3KW8A

Two-domain laccase from streptomyces coelicolor at 2.3 a resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
273
Chain Sequence
b'GGEVRHLKMYAEKLADGQMGYGFEKGKASVPGPLIEVNEGDTLHIEFTNTMDVRASLHVHGLDYEISSDGTAMNKSDVEPGGTRTYTWRTHKPGRRDDGTWRPGSAGYWHYHDHVVGTEHGTGGIRNGLYGPVIVRRKGDVLPDATHTIVFNDMTINNRKPHTGPDFEATVGDRVEIVMITHGEYYHTFHMHGHRWADNRTGILTGPDDPSRVIDNKITGPADSFGFQIIAGEGVGAGAWMYHCHVQSHSDMGMVGLFLVKKPDGTIPGYEPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative copper oxidase
molecule tags Oxidoreductase
source organism Streptomyces coelicolor
publication title Structure of laccase from Streptomyces coelicolor after soaking with potassium hexacyanoferrate and at an improved resolution of 2.3 A
pubmed doi rcsb
total genus 83
structure length 273
sequence length 273
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3kw8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3kw8A02
2GBAA 4G7QB 1B3IA 4HAKA 1SJMA 3ZIYA 1E65A 1OCCB 2PPEA 3FU9A 2JKWA 1V54B 4A2DA 3ABMB 4KOCA 3MBWB 3T6ZA 4WKXA 2I85A 2FQEA 3QPKA 1AZCA 3UADA 2N0MA 1AOZA 2BHFA 3NJIA 1KYAA 2PLTA 2FTAA 3AG1B 2PPFA 4GP5B 4YSTA 5D4HA 1EZLA 1XB3A 3QJQB 1BXUA 2H47C 4KNTA 3TBBA 3CZUB 1NINA 1URIA 4E9TA 1JVLA 6PCYA 1TEFA 2BO0A 2YAOA 1TKWA 1QHQA 7PAZA 1AZNA 1SHXA 5B1BB 2PP8A 3H4FA 4Q89A 2EIKB 2BZ7A 3QJRB 5B7MA 1RZQA 3OMIB 1E5ZA 1NICA 1NIDA 2QPDB 2CUAA 1WA2X 5I28A 1A4AA 2FT7A 2MTAA 5I5IA 1AQ8A 3EF4A 1OE1A 4E9QA 1KCWA 1JXGA 3WKPA 3GXUB 5LDUA 1KV7A 3G5WA 2J5WA 1RZPA 1J9RA 1V55B 3PAZA 4YL4A 6PAZA 3S8FB 2MRYA 1PCSA 2EIJB 3ZDWA 1BEXA 2CALA 2YAQA 3WNIA 3ZX1A 1W6LA 3X1BA 3FSWA 1L9RA 1NTDA 2VM3A 3TU6A 2XXFA 2YAFA 2ZONA 1GR7A 3H4HA 4QKTA 4BK5C 3AW5A 4DP5X 1IBYA 3T6VA 1L9TA 3T9WA 2XV3A 2BW4A 4NB7A 1AACA 4YSRA 1XB6A 4ENZA 5I6LA 4A66A 3FSAA 1PLCA 2HX8A 2VSMB 3FSVA 4CSPA 3JT2A 5FC9A 1E30A 2AFNA 5I26A 3FT0A 1UATA 3UABA 1NWOA 1JXDA 1M56B 1ZV2A 2XYBA 1BAWA 3TASA 1BXAA 4AZUA 3UAEA 1A4BA 4DP6X 3U25A 4DP8X 3ZBMA 4YSSA 1IC0A 3GDCA 4BWUA 2NRDA 1NWPA 5PAZA 1NIBA 1XB8A 3OD3A 1OE3A 3TBCA 2UX7A 1RKRA 2GI0A 4G7SB 3T71A 5IY5B 1V10A 2XX1A 3CDZA 4YSEA 1KCBA 2FT6A 2QT6A 2ZOOA 3IEAA 2PP9A 1J5CA 5B7FA 1MZYA 4AI7A 1NIAA 3UGEA 1BQKA 1L9OA 4E9XA 5B1AB 5AFAA 4G71B 4GP8B 4DP1X 2IAAC 1WAEA 4GYBA 2Q5BA 2DV6A 4CSZA 2XX0A 1HAUA 1TU2A 1NZRA 5B1JA 3RYMA 3S3BB 4DP7X 3OQRA 1SFDA 2IDQA 3ERXA 3NJMA 3TA4D 1NIFA 2DWTA 1JZEA 1ID2A 1SDDB 1MG3C 4AKOA 2BP0B 3FYIB 2E86A 1SNRA 4RH4A 4N4YB 1E5YA 3EHBB 2YXVA 1L9QA 4G7RB 1GS7A 4HCIA 4HALA 1CURA 2GIMA 4E9VA 1A65A 4FAAB 2OJ1A 1IUZA 5AZUA 4EF3A 3H56A 4YSAA 4JHUA 1WA0X 4HCFA 1SFHA 5I6KA 4P5RA 1A4CA 1N70A 2Y1AA 4UANA 3AG4B 2UXGA 4UF7C 1HAWA 3NJFA 3X1GA 2OCCB 3NT0A 3UAAA 4M4RB 2EILB 1PAZA 1PLAA 2HRGA 2YXWA 4BDVB 1PF3A 1ILSA 3AG2B 1AIZA 1PMYA 1AS7A 2YAMA 2R7EA 3IE9A 5AKRA 3FSZA 4MFHA 2FQFA 2YAPA 1M9WA 1OOWA 3ABKB 2AZUA 1N68A 1ZIBA 4KNUA 1KGYE 2A3TA 2WO3B 4PCYA 2VW4A 3MX0B 1GY1A 2VMJA 3EH3B 1J9TA 1PLBA 2IWFA 5B7EA 3WIAA 3AY2A 2XXGA 1MZZA 2J55A 1VLXA 2AANA 2BW5A 1L9PA 4L0PB 2CJ3A 1AZBA 2VSKB 5A7EA 1JXFA 2BWIA 4BDVA 2YARA 1KDIA 4BWTA 4YSCA 1OV8A 4YSPA 3OM3B 2HXAA 2IH8A 2Y69B 4KO6A 3WI9A 3NJGA 3QJVB 4HHGA 3ASNB 4DP0X 3PCYA 2GHZA 1GY2A 3S3DB 3NP4A 3FQYA 2UXVA 3DIVA 2UXFA 1PNDA 1ZPUA 1OCZB 2TSAA 4N8UA 1R1CA 2P80D 1AS8A 1J9SA 2UXTA 1FFTB 5PCYA 2TSBA 1GS8A 2BP8A 4YVNA 3X1FA 3L45A 4PAZA 5I5MA 1NDTA 1T5KA 1BQ5A 3KW8A 5TK4A 2XWZA 1MG2C 1I53A 1NPNA 1DZ0A 1JZGA 2X88A 1SDDA 3NJLA 4WTQA 2FJSA 1PZCA 4A2FA 1CYWA 2I7OA 3KW7A 4TXVB 1GW0A 5D4JA 4G72B 4QLWA 3IN0A 1JZHA 4HZ1A 1ZDQA 2H3XC 2HLEB 1SF3A 2HX7A 2JXMA 4JKNA 3PLYA 3V9CA 4UAHA 1ASPA 3BVDB 3FQ2A 3QJSB 4BWWA 1PY0A 1JVOA 3FPXA 2FNWA 4G70B 2QDWA 3D12B 4F2EA 3NP3A 1DYZA 4YSOA 2CAKA 3QJTB 1W8EA 8PAZA 1PNCA 3FYEB 2YAEA 2DYRB 3AZUA 2P80A 2IDUA 1AG0A 3EH5B 5E9NA 4P5SA 4A68A 1JZFA 2AZAA 1TEGA 2DWSA 3X1NA 3C75A 2H5UA 4GY4A 2JFCA 1YLBB 3V9EA 1E67A 2Q9OA 3FU8A 2PP7A 1J9QA 4YSDA 2XV2A 3ASOB 9PCYA 2LLNA 3CVDA 1F56A 3CVCA 4HIPA 3QJUB 5EHFA 3N55A 2CCWA 4AKPA 3PXLA 3FU7A 3DTUB 2PCFA 2VN3A 2YAHA 2RACA 1SHWA 2XUWA 1IBZA 1A3ZA 2HZHA 4A2HA 4DPAX 3UACA 2B08A 4W1TA 3SBRA 3SQRA 1HFUA 2BWDA 2WO2B 3IN2A 3BQVA 3PAVA 1ET8A 3WKQA 2GC7C 2WSDA 4HCGA 3T6XA 3NSFA 1OCRB 2VW6A 5I6MA 2XVBA 2W8CA 4E9RA 5I5JA 1CUOA 3HB3B 4KO9A 3OMNB 4AKQA 4DP2X 3HEIB 4YVUA 4A67A 4BXVA 1RCYA 1OCOB 4DP9X 1JZJA 4KNSA 2UX6A 3GYRA 3X2QB 3EH4B 2XU9A 3SBPA 4A2EA 2BP8B 5I6PA 4A2GA 1OF0A 1BXVA 4GP4B 3PPSA 1ASQA 2IWEA 1MDAA 1ET7A 2R7EB 1ZDSA 4DP4X 3SBQA 3N2JA 2FQDA 5B1JC 1ET5A 3FS9A 4FA7B 4KOBA 2PPAA 2HRHA 1AR1B 7PCYA 1ILUA 3FPYA 3NYKA 1ADWA 4GXFA 4E9YA 2X87A 1FA4A 1XMEB 3NJHA 5B1KA 1WS8A 2J57A 4YSQA 2GC4C 2IDTA 1KBVA 2I7SA 3ABLB 4W9ZA 1AANA 1PZAA 1BQRA 3ABGA 1KDJA 5F7AA 5I6NA 1AZUA 1KBWA 3NSYA 2QDVA 2QPEB 4E9SA 1QLEB 4E9WA 1AS6A 5TK2A 4BXSV 4F2FA 2DYSB 5B3SB 2FWLB 2XLLA 1IKOP 1AZRA 2VM4A 4KO7A 1NPJA 4NAJA 3X1EA 1A8ZA 2IDFA 3FQ1A 3CDZB 1X9RA 1OE2A 2GB2A 2IDSA 1PZBA 2GSMB 2YQBA 5I6OA 4AX3A 1AAJA 2EIMB 1JOIA 2OV0A 2B3IA 4KO5A 1JERA 3CG8A 3S3CB 1ETJA 3FU7B 1FWXA 1M57B 2XV0A 2VW7A 1J5DA 4M3HA 3IBOA 1QNIA 2BP0A 5D4IA 1GSKA 4YSUA 2AVFA 2IH9A 2FT8A 3CVBA 4JHVA 3T6WA 3NSCA 2ZWNA 4K9JA 3S8GB 5ANHA 1CC3A 1NIEA 3DKHA 2BZCA 4DPCX 4NERA 3NJNA 3OMAB 1BYPA 1GS6X 4F7KA 3WNJA 1JZIA 1BYOA 2PPCA 1ASOA 2ZXWB 2PPDA 3PAUA 1EHKB 3NJJA 1L9SA 1ZIAA 2FQGA 1WS7A 2PCYA 4DPBX 4HHWA 2EINB 1GYCA 1W6WA 1AG6A 2DY2A 1SF5A 2HX9A 2J56A 1X9UA 2W88A 2IWKA 1WA1X 3JTBA 3AG3B 3QQXA 4X4KA 5F7BA 3NJKA 3WG7B 3NSDA 2CBPA 4ZK8A 4Q8BA 1CYXA
