3KW8A

Two-domain laccase from streptomyces coelicolor at 2.3 a resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
273
Chain Sequence
b'GGEVRHLKMYAEKLADGQMGYGFEKGKASVPGPLIEVNEGDTLHIEFTNTMDVRASLHVHGLDYEISSDGTAMNKSDVEPGGTRTYTWRTHKPGRRDDGTWRPGSAGYWHYHDHVVGTEHGTGGIRNGLYGPVIVRRKGDVLPDATHTIVFNDMTINNRKPHTGPDFEATVGDRVEIVMITHGEYYHTFHMHGHRWADNRTGILTGPDDPSRVIDNKITGPADSFGFQIIAGEGVGAGAWMYHCHVQSHSDMGMVGLFLVKKPDGTIPGYEPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative copper oxidase
publication title Structure of laccase from Streptomyces coelicolor after soaking with potassium hexacyanoferrate and at an improved resolution of 2.3 A
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 83
structure length 273
sequence length 273
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3kw8A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3kw8A02
3SBPA 4QKTA 1JZEA 5IY5B 2J57A 3UACA 1SDDA 5B1JA 4E9YA 4MFHA 5D4IA 3TASA 2AVFA 4A2HA 4PCYA 3S3CB 1PAZA 3QJUB 2XU9A 3ZIYA 2CBPA 3CDZB 1E67A 2H47C 2DYRB 4BWUA 2XXFA 5TK2A 4NB7A 4BDVA 2R7EB 2IDFA 1ASQA 1GR7A 1E5YA 1NIFA 4N8UA 1JOIA 2AANA 2VW4A 8PAZA 3T6XA 3DKHA 1AACA 1AANA 1GS6X 9PCYA 5D4HA 2Y1AA 4AKPA 1GYCA 3AG4B 1B3IA 4KO9A 5PAZA 2HX8A 2X88A 2VW6A 4HHWA 1TU2A 2YAQA 4UAHA 1KGYE 1A4AA 1HAUA 1PCSA 2QDVA 5D4JA 4BWTA 1SHWA 2CJ3A 4E9QA 4A2DA 3ASOB 3ABGA 3WG7B 3MX0B 3NJNA 1J9SA 1NINA 2BWIA 3G5WA 3DTUB 3FU7B 1JXGA 2DWTA 4A67A 2CCWA 4G7SB 4DPAX 2N0MA 7PAZA 2BP0B 2IH8A 4JHUA 4KO6A 4DP0X 1GW0A 2EIJB 3OMNB 3ABLB 3NSYA 4P5RA 4CSPA 4YSCA 1MZZA 2RACA 4X4KA 3DIVA 4YSAA 1W8EA 1GY2A 3X1GA 5I6PA 4E9TA 1ID2A 1OV8A 2PP7A 7PCYA 3IN0A 1JZHA 3UGEA 1I53A 1JXDA 3PAZA 3D12B 4W9ZA 2I7SA 5I6MA 3FSZA 2TSBA 4L0PB 2H5UA 3JT2A 2YAOA 1A4CA 1ILSA 4DP4X 3NJLA 6PCYA 3IN2A 4YVNA 1V10A 3CG8A 3QJTB 5I5JA 5FC9A 4E9VA 4DPBX 4GP5B 2VM4A 5F7BA 1BYOA 4DPCX 2BP8B 1JVOA 4RH4A 1AIZA 1IKOP 3UADA 2FT6A 4DP1X 1GS7A 1FWXA 3S3BB 1N70A 1ZIBA 4DP5X 1SDDB 3N55A 3UAEA 1PY0A 2DV6A 4BXSV 4WKXA 1ZDQA 1NIBA 1BXAA 4K9JA 1PNCA 4E9WA 1M9WA 2HX7A 2EIMB 3ERXA 3FSWA 2IWEA 3JTBA 1RKRA 2VW7A 1ASOA 4UANA 1ZDSA 3ZBMA 4FAAB 2X87A 1AZRA 1X9UA 1AQ8A 2BW5A 4NERA 1F56A 3NYKA 1BQ5A 1JERA 1ET8A 2QPEB 2XYBA 4YSEA 1AOZA 5I6LA 3NJHA 2PPEA 5TK4A 3OD3A 3AZUA 4HALA 4G72B 1A3ZA 2VSKB 2GC7C 5AKRA 3TBCA 2EILB 1NPNA 3AG3B 1NICA 2ZOOA 1CURA 3C75A 4EF3A 1NTDA 1HAWA 2A3TA 4P5SA 2YXWA 2MRYA 4DP6X 2GHZA 1KCWA 2JKWA 3X1BA 3AG2B 2AZUA 3FS9A 5A7EA 1NIEA 1SF5A 3ASNB 4NAJA 2XV3A 1X9RA 2QPDB 1M57B 1E30A 2UX7A 5I6OA 1ILUA 1TKWA 5AFAA 3SBRA 1PLAA 3EH5B 4HAKA 2P80D 3CVCA 3QJQB 1PNDA 2Q5BA 3FQYA 2WSDA 1PZAA 3NJKA 1WA1X 3SBQA 1BXVA 1QNIA 5E9NA 1GY1A 1FFTB 2GI0A 3TU6A 1M56B 3SQRA 3FYIB 3PXLA 2PP8A 1OE2A 5B7MA 3EHBB 3FPXA 1AS8A 4FA7B 4F2EA 2QT6A 4GXFA 2IDQA 2HLEB 2QDWA 2IDUA 2IWFA 1AZCA 1VLXA 1SFHA 1ET7A 1NIDA 2XX1A 4E9RA 1KBWA 3KW7A 1TEFA 4F7KA 3V9EA 1WA2X 3OMIB 2J5WA 4KNUA 3N2JA 1L9SA 3X1EA 2DWSA 2BO0A 1W6LA 3H4FA 2FTAA 3EF4A 4QLWA 2BHFA 1JZJA 3GYRA 3V9CA 3ZX1A 3OMAB 4DP7X 3X1NA 2PPCA 1ADWA 3QJVB 4E9XA 1NWPA 1JVLA 5I5MA 4KOBA 3EH3B 2HRGA 2FT8A 4KNTA 2ZXWB 4HCFA 1AZUA 1V55B 3X2QB 4UF7C 4M3HA 2GSMB 4AZUA 3NJIA 1AR1B 4N4YB 2GIMA 3KW8A 1E65A 2W8CA 1KYAA 3FU9A 1J9TA 3H56A 2I7OA 5I6KA 2XUWA 4AKOA 1DZ0A 2OV0A 1KCBA 3BQVA 3AG1B 4A2FA 1ZPUA 1IBYA 1RZQA 2FQEA 1L9PA 3FYEB 4AKQA 1CYWA 4E9SA 2IDTA 2Y69B 3NJFA 3T9WA 3FT0A 1J9QA 1URIA 4CSZA 1RZPA 1A4BA 3RYMA 3QQXA 3FQ2A 2GB2A 1WS7A 1L9RA 1AG0A 2FWLB 4YSSA 1J5DA 2WO3B 3QJRB 1KV7A 3QPKA 1AAJA 4PAZA 1L9TA 1XB6A 2IWKA 3GDCA 5I6NA 4YSQA 5EHFA 4BDVB 3MBWB 4YSUA 5B1KA 4GP4B 5B7EA 1SJMA 4KO5A 2XVBA 3NSDA 2HXAA 4A2EA 3S8GB 2YAPA 4HHGA 3WNJA 2WO2B 4YSOA 2BZCA 2PPDA 2FT7A 2IDSA 1V54B 2PCYA 2PPAA 2NRDA 1PF3A 2GBAA 4YL4A 4BK5C 1SFDA 5LDUA 1WS8A 1DYZA 2FNWA 1HFUA 2H3XC 1ZV2A 2FQFA 4Q8BA 4G70B 1J9RA 1CYXA 3PPSA 1JZIA 5B1JC 5I26A 1AZBA 2MTAA 2I85A 3IE9A 3WKPA 1NIAA 3NP3A 3FSVA 2IAAC 3PCYA 4YSPA 2BWDA 3WNIA 4BXVA 1WA0X 2BW4A 1SHXA 2ZWNA 3T71A 1SF3A 4G71B 2CUAA 1OCOB 3T6ZA 4F2FA 2J55A 3S3DB 5B3SB 2YAHA 4A66A 2CALA 1OF0A 4JKNA 2IH9A 3ABMB 1A65A 2VSMB 1MG3C 4A2GA 1TEGA 2B3IA 1PZBA 2VM3A 4GYBA 1OCRB 4KNSA 3NSCA 2EINB 1ZIAA 3GXUB 1RCYA 3PAVA 3NJJA 2UXGA 2YAMA 1EZLA 1BAWA 4GY4A 4Q89A 3ABKB 1R1CA 1NDTA 1T5KA 2XV0A 1AS7A 3X1FA 3NP4A 3TA4D 3AY2A 4GP8B 4JHVA 2HRHA 4HZ1A 3UABA 1KDIA 2YAFA 4W1TA 1ETJA 1MDAA 4YSRA 2ZONA 1CC3A 3NJMA 1CUOA 2OJ1A 4AX3A 3QJSB 2XX0A 3TBBA 1ASPA 4KOCA 2VMJA 3NSFA 1BXUA 3OM3B 4YVUA 1NWOA 1XMEB 1OE1A 4ENZA 1YLBB 3FPYA 1NZRA 4G7QB 1KDJA 1SNRA 4A68A 3OQRA 3NT0A 1GS8A 2HX9A 2OCCB 1FA4A 3FSAA 3ZDWA 1AG6A 1OCCB 1IBZA 1JZGA 3FQ1A 1PLCA 1MZYA 2PPFA 1OCZB 4M4RB 3IBOA 2PCFA 1L9QA 1KBVA 3CDZA 1PMYA 2FJSA 2EIKB 4DP8X 2FQDA 2GC4C 3NJGA 5PCYA 3WKQA 1XB3A 2R7EA 3CVBA 1AZNA 4G7RB 2W88A 4HCIA 3UAAA 2HZHA 3T6WA 3AW5A 5F7AA 3U25A 2UX6A 4YSDA 2AZAA 3PAUA 4DP2X 1W6WA 2FQGA 3EH4B 3PLYA 2BZ7A 1BYPA 1IC0A 1JXFA 3WIAA 1PLBA 5I28A 1AS6A 3FU8A 1MG2C 2JFCA 3CVDA 1BEXA 3FU7A 1QHQA 5B7FA 2VN3A 5I5IA 1L9OA 4BWWA 2YQBA 5B1BB 2XV2A 3T6VA 2BP0A 3HB3B 5AZUA 2Q9OA 1QLEB 4ZK8A 1A8ZA 1E5ZA 2CAKA 2P80A 3IEAA 1IUZA 6PAZA 5B1AB 2YXVA 4HIPA 1PZCA 2UXVA 3CZUB 1OE3A 2LLNA 1ET5A 1UATA 2DY2A 2PP9A 3BVDB 1EHKB 4AI7A 2J56A 2XXGA 5ANHA 2B08A 2E86A 2UXTA 1J5CA 1JZFA 3HEIB 4DP9X 2JXMA 2DYSB 3L45A 2XWZA 2TSAA 3S8FB 4HCGA 3H4HA 1NPJA 2AFNA 1XB8A 2YAEA 1N68A 2XLLA 1WAEA 4WTQA 2PLTA 3WI9A 1OOWA 2UXFA 4KO7A 1BQRA 1BQKA 1GSKA 2BP8A 4YSTA 4TXVB 2YARA
