3KW8A

Two-domain laccase from streptomyces coelicolor at 2.3 a resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
273
Chain Sequence
GGEVRHLKMYAEKLADGQMGYGFEKGKASVPGPLIEVNEGDTLHIEFTNTMDVRASLHVHGLDYEISSDGTAMNKSDVEPGGTRTYTWRTHKPGRRDDGTWRPGSAGYWHYHDHVVGTEHGTGGIRNGLYGPVIVRRKGDVLPDATHTIVFNDMTINNRKPHTGPDFEATVGDRVEIVMITHGEYYHTFHMHGHRWADNRTGILTGPDDPSRVIDNKITGPADSFGFQIIAGEGVGAGAWMYHCHVQSHSDMGMVGLFLVKKPDGTIPGYEPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative copper oxidase
publication title Structure of laccase from Streptomyces coelicolor after soaking with potassium hexacyanoferrate and at an improved resolution of 2.3 A
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 83
structure length 273
sequence length 273
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3kw8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3kw8A02
2CUAA 3X2QB 1NIBA 3NJIA 3FS9A 2GC4C 2GIMA 2EIJB 2X87A 3HEIB 4NAJA 4MFHA 4EF3A 2XYBA 1JVLA 4E9XA 2IDTA 4BDVA 3FYEB 3WKQA 1OCZB 4F2EA 4G7QB 3EH3B 1GY1A 3OM3B 4E9WA 2EILB 1GYCA 2NRDA 4GP4B 5I6KA 1W6WA 2VMJA 1KYAA 2X88A 1JZHA 1N68A 1FFTB 1B3IA 1RZPA 1NZRA 5I26A 2WO3B 4HHWA 5TK2A 1SF3A 1AZUA 1DYZA 3EH5B 3QJVB 2PCFA 1CUOA 5B3SB 4W1TA 2XXGA 1JZEA 1PLCA 3WI9A 2BP0A 2YAQA 1ETJA 3T6WA 1PZBA 3TA4D 2PP8A 4YSPA 1QNIA 4A2FA 1CYWA 1NIDA 1HAWA 2VW4A 4Q8BA 4WTQA 4AI7A 1MDAA 2CAKA 1NINA 7PAZA 1ZDSA 4NB7A 2VW7A 3N2JA 3S3BB 1BYPA 1IBZA 4G70B 3NYKA 2BP8B 3AW5A 3FU7B 3L45A 3ZX1A 1V55B 1OCRB 1BXUA 2GSMB 2DYRB 1GY2A 1J9TA 2PCYA 2YQBA 1EHKB 1PMYA 5PAZA 4DPCX 1J5DA 2UXTA 3ABKB 1IUZA 1BQ5A 1JZGA 3IN2A 3MBWB 4P5RA 2VM3A 3TU6A 2HRGA 4G72B 4M3HA 1NWPA 2PPEA 2HLEB 2PP9A 4HIPA 3QPKA 2HRHA 4GP8B 4DPBX 1KDIA 3ASNB 1ZV2A 1ZDQA 3PAVA 1BQRA 1OE3A 2Q5BA 1E67A 2FWLB 2QT6A 3FU8A 5E9NA 4DP8X 5I6LA 3BQVA 4A2EA 3FSZA 5D4IA 2VN3A 4ENZA 4DP9X 2GI0A 2FQFA 4E9QA 4A67A 2N0MA 2I85A 3NSFA 4JKNA 2EINB 1QLEB 3X1FA 5EHFA 2MTAA 3WKPA 2BP0B 1L9TA 4W9ZA 3NSDA 4DP6X 3T9WA 1SFHA 3NJFA 1M56B 4YSDA 3FQYA 4A2GA 2XV3A 2YAFA 4HCFA 2Y69B 1KBWA 3H4FA 3HB3B 2PPAA 4DP1X 3S8FB 2DYSB 3DIVA 4UAHA 1E5YA 3SQRA 1MZYA 1OCOB 1GR7A 1QHQA 2I7OA 1A4AA 3QQXA 1ADWA 2IDSA 3OQRA 4YSQA 3CDZB 1SF5A 2ZXWB 3IBOA 1ILSA 2FT8A 2YXWA 1SDDB 2BP8A 5I5MA 2FQGA 3FU7A 1XB6A 3NP4A 3FQ2A 4F7KA 2UXGA 2ZWNA 5IY5B 4YSAA 5D4JA 3AZUA 4HCGA 2JXMA 2XVBA 4ZK8A 1NIFA 2UXFA 2VSMB 4GXFA 5FC9A 3CG8A 3UACA 3UADA 3UAEA 4DP0X 5AKRA 4A2DA 1MG3C 5B1KA 3FPXA 3ASOB 2YAPA 4YSTA 2B3IA 3PAZA 5PCYA 1DZ0A 2H47C 1AZRA 3PAUA 1PZAA 4K9JA 3GDCA 4YSOA 1N70A 2TSBA 2P80D 3T6ZA 2FQEA 5B1BB 1PNDA 2HX9A 1SHXA 5I6PA 4A2HA 3FQ1A 3QJQB 5AFAA 1T5KA 1V54B 1AG0A 4HHGA 2GHZA 4Q89A 1UATA 1WS8A 2E86A 4GYBA 4YSUA 2XUWA 4GY4A 1JXFA 1BQKA 1JOIA 1URIA 4P5SA 4YL4A 2FQDA 1NIAA 3PPSA 1AZCA 2RACA 2J57A 1AR1B 1OCCB 3GXUB 3OMNB 2IDQA 4KO6A 4PAZA 1OE1A 5A7EA 1HFUA 2OJ1A 4BWTA 1ILUA 3QJUB 2XWZA 4AKQA 1J9RA 2BW5A 1W6LA 3T6XA 5F7AA 2YAEA 3AY2A 2W88A 3CDZA 3FPYA 1X9UA 4KNTA 1AOZA 2QPEB 2GC7C 1SDDA 2BWIA 3G5WA 3IE9A 4KOBA 1NIEA 1SHWA 2FNWA 2VW6A 4AKOA 2UXVA 1CYXA 3WNJA 2AZAA 1JERA 1YLBB 1CC3A 5B7MA 1GS8A 3QJRB 5B1JA 3BVDB 4YSEA 2IWKA 1JVOA 4AX3A 2UX7A 3NT0A 4E9YA 4JHUA 4KNUA 1AZNA 2HZHA 2W8CA 1E65A 4M4RB 4CSZA 1JZIA 2CJ3A 3NP3A 4GP5B 2WSDA 1MZZA 3GYRA 3AG2B 3S3CB 4BK5C 3NJHA 3UABA 4G71B 2BHFA 3T71A 1HAUA 3DKHA 1J5CA 3V9CA 3EF4A 2XX1A 2P80A 2DV6A 3PLYA 3SBRA 1PF3A 2HXAA 1M9WA 4YVNA 4UANA 1ASOA 2IH8A 3FSWA 3CVDA 1A4CA 1MG2C 4TXVB 2GB2A 2IAAC 2OCCB 4KO7A 1GW0A 1WAEA 3MX0B 4E9SA 3KW8A 4WKXA 2MRYA 1IC0A 9PCYA 4HZ1A 5I6MA 1KDJA 1L9OA 3NJGA 2TSAA 3TASA 2YXVA 1L9PA 4BXVA 4QKTA 1AIZA 3QJTB 2IDUA 1OF0A 1PLBA 2YAHA 1ET5A 3OD3A 4KOCA 4BXSV 1PY0A 1ZIAA 1OV8A 1KBVA 2BWDA 1J9SA 1L9QA 2WO2B 1FWXA 1SNRA 1A4BA 1ASQA 3EHBB 3S3DB 1KV7A 1A3ZA 2B08A 2YARA 4KNSA 4RH4A 1X9RA 3FSAA 4E9RA 3U25A 1WS7A 2YAMA 1ZPUA 4YSSA 1TEGA 1AZBA 3ABLB 2FTAA 1JZJA 3ABGA 3ERXA 4F2FA 1GSKA 2CCWA 1OE2A 5B7EA 2J56A 1ZIBA 3ZDWA 3DTUB 3UAAA 1SJMA 1JXGA 2R7EA 2IWEA 3ZIYA 4HAKA 5TK4A 2AANA 1PNCA 3FYIB 1TKWA 6PCYA 1TU2A 1AS7A 2Q9OA 3FSVA 1BYOA 4DPAX 2A3TA 3S8GB 4DP4X 1NPNA 3WIAA 3CVCA 4KO5A 1I53A 4AKPA 1R1CA 1NDTA 3AG4B 4A66A 3CZUB 4X4KA 3SBQA 3SBPA 3TBCA 4BWUA 1SFDA 2ZOOA 1BXVA 4YVUA 2BO0A 1E5ZA 2BZCA 3AG3B 2XLLA 2XXFA 2LLNA 1VLXA 2OV0A 4YSRA 3NJNA 1KGYE 1KCBA 3OMAB 4BWWA 1NTDA 1BEXA 2GBAA 2FJSA 2JFCA 3X1GA 2H3XC 3NSCA 3JTBA 1AS8A 1J9QA 2FT6A 1ASPA 1PAZA 1AAJA 1KCWA 1W8EA 1RKRA 1AACA 2PPDA 1IBYA 2EIKB 2ZONA 5B7FA 3X1NA 1WA0X 5F7BA 1AQ8A 1XMEB 2QDWA 4N4YB 4E9TA 1A8ZA 1PLAA 4G7SB 1A65A 2BZ7A 2VM4A 1CURA 2VSKB 1M57B 3CVBA 2QDVA 2R7EB 1NPJA 2FT7A 1RZQA 2EIMB 2XU9A 3FU9A 1JXDA 3NJJA 1RCYA 5LDUA 5B1JC 2PPCA 3EH4B 6PAZA 3PCYA 2DWTA 3T6VA 2CALA 3OMIB 4QLWA 8PAZA 4DP7X 2PP7A 1FA4A 1L9RA 1XB8A 2HX7A 1F56A 3D12B 2H5UA 2J55A 3NSYA 4BDVB 5AZUA 1ID2A 2J5WA 2IWFA 3QJSB 1E30A 2XV2A 1AG6A 4A68A 1GS7A 3N55A 5D4HA 1PCSA 5I28A 2I7SA 2JKWA 5B1AB 2XX0A 3C75A 4DP5X 5I5JA 4FAAB 4AZUA 2DY2A 3FT0A 1L9SA 2AZUA 3JT2A 3KW7A 4FA7B 3UGEA 3H56A 4E9VA 3AG1B 2AVFA 2Y1AA 3TBBA 5ANHA 1ET8A 4L0PB 1XB3A 3V9EA 3WNIA 4YSCA 1WA2X 4HCIA 3X1BA 1GS6X 1NWOA 1AANA 3PXLA 4CSPA 1EZLA 1JZFA 2QPDB 3ABMB 4N8UA 1V10A 3NJKA 7PCYA 2PLTA 4NERA 5I5IA 1ET7A 1IKOP 2PPFA 4HALA 5I6NA 1NICA 5I6OA 1BAWA 3NJMA 2DWSA 1WA1X 3IN0A 1PZCA 1TEFA 2UX6A 3WG7B 2HX8A 2CBPA 2AFNA 3IEAA 3ZBMA 2IDFA 4PCYA 2BW4A 2XV0A 1BXAA 4KO9A 4UF7C 3X1EA 2YAOA 4JHVA 3NJLA 2IH9A 1AS6A 4G7RB 3H4HA 1OOWA 3RYMA 4DP2X
