPC 4XMXA 3FUMA 4XN1A 3UCRA 2YSTA 1OT4A 1T4KB 2KBGA 4XC3H 4C54A 4XB3A 1GAFL 4P3DA 4U1NB 1MF2H 5L4IA 1KN2H 2WYZA 1R3LB 3ARUA 1QI3A 3EJZD 4F24A 3RWEB 3NTCH 4F8QA 3QS3A 5GJTH 3PU7A 5TGBA 3QISA 2K6YA 4OQTL 2ETWA 4XGZA 1W72L 1UASA 2HN7A 1WZ1L 4LT7A 3QQ3A 4PP1C 3HAEH 1PX4A 3LZRA 1WA0X 4FXGA 4IIQC 4UDUB 4LLWA 4XP5H 1HFUA 1AHMA 2YQ3A 2CLZA 2BOBA 5AYUH 4EN3A 4DAGL 5CLZA 1GMIA 1RU9H 3OBAA 4MAUH 3LDBB 3GSXB 1D5ZB 3QEHB 3EBGA 2X2HA 1E4WH 5GGVY 2RR3A 3F7YA 3VXRA 2ADJB 3BFOA 2VQUA 5B8CC 5D72L 2CDEB 4KRMB 2BVQB 2L7EA 2XVBA 3H9SD 3P4LA 3NCBB 5CWSA 5FYJL 3WO4B 2XETA 4AYBA 3I50H 1XD1A 4GLRH 3I6SA 4HKBA 4XMUA 3RNQA 5HHVH 3DGGA 5JYLA 3IDNB 4RFEA 2HMIC 1YMMD 3B3BA 3JZYA 4QRQB 5F9OL 2FIKA 3EG9A 4HZLB 5EOTA 3TBTB 1D5MA 3FSAA 3GMOB 4ZMNA 2WGNB 2EUXA 3NPSC 4R0LC 1NBZA 3EFFB 3CZUB 2PKDA 2FO4B 4ZXBB 1KTCA 4JFYA 4PRBB 3AW5A 2VMDA 2GBUA 3EO0A 2O61A 3FF7A 2X40A 4BFEA 2XXFA 3I74A 2YD5A 1P2CB 3EYUH 5JORB 5EU6B 4UT7L 1VPOL 3ILDA 1G7JA 4PGDA 1XAUA 3BUYB 3QB7C 5AALA 5H94A 4XB8A 1E4KC 1HAUA 3PDGA 3CVIL 1HX0A 3MRRB 3TBBA 5B1JA 4O9HH 5DFVD 3QIUC 4L3FA 4XO9A 4BKTC 1WZ1H 3P2TA 4GP5B 5TD4A 5EEUA 3V0VB 4LIQH 1QLEH 5EBMB 5HJ3A 3GLZA 1Z3RA 4OH2A 3OB8A 4L1TA 4X7CC 1E90A 3CBRA 4UQ9A 2YAHA 4U1LB 5IM7B 2EDMA 5LBVA 3EF7A 4S0TD 5K1JA 3RL2A 2EH7H 5EZOH 1WDAA 2ALWA 1RJCA 3H2PA 2CK0H 2WLYA 5IIEA 3NIGE 4OLVH 2AQSA 1FFQA 4KRNA 4DPRA 4BFNA 1INDH 1ZPUA 3IRPX 5MEPA 4B6ZA 5DA4A 3KLQA 2F54D 1Z2KA 2NY2D 4P2AA 3LPFA 2ZSWB 4FHKA 1NIBA 3D85B 1CGSH 4EQ2A 1D9KC 4Z7IA 1E4XH 2D31B 2P24B 3JV4B 1TVHA 1X4YA 2B2XH 5C08A 2JI2A 3PV6B 3KPSE 4K55A 3E0GA 1L7TL 4FL4B 1ZWIA 3WDJA 4BFIB 3S88L 1AGDB 4IRSC 4QRRE 3Q2LA 5I1HL 4QRUA 3PAZA 4BQ9A 1EBAA 2GHZA 3JWNC 2J2ZB 1IM3D 3BKCH 2IAMC 1YSOA 2AK4B 2WXKA 4ZO6A 1AQKL 1AP2B 2OXHA 5C0AA 4U6YB 2FHFA 5C0JB 1HH6A 5JQ6L 3CGTA 3VXOB 5KS9E 4BK8A 1VADA 3EO9H 2QQQA 1TITA 1NCGA 3OGCA 3N44F 1HHKA 2C4XA 4A6YA 1GCFA 4RA3A 2Z91B 2Q6WA 5I30H 4ZUSB 4BKSC 2DLTA 5TE6H 1C5BH 1A25A 5F1KC 4MCYB 4IRJC 3VE0B 4LLMA 3CMGA 1MCLA 2P8PB 4KNTA 4KJYB 1GGBL 4JDVA 1CDHA 1HEHC 4KQ3L 4BFGA 1E43A 1XIWB 4WGWB 1R19A 4UQIM 1IFGA 5I1KH 4YNYB 1OF0A 1MSPA 1OPGH 1SQ2N 3U4EB 1C16A 1P4BL 1XR8B 1HILA 4XMLH 1B4TA 5C07D 3RVTC 1LILA 4E41E 1T2XA 5FM5O 3MHZA 4X6EA 1CE6A 1QNIA 1GL4B 4QT5B 5BOPA 3U0TA 3UJJH 5E1IA 3L4VA 1L0QA 4LBEB 2XYCA 3TCLA 4WW2C 1NIDA 4XTRD 1MZYA 2IFFH 2J21A 5FFGA 5IFAH 4JDTH 2NY5C 1YN7B 5AVYB 2NY1D 4WO4A 1HHGB 3EJQA 4N86A 4ONHA 2HX8A 3V4VL 1R3HA 4IDLA 4BXVA 2NY7H 1ZKAA 5E2TH 2VERA 4JFDD 4AW4A 3VDBA 1BVKB 1J9SA 3PS6A 5TF1H 4WI0B 1SEQH 4OGAC 1BSIA 5IFJA 1CFSB 