chains in the Genus database with same CATH superfamily
4JBSA 1HH9B 4XBMA 4MASA 1JYVA 1CDJA 2ZCLH 3TCLA 1KTDA 1MRDL 4L5FL 3GJFB 2C3VA 3AC0A 4KOCA 3L9EA 4N2KA 4AH2A 1V5JA 2B7DT 5FW6A 3VM7A 5CAYB 2OCJA 3ZTDC 2WJ5A 1WFIA 4UV7H 3TFBA 1A25A 3OKLB 2EUZA 1CVRA 3QCUH 4OZFH 4AE1A 3CFJA 5IJCC 4XPTH 2J8OA 2YHGA 4EUPG 2BVEA 3U0WL 1CFTA 3P73A 2FUTA 2H1PH 4FTVA 5GSVB 3WKNA 4DKFH 1QKZL 3EYQD 3PHQB 2DTML 2GK0B 1B0IA 1V7NL 2C4XA 3V5HA 4TNEA 1NCOA 4AXWB 5M7QA 4J4PD 5LGHL 2KMWA 3R4RA 4F3FA 4F9LC 3WIIL 2LAGB 4Q2ZA 1UJ3A 2ARJA 4PS4H 1DVTA 4G43A 5C0JB 3T3PF 1FO0L 3C8HA 1NEZB 2XG4B 3FN0L 3ILQC 3MNMA 4H88H 1L6ZA 4QT5B 2LQRA 4RRPG 1T0MA 3NK3A 3E3QE 4L18A 4G82A 1MF2L 3H53A 4HIIA 2WQ8A 1L0PA 4G80A 4YDMA 5LO7A 3BKCL 4YFLI 5IMLB 5IHHA 3OZLA 4TLKA 4ZUVA 1RXLA 3C2AH 4AQ8C 3HZVA 2HP4A 3T8MA 2A74C 3ZX1A 5LBGA 4ZAKA 1GC1L 1ZA6B 4YX2L 3LZLA 1L9RA 3D3VD 3TU6A 3QNYA 1ROWA 1XAUA 5JHLL 1JF1B 1DDHA 4QUOA 1JPFB 1L9TA 4OZGA 4KVPA 2BW4A 1RUKH 4FE9A 3D30A 3IB4A 2G30A 3L1GA 1KOAA 5EC1B 2OTWA 4FQCL 1HE8A 3CZFA 5FC9A 3MXWH 2DMKA 5I26A 1RZFH 2D2CC 3VXTA 1J1XH 4I7ZC 4FN0A 1FLTX 3MJ9L 1CTMA 1P4LB 2A38A 2HCZX 2I26N 4IOSA 2WXNA 5H37A 4DP6X 1KZQA 4M3KB 4QOKE 2NRDA 4B95C 3GFUA 1UASA 1OANA 4K9EH 2GTWA 3OD3A 2J8UA 2X53A 5AL0A 4EDXA 3U2JA 1Z6JT 2UX7A 4WWKD 3NEOA 4OVVA 3AS3A 5CKGA 5GS0H 2ZTBA 3TTYA 1QR1A 5F89B 1A02N 3BAEL 3HB3D 5B7FA 1T20A 4MVBD 1J1PH 2I60H 5D70L 3UGEA 5F0JB 2IGFH 2HPOA 1A1OB 1CGXA 2VJ0A 3V0DA 1KUMA 4LEEA 3ZGIA 1ORQB 2OMYB 4JREC 4NBZB 4BGLA 4K5NA 3PWPB 5B8CC 1O6SA 1DL7H 1SFDA 2IDQA 4PRDB 1TVBA 1SMDA 3WTVA 4ZX6A 1MUJA 4P3DA 3KYAA 4EDWL 3D2UB 4KKRA 3SE3A 4MZ2A 5DO2D 4GW5B 4X5RA 1SYVB 1GS7A 1QFUH 3N85L 4HALA 4KDWA 2GIMA 2VLKB 1IX2A 4HBCH 2IGTA 1NAMB 1KY7A 2R2HB 1KCUH 4R2GD 5HHMB 1DJYA 2NUPA 4Z23A 2BSSB 3H9YA 3AITA 5DVMA 3WN5A 4N87A 5AZUA 3BI9X 5E8PB 3NCJL 3BYTA 4HUWB 1JZ5A 4Z7UA 1YMHA 5DMYA 2FBJH 3UBGA 5IBLD 3MRQB 4LPUA 5LBSL 4ZMTA 5JR1L 1RZKH 2MJWA 1YEFL 2OJZH 2XACC 1E42A 4J1UA 1MIEH 2WOYA 1KGXA 4YHNA 3AABA 2FR4B 2P1YA 2VLRA 4RMSA 5GGVL 4IS6B 4MNQD 4NUQA 1MCBA 2JKRM 2ZSVA 3D07A 2FQFA 1N6VA 5CJXC 5C1MB 5HY9A 3ABKB 4FS0A 3CX5K 3LRSA 3VFOA 4QKXB 2ERJC 1WD8A 2A3TA 3A6BH 4FG0A 4OIAA 4PCYA 1SUHA 4K3DL 5LHDA 2QVIA 2H45A 2VMCA 3RVTC 3P0VH 1UWGL 4P5TB 1WE5A 1YMMB 4V1DD 2V8LA 3MBWA 4LXFA 1JNLH 4JHWH 2DQTL 2E4FA 1QASA 5FECB 5F96H 1XGZA 2OM5A 4ZUSB 4BKLA 4JY6A 2MQ3A 1FJ1A 1T66C 2V4LA 2YARA 1KDIA 1BVLB 5KBKA 4S11A 4HQQL 1WAPA 1WJ3A 4K8RL 3HUJF 4ZAKC 2IH8A 5G5DA 3BHBA 3PPEA 2FO4B 2EXYC 4NBYB 3S35X 5HI5C 1H15B 5DZJA 4K5MA 3LZFL 3SB3A 1TZ8A 4FQXA 4Z5RA 1JZ4A 3NP4A 3CHQA 3VI3B 4DGYH 3G04A 3VACA 1DSFL 4AL8H 4GUPA 5A2JH 1NLDL 3DOSA 2BIHA 2TSAA 4W4NA 1CG9A 1CXEA 5D96C 4F2MA 1VSCA 5CHNB 2R2CA 2UXTA 3J07A 4OF0A 3V6FA 3P2DA 3ATDA 4LSPH 2H6OA 1TFPA 1P5UC 4FFYA 3QFGA 1KZYA 4NKIH 3EAKA 4LLQB 3MTXA 4P59L 2QHRL 5C7ZA 3QFDB 5TK4A 2XWZA 3INOA 2DQFA 3CX5J 1S3RA 1F4XH 5AOZA 1KPRA 4MJ2A 5IFHL 2DYPB 3IWVA 5EBGA 1HESA 1CYWA 2KQNA 1BZ8A 5AYTA 1GW0A 5ID0A 4NQED 3B5GA 2Y7LA 3SGDI 1XR8B 1A1NB 2OMVB 1ED3A 3IRZA 1L9NA 2IAMC 3LEXA 3O8XA 4NHUA 1N8OE 4XP9L 3T1FB 5JHDB 3ZHLA 2FEDC 4X7SH 4Y4FA 4P49A 4QOKA 3DIFA 5CHNA 5CP3H 3AWGA 4M8RA 5D6CA 5ADPH 5F9JA 2EUVA 4LESA 3C6LA 3MUGA 3QJTB 4YZFF 1AQKL 1RIUL 4IBLT 4JB9L 3NSXA 2DYRB 4AYDC 3IT8D 2VSCA 4L1TA 4GKSA 1AG0A 3GMLA 4PG2C 1YN7B 2FEEI 4FQJL 2BOCB 4KRMB 5AB0A 3ULVD 3HMXA 1VFAA 4Y1AD 4JRLA 1B0RB 1QFWM 4EIBA 1NCDH 4QOKB 1UD4A 4TTDC 1MRCH 2H2PD 4HIPA 3GUFA 4OIFA 1AVAA 4BQ9A 1RZJC 1PSKH 1KIQB 4BUGA 5IQMA 4N2HA 2Y36L 4M62H 2PMZA 4NM8L 4OZIA 1NGQL 4O2FB 2AK4E 3VI4F 2L3BA 4IGBD 5AZEH 3FUHA 4MDRA 4JHAL 3SOTA 4AVKA 1RK7A 4CC1A 1FIGL 3N41F 3WJJA 5DO8A 1KF9B 5KJ4A 1Q38A 3JYBA 3LJ3A 5KYUA 5KW9H 4N1EA 3RWEB 2IDCA 3F01A 3LN4B 1N59B 4Z7UE 2IAMD 4F9PA 5I1GL 2C3HA 4U1LB 5JPNA 1H0DB 3CDCA 3BZ4A 5IQNA 5JXEC 2BVQB 1X7SA 1OAUL 1WC7A 2JWYA 2M2DA 2VLRE 3J27A 4JZJB 3WJMA 4APQA 4F15B 3MLVL 1F13A 2OTPA 1HHIA 2OMUA 4APXB 3M6DA 3DSFL 3PGCB 1CICC 1WBZA 1Q1JL 1S9VB 4B9FA 2WIIA 4I77H 4KC3B 3MREB 4HLZH 1NEPA 1AQDB 3PABB 5ABAA 4BK8A 5I1IL 3GRGA 5HHOA 4TF4A 1I3GH 3B8SA 1MXGA 4CMHC 2R29L 4FNTA 4X6CA 5HTSA 3PV6B 5D2NA 2GJ6D 3OB8A 2HT3D 2Q7YA 2EYTA 4P5TC 5EZIH 4O51A 4PGEB 1CD8A 2QSTA 3CVHL 3P9MB 4WWKC 3X3GL 1MIMH 3OL2A 5TTRA 3P4NA 5ESVB 5KSAD 1F58H 2QSVA 2XOTA 2FWOA 2X6VA 1DQJB 3DHMA 4MYPA 3SPHA 3ZO0A 4ZMZA 5KYWA 3PGDB 4HXBH 3WLBB 3GLEA 3O41B 2AMUA 1A22B 1S9VA 4QRPA 4YC2B 2A6JB 1RUPL 3BXNA 1D2PA 3VGAC 5BXFA 4OZGF 4B6ZA 4PRHE 2GUYA 3NSYA 1HNGA 5LAXB 5JA8B 5AVRB 3W0WA 4AUYA 3FQRA 5DD1H 5T1LD 5GXBB 4HS8H 2XFXA 4XN8A 3VFMA 1YEGH 3UXFA 3FQTA 1X5HA 2BM3A 2VLKD 2VZVA 4O58L 3OX8A 3FQ1A 3O9WA 2W59A 2NY4D 1YEJL 3WO4C 1CLCA 1EGJA 5AAWA 1IKFL 5EZLA 2WBJA 4LIQE 1DJXA 4MMZA 4M93B 2NY0C 4QRTB 2F19L 4V11A 2B3IA 3TIEB 4F9LA 