chains in the Genus database with same CATH superfamily
3X2QB 3MJ6A 4HLJA 3GNML 4POUB 3LVTA 3K6SB 1JCKA 1L0PA 4A7SA 4BFRA 5KVFL 2O93L 3ARBD 4UYQA 2RBLA 3GMLA 4E9XA 5TDOB 5E4AA 4U6XB 3QAQA 2JVUA 1SEBB 3SDAD 2ZWKA 4G7QB 4YDLC 5CEXB 2I60L 2VC2B 2NTFA 4IGBA 4WUUB 3W11C 4HGMA 1ZLVH 4C4BA 5C0GB 4G80A 4GMTL 3N44B 4JO3L 1FE8L 2WINB 1CFTB 1HNYA 4PRPB 3O9WA 4MGXA 5FYKE 4TQHA 2WO3B 1NGXA 4Y2DB 3E3QC 4NPYA 1OF2B 2EIEA 3CSFA 2R23B 4R3SB 5BZWB 3WENA 4NOFA 2FIRT 3R1GL 4G5ZH 2NNRA 4HUUA 1D6VL 2YMXL 4LEBA 1PZBA 4Q58C 1VFBA 1XSIA 1K4DB 3VXMA 4UTAA 3FO9A 1CYWA 3MV01 4HHAB 1QASA 1TJHL 5DMKB 4L4TB 5FYLH 2IG2H 3ILPA 1HHKA 1XD0A 2DQJL 1PZ2A 4LCYB 3TTYA 3WLWD 1CGWA 2K8QA 3MLYL 1VPOL 4BRVA 3D1MC 1MDAA 1GKOA 2GT9B 1TVBA 3T3ME 1ZWIA 1CTOA 2CK2A 3OKYA 4FFVD 1S5IL 3B9KC 2ZG3A 4A37A 3GHEH 4XVJL 4FA8A 2ZCKL 3L45A 5DJZB 3B7YA 4M8QA 3TVMD 5CM1A 4KH2A 3NRQA 1RPKA 4R84A 2E76C 5IJBC 5LLIC 2WCPA 2BRRH 4JMXA 3UTQB 4H7VA 3K1DA 1OVZA 3FU6A 4PVLA 3GJEB 4U1SB 4F7CB 4KRPC 1PMYA 1WBYB 2GTWB 3CJJA 3LHPH 1D5XB 4WTXA 2WTRB 4XOBA 1WBXA 4KI5C 4YDIH 2O6PA 4WUUE 4IRJA 1KB5B 2PPEA 5DD3L 2XXMB 4BUGA 2X44D 3D08A 1A6VH 1WFUA 1ZV2A 2DQCH 2IOMA 1OAXL 3H9YA 5A6IA 4L1BA 3TH3T 2GJZB 4QR7A 5JIDA 4XCFL 2IF7A 4X7EC 5E9NA 4DP8X 1A1MB 1CDIA 3HS0B 3O2DL 4XWGH 1QLFA 4F7PA 1EAJA 3QWOA 2PTTB 3ULUC 2FQFA 4F37F 3QT2A 4O02H 4YXHL 2NY2D 2EEFA 4BA0A 5DWPA 1ZA6B 4YO0B 1MUJA 1L9TA 1VADA 4UUJA 2MQ3A 5BCAA 2Z31D 1I9IL 1PBYA 4L4TE 4TL4A 5DDHA 2OXHB 2UY7A 3G5ZA 5SWZE 3ROLA 2W91A 1TEYA 3E2HB 2IAMD 2G2NA 1VJSA 4LQFL 1BFSA 1KBWA 4N0YL 5JOPE 3QR0A 4ISVB 5DJAA 1HSAB 4JY6A 1UFUA 2Q2EB 3FOLB 1ADWA 3JZ7A 3OQRA 3QUHA 4RFNB 3V6ZB 1FNSL 4JPIB 3I6KB 3QUXB 3B2UC 1HH6A 1ECYA 5AVTB 3CZFA 1EEZA 4GBXB 1WPCA 1NAMH 5ALCL 3ZXAC 3S48A 1W72L 1MIEH 2WQXA 4TNVK 5CMAA 5D8JH 5C07D 1HZHL 5JOEA 5C0BD 1NMAH 4OVUA 3F04A 1E2ZA 1G94A 2AXJA 4FKKA 2C26A 5DK2A 4LSTL 4OIBA 3SY0B 3ZRCC 4CVXB 3X13B 1VKXA 5AKRA 3KPQA 4XNQA 3U6XA 2D2CC 2XVKA 1X5FA 5F9JA 4YSTA 1EJFA 4MA3A 2OFQA 1EZSA 1XGPA 3FUHA 1JV2A 4CC4A 4PTTB 3ARXA 3SY6A 1FZJB 3BZFB 1HL8A 2YLHA 1ID5I 1C1EL 4EXPX 4UILL 1KIRA 3CN1A 3AWGA 1I3RB 2H1LM 2X6BA 1TVHA 5L4FA 1WHPA 1CB4A 4BFKA 5TDPA 5JPNC 4GRWB 2CXGA 3QQ4B 4GT7A 4AIEA 4PBWD 4GY4A 4WV1B 1P9MA 1JOIA 2DQGH 4Y4HC 1URIA 1JPSL 3APDA 3W0WA 1NM4A 3KLAB 4EJ1C 4B9PA 3UMTA 3PPSA 1MCFA 4QO1B 2CRYA 2DQMA 3BP5B 3DUUA 2YD8A 3HZYB 5EBLA 3SB3A 3WFBH 2IDQA 4KO6A 4RISL 5DUPL 2OJ1A 3HG4A 4BWTA 4U2ZA 1TSRA 1BZ9B 4CVZA 1CL7L 1VCAA 3NCMA 3HRZC 4X4ME 1MRFL 1CFVL 2FAUA 3P3YA 4D9LH 3FPYA 4XP9H 3VSTA 3GXNA 1T03H 1J8HD 3RHWK 4FXTA 1YEJH 1YJDL 2VDLH 1LE5A 5GSVA 5MENB 4Z8FH 2FBJH 2NY4B 2ZQKA 1UH3A 4K8RL 1IJNA 1WUZA 1ZLVK 2F7QA 1T1XB 1SJHA 5EO1A 2CLZA 5JLZA 4WW2C 3VGDA 4Z76A 2A4CA 1YYLH 1ZS2A 2A73B 3A6CL 4I0CC 4LL9A 5H94A 3THML 3S97C 4X6EB 5T5FL 1PDKA 4K9EH 1TZIB 5HDQL 4KRNA 3QXDA 4X6CE 5CLZA 4RCAA 2JMRA 3P3TA 4NBXB 3RGVC 4LESA 3ESVF 1YMME 2XA8H 3JYBA 2ATKA 4HZLA 2V2XA 3S8WA 5BV7H 5AOMA 4P57B 1Y07A 4GRWE 3Q01A 1F4AA 2EIZB 3LKPA 4N8VA 3VD7A 4E42A 4PB9H 4NQED 2IANB 1XAKA 3HG1E 5LGYA 2FEEI 3T0DA 3MGAA 2Q8BL 1F11A 1G6RA 2HVKA 1LK2B 5KYUB 3Q8CA 4MHHI 3GSNL 2NW2A 3M1OA 1ZEAL 4C56D 3D85B 3FTSA 4NUGH 4WW1B 5KSAD 3EDEA 4MBRA 3K5SA 1OM9A 3MX0B 5D1ZI 4XAWH 3GO1H 1EFQA 4XWOD 5IQLA 3RVVD 2QBWA 3EGXA 2O6CA 4ZUVA 3L3HB 1MXGA 1JV5B 2ZX6A 3EDDA 2M8XA 1X5MA 3VXOA 5C2BH 4MAZA 1BSIA 1NCDL 3NESA 1KXTB 4ICXA 4ONHB 5SWSD 3F7QA 2GABA 4Q14A 1BJ1J 1DQQB 3LV3B 5GRYA 3US9A 2X28A 5CO1A 3RGBA 3ZE2F 1D5RA 2J1XA 3AAZA 4UQEA 3EHBB 2AC0A 2VZ3A 3MCKA 2YARA 3DURA 1FFNB 2MTPA 2MH4A 3MA7A 4AG4H 2OP4L 4E9RA 3IXAA 3FO2A 3RWIB 5CLTA 2ZNXA 2WKGA 4LBEB 2OCJA 3E1ZA 3UERA 3T08A 3BRGC 1RVFH 1DBML 3BW9A 5K39B 3MGTA 4P5MA 1JF5A 2OTUA 5HVFB 5IMKA 5L4IA 4N86A 2CGZA 1CFQA 1OE2A 2RCSH 1N6UA 2IANE 5T1JA 5E95B 4ZYKA 4LRNH 2VH5L 5IP4A 1SJMA 1YJDC 3BUIA 1RZFH 4G6JH 4JM2C 5F88A 3I84A 4A6YA 4BKTC 3IK2A 3LXUX 4K8RC 4EN3A 1A6UL 4AK2A 4JY5H 4Y1AD 1DVFD 2QVFB 4WTWA 2K4AA 5BW7C 1XWVA 3MLZH 2A3TA 3LH9A 4PVNA 4TNFA 1BMWA 5FXCH 1MCOL 1PG7W 1S9VB 3BCDA 3QWNA 4HA1A 4BD4A 4JFWA 1JYNA 3O6FD 1SLWA 3R4RA 3RVUC 3NIDB 3ZJAA 1QSZA 5D7JB 4GRMB 4K23L 5FO8A 4LSUH 4BFNA 4N5ED 2NQDA 4NP9A 4DETA 5HPMA 1A14L 1C5CL 4R90L 3IJEB 3A3YB 4LLVB 5CU5A 5E8NA 2JKIS 4DKFL 5I1AA 5JIIA 4IEFB 4JS7A 4KAQL 1TQTA 1IAIL 4DOHB 1CCZA 1XGTB 2HB0A 3FT2A 4YBLC 3UIZA 4XOEA 3QUZD 2GAZA 1T66C 2QR0A 4QRRB 1E40A 2WVSA 4P06A 3OKNB 3OSVA 2WBXA 1JGDA 2QFPA 2MQGA 3GF8A 5IB5B 4DKDC 1IKFH 3H2PA 1S7XB 3F12A 5I8EB 4NUJA 4K3HA 4KDVA 1H6EA 2Y0SA 4GEIA 5B7FA 1ODAA 3T2NH 4TRPL 5C7ZA 1AQ8A 1P6AB 4FQ1H 5D1ZD 1F58L 2DIAA 1M2VA 5ESQA 1MH5A 4G7SB 3SYOA 4JPVH 2HKHL 4LB8A 4YDLB 1MF2L 2FT7A 2J2ZB 3WMPA 1NEZG 1NDMB 5LDUA 5C0RL 5I73B 3KYOB 3EH4B 3KXFB 4MQXC 4L05A 1XIWA 2EJ1A 3O3EA 2PTUA 1HHHB 5T1LD 5MP6L 5I1DB 4QLWA 2XPYA 2HRPL 4G7VH 