3TYFA 3DDGA 3G5XA 3EGXB 3P4OA 2H0FA 2F58L 3I9GH 1ASQA 3AUVA 3BJLA 1A8JH 1OAKH 2J8OA 4OT1H 2ED6A 5E8DL 5FUOL 1SVCP 1FNSH 2WQ8A 5JIDA 3ZZQA 2E8ZA 4Z7WE 1G9HA 1BX2B 3EXJA 5LG1A 4L4VA 3C9NA 1UATA 1X9UA 4LLVA 3LNEA 2YC1B 4B9YA 2R8SL 3CFJB 4Q89A 3I2CH 4P9HC 2GPZA 5D2NE 2XQYK 3NGBC 2O5ZL 3KYMA 5GRXG 4HUXB 3QULB 5AD0A 1T22B 1KYFA 4AT6B 3VXUA 3D2UB 2V7NA 3MBWA 3CFBA 1BMWA 4QO1B 4Y4FA 4L23A 2WW8A 3AWFA 2EDDA 5CJ8A 5EU6D 5GRJH 2VSCA 1JDCA 2VN6A 2E9JA 3CD4A 2BZ7A 1HL5A 5ADOL 2MEJB 4CC0A 2N56A 4GH7B 4LCUB 1EAPB 4JM4H 3QWOA 3L3OB 2VDMH 4KKCD 4L9LC 4YWGH 5K1NA 1JHLH 1F8TL 1WK0A 3LXBA 4W1TA 3S3SA 4MMYB 4XNBA 3JXAA 4NPYA 2AV7B 2GUYA 2ZKHH 3MV8D 4W9KC 3IRCA 5HYSB 1JN6B 3A23A 4Z7VB 5T5NF 1KEGH 4YHMH 2CM5A 1BZEA 2H5UA 3Q9QA 4P59L 2GIMA 2WLLB 2BSRB 1JG9A 1RULL 3AG3B 4KKCC 2PTUA 3RY5A 4AE0A 4PLOB 1PZ2A 3IE9A 1A02N 5E8EA 4ADJA 1DJIA 1TQTA 3KPRE 4PGCB 3S4SB 4YSTA 3RLSA 1QFPA 2BWDA 4URTB 5CJXC 3SDAC 2OTUB 3MRDA 4NEHB 1CVSC 2ZWYA 3MAWA 4WW2A 4CADB 3DV4B 1PZCA 2GJJA 3RZCD 5D5MB 1RJZA 5LXGH 1JZHA 1A4AA 1UADC 4LAQL 4ZX4A 1ZV2A 1GR7A 3OB0K 1JOIA 1Z7JA 1TNNA 4JFPA 4K94C 3I6GA 2OW6A 4NYLA 4KH2A 1DL7H 1GZHA 3DRTA 4PJ9D 1CLOH 2C8NA 3EOBA 1X5JA 4IQHA 3FTVA 3NJHA 1DBBH 3K2UH 2EVJA 2F8VA 4JPKH 2O5XL 4J6RL 3U1PA 1SNRA 2MCPH 2Y72A 3UH8A 1D5RA 4YFDB 1FCGA 3MRKA 2PCPA 4UM9A 5DJ6A 2OZ4L 4FG6C 1VLXA 2QGBA 1DDHA 5F44A 4OCXH 2GJ6D 25C8H 4FQ1L 5DJ8B 1NMBL 1YNKH 1H6UA 5TQ2H 4WI8A 5LBSA 5JQHC 1ZS8A 2DQJL 3P11H 3FAXA 2Y5TB 4Z0XB 4AH2A 3DV6B 4TNWK 5JHBA 4XXWA 5B39B 3BZEA 5C09B 1T0OA 2C9QA 4FHBD 4FYTA 1N0LA 4UI2A 3TT1L 4U1KB 1T1YA 2E9BA 3DWTA 3AWGA 5LGHL 3ZDZF 1CTMA 4P5TB 3P40A 4OFDA 4FP8L 4KVCH 4RAUA 3CDFA 3K2KA 2HX7A 5CJQH 4A7VA 1RV6X 1S9KC 4JPWL 4NRZB 4XPGH 5GSRB 3OG4B 3OKKA 1O7DC 1DBJL 2PW1A 3MJ8B 3HAEG 4L4TE 5TFSH 3LNFA 4IKNA 1J18A 3IDYB 2DTML 2WSKA 3RKDD 2OZ4A 4PJ9A 3EBIA 3K6SA 2CBMA 5EO1A 4OD1L 5A2IH 2PTVA 2DLFL 4FLSA 4OFIA 1W0WB 1HU8A 1OTTD 4Y0GA 2ADIB 3ARSA 4PJIB 3ZOAA 1MRFL 4XC1H 3PQYE 2EACA 1KSRA 3UAJA 3EW3B 1TZIB 4AV5A 5FV2A 5DEZA 5CJXA 4O5LL 3V7MA 1MRCH 3HZYB 4JFWA 3CHQA 1CD1B 3PWVB 5CJOL 6TAAA 5B3SB 4KV5E 4ELME 1QYGH 1RK0A 1YNLH 3CUPA 3VXQA 2CJTA 3HMWL 1EFXA 4AXWB 4MZ3A 5LAXB 2Q10A 2F8IA 1L9NA 3T71A 3K8KA 4NKMA 3DX1A 3D39B 4M6AA 1GY1A 2RAMA 5F7UA 1CQKA 1MXDA 5LNDA 1ZTXE 4MB1A 4WFHD 1PZSA 1I8MB 1EGJH 2A4CA 5IQ7H 4XE5B 4F3FB 2E6PA 4P23B 2IBGA 2NT0A 1YEWA 1NFDA 3QZWB 1S7RA 5LKNA 3B9KC 2BVPB 1AG0A 4XXDA 4KAQH 5C0AD 2OJEA 4A2DA 4P99A 4CMMB 1WZLA 1EO5A 1NSNH 2R4RL 1XH3A 2ZUQB 3VGAB 1RUPH 4ZTOL 2IANA 3TH2T 2FIRT 1J5OH 3Q8BA 5I1HH 