chains in the Genus database with same CATH superfamily
3H1ZA 5L2JA 3MUHL 2X89A 2VLRE 4B0MB 2I60H 2WTPA 5HDQH 5IOPB 3ECVA 3SGKA 4HBCL 4KKPA 4OVVA 4CW1A 2R4SH 4NUMA 1SDDA 3MRFA 4X5RA 1KCRL 3QIBB 2AVFA 5CBEB 1UM6H 5CZRA 1ZWIB 2RALA 1BZQK 1SM3H 3WGUB 3CHXA 3GKWL 4DETA 5I66B 3QDMD 4NQXA 3U1SL 4MMZA 4KK8D 4BZ1H 2EC9U 2EXWC 1R3IH 2DYRB 1TJHH 3LXAA 5F72S 4FXTA 4EIZC 5ENWB 1U8LA 3DYOA 3MUY1 4J3OF 2P24B 1CXLA 1G1KA 4QWWC 3EFDL 3RVUD 4ZMZA 1DJIA 3VXUD 1CJYA 4ETYA 2AEWA 5T1JA 1BD2A 1YY9C 5D4HA 4B9GA 1CB4A 1JTOA 1H5BC 4UTBH 4FQLH 3H7BA 3VA6A 3GPEA 5LNGA 1IC7L 4UU9B 3EYFB 2YMXL 3P40A 4E5XG 3ABGA 4NGHH 3V4UH 1HNGA 1FFOB 3K2MC 1NKOA 4ABQA 4JDTH 3TBSB 2BWIA 1VGEL 3CFNA 3FU7B 4MCZA 4AE0A 1BGXL 1QI5A 3RI5F 4JB9L 1YNTA 4P5KB 2VC2L 4M9PA 3WJJA 5KS9E 1XR9A 1MZZA 2LU7A 3WIHH 1IGMH 3PL6A 5GSVB 4XC1L 1JWMB 1FRGL 3IJ8A 2PYEB 3ME0B 3VB8A 5JDSB 2BSTA 1LDPL 3P30L 5F1IB 3RE0A 1Q0XL 3ZSTA 4C56D 1B3JA 3IN0A 2H3KA 2XPGA 5DZJA 3UGEA 3B9KD 4MBRA 3ATFA 5EZIH 5FYJL 3WXWH 4JPVH 4KC3B 1UCTA 3P69A 5IW3A 2TSBA 1CYGA 2P8MB 1NAKH 1YNLH 5I19H 3HG3A 4F57H 2E74C 4NZRL 1B0GA 5H37G 2ZXDA 4C4KO 1V10A 3MOBL 5FM8A 5CIPA 4MJ5B 1U93A 5C0GB 2XWCA 3CZNA 5IFAH 1GOHA 3QCTL 2JQZA 3TVMC 1J8HD 5D72L 1Y18B 3KGUA 1E2WA 2NY1B 3QO0A 1HHHA 1BJ1J 1PQZB 3SGDH 4S1QH 3L1OL 1SXCA 2PYFB 3C2SA 2X4UA 4ODVH 1MCEA 2E0PA 2DS4A 3EJCA 3KPSD 3HTLX 4PP1C 3RGVC 4WJG3 3RPIA 4WI0B 4BXSV 1F2QA 4GS7C 4AYFA 1PNCA 1YN6A 2AITA 3K4DA 4HIIA 4XOAA 3V8OA 5IG7A 5JORA 1FFNB 3BQUB 2XOTA 4F7CA 5E2VH 1GYVA 2VT0A 2W9LA 3JV6B 1PX3A 3DETD 1U91B 3NA9H 4U4IA 1NUNB 4PGZA 2OMZB 4ZOEA 2P45B 1HOCA 3QA3A 3B9VA 1JHTB 3W11C 5C0AA 4HK0A 2ICWA 3D52A 4Q6YA 1AO7B 3I3EA 3GS4A 1UHVA 5F89A 4HALA 4A7UA 5IB1B 4WW2A 1PZ2A 2UWEB 2UY6A 1I7TB 4FEIA 4M3KB 3OTTA 4Z76A 3S0PA 4ISVA 1JNHB 1IE4A 4BCZA 1PY4A 4LXFA 1GW6A 2EILB 2ZUSA 5KZCD 1OTSC 1U3HD 2A77L 1N8OE 2VXVL 5BRZA 2C9QA 2P43B 4IU2B 4U1MA 5HHOE 3ZYZA 2OMVA 1HZHL 1WWAX 4E0RB 3VMOA 4GSQA 3REVA 4FQXD 3IK2A 5DF0A 3QUXA 4N0FA 1F11B 5GGQH 1QSZA 2BERA 3WMPA 43C9A 4DN4L 2HWZH 3VFPA 2MTPA 4AQ8A 3QQNA 2XG4B 4ODWB 5GRZA 1ZHBA 4KQ3L 2X53A 4Y4KB 5D7EA 5EOCH 1EFXA 5I1EH 4XNXL 3SBQA 5FPIA 5I5RA 3PGFL 2X2UA 1T1YA 3QWQB 3VM5A 1HEZA 3O9WB 3SJVE 4M5SA 4PJ9B 4EBQH 2C1PB 2YGOA 1CL7L 2Y07L 4PRHE 1ZANL 2EYTA 4JO5A 1JK8B 5T1KB 1MI5B 3EHBB 3MRIA 4YDKL 4C59B 1MJUH 4XXCC 5HBBA 1BWMA 4U7KA 4HG4J 1BX2B 4NZDA 5J57B 4K71B 4LSDA 5D5MA 4R2GD 2F5BH 2Q7AA 3Q5TA 4JY4B 3L4WA 5DI8B 4KROC 4PGBA 2AEPH 2B8OT 4G3YL 2JV6A 2XKSA 2OL3B 1AGBA 1KBWA 1F1AA 2P52A 4YHIA 1NBQA 2BSDA 3W39A 1E4XI 3AB0C 1RK0B 3WHE0 5C9JB 3RDTA 2ATAA 5AENA 4MA3A 4N8CL 4D3CH 1RJLA 3KGTA 3UG5A 2WBJB 4EZLA 2ZICA 2QPFA 3B9DA 3ZX1A 1AXSB 1Y6MR 4XP5H 3X1NA 1E3ZA 4F80A 3MXWH 2FJHB 2OMWB 4NOBA 2MOQA 1A14H 5I5MA 2WXQA 4AITA 2Z92B 2IOMA 3U6RA 2L0DA 3K8KA 1WT5A 4OM0L 3FNKA 3FB5A 3V8CA 2GSMB 3CTTA 1TJGL 2K4WA 3PV7A 4MNGE 2OULB 1MCHA 4FZEH 1YEJH 1WRFA 4R5XA 1TSHA 1OAYH 3GUTA 1WTGT 4IKJA 1J9TA 1YMHB 2XUWA 4I3RL 5D7LD 3AG1B 4MAUL 1W0VB 4ONOA 4F15C 4TRPL 3EO0A 3OGOE 4MKMA 4J28A 4JO3L 5SWZA 5I0ZA 1J87A 1ZT1B 5E2UL 3L7FA 4JQIA 4R7NA 5HGAA 4PCSA 3QQXA 3E0GA 3FQUB 2D4DA 3FO2A 5DD6B 3FB6B 3BKYH 4CU6A 1NBCA 3ZMRA 4JN1L 4QWWD 3KAAA 1XB6A 5C07E 2F7IA 4YSQA 1AGFA 1UKTA 1GXEA 3QUHA 8FABA 4GNKB 1YY9D 5B1KA 4GP4B 3WMSA 3L3DA 1BFVL 4YX2H 5GGVL 2XFXB 2FEEI 3MLSH 4PJBB 1RZ7H 1KC5L 3JTTA 4F20A 1OAKL 2APXA 4WO4B 1A6UH 2CR6A 1RPUA 4PREB 3T0BA 1DHKA 1NAML 4ZS6C 5I1HH 5F7UA 2ATKB 3FQNB 3ULUL 1I8AA 4H26A 3Q1SL 1DYZA 2QMKA 4KFMA 2V8LA 4O4YH 2VXQA 1YUKB 1JL8A 2HTKD 4LOEA 2KERA 3BWAB 3VFVA 3VQ2C 2FB4H 5DYOB 3A0OA 3A3YB 1ZA3A 5I1AB 2O1AA 1D5XA 2I27N 4TV3A 1NKRA 4N8VG 2YPVA 4OCRH 4JUSA 1MLCA 2GTWB 1WA0X 4JKLA 1N6QL 2VDQB 4N2FA 1KPVA 5AKTA 1OAJA 3RBSA 2HB0A 5T3XE 5FUCE 3ULUC 4FXGA 2G3MA 3KYAA 4RGNE 4OGYL 3CLWA 2W1NA 2WPGA 3ABMB 5BO1L 3PXHA 5D7IB 2B3IA 2F5AH 1OCRB 2KL6A 4PJIB 3HMXH 5IVXF 2XV6B 1ZVNA 1AGEB 3TVMD 4C55A 1KCUL 3RL1B 4N5EC 2EUWA 4PV8A 1Y0LB 2CIKB 1PG7H 2ZUVA 1ZA6A 4Y5XA 1ZT7B 5AAWC 5TDOB 4P23B 1RFDH 3C6SA 3U79A 4X6FA 