3NIDE 2Y7QB 1EZUA 5GZNA 1KYDA 4XCEB 3K1KC 5I30L 1HEJC 5B21A 2HUHA 2YGNA 3M17A 1UB5A 2FECL 3PV6A 2XX0A 1E4XH 4GLRI 4X8JA 3D39A 1Z9SA 1JUFB 1L9SA 4YK4C 1KTJA 2AZUA 4DOHE 3IT8D 1EAPA 2WUBL 5I2IA 5LKNA 2DQEH 2FEDD 3LZFH 4PB0H 1U8HB 5A3IC 1XL6A 2EYSA 1Q0YL 3JV6B 5FYKD 4Z7QB 3BVWA 3D18B 4GXUM 3MNWA 3P40A 3HJ0A 4PGCB 1KN4H 1A9BB 2H0FA 1HX0A 1ZA3A 2WYTA 4GUCA 1FGNL 3B9KB 3NCEB 4JR9L 1AGDA 4TV3A 2UVFA 1AD0A 1PKQB 2C4XA 4TUJB 3VSUA 4WHTA 3GJFB 5H35B 4M6OH 2E6JA 5C97A 5JOFA 2QELA 4IU2A 1HHJA 2Y3NA 5D1XB 3L3JB 2J88H 3P9MA 5D93B 4OI7A 4XO4A 2DWSA 5E23A 1EZVY 4KRPB 2UX6A 4N2IA 5IHUH 1FO0H 4DGIL 3PGCA 4F7TA 3TNMB 1DTUA 5BVJB 1AHMA 4BFGA 4Z7WB 1FZKA 1FBIL 5C09A 1EDQA 4YR6A 3RWHA 3KXFE 1V3MA 4EKJA 1DDHB 2VERN 2EABA 2IH9A 4NRXA 3WIHL 4PJ9B 2JKRM 4CC1A 2DLFH 4UOW1 3OPUA 3U1SH 3MBEC 1HTYA 3IFNL 5D7SH 4PJAB 3QUYA 2GC4C 2IIJA 2VXTH 5JPMA 1K6QL 4HDIB 2J8HA 3RTQC 2IADB 3C6SA 2HT2C 2FYVA 1MFCH 2IDCA 4P2AA 5F93C 4WUUD 5FOBA 4DZBB 4F33A 3RWJA 1ESOA 4LIQH 1KYOK 3F5WB 1LNUB 3OM3B 4YH6A 3Q5OA 1Q38A 5I18L 4HBQA 2D7QA 2DDQL 1UXMA 5J12C 3LEXB 1RZPA 5HGAA 5HDLA 4R5XA 5KJRH 1OAQL 1R5WA 4V33A 3PJLA 3G5YA 1KTKE 5JHBA 2OW6A 4AEIH 5BUGA 1PKQE 3EZ8A 3O4OC 4YMPA 4MDIA 2MWCA 4RWYL 4YXLL 5A6MA 4MJIA 4AITA 3ZDXF 3TEZA 4LDOB 5D1XE 3EH1A 2X2IA 4ETYA 2OSYA 4L3CB 4DGYH 1D5BB 1UD3A 4L4TD 1R0AH 4ZD3L 4M7LL 4KJWD 4FCHA 5SWZD 1T1YA 2CIKB 3SD5A 3F3HA 4OLWH 4MQ7B 5DMIL 3QCUL 4UDTB 4BKLB 4WJ5B 1BZ7B 2VUYA 3VXPA 5JOPD 3I50H 4UDUB 3V4UH 1E9QB 4FLOA 5I16B 3V8CA 1NINA 2G2PA 2QQNH 4IOFC 4LLMB 3CXFA 4ELMF 3LRHA 3QO1B 4Y7OC 2EO9A 3QQ9C 3TX4A 3UTTA 4X5PA 2VXSH 3EAKA 4JQIA 4ZMAT 2B1HL 4PJAE 4LKCA 3QCTL 5FYJU 4G1MA 1MNUH 4PJDB 4EQ3A 1T0PB 4XNZC 1Y0LA 4G3YH 5KVFE 1KLFA 1KXVC 2Q7YA 5FKAA 2FATH 3WUWG 2ZCLL 1CDYA 1HIMH 3QBTB 1FAKT 3ECUA 1U8MB 2B1AH 2Y5TA 5LCVL 3MBWB 1M6UA 5JPNB 2W0PA 4NQUA 1QFUL 4UV7H 3FSOA 3TU6A 1YN6B 4M6NL 3S2CA 4FFYL 5D1QC 4BZ1L 3ARBA 5DRWA 5JHDE 2XSKA 5LO7A 2AKRA 2H2PD 1XBDA 4UINH 1GC1H 3FU5A 4JDEB 5DWUL 5CGTA 3ATAA 5A16A 3KGRA 2QZQA 4ZTPH 2VMEA 1DANT 1U8OA 1YEGH 2R0LH 2VQUA 4FLQA 4IMLB 5D71L 4B96A 4L8CB 2O6DA 2XIBA 2G3NA 1I4FB 7FABL 1M6OA 3KDPB 3D33A 1SHMA 5C0IA 4OKVB 4JGNA 1NCCH 4Y7MA 2CBQA 4WFFE 4BM7A 2GITA 5CJXA 3NSDA 2ZYHA 1NJ9A 3FOMA 3EO9H 3QYCA 3K2IA 4OIIH 2ZWYA 5T3ZL 3VG0H 2JJSC 3FCBA 3NJFA 3PHOB 4H88H 4H26B 2OX5A 3OTTA 4HXAH 4PRDA 4RDBA 4FNSA 4PTUA 4WU5B 4ODTL 1XAUA 4YZFF 3DYPA 4WW2B 3A5VA 1GR7A 3QUXD 3RDTC 4OF3A 2DM2A 3S37X 2FWOA 1CFSB 4ABVA 4AGQA 4ELMA 1SDDB 1KMGA 3AROA 2X4TA 5FB8A 5MHSE 4ZPVB 4I7ZC 1A7RL 5GGRB 2GSIA 3QIBC 3FFDB 2RR3A 4PWEA 2BIMA 3NPSB 3H2QA 1W72B 3TVMA 1ODUA 5DJ2B 4RMRA 5B8CC 4AY0A 2N01B 1E4HA 2CDGA 3Q1EA 5FYJH 3ECWA 2XG5B 1NANI 3QEHB 4KROB 4E2OA 3RWGA 4ZSOB 3QULA 3ASOB 2B3IA 5AYUH 5FYLL 4ZS7H 2X89A 5KBMA 4QHPA 1YMMD 4GKZA 5DRZB 5GRVK 4CKVX 1FFPA 4OB5H 2XG4B 1GJWA 2DMHA 5ID1B 4IKIA 3UCQA 2QKIA 3ZHLA 3REVB 3IRPX 5HGDB 1SHXA 5I6PA 3FQ1A 1EV2E 2H26A 1XF4A 4JW3A 1T5KA 4PJXE 1MFNA 2R29L 1P1VA 5DUBA 1J5OH 3HG1D 8FABB 1WS8A 3W9EB 2HSIA 5DVPA 4HIXL 4IRZL 3WAKA 1T89C 1ZJBA 1PX4A 3ARQA 2ENPA 5JZ7D 3KLSA 2GUOB 3VI3B 1EDYA 1NIAA 5ID0B 3VXQB 4S0TD 4YDIL 1FG2A 1BQHB 2Z31A 4UQBA 2RD0A 4L9LC 1JN6B 4FXGA 1KEGH 4V1DB 4PJ8D 1IGFH 1R46A 2IAMA 1W6LA 1WBZA 1NBZA 1ZKAA 1CFMA 2LAAA 1A6VL 4GG6B 2DQCL 4UT9A 1BQUA 5LNGA 3VD2A 2ICEC 2Z91A 2ZKMX 2UYLA 4FJYA 4ENED 2NY4D 3BO8A 1IBGL 1DJSA 3AQYA 4LCCA 1FNGA 1FCCA 2BWIA 2OMZA 4JQVC 3SZ6A 2O1AA 5AW8B 2EE6A 1BVLA 1HOEA 2X3BA 1BREA 1WFNA 3EGDA 4G42B 2BOCA 2CLRA 4P2RB 5JYMA 3VFOA 3TTSA 3U2JA 1ZHLA 4Y19B 3BGFC 1FN4A 4ZSOE 4MXVE 1O6VA 1UZ8A 2EIDA 1T3FB 2A77L 2GPZA 3DI2B 4FF9A 4FNUA 4JHUA 1SGKA 4R4NC 5C0BA 3IXTB 2W8CA 4WNQB 1E65A 5I9QC 2JI2A 2SEBA 2OW7A 3CQQA 4GI8A 3BAWA 3HR5A 3CIQA 2DTSA 4B41A 1HH9A 4X5QA 1RMFH 3BLBA 4CILA 4ZFGH 1VA9A 2IQ9H 3CLWA 3LB6C 2IAND 2VABA 3DECA 5KVDL 5KS9E 3T71A 1MCIA 4J4PC 3SDXF 4U3SA 3K5RA 1CLZL 1NGYA 1XV8A 2LU3A 4WUKL 1Q9LB 1I8LA 3NA9H 4KXZH 3VI3E 4Z78B 3D85D 4N0UA 4YVNA 3PWJB 2P3YA 3QI9A 2H32B 3MUY1 5D8JL 3U7WH 2YIHA 5CEZH 2XA3A 3GSNB 1SYSB 1NMAL 1JNLL 4V1DE 3OKOB 3ZDZF 1ETZB 4AM0B 5HI5C 2VKXA 4IBQA 1KENH 3J7HA 3DVIA 5LN8A 2JKSA 3IFOB 2FGWH 2HYMA 5CHNA 2AI0H 4NYLB 3IJ8A 5TE7L 1YEIL 4J3OH 2Y5EA 1NKRA 2LVCA 3BT2H 5I0YA 4UT7H 1OARL 1YDPB 1CT8B 3EHBD 4MJ6B 4Y19E 3KHOA 4FJ6A 5DXWA 5E24E 4DF9A 3PGFH 3PL6C 3DJRA 1J8HA 4ZMYA 4OZIF 3ZMEA 1QG3A 2PUQT 4HKJB 4JKLA 1ZT4B 3FSAA 2MCPH 1MKFA 2DQGL 3U25A 1B0IA 3RFZB 1E8XA 4IHOB 1D2PA 2X10A 4ZQKA 4APQC 3UTOA 5D7IE 4XXDA 1E6JL 4GAGL 5AB2A 2OQJB 5F3BA 1OP3H 3WEAA 1ZPLA 2KPNA 4TTDC 3D0LB 5FUCE 3RNQA 1N64L 3QEUA 3GFUA 1MVUB 1QLEH 1UZGA 2YD0A 3FK3A 1Q9OA 3IMVA 2K1MA 3Q1SH 4HV8A 1JXGA 3ZIYA 3VXSB 1E4WH 4H1LA 4Q6IA 4QRSA 3BZEA 4D9LL 1FSKC 5T1KD 5HHPA 1ADQA 4CDHA 4J3OG 3SDXA 3L3OC 4Z8FL 2ZWLT 3DX1A 4NQEA 3L3KA 5DZJA 4CW1A 1P4UA 3P02A 4GXUN 5DJCA 3LSOA 1OPGH 4CSSA 5AAWA 5D7JD 5AOZA 2P5PA 3DGGA 4G8EA 1R1CA 3AG4B 2KH2B 4C56A 3TIEB 4PW3A 4S1QL 3SBQA 3WNOA 5DD0H 5KSAA 3FB6B 1JZ8A 2XBDA 2R59A 4LP5A 4PLJD 3TT3H 3RJQB 5GHWH 5IMLA 4KKPA 3Q8FA 2XA8L 4Y2OB 1FYTE 2XNAA 1VLXA 2BNUA 4R7DB 4MS8D 2WOYA 1P53A 1DL7L 3GRGA 1D5IH 4M8RA 