4NWUL 1BZ9B 3BUQA 4L4TA 4WU5A 4FKKA 7FABH 1JNLH 2ZCHL 3OSKA 2VW4A 4OV5A 5EEZA 2D0GA 1BWMA 5DO2D 1KT2B 4YS4A 3QUXA 2X1WL 3NFSL 4Q14A 2KKQA 3S3CB 3FQRA 1FG9C 4NCC2 3UAAA 3C2AL 4O5LH 1PD1A 3VW3H 2E7HA 2YPLE 1IIIA 3N6YA 4YXHH 2QSQA 1TU2A 4Y5XB 3KPNB 3ZMRA 4EZLA 4QTHB 3OF6A 5I5IA 1RQ5A 2GIXA 5AVUB 1XH1A 1YMMB 1WIPA 3D09A 4GW5A 2UXGA 3S97C 2Z8SA 4HF5H 1F11B 4WI2A 2NY0D 1UWFA 4Z0BL 3VX0A 3NCJH 4ZQTA 2Z64C 3L6FB 1M6OB 3VTAA 5I1JH 3BUPA 3FT0A 5ITFB 1U8QA 2M26A 3T8XB 4BRJA 5IESL 3MRPA 4PEEA 1HCFX 4Y2DA 3BN9D 1XDTT 4A6YH 2VGLM 3R0MA 4ZOBA 5FCUL 3WUWA 4C57C 4H13C 3FTWA 4A7GF 4LNVA 1QVOA 3C5SB 3WEOA 4FTVE 4F5CA 5DEGB 5F7AA 2BERA 5IKCB 2ITDA 3QUMH 4P2QE 5A43C 2IADB 4BDVB 4PRNB 4BSJA 3DLQR 1VEMA 3KCWA 2TSBA 3VXMA 1CT8A 5GRYA 1KEMH 1W0VA 4QYOB 3PHQB 4FXKC 4GT7A 3W0WE 1GZQB 1H8NA 4I77L 3TBVA 3TA4D 4DZ8A 3AY4A 2FX9L 3SKOB 1TPXB 5D1XC 4CVZA 1SN2A 2QSTA 4ZW3A 1MFEL 3P9LA 1XXFC 1PLCA 8FABB 1IAIH 3R06A 1EJ8A 2HPTA 4UTBH 5GISL 4NM8L 1I8KB 3LQMA 3W39B 5EO9A 2R2EA 1F4AA 4MXQC 1NANH 1YJDL 3E80A 1GPOH 4D7BA 1AKJB 2AW2A 2OCCB 2WXMA 3PHAA 5IM7A 1YPZE 4FJ6A 4MMXB 1QI4A 3CZKA 2FECI 2BOBB 1S7TB 2H8PB 3L5JA 1PSKL 5AZ2H 5EG6C 3RL2B 1CGSL 3Q13A 1FE8H 4RFNC 5A3ID 2AK1H 5ICXA 3GSQB 1DP0A 5L9DL 2YO3A 1D5ZA 4J3WA 1NCNA 2F7OA 2XTJB 2UWEF 3GMMB 4JM2D 3T65A 3SJVD 3DKHA 1F56A 1IAIM 4LDCA 2ZONA 1V3MA 2E7BA 1ET5A 2A73A 5IOPA 2WC7A 4WV1C 4JPQA 1CLYH 5A3IC 4HWEH 4WSKA 4TSCL 5HGAB 2X4RA 2IPKB 2Z65C 2XZAL 4OZHE 4OZIF 2MNWA 1Z0MA 3HUJB 5C97A 1JGUH 2WO3B 2VXTH 1GHFL 1MFAL 1NCBL 2R51A 5E08L 5KYUB 1RHFA 3WEMA 1HWHB 2WD0A 1ZT7A 1R0AL 1J8RA 3MCLH 3BLBA 1MCFA 3EFFA 4ZXBA 3LQZB 4XT1C 2AJZB 4MXVF 5T3ZH 3QUYA 3H0TA 1JNHA 2YD6A 2GB2A 4UV7H 5EMYA 4XP4H 3RWFA 3EJPA 1HESA 1I3UA 2YPVA 2MQGA 1GH7A 2VMFA 3TP4A 4A2MA 4NQDE 2F9BT 3L1OL 5F9JB 4G6KH 1O6TA 4DZBA 3LRHA 1OVZA 1AZRA 5C0JA 1HL4A 2F2HA 4JVUA 5D2LB 5K9QG 4U1MA 3WAJA 5F21B 3HG1E 4EZKA 2IH9A 4KK6C 3UL4A 4Y2LA 4H5SA 2X70A 1RUAH 2VLRA 3D08A 2JXMB 4KKLD 4WJ5A 4HHWA 1NFKA 3WFEH 1H19A 4ISVB 3FUFA 5D1XA 2AV1B 4A67A 3TJEL 4ACTA 5K39A 1UXLA 1BFOA 2ZP9A 1SJHB 5D7JB 4L8CA 4AQ8C 2BFVH 2NY6C 3HTLX 3C6LA 2K4AA 4AQ1A 4DN4H 5J6GA 1LDPH 2DYPA 3DOIA 2X4TA 1UCBL 3JTBA 4N4YB 3WN5A 4H2AA 4EPSA 1EZSA 5J5EA 2E6JA 2DQJH 3GLDA 3P11L 2IFFL 1CU4H 3DOSA 2LQRA 2H32H 1VEPA 1IGML 1TZOA 1S7UA 1ACYL 2N4IA 3ZHKA 2F19H 3K7UA 5HGHB 5I6OA 4B9ZA 3RPIB 4HC1H 4MA7L 2HH0H 5I9QB 4B95C 3ROLB 3MCLL 1PLGL 4CNIA 2YBGA 2PR4L 4XCYA 1U6AH 1DQLH 4FQXD 1I7ZB 2F1AA 1JTPA 3MNZA 4ZO8A 5C8JA 3UTTE 1FP5A 2AMUA 2F58H 1QFWI 3FBQA 4ODSH 1RZGB 3BD5A 3HZKA 4PCYA 