4KO5A 1JERA 3E2HC 5SX4I 4Z7WA 2A1WL 2CHXA 3C8KB 3HI5H 3R06B 3MXVL 4G59C 1BF2A 4JJ5B 5LCVL 4ODVL 4P06A 1CT8A 1KELL 3OR6A 1YECL 2UZIH 1FGNL 4WWOA 2B0SH 1YCSA 4B0MB 4F27A 2F5BH 3OZ9L 2EC9U 2LU7A 2IH9A 3B56A 2LTQB 3IDIB 3SYCA 1U8NB 1J8KA 2F6AA 3KYKH 4OCXL 4UDUA 1RMFL 4QPEA 5E03A 5SX5H 3ZTNH 1LMIA 4M7LH 4X9YA 3NJNA 5HHQA 1TXKA 1JDDA 1U8LB 4LRIC 4EQ2A 4G83A 2XKUA 2ZP0T 2P49B 4W6XB 4OU3A 4LFHD 2IOOA 5DLMH 1T2QH 2EKSB 3O45B 4TQPA 4PIRF 3VH8B 1XGQB 2OLDA 1LLAA 5TFSH 1GMEA 1D6EA 1IC1A 5K9KB 1H19A 5HYJB 1TFHA 5GGSB 1LO3H 4FG6C 4HUXA 4K9EC 1F02I 3TO4C 1JE6A 5DJAB 1AY1H 4JFYA 1NDMB 3D1MC 3DPBB 3ARYA 5E2WL 2VGLM 2XIDA 5KJRL 4KKPA 5D1XD 3ZIYA 4EN3C 4X9GA 5CSZB 4LLDA 4U1NB 1CR9H 4XN4A 3BP7A 3ZYOA 1B4JL 4PI2A 4ALAL 2YBRA 1AFVL 2I07A 2BX5A 2WV3A 1KT2A 2PTTB 3D3VB 2IAMA 2XWDA 3NA9H 4D94A 4OM1L 1LE5B 1IC4L 1HCFX 3L4CA 3F12B 1QLEL 3D2UD 1CD0A 1W72L 5I1CH 3N43B 2WD0A 2A9CA 5ESAB 4PJ8B 1U3NA 1R3LA 3WKML 4AQZA 1YEHL 2J6EH 2F8IA 4NQDE 4R2GB 4MGXA 3ARUA 4FHKA 2C7FA 4HFWA 5B1BB 1DJWA 4TL5A 2WMPA 4PJ7F 1CGSH 1FFPA 2C1PB 1S7WA 1SOQA 3LNIA 3N3EA 3P9MA 2E27L 3V4VH 2WVSA 1QLFA 4H0IA 4XMPH 2FWOB 1DVFA 2BIQA 1EJ6A 2LGNA 2UY7B 1L9MA 1OQXA 2HT4C 3EUUA 1A14L 4OLWH 3SEPA 2ZWSA 2GJ6A 4KUCD 5I1KH 2XWRA 4AW4A 3VGHA 4JQIH 4BKLB 4ZUSA 3IMTA 4X6CE 4KQ4H 4Q6IC 5I8EB 2MRYA 4C56B 1NLBH 3HPJB 4OSUL 3OLDA 1RHFA 3K72B 3TNMA 3X1BA 1A2YA 4AMKH 5AAMA 1DQLL 4KXCA 3TT1H 1ES0B 3BP4B 4FFTA 4KAQL 1I4FB 4L0ZA 5FFOA 4XMTA 4G43B 1JHLL 4Q9BA 4JM2F 1L0QA 4FI8A 4LBEA 4P5TD 3ISYA 1X5JA 3HAEB 4PG9B 4PVBA 4KFZC 1MHHA 3QDJD 1KYOJ 5C0IA 3W0WE 5JZ7D 1BVOA 2ZCHL 1IGTB 1GTFA 4GUOA 2CKNA 1E30A 2YPVA 5BRZB 1Z2KA 5T5FH 1EAOA 3FT0A 4L8SA 2UWEB 2Y5TA 5G4MA 2D4FA 1J1OL 1JXDA 3D05A 2XYBA 3O3DA 2WAHA 4MDIB 4M6AA 2CG9X 1DBKH 2GY5A 4C56A 1KTRL 3MV8A 1TYRA 3HPJA 4Y5YB 1ERNA 4K5OA 3BD3A 5D7KE 1NWPA 3VMNA 1NAKH 3QDGD 1CN4A 3CHOA 1MHPH 4ZPTA 5GGRA 4HIHB 5DHMC 5JIDA 4OLUH 4P2QB 3WBDA 1AD9A 5EA0L 4PJGA 2GI0A 3TZVC 2IQ9L 3WE1A 2ICWB 4DKDC 2E9WA 4I4WA 4MXWL 1O7DC 3WFHA 2A77H 5KVEH 2CHWA 1Q9KB 5DD5H 4AM0A 1DBJH 4MRBA 4RWYH 1J5CA 1PPIA 1CDUA 1F6AB 3T4YA 4ELKB 1RERA 3GMPB 3QUZD 4FQHA 4GP8B 2P26A 3ME0B 3IGAA 1JPTH 3OJMB 4PJFA 4GYBA 4UUJA 2YKLH 3QULA 2F53D 4LSTH 3V7AE 4K94H 2XX0A 4HFUH 1HQRB 2YGPA 2CCLA 3NH7L 5IESH 4HIEB 3MV7A 2EE0A 4DAGL 1SDDB 3DK0A 4KVCH 3RGHA 1KN4L 3M17A 5JMOC 5CSBA 1JMZA 2NY3B 1KFAL 3MV11 3OKMB 5IOPA 2KI6A 2XN2A 3QJFA 1A65A 1E9OB 2APVA 3RTQD 5IUCA 2HH0H 5D7JA 4N1CA 4XVJL 5A2FA 4J7RA 1HWGB 5CGBA 2W07B 2CXGA 3QUKB 3ZGHA 3PJNA 2MPAL 1KYDA 3D5OF 2AF2A 5DUBA 1MPAL 5T3ZE 5IV2B 1F5WA 2AAVA 2CZNA 3ARWA 3MRFB 4FMVA 2YD5A 5JOFB 4LPWA 1VF5C 3VRLF 4G1MA 4HCFA 1XXDC 5I6KA 4K8RC 4PGZA 1CLYL 2A9NL 1UA6H 3PHOB 5LUMA 3OF6D 5F6HI 5IFJB 1BFVH 4X6BB 1XSJA 4HKXB 3HR5B 5C97A 2YXWA 2NY0D 5K5YA 2FL5A 3WOVA 2APBA 4WJKB 4GW5A 3Q2CA 4PJEF 1XL4A 3HE7A 2IG2L 3FB7A 3EO9L 4IRJA 3JV4B 4ZTPH 3VFGL 4NQCE 4UV4H 4Y2OB 4OV5A 5EN2B 1DVQA 1GAFL 4NENA 2OW6A 1NCHA 3QNYB 4JFDB 2Q86A 4IOIA 2NUTA 1B9KA 2WO3B 3Q8AA 4HX1B 3O8XD 4XNBA 3AM8C 3DDFA 3IGFA 3TF4A 1PZ5B 2ITCB 3KJ4C 4YHLL 1HX0A 4HV8A 1CF1A 1CFNA 1U6AL 2XG5A 2XXGA 2OK0H 4PJAB 3KM1A 4DKAA 3GLDA 3E6FB 4N8VG 2XRAL 1QFOA 3NIDE 4M61B 5DZOA 1UEMA 1NBYA 1F3DJ 5F21B 3QA3B 4L8CB 2B39A 2WKGA 3CFJB 4KQ3H 3RX5A 4JDTH 1AGBA 3ZE1B 1IM3B 4HKZB 2FSDA 2PF6A 4KMLB 5JIHA 1YNLL 5T5NG 5F6IB 2GT9A 3FH8A 3L9YA 3D85A 1XGPB 3PWLA 4E41E 1A6UH 5GZNA 1PKQA 2BS8A 4N8PA 4Y2DC 5F88B 1J5OH 1LWHA 3LIUA 3S3DB 1EDYA 4U1IA 2I9TB 1S5IH 3IAQA 1OSEA 3QHZL 1RHHA 3BOVA 4K3HA 3F7PC 4ZDHB 1UENA 2QV4A 3OWRA 4QHPA 5AW4B 1I7UA 1T0MB 2X5PA 4MJ5A 4HH9B 5IW1A 4WI0B 4XCFH 1FYTE 3QPXL 2EO7A 1VZHA 4KI5E 4N8CH 4UT6H 3O4OC 3R8QA 1VACA 4OCWH 3T77A 1FFTB 4EN3A 3VG0H 1BOGA 4PGJA 3S88H 4ODBD 3G6AB 3S3PA 4U1KB 4YDKL 4WW2C 3VE0A 3LPWA 3SO3B 5ACZB 4UM9D 2ICWJ 4WW1A 3C87A 5EOQL 5DHXB 4P57B 1QW9A 3T3PB 4UINH 4ZPTB 4TNGA 4WTQA 3F58L 3NJLA 3OAZH 5E2VH 3G08B 4M1GH 3KEDA 3GSXA 1F41A 3S37X 1IGIL 3KEHA 2XN9E 4OQ1A 4PWGA 4DEPC 3AS2A 1N26A 4CJ0A 1NFIA 4GKZB 1JFQL 1FAIH 3UIYA 1NUNB 1ZXQA 3KVPA 4ODXA 3BVXA 1AC0A 4C56E 5EO1A 3C5JB 4Y19B 3HHMA 4R9HA 1IGYA 4XGZA 4UT9A 2H0FA 2JLPA 3BW9B 3DSNA 3DVNA 4R5TA 1S7RB 2VDOH 3AUWB 3O6KH 4OCRL 2J71A 3VW3H 3NPZB 3JTTB 5IW3A 1MWAL 4P3CH 3SGJC 4PJCE 4XCEA 4LKCB 5HJBA 4P5SA 5EIIA 2VIRA 4N0UB 2YUWA 5ADOL 2NCMA 1TDQA 1N12A 4WGWB 5IFAL 2P5EB 3FU8A 4FI6A 5C71A 4BFJA 4JO1H 2APTA 4PJFE 1N3NB 3ULVE 4I3RL 1PDKA 3MLUH 1QSFE 2E46A 5HP5A 4IJTA 4QHUB 5L0QC 4MX7B 1GC1C 1QACA 1XIWC 4NQXB 2WQAA 3VA6A 4KHTL 3UTZA 3FT4B 4G1MB 1O6TA 5JPMB 3HS8A 1YA5A 4X6DB 4BFIB 1AJ7H 1PY4A 4Q0XH 1K6QH 3APCA 4PB9H 4AQEB 1I1AD 4HKXA 1MFNA 5EIQA 1NCAH 5BOZG 2HZHA 2AEPL 4OZGE 3SQRA 4AZ8B 4RGNE 3VXUD 2CLRB 1ET8A 5FUCE 1SJEA 2FK9A 4G8FB 5HHPB 4S10A 4MD5B 5IB5A 4NN6B 4JRXE 2K45A 4OLXH 2NY3D 1OSZB 3K80A 3VXRA 5F7LB 1MCWW 4E9RA 5FEBA 4HKBA 4KX8A 2ITCA 1IV8A 4F58L 4AKQA 1Q72L 1JRHH 3NAAH 5IQ7L 4UZSA 2YBRB 5FF6A 4K3EL 3SCMC 2ED9A 2P46B 2YMXL 1M7DA 3I02B 2ZX5A 2VLLA 2H6PB 4ZAKD 3EH4B 2CRMA 3PQYA 3NOIA 1PZ2A 3SE6A 2BRQA 4TVSa 2R8SL 1W80A 5E6YA 4KRPC 3S2AA 1CCZA 1QEXA 1HZKA 1GSMA 1OPOA 4QO1B 2V7NA 3AT9A 4HJTA 3S0PA 