4BWWA 5HYSG 1QABA 3HZKB 4CMMB 4OD3L 1Q94A 5SWSA 4CAGA 1HQ4B 4YHPB 3QDGA 3DXAB 4MKTA 2JJWA 3RLSA 2ZOWA 4RQQB 3TBWB 1OANA 3JTSA 1W8EA 4OZIA 3O41A 5EZOH 4UT6H 5CSZB 3CZGA 2XETA 1YY9C 3MBEB 4TNWF 4F8QA 2EDWA 4JKKA 4PGZA 1E27B 4ODVL 3U7YL 4NQSA 3SPJA 3STZB 3OR7B 5EIVA 1PZ3A 5KSVB 1HHGA 2K0RA 3NEEA 2X4UA 4M02A 4M7KH 4C4KT 4O5LL 5LQBH 2L8AA 5AWNH 3LQAC 3KXFD 4HH8A 2EIMB 2Y3AA 5ECGA 2A6JA 2PPCA 4ZO9A 2APVA 2VLJB 4JFQB 1TU2B 4QRQA 3SSGA 3EJPA 2DB8A 3BN3B 4WI2A 1IGJB 2X0VA 5JDSA 3ALXA 3CZLA 4LLWA 5SX5H 1A6WH 4Y1AA 4Z0BH 1DVFA 2OJZH 4I18A 3TJHD 2BWQA 3T2OA 4XNUH 4AG4L 1E30A 2YN5A 1NKGA 4KK5C 4QOKE 4WI0B 4CNIA 4F5CA 3CLEL 2H4EA 3MLTA 1EXUB 3KPPB 1BPLB 3TV8A 2I7SA 4EDWL 1A7QH 3KBEA 2CO6A 3WJLC 1KTRL 2H3KA 3NN8B 3O6FA 4MMXC 4X4ZA 5D70H 3UGEA 1DJZA 2YXMA 2OMWB 1I1YA 3FUDA 4AEHL 3NJVA 1YN7A 4DCQB 3F58H 1AI1H 4PV9A 3DXAE 4G6JL 5CZRA 1VFMA 2YKKA 7TAAA 1QFPA 3X1BA 4O58L 4PJ5B 5FM5O 3BWUC 4HLZH 2P8PB 4MCYA 3PWVA 1BMGA 1PTZA 5ADPH 3NJKA 1OSPL 3ATEA 2BC4A 1ET7A 2QTEA 3QUZA 4HIIA 5D1XD 5CIPH 4NKOA 4LDEB 2Z0UA 1CWVA 4JZJC 2VLRB 3ZPDA 4QD2E 1PZCA 3QHZL 4H8WC 2IFFL 1G0YR 4ONFH 3MZGB 4G6AC 1PX3A 2CBPA 1Z9OA 1G0DA 2XI9A 1KJ2A 3WTVA 3VSQA 4HJGA 5AVXB 3SOBL 1F0LA 4W6YB 3HKFA 4PJ9D 5D1QB 2NY6B 1HILA 5D1ZA 3T3MF 4ZW6A 3SKJH 2Z0BA 5GGSA 2WNXA 5J13C 1FPTL 4XPBH 1NFIA 3VFMA 5BVPL 3ULUD 3FU3A 1BVNP 1MCPH 3GS4A 3BPLC 3ARDC 1MAKA 1P84K 2EDKA 2R2BB 4JFFB 1P0SE 3AITA 3F6IA 3T77A 1UA3A 4TOYH 5T1LA 3IGAA 1U3ZA 5F6HJ 2CHXA 3AGVA 1S9WA 1DZBA 1DCLA 1G9NH 3EH3B 1KXQA 3N44F 5DD6A 5JHDD 2JIXD 1A6TB 4QXTB 1BVKA 2X70B 1DSYA 5D2NB 2NXZC 1W6WA 2X3CA 4FQ1L 1RZGA 4KJYA 1EH9A 2X88A 3TYGL 5CEYA 4GW5B 3FBKA 4JPVL 5DUML 3B34A 5FK9A 3ZT5A 4K3EH 4N8PA 2V2WA 3TC9A 1INDH 3V6FA 2D3VA 3QXVA 3B2UD 2YQGA 3NFNB 5G4MA 4FQ2L 3RDTB 4OGXL 5I6XB 1OP3K 5KN5B 1XDTT 2H3NB 2G75B 3H9HA 4GRLC 3FB7B 4WFFD 5C9JA 1CVRA 4YSPA 3VVVA 2WKOF 1JIBA 4PGBB 4XHJC 2GK2A 2VLRE 1DE4A 1BIHA 5C8JB 4W9HC 4CMHC 1B6DA 3QIBB 4OGAD 4WAFA 5KBNC 3IVKA 3QDJB 1D2OA 3NA4A 1HYSD 4U6VH 3L95A 1HL4A 3KMDA 4TVPH 3F64A 1D6EB 1M1XB 3GRBA 1XSJA 2BFGA 4LSVH 4R0LA 3MRNB 4ZW7A 4DPRA 5L8KB 2WW8A 3EJYD 1MEXH 1JFQL 2KQNA 4LF3B 4G70B 4I3RH 2Z7ZA 1CQKA 1EWHA 2DQEL 3LN4A 4JY4B 3LZFL 4PB0L 4LHUB 2OMYB 1J9TA 4MAUH 3B83A 5MHSD 2JXMB 3KL3A 2J6EH 4DO6A 4LO9A 5GRVL 1UWXH 1P7QB 2BSTB 2WHVA 3K6SA 1JNNH 4G82A 3F62A 1WFMA 1QO3B 5TDOA 5D2NE 4U6XA 1IKNC 2PP9A 4KMTL 4CUCA 1SEBA 1B2WH 5F96H 5F1SA 1XR9B 5CEXA 15C8H 4WUUA 1AE6L 3UJIH 5C0GA 2DN7A 2WINA 1CFTA 1GPOH 3PDDA 4NP4H 4P23C 2X1QA 4PRPA 4XN8A 4PJGB 3RURA 1V3LA 2V5YA 1OF2A 3TGXA 2P46B 3UP1A 5AKTA 1KGCE 4HIHB 4R3SA 5BZWA 2DLFL 2ICEB 5EU6B 1BA9A 2NY1C 4X6DB 4ZTEA 3MLVH 4ETQB 4JRYB 5AALA 4KPHH 4HG4K 3QDJE 4TSAH 1K4DA 4WTZA 3CSYB 2OULB 5CINH 5JIQA 2DICA 4HHAA 5E9DE 2WKOA 5IBLC 4WHCA 1UA6H 4L8BA 5DMKA 4YDJB 4QTIH 1MFCL 2P43B 4L4TA 1MFMA 3BGFB 2AXGB 1MFBH 1OGPA 1LMKA 4LCYA 5SWZA 3LPWA 1H5BC 3VB8A 1BBDL 1SXBA 2FH8A 4AYSA 4F1ZA 5SX5K 3NCCB 2GT9A 3G6DL 3FB8B 4WGKA 5I1HH 2VZ1A 4N6QA 3L1EA 3BSZL 1AYRA 4F80A 2C4FT 2Y7SA 4MYPA 5DJZA 1HCYA 5E2WH 1WJ3A 4GUPA 3ALPA 1XF3B 2P8LB 2J43A 3UYRL 3VE0B 2GG1A 3HLKA 1QLRA 2OMTA 4RGOH 4AEIL 1MY7A 3UTQA 4KROD 4U1SA 1G7MB 3GJEA 2I27N 5FC9A 4F7CA 4OJAA 3D8MA 3JWOC 4YHZH 3WS6C 2GTWA 1XMWA 3MREB 2ARWA 1D5XA 1OZTG 1VGEH 2WTRA 2KL6A 5EC1A 3QUGA 6FABL 4M4RA 5B1KA 3QZWG 4M7JL 5HI3C 4ZMOA 2YAPA 3Q05A 3R8BB 3G9AB 1MW1A 5KYWA 4UM9B 4Z77B 3WNMA 1IFRA 4YWGH 3VFUB 3LXAA 3N1GC 4PGDB 1N70A 2MOVA 3GDBA 4PRBB 3ZKXC 2EIBA 2YQ3A 3LCYA 2E4FA 3HS0A 4WFEE 5L2JB 5EU6E 3QJQB 4X6DE 4GRWF 5IQNA 2ZX9A 2E7DA 5DC2A 1UATA 4JRYE 3SQOH 4DK6A 5F7NC 3QZOA 1ORQB 3TPKA 4AQ8C 4ZMXA 1ZA6A 4NN5C 4ZUSB 3WLBB 4XH2B 1HEHC 1MNUL 4YO0A 5T3ZE 5L8JB 5F7KC 4YL4A 4G3YL 3MKKA 2ZKWA 1UD4A 3QZPA 4MYWB 1FQ9C 2Z9TA 2RACA 3P4MB 5E08H 3X3FH 2B1AL 4V1DD 3GXUB 3PL6B 3S4SA 4ADGA 1LO4H 1FG9C 2VGLM 5IWLC 2IGLA 5DJ0B 3TF7C 4AKQA 1J9RA 4I85A 1HSAA 3FT3B 3GSVB 1F6FB 3FOLA 2X40A 4I1NB 3V6ZA 3ZLQC 2OAAA 5ILTH 1X9UA 4JPIA 3AWEA 4ZTPL 1RIHH 2VR9A 3QUXA 1BCIA 4Y4FB 3MLUH 3C8KB 4X4MA 4Y19D 2F15A 1T04B 4NC1C 4Y5VB 4K8RD 1SUHA 1NCCL 5CN1A 4X9GA 2A0LC 3OR6B 4QRAA 1O7SA 4X4XB 1ZD6A 5JDJA 2GIXA 4HWEL 3CDFA 4OIIL 3SY0A 4CVXA 3X13A 2XC8A 5FYLE 5FUZH 2ED8A 1X5JA 3E8VA 2WBJC 5IMOB 3BRFA 1UWEH 1IAII 3NP3A 3HVDA 4OZFA 4PTTA 5DZLA 1AY1H 3DROB 1FZJA 3BZFA 3TA3C 4F7MB 3NDYE 3DKHA 2O61B 3DJZA 1YMMA 3SYCA 3B9DA 3SE6A 2WTOA 4ZMZA 4L18A 2VDQH 3SPCA 3HKZA 2HXAA 2ZXQA 2JI3A 4R26L 1OIOA 5BZDB 5EC2A 3HG1A 4WV1A 3QWRD 3TOPA 1SMAA 3AT0A 3ARSA 4AENB 2R27A 2OCCB 1XH1A 4JPWH 2PTVA 4ODWB 4E9SA 3KLAA 5C0NC 1GTFA 1SVZA 3AJ7A 2MRYA 4ZW5A 5I6MA 4QO1A 5LG1A 2KI6A 3HZYA 5F72S 1GZPB 5F70A 1HDMA 3TJPA 1Q0EA 2EXYD 1ONQB 2JJTC 1YQVH 2BOBB 3EYFA 5GXBB 3ARZA 2E46A 4ZS7L 1BZ9A 2DKSA 2IDUA 3KPLB 1OF0A 3A6OA 1UWXK 1FLRH 4L1HA 4OB5L 1FYTD 4PJ8A 3V0AC 1OV8A 1YEEH 1MI5E 3DX2A 1FIGH 5D6DC 5I66A 3HZMB 1LO3L 1J5OL 4IBSA 2VDMH 4HUVB 3SPVB 4AQOA 2KUTA 1DJIA 2FECI 1T1XA 4R8WH 3RX5A 4M6ML 3BRDA 2ADJB 1YA5A 1GYVA 1K8DB 2EYRB 4AV0A 4BQ6A 4RBPH 4XO9A 3FUJA 4H5SB 3DETD 4RAUB 5LBSA 4Z7IA 4X6EA 5CZVL 4NWTL 1KIPB 1TZIA 1CLYL 3K2UH 3RX8A 2ZPKH 