4BA0A 1KG0B 4MDJB 4KRPB 1FPTH 1Y0LB 2IDCA 1ED3A 4OB5L 2P42B 3SB3A 3W0WB 5JW3H 5IMMB 3LS5H 1CD8A 1FC2D 4XPBL 3WKPA 1AH1A 1ULVA 3KPSA 1YEIH 3RURA 3SDCD 35C8L 4PJHB 3ZQ9A 3SY0B 1IBYA 4P2QB 1RZIB 2OR9H 2VRQA 4IRSB 4HS8H 4PY7A 1AR2A 3NCCB 5F1IA 4ZG1A 3LRSA 4H8PA 3C5JB 1TTUA 4PJBA 1INEL 1GS6X 1MFNA 4DTGH 1JD9A 5J7CC 2EIMB 4NAMA 2CCLA 4ZTPH 4MQTB 2DRUA 2ZXAA 2VNCA 4FNLH 4PS8A 4N0CD 1XB6A 2WLIA 3S7GA 1M2OA 1DQQB 3UC0H 4NKIH 1S2EA 2FGZA 1N2RA 4HIEB 1IJ9A 2WVUA 3VJ6B 3WG7B 5ICYB 1JDAA 1MF2L 2E56A 2XN9E 2IVFC 1JZ7A 2I07B 1IEAA 1HSAB 3Q9PA 1AI1L 3F7PC 1F8TH 4G9FA 1RZQA 1R3IH 2ZOOA 3SPHA 4HUUA 4R4FL 5E8PA 4HPYL 3BAEH 1MFMA 1AZCA 2ZSVB 4NRYB 4ZMPA 4JFQA 3F7YB 1P7KB 3PJNA 5CGYC 5BMFL 3RZCB 4EE2A 3NIFF 4P0DA 1PZAA 2CR3A 4WEBH 4HU8A 2BVQA 2HH0L 3EGDB 5C92A 3KHQA 2HKAA 2GKIA 4CKVX 4YSUA 3U0PA 1P7QA 4O2CB 1TTBA 3WFBL 1N5YL 2QELA 2XN2A 1WG3A 3QQNA 4R8WL 1CBJA 2FJGB 4HMDA 4LBEA 3UDWA 1VEOA 1S3KH 4ELKA 5EF0A 1NLDH 4RVBA 3JTTB 4BFFA 2P28B 1JI2A 2Y7LA 3ZRFC 4Z78B 1Z9NA 1BD2D 3QFJA 4HQQH 1PZDA 1XSKA 2VDOH 2F6AA 3ARFA 5HDBF 1NEZA 4LPYA 2VJXA 5EC1B 4Z3TA 1KC5H 1YCSA 2CBOA 3OB0H 5DLMH 4HS6B 3S35H 1QTYT 4HAGA 4L29B 3VI4B 5I75B 3O9WC 5T5FH 3S5LA 1EJOL 2FWUA 4ZX3A 2R0LH 5GQBA 2AK4A 3WFDH 4CADA 2AEPH 2ZAHA 2IQAB 5I15H 3EIFA 1P1ZA 2WXHA 2BSTA 3C87A 4OZFB 5F0PB 3CC5B 2JKWA 5L0QC 2WLZA 3X12A 5E2WH 2YWZA 1MZZA 3ARQA 3OLGA 4LSUH 1QOKA 2HLFD 3P3RA 2B59A 5HI5D 3RWJB 2EXWD 5HD8C 3RWIB 2JQZA 2IGFL 4AENA 1YNKL 5DMGD 1B0RB 2FQFA 3EYUL 2X1PA 1NDGB 4IMKC 4BUHA 4GUOA 4MAYD 1SM3L 1UOKA 3LKOB 1JSYA 1NC2D 1U8HA 1QRKA 5IB4B 4N2CA 2V7NB 3MBWB 3ZGIA 2CNYA 4PM1A 1DDHB 4Q2ZA 4MA8L 3F6LA 2NNCA 4J1UB 3CN3A 4ONFH 4LCUA 5C9JB 5FW8A 5I23A 4F15C 3ZIYA 4XBPB 3CFKB 3TA3A 4GW4B 4X6EB 4X9FA 1M1XA 4HX1A 4B9GA 1A7OL 4CSPA 2ZWKA 4QHMB 3CV5A 1ZHNA 5I1GL 1JZGA 4WI7A 3QNFA 4MB3A 4HUVB 3D1MC 4JO3L 2WQRA 5FKPA 5BRQA 4X7SL 1G84A 1G7QB 5LN8A 3P0GB 2X38A 1ZHKB 1BCIA 3QJRB 4R4NC 4OLXL 5H2BB 2LLGA 3G08B 1MHEA 1VZIA 1QQDB 3RIFF 5DHDA 5AAWC 1F1GA 4O51A 5KBDA 3D4YA 2OXHB 4YSEA 4XMTA 2G0KA 1Q94A 2E7LA 2R69H 2WINA 2DBJA 2VO8A 2GITA 4DETA 5KN5A 4I7ZC 3LNHA 5L2KA 4TQHA 1TR7A 4X0KB 2BXYA 3RWHA 1KB5B 3BVXA 3D69A 1GPOL 1JZDC 3GI8L 2WSPA 4MNQD 4IOSD 1IGFL 4J8QA 2WXOA 2FJSA 2NY3B 2A3TA 3MRKB 4UM9B 3DSFL 4ANUA 4H26A 4Z7QF 3EUUA 2MNUA 4X5WB 5DMIL 4CGTA 5IHHA 4TQEH 1PL3A 4H4NA 1IFRA 1ETJA 3E6FB 5J57B 1CLZL 5LCVH 1ACCA 2AK4E 2VLLA 3QNYB 2GSIA 1U2YA 1OSZB 3GJFA 4IMKA 4MBRA 4PJ5B 1KJ3H 4ZFGL 5C6PB 3K6DA 1N7ML 2CO6B 3RJDA 4MRBA 2D2CC 3INUL 3IB4A 2DDQH 3LYRA 2VM9A 2JI1A 2E27H 3QR0A 