3V0JA 3T4AC 4GBXA 1CDBA 4FA7B 2PN5A 4J3WA 5FAAA 2HRHA 4LLYA 5KSBE 3TZVB 1JWSA 3IXAB 5ETUB 4RAUB 2GSGB 1VFMA 3O8XB 1DQQA 1OAJA 2ADYA 4M9OA 5LGHH 4YSQA 3I02A 2NTSP 3ARSA 3NABL 4FULA 2I7SA 4IJ3B 5D7JC 5A16A 3T8VA 5GZND 1VKXB 1BQRA 3SE3C 1I1YA 1WZ1H 2Y7QB 3RWIA 1G87A 4Z78A 1D5XA 4WIQA 5CP7A 4M8UA 2K6ZA 1H3WM 2BNQD 2QGCA 2QPEB 4C59B 4E9SA 5HGBA 3LRKA 4QO1A 1KBGH 4I3SL 1VEMA 3FRUB 2PXYB 2V33A 1SBBA 3ZR5A 4JM4H 2ZT9C 2X4TA 1HHJB 1RFDL 1SOKA 3CFNA 3K8MA 3LSOA 4XPAH 2R15A 5EORH 1RY7B 1TCMA 3UP6A 3SKJH 2IANB 4XO5A 4EXPX 1JG9A 4MYWB 1QA9A 4XMZA 3VD3A 1OP3K 1AGFB 1PBYA 1MCPH 2AJXL 1S7SB 2BNRD 2GSMB 2JELL 2W80C 3MBEC 4GOSA 4NNXB 4XNXL 3CFQA 3GSVA 4ZD3L 2X12A 1EEZA 1NEUA 3GF8A 5HHMD 5BXFB 3BVNA 5AW8B 4RLDA 4F7CB 3N0AA 3BW9A 4U3SA 4NJ9L 3T0VA 2ZUVA 1FNSL 5HVGB 3FT9A 5CD5C 2NQCA 2XN9A 1SBSL 5L2KE 2Q10A 4QYAA 1RZFL 3WUWB 5I9QB 1OAQH 4IKNA 3HR6A 3KL3A 4HH8A 3K4ZA 1XCTB 5DJYA 1GSKA 3I75A 3CN3A 3AS0A 4ZMPA 4NUPA 4D9RE 3CVBA 3IU3A 2H41A 4MZRA 4WUUD 3U1QA 3FONA 3FQUA 1XXFC 3KPMB 4B7IA 1NEZG 4GXUM 1NIEA 5CZXD 5AL8A 3CNKA 3N1PC 5AAMC 3P2TA 3CVIL 4UNIA 1BQUA 1NJ9A 3BVNB 5E4IA 4WI4A 5AVXB 3MLZH 12E8L 4PRNB 3P9WB 2G5RA 2AQ1A 2DH2A 3Q48A 4HBQA 4WWKB 4G5ZH 3ZQ9A 1LO0L 3DJSA 3E8UH 1FGVH 15C8L 4B60A 1AGEB 1FZKA 2F74B 5FO8A 3N1FC 2BCKB 1M3JA 4M00A 3DROB 1DCEA 3NACL 3FAWA 4PJAE 1AQDA 4F1SA 5ID1A 3KS0H 5T1KB 1M7IA 2JCCE 3NJKA 3RI5K 2FX7H 4TUOB 2QSQA 4GW1A 4XP5H 3A67L 3KPMA 1RIHL 1M7XA 3JQOB 3ORJA 4PMEA 1OCCB 2EIBA 3HNTH 5EDXA 3UYRL 1MF2H 3FCUB 3IRCA 4J28A 5SV4A 3TBSB 2YXMA 1RULH 3MBWB 1PQZB 1CXIA 4N20A 5D71H 1WWWX 5CJ8A 3SYQA 4FLHA 1LE9A 3QPKA 4YZWA 3C2AL 5HVHC 2EYRA 2PLTA 2HN7A 4FRWA 2GY7B 4QXGH 1FN4A 3FO9A 3LKSA 2X4QA 4HOWA 4JFHE 1GC1H 3DV6B 2MSPA 3TFKC 1MUJB 3ECBA 5EIIG 3EBHA 3OAYK 3BGMA 5IVZA 4KNTA 43CAB 2YAOA 4MJ4A 1A6ZB 4MD4A 5DJ6B 3RTQB 1ZLDA 2V7NB 1HZHL 1AGCB 3ARFD 3HZYA 4IRSC 1I1FB 1XCQA 3KWWA 3PUCA 3DXAD 4YDNA 1MXDA 2F54A 4QRUB 5DMKA 2BZ7A 1L4IA 3VWJC 2X89D 5KYYA 3BP7B 3GK8H 1ONQB 1YEKL 3PQYE 2B1HH 2RBLA 3CDFA 3E8VA 3KXFD 4ZS7L 4Z7VA 2YD9A 3I9PA 2X4RA 4GH7B 4JRWA 5TE6H 3DO7B 2BJMH 2A7BA 2R39A 1BLNA 4JKLA 1KV7A 3BO8B 3G5WA 4OQTA 5CP7B 2FGZA 4JR9H 4ATTA 1D7DA 4JFFB 3MOQA 1ZJBA 2R0ZL 2OSLB 5F1IB 5L9DL 2ZD0A 2B59B 1AYRA 2D3JA 2ZAHA 2QLVB 1HOEA 5GS0L 2DWYA 5IQ9A 3B2VH 4YFLF 1DN2A 5INCB 4AJWA 3LN5B 5DMKB 1QSEA 5ID0B 1Q94A 4ZMAT 4NRZB 1B0GB 4J3BA 1RUAL 2EYTB 3US9A 3MRGA 5CGYC 3JV6A 4QXVA 1JAEA 3T9WA 2NT1A 2XVGA 4UWQB 1JDAA 3TBVB 3SCMB 2A4ZA 2AK4A 4G8IB 1S5HB 4W9DC 1WCBA 3UGXA 1E3FA 4A66A 3TZVD 5FO7B 3BQUB 1CFVL 1WT5A 4IHBA 5CJ5A 1JHKL 1CI3M 4IHOB 1I9RL 3P77B 1PYWA 3WAJA 1G7IB 2CQVA 3KNBA 3MRJB 3QJZA 3B6SB 4LVOB 1F11A 1E9QB 2LVEA 3D39B 3F7QA 1NLDH 3L5WA 1IC0A 4HK0B 1EFXD 3GINA 4FNRA 3WUWA 3N85H 4HLEA 1NC4A 3WHXB 1KLGB 4DVBA 4I0PD 5DJYB 3TVMA 1QTYT 4GAGH 3L3OA 5H2BB 4BRVA 3OVUB 3PFQA 2IH3A 4KUZL 2ALAA 1IEHA 1IM9D 4MQ7B 3T3PE 1DJSA 3WCYA 2PYED 1S5HA 3EOYG 2QHRH 2ZICA 4JKKA 4YSEA 3FONB 3FQUB 3SO3C 4IBQA 3DOSB 4C8XA 4AIXA 2P5PA 3IAPA 1RZKL 3QZOA 3VXMA 4BZ1A 1C1EL 1NGYB 1YPZB 3GTVA 5I0YA 1WEJH 5DRZB 3BEWB 5HHVL 4D0DB 1P9MA 3QSKB 2WB1A 4FF9A 2DV6A 3MJ8A 5ANMA 3MZTA 3V0IA 3SIKA 4PGCB 5JNYB 5FYJH 5D1QA 4Y5VA 4HJSA 1MCEA 2HFFA 4X7SL 1A7NL 2J4WL 5I74C 3IMWA 3AREB 3N0PB 3NQIA 4XN1A 1TTRA 3ARRA 5FHAH 3V6OC 1OP4A 2QQNL 3FYIB 4G9DA 1M53A 3D48R 3KD4A 4I18B 2C9XA 3ARXA 3G9VA 3RNQB 1E5YA 1ZGLA 2YXVA 2C9SA 3DX4A 1CURA 2B20A 3EYSL 5BZXA 4EKJA 5DTFB 2DIJA 3T8XA 1H0DA 3EFFA 1FFPB 1HJBC 3LZRA 2C1PA 3LZNA 3TM6A 4IBSA 1OK8A 1U8QA 4KY2A 4JHUA 1HXKA 2YR3A 3DARA 1NDGB 3CWGA 5I0DA 4YR6A 2CGYA 2XG4A 3G5YA 1MHCB 1N70A 3RGBA 1HYSC 1TR7A 4O4YH 4JEGB 5HDBB 1RIVH 3QZPA 3X1GA 4EN2A 2WQXA 3AQXA 2WLKA 2ZX7A 1WZLA 2EYSB 5C6PB 1E6JL 2B2XH 2NZ1A 3ECBB 1JL8A 2FGWH 2R4SL 1G7PB 5HHOB 5FKAB 5F6IC 2DLTA 1P4UA 4WCYH 2ENQA 3KHOA 2XTJD 4NM8H 3RGVB 1AS7A 1G6VK 4AYFB 3T6QC 5DJCA 1MCSA 3UROR 3EOAB 4WI5A 5AZEL 4MMZC 2NR6D 4OV6F 5E56A 1C5DB 3EDFA 4M56A 32C2A 4AL8L 5BV7B 2DJSA 5H8DA 4NN7B 5IG7A 5KEZA 5F0MB 5T5FA 4AGPA 3KBPA 4N5UA 3FTWA 5IIEB 1ZS2A 5I76B 3OLGA 1GJIA 4I0KA 2B9AA 5HYEA 5FF6B 1S7XA 1YUHA 3U6XS 1VLXA 2DM4A 2DD8L 3Q3GB 1T21B 1X4YA 4JG0H 2PYFA 3TBWA 2NY1C 1AZBA 2X2JA 3QORA 4GQZA 4U1HB 1MCJA 4LLWA 3HFML 2HXAA 3DX8A 1LQBC 1ZGLP 1G4RA 3NCXA 2VKWA 3UTTE 5AVVB 5MENA 3RDTA 4I77L 4O2EB 4XCCH 4XP9H 4X6FB 4N68A 5KN5A 1TENA 2XNAB 3ALXA 4DTGH 1L7IL 1I3GL 1Z0MA 2NSMA 2BDNL 2XBZA 3MGTB 4X98A 3WKYA 4DKEH 3A4FA 1T20B 3IYLW 1N4XH 4PJ9A 2TSBA 1JYXA 1AGBB 1YJDC 2HB0A 2KC0A 1OP3H 1AZVA 4NQSA 3UYPA 1II4E 2YGQA 4FQJH 4NLHA 2JF1A 2A9AA 5E00A 2BIPA 3AWFA 4AEHL 3BDYH 3KW8A 1QNZL 3NGBB 4NCC2 1BIIB 3I6KB 4WSJA 5C08B 5F2FA 4FFYH 3P02A 3QUYD 4I9XA 5HPMB 1NCDL 2NOYA 2R2EB 4HJJL 5TF0A 4NFCA 1R47A 3QUXC 1ZRUA 5KVFL 4HK3N 3N6YA 1JYNA 1A1MB 1CGWA 1JZHA 1JPEA 1MEXH 2VC2B 5DD1L 3ZTEA 1IAIM 3STZA 5JOPE 4J3OC 4MA3B 5LJYH 4ZMYA 5AVUB 3BZEB 1TQBC 1ZS8B 3CFTA 1I3VA 3O3EA 3CPUA 4UIMB 3JWOL 3OHXB 3UJIH 3P30L 1IGTA 4O58H 1OT2A 3P3SA 4JHAH 1Y18A 3EYOB 4PS3A 1W0WB 3BWAA 5JO5A 1EA9C 4AIZB 1IKFH 5GJSL 4JVWA 2BY2A 3W0WB 1OWRM 1BXXA 2DQDH 1FHNA 3QEHB 4IOFC 3PYCA 5I73B 2IQAA 5ILTH 3NEEA 2GVYA 