4XN7A 2WXMA 4HS8L 3BAIA 5FS5A 4P57A 5F6HI 4Q9CA 1Q72L 2EIZA 3SQBB 2IANA 4M3KB 2BVOB 4OUOA 5DQ9B 2WZ6A 3IJ7A 4OZGB 4YGVB 1MLBB 1LK2A 5KYUA 3PWPB 5JW5B 3UYPB 1PIFA 1AXSB 4PR5B 3JVGA 3D85A 3NIDF 1P1ZA 2WO4A 4TSBH 1X5LA 3EJUA 4OW6A 2ENSA 3MX0A 1U8NA 4QOKD 1AHKA 3ZYJA 3HBPA 1R6VA 1SFDA 2DQTL 2WZ0A 2RQ8A 5HD8C 4NO2B 1WISA 3PY9A 1QWHA 5F7HA 2HG5B 3X11B 3ILQC 4H0HB 4MNGE 2OV0A 4JZJB 4Q6YA 1DQDH 3V6BR 3BLPX 1KXTA 2CG9X 4ONHA 4CL7A 4WNSA 2IV8A 1CXEA 4YAQB 1DQQA 3DXAD 2FZ3B 5DK3A 5J1AB 4XPFL 1KWKA 1F2XK 1SOQA 3ESMA 3CH1B 4K15A 3MRCB 3M86A 3NA9L 4URTB 2VMFA 2B59B 2WVTA 3HB3C 1A2YB 1FFNA 1HZKA 2YJLA 4FCAA 5J13B 5CEZL 3CVHB 4Z7OB 3RWIA 3RY5A 1BVNT 4LBEA 1FUNA 2ZONA 2BERA 2H7WA 4JAMB 3BPLB 2DIJA 4LGSB 5F9WC 4C55A 4BV1A 5K39A 1T7WA 1T0MB 2V3EA 4YPJA 4JG0H 1G6RH 1YCSA 2R1WB 3OWRA 4L8SC 2AGJH 3WYRA 4EXKA 5IT2H 3X12B 5BPPA 1ZHNB 3BP7B 1CBJA 4PJIE 2YQ2A 1HKLL 2AI0L 4P46B 1ZT1B 2HG0A 2NLJB 2WNWA 4KTYA 1JFHA 3V0IA 5FV1L 1XCXA 3PWPE 1I3GH 1UURA 3QPXL 4BCZA 4YL9A 4XO5A 2NXZB 3Q6GH 1EBPA 3WHE0 3T6VA 4OCYH 3WOVA 3CFMA 5T1KA 1MCSA 3PGFL 2D73A 2FYYA 1LM8V 3VFWA 4NQDB 4EI5D 4XVOA 3GBNL 2NQCA 4G6KH 4IKKA 2MCPL 1MJJB 3KPSB 3N55A 2WWKO 3QHFH 1TNMA 3FULA 5D4HA 3UAJC 1UWFA 4GRLB 2AF2A 5D7JA 3FT0A 4RIRB 2D7PA 2Y2WA 3D07A 4JO1H 4D0DB 5DT1H 2Y7NA 2X4SB 4HT1L 3J27A 3R06B 3IJEA 2J21A 3QQDB 4Z7QF 1NCNA 5IBUG 1J1OH 1MW2A 3VRIB 3WNIA 2BFVL 4H2AA 4B9CA 2Z7WA 2K70A 5FFLA 3LKQB 4CSPA 5FUOH 1INEL 4I13B 1AMXA 1U8CB 25C8H 4NZ8A 2WBWB 3OKNA 3CSPA 2YOAA 3UZVB 1NCAL 2LABA 4K5LA 5INDB 2VLRD 1BAFH 5F9OL 1KYOJ 1O9ZA 2LFEA 5DURB 1S7XA 2FHBA 3TN0C 1J1XH 1SJXA 3P9WB 4AQAA 4Z7WF 4ADJA 4FQHB 4OZ4B 1ZLUH 4GW1A 4RFOL 2NY6D 4ES8A 4E36A 2CIIB 3MRFB 1RHFA 2JTDA 2DWEB 5IW3A 5EOQL 1JGIA 1NEZB 3II2A 4P9ML 1DJHA 3P3SA 2J2ZA 1NDMA 3KNBA 1ETB1 3B2VH 3L08A 3KYOA 3F7LA 3H4HA 3CSBA 3DYOA 4NQDE 4PJAF 3MRGB 3KXFA 3ULUF 2OMXB 3RDJA 1HHHA 5I1DA 3KPSE 5L0QB 1IEBA 2JF1A 3EXLA 4PP1D 5KYYB 1KY7A 2Y7QA 2XYBA 1ZSDB 3LNEA 1RD6A 1BGXH 3LIZH 3GI9H 3RTLA 1UH2A 2NY1B 5DQJB 1UWGH 4RNRB 2A6IB 3BT0A 1U4EA 4YDKL 5FHBH 4OCRH 4MXWH 1OB1B 3WN5C 4JPQA 4ATWA 4BH8B 2VMJA 4M5SA 1UXWB 2R0WL 3GEWB 5FKPB 1IBFA 5AD0B 5LWYH 2F53B 4NUQA 2BY3A 5AWNL 1AZUA 1U8HA 3AM8C 3HI1B 5FAAA 3RRQA 4RBPK 3JV6A 3HNVL 4U2YA 2Z92B 3D18A 1QRNB 3BGMA 3TLRA 4PGCA 1KGCD 2QFRA 4XMWA 4HUMB 2R8SL 4JFXB 3L5IA 1ETJA 2AJXL 4K7PL 4F37K 2PP8A 1SLUA 3BKML 5L88L 2QV2A 2C7FA 3DX9B 4GT0A 3B3IA 1WSST 5GZOD 3GPEA 1PKQA 3QDJD 1OCWH 4XBEL 3GJFA 2VW4A 5H35A 5E9DD 2CR3A 2Z6FA 4QIRA 5D1XA 3L3JA 4AGNA 5DMGC 1JK8B 4HKBB 4O4YH 1NBVH 5KSVA 4NS0A 2W59A 4KTDH 2VRQA 2ADGB 2VW7A 5HDRA 5BVJA 5B39G 4Z7WA 1G7JA 3S3BB 4LHUD 4W68A 1OSYA 4ABUA 1JG9A 3UROR 1QZ1A 4PMEA 4H0LC 3MU3A 1T21A 1DDHA 4L23A 4R97B 3TM6A 5HP5A 3NZHH 3F58L 2V7NA 1AI1L 2XQYG 1DFBH 4PJ9A 4PHZA 3ZQWA 3E38A 1ZLEA 2DI8A 2CPUA 3P11L 3KPNB 4GOSA 5I19H 2DI7A 4PJAA 2O6FA 5EWIH 1DSFH 4HDIA 3INUL 4OFYD 4M3HA 3DOHA 2EH7H 3C5ZC 2IADA 1LO0L 3Q43A 4NN5B 4DZBA 4FNRA 3DGDA 3F5WA 5E1AB 4NC0B 2CBOA 1OE3A 1W0WA 2YD5A 3VGEA 2E5EA 3D4GA 1P4IH 5I6LA 1AIFB 4X9IA 2E9IA 1QRNE 2JIXA 3U6XS 3WV0A 4I77L 2YUZA 3LEXA 5JHDA 1BMZA 4WFED 2CU9A 5EU6D 2NW3B 4HEPG 4XXWA 3SKJL 3U4KA 3FTXA 4JRYD 4KVNL 2HH0L 3OZKA 4XPBL 3LH2H 4KZ0A 3G3LA 4EZMA 1MCPL 4P3CL 3DRQA 4L2YA 5T3ZD 5IOPA 4L3CA 2ITDA 4B0MM 1D5BA 2VSCA 1ZANH 3KS0H 3MCG1 1F1GA 1JGEB 3C5JB 3LRSB 4TOYL 4YFLI 2MCG1 3VI4B 4MZ2A 2YS4A 2CIKA 5DZAA 4MQ7A 4JFZH 4WW2F 4JPKH 4UDTA 2BSCA 2DYSB 4WJ5A 3B8YA 4BKLA 4D0CB 4IDLA 1BZ7A 4K0OA 1D7BA 1OAJA 1Z66A 2LVEA 3BQUD 3P9LA 4UDUA 1MZYA 5I16A 4LLMA 3RPBA 1S3KL 3QO1A 4JG9A 2C3HA 5TQ2L 5L2KB 4NO5A 3L5XL 1IQDA 1JPGB 5BOZG 2FO1A 4NPJA 1U8PA 3Q8AA 4J3TA 1N8OE 1WD9A 3HNTH 3TA3B 3FCGA 2P26A 4U1NB 1JHLL 3LN5B 5D7HA 3WUWB 3SHSA 3KAAA 5C0DB 3BN9D 1QWNA 4WO4B 4JKMA 3N1QC 2EO7A 3PWNB 4LRIA 4Y9BA 3WNNA 5DS8B 4MXVF 5HHOB 2FSDA 3UAEA 1HE7A 3QIWC 2F8XC 1WF5A 1A25A 5FYLD 5AW1B 4RZCB 4ODXB 3WDIA 3BAEH 3OAZH 2MMXA 2C5DC 4TVPL 4OF6A 4FN0A 4LSVL 4JDEA 3TV3H 1KGJA 3AT9A 1PD1A 4KKNA 4IMLA 1EHNA 4I3RL 3RL1B 1V54B 3MRLB 3S37L 4XODA 3UPCA 1I4FA 2OA9A 3R4DA 4GYBA 3TBTA 1RUAL 3T1WA 4AW7A 2ZG2A 5JXED 4AZ8B 1PW3A 1ZLUK 4KZEH 4MAUL 3VI3F 1WC7B 5BS0B 5F7EL 3LS5H 4PJXA 4P5SA 2I5YL 1T1WB 3ZK0A 3OL2A 2BIPA 2YWZA 4U7SA 3PHOA 4H26A 4JQIH 4PAZA 4XX1G 5HYIA 1Z5HA 1OT2A 2HJFB 3IMTA 5GPRA 4GG6F 1IQWH 4WU5A 2NSQA 5BO0D 1MJUH 3GZOA 4JE4B 4WW2A 4EN2A 2IMMA 3SKMB 4AXWB 5CCHE 4K07A 3UJIL 1U2HA 3IDIA 4Y4FD 3ZTDC 1KPRB 1RURL 4NP4L 1QQDB 2BVUA 1SDDA 4O2FB 5F0LB 5CJ5A 1H15B 2UZYB 1MI5D 5DVLA 2VO8A 3ARGC 5SX4H 3WCYA 2FNWA 4YBQD 5EOCL 9CGTA 5GGRA 2B0SH 3QZNA 4ONGH 3IGUA 3UTPD 2X38A 3UDWA 4XPAL 4PY7B 3FN0H 3ZO0A 1W72A 3BVDB 3MLVL 5DJ2A 4MJ5B 1OAZH 4ABWA 2XG5A 4TSAL 3HBZA 1QSFE 3QEHA 5CINL 4ZZKA 1FGVL 1MCHA 4ZSOA 5D7IF 1ZHKB 3DSFH 3UGUA 3FUIA 3MA9H 4QTIL 3D69A 1MXDA 4ZS6C 3P3RA 3L2LA 4U6YB 4LOUD 4G71B 3DLQR 2XG4A 1IM3B 5ID1A 4BFJA 4J1UB 2QHLA 2Z8SA 1TKWB 2ZYRA 5I1HL 4GAAA 1YNKL 3QHTC 5BS0E 1QTPA 1TYJA 4HFUL 1DLFH 2DV6A 5A1AA 4TTGA 3WXWH 8FABA 2DF3A 2LU7A 2DL2A 5E2WL 2X42A 2H2SD 2YEVB 2BNQB 1VB9A 3N6YA 2BINA 5C0CB 3IMUA 5CU9A 3VI3A 3ZR6A 1MCEA 4ABQA 2XTLA 