1HINH 4BA0A 2ZYSA 4N8VB 3RGVD 3X1FA 1A9BA 3PWPB 3QZOA 4TVPE 4G6JH 4Y7MA 2ZSVA 1W8OA 1ZPLA 5CEZL 4GMSL 1CC3A 1GPOL 4JY5L 2AJUH 1JNNH 1HS6A 1BMZA 4JGUA 4ATWA 1LGVA 5I18H 1BZ9A 2GKIA 4YQXL 3GMLB 3EO1B 4KPHH 4QXWA 5D2NB 1CFQA 3E1F1 1IV8A 3FPYA 1NZRA 2D3JA 3S7GA 1V7ML 5BMFH 4A68A 4KVNL 2QSTA 4BRVA 2VRQA 2GSGB 4H44C 1I8MA 1AKJB 3ULAB 1A3RH 4NFCA 2VAAB 5A1AA 1TFHA 4XO8A 2QPUA 1SQMA 5LQBL 1OCZB 1H8LA 2NXYD 2YO3A 3FZUC 3C09B 4WWPA 3RVVC 3BEVB 2F2HA 3O8XA 1PDKB 3TBYA 2PO6A 1XB3A 2R7EA 4L3FA 4HFUL 4NHCL 4UQCA 3UMTA 5IHWA 3EYOB 4J23A 3IDUA 1IKFH 1H3XA 1KIUA 3MV7A 4G7RB 4NJAL 4OFDA 3VSTA 4B3VA 1MOEA 5A16A 4L3ED 2F7PA 3AW5A 3CFMA 2OSWA 3EJUA 3AJ7A 4UT6H 3KPQA 2XRAH 2BJML 3QXAA 3EH4B 4MZ2A 3BHBA 3MCKA 5TDPB 5J6SA 3BN3B 4UT9A 3R7QA 5I28A 3OGCB 4J7RA 4MAYB 2ZWLT 2ZSWA 4PJ7F 4S0TD 4AQEA 5I5IA 5J5EA 2IBZX 2OL3H 4KFZC 1HT6A 4HOXA 2BP0A 1ZHLA 4LL9A 3GSRB 2XC8A 4X8XA 3HI1B 4XNZB 1QLEB 2EE6A 4JN2B 4ZK8A 4WQOA 1LO2L 3ZGHA 5MERB 2HAZA 4DVRL 3X13A 5L2KA 4MNQD 4ZUUA 4KROD 1ZE3C 4F9PA 4AK1A 3I6GA 1UADC 4A7GA 1BVLA 1NMAH 4TM9A 3UPRA 3GSOA 5KBMA 1BHGA 1MJ8H 3WE6A 1D9KB 3V5DA 2E7BA 1RUAL 3LPFA 4IMLB 4AVJA 4NO0A 5E1AA 1TTBA 4ONHB 2GT9B 1OCWH 3TCLB 1GJUA 3MRJB 2Q7YB 3Q2WA 5I30H 3VSQA 2AFNA 4XWGH 4MMXC 3RNKB 2H6PA 3DV4A 3G9AB 1NFAA 3I9AA 4P2QE 5IBLC 5F71A 5SX4I 2E46A 1YNKL 3DO7A 5ACLA 1KEML 5AW0B 2QPSA 4LCCC 5C92A 1RZJH 3HBZA 4XZUB 3OKYA 4QNPE 4HJIA 3O0RL 3LH2L 5GS0L 1QR4A 2DWDA 3HC4H 4AMWA 5E9DA 5FGCB 5DHYA 2W0FA 3F7VA 4DGIL 4Z23A 4E68A 3VXPA 2FX7H 1GMIA 1LMKA 3CSYB 4Z7NE 5AAMC 4TUOB 3AU0A 1MVFA 5GSRA 1G9EA 3E8UH 4NM8L 3I6LE 4YC2B 3C6EA 5B39A 3LDBC 1IFHH 3K72B 4BDVA 3MJ9L 3KCWA 3UZVB 3HNTH 3BFQG 2I32A 1FHGA 1DEEB 2JQMA 3QULB 1MVUA 3FO0L 3QJXA 5ADOH 3WEXA 1F42A 2GAZB 1DBBL 4TKWA 1QEXA 1DVFA 2XSKA 1TU2A 1P7KA 3IMWA 2BY0A 2Q7NA 2BOBA 3KPRA 4JBSA 3SD5A 4QRTB 3OKLB 2BNRE 1SYSB 1O9WA 4RWYH 1FN4B 3WG7B 3X17A 4KUCD 3ZDYE 4QGYA 4NQEA 1W16A 4H0IA 1H8OA 1BFTA 2DWTA 4HEMA 2HT3C 3DBXB 3GBEA 5D1QB 4Z78A 4GRLD 5ERWB 1H3PL 4DEPB 1BAFH 1I8LC 1A4JA 2DLFL 5E4OA 5D7HA 5AZ2L 2G4EA 4J2QA 4UQ3A 2VDQH 5CAYB 4UDUB 1MVYA 2BOLA 2G60H 3KPOA 3WJMA 5D7SL 4PJFE 4FGMA 4OCWH 4HCRA 4L9DA 3QXTA 5D7JA 3D12B 2CUIA 4Z18A 4EOWL 3WENA 3AQXA 4JFFA 1J7VR 1QX1A 2DF3A 2IADA 2FUQA 4G59C 4PP2A 3GMNB 2ICWI 3GRWH 4IOSA 2X6BA 2F7OA 2EXYC 4ZTPH 1FV1A 4H5SB 4AJ0A 2OX5A 2IPUG 5T33L 3AQZA 4QHNB 5DA0B 4GP5B 3QG6B 4WVRA 2WWMC 4YZFE 1UWXK 4BFIA 3GHPA 2WV3A 1JVOA 1QHPA 3NFNB 2XFGB 4XP1H 1NBVH 5IBTH 1H3TA 1WD9A 1QABA 2HTLD 4FLOA 4DP1X 2YJQA 4NO3B 3K2UL 2ZWZA 3FKUS 3VGGA 2XI9A 3N55A 2ZG2A 1DDHA 5DUBA 1CGSL 5EO0A 1CDYA 1KYOK 2A4CA 1G9NH 2AJ3A 1S2EA 4U6XB 2VN6A 2JIXA 2NUTB 4K3DH 4ZW6A 2BFVH 4HWBA 3QDAA 1FNLA 3TWCH 2OXHB 5T5FA 5FB8B 1S7XB 5JPNC 3KDMB 1RU9L 25C8L 3D4CA 2PWHA 1U8PA 5I71C 3EGXB 5C0EA 3TURA 4M6MH 3SO5A 2IOOA 3MUGB 5C2UB 2FEJA 3HUJE 1HHIB 2XYBA 1E27B 3BZEA 4HFWB 1T1WA 2XICA 1DLHA 4RMTA 1A7PL 1EAOA 3C6LC 3QNXA 3FF7A 3EIFA 3V4PL 3DVNA 3ECBB 3F7PC 5EO1A 2EE9A 3KR3H 2CDGB 2QADD 2H6UA 2GSIA 4GMTL 4NKQB 4P2OB 4ZPTA 3KGRA 4U1GC 1OO2A 4JFYA 1CE6A 3QCUH 4H7VA 3T1WA 2VUYA 1TUPA 3V6ZB 3H9YA 3WN6A 3GHEL 3H2QA 2RCSH 5KJ7E 1PPIA 3NG5A 3FZUD 3SKMB 2OM5A 4CADB 5CEZD 4IYKA 2WUCL 3RVVD 4EI6B 3JT0A 5CBAA 4LHQB 4ES9A 2NY7L 2WMPA 1I7RB 1HXKA 4HAKA 4UZUA 3K2KA 5JIIA 2RHEA 1VPOL 2R0KL 3L4VA 3LN4B 5HGDB 5AQ0A 1HDMA 3ZTNL 2OTWA 2CKBL 4GRWE 4KX7A 5GGRB 3C5SB 4M62L 3F6LA 4K3EL 2CO6B 3MRMA 1L6XA 4LAQL 5JW4N 2LE9A 2A4ZA 3D2UB 3MV8E 4R4BA 3H0TA 1HH9B 4MA7L 1RIUL 5EO9A 1URLA 4D0CA 2QT6A 4Z7UE 3RWCA 2N1TE 1FYTB 4WKZA 3IJYB 4BQ8A 4XRCB 3IDGA 4LVHB 4CVZA 3AXIA 5DLLA 2AGJH 1OB1A 4X8JA 4PGDA 4E9RA 5HHOB 1DJXA 2SEBB 2WLIB 2W91A 4NP4H 1KOAA 4MDJA 5DVNA 2XN9E 3T2NH 5C0IA 1LEKB 5JHAA 2H32B 1F3DH 1IAKB 1W6LA 1ACYH 2OMUA 4L9LC 3ULVH 2OR7A 5LCVA 3MCLL 4TULL 2DI9A 3KHOA 5CJOH 2IALA 3CZEA 1CLVA 4JRFA 5C3IA 4E41B 4AH2A 4PJDF 3BIKB 3SJVB 1Z1WA 3IFNL 4U6HB 1YEHH 4M7KL 5JPMB 1P2CB 5GZOC 1OZUA 1K6QL 4PRHB 2F15A 3VXRE 5IBLD 5IHHA 5DC2A 1WBYA 4ZSOA 2E56A 1DSFH 1AR1B 3WNMA 4XP9L 3MRNA 4O02A 3GB7A 1FO0B 1NDGA 4ILDA 4DTGL 2P48B 2ADFH 3CQPA 4DUWA 4U1KB 4P99A 3UBXG 1HSAA 5TH2A 3MDJA 3LRSB 4WJ5B 1G7IB 4HUUA 1EHNA 5GS1B 1N5YL 5IMOA 4W4OC 5DJ6B 3R7RA 3TN0C 1LO4H 1E5AA 4A55A 1OSPL 1UFUA 2JJSA 5KAQG 3L95B 2VNCA 2XIBA 1XGQA 4MX7A 4TSBL 5IB5A 4RAVA 3SO3B 1I1AC 4DGUA 4ZO6A 2CLZA 3NAAL 4D9RD 1XIWB 2F53D 5E6RB 2PW2A 1J5DA 1LXMA 2K0RA 3TA3A 2FD6H 1L9TA 3BVTA 3GDCA 4TSAH 5FV1L 1HE8A 1DBAL 5BXFA 2J8UF 1OHQA 3PQYB 4H13C 4KUCF 5DMIH 4QRUA 4U1LA 1T03L 3ZRSA 3DPBB 3FUMA 3EDJA 4JO4H 4XXDA 2JB6A 4U49A 3S8GB 3QUMA 3UTZA 2YWYA 4MNGB 5GS0D 4OZGF 4UQ2A 4AGMA 1DLFL 5CILL 3TV3H 1YVLA 2FK9A 3HZ3A 2PPAA 5EV7A 2CRYA 3ZL4H 4UMGA 3UBXB 3S34L 1YEIL 1VDGA 2R56L 4LSQH 1AP2B 