3QWRD 2VDLB 2X6BA 1VPOH 2A74B 4N24A 4LOVA 5F3HA 4NPJA 3CK0H 3IXTB 3C5ZD 2PO6C 4KXZI 4YLBA 4RVBA 3CN4A 5E0QA 3VWKD 2YPLA 4B9YA 2APSA 5GGTH 5ICXB 3SDCC 5KVDH 3FTSA 3HAEH 3WN5C 2UZIL 3ASOB 4LLVA 4PWEA 3SBWC 4AC4A 1T5XB 1H5BC 2QLYA 3QJHA 3LKRA 4AYSA 1GXEA 1BZ9B 4EI6A 3QJUB 3VFUB 2HKFH 4XGZB 5KSBF 4RFOL 5IK3A 2CCWA 1BVNP 3KGRA 5C0EB 1AE6H 1BQLL 5FX3A 5DYFA 3GBLA 3KYKL 4GRWB 4PJBB 5I1IH 1ORQA 2OMYA 3NIFE 1SJHB 5K1JA 1FNLA 3FTVA 3V8OA 5FYJU 3RIAK 2FJUB 1E4KA 4A2LA 4DJMA 4Z7QE 2R29H 4JRYA 3QDAA 3RB5A 1SVZA 4PVNA 5D9SA 3GMMB 2BS9A 3MRDB 2LOEA 2BWDA 4B53A 5HSFA 2BVTA 2KYIA 2GK0A 4KK5C 3SDXA 1CDCA 4Z77A 3AQZA 4Q9QL 1MREH 4BHUA 1F58L 4JY5L 1FIEA 4LHUD 4JO2H 3LN9A 2CA4A 4HJGB 4Y8AA 3ET9F 4XC3H 1IBBA 1CXHA 1LO3L 1G0XA 4HPHA 3FL7A 1AY1L 4A7VA 1OCOB 4P2QE 1KGIA 4G3YL 5KJRH 3T0DA 2JCWA 2VLJB 4AZ8A 3GB7A 2TAAA 2VH5L 1TZAA 1UM6H 1UM5L 2CH8A 5F71A 3GM8A 5AW6B 1NCCH 4LU5L 1I3RB 1VJSA 3GIZH 3OF6A 2BC4B 3FQXB 3MCKA 4HS6B 5J6SA 3ZUNC 2KS0A 4ACPA 1DDHB 1CZ8L 3G08A 4N0FB 5I24A 4LPXA 4JM0A 4CA4A 4HX1A 4QI3A 4TVUA 3I2CL 1TLMA 3RVXD 1WFTA 3V7MA 4DW2H 3O4LA 3KH4A 1RJLB 2ROXA 3DO7A 3FUDA 2ZG3A 2NXYC 4RSYA 3UTTA 1KELH 1Q9WB 3KPTA 4M61A 1A7PH 5MENE 1IJNA 2B0SL 2C9PA 3VH8G 3SPIA 3U30B 3GO1L 1MWAB 4P9MH 2XBTA 1FPTL 4AIOA 2BNQE 2X70B 3MA9L 2E7MA 3RVXC 2G75A 3Q43A 5E5RB 4X5LA 1WP6A 1KCSH 5E1IA 5EOCL 2HG5B 1NPJA 4A7GF 4PJAF 4WU5A 1CU4H 5EH1A 2Q3XA 3UBFA 4DFIA 4WHYH 4F24A 2X3BA 4NEHB 4JGUA 3GJEB 3HS0C 3PREA 2IDSA 4LCUA 4S1RH 2ZKYA 3NSJA 3PWJB 4G6AC 1FNHA 2EDYA 1Z9SB 4L4VE 1HHHB 3RBSA 5C0FB 1J5IA 5BQDA 1BQHA 3GMPA 4NO0D 3CZGA 1DQVA 4LLAA 2Q3ZA 3R1GH 5ACMA 4FQPA 3UTZB 5CEXA 2PCPA 4EZJA 2J1WA 1GH7A 1G9ML 4PBVC 2PW1B 3TO2B 3ZUCA 1JD7A 1E5AA 4BZ2A 4JVPA 4LASH 4JS7A 3P4LA 2YMTA 2HSIA 2BP0A 3BPNB 5E2WH 1Z5LA 2AVFA 4BYHA 4L1LA 3IFNL 3NCBB 3VSQA 3BH9B 5DD3L 2X44D 4KNQA 4I13B 1MW1A 1J8HB 3QJHB 1HHHA 5C0FA 4OAWA 1GYAA 3EW3B 3ZHFA 1A6AA 3GI9H 4OM1H 2IQ9H 4FLOA 5F7UA 2VAAB 3D39D 4ZOAA 1N6UA 3N40P 4A7GA 1DBJL 3WSQH 4RWYL 4KQ0A 2YPLE 4H8VA 5E99L 1YEHH 1VGKA 2J6EL 4IOFD 1ICTA 5DK3A 1DP0A 2HFGL 1UC6A 3VO0A 3QQXA 1CGSL 4LSTL 4A55A 2RQEA 4N0UA 3WG7B 1I7TB 1QTSA 2HT4D 3NH7H 5AOMA 4L1BA 4OTXH 1B3IA 1CE6B 3BGFC 5GISH 3SDCD 1A3LL 5F9OH 1CBJA 1MAJA 2JQZA 4XMUA 1MQ8A 2ZNWA 4RMRA 5AW5B 3LZQA 5TF1L 3HRZA 1KFAH 3GLZA 4MAUL 4PRNA 2P45B 4CKVX 5C0JA 3D25A 4JRYE 5BJTB 4ZS6D 1XH0A 3SKOB 5K9OA 3QUMH 3AT8A 4JANB 5JPMA 1AZCA 5JHAA 4KV5E 1FFRA 3WLBA 3JWNC 3SQOL 1N5AA 2DL9A 4ZW6A 4C56D 4Q7DA 3PU7A 4KH9A 4AMKL 5DQJB 2WIMA 3D2UA 2NMSA 1B4LA 4R4BB 3A6CH 1U42A 5DLLA 3WMPA 1RK1A 1Q90A 1AKJB 4MQXD 3DO3A 3D85B 5DJDB 4D0CA 2WWMC 2ED6A 3GJFH 3FRUA 3MMEA 3H3PH 4WJ5B 2ZOUA 4N2AA 4R4FH 1WFUA 5E94B 1E5ZA 1KGUA 3DUHA 2IH1A 1I8MB 4S0SD 1GOFA 1FZMB 5FYKL 1BQSA 2R29A 3HBZA 4CN1A 1RD6A 1NFDA 4X5PA 4PJCA 4PD4K 2R9HC 2AQ3A 3MO1B 1MFVA 4TQ8A 5LDUA 1WRFA 4JGNA 4JZNB 4BZ2L 3NZUA 1KCKA 3PAZA 3RVWD 3ZZLA 4YHLH 2NNXA 2WLHA 4YHML 2P52A 4MNQE 5LCVA 1JWUA 3E6HA 4PJHB 5AOKA 5FYKD 3STLA 2G3ZA 4PLKC 2MHAA 4HUNB 5SX5K 3RNKB 1KYFA 2CALA 3ZE2E 2A77L 1MCWM 5F9AC 2R56L 2NY6D 4BCXA 1TSRA 1WK0A 3GSXB 3IMUA 4HF5H 4X8JA 3KPRE 4E0RB 3D87B 4PGEA 1ZV5A 1BZDA 2VNCA 1U8HA 5IHUH 1YNLH 4Y2DD 1X5LA 3I9IA 5MI0C 4B27A 5D6CB 3I85A 3ZKQD 1YYML 2NSXA 4C58B 3QHZH 4Y9BA 2W0KA 2VB5A 3BJLA 1KB9K 1A1OA 4JRXA 2MNWA 2PW1A 3BP6B 5I30H 4YSSA 4MCYB 3KBEA 3GDCA 2EVGA 2EKSA 3O45A 3LXAA 3VXRE 2CGRL 3VGFA 1NM4A 3PJLA 3TP4A 5EEZA 3KL0A 3LNEA 4HZLA 4DGIL 5GGVY 4H44C 2Z34A 2HH0L 4JK0D 4R84A 4YIQA 1QWNA 4PTUA 4NN6C 5SX4H 2MPAH 3RBGA 4NP4H 1NBZB 4NPKA 4ETYA 3GPSA 2XFGB 4Y4KC 3VRJB 3VXQB 5I1JH 4RFEA 2ZOOA 2FSEB 3IEAA 4WQOA 1T22B 1CLYH 3BZEA 4O02A 3TBTB 1U2YA 3QQDB 5B38B 1BEYH 1C08A 3D51A 1K8IA 4LCVA 1JCVA 3T2OA 1BQKA 1F11B 4ONOA 1JFQH 4DP1X 4F8QA 3V4VB 2JCCB 4M7KH 1Z7JA 4KKLD 2N1KA 3UJJL 2RCSH 2EDXA 3RYMA 1J48A 3F3HA 4DP7X 5J11C 1KSRA 4UV4L 5CS7A 4R97B 5KSBA 5JOPD 1MG3C 4QCIA 3L9RB 1OTTD 1S9KC 4D7BA 4EVNB 2DJUA 1LEKB 1ZY9A 2VDOL 4F9PC 5HYSA 1J8SA 2X3CA 3O6KL 3K6NA 3B2DC 3L54A 3RTQA 5T3XD 1IFRA 3LDBC 3M1BA 3TV3H 4ZOEA 1H9VA 1U6AH 2OJ1A 4WDIA 1LDPL 5CLYA 1IQDB 3QDHA 3O2DL 1ZVNA 2KDYA 2PYEA 4U6HA 1MLBB 3LHPH 4WV1A 2X89A 1SFHA 1EAQA 2P5WB 4JO1L 1NFAA 2J8UF 3ULUF 2PNDA 2QELA 1F4YH 3SDYH 3PQYB 3KPRB 5BUGA 2EILB 2KH2B 4L4VD 1I8UA 2DW5A 4FL4B 2FWUA 2ATPB 3GMNA 4CN4A 1TUPA 3RWCB 2QKIA 3ZLQC 3C6LC 1EO5A 1ZGLB 5G2NA 4ADGA 3PIQB 4YGVA 3UZVA 1OOWA 3WS3A 2FATL 2IEPA 1N68A 1HXMA 3Q9PA 3VWKB 3DDGA 2EXTA 1A21A 4XCFL 2UVFA 3MRMA 4V1DE 3V7AG 2BWQA 3W9EB 4PLNC 2IH1B 3SPJA 2ZIDA 3MLRH 3BH8A 1MZZA 3VFWA 2IBBA 2L7UA 4PW3A 3ISRA 5T1LA 4LOUC 4PFEA 2CCVA 3G6DH 4YSPA 1GHFL 1U8IB 3ZR6A 5JHDD 4YHOL 4BA0A 1HHGA 2Q8BL 3GBML 4ZAKB 3LKOA 1TIUA 2B5IC 3QDGE 5G55A 3EDEA 2A9ML 4KX7A 3L6FA 5DD6A 3GRWA 2WQSA 1ZAGA 3U4EB 1NFDE 1PZSA 2GHZA 43C9B 1TTUA 4OM0H 1K3ZA 1OK0A 2R8SH 1S7WB 3KGTA 3BH4A 2VN5A 3L1OH 5L88H 4XRCA 1UJ3C 5C0CD 4IMKA 4Z7IA 5LGKA 4UM8B 3HG3A 4YK4C 3O4LB 2WLLA 2F54D 1JV5B 2J1YA 2P80D 4WO4B 1YPZA 1G1KA 3QJXA 2GEEA 3B3IB 3DC0A 3FO2A 4NQUA 4PJ8C 4JM2A 1OOAA 1F3JA 5ADOH 1RJCA 4GIPD 1JNHA 2R4RL 2A99A 4W6WB 4ZO8A 5CF3A 1MG2C 1U3YA 1WZKA 5CIPH 4LP4A 