1KACB 2W9EH 3VXQA 1I85C 4GKOA 5FO9B 2XWXA 4R96B 1KOAA 3AXLA 1A0QH 1R3HB 4V1DA 4NQCB 4ZFFB 2NZ9C 4MSWA 3NCXA 3FQRB 1OAUH 4GG6A 3KBHE 3OD3A 4UQ2B 5DEGB 5EZLB 2C9AA 3ULVC 1XR8A 3MV7B 1X7TA 4WSGA 1S7UA 2OYPA 3CSGA 1OP9A 4XMPL 2ICWB 1LD9B 4GEJA 4Y19A 5DMJB 2VL4A 2XQ0A 3HPJA 5ALBL 5DO2C 5FCUL 4G6MH 3HE6C 3EYVB 1JZJA 1CLOH 1NUGA 5LGHH 3VXTB 1FDLL 4WNQA 3GIZL 3RG1C 2X12A 1LO4L 4J7RA 1E42A 5E6YA 2KZKA 5E5MB 2CCWA 3L1GA 5T5FA 3SEPA 2Q7AA 1CIUA 3ZDWA 3DTUB 5D7IA 1FHGA 3TS8A 1KG0B 1YC7A 3WN6A 5F0MB 5IHZB 4JFOB 1U8JB 1Q90A 4OBSA 3TCTA 2X9WA 3PWPD 3A0OA 3TJEL 4XC3H 2DZEA 3S34H 3LX9A 3HG5A 3MLUL 3BKJL 4Z78A 3AU0A 4NSKB 2H32A 4IQHA 1G9EA 1FHNA 3GSNA 3ARYA 1SYSA 4I88A 4HWZB 3OKOA 4NQCE 1AZVA 4MDJB 3QWRA 4NI3A 1X5GA 3HG2A 3QCVH 3TBCA 2YD2A 1GH7A 2AJUL 4NM8H 3L3IA 3IFOA 2EDOA 3TN0B 2XLLA 1RERA 2CGRL 1U8QB 1TQWA 4NYLA 2HT4C 1AY1L 1RZJH 4OU3A 1UZ6E 4UI2A 5BRZE 1HJCA 5A43C 4BUQA 1UB6B 2FR4A 4D3CL 1YDPA 4U33A 4B95C 1X4ZA 5DRNB 1CT8A 3X1GA 4MJ6A 1NBQA 2VR3A 2VZVA 2VDQL 4WHYH 3UP6A 4I2XB 4DAGH 1GGUA 3JTBA 1QD0A 3OAZK 3ZTNH 2WLMA 4HKJA 4NZTH 3SDCC 1ZT4A 3IS1X 2W0LA 5IVZB 3RFZA 3DX3A 4IHOA 2FD6H 4JFSA 3V0DA 4ZT1A 3QZBA 1XMEB 2DQHH 3CMGA 2OQJA 5LBVA 4JBSA 4P46D 4AJ0A 4TLTA 4LHJB 4MA7H 5GS0L 4H8HA 2VSKB 1WIPA 4RDQF 5ES4B 4HJEA 4NHUB 2NXZD 3WS3B 1FLRL 3VNYA 3WFHB 3WN5B 1YEEL 1KJMB 3V0EA 1F45A 3EDFA 4PG9B 3K4DA 4KKLC 3NDZE 1U3HC 4NQDD 1JWUB 3ELAT 2VDNH 4JFEB 3EFOB 3KPSD 4XNYH 2CLVB 2H5UA 3L7FB 4WHYG 4X2UA 3OMZA 4R8WL 4WQOA 4OTXH 4NJAH 3F84A 2P5WB 4J8RB 2A9NH 2BSED 4ERSL 3CXDL 3FB6A 3RNKB 1OALA 4DTGL 1CE1H 2IBZX 2FBRA 4DN4L 2BSDA 4QOKA 1J0HA 3K2UL 4IJ3C 1S7QB 3Q8EA 5ANHA 2F5BH 4I2XE 2G3ZA 3D0VB 3V9EA 4R7DA 3RWFA 5HYSB 1F4XH 1V7ML 3QXUA 2PKDA 2VM9A 1MHHB 1QI3A 2EXSA 5CP3A 1P84J 2AQ3A 5KAQF 3HZKA 4CMMA 1XH3B 5IMMB 5HI4D 2O5ZH 4YHPA 3EBAA 4LOVA 4EUPA 3DXAA 5CEZE 3DWTA 4YIQA 3TBWA 3WL9B 3W37A 1ZGLM 3FCUB 1B0RB 1MPAL 4HALA 1UM5H 1AHWC 1H19A 2D7MA 3NJMA 5CSZA 1T2XA 1MHCB 4HISA 3MBEA 1YUKB 3FT9A 1ADQH 1S9YB 4KTEH 1CXIA 2WXGA 3KYNB 4ZO6A 1RUMH 2BW4A 3B3BA 3STZA 5DI8B 3GSQB 4RA0C 3V0WH 1MJ7L 3RVTC 3ROOB 1CGVA 2N4IA 3VG9B 3GMNA 5I1EL 2J6WA 3UPAA 1FC1A 4WWKD 5DA4A 5IGXH 1PZUB 4JFQA 5E1HB 3K72B 1TZGH 4AQEB 5G4NA 2EIJB 2P5WE 4WRLA 1ACYH 2X2YA 4MFHA 3FRUB 4BGLA 5J8OA 2D3JA 5F1NA 3J8F7 4PWJA 4WI0A 3SGJC 4DGVH 2V9RA 1EXUA 3KPPA 1GY1A 1G5GA 4J6RH 1KZYA 3OXSB 4YDVA 4EI5A 5GS0C 1C8QA 5IBLD 5DHVA 4JVUA 3MLXL 4PGJA 3NN8A 3UO8B 3VMNA 3S5LB 2VR8A 2PWHA 1N68A 4LAJH 2CJSA 3GLEA 4S10A 5TK2A 2RJMA 3EDKA 5TE6L 1QRND 4GAJH 3QJVB 4DCQA 4L4VE 1T22B 1FNLA 4UTBH 2A1WH 1NKOA 3H0TB 3Q6GL 1R34A 3RX9A 2P8PA 1JF6A 2K3HA 4EBQH 5E8PB 4J28A 4OM1H 4AUYA 3CMOL 1CXKA 1YNLL 3DX8B 4OD2B 3NFPA 4FLRA 1M3IA 1P4BH 1RQ5A 5ENWB 4AI7A 1ZRUA 5CXPA 3UH8A 4G8AC 2VLRA 5TGBB 4ZXBB 4PS8A 3BFWA 2HLAB 4JQXA 3CGTA 2C1OB 1IX2A 3RB5A 3CLFH 3MRPB 1W15A 1IBZA 2KKQA 3WHE1 1DVTA 4JO1L 5LNEA 1J1OL 1KJ3H 2BSRB 1LQBC 5KVGH 4NZUH 4NZJA 2WOBA 3K2KA 3LTVA 3VX0A 4HMCA 3HHSB 2R2BA 3IYLW 4M03A 4FQXC 3ABKB 3EOTH 4KNQA 5JNYB 5F1IB 1FIEA 5FA4B 1G1OA 1MRCL 3QIUD 5EU7C 1BAFL 2Q2LA 3CK0H 3VO0A 4UTCA 3HI6H 2C9QA 4RMUA 3L2NA 1A7BA 3BHBA 4BH7B 3RKDC 4JM0A 3GMPB 5C86A 1A6TA 3FBQA 1AO7B 3FU8A 1I1FB 2X70A 5D2NA 4OI9A 2CCLA 5JYLA 4PJGF 4WFHE 4ENZA 3D2UB 1GGBL 4HUXB 3V7MA 1DQML 4A67A 1IEAB 5ITBL 2UZIH 3EYUH 4X6DF 3EG9A 1TJGH 1CI3M 3RDTA 3VFTB 2ZAHA 5KN5A 5GSRA 4ZX5A 3UTSB 2VXQL 2H3NA 3FQ4A 4WEUD 3L81A 2RA1A 3RVXD 4PGBA 3HCVB 5C8JA 1QFWM 3LIZL 4MB5A 3GI9L 4V2BA 4YHOH 3WFZA 3FH7A 4UAHA 4MZRA 3RHWF 4Y0GA 4BFEA 1OSZA 3QDJA 1INQA 5GZOA 1S7WB 4M9OA 3ATBA 4YHYC 4FG2A 1RZKH 2AS5M 3REWB 1D6EA 2APWA 5E9DA 3OKDA 4DGUA 3MRNA 2YGQA 3IBOA 1KTDB 2R69L 4LF3A 2YXWA 2RQEA 4W4OC 3ATDA 3ILDA 2Y24A 4PJ7B 4JY4A 5LDSA 4LHUA 5LUMA 3ZTJH 1J1PL 2XZAL 5FDWB 5C6PB 2OMYA 3TBYB 4BQBA 4OKDA 4WO4D 2JXMA 3OGCB 3BFQG 1OTSD 1MCKA 2ZX8A 1IE4A 5CGMA 1JZ2A 1P7QA 2BSTA 1N19A 3NRFA 4KHTH 2IPTH 1OCWL 2C7UB 3D3VE 2GFBB 1AO7E 1QSFD 3ZHKA 5C0ND 5D7LB 5FX3A 5LCVA 4JG1L 5PCYA 3MOBH 4Y16B 1P2CA 3NAAL 3KH4A 4NBZB 2MPAL 4OFYA 4CADA 1R75A 2P52A 1NBVL 3NGBC 4FFYA 4BZ1A 2IALB 1P4LB 2ICWI 3MRDB 3QQ3A 3TCXA 5HJ3B 3IPFA 2KDGA 2VUOA 3EBIA 5CZXC 1SBSL 4PJGA 4NNYA 2IGFH 5BS0D 4LFHG 3NZHL 4HIHA 1KYUA 4YOKA 5EU6A 1FAIL 3EYOB 3O4LB 4MCZA 4X6DA 5DC9B 4ETQA 4I4WB 3ZTJG 4JRYA 1AP2B 1QACA 4GSXA 1OGAE 1L9MA 1DSFL 1XGUB 3CNKA 2GJRA 3EO1B 1HFUA 4OZHB 2EH7L 3GMRB 4YDJA 2P9RA 1A1OB 3T8VA 4FLHA 4OQTL 1EO5A 2YUVA 4XGZB 3SE4A 3AY2A 3HE6B 5JUEL 3F7PC 1REIA 1QNZL 3BQUA 4X0KB 3CN3A 1CF8L 1OY3B 2CXKA 4PG2C 3UG5A 1BLNA 5IUSA 3G5WA 3WJMB 1JGVL 1W80A 3RU8H 3IGLA 1NIEA 3GKWH 2VZSA 2FLMA 2VZTA 4AL8C 1EHLH 3U79A 2P8LA 4G6FD 3D4YA 3KHQA 3VE0A 2VDPH 2JV6A 2VC2H 1DN0B 3EO0B 1UXSB 5CN3A 3MFGB 5B1JA 4IRSC 5D7LE 1G7MA 2OTWA 1TCRA 4E9YA 3MREA 2BM3A 2WJ7A 2ZYSA 3ME0B 4U0QB 1QW8A 3QZWB 3WFDH 4B9ZA 4ZUUB 4JZNB 4QWWD 5DO8A 5HHMB 1J0IA 3WMQA 2CSPA 1KEMH 4TVPE 4Z77A 1WEJH 1QSEE 3QYNA 4YFLF 3UABA 2KDYA 1QW9A 3GWJA 2P44B 2VN6A 2OPCA 3KWVA 3L3GA 4PGDA 4IKLA 5KANG 3ETBJ 3ILQD 4KXZI 3L4UA 4MCMA 5I75C 2WNKA 4ZW8A 5L2JA 3JSSA 1PSKL 4I3SH 5BMFH 2YSSB 2GYSA 1ORQA 3HNTL 4FNLH 2R29A 4PRIB 