5B1JC 1U3NA 3S88H 4JO2L 2ENSA 1QYGL 3QFJD 5C97A 1MWAA 2CMRH 1YAIA 3WKPA 5JA9A 3CQFA 1IEBA 3BWUC 4JM2B 5E8EB 2UZYA 3WNIA 2XT1B 4NO2A 3WEOA 1AC0A 5IEHA 1HL4A 4F9LA 3ULUF 2V2TB 2DQDH 4QDGA 1HI6A 3OZ9L 2AQPA 2BXYA 1AQDB 2YPLE 3CZJA 3OB0K 1F90L 4G6FB 1NQBA 4P2RB 4ZYKA 1MQ8A 5C08E 1DDTA 3GBNL 3S3DB 4WU7A 3K80A 2F8VA 2HJLB 3KNBB 4PHXA 5C70A 4JM4L 12E8H 4EKJA 1YECL 1O7DC 2EXYD 2VM3A 3FC8A 3N3EA 1LNUB 4NKDA 2VDML 1T0PB 3FT2B 1T5WA 1G6RB 4DAGH 4K5MA 2E5EA 1YYML 1WTLA 4PLJD 4ZNEA 4KQ4H 5EZOL 2YAMA 4JDZA 3MRLA 4BH7A 3UEZA 1WD8A 4IBWA 1H15A 2OQJA 1DQQA 3EJYC 1EHLL 3HZKA 2QFPA 1FZMA 3UZQA 3BPLB 2QQQA 3PWJB 5ITFB 3HG4A 5E6IB 3N5AA 2ADJB 1DANT 1XAUA 2Q3ZA 4I85A 1P7HL 1OARL 2AMGA 4NZ8A 1DBJH 1LD9B 4XHJC 2RIKA 3MA7B 2GUOB 1PLGH 3HG1E 5ALBL 5DHVB 3MNWA 5F0JB 3QO1A 4GRMB 1KTDA 4ZAKB 1ETJA 1ETZA 4FQJH 3SY6A 1JV5A 4JPQA 3VYNA 4Y1AB 5GGSY 1FFPB 2A99A 4N2EA 3QRLA 4XB7A 1OGAA 2LABA 1IKNC 2XX0A 2YOAA 5EWIL 1MQKH 2OBGA 2O5ZL 5DD5L 1SLXA 2DTSA 1NWOA 4YO0B 5IR1B 1F58H 4PMEA 3TNNB 1EZVX 4JFHE 3MVSA 4G42B 3X3FH 4YHML 4U1JB 4RQQA 3LSOB 4XAKE 3TT3H 1SXBA 4UV4L 1VFAB 2NTFA 4B5ZA 3C60B 4LOVA 2ILLA 3C6LD 5LXVA 1KCLA 4DK6A 1A6AA 1JF1A 3ESUF 1F4HA 4MYWB 4N2IA 3BRDA 2VJXA 3ARRA 3UYPB 2NQ3A 1WPCA 4M4RB 2FYVA 4ZOAA 2GW5A 4Y1SA 1LP9A 1YCSA 3WKQA 3WEMA 1Z9PA 4N0YL 2R69H 1OHZA 2D7TH 1B4TA 5DS2A 3ZHFA 1HILA 2ZPKH 3ULSB 5IVZA 1F41A 5GXBB 3N1MC 3CV5A 3ZZLA 4LARL 3QGVA 2CHZA 4NNYB 1BD2E 1J5HA 2QTVA 2BVUA 3NIGF 4FKEA 3Q43A 3JZYA 1GYAA 3PAUA 4PGCA 3CMGA 1L0YA 2IBZY 1Z5YD 1UM6L 3V0JA 4YHYC 3HNVL 1PLBA 5LB1A 2F6AA 2C9UA 1BQLL 2VISB 5DJYB 4FNLL 5K9KB 1MG2C 1J48A 1JGUH 1G7MA 3F8UB 2VN3A 2KT6A 2KI6A 4J4PD 4EDWL 4I8DA 4UDTB 2MPAL 4Z5RB 1IILE 2H32H 1HHKB 2X2JA 3K91A 4OLXH 5DC9B 1SOXA 3O6KL 2RBLA 3BUDA 4WSKA 3SB3A 5B1AB 4YZWA 2DQGH 4GAGH 3DX9A 4LLWA 1S9KC 4AYBA 4YAQB 4UTBL 2XIIA 3ARGA 5GRUL 2MQCA 3WUWG 3IFOA 3QFDA 3QJFA 1OSYA 1BBJA 3COOA 3D06A 4FTVE 4W6YB 2Z8VC 3SPIA 3T8XB 2YD2A 3JV0A 4A6YA 4ANKA 1J12A 3KLLA 5E2WH 2W95A 3VI3A 3MLWL 2TSAA 5BV7L 1XF4B 2DBLL 3NTCH 4K7FA 1EO8H 4JFSA 2C3HA 2ZCKH 4OT1L 3KYMA 1UM5L 3NDYE 3VD9A 3QEQE 3V0EA 1AOHA 1NOAA 3BC9A 3WIHL 1FO0H 3C8KB 4D9LH 3DX3A 1C9SA 2NY4B 1FCCA 5L7XL 3OG4B 1FE8L 4M9OA 3ZE1B 4XPFH 5FW8A 4AXWB 4CNIB 1PX4A 5TE6L 2W5PA 3RHWK 2Z31C 3T2LA 2D31A 3DSFH 3ESVF 4JPVL 4E9YA 5K9OB 3WUWB 4FQ1H 1FDLH 2O5XH 1NAKL 1YNLL 3MRQB 5BV7C 2XZQH 3QEUA 3UJIL 2WB7A 1C5DB 4NWTH 3DSNB 3ZDZE 5F3HA 3DWTA 3F5WA 4JPKH 3WLWC 3MNZA 1RLWA 1TJIL 1Q1JL 2VWEE 2ARWA 1R3JA 1IGJB 4HJJH 3TN0D 4MSWB 1UXMA 2V3FA 4JDVA 3VI4B 1I1AD 2EVFA 4A39A 4N0UA 5T1MB 3WDIA 4UMSA 3V6OC 1RJYA 2GJRA 2X4OA 2A5UA 4ODVL 1XF2A 4P2QB 1CO1A 5EEZA 3DMMA 1CG9A 3EJTA 4P46B 2X05A 3VRIA 2RQEA 3VVVA 3PHOB 3SDXE 2WXHA 4XX5A 4M4PA 1EERB 3H53A 4IIQB 4X7FC 4P2YA 2NY2B 4J2XA 1KIPA 1EA9C 2BXZA 4KRLB 3EDKA 2IF7A 3BGFB 3NA9L 3T4YA 1SBSL 4LF3A 3I9GH 4WFGD 3EJPA 4KXZI 1SOQA 3TJHC 4F58H 2YRBA 2APSA 4CSPA 1KLGA 2EUZA 3EBIA 4Q4IA 1CU4L 32C2B 3ZDXF 4O2CA 4WHDA 3RUGF 1JV2A 4Z7NB 4XOCA 1ORSA 3J07A 1U8CB 4OF8A 4WUUD 5FYLE 5AD0A 1HQ4A 4GEJA 4A2MA 5CZKA 4XTRC 4GQ9H 5J8OA 2CK0H 2HKHL 3P02A 3HE6C 2WP3O 1CGXA 2DQHL 1YMMD 2GTZB 2NNXA 5BVPH 3WLBB 3U6XA 2AV7B 1GTNA 2N7SA 4KKZA 4M56A 1A4CA 1A7NL 3WTTA 3D0LB 4I9XA 4WY7L 2A73A 5HHMB 5DJ8B 3DJTA 5FS5A 1A6TB 5I23A 1KN2H 2YRLA 3OXRA 4IJ3C 4ANWA 1P4IL 4X6DB 2BVQB 2HWZL 4NQSB 5D5ME 3ZDYB 3VM7A 2BP8B 1G1OA 4WSJA 3W5NA 1CVSC 3E6HA 3HHSB 3STLB 1SMOA 3VCLA 2HSIA 1I85C 1NOLA 5FCSH 1N19A 4ZRGA 1EGJL 1O9ZA 5JOPE 5I16B 5DHVH 3UAEA 3SDAB 2VDOB 2VLLA 3NABH 4HDIA 2JI2A 1RSYA 2WN2A 3FCGA 1P69B 2CBQA 4NQCA 4JR9L 4AOFA 4MNHB 2Q6WB 3O6FB 1ERNA 4MD0A 1M6UA 4M61B 2A9BA 4AEIH 1MIMH 4FQ2H 1BEYH 4I77L 2BIHA 2F8OA 3L3GA 5I74C 1ZVHA 1B2YA 1E9OB 1T80A 1XGRB 2ZCHL 5BQ7A 1AZRA 3Q2VA 1TQWA 3DIDA 3PU7A 3CMOL 1UD8A 2ED8A 3O3BB 1GZQA 3SODB 1ZLWH 3V0VB 1C08A 3ML8A 3N9GL 5IFJA 1U41A 4RA3A 4XI5D 1A3ZA 2VSKB 5B4MD 4RMRA 3VXNB 3IF1A 3RL2A 1T4WA 3HHRB 2CIIA 3MLRH 3TBCA 1R5IB 1MCWW 1NGQL 1ZXKA 5ACMA 3RKDD 4EF3A 3UYRL 4LCWB 4ZQKB 1JGDA 4BZ2A 2WXLA 3NZUA 3P9MB 4ICXA 3GC3A 1T22B 1S7QB 4J3VA 4CU7A 2VDKB 1YQ2A 3MUJA 3VXMB 2VMDA 5GHWL 2WXGA 2H26A 4J6RH 5D6DA 4M43H 5SWZE 2QPDB 3ARWA 2VQ1A 4HC1A 3FBKA 1XL6A 3GINA 2R2HB 1PLAA 3ABZA 2FL5B 3EH5B 3K0WA 2GK0A 3MN8A 2VE6A 1UWEH 3AAZB 4GIAA 4OLYH 4LLDB 5CEXA 1YEJL 1KZQA 1NCWH 4AK2A 35C8L 4WLCA 2R29H 3VXQA 4ELMA 4I0PB 3NJKA 1BXVA 2PMZA 3HUJB 5KVEH 2J73A 1X7SA 4L2YA 5HGHB 1GY1A 4IHBA 4KDWA 3VRJB 3ATBA 1K8DA 1CD1B 3OKMB 5E1HB 2NPLX 4L2LA 5E8DH 3SQRA 2H0FA 2FYYA 2IGFL 3O41B 5HY9A 2Q8BL 2V7NA 1A2YA 1ZTMA 3R06B 5I1KL 2QDWA 4R4FL 5M94B 3QXDA 5HDRA 2XX1A 5EF3A 1D7BA 3OX8A 4MZRA 5AAMA 3GLAA 5L4IA 3DO3A 5FLVA 2OMXB 1FNGA 3GO1L 1E42A 5LN4A 3PNRB 4WWKC 2BO0A 3IM1A 1RZKH 4WFHE 