3BP6A 2CRMA 2ZX9A 1LK3H 3ARVA 4AGMA 3MLXH 1WAAF 4HT1H 3KPLA 5DK2A 2ZZUT 1D2PA 2DEYX 4I3SL 2PO6B 4ONHB 4EF3A 3W38A 1KZQA 1NFIA 3P73A 3RBSA 4AI7A 4HKJA 3O2DH 2HRGA 5FR3A 5I6MA 3T0EA 1YEFL 5FYKD 3F12B 3AG1B 4J39A 1XCTA 5CAYB 5HYJD 1T89A 2H41A 4M8RA 5DGRA 4FMVA 5E5LA 3GSWA 3K46A 5CZVH 2YAOA 5C0IB 4KMLB 1PZ5A 2VZ1A 1D5BA 4TTGA 4Z0BH 2XA3A 1LO3H 1MUJB 4LP4A 4AUYA 5EF3A 2JIXD 2XWTB 3GHEL 1N4XL 3FOMB 2QR0A 3I02A 4ZOCA 5TE4L 5CR1A 2D3NA 1BREA 4M48H 5B38G 2ICWA 2O1AA 1XMWA 2APSA 1AD0B 1TVDA 1ZA3A 4Q0XH 5E94A 5J3HC 5C3IA 3TT3L 1MPAH 4Q9CA 2VN4A 3SGKC 2WBJB 3F3HA 4OT1L 4PRHE 3IMUA 4G43B 3L2MA 5JNYB 3CXDL 3BT0A 4PRAB 4ODXB 4QEGA 3T1FB 5ACLA 4LGSB 4MDRA 3GXMA 4WU7B 2ZUTA 4TVUA 5C6TH 2G9HB 1A6UL 2PXYD 2H0PA 4V1DA 1FYTA 4FFZH 2D2OA 4LCWE 2PCYA 1HNFA 3NK3A 4JN1H 5AVVB 4F7TA 5E23A 4FS0A 5ERWB 2Q8BH 5I1CH 5JZ7D 3ULVE 5SWSA 2VH5H 4I88A 4FA7B 4P06A 2AK4D 3FQXB 5A2KH 4X4MA 1BFVL 1SMAA 5ABAA 1M2VA 1S46A 4XO4A 3ATAA 4JFHE 3OKMA 3SBQA 3OD3A 1QP1A 3A6CL 2R2HA 4N2BA 3JSSA 2F54B 5FYKH 1P4IL 5I0YA 5DUBA 2CPUA 5T33H 2VDNB 1YY9C 1UJ3A 2XWRA 4GI9A 4LRIA 2ZUQC 1JHLL 5ID1A 3ZRSA 5I17A 4Y19B 2VZVA 3WLBB 3QZBA 5C09E 5K93A 3WEBA 3D3VD 3NABH 2NY6D 4F7PA 1XF4B 3JQOB 3KCPB 4PJAE 1KTRL 3PWVA 1FPTL 1TXKA 2YXWA 1S9XA 3AADB 3RY4A 1XT5A 5I5JA 3SPGA 4NQVB 3WUZA 3M88A 4PJ5E 5C07B 1UKQA 2W65A 1SOQA 1EPFA 4ZPTA 1QRND 4MJ2A 3SYOA 3DJ9A 1IQWL 2VDKH 3C8DA 5AWNL 3ZDXE 1JGUL 4A66A 1E9PB 4Y9BA 4MNGB 3CMOL 4Q56A 3OTTA 2HJFA 5CN3A 3KGSA 3ZL4H 1C08B 1T0NB 3I50L 3LSOA 4GP8B 3UYOD 5CIPH 4JAMB 3G5YB 3MRQA 4XHJD 3PGDB 2A6DB 2C9PA 2IALB 1OM3L 3VFNB 4YHOL 1X5YA 1JBJA 3CH8A 2PMZA 3QJUB 4CSZA 4YSQA 4RNRB 5JHDB 3W82A 5I5MA 1RUQL 5DJ0A 4D9RD 1Z32X 2YK1L 3ARZA 3BWAA 4MA3A 2OZ4H 3IS0X 3WAKA 4LCWD 3LQZA 3VXUE 3MA7B 4APQA 4D9LH 1OOAA 4JBSA 1EJOH 2CLVB 3JWDC 2MMXA 4L9DA 1FH5H 1OF2A 2X7LB 1VERA 2ZG2A 3I6LE 3QWNA 1WBZA 4DPAX 3BI9X 5FYLD 3ULUL 2H0JA 2JKSA 4DZBB 4HFUL 3FQ2A 1NCAL 4E5XA 1RMFH 1S7WB 4HQQL 1I8KA 4N0UA 3W39A 3HZYA 3II2A 4WUUA 4WEMB 4RSYA 3O3DA 2VLRB 2NNRA 2DBLL 4V33A 4YK4B 5ALBL 3HI5L 1QRNA 2CIKB 3FSOA 3PDDA 3GMQA 5GJTL 5B8CA 5JOPE 2DI8A 3PREA 3QUKB 4K3EH 2X88A 3D52A 1A6VL 4M5ZH 1A65A 5CSZA 3FCTB 3QGVA 5I1AA 2QHLA 5C0BB 2YEZA 4UQBA 3DX9A 4QIRA 1U8OB 4X4XA 5IZ7A 3MV8B 1LEGB 2AJVH 1BQ5A 2R9HC 3LH2L 2WXIA 1DJXA 4XCNA 3ISYA 1J12A 1I7UB 2BP8B 2ZX7A 1EZVX 3HPJA 3UTSA 1BVLA 4ZMXA 1A6WH 4ODSL 1T7ZA 3KJ4C 4LASH 4BH8A 5IMLA 4WUKH 4ZOAA 4X6CA 2ODIA 3NAAH 2C3WA 3HN5A 4OVUA 4Y5YB 3MREA 3TA3D 1U93A 2NQ3A 1A4KA 4WU5B 4ZUTB 2AEQL 3FQUB 4F2FA 3CTTA 3ASOB 4KVNL 4MDJA 4X5RA 