5DD5H 3UG4A 2F8IA 5BUPA 3S5ZA 5DJDB 3K2MC 3WLBA 4ZUSA 5FLVA 2FX7L 4IRZA 1B3JA 1Z9PA 5JXEA 2AABL 9PCYA 3P4MA 2ZUVA 3TNNB 1RPQA 2R4SL 3NJGA 4YHLH 1QBBA 4NQCD 3V95A 1YEDB 4K9EC 4OT1L 4L3FA 3SDCB 1AIZA 5DJ0A 2LQRA 1LJMA 3CV5A 3U9UA 5KW9H 5AQ0A 4P5TD 3GSVA 4PUBH 4ZQTA 5FGBA 4A7UA 3WDJA 4M00A 2I07B 4KK8C 3AB0C 3TV3L 1G7IA 2WIMA 2HFEB 5EA0L 5BRZD 1NUFA 2VO5A 1FWXA 5ACZA 3QRGH 1ASQA 4Y4FA 2J4WH 1AKJB 1KB5H 1ZS8B 3OLIA 4FL4C 4X5WB 1T04A 4Y5VA 4RZKA 2F08A 4KZEL 3FXIC 1TTUA 1S6NA 2YPKB 4PQXA 1NGPH 3ELQA 3OR6A 4FFZH 1ZPUA 3D2TA 3FZUC 4M93C 4TUOB 4Y1SA 2DEXX 1U3HB 2KZWA 2FTAA 3EJSA 3CFCL 4LP4A 2OR9H 3KR3H 1I9JH 4F9LC 2IH1A 4JKWA 2J56A 4OAWB 3HE7D 4IU3A 3DROA 4F7MA 2Q3ZA 4KDTA 4PJIF 4LL1A 2O61A 1ORSB 2AANA 4OZGF 4JCLA 4YEEA 5C9KA 1N0XL 4WSJA 4ORZC 1BFOA 1FVDA 4U49A 3S8GB 4DP4X 4ONGL 2VR7A 3MV8B 4RMQA 1NAMA 3BWUF 4JO8A 4AENA 4ODWA 5F7DA 1OAZL 1YEHH 1ITCA 4ZZFA 3FO1B 2ZOOA 4LLAA 4LPXA 1GZPA 4FMKA 4LSPL 5K5YA 2R1YA 3DDGA 2ZXAA 2HVJB 3AGWA 1ONQA 2QJDA 4HK3N 2BOBA 5E6IC 3D4ZA 3MA9L 4M1DH 1AHWB 3DA0A 4X98A 2CBTA 3QEGH 1Q1JL 4ZBJA 2R83A 4LEEA 4N9GB 1S2EA 1NTDA 3WUZA 4P9HL 5T1MA 3NSCA 3AY4C 2VLLB 1X9LA 3HZMA 4LARH 3S96B 3KLHC 4HUVA 3SPVA 2VDQB 4NNXB 4KHXL 4Z7OF 5EFIB 1GZQB 5CEZD 1KCWA 2AEPL 4LEOA 2R39A 3S9DB 1I8MA 2ADJA 3UBXG 3WNLA 1FV1A 1U8IA 3BIKB 4K94C 2W9EL 3SE9H 4H5SA 2QKSA 1K4CA 1L7TL 2HKAA 2AQQA 1IIKA 1KIPA 2X1PA 3ZUNC 2Y1ZA 3G04B 2WXIA 4GRWH 1EVTC 2BDNH 2DM3A 2BZ7A 1IC4H 2HWZL 1NGZA 2UVEA 5JW4Q 2YPLB 4WEEA 4J3OD 2W9DL 4NXKA 1RCYA 4FXKA 1N6QH 4P2QB 3SQBA 4HK3J 3TXAA 4PJIA 3B2PA 3ARRA 4LVNB 3TYFB 3NIFB 1UJ3A 4YGVA 1A47A 1MLBA 1EFXB 2BVQB 2EDDA 3KYKL 3D12B 3PWPA 5JW5A 3I6GB 1AXSA 2ENQA 2P5WD 4XZ4A 2YGOA 5EBMB 5FIEA 1JGUH 3F65A 2JB5L 1TMQA 5KEZA 4G6ML 1GYUA 3M8OL 5DVMA 5HGBA 2V5SA 4P8QA 5LGHL 4ZOEA 4UQAA 4NO2A 1U0QA 4S2SA 3FQTB 4ZW3A 1M7DA 1OM3H 1G7LB 3B5GA 1ET8A 4ZMTA 4JANB 4NKMA 4PWIA 5CBEB 4PLNC 1ZVSA 4ANKA 1EEUA 4L4VD 4YHMH 5J1AA 3PXLA 3MOAL 1JNHA 4XC3L 1RJZA 4BZ2L 1JAEA 5E70A 2FSEB 3MRCA 4FQJH 2Y4SA 3KPRB 3MLRH 2B59A 4KDWA 3MRBB 1HXYB 4HLEA 2QV4A 1HEZB 5HYEA 2EE3A 3H6JA 1AGCB 3ZKMC 5IZ7A 3WG7B 3U0PB 3EJQA 3PPEA 3MACH 3QCVL 2W65B 2R1WA 3P2TA 5F3FA 1WIOA 4P2QE 1XHHA 3ARUA 3Q48A 4HC1L 1ZHNA 4J3SA 5EORL 3BP7A 1D5MB 1CXLA 1S78C 1XCQB 4P46A 4X80L 1ZT1A 3QXAB 5EH1A 3WKNA 1I9RH 1NOAA 1RZJL 1TLMA 3MXWH 3TZVC 3UC0H 4AVKA 1KULA 2EDEA 3BMWA 4ZUTB 3ZX1A 2CJUH 4B50A 2A4EA 3ECQA 3DTDA 3Q44A 3FS9A 4J3VA 1EK3A 3IRZA 3ZTNL 2ZXGA 4NQDA 4B7IA 4NZTL 3QA3A 1LEGB 1OCZB 3DBSA 2WBKA 1QKZL 1MJJA 3KPSA 5CGYC 1DVQA 2F74B 1F3JA 2FD6L 5KVEH 1GYCA 3KYMB 4GP4B 3ES6B 2WPGA 2DQHL 4XBGB 1IU1A 2DAVA 1TT6A 4RIRA 3H42H 3VGBA 3A47A 3FQNB 2HPTA 4D0DA 2BSEA 2X4SA 5C7XH 3QQDA 5A2KH 4WFHD 3A4FA 3VRIA 4YHYB 2QVMA 3LZOA 5I71C 1XF5B 2NR6D 2AMGA 3IDMB 3KPRE 1JZEA 1PLCA 3SGDH 3WIFB 5DK0A 1T20B 2D03H 2N0KA 5AVYB 5IB2B 4FFWC 4DKTA 3LKQA 5A2AA 1U8CA 3COOA 2VDNL 3IFPB 5AB0A 2E56A 3FT1A 2XKUA 4XNYL 3W5MA 5GJTL 4K5PA 2NOYA 4ZXBD 2K8MA 4LLQA 3MSPA 4M61B 4TULL 4HUKB 4F9PA 2P28B 2JELH 4OTXL 2VISB 1CU4H 3KGTA 1ROWA 4E0RA 1ZDSA 1OTUD 4NB7A 1YEKL 4FQHA 4WWID 2DLEA 2QSTA 2CHZA 5E0QA 1MCWM 3KM1A 3MRFA 4F15B 2DWEA 3ZW3A 1V55B 1NEZA 4RWHA 1OCRB 5EEXA 1J11A 5E5RB 2GSMB 1F4XL 3ISYA 3NGBB 4LQ1A 4HJ0C 2X4NB 1BP3B 2Q3XA 2YMOA 3SE8L 4M48H 1MHPL 2OMXA 1LP9B 2ADIA 4L29B 3B7SA 3KLDA 5JW4M 5KYYA 4ODHH 4NX0A 5HDOA 3DYMA 1FNHA 1I1AC 1UM5L 2D2OA 3D3VD 2IJ0C 2KQMA 5DQJA 1AO7D 4RNRA 3TFBA 1DBKH 2A6IA 1FNFA 2X2UA 3BAJA 1MFEL 4GAYA 4Q9QH 1OB1A 3EDJA 4KK6C 1TETL 2E7BA 2XDHA 2OYLA 4BH8A 4ZOCA 1W8OA 2D4FA 5FGCE 5AD0A 2F53A 3CC5B 2X53A 3UJJL 3HI1A 2I85A 4QXUH 2Z92A 3WKMH 1QRNA 4P2OD 5IGXL 5E8OA 4JFXA 3S35X 3WKYA 1YG9A 3VI4F 5ANME 4PLKD 3DX9A 4AEFA 3BIBX 2WAHA 4YSDA 2UWEB 3GUTB 2XV3A 3N43B 5J6GB 1OGAD 1VIWA 3CQFA 3GHBL 3PU7A 5GGTH 4DP1X 2V8LA 3CIAA 3DIVA 3L7EB 3NFSH 4DGVL 1JK8A 2AAAA 2OI9B 4HKBA 4J6RL 5GIRB 3D30A 1Y18B 5B39B 1F90H 2ADGA 1SQ2N 2QVKA 3MMEB 1TTGA 1Y6NR 2NTSP 4K2UL 1XGRB 1W8NA 2W95A 2V2TB 1GYWA 3PDOB 1OQXA 4F7KA 3C09C 3IETB 2HFGH 3RIKA 4EMZA 5IY5B 4HKXB 5A2BA 3OKMA 2APXA 2YBRB 4UTBL 5TFSH 3LS4H 2AQSA 2ZF8A 3PP3H 1S9XB 2ZUTA 3S0PA 5I75B 5C2UB 3KPNA 4MLSA 2Y7OA 5TE4H 2F1AA 4PWKA 1NAKH 1QHOA 2XWEA 3ULAB 2VDOL 5D7LD 3II3A 3KJ6L 4DP0X 3STLB 4Y16D 3BPOC 3RPIB 3TFKD 1JTTA 4A2LA 1JE6A 3RE0A 4KKQA 4FZ8L 1DQVA 4HS3B 1JXKA 3Q2NA 3N41B 1AZRA 3QIUA 4TVPD 5E1AA 1PZAA 1AXTL 2E6QA 4M62L 1QSED 2TSBA 2VXUH 3CLFL 2DLIA 3CPLB 4PCSA 4TMPA 3GJFH 1T5XB 3RZCC 1QBLL 2FBOJ 3O4LD 3O6LH 1J0KA 2X41A 2NW3A 2EYTB 2XUWA 1X5AA 2BVPB 1JXFA 4M3JA 5KVGL 3AB0B 3WHXA 2FQDA 1GZHA 2DMBA 2ZIDA 2F54B 4GMSH 3I6SA 3RKPA 3C6LC 1F6AA 4FL4B 1W91A 1JGEA 3C5JA 2MCMA 3O3DB 3VI4A 3RZWA 3DX4A 2FIKB 5CJQH 4E68A 5DO2D 3FU0A 1AQKH 3OSKA 3CK0L 3BXNB 4K3DH 4PEEA 3HI6L 1OLLA 4D0CA 3I02B 3F7RA 3GGWA 4M93B 4W9JC 4Z3GA 3ZE2E 1KELH 4F91B 3KE0A 1B4LA 2JK5A 3ULUH 3AQDA 5KJ7E 1CD8A 1HCFX 2XKSA 4YNYB 3GNMH 4KOBA 3C2SA 5KVFH 2UZIL 2GHWB 2WLIB 1CYXA 3BSZA 3WNJA 3M7OA 1TJGL 2F61A 4HOZA 5FO7B 4ZFZA 1CMOA 3HAEB 3QJRB 3LN5A 3WUWA 3ABZA 4FYRA 1E5AA 3EUDA 5C0DA 4WO4A 4KNUA 4GQRA 4YX2L 1Q1PA 4JO3H 1FE8H 1ZHBB 2Z65C 1WWCA 