1RZ7L 5DDHA 3ZKNC 2B7DT 3HS0A 2J44A 3PV6A 4B53A 4M5ZL 2X44D 2YKKA 4CN6A 1IB5A 4E9XA 5I1HL 3EYSH 4Y5YB 1A8JH 1KXQA 4IRJA 4ELDA 3G3LA 3MJ7A 3ZT5A 4C4UA 4IHOA 3BPOB 3T2PA 4TUKH 5A2JH 4DGYH 1NEZA 4WV1C 5INDA 3V4VL 4YPJA 3MV8B 1TVDA 1NH6A 1SGKA 2MWCA 1F3RB 3KW8A 4Z7UB 3NRFA 1C5CL 4KY1H 1WIPA 2FJUB 2XQYG 3Q7JA 4LLYB 2WYIA 1KJMB 4DH2A 3UTOA 2WXIA 2OXGA 3LKQA 1U30A 4N2KA 3B5TA 2ZKHH 2F19L 1TZHA 3O4LA 4ZTEA 3B3IB 1FNSH 3TJPA 3AS2A 5I1JH 3NPZB 1TQCB 4FERA 3BP5A 1J9QA 3T3PE 3K6SA 4F3FA 3RWIA 1HCVA 2YS4A 2WQSA 4YR6A 4FNPA 4W9JC 3IB4A 3VFUB 2F5AL 2FCBA 4HMCA 4O2FA 4UYQA 3WLWD 3ESOA 4N0CD 3M6DA 4DO5A 5DZLA 1O7VA 3TO4C 2KLSA 1GHFL 3AS0A 3VX0A 1U8MA 2N1KA 3VDAA 2HLAB 3CDFA 1N4XH 3L1FA 5B7EA 3RTQD 1PG7L 4ODHH 2OTUB 2BRRH 1RFDL 3D05A 2PO6D 1X9LA 5DJCB 4TQHA 4GKNB 4YSOA 1OPOA 4A37A 4FADA 2QKIC 2PCYA 3QE5A 2BCMA 3G5VA 5IV2A 4DVBA 1WUZA 3X3GL 3P77A 1QUPA 5FGSA 4AIXA 1MREL 4PJCF 5HHPB 1EQWA 2ZUTA 5JOFB 4Y2OA 3PPSA 4JQVC 2AJUL 4UOW0 3DK0A 1RH8A 2Y7LA 1I7ZA 3TJHD 3EG9A 2VQTA 3CU1A 4HKZA 3BWUF 5I18L 3WFDH 1F45A 4LIQE 5JPNA 4KPHL 1IBGH 1NIAA 1X5FA 4L4TD 5KG9B 1I9RH 2BZDA 2MQGA 5BMFL 1R4XA 3H9SB 3P0GB 3PF2A 5JHMA 4XTRD 4G8IB 1COBA 3HR6A 2WNXA 3EJRA 4LHUG 2ZWNA 1MFBL 1J86A 4ORGA 5IROA 4AE1A 4OUUA 3NRQA 2H3NB 1R3KA 2OJEA 1MCQA 3FQXA 3IXAA 5B3NA 4XBGA 1PIGA 4KHXL 1VKXA 4JW3A 1Q90A 3IKCB 1V3LA 3PDOA 2MHAB 1KT2B 2B0SL 3BJ91 4X9BA 5HJDA 3UDWC 5JXED 1S7SA 5JHDD 1MHHB 4U3CA 3W2DH 2VDOH 3WXVH 1IKFL 4R90H 1JGLH 4PJGA 2JKIS 5L2KE 2AQRA 1PS3A 4EIUA 2C9SA 4Q0XH 3IDXL 1IAIH 3MFGB 1A0QL 4Q89A 4AWJC 1JN6A 2MOGA 1OAXH 1TQBB 2BVYA 4NKOA 3CDGB 3VXUE 5EDSA 2ZXBA 3NP4A 4G1EB 4XMVA 1UZ8A 1E0OB 1AQMA 4JKWA 4LHUB 1WCQA 2HRHA 1E5CA 4QPEA 3ZN6A 3PWVA 2UZXA 3UOAB 3PUCA 3WOVA 4LSRH 4JE0A 3NJMA 3UERA 2VDLL 4F1SA 4ZMWA 3IMUA 4YIQA 2OYKA 2CXGA 1XXDC 3LEXB 1H8NA 5FIEA 5SV4A 4PJ9C 3VD4A 3TBVA 1SYVA 1W2KT 3LKNA 2HFTA 2HA1A 3GLZA 2VDKH 3DBSA 3SE8L 4LT7A 1VF5C 4X4XA 5C1MB 3HZYA 4FX5A 3FQ1A 1PLCA 1A4KB 2JJUA 5E9DE 4RDBA 4FP8L 3NCYS 2PCFA 1L9QA 4XWGL 4PH8A 4L1LA 3BYTA 3MXVL 4DP8X 2Z8WC 5PCYA 4Z0XA 3GS7A 5DEFA 1H9VA 3EJZD 4FFYH 3QS2A 3D18B 1TCMA 2IQ9L 1YQVH 3TEWA 2OZ4H 2IQAB 2X70A 1RK7A 4MCYA 1PGRB 4E36A 2WKOA 3X12B 5C8JB 2G0KA 5K5YA 4JZOA 2DW5A 1IU1A 5GZOA 5FGBA 5I76A 1J8HE 4AL8L 1RAMA 2OSLB 3KPRE 3HC4L 2BX5A 1WWCA 4LNRA 1XZWA 4MB5A 4DKTA 4W9GC 5DMYA 4LQFH 4PJXA 5ICUA 1Q8MA 2FX7L 5EUOF 2EO1A 2B4CH 3FU5A 4NQEE 1Q72H 4HEME 2YQBA 1IEHA 3BUYA 2X6AA 1XL4A 3FSOA 5IVXE 4GUQA 3D07A 1R5VA 3BLBA 3D69B 3DJSA 5I1DA 2ZIDA 1NFIA 2R15A 3CHSA 4JAMB 5H35B 4CGUB 2F74B 4XCEB 2IANB 2FE0A 4PCKA 3ZKMD 4GJTB 2HMIC 4PRIA 4BFBD 1TZOA 3DYPA 4Z0BH 1I1FA 5DQDH 1OE3A 3BN9C 3QZMA 4RISH 3VXSA 4CILA 2DY2A 1XGUB 2ZKMX 5LVEA 4AL8C 1NC2B 1ONQA 3HMWL 2R9HC 1TLMA 4WWKD 1LE5A 4RWYL 3GMOA 1UCBL 4DP9X 3MR9B 2WVUA 4QHUB 4X8GA 1OL0A 5J9PB 1BOGA 4JFFE 5EOTA 3D0VB 3HJ0A 1EMTH 3DHUA 3LN5A 4TLTA 1WAEA 2G3XA 3CHRA 4NSKA 2NY0C 3CCHA 5DYFA 5HJ3B 1XR8A 2GFBB 3CZSA 3VRLF 4YUEL 3O4OC 5DUJA 2D7QA 1GSKA 4YSTA 1NBYA 3ECUA 1E28B 2G60L 3ZYIA 4HW6A 5I24A 4FQCL 1D5MA 1CGVA 2E4FA 4K2UH 5B1JA 3TPUB 5L88L 5A2FA 3LQAL 1S7RA 2IBBA 1MCNA 4L8SC 4EN3C 3OKKA 2XU9A 3ZO0A 3S5LA 1YN7A 2IH3B 2P3YA 4HHAA 5C0NC 3QIUB 3MBED 1IARB 1OD9A 4KDVA 4L3CB 4N1CA 4P8QA 4Y4FB 2HG5A 3RX5A 5MENA 3AREA 3AUWB 3GFUA 3CK0L 2LU4A 2XWXA 4FTVB 2X1QA 2IDFA 2NY3C 2EP6A 3HC0B 4C47A 2DM3A 1F3JA 4FG0A 4I18C 1NBVL 1XDTT 4UT7H 2D9CA 1DUZB 3NCFB 1FBIH 1G9MH 2BSCA 2OW6A 2X88A 3OV6A 4A04A 3QWOB 3TO4D 1J1XL 4UIMA 2P28B 3QEQB 4EXPX 4OBSA 1KBGL 3C9NA 3QORB 3FB8B 4BWTA 1G9NL 3LQAC 3NSJA 4PJ7E 2CJ3A 4EAEA 4E9QA 4K8RL 4F92B 1ULVA 4D9QD 5DRZA 1T3FB 2BFVL 2AJSL 1MJJB 2WBWB 4LVNB 2L7EA 4N25A 3WHXA 4G8AC 2R2CA 1K2DB 2VLKA 2JCCA 2VITB 2AQ3A 4JHUA 2KDGA 4EI5D 3NSYA 2GUYA 3U83A 3H7LA 3C5ZB 3F7RA 5AYUH 4YDVB 1UKSA 2ZOWA 2YC1B 4XMKH 1CLCA 3EFFA 3N1FC 2BDNH 5GISH 1SLVA 3ZDZB 5I6PA 2P5EA 3PY9A 5F3BA 4MS6A 2X3CA 3VFTB 3ZUCA 1P7QB 3G5ZB 3FQTB 3DJZA 1JPGA 1NCDH 4MYPA 4L3AA 1IL1B 1PBYA 1UWGH 2YBRB 2A9CA 1G9NC 3APFA 4R9HA 1IKNA 4K8RC 2VRKA 1GA2A 1VAHA 5GGTA 1YEKH 2O61A 2JXMB 3HS8A 4TPRH 4LASL 2HKFL 1D6EB 4IGBB 3MV11 2DYPD 1OW0C 4Y16C 5D96C 3IN2A 3F12A 1OPGH 4BFRA 5D2NC 3QIWB 3CC5A 1I4FA 4X7TA 3SDXB 3CSBA 3QR2A 4JG1H 2CE6A 1QHOA 3WKYA 4TSCH 4JFPB 2KQNA 5JMRA 1H0DA 3UADA 1W0WB 4I2XA 3S3BB 1T89C 2MCMA 4APXB 4DP5X 5C0FB 1PAMA 1FFRA 1SBBA 3QDJB 1FNHA 2K45A 4WKXA 4ACTA 1U33A 2ZCLL 5C3TA 2V5MA 3WY4A 4G7VL 3V6FB 2JVUA 2XNAA 4KTDH 2FR4A 1O0VA 3T3PF 2L04A 4QUOA 2EDQA 3KPMB 3NJVA 2X87A 1LYQA 3QK0A 3TV8A 1SJEB 2DICA 5J6HB 3ROOB 3CH8A 3SGEH 3SPGA 5C3LD 4N22A 4J3OG 2IMNA 2KKQA 3M07A 4AW7A 1A7QL 1VADB 5EBWB 5T1DH 1NMCC 1AOZA 4P4RA 3SCMB 3W57A 2CGYA 3BD4A 3NJHA 4K9EH 1P4LB 3AZUA 4ZSOE 3HZVB 1A7RL 1ZMYA 1BCIA 