2CCWA 3C5ZD 1NGQH 2F5BL 2Y0SA 2WCSA 1WFMA 1EGJL 1IO4C 3LZLA 4JUSA 2AABH 4FYQA 4Y4HC 2FB4H 5C0FA 3AT8A 5D2LA 1E27B 3JT2A 2PNDA 4Y19E 1K5NB 4QHLB 3RFZA 1ZVSB 2GHWB 5EBLA 1FNGA 3NRPA 2R2EB 4MYWB 2EQDA 3OC8A 1UB5B 3WS3A 4EIUA 4K5OA 4ZMLA 2J5LB 2XTLA 5K1VA 1TJXA 1NAKH 5MENA 5AEAA 5E4EC 2UXFA 5HGBA 3TM6A 2NPLX 4M7KH 2XXGA 5JMOC 2F7IA 3T0DA 3CHSA 2J43A 5J6GB 3J7HA 1AFVL 3Q5TA 1JJUA 3D18B 4G6AD 1D3CA 1AGFA 2P1YA 3FT4A 3MX0B 4DT2A 2OMUA 3CPLB 3BSZH 3IJYB 4QRBA 1S9VB 3IJEA 1KENH 1M3JA 5F7EL 3L4XA 1WBYB 5D7JC 3WS6A 2HG5B 5EEYA 1RK7A 2NY6B 4FEIA 3WFCL 1ZSHA 2HP4A 4OJCA 4A2FA 5GGUB 1FNAA 3KD4A 4JDTL 2DQCH 3F7VA 4APXA 2HFTA 3V2AR 1J9CT 4S11A 3NJFA 5EUOA 4MQSB 3RWGB 3SQOH 3CZJA 1I7ZA 3ZT6A 2BOLA 2LOEA 4N8VA 3QJHA 3V7AE 4MAYB 1INQA 4L1SA 4NUMA 3IYLW 1QKZL 1E28A 3GJFH 4WQOA 2BRRL 1N7MH 2FBJL 4NQCB 5JHLL 3H0TB 4LSTL 2BZDA 1JZ2A 3GNMH 1XF1A 3FPYA 4W9HC 2A74B 4U7MA 4XPAL 1RZPA 2X6MA 4JO8A 3EFDH 4FJZA 4ODTL 1ZLWK 4E9LA 4Y9EA 4R7DA 4AX3A 3CZEA 5DRXA 5I0DA 4AL8C 5DTFB 4K94L 5DRNB 4P2OD 1CTOA 3O3BA 2NCEA 5KJRH 3QDMB 3MLWL 2BCKB 1YYMH 3ZKSD 1CXEA 3WHE0 1C8QA 4H88H 4ZK8A 3TZVA 3UZEA 5EU3A 3NUKA 4XP9H 1FZKA 4Z1PA 3EKCA 3L81A 1UA6L 3BP7A 4MLIA 4BM7A 1TT6A 2YEQA 1QSEA 5AAMC 5K9OA 2JXMA 4HK0B 4WJ5B 5E4AA 2VLJD 2J8UF 3MOAH 3FTYA 1B4LA 4Y4HA 2J5WA 2DV6A 1CK0L 5K39B 2BIMA 5F8RC 3VGGA 1R33A 4TULL 1ONQA 2ESVD 4LF3A 1NC4D 4XVTL 1OP3K 4X50A 2OL3H 4EEEA 2DQGH 5I6XC 4M7JH 4WI9A 2CXKA 1CGTA 3C6LB 4HUUB 3WNNA 3T6WA 4BRVA 5H35B 4LSVL 4AJYV 4W9IC 3ECBA 3Q48A 4F58L 1R3JB 1HDMA 1QEWA 3GHEH 2XN9D 2OR8A 1YQVL 1NICA 1BM3H 3U0PB 3ULVH 4G11A 4GEIA 3DTXB 2J4WL 1IBZA 2J6EA 2WMPB 5C0ND 2VWEC 4XPTH 1WAPA 3DX6A 5K9JL 1SXSA 3QJFB 2XN1A 2X9ZA 3PIQB 2C3XA 3EDFA 2Z3FA 5C08B 4LIQE 1ZT7B 3GJEB 1IAKB 3RZCC 4H0IA 3W11D 1NCDL 2W07B 2NY3D 1AZZC 2VXUH 3HC3L 1OK0A 3U0WL 4L29A 3CK0L 1Y0LA 2ZPKH 4YLCA 1N26A 4UAOB 1A1NB 1K4DA 2COVD 2VXTL 3MOBL 2B20A 2ITCB 2H0EA 4PLJC 5DZNA 5GS1A 2FEEI 4RIRA 3N40P 4YPJA 1YEHL 4I9XA 5ISZB 1RHHA 5EC2A 1J9QA 1ECYA 1SOKA 4YSAA 1DLHB 5GGTA 3LXAA 3N41B 5DYFA 1QEXA 1LE5A 3OHMB 3SGEH 2Y5QA 3QHTC 3NJLA 1GHFH 1MFAH 1NCBH 4HLZG 5E08H 4E41D 3IT8D 3QW9A 1ID5I 3HMXA 1ORSB 4D0CB 1A9EA 5AOLA 2J1XA 2UX6A 3D4GA 3L4CA 4W4NA 1PW3A 2ATAA 2DTSA 2NTFA 5CEZD 4LKXA 2Z7ZA 2CJSA 3BH4A 2Y3AA 1S7VA 3PFQA 2OKMA 4RZKA 1SHMA 5IFHH 2Y2TA 5TH2B 3VXSD 1F00I 4IGBD 1A9VA 4P9HH 2QDVA 1BLNA 3NESA 4KHXH 4U1HB 5HHPB 4PJ5A 2FSEA 2W9EL 2KPNA 3EOTH 3CCHB 5T3ZE 3D25A 3TA3B 4JFDE 1GYVA 1ML0A 4PVNA 4BFBD 4H0HB 3TONA 2E59A 1IQDB 3A24A 3I9AA 3Q1SL 4JPIB 3SD5A 5IOKA 2ZUVA 