1OL0A 3ZKNC 4D0BA 3WFCL 2QL1A 1W8NA 4LB8A 2ZKWA 4TXVB 2CLZB 2VITB 1B0GA 3CBRA 1KIUA 2DQEH 1EHXA 5GS1B 4ENEC 3QAQA 3VFTB 4B9JA 4X5XB 5E95B 5ITFB 2WKOA 3WLWC 1S3KH 1NOAA 4Q6KA 2KZWA 5EDSA 5EPMB 3QE5A 1PY0A 1E9PA 1K6QL 4PB9L 4HG4J 1U8LA 3MCYA 1D9KC 3FUMA 3C09C 4B9IA 5I1EH 4RGOL 1BG1A 3LVTA 2CAKA 1D9KB 3D4ZA 5CZVH 3FYEB 4ZMQA 2YAEA 4ZFGH 5KJ7E 2E7DA 2BCKA 5A2KH 4L37B 4OF8A 1BMWA 4OLXL 1I1CA 2YSSB 4P04A 5E9NA 2WN2A 1DR9A 4KJPD 3OR7B 2DWSA 4NJ9H 3BD5A 5GGSA 1A1MA 1S9XB 1FNSH 2CU9A 2ZF9A 1KXVC 1QD0A 1SDYA 3EOAA 4MJJA 1DUYA 1JRHL 2VZOA 3HJEA 3NAAL 3RFZC 1H6TA 2OJEB 3QQ9D 4GRLD 3CVDA 3KLAA 2YMXH 1WWAX 3G7TA 1KTBA 4ZMNA 1ZVSA 4KPHL 4Z7WB 3RE0A 4FFZL 1LE9B 2VDLH 1KT2B 2PTTA 3QS3A 1ND0A 4XXCA 2J3SA 2RGSA 3PAYA 4D7PA 5C8JA 4XO3A 3CVIH 1WHPA 1NBYB 4U1HA 2WIIB 3RVWC 4JX0A 3V4PB 2MCPH 2XPYA 5C0GA 3DXAA 3IN2A 4G5ZL 1KGCD 4M1CD 4X6DE 15C8H 3L4VA 4ANUA 2G2PA 1LK3H 3DJRA 2QZ5A 1JRHI 1ZLWH 2EVJA 5K93A 1G7QB 1ID5I 3TIDA 3K7UA 3FCGA 5I5JA 2V9QA 2J72A 1FAKT 2GSIA 2XWBA 1VGEH 2D03L 3B9KC 3GNML 3QRLA 2FX7L 1F1DA 1XF2B 4BXVA 3VB9A 3A67H 3INUL 1SJHA 5CBEA 3QUYC 2ZUTA 3HNVH 2WPGA 4JPKH 1KBGL 1RULL 4A2EA 2DWDB 2Z31A 1BXVA 4YOKA 4ELMB 2XICA 3MBED 3HG4A 4H1LB 1MSPA 3VXME 4ZS6C 5FCUL 2Y06H 1ZK5A 3QC6X 4NNYA 1MCPL 3SPVA 1YJDL 4IQHA 2JTYA 2FLBT 4GSDH 4AUJA 2Z91A 1ILUA 4UAOC 4DFHA 1OM3L 3SDDD 3U0PB 1CGVA 1TG8A 2IPKB 3P4OA 3F8UB 5D7SL 4URKA 1EFXB 1M2VA 5F6HJ 2ZXDA 1KG0B 4Z95L 4ZFOB 3V52L 3P11L 3JBG7 5I0VA 5F0PB 1QX1A 4FC3E 1IFGA 3V0WL 4P99A 2WKLA 3QIUC 3QDGA 5BRQA 2EE2A 5MP6H 3EO1A 1XVSA 1DVUA 4XWOD 1AS6A 5DK2A 4HPOH 3Q5YA 2BJML 3RGVC 4H1LA 1G6RA 4AVJA 3W57A 1J87A 4AVIA 4CW1A 2VM4A 4Y5YC 3ENEA 2XI9A 4I18C 3OKKB 4WUUB 4R7DA 2NXZD 1JN6B 4PJ7E 4FQQA 2JKNA 2YLKA 4LCIH 3D8MA 2IDFA 4DN3L 3NIFB 4UNUA 3O6ML 2YOCA 3CVHA 4PUBH 3CZJA 1NCGA 5DUMH 3LEXB 3X12A 2ZOWA 2UV3A 4XOAA 3MRNB 5JIMA 2BSDA 1ETZA 2DI8A 3LKRB 1KJ2B 2ITDA 2HKHL 3DMMC 1RSYA 3BFQG 2CIIA 3CDYA 2XZAH 3FQNA 5E2TH 1A0QH 4NQCB 1G9NC 3IRPX 3K2MC 1MOEA 4ZMOA 3A22A 4MCMA 1QR4A 5ENWB 2FIKB 1T89A 5FGCE 1HVXA 3K46A 1Q9LB 3M88A 3TO4B 5KTEL 4JFQA 2XPGA 4M3HA 4U2YA 1DVZA 2P24A 3VXSA 3ALPA 5IW6A 2J8UB 5D4IA 2J88L 3MV9B 1U9KA 4Q58C 4BFRA 1YYCA 4JKPL 4UILH 5FDWA 3BRDA 3CFKB 1H3PH 3CXDL 2H2SD 1NGWB 3UYRH 4K7PH 3SPCA 4LBEB 5I19H 2YRPA 4G8IA 5FFLA 4K23H 1HH9A 5DC9B 3GUTA 1XIWA 1WO2A 4O02B 3TBTA 4BKSC 3TJHD 1A5FL 1NDGA 4JG9A 1R33A 5ICUA 3TEZA 4HJ0C 4XN2A 1U33A 3R7QA 4CADA 4TLTA 5E6IC 4OZIB 3A6OA 1AYOA 4X6BA 4IMKC 5CJQH 1C1EH 2H6PA 3IFPA 3PDOA 3REVB 5TDNA 3RWDA 4Y8DC 5LB1A 3ESVF 3DV4B 3V4PA 5JIIA 5FA3B 5HHVH 3POCA 2EEDA 1FUNA 4WLCA 3ESMA 2BOBA 2P8LA 3LN4A 2UZYB 3T0AA 5EF0A 1CYXA 5FGCB 4F91B 3W37A 2B1HL 4JO5A 5D5MB 2NUPB 4N2CA 4LEOA 4LNVA 3QR2A 1EEYB 3DBSA 3IMSA 5DRZA 1QMUA 1UUNA 3TZVA 1FH5L 2VRQA 3L3KB 3ZE0F 3ABZA 1SM3H 3KCWA 1BZ7B 1JZDC 1TVHA 3UADA 4X6DA 4NUGH 3KYNB 3NIGB 3WO4B 4BFIA 1NAML 4HIEA 2F7PA 1RU9H 1I8LA 1OW0A 1HSBA 4L2LA 4PRPD 4GKLA 1ZT1B 2Y24A 2AJVH 4RMUA 1RUAH 1JVLA 1DLFH 1TEFA 5H94B 3CTTA 4HU2A 2WYIA 5D5MA 2EIDA 5LLIC 3F62A 2JH2A 2VMEA 4XNQB 3K81A 3IE4A 3IM1A 1RHHB 4OT1H 3CSYA 3DX3A 4DVRH 4HKBB 2DLGA 2ODIA 4LCUB 4BSWA 1XF3A 5E4AA 25C8H 2O5XL 2UVEA 4ZW8A 3RFZA 1BJ1J 4PCSA 4YBQD 1BOGB 2W9EH 1E3ZA 1P84K 5CZRA 1TZGH 2CIKA 4FTVB 3UDWA 5I16B 3C09B 1P4LA 1EMTH 1C5CH 3LVEA 4WKZA 2VDPB 2HFEA 4KK6C 1KB5H 3S6CA 4PBDA 3PFUA 3U6RB 2OX5A 4KKAD 2Z35B 3FSWA 4TSBH 4F3FB 1NTDA 4TV3A 5K9JH 2ZONA 5J1AB 5ACLA 3GRWL 2H6UA 2IV8A 4KY1H 1D5ZB 1WZAA 1IBYA 5MERB 3T6VA 4QYOA 2MWCA 5A6LA 1VEPA 2H3KA 4AQOA 2NPLX 1KB3A 1T5WB 1QATA 1RURH 2R69A 4MJHA 2K78A 2WLLB 4LSUL 3JT2A 2AJZB 4NX0A 4OKVA 4CSPA 5ISZE 3U9WA 4YE0A 3LNHA 5I16A 1NWOA 4BELD 3BWAB 3DURA 4L3EB 5KANG 3MNZB 3UAEA 3FT3A 5J12B 2QQNH 4J27A 3RNKA 4ILDA 1F42A 2CO6A 4YK4B 1U8KA 1L3WA 3RVUD 4KMTH 2NY5L 5DC2A 1OE3A 1BFSA 3M46A 1FFOA 3U2IA 2NZ9D 3PDGA 5TPWL 1RKRA 3GSRA 1OXYA 1XGYL 1V10A 4L23A 4GG6A 3ZZQA 1MJJB 3MOAH 2E7BA 3BDYL 1EJOH 5DS8B 1CE6A 3BSZH 5D7JB 2VQ1A 4O4YL 1X6LA 4IBVA 3QCVH 1XSKA 1DVSA 3NZSA 2ADGB 2VDOB 2KQMA 4C4UA 3WY2A 1SN5A 4JRYD 4EIZC 1I75A 5D93B 4XH2A 3UC2A 2R4SH 2H9GB 4U3SB 2CDFB 2PCPB 2ZZUT 4WCYL 1P4IL 1IRAY 1NZRA 5B1JA 4TVPD 5DSCA 5DDHB 3QPQD 3REVA 3RWDB 1KXQA 1KWKA 1N5YL 1O5PA 2ZWZA 4JQVA 3TA4D 4EIGB 3ZDYB 3CQQA 1D6EB 4DOHE 5K9KA 3KWXA 2DQ6A 3NRQA 2ZCLL 5IVNA 4D2NA 2XN9D 3F7VB 1NBZA 1K2DB 2C1OA 3PG2A 3BAJA 4PRPE 4MA3A 5D7HA 1VPOL 2X09A 3IGUA 4LRNH 4UTBA 2WLNA 3CK0L 4UV7L 3C5SB 1UYWL 3WGVB 5AKSA 3IVKA 4R83A 3MSPA 3U0WH 1FZMA 4YNYA 4X42A 4DKFL 1A4CA 1CFNB 3HFMH 2XHNA 4M5TA 5JYLA 1W91A 3LCYA 3Q6FB 4WEMB 4GAYA 4ALAC 1BJMA 1EERB 4M4RB 4RFOH 4AQ1B 3UC0L 3L3HA 5JW4Q 4ERSH 1AE6L 1BQLH 2CLVB 4PS4L 4N2GA 1IM3A 3G5XA 1LEKA 4NKQB 4ACTA 1PMYA 5AKRA 1U30A 2G3NA 2NLJB 2Q3AA 4DTGL 4X4XB 4H40A 4NPYB 4NRXB 4PHXA 5F72S 1FO0A 3F5WB 3NCMA 4H88L 1T89C 4DKEL 4GBXB 4JMXA 2MQ0A 3GRBA 4FNSA 3S9DB 4EUPH 3QQ9C 5FGRA 1QWHA 3IF1A 2ENYA 2R69L 4L1HA 3DVGB 3GKWL 1GYVA 5EB9A 4HWBA 4BJLA 1SQMA 4Q9QH 1J9TA 3JWNH 3TBVA 5JW4M 1A3RL 1K5NA 5IB4B 4Y5XC 2E75C 2NY7L 2JQAA 1MFBH 5DWPA 3LKNA 4HS3B 3PJSA 5HJGA 2Z8RA 1PG7L 4BWTA 5LG6A 3Q44A 3RPKA 4U1GC 2A6IA 