4NENA 4ODBD 4JO1H 3NIFF 1ZLSH 4GFXA 4HQQL 4J8QA 2NY6C 2JJTC 3AG3B 4RGOH 2LW3A 5EPMA 5JW3H 3BT0A 1HAWA 3VWJD 1AD0A 4DP6X 2VB5A 3U46A 1BMGA 1BW8A 3CHOA 1IEAA 5LG1A 5DJZB 1T0NA 1GC1H 4KJQC 2BH0A 5IJBC 2C1OB 1ILUA 1LLAA 1BF8A 5DJ2B 3GMQB 4LPUA 5IMKB 5HI4C 4BZ1A 2BSSB 1WWBX 2LQRA 3QJQB 4LDEB 1BZOA 2WOBA 4JRYA 3MBWA 1FZOB 3QI9C 4HIQA 1I8UA 1MFCL 3S35H 4HWEH 4GI9A 5MEOB 4B9ZA 3LKRB 1PKOA 3QQ4A 1HESA 5E9NA 3O2DH 3MLZH 4EI0A 3MLYH 3Q6FB 1D3CA 1G5AA 1F02I 5EBLA 1MXDA 3VFWB 4FA7B 2V6HA 2Z31A 1NUDA 2ZAGA 2Y2TA 5FYJE 4N2GA 5F9DC 1NIDA 4N2LA 2ZUQB 2CO7A 5IB2B 1P4UA 3QSKB 4XCFL 2FD6L 3BKJH 5JW5B 2HMID 4AIZB 2CQVA 5DMIL 4XN8A 2R51A 1NFDA 4I0CC 5K39B 4ZFOA 4JO4L 1TVHB 3BN9D 1Y07A 2FTAA 1OTTC 1I9IH 4RETB 3GYRA 3LIZH 1M7DA 3SQOH 1G7QA 5GGVY 3D3VA 3OMAB 3GLEA 3ZT7A 2QR0A 3EGDA 3V6OA 4OF6A 1GKEA 3BAEH 5E8NB 2VZUA 4U1NA 1N3NB 2J7LA 2YJLA 3QUZD 2KHAA 5G4MA 3ISRA 4ZPVA 5ITBH 3EH3B 1JPST 2Y1VA 3L3IA 2FT8A 3K1DA 4G80A 2IH1B 3AGWA 1RK1B 1XGPB 3KYNB 3X2QB 4DOHE 4M3HA 4WU5B 2NY0D 3TONA 1W9XA 2BWQA 3V5KA 4LAJH 3Q48A 2CMRL 2W07A 4O9HH 5AVQB 1PZUB 4ZNEE 2BNQA 4F2MA 1RUML 2FHCA 3BH8B 5C0CA 3MA9H 3WS3A 3U7WH 3MROB 1T7WA 2DTML 3PP4L 1KCBA 5TDNB 1T2XA 4XMLL 1J0YA 3BP6A 2NYYC 2FQEA 1CD8A 4M1GH 2IDTA 1ADQH 1X9QA 5DFVC 5JO5B 1U3YA 3U7AA 4EN3D 4KKLC 3L81A 5FFLA 1AMYA 3INUH 2NR6D 5C0ND 3QYNA 5T1LA 4MJIA 1S9WB 4ETQA 3WTWA 1WSST 1OGAE 4XVTH 4QT5A 4XO9A 4PAZA 2NY3D 2ENPA 2E47A 2FWOB 2IWKA 3W0WD 5I6NA 5EN2A 1B0RA 1VFBB 1SEQH 3B43A 4KTEL 1OP5H 3RY6C 1A5FL 1Y7VA 2PXYA 1HNYA 4OD1L 4AIEA 3PS6A 3HE7C 1E8XA 4Z7QF 2WO2B 5F93C 1ESOA 1V54B 3HI6H 5BS0B 3HI5L 4PVMA 3NESA 4PJ5A 4AG4H 4PR5A 4P3CL 1M7IA 1LWHA 5HYSG 4YL4A 1D2PA 5HTSA 4Z7OE 3HB3C 1KTLB 2X0WA 4AV4A 2ETWA 4JFDA 1AHKA 2YOCA 4PJAF 3R4DA 2ZUXA 1DL7H 3X3FL 1CR9L 3T4AB 1IGFL 5ANMB 3TT3L 3OL2A 4MA8H 3DIFA 2PTTB 5FOBB 5T5NG 4L37B 4JFEA 4FMFA 2COQA 1RHHA 4PJDE 5LHDA 4XVJH 2F61A 4K8RD 4X6CF 3KE0A 1S7VA 1G5GA 2FSEB 1HXYA 5IEKB 3VD7A 3BXNB 5LBSL 2CALA 4BK5A 4JKNA 4Y16D 2R1XB 5HYSB 3DXAA 3G6DL 5B22A 5HVFB 4X2UA 4QRRA 2R69L 2ARJB 2G5BB 4MDIA 5DVKA 1B9KA 2D7TL 2V9UA 2E9WA 2EINB 2G9HB 2F8IA 2GJZA 1WUNT 2YR3A 4XC3H 3QBTB 3ZL1A 1G7JA 4R8WL 4A7VA 1DVUA 4HKXA 3ARTA 4AW4A 1QBLH 2VXSH 1Z9NA 4J12A 1PCXA 3V5HB 5IGXH 1CXEA 2Q76B 2GBVA 4G6ML 4QNPF 2F54A 2FWUA 3JTSB 1AYRA 3D4YA 2WBKA 3GSQB 1N0XL 1KXTA 4AQ1C 2UZIH 3OR7A 2HCZX 4OU3A 5F9WB 3VI3E 5KJRH 5KYUB 4N1HB 1VZGA 5IW6A 4PRDB 3DLQR 3CFBA 1ZLUH 2DD8L 2XETA 3A6BL 3L3KB 4AX3A 4EZMA 1LK2A 5DMKB 3TBBA 3ENEA 5ID1B 4ZUWB 4WTXA 4KTGA 5EIQA 4ZDHA 5HPMA 4Z7VA 1PL3A 4OZGE 3ROLB 3ARFD 4ZMAT 2Y3NA 1SNRA 4PWKA 4AV5A 2R2EB 5IOPA 2HX9A 2CPUA 4JKMA 5BW7C 3P4NB 3W37A 1QBBA 3QDMB 3RVXD 5LAXB 3ZDWA 3GSNH 3QIBA 5CBEA 1FPTH 2NY6D 3H42L 5MHSD 1JZGA 4H0GA 3CD4A 1ZWIA 1MZYA 5KBLA 2R0ZL 1A3QA 3NGBC 1KTBA 5I66A 4CBZA 4WNQB 2B16A 1NLBH 4J3OH 4MDRA 1T5XB 3APCA 3KPNB 1PMYA 1EO8L 2XCMC 2UVEA 2FQDA 3DTXB 3NJGA 3NK3A 3VXUB 4PLOB 5ENWA 4KJQD 5EU4B 2P24A 1DVQA 3U2SB 1URZA 2WGNB 5IFHL 4HSCX 3UAAA 4KVCL 2XA3A 2PNDA 4N0UE 3ULUE 5HI4D 1WWWX 4G9FD 4QRQB 3TBWB 3U25A 1RSFA 2WUBH 4O51B 4MQTB 4X5PA 3QI9D 2FQGA 4HMDA 5I0WA 4UU9A 3OKOB 2HLFC 3EYFA 5JPMC 2VIRB 3VWKC 1MCOH 1PIFA 1FFOA 2VERA 1UA6L 2HJKB 3TBSA 4J8RB 3FU7A 5B7FA 1AR1C 4GAJH 5F0LB 1DVZA 1FZJB 3OHXB 4P5KA 2HUEA 5LUMA 2BMKB 4IDJL 2AS5M 1E5ZA 4ODTH 2YQGA 3UBHA 2P80A 5E99H 4C56B 2ZXEB 4HXAL 3S4SG 5GSVA 1IAIM 1JWMA 2PYEA 3ME0A 3B9KB 5JDSA 3FTSA 4LBEB 5F1IA 2OJZL 1P7BA 4RRPG 4CKVX 3BVDB 1CF8H 3VNYA 4YE4H 4KZDH 1GGBH 2CDFB 4NQDD 1QSED 3GI8H 1JZFA 1LK3H 2VDRL 3CLEH 1FVCB 3OJMB 4HZLB 3LZQA 2P8MA 1RPKA 2FSDA 5T3ZL 4BQ6A 3CZFB 1NA8A 4JFQB 4C4KT 2WLLB 3KS0J 2A9NH 1P5UB 3SE3C 4ZMOA 1AE6H 3ZLQC 4KHTL 1J8HB 4UB0H 4MJ5A 4NKIH 4E9LA 1JYNA 1EXUB 1KGUA 4F58L 5C0GA 4CSSA 1BLNB 1ZTXH 3KEHA 4BKLB 3OKEB 3OWEA 1Y18A 1BA9A 4XNMB 4ICWA 4NAMA 1PQZA 2W0KA 4QKTA 3S4SB 1QOKA 2CK0L 2PYFA 5EIIG 4GIOA 6FABH 3C08L 5JQ6H 3HMXA 3IVKB 4WI0A 2IIJA 5ETUB 3TYGL 5DJAB 4A2HA 5D1ZC 2CZNA 4NQCE 1M7UA 5F7KC 3OLGA 1FFNA 4NN7B 3BQUA 5KUMA 4XMZA 2EDEA 4PUBH 1K3IA 1EX0A 3JV6A 1XCQB 1XH0A 1U91A 1XQ4A 2A74B 1AI1L 3MGOB 4BWUA 2I25N 1NGYB 2OMZA 5DUPL 4HT1H 5H37A 4M48H 1S3RA 1QD0A 1JHTA 3ARDC 4KK5C 1AACA 5E08H 4FG6D 1KN4L 4PVLA 1AO7A 2X10A 2CBOA 5KZCB 5IB1A 1UOLA 5DMGC 1U3HB 1MW2A 4HV8B 2UWEA 1I7TA 4W68A 4H40A 3UDWA 1PKQB 4M7JH 5EIIB 1JNHA 5CJBA 1RVFH 2IEPA 3QPQC 2A9AA 4PCTA 1BSIA 3WAKA 4FQXB 3HE7D 4IU2A 5AZEL 2E4TA 1MIML 1EJOL 3NN8B 4FQ2L 4E0RA 4NI6A 2PWEA 4NZFA 4PBXA 5MP6H 2ZWSA 2IH8A 1NCOA 3B7SA 3NACH 4OFPA 4YSCA 3ASWA 1F11A 1WBZB 2XJKA 1U8JB 4G7YH 4OCXL 4ZXBD 2W0PA 3BPLC 1OWRM 5KYNA 3HB3D 1PD1A 3L4TA 2V37A 3IRPX 3VW3L 1M53A 2VYRE 2WLJA 2XG4A 3A4DA 4ODWA 2YD1A 5CU9A 1MF2L 4Y4KA 2QBWA 3DX6B 1BLIA 1PG7W 4YHZH 