4YL9A 1U3YA 1A1OB 5EZLA 5GS3A 2F7QA 2EKSA 2HFFA 2G5RA 2VDQB 4NM8H 5DVPA 3ZU8A 1I82A 3GIZL 4G9FD 5AVTB 3O3UN 5E6IC 5AW9B 3BXNA 4WY7L 3IDIA 4RWHA 5C1MB 3S8GB 2MRYA 2BIHA 3T0EB 1OP4A 5TDPA 1IB5A 4PJCB 3UYRH 4LCVA 4B9FA 2DQEH 3JYBA 3CDYA 3UBHA 4ZTEA 4J3XA 1A4JA 2NCMA 5F1NB 4PWGA 3ZZ1A 3X12B 5BOZG 2B39A 2Y2YA 1PQZB 3BKYL 3ET9F 3KXFE 1HE8A 5DLLA 2JJUA 4CVXB 1TSHA 1N59B 1NC2B 4I8DA 4FKEA 4M6MH 1XIWD 3B2UD 4D9LL 3K71B 1FBIH 3APMA 4KDWA 5ICYA 2Y6TE 1GSKA 3KDPB 4K3EL 4YPGA 1MHHA 1KCUL 3AG2B 5JIQA 2Q87A 1EJ6A 3KS0H 3ZZLA 3O6FD 2AJXL 2EYRA 3KYMB 3N1PC 1DQDH 5TQ0L 2J88H 3SKUD 3V0IA 3IXAA 4RMQA 5DI8A 2DWDB 4HUMB 4MFHA 2OMWA 5T1MB 3BPLC 2B8OT 1DVFC 1MAJA 1EEYB 4JZJC 4TF4A 5T1DL 1FVEB 5I6NA 3ZXAC 1ZGLM 2MJWA 3CG8A 3AM8A 5JLZA 3V5HB 3QJQB 2CPCA 3SE3C 3U7YH 4WW2F 1Y6KR 4OQTA 2WKLA 2JB6B 4MMYA 5C70A 5HYSA 3OZ9H 5K5YA 1TJHL 5GS0L 3L54A 4Y9CA 1QAWA 3L3GA 4GUPB 2ZXEB 1YJDC 3P73B 1GZHC 3TNNA 1CFQA 3IJSA 5EU4A 1CL7I 1UKTA 1UFGA 3UAJC 4U3SA 2JCCB 4NLAA 5IT2L 4KO5A 2VJ8A 1FO0L 1F2XK 2W92A 3TJEH 3B9VA 2VDLH 3F12A 1NKOA 3QHFL 2CNZA 4NGHH 1H6EA 5SV3A 5BV7H 2R56L 4WW2B 4R7XA 3VO0A 1UUNA 2ZUUA 2ZNXA 4G2AA 2GJ6E 4KKQA 5FFOA 3WYRA 1FGVH 5BZWB 3H1ZA 4JPWH 2VISA 2F7RA 2QR0B 2E47A 3WIIL 2GEQA 4FX5A 2MOQA 3K4DA 5C08D 1RK1B 4UANA 2QZQA 5E94B 4HV8B 5CF3A 2V3FA 3M17B 4L18A 4YR6A 1KGWA 2WNGA 1MIMH 4K3HA 2BMKB 5FYJD 3VD3A 1UJTA 4FI7A 5DD6B 1I1AC 2W65B 4NAQA 3ZE0E 5FYJU 4I9WE 5EUKB 4LCIH 2JQAA 2QVFB 1N0XH 1P5UA 2GSGA 4S1DC 1DJSA 2DI9A 1J86A 4YDLC 4PTTB 5ERWA 2HX9A 1CL7L 1OCWH 3CH1A 5HDLA 3R8BB 4L3ED 5JA9A 1JZ3A 1JFHA 1ZANH 3QUXC 3RUGE 4BK4A 4ES8A 2OX5A 5EIVA 3WL9B 2YGQA 4GKZA 3NT0A 4V11A 3X3GL 1EDYA 5HPMA 2XBDA 3FTSA 3ULVD 4JVWA 4RBPK 4MD0A 1TJIL 3SE3A 1I4FB 4GAYB 4HKJB 2ROXA 1DQJA 1RUPL 1HI6A 1XSIA 5IB3A 3RTQB 3U46A 1J1PH 4OUUA 1XCWA 5IEHB 1ACXA 1S5IH 1IM9A 4HPYH 3BWSA 5J1TC 3OX8B 4K7PL 5D7SH 3C2SA 3SEPA 4L37A 3POCA 1MUJA 4TVPD 1BMGA 1PJ9A 2XWTA 3U36A 3MBEB 3H56A 3VSUA 3MC0A 4HWZB 1WUNT 4JPSA 3DROB 5J1AA 1F13A 4G6AC 5I2IA 4U31A 1ZA6B 2EDTA 4K4KA 2P7TA 4DCQA 2JELH 3ZKXB 4X8XA 4OF6A 2FEDD 1QR1B 1K72A 1RZ7H 1MFCL 1G9EA 3MJ7A 2W94A 3L7EB 1NOFA 5C08E 1FFNB 3WCYA 5JXEC 3MV9E 2CRYA 1CCZA 3WXVL 5I1IL 3FQWA 2G9HA 2HT3C 1CD9B 1KYOJ 2KMWA 2VDLB 2OFQA 3N91A 4ATTA 2VUYA 3BP6B 4NLHA 2OYPA 2HMID 1T1WA 1KPRB 1PY9A 4HS3B 4Y1AE 3NRFA 2BVPA 4JFXA 3RWCA 3P3YA 1H6FA 1IRAY 1RZJH 5JHDA 4FQIL 5GIRB 2P8MB 5DJ0B 1E9QB 3IPEA 1WTGT 4ZUWB 5FW6A 5D5ME 2ZAIA 3TVMA 5DMIH 1KACB 1MJ7H 1V5JA 1M2VB 1MWAL 3QNXB 1CJYA 4XWGH 4HT1L 1ZD6A 1R34A 3FSVA 4CVUA 2E86A 4X9BA 