1N67A 1RUKL 4PJ5E 1JF5A 3QJVB 2E6QA 5HYSG 2ADFH 1MEXL 1S7QB 1QZNA 2VISA 3QK0A 4GS7C 1F3RB 3PCYA 4LHUG 4YO0A 3HLAA 2VH5H 4Y4FD 1T1ZA 2V0AA 3P30H 3HTLX 1WUNT 3PWJA 3US0A 1AXIB 1F4HA 1EEUA 1OCZB 5GJSH 4N8UA 1CZ8H 3GBDA 3LKNB 4WUKL 3MJWA 3ARGD 5I17A 3DJTA 3TLRA 2F53B 3GXTA 4RGMC 2D7NA 4PAZA 2YEQA 3IDXL 1S7RA 4UQAA 2P8PA 4PR5B 5FDYA 3VI4E 3CDGB 3TVMC 2DJMA 2EZ0D 1EGJL 2YXFA 3EJZD 3S37H 3W82A 1I1AB 4UOW1 1WH0A 1NPNA 4MNGA 3TX4A 2X88A 5GGRB 4J3TA 3HRZC 2B16A 4Y4KD 3D69B 3U4AA 3V10A 4P9ML 2HKFL 2IGFL 1FPTH 2Z4QA 2GJJA 3BGFB 3CXFA 3BUDA 3GZKA 5JPMC 4JKNA 1BD2A 2XY1A 5IVXF 1BAGA 2JJTC 1PDKB 3FTUA 4MQTB 1CU4L 4R6UA 4R7XA 3DOHA 4TUUA 4PLJD 4JFZH 1CGYA 1D5XB 3LQAH 2GFBA 5EN3A 5DF0A 4LSRL 2VR9A 3QISA 1OLLA 1WTGT 3AZUA 5JDJA 5AOLA 2OA9A 1RVFH 6FABH 3LS4L 3ZYIA 3QWRA 3MU3A 5D7IA 2E9GA 4JFQB 5DHEA 4IYKA 1EJ8A 2AERT 4GFTB 3SODB 5K59F 3BFOA 1M4KA 3QIUA 5DUPH 3VXNA 1JPSH 4Z3FA 1XGUA 4H5SA 3QEQA 4M6NH 1K2DA 2K8MA 3QG6B 4WY7H 1BD2B 4LDLB 3IFLH 4PSPA 1SY6L 1TF4A 1VDGA 3BQUC 3FT2A 3UZQA 2DQIH 2GKIA 2OJZL 4DEUA 2H0JA 2GQHA 1WG3A 4L9LA 4M03A 1ULVA 2ZCZA 2F18A 4Z7UB 2O72A 4S1QH 2E3VA 4J8QA 1UM5H 5JW4N 3PHOA 5CM1A 3FUNA 1HHIB 2OMUB 3HC0B 2CK0H 3IDMA 5DJ0A 3OLIA 3UG5A 4NN5B 4IBYA 2P5WE 1DJHA 2WXQA 3RLSA 2CLVA 3QDME 4U7SA 4HJ1A 2Y2TA 2X6MA 2OYMA 3BQVA 4K3DH 1Y0LA 4OGAD 1AHMA 4HIJA 1W2KT 4MCZA 1U4FA 4OQTH 5FV1L 1UWGH 2NTFB 5G4OA 3GMRA 5E99H 2VW6A 1JNLL 4JHWL 4LSQH 2FBOJ 2G4GA 4MKMA 2WINB 2BNRB 4RESB 4PJIA 3OPUA 4X98B 3IXAA 1B2WH 1BM3L 4RSVA 4F7MB 1GVIA 5CU9A 5IB4A 1FNAA 5GISL 5LGJA 3QG7H 5BO1L 1BVNT 4GEJA 4NNPL 1WWBX 2DMGA 4LARH 2EH7L 5DD0L 2IPUG 5EOCH 4HKZA 1FLRH 5EU7E 1CGUA 3QUML 4JPQA 4JKMA 4L4TD 5HHNA 4Z3IA 2BVYA 5HGBB 2E59A 4Z9KB 3FUJA 4DGYL 1GIGL 1S7QA 3L7EA 2JV6A 5B1JC 4X6EA 4S1RL 1C5DA 4KOBA 2CLZA 3QRFM 1D5MB 3ESUF 4MXQD 4ABVA 5IBUB 1OGPA 4HHAA 2XQYG 4MNHA 5DQDL 2QVFB 1JV2A 1M71A 4GUPB 4LE8A 2V2TA 5LGJB 2Q0ZX 4UTBL 2D31A 2WZ5A 1H9DA 3H3PL 2P43B 3EJCA 3OXSA 3ABLB 4P59H 3ARVA 2EYRB 2J8HA 4QAWA 3RFZB 1OP5K 1S8DA 5IFHH 2CIKB 1LO4L 1HYRC 3IJYA 2QDVA 3LH8A 4P4KA 1Q9OB 5FV2A 1RK1B 3Q6GL 2ROYA 2W0LA 1KIRA 5F7DB 3RL1B 2R83A 2HLAB 4FLRA 1F90L 1ZA6A 3DRQB 4RIRB 5BS0A 3HC2A 4BZ2H 5F7FA 1UD5A 4NAJA 4ABWA 5DCCA 1JXJA 1F6LL 3VSUA 3HVDA 2NNRA 2YA2A 3CDZB 3S34H 5DJXA 2JJTA 1FC1A 3IPFA 4U6VL 1V8HA 1M2VB 4MB3A 4XVTH 2Q87A 4MZIA 3AB0B 1XZ0A 3SY0A 4JO8A 3CG8A 4PWHA 5AAPA 1S7VA 1N0LB 4GG6F 1U8JA 4N2NA 2HFGH 3E6HB 1SEQH 1CQYA 4F7TB 2X4OB 4YQXL 4YMPA 4P2OC 4ZZKA 4LCWB 1G6RB 4MXVE 1SYSA 3RY4A 5MHSE 5C3LD 1UADC 1YYMH 2WLIB 2X9ZA 2AXFB 4JCMA 4G7YL 1Q94B 5JXED 2OCFD 1A3LH 5DJZA 3ZE0B 4X80L 4XT1C 1IAKA 1SN0A 1SQ2N 2ICWA 2X4SB 4LMQE 3FO1A 1R6VA 1YMME 4H8UA 1ANUA 1H5BA 2WNWA 5TF1H 3VAEA 5DTFA 3T8XB 1USZA 3M86A 3CV5A 4ENED 1OKEA 1RZ7H 3KGUA 1FV1A 2JQMA 3CZKA 3Q0HA 5CKAA 5HYQB 4UBDC 5E51A 1PTZA 4R26H 5KANI 1Q0YH 3MV8D 4WO4C 2VYRE 4P9HC 4TMPA 1R0AL 5DVOA 3D39A 1UT2A 5I1JL 4NDMB 1W0WA 4RX4D 5KW9L 4LSSH 3DYMA 3VSVA 2FO1A 2BHZA 3HPLB 4RQQB 2AXFA 1KCVH 2HUEA 1WA1X 4WNQA 4YC2C 3W81A 4TTDD 4YGVB 3S48A 4R4FL 1ZLWK 1IC7L 3OKEA 3D0LB 1B4RA 4A1RA 2QMKA 4XTRC 1BP3B 4U1LA 1NUFA 5JPNB 4HVBA 3O11B 2ZQKA 4P23D 1Q1JH 2IC2A 4P2RE 3HUJB 4AE0A 2QADD 1KENL 5HJDA 3L3IA 5DQ9B 1AXTL 2H2SC 1J7VR 2L7EA 1LDPH 1TJGH 4XMWA 3UERA 5GGUB 1BLNB 3UBXG 4QRRA 5GRJL 4CMMB 3LHPL 3VYPA 1G4MA 4G8AC 2LFEA 1J8RA 1URIA 6PCYA 5HYSB 2VABB 2IF7A 2O6FA 2WN3A 4U1MA 4FA6A 2EO9A 1URZA 4PJIE 2AJUL 3KYOA 2XDHA 3QHFH 4X6FA 2GAZA 1IBDA 3H4FA 5CSZA 4HXBL 5C09A 2EIKB 1GJWA 1HEHC 3I50L 4FQQB 2DM7A 2D7MA 5I1DA 1XEDA 4ZNCD 1JV2B 1M71B 1BM7A 1BZ7A 1QWUA 2XVKA 1NCIA 1MHHB 5K39A 4B9GA 4XX5A 1DFBL 3QR0A 3S35L 4HS8L 2LE9A 5CBEB 3LQZB 3M8OH 1NC4D 4JFDE 3PHAA 1MI5E 3IJYB 4P4KB 5GRYA 1YEGL 3MLRL 5ESAA 6PAZA 3EZ8A 3Q06A 1RZGB 4HK0A 4BUQA 1NMBL 5C07A 5IOKA 1AC6A 4Z8FL 4OLYH 3O81A 4X0NA 1GR7A 2F19H 1GHFH 3O8XC 3RX9A 5D8JH 3U7YL 1AD9B 1BEYL 3VGEA 4BK5C 2Q8BH 2ESVB 2JTDA 2Q2LA 2UYLA 2NYKA 3UTPE 5IB3B 1MFCL 1YY8A 4MCNA 3L4WA 5IMOB 2IJ0C 4OD1H 3QZBA 2DQHH 4YE4H 5D1XB 1W0YT 2A9MH 2EAEA 2HX8A 3CLWA 4X9FA 3GTNA 5DEGB 1FGNH 2GJPA 5LNEA 2F8OA 3CHSA 3JWNG 3VRLE 1BAWA 5KYXA 2JKLA 1UTDA 3H7BA 4ICWA 2K9FB 3LHAA 2BIMA 3F7KA 1J11A 3GI8L 3LKOB 3LRHA 2WXKA 4LCCB 4LO9A 3PL6B 1ITCA 1U58B 5C70A 3MRIA 5ELIA 3EJUA 1ZT7B 4QRSB 3O2DH 4GQRA 5HJ3A 3NFNA 1IAOA 2WZPD 1O6VA 1K5WA 2VMDA 1O0VA 2C5DC 1ML0A 4XCNA 1KCBA 4GSQA 4UM8A 1XHHA 1G9EA 2WANA 3T1FA 3IS1X 1F2QA 3VFUA 4ZUTB 4WO4A 3DIDA 3VFVA 4H2AA 1NANH 4LNRB 1ZLVH 3FQNB 1KTLA 2IAAC 2XIIA 4ZT1A 2O61B 3ARFB 2VDQL 3IDYC 5BPPA 5AYUL 1FZKB 3H0TB 3HCVA 3QEUB 3TTSA 5C86A 3ERXA 5FUOL 3VD5A 1G9NL 1K9TA 2YGVA 3M1OA 4X8GA 4TOYL 3GMMA 2KT6A 4X7CC 4XNYH 4QJ3B 3ETBF 3DPDA 5CJOL 5DQJA 3TJPA 5DUJA 5EO0A 1QRNB 2CPCA 1CR9L 4N22A 1KIUB 1AKJA 3EHBB 4JHZA 1QSZA 5HHXL 1OTSD 1YN6B 2DEXX 3MFFB 3SDAA 2A0LD 5IGXL 2MMXA 3BN9C 1IUZA 3B7SA 4AK2A 1BLIA 3CBJB 3O3EB 4PN6A 1DTUA 5CMAB 4JLRB 2GIYA 4JDVB 4LAQL 2OSWA 3G6DL 3UMNA 1KB5A 3AG4B 1PEZA 5TE4L 3VJ6A 1QFHA 1OT4A 2ICEC 1PAZA 2XT1B 2ICES 5F3HB 3SQBB 4BZ1L 1AGDA 2VDLL 1ILSA 2SODB 3OXRB 2DQCH 4XCYA 3QXAB 5CJBA 4JW3A 1S6NA 2R2HA 5DJ8A 5IZ7A 1RAMA 4DT2A 