3ES6B 4HK3N 1PJWA 5DD3H 3IAPA 1PSKH 4L0PB 3O9WA 4M29A 4OLUL 4LSVL 4ZOCA 1WGOA 3D33A 4PJ9A 2C1PA 1FSKB 1XSJA 3EYUH 3MUZ1 5GJSL 4Q9CA 4LMQI 4UV7L 2BIOA 1KIRB 1KTJA 1JK8A 4UT6A 5T1KA 1MI5A 5CCGE 2P8PB 5CINL 5FC9A 4M43L 3VQ1C 2XN2A 1BX2A 1IGYB 1IGTB 4PJ7B 3R1GH 4FZ8H 1HU8A 1GCFA 4JY4A 4MJHA 4U1IB 3TCTA 4DPCX 4S1DC 5DI8A 4MHHI 1TR7A 1DP0A 4OLYL 4XNAA 2OL3A 2ESVD 4NZUL 2LV4A 4Z3GA 1SOSA 1NCWL 3UJJL 1ML0A 4U2YA 1RK0A 5C9JA 2JI1A 2CGRH 2XN1A 3D39D 2F53E 3TL5A 5KVEL 3ZZQA 1J8SA 1KTCA 4ZUVB 5AVRB 5H2BB 2WBJA 2A6JB 2H2SD 4CGTA 1N67A 1AXSA 1E8ZA 3JTBA 3G08B 4GSUA 1MCPH 1E4KA 4GT0A 1HZKA 4FAAB 2FJHA 2OMWA 1KXQE 2BVTA 3T0VA 2WOYA 2Z92A 2AHIA 2J5LB 5DC0A 1PFCA 4GKLA 2ZNXA 3ETBF 1QSFD 5I6LA 2I5YH 3T3MF 3O4LD 5MEPB 5B38B 2IV8A 5D7LB 4HJ0C 4OI7A 2R1WB 3BKML 1YMHA 1IC1A 3KJ6H 3QFJE 2A3TA 2YXWA 2H2PC 4JFWA 3QQDB 1S8DB 2ITCB 2O6CA 1FIEA 4S11A 1UACL 1W0VA 2E75C 3P4OB 4Y19D 5HP5A 1UD4A 3ZDXE 2VJ0A 2HVJB 5I6XC 2HKAA 1ZT1A 1MFNA 2HRPL 4OQTL 3VA2C 5I0DA 2YA0A 3FT1A 1MAMH 3VXTB 3FQUA 3SBRA 4TUKL 5DD6A 1MFAL 1WO2A 3FB6A 1MRCH 2FECI 1UT2A 1E9QB 2Z3FA 4W9HC 4XT1C 3U1QA 5AWNL 4G83A 1H5BB 3AT8A 2Q5BA 1UJTA 3RX7A 1RURL 3Q0HA 3B2PA 3FU0A 1GGCH 4WI6A 1NC4D 4V1DD 3OQ3B 2XFXA 4PJBA 1XCTB 1LE9B 2GI0A 5ID0B 3T2OA 2EDRA 4WO4A 3P3RA 1FNSL 2HLFD 4PREA 1BVOA 1JFQH 5I1JL 3VWKD 2ATKA 4F8TA 4GG8B 5FO7B 3RY4A 3FQNA 4GI6A 1TF4A 4AT6B 3GK8L 1P4BH 3UO1H 2EDNA 3BMWA 4GBXC 2X0UA 1HC1A 2ZG1A 4Y9FA 3B2UC 4ZMNA 2PWGA 3BWAA 4XNUH 4JL1A 5DYOA 4OF5A 2JF1A 4QHKJ 3BPNB 5I1AA 4KH2A 2C3VB 1AQKH 2IO5A 3VG9B 1CT8B 4URKA 2GTWA 5JR1L 3V9CA 2QVFB 3A6OA 1HCFX 1KMGA 2K78A 3DVGB 3HNSL 2ODIA 3QJVB 3IJHB 1U9KA 5IHUL 2VC2B 4ODSL 2VXUH 1FL3B 4KOBA 5HDBE 5LAPA 3HPJB 3B2VH 3TVMB 3UBGA 5D7IA 4XHQA 5JOEA 3GRWA 2VXTH 3IFLH 5F88B 3Q5YA 4PG2A 2YUXA 4PJIA 3QNFA 3RRQA 3KYKH 3WFDL 3WFEH 2QSCL 4N4YB 1IBGL 1AGEA 2XVGA 4CRPA 1FORH 4PJGE 3RL1A 3T5WA 2VRAA 3RGVB 4X6EB 4PWEA 3OLIA 1NANH 2HFGH 3BGFC 3ZQXA 1EO7A 1Y0LA 2CIKA 4AKOA 5HI5C 3NEXA 4GS7B 3L1EA 4WUKH 4F37K 1ZT7A 1TZ8A 5TDOA 4P23A 2TRYA 1MWOA 4LRIC 1UOWA 4N8VA 3N41F 3THML 2Q2LA 1CYWA 3PWPA 4WFED 5D1ZD 4E9SA 3C5XA 2Y69B 5T3ZD 4HJEA 2CH8A 1KJVB 3LVTA 1RZPA 1A4BA 4UQBA 1BREA 4ZFGH 4LPYA 1WS7A 4YSSA 1OP4A 2DJ4A 4Z3TA 3IT8D 1QWUA 4NNXB 2BP5M 2Y23A 4R90L 3JV4B 1OW0A 3ARBC 2R0WL 3CBJB 3U48A 5FO8B 4W9CC 3ARDD 1AXTH 3GMLA 3EO1A 1O6SB 2C7UB 2QLVB 5D2NA 4HIJB 2R1YB 5LXGH 4WK4B 5F9OH 5DMGD 2NXYB 2GSGA 1DQKA 1AKJA 5E56A 4RSYA 4WI2A 3MLUL 2VAAA 3KM1A 5F96H 3QPQD 1CIUA 1QW8A 2FLMA 4P5MB 3HPLB 2NNFA 4IRSC 1HFUA 2AXGB 3BEVA 4HF5L 1PDKA 5HPOA 4G70B 4K7PH 3VSVA 3Q2LA 3LHPH 5L8JB 2V9QA 1FVEB 2ENQA 2Z8RA 2YFNA 4L3EB 3OPZH 1AZBA 5DRXB 1KB5L 1B2WL 3KLDA 3EYOA 3KJ4B 1V3MA 3SKJL 1MELA 5A6MA 2EJ1A 4Y9BA 2GG1A 1QNZH 3FBQA 3TF7C 4HUCA 4OZIF 4AEFA 1Z9MA 5FO9B 1L0QA 2FJGA 3P11H 3KWVA 3F58H 2LOEA 5TDPA 3RNQB 1IZKA 1G43A 1QUNB 3OGCA 4PJXE 1HTYA 5KANI 3AU1B 4MAYA 3POCA 3FFCD 5HYJD 4IQHA 3QAZC 2NTSP 3BAWA 4MNQB 3FN0H 2EDWA 2HT2C 3GSRA 4KROB 4YXKH 3S37X 5DLMH 3HI1A 4JN2A 5MERA 1YQVL 1HEJC 3CN2A 3BFWA 2BSEA 2CO1A 4S1DD 3AB0B 3H54A 4PRIE 4YHNB 1L0PA 1SXZA 2YSTA 2Z64C 5KSBF 3WKML 2BVOB 3VXSE 1IM9D 5C6PB 1QFWM 4ZZFA 3DRQB 5AB9A 2Y5EA 3CFEB 4NP9A 2XTJC 5C0JB 1D9KA 2XBDA 1G0XA 3N04A 4IMLA 1KDIA 5GS2D 1SY6L 2GT9A 4ONHA 3TCLA 2Q7YA 1YYLL 3MRJA 1D5IH 4OM1L 2YXMA 1O7SA 3RNKA 4JY6B 3US1A 4I0PC 4PJDB 2D3VA 5HI3C 4J27A 2ZAHA 3P3YA 4Z0BL 2CHNA 2CSPA 5DQDL 4ENZA 1HHJB 2WN3A 3Q3GB 4G7QB 2BM3A 4XZUA 2DQUH 5KEZA 1Y6NR 3ARED 3CZKA 5C2BL 1FA4A 5FW7A 3IDMB 4WZ9A 4KKRA 5D7KD 4WTZA 2ORBL 4QD2E 2WINB 1A6ZB 2NZIA 3SDCD 4F15B 1R3LB 2H2PD 3CSYA 3IBOA 4TUOA 3VH8B 1P6FA 5HYQB 2FJSA 2D2OA 2EIKB 1PFOA 1BJ8A 2VSDA 3BUIA 4I7ZC 3K72A 4W70A 4HBCH 5MENE 3UZVA 1KCRH 3EBGA 1DEEA 3MRBB 3QULA 4BGLA 3LKOB 3GKWH 4LKXB 3RPKA 3U1SH 2FO1A 2GAZA 3ZXAC 4PV9B 1ETB1 5EBMB 5F7AA 1Z5HA 2J8UB 4NDMB 2A9ML 4QRTA 2Y7MA 3EH1A 1O7DE 3MJ8B 3OKLA 5LGYA 1QTYT 4QXUL 3RIAK 1SYSA 4GRLB 4LCVA 3EFDH 4OTXL 3GIZL 5DJXB 1FN4A 3D85D 1JHKL 4OZGB 3CVDA 1BEXA 3DBXA 5D1QA 2KC0A 5ERWA 3KBHE 2DM7A 1F18A 2JCCE 5DUML 4NO5B 4JFTA 3RJDA 1JRHH 3L5WB 1IC7H 2CAKA 2G3NA 3IS0X 2X4RB 3ILDA 2VH5L 2YMXH 3OAZK 2J2ZB 4RIRB 4UT7L 1W72L 4OKVB 3WFBL 4GBXD 3IRCA 1IIIA 4UDUA 1VGEH 3B2UD 1HK6A 4P07A 1BGXH 1WFOA 4PGEB 1JK9B 4KJPC 3U0WH 4ADJA 2VC2H 4F33B 1R3HB 4Y2NA 4UNVA 2E86A 3KH4A 3N44F 5K59F 1NAMB 3H9ZA 5D8JL 4LSUH 4XC1H 5CMAB 3B1UA 2EDJA 4U3SB 1LDPH 3P30H 1H3GA 1Q0XH 1Q38A 3CN4A 3MJWA 5ICXB 3PP3H 3KHQA 4RMSA 1N68A 1SLUA 4H5SA 2DWYA 4QHNA 3QG6A 2V5YA 3LEYL 2BDNL 3PWUB 1G9MC 3NFNA 1SOKA 4TXVB 1J11A 1EDYA 1OP5K 5BOZG 4NZRH 1NCDL 1BIIB 4NO3A 3MOBH 2WNWA 3QCTH 3FB7B 3G5XB 3G04B 4U6XA 5HI5D 5D72H 2NUTA 1NL0L 1BVNP 1AGDB 2OXHA 5FB8A 3L1OH 1S7XA 2AI0H 2M8XA 3KDMA 4IOIB 