1KJ3L 2JJSC 4C58B 2VR5A 1WFIA 4M3JA 2O93L 3OHXA 1OO2A 1XBDA 2HSIA 3CN2A 4Y16C 3MUGB 4AEEA 1I8LC 1J8HE 1YQ2A 2VCOA 2W81C 4LAJH 4MVBC 5C0FB 3EO9L 1WLHA 4M5YH 1N5AB 1U95A 3G5WA 4FN0A 3L4UA 3V0HA 3LVTA 5AB2A 1FAIL 1X7TA 3I6LD 5EWIL 2Y7SA 1UT2A 3IDYC 4BSVB 2VABA 1NMAH 5EOQH 2XRAH 3QCUL 5D93B 3TN0A 2H7WA 2P5WB 4ZJ9A 2IH1B 2OJ1A 4YWGL 5IREA 1DR9A 1HZHL 2VN3A 4IRZL 3ULSA 5I30L 5JOPD 4IOFC 3S8FB 2ARJQ 1VIWA 2ENJA 5JIIA 3FT4B 5GISH 3WMSA 5HHOE 1J5DA 4ZODA 4OZGB 2GVYA 1JK9A 1OD9A 1IC1A 4V1DB 2D7MA 3CJJA 5FDWA 3MNDA 1G0DA 5FX3A 3O4LA 4MKMA 4JY6B 3O0LA 3OQRA 4KROC 3X1BA 2QL1A 2KZKA 2CA3A 2FWSA 2IALA 3F7VB 4XPAH 1QX1A 4ZD3L 3SDDA 3ILPB 1JV2B 1UEMA 4WHTA 5D2LE 2AFNA 3MREB 5BRZD 4QLRA 1JAEA 3EG9B 4XWGL 1EAQA 4NQDB 4Y9GA 1MCWW 1OHZA 2J73A 4MJ4A 3UZQB 1J1XH 4OCLC 1J10A 3MLWH 1J9TA 3O2WH 4TV3A 4WSJA 1FRGL 3K80A 5F2FA 3TYGL 2ZOKB 1J0ZA 5B3JE 3HRZB 5GGRA 5IFAL 2G9KA 1F41A 5A2BA 3ZMNA 3UYRL 2B1AL 4NAJA 4J3TA 2X7LA 1K2DA 1NIEA 2Q1EA 3T6XA 3MLVH 4Y5YC 3I9GL 5I17B 1OCZB 3RRQA 4AZ8A 1NKRA 1UXWB 4GRLD 1FC1A 1PNCA 2IG2L 4JS7A 2D4DA 3L1OH 1PTZA 1UD6A 4GG8B 1VFBA 1ASOA 3KCPA 3N0AA 5ALCL 3BYYA 5F7NC 5TGBB 5JIMA 2CWRA 4KKBC 5EBMA 1KFAH 2F1EA 2XPYA 4UYQA 5C0CA 4F93B 2BP0B 2D7TL 4GRWB 5IB2A 1T7XA 2J8UA 1AR1C 2XDHA 5HGDB 4N2HA 5CP3H 3EYOB 3TBYA 5C2BH 3T0VA 5HTSA 3RVTD 2YGNA 3UZVA 3SDXB 1ZDSA 3MJGX 4ZMWA 3EYSL 4CC4A 4PJXE 1ES0A 3ALWA 5ICXB 2YN3A 2OMUB 4DKAA 3QJVB 5MI0C 4Y5XC 3ECBB 4C4UA 2Y7OA 1SYSA 5ES4B 3UERA 1XGYH 3HBQA 4PRIA 4UQ2B 4WI3A 2J5LC 4R8WH 2DL2A 3BD4A 1LEIB 2BSCA 5FOJA 2A6KB 3QUYC 3HLAB 3HC3H 1B3IA 2V6HA 4IIZA 3UAEA 2CSPA 3MV11 1GOGA 1I1CA 5A6LA 4RFEB 3U2JA 3OJDA 4YGVB 1CICD 1Z5LB 2X4UA 4G1MA 5D7IA 5D96C 4DEPB 4PV9B 3FU7B 1KC5L 1MREH 4GW1A 1PYWB 1U8MA 4JO1H 5EUOF 2PPCA 1A3ZA 3NSJA 4AIZA 1RIVH 4XP1H 4NQCA 3EO0B 5F6HI 3PAUA 1L6ZA 3LD8B 2G60H 2EYSA 4R7LA 5D7IF 2PCFA 5JORA 3NIFB 3CFEA 1T0MB 2XQYA 5ALCH 4QD2E 5TQ2L 5BOJA 4A7QA 2H9GA 5AYUL 4MAYC 4AQ1C 4YE4H 2ZAGA 1WP6A 5D4QA 2GTWA 3IFNL 1UM6L 4TUKL 3WN5C 1ILUA 1LGVA 2OL3B 3BAYA 3VSVA 2XFXA 1O7VA 4Z7WA 4KMTL 3LDBC 1D2OA 2WNWA 3U4BL 4X5QA 4RX4D 4A6YB 2O5XH 2DWEA 1MRDL 1C5CL 5JW4Q 1IKOP 1W6LA 5B8CB 3FFDB 1BA9A 5IG7A 3M8OL 2Z1PA 5DF0A 5KYXB 5HDOA 2BW4A 4GSQA 4GQPH 3ZJAA 5LLIC 1PJWA 3S34L 2WVVB 2I9TB 2B9BA 2WCGA 2V5MA 3RGVC 2PLTA 3LEXB 2NXZB 2XWXA 2VL5B 5KBKA 4M1CD 3MX0A 2EICA 2WB1A 3V0JA 2X4OA 2BS71 2D9QB 1MDTA 4LPXA 3WY2A 3BQUA 3CWGA 3NPSB 5CXPA 3VWJA 4UQ3B 1ODUA 5C7ZA 5I8OL 4PRID 2L8AA 1KLUA 2H26A 1I9IL 4HIIB 4G7SB 2Y1YA 3X17A 4BGDA 4XNXH 3WTUA 4N90D 4X6CE 5MHSE 1EHNA 2VN5A