4JKPL 4JZOA 4H4NA 3GSOA 4JL1A 4UIMA 1GGCL 1GSMA 4ODXA 1KN2H 4XMKL 1I1RA 1RZKL 3UBGA 1WFTA 3C5SB 1HAUA 1IGCL 2VITA 1ZE3C 3NIGB 3NQKA 3R1GH 4P4KC 5EEVA 1D6VH 1KNOB 1HL9A 2YMXH 3N0AA 3FN9A 4BE5A 2JJTA 3RL1A 4NXSA 5E6IB 3I85A 2JKJA 3E0GA 4JPSA 3I9IA 2NY3D 2PWGA 3SPIA 1G4MA 5IK3B 4GQ9L 1O7DE 2N1KA 2YRBA 2N7SA 5BS0A 5LG6A 4DERA 1BW8A 5I1GL 5ESAB 1AR2A 4FI7A 1AD9A 4WKXA 4P49A 1IC0A 1T1WA 4CRPA 1I3UA 4KHTL 5DGRA 5KTEH 3W82A 5E5LA 2RIKA 1S5IH 3MJWA 2HJFA 2ZCKH 3G6JB 4UWQB 3DOSB 1GMIA 2MNUA 1BPVA 2IBZY 5TF0A 3ZZ1A 3HI5L 1X44A 1XTLA 2Q76A 3S3PA 5SV3A 1AKJD 5IQMA 1KPRA 1L9QA 1QQDA 4O2FA 1JHKL 3HOGA 3LNHA 4PI0A 3NBNA 1L6ZA 3LDBC 3VTTA 5TPWH 1OTTC 4HD9A 5I1LB 4LU5L 5D9SB 5DD3H 1S7SB 3VYOA 3QZLA 2XTJC 4MJ5A 2R56L 1JRHL 1OAXH 2DLTA 4G9DB 4DQOL 3ABLB 3HZVA 4XCFH 3ARVA 2NNAA 3O2DH 1X5IA 1YY8B 3ERXA 2ILLA 3NIGE 4NWUH 1E28B 4NN6C 1ZHKA 1T4KB 4QLRA 1LWRA 3M1BB 4YXHH 2R7EA 2PF6A 3F85A 2AJ3B 4NCC2 4CVWA 1NDGA 1ZAGA 3FQUB 4MVBC 4F2MB 3T09A 1T1ZB 2G5BB 3Q8BA 5G5DB 1TKWA 3L1OL 4GXVH 2F7RA 1NCIA 4PV8B 2O26U 3RU8L 4CGTA 3OKKB 2F0CA 1Z9NA 1L5GB 4N0YH 1FFOB 4TSCH 3CVCA 2VDPL 4JO5A 1JD9A 2MHAB 2Z1KA 1IC1A 5C0CA 2NXYB 5AVSB 1AFVH 5E03A 3ARTA 4LCWB 5AB1A 2COQA 3TO2B 5FO9A 1FNSH 4H8UA 2BO0A 4R96A 4BQ9A 1T0OA 1YRKA 4HKZB 3TO4D 3GTNA 3ZHDA 2WIIB 1EANA 4MJIE 1R3HA 1AGFB 2QSCL 4NQCA 1SEQH 2WUCL 5ALCH 2EUWA 1WEJL 2X1OA 1JK9B 3FQRA 3VACA 1W72H 3QP3A 4UQ2A 5FOJA 1HZHH 5EZLA 3Q5YA 3FONA 4KKBC 1AKPA 5TTRA 1A6AB 2ZUXA 1WWWX 1TJIH 4FKHA 5IHHA 2APSA 4XI5C 3NACL 1FNEA 4RETB 3F7VA 1C7TA 3IJ9A 5HHVL 4FNLL 2ICWA 3PS6A 5DD5L 3FUEA 1BJMA 1NFKA 2BHUA 2OSWA 1A4JA 2ADFL 1YUHB 2A83A 1F5WA 3NABH 3EIFA 3GJFK 1C1EH 1N4XL 4UILH 5EDSA 2F19L 4N4YB 4YHLL 1PLAA 4N25A 1QUPA 2R1XB 1MIMH 2R0ZL 4M29A 2WB7A 5E5MA 5E51A 3POHA 2IV9A 5AOLA 4P2QD 1KG0A 1OW0A 3RWEB 3VFSA 4J3OF 2M2DA 5IHZA 4HOWA 2F7IA 3HE7A 5J1TC 4OIFA 1QUNB 3AS3A 1EHXA 1HQRB 1NLBH 4QYOA 4KGLA 5LAXA 2DJ4A 2YA2A 2CA3A 4NSKA 2EKJA 4RISH 3U9PL 5I71B 1CJYA 3R8QA 3QJSB 5F2FA 1AG6A 4RAVB 1KJVB 1AQHA 5BRPA 1CL7H 2CNZA 2GK0B 4FFZL 1LTXA 5EDXA 2CKBL 1UHVA 4MDJA 1MRFH 4O2CB 5IKCB 1AGEA 4L0ZA 2W07B 2WWMC 4MAYB 5I5JA 4FAAB 1LQSR 2DTML 1NGWB 2ZKXA 4WI7A 2D7TL 3BUYB 5F7MC 3KR3L 3BX7C 4CGUB 1YJDH 3AG1B 3V5KB 3KWTA 1U8QA 3L5WB 2PCFB 2NY5C 5L7XL 1UQSB 2C34A 1GGIH 1TQCC 4K8RH 3ZDXE 4J5VA 3HFFA 3TBVB 1UB6A 2XKNB 4BINA 4DZ8B 1CE6B 3WTXA 4OGZA 4PJCB 5B4MC 3O0LA 3JV5A 3KPRD 4LSDA 1JZFA 3A6CH 4I2XA 2I26N 1A7PL 3IAGC 4TVUA 4NERA 3THMH 1F86A 5T5FH 3I9GL 3G08B 4RSVA 5KSBE 2OS7A 1BQHG 3DHJA 5I6NA 5IVZA 1JVKA 4ELME 5ICXA 4NAQA 3DO3A 2YFOA 2YZ8A 5JW4N 5KBKA 3JYCA 4PCYA 1BF5A 3ETTA 1PZSA 5L9DH 2Q8BH 2XV0A 2PXYD 2H32H 5EUKB 4G8GE 1I1AB 1LEIB 3VGAC 3ZVVA 2ZD0A 3GSNH 3QEGL 4NHUA 4W9GC 3WS3A 4QHMA 3WFHA 1XH0A 3WN5A 1ZK9A 1KJMA 2VLKB 5KG9B 4A7TA 4PG9A 3ESOA 2ITFA 5BQ7B 3D9AH 2BK8A 5EO0A 1JWUA 1TFHA 1PYWB 3DX6A 1KGXA 4U1HB 3OBAA 3L7FA 1DP0A 4DH2A 3VRLF 4F2EA 3GBLA 2E8YA 2NY0C 4OCNC 4YPGA 2DIEA 2P5WA 4J8RA 2BH0A 4MQTB 1TJXA 3RNKA 4L8DB 1KYAA 3Q0HA 1FFTB 2BDNL 1U58B 1IC4L 4HHWA 1S7QA 3VDCA 1JWMB 1J12A 3DBXA 4HMEA 3QVAA 3VQMA 3D0VA 2VAAB 1E8ZA 1NBYB 1FZOA 3G9VA 4R83A 5HYSA 5JTWA 2OZNA 3GEFA 1MHHA 4KJQC 4NT6B 1F1AA 2G2RB 3O8XC 1DQJB 4XNMA 1I7UB 1OO2A 5IMMA 1IAOB 4L4VA 5FECB 3VQ2C 2F18A 4NRZB 3QUML 3U4AA 3WL9A 3S35H 2Y22A 3C09B 4D0BB 4MNQB 5D4QA 3Q2LA 5DYOB 2VDNB 35C8L 3WFCL 5CJ8A 3VTMA 4C83B 4XXCC 1MHCA 2VWEC 4PHXA 3CN0A 2EDTA 1S9YA 2AAVA 3IJSB 4F20A 1FZMB 3KYNA 4LVOC 3UOAB 1BYPA 1A6UH 3DTXA 1DUYB 1OD7A 4GKNB 4QRTB 5FV2A 2VLKE 4FZEH 5FW8A 1XL4A 3E1F1 3GSQA 3GS0A 4S1RL 2J8OA 4BFOA 1BEYL 4Y4KD 3ROOA 3WFEL 1MCOH 4LDCA 4AIOA 1B0GB 3L17A 2NYYD 3K72A 2AVGA 3T2PA 4AQEA 4DPCX 3C60B 4K23H 3A24A 4PP2B 3T0EB 1IUZA 2H41A 3MLRL 1U2YA 3RZCB 2WXOA 3FRUA 2HTKC 1KTLA 2FX9H 1VHPA 2ERJC 1C5CH 4R90H 4DKFH 3MHZA 2AEOA 2VCOA 1XCTA 2P42B 2Y6SD 3QNZB 3VGHA 4KAQH 5AOIA 1EMTH 2DD8H 3A67L 3OXSA 3WTTA 1IAIH 1QRKA 4N0UE 4PGEB 4PLOB 3MACL 4PRNB 2E47A 3M6DA 1RP9A 3C6LB 1IZJA 3P77B 1L4IA 1MY5A 3WEXA 4LEXL 1JPEA 4A63A 1J8RA 1A1NB 1KZQA 3UZEC 1DJYA 2WWOA 1I9RL 3KVQA 4JKNA 3CD4A 4OFIA 3MXWL 1H3PL 3ASWA 3E80A 4UTAL 4BRJA 4MNQE 3ZDYB 4UQ9A 1RJLB 2NR6A 1IE5A 1LO5B 4BFIB 3U6RA 1PGRB 1IB5A 1V5JA 1YNTF 5E8PA 2ZSWB 1YAIA 1S7VB 1HHIB 3IMRA 3BZ5A 4OD2A 4ANVA 3ZE0B 5CD5C 4PRAA 1THAA 5ENWA 5I5RA 3GLDA 1XGQB 3VD4A 2HKHH 4QTFA 1MF2H 5TGBA 4ZXBA 3BP4B 5KVEL 2HLAA 1KY6A 4MMYB 2C1OA 2PMZA 4N2KA 3MRPA 5AAMC 4KRMB 3FF7A 1XB6A 2RTTA 2HRPH 4F27A 1WO2A 1ML0A 1R3LB 3VGFA 4O51B 2OR7A 3GMMA 4DT2A 3T0EE 5I30H 2BSRA 2QQKL 3OAWA 3QR1A 4KVCL 3ESPA 2EXTA 4FMFA 4P4KB 1HXMB 1U9KA 3T4AC 5AUMB 2VSMB 4QTHA 3C12A 3UACA 3NRPA 5M95B 1T80A 3HHSA 5ICYB 2CH8A 4AYDC 1F1DA 2KZ1B 5FA4A 2YUXA 1QVOB 2XHNA 2VDOB 2WUBH 3HA0A 4FTVB 4GO8A 4POZC 2IH3B 4G43B 3O0RH 1FORH 3SDXE 3R7RA 3IM1A 4Q56A 5DHEA 2XPGB 5IB1B 4KK9D 4LGRB 1MCDA 3GMPA 3SJVB 3D3VA 3X3GL 1IAMA 4UZSA 1AO7A 3WEBA 4N0CD 1FGNH 1AG0A 3AUWB 4Q89A 1XT5A 2GJJA 1F4WL 4Y5XA 3GBMH 1QTSA 3H2WA 3LZLA 3ZDZE 5E2TH 2LLGA 1BQKA 2XV6B 3FO0L 3D25B 4UZGA 2OZ4L 3VFTA 2F54D 4HW6A 5H4YA 2CE6A 2IOOA 4LLUB 3ZE0E 4IGBC 1WICA 1BFTA 1SVCP 4DGIH 3P54A 1R47A