4YHIA 1P0SE 1WIUA 2DB8A 1A14H 4OLWL 1XGPA 5TDPA 3LQAC 2K3HA 2YD6A 3KLAB 5IBUG 1TTBA 5F7EH 4JQIL 5MEQA 1UVQA 2NY4C 4QTIL 4QRRE 5IREA 1UZ8B 3C08H 3BAWA 5A43C 5BJTA 5I75C 2WP3O 1T5WA 4NGHL 2MEJB 2FLMA 3OC5A 5EU6B 1TTGA 2VLLB 5JQ6H 4BDVA 2D03H 3DI2B 4KROC 1GKEA 3ROLA 4P5KB 4QJ4B 1AP2B 3MLWL 3PABA 2M1KA 5C09E 3RI5F 3VDAA 1GGIL 3PY9A 2E4TA 4GSXA 4M48L 3VXRD 4HHGA 4EI5D 2Y22A 1X6NA 3RWHB 5KBLA 2YKKA 1MCDA 2BIIA 3LNGA 4WF7A 4JQXA 2R27A 5C0BD 4UT7L 5A2CA 3OHXC 1NH6A 1JTPA 1VZGA 3O6LH 1MW3A 4XB7A 3FQYA 2QHLA 4ZXBB 5DMGD 4ZO6A 2H4EA 1WCBB 4H0GA 1MCNA 5ALBL 4BK4A 2J8UE 2FSEA 4PU2A 5JTWA 5CZVL 3H6AA 4ZFGL 1O7VA 5E9DD 3U83A 1ZGLM 5DC4B 3ZRFC 3GXDA 1NCUA 5PCYA 5C07E 5I0XA 1Y18B 3EYOA 4OLUL 5KBNC 1J0IA 3RX8A 5E1GA 3U82B 4ZMWA 5I5MA 1LEIA 1NDTA 1IMHC 1O9ZA 4CNIA 5KVEL 4M1DH 5JIKA 5BS0B 1JZGA 1CICD 4ZYKB 3G5VB 1T4KB 4WTZG 3WEMA 2WY3B 4XAWH 5D1ZA 4U6YB 4QLWA 5FK9A 3RWJA 4CUCA 4M7ZB 1ZDQA 3S36X 3QQ3A 3MJ7A 4CVXA 3PLYA 4PGBB 5DFVC 3UAFA 4HIXH 3BVDB 4N3UA 3MRKB 4HFUL 4P23B 4F33A 3GBNL 3FN9A 4I1NB 3GSVB 3UTTB 2FNWA 4CADB 2WYZA 4LDOB 1VCBC 4DAGH 1WT5C 1YMHB 1FL5A 2DAVA 2PTVA 5D5ME 4MA8L 1P7BA 2A83B 4JFWA 1P7QB 1S78D 1YRKA 3BP6A 3QIWA 1A3QA 4AQEA 1U8OB 5E2TL 1LK3L 5HHOD 4W9GC 2NY0B 1V7ML 2VL5A 3KAAA 3P3YA 2NY1B 1MVUA 1SLVA 2AKRB 4Q14A 1WIOA 3HB3C 5DJZB 1OCWL 3DUUA 2VL4A 4R3SB 3MRLA 1OGTB 4MS8D 1B6UA 1MY7A 4GRLC 2H32B 4XB8A 1OIOA 4XHJC 3INUH 5FXCH 5EO1B 4KXAA 1G5GA 1OGAE 2VQ1B 2YRZA 4UTCA 3W9EA 1QSFD 3O2VH 4S1DC 3V95A 1EO8L 1BVKA 2IG2H 4R90H 3VJ6B 2XUWA 4AGNA 3JTTA 4ZTPL 5C2UB 2C9VA 4W70A 5JW4R 1A3ZA 4KJWD 5CCJA 3EJYC 4U1JA 3Q2NA 1KCRL 4W1TA 4M8VA 2CDEA 4LCWD 5FDWB 3GSNB 4L3CA 2J25A 1OAKL 3NRPA 1IQWL 1I3RA 3WNLA 4YHYB 1XGRB 1ROCA 1GGTA 3TGXA 4U7MA 5D7SH 1EUUA 1Q1PA 43C9A 1FL3B 2VO5A 4B0MM 3RURA 1L6PA 3RKDC 3TBSA 3OPZH 3DYOA 4MKTA 2W0FA 3CH1A 3B5TA 3V0WH 4ANVA 2VN6A 2VDML 1GPOL 3VD7A 5TQ0L 2L04A 2AEQH 5T1MB 3GYRA 2B5IB 1BW8A 2AITA 4MJ6B 3TH4T 1LE5A 3ULUL 5HGHA 4KGJA 5I1LB 2QR0B 4PJ7B 3MRCB 3ZZSA 1JUFB 3W5NA 3QP3A 3SBPA 4EI0A 2HTKC 2QADB 1SVCP 4V1DB 1P69B 3H9ZA 1R5IB 4MTMA 4FEIA 1ASQA 4N0YH 3W9DB 3RPBA 3O6MH 4BH7A 4D9QE 4NJAH 2KZ1B 4S2SB 2Y07L 4ZO7A 4XPBH 4E0RA 1QO3B 4ORGB 3HNSL 3HW7A 4W9LC 2WLMA 4UNVA 3GJFA 5FOBA 2IGLA 2R1WB 2X87A 3L3KA 2PW2A 3WFDL 1CJYA 2W60A 1QA9B 3ARDB 5J8OA 4JUTA 4Z18A 2C9QA 1OB0A 4GNKB 4OLVL 2R59A 5K39B 3UBXI 5CN2A 1H8SA 1PZAA 2YK1L 1AO7A 1SOSA 3HIZA 5F7AA 3C6LB 1CFQB 1CL7I 3MGOA 3FOLA 1N9PA 2J88H 4PJDA 4PV9B 3UAJD 4FQ1H 1E8WA 2Y7NA 3KLDA 1FAIL 2O5XH 1HINL 4K7PL 4GJTB 4PJ6A 3A4DA 1TZGL 3MMEB 2R23B 3L7FB 3X1EA 4YO0B 1VRSA 1EMTL 5D1ZB 2UWEF 4LP8A 1G6RH 2VQUA 1S9XA 4RAUA 4JL2A 1T1ZB 3IMRA 1E43A 4JFXB 1ITBB 1WFJA 4PCTA 5DFVD 2WQRA 4I48B 3SYOA 4U6XA 5I6OA 4UM9B 4R4ND 1MNNA 3LDBB 4OCRH 4ZXBD 2N3JA 1MWAH 1C7SA 2LV4A 1ADQA 5DXWA 4KY1L 5LWYH 1FL5B 3B6SA 3MA7B 5F9WC 1UB5A 2JKSA 1X5MA 2V9TA 3STLB 3PWVA 1P7QA 3MCG1 1P7HL 1HSAB 1RURL 5IFAH 2VDRH 5H4YA 1J5DA 3IBOA 1IE4A 1MFEH 1ZLEA 3QUXB 3ZE2F 3KBFA 2R23A 5E08H 4EVNA 1F00I 4O5LL 4C4KO 2FT8A 2C1OB 2VITA 4JHVA 4XP1H 2V5RA 5DS1A 4HSCX 5ANHA 1AJ7L 4R7LA 4DPCX 2FH6A 5JHDA 1T1YB 3BKYH 3EDDA 3OMAB 1YNKL 4OJDH 2FECI 2WINA 3GSNL 1N7MH 3N50A 3FT4A 2VR5A 1ASOA 2OL3H 1NBVH 2V7HA 3LMJL 1AZZC 1L9SA 1HEZB 2FQGA 4CRPA 4DPBX 3BRFA 3QXUA 5J13B 2ED8A 1NGXA 4XP4H 5FA4A 2HFFB 1K8DA 1M9SA 1N5AB 4Q9RH 4GKSB 1AH1A 4IRJC 2AQQA 2W9DL 5EO9A 4KROB 4PTUB 1IAKB 1OD7A 1B4TA 1OGAA 2ZUUA 4RA0C 3FB5A 4F58H 1GCYA 4GG6B 2Z93B 1PD6A 2EP6A 5DJ6A 1YEDA 3PV6A 1ACZA 1FHGA 2AQPA 3L17A 4PJXF 5J6GB 2NY6B 3V4UH 5HHQB 3BP5A 3QEQD 3S5YA 5L2JB 5DUBB 4W9JC 1XSOA 1YEWA 2W9EL 5FM8A 5A2BA 3ULVH 2DQMA 2Y3AA 5FYLH 3DO4A 3IDJA 2CDFA 3ULSB 2X41A 4LRNL 1IC5L 1KB5L 5HGHB 5DDHA 1UYWH 5E8EA 3TJEH 4X4XA 3AQDA 2OMZB 4G6KH 1IL1B 5HDRA 3GSWA 1UG9A 1ZCRA 1MWOA 4JFHD 3O9WC 1JZ3A 3F7VA 4RBPH 2WXFA 2XXCB 1IEBA 3WTSA 3BUBA 1KNOB 4DUWA 1M42A 2GPZA 2HLAA 4RIRA 4YHIB 4PRHA 2QQKH 3MOBH 4GI9A 4XOCA 3UC0H 4DEPB 3I6GA 3CXHK 4FABL 3V0AC 1IQDA 4UIKL 1QO3A 1SDAB 4Q9CA 1Z9MA 4MSWA 4XC1L 2JI3A 5SWZD 4U1SB 5EBLA 2MTAA 3FCTA 4K2UH 4HJEA 5EFIA 2FJHA 1G1CA 5E8EB 4XPGH 3KXFE 2R69H 1PX8A 2MH4A 4L48A 4JM4L 3WXWL 3HLKA 4QMEA 1A3RH 3L5JA 3OGCA 3U1SL 3SKJL 1XGYH 4AQAB 2YAQA 3ULAB 2AS5M 1OALA 1UOWA 3D52A 5BW7A 4XNXH 4JG1L 3K6SA 4PQXA 1OHQA 3PRZA 1ZK9A 1ZOXA 4UZGA 3FUIA 5IF0A 5IQOA 1RV6X 3FF8A 2JJSC 3KPSA 1T0NA 4U1GB 4P5TA 2F7QA 2ADFL 1QUNB 5T1KD 3TT3H 3RUGA 1JK8A 5T5NF 3EYFB 4ZX4A 2O5YH 3QO1B 2FJGA 4ZX3A 3U48A 5J6HA 2GTZA 1AMYA 1HH6B 1ZTXL 3PJSB 4GAFB 1PD0A 5DZAA 2CO7A 4OGXH 1ZE3H 1O75A 1DEEA 4XZUA 2Z1PA 4BFFA 2OXGB 1A4BA 5D7LE 4AQAA 2B59A 4QHNA 4I2XE 1LO2L 3F84A 5ACZA 4EUPB 1IFHL 4CVZA 5TDOA 5IKCA 5C08A 4HCRL 3VTTA 2K9UA 4DH2A 3L2MA 5ALCH 1JNJA 4KVNL 3L9RA 4URTB 2VDQB 2ZKXA 1NCBL 1A7BA 2J20A 4U6YA 2P8LB 1NCWH 2HJFB 4IKJA 2RMNA 1UOVA 2E9JA 3STZB 3S37L 3V5DB 1LO0H 2NNAA 2QT6A 1Y6KR 2PP9A 3OKDB 3U9UB 3MRKA 4XE5B 2WTPA 2QQLH 5BRZA 3P77A 4EJ1C 2HMIC 4RZKA 1G7IA 3OHXA 1NIAA 5E6IA 3BSZA 5DVPA 1MFDH 3JVGA 2ZYHA 1BAFH 1J0KA 4N0CD 2DLHA 3N44B 1PW3A 4J23A 3WHXA 1FDLL 4CVZB 4PGDA 3MRHA 3Q2WA 1TJHL 3OR6B 2DWTA 3LQAL 4MWFA 3TV8A 2AJ3A 2E86A