2B39A 2GITB 4AQAB 2HG0A 4OD2B 3EGXA 1BQHB 5I1GL 3OWRA 4U0RC 1AVAA 1IC4H 4HPHA 3MUGA 4JFOB 1HHIA 1E27A 3FCBA 3KS0H 4HFWA 1GYCA 2WLYA 3P4MB 5PAZA 1USZA 1DVXA 1YUHB 1NJ9B 2VW6A 3ARBD 3O3EB 4JJ5B 3I6KB 5INCB 1S46A 2QDVA 4OZHF 4RDQF 1GOFA 2ZX8A 1YC7A 3VDBA 3IJSB 3ECBA 4G5AA 2KPNA 3ZE2E 3L5HA 2ZOKB 4YDJB 2CDGA 3MNVB 1X5YA 4KTDL 4P2OA 2WYZA 4NZTL 1YEFL 3V6ZA 5M95B 3OF6A 4NQTA 3IJEB 4P5RA 2RACA 3GXTA 1EHXA 2EDFA 4FFZL 1WITA 3SKMA 4CADA 2L4OA 3MMEB 4IRSD 3UGXA 1ZT4B 4ZX4A 1KXVC 4EI6A 2VXVH 1WJ3A 4OFIA 3RLSA 4W4NA 3VG0L 5I1LB 1I7RA 4J6IA 2VDNL 1HZHH 5FYKL 4ZX3A 2FVNA 3LN4A 5HGDA 4FXLA 4CN4A 4RX4D 5GGRA 3ZRCC 4RGOL 3C5SA 1SEBB 4DN4H 3A6CL 3CFKB 3NIGB 2DL9A 4CU8A 2CO6A 2H5UA 1UH2A 4LPXA 1IT9L 2YAOA 1HIML 3VGEA 5JYLA 3NJLA 6PCYA 4KQ3H 2EC9T 3D2UA 4PV1C 1FIGL 1HH9A 1ZLUK 4FLQA 3CU7A 3CIAA 4UOJA 1FYTA 1P84K 3IJYA 4XNXH 4MXWL 3PGFH 1CDIA 4XRCA 4H8UA 1LO5B 3D9AL 5HHOA 3VYPA 4ALAH 2HT2D 1IKOP 2SEBA 2WLIA 5CJ8A 4V11A 2Y07H 3TM6A 1ZANH 5F1SA 2DIBA 2EKSB 4M1CD 1UYWL 1UOKA 3O45B 4OR1A 1LEKA 4YDKH 2H32A 3S35L 1NGWB 1IAKA 1LDSA 2M26A 1CLZL 4JHZA 2EDXA 5J0BA 1M9WA 3MLZL 4GSXA 5AVYB 3QJOA 3Q8BA 4LKCB 5GRVK 4G3YH 2OTPA 4NBXB 1B0WA 2BY2A 3HR5B 1HKLL 3D3VE 3S36X 2XTJD 2DQEL 3V6OE 4MMXB 1FG2B 3OAUL 4HJUA 2GY7B 4E41A 2Y6TE 3WAJA 1TSRA 3U82B 1IQDB 3BIKA 4RBPH 4WI3A 3SJVA 2V3DA 4U6HA 3K6NA 4N8CH 4Q58C 4S1RL 5F1NB 3NFPB 1P2CA 5JPMA 2DN7A 4QRPD 4PRHA 1S7TB 2NLJB 2VKXA 4LCCB 3F7LA 4CAGA 4CJ1A 4QJ3B 1DR9A 5HI3D 4ZX5A 2D0FA 4YHKL 3QUYC 1FH2A 2EIBA 4D0BB 5LG6A 1G94A 3CBRA 1S3KL 2BNQE 4DN3L 4F2ME 1FO0A 1NEZG 5C0CE 1GSMA 2EYSB 4GQRA 2VLJD 2EO9A 3C75A 1NTDA 1YJDL 4OM0H 1QLRB 1A22B 4U1KA 1TJGH 1OOAA 4NXKA 2K6WA 4YFLI 3LRSA 4WJ5A 2F68X 1DUYB 1G7IA 3DGGB 3LDBB 5GS1A 2F53B 3GSXB 1RMFH 2F7RA 3FTUA 5DJ6A 5E00B 4CMHC 3V2AR 4Z7WF 2J1WA 3L95A 2X3AA 4R4NC 5AFAA 4K3HA 2NY5L 4NAQA 1OAQL 1TOXA 1XIWA 3DPDA 4MAUH 4DESA 1UEYA 5FWRA 4O9HL 4TRPH 4KITB 2PWDA 3PQYA 5IJVB 4JO3H 1XEDA 3AXLB 2K8MA 4RAUB 5E2UH 3MA9L 2DOCA 3DPBA 1EUTA 3U7WL 2J20A 1I1YB 4ZW3A 5J12C 4DCQB 1PEWA 1FFTB 4MNGA 3A4AA 3NIDE 3CZLA 3INOA 1KYOJ 4M1GL 4JN1H 3M17B 4N2MA 4PJ5E 3UBXA 4M6OL 4OFQA 4FXKC 4PM1A 2X3BA 3DO4A 3QFJB 5EB9A 1VLXA 4BK8A 1BFVH 2NY5C 5GGVH 4QRAA 1AP2A 3WCYA 1KC5H 4WGKA 3FN9A 4XVTL 1OAKH 2FBJL 3ZDXB 4JFDE 5L8KB 4GG6F 2DJSA 3RUGB 1NAMH 2WJ5A 3VFGL 2C34A 1Z7JA 2DWSA 3EOTL 2CNYA 4JM2A 2W0LA 3EF4A 2Z4QB 3Q1SH 5E8EA 3SDYH 1SPDA 1RZ8B 2BNUB 1T6WA 4BFJA 4KJPD 1JF5A 4LGSB 4RNRB 3VAEA 3QYMA 2V2TA 3HI6L 4DP7X 1PVHA 3ATAA 1AQDA 1HE7A 4P2RA 1QACA 3HN8A 2C9RA 2CA3A 2HJLA 3KNBA 5AKSA 3ZO9A 4XPTH 5IHBA 3KL5A 1BF5A 3DXAE 4QRRE 2A1WL 3U9PL 1N6QH 1P6AB 1LNUA 3GIVB 3FCSB 5L4FA 3FT2A 3D50A 3I74A 3F01A 1G6RA 4HAGA 1O5PA 4AEHH 2OLDA 2DQMA 2AQTA 1T21B 4EDXB 1G0DA 4MA8L 1MSPA 4OIIH 4OGYH 4IRZL 5BO1H 1HJBC 3PWJA 4HJGB 5ITFA 5E6IA 2ADJA 5K9JL 1E4XH 4P5TC 1L5GB 2O30A 1F6FB 1LD9A 5JHLL 5KUKA 3MA7A 2GUOA 3OVUB 1IBDA 5DHVA 1KCUH 4HP5A 4GRMA 4ZAKA 1EV2E 1TTUA 1TKWB 1U2HA 1DQLL 1FFPA 2CXKA 2KQMA 4Y1AA 4C8XA 4Y1TA 2GTQA 2WTRB 4OV5B 1IFRA 4XWOD 4IMKC 4UNUA 5EA0L 5DQ9B 3SPHA 2F08A 3QIBD 1KBKA 4PJEF 3ZHNA 4YO0A 5IR1A 4IGBC 3C6LB 5KVGL 1UTDA 2IGTA 4G42A 2YUWA 3DX8B 4U1JA 4Z7VE 3LSOA 1BVKB 1QBLL 5CEZH 1GPOH 1VFAA 4KJWD 3WNJA 3C60A 2W94A 5I0YA 2PPDA 4JY5H 1AXIB 3L17A 1I3RB 3ZE0F 2Z65C 4U1GB 5F9JB 3H7BB 3UYPA 4TNGA 4I1PA 2PCPB 4M4RA 1SFDA 2K9UA 4HLZG 3T0EC 3MCYA 1V7MH 4ZQTA 2H45A 4Y89A 1XX9C 4KVNH 2OMYB 5I82A 1T2JA 3IDIB 2WCGA 4QHLB 1IBHA 4AYID 1E6JH 2GY5A 3ULSA 4FFTA 5IK3B 3A24A 3V4PB 1KLFB 4NNYA 3M8OL 5EUKB 3PCYA 4YSPA 5SX5H 4P48A 3WYRA 2EVHA 5I8OL 3IMRA 4JMXA 3KCPB 2UUDH 3GSNL 4HFUH 4NHCH 1FPTL 3P9LB 1LO3L 3JWNH 2O5YL 4F5CE 3SCMC 2LU5A 4NJAH 2R29A 1Q9KB 4LVOC 2VISA 1V5JA 3HJEA 4FULA 5DJYA 1L7IH 4ZW7A 2NSXA 4BFOA 5K9KA 5SWSD 4S2SB 3MGTB 1ZE3H 4M02A 2X4SB 3EAKA 3PXJA 4U1HB 5BPPA 2DH3A 1XF5B 4DZBB 4UDTA 2OYPA 2CKNA 4RRPM 4KV5E 4Z5RA 1P1ZB 2LVCA 1HHKA 5FHBL 3A47A 1X4YA 3D09A 4Z3JA 4YL9A 1J8KA 1Y6KR 1KXHA 5K1JA 1TVBB 2CKBB 5AG8A 4R7VA 3LEVH 5FYKD 3SDDC 4YAQA 1JZ7A 4JCMA 4L9LB 1R1CA 3RWJB 1CK0L 1KCSH 3G7TA 3TO2B 2BP3A 3T8XA 4DVRH 1LO2H 5FAAA 1SJHB 1T7YA 1UC6A 4XPGH 3WKNA 3L16A 4GPVA 4BQCA 1R34A 1XF4A 3LX9A 5ICYB 4GAJL 3SYAA 4NKMB 4QOKD 5JW4R 1YPZF 3ZR6A 5A6LA 1I9EA 1BM3L 4R0LC 3BD3A 3WNNA 4CBPA 2FX9H 4JRXD 4OLEA 1ASPA 1MCRA 1TXKA 2CG9X 5C6WH 3NSFA 1BXUA 3C8KA 1RUAH 1KG0B 1ZJBA 4ADIA 3IPFA 4XAWH 4HS8L 2DEXX 3T0XA 5CF3A 1KYUA 4AXWA 4CNIA 1GS8A 3QUYD 1WFIA 3OJDB 5K9OA 3I9IA 3WUWA 4A7TA 1KEMH 3BH4A 4X5LA 4LPVA 1CMOA 4XPHL 1W91A 3MRQA 2ZTBA 5GGUB 2P5WD 2A9NL 4O58L 1C5DA 2WAHA 3TN0B 3DSNA 2WSKA 3O0RH 3LH2H 1I1AB 2LFGA 5GS0H 1IGJA 4G6AD 4DUXA 3H8NA 5JXAL 5F9AC 4MSWA 4FEMA 4BE5A 3VI4A 2VM9A 2A4EA 5T1MA 2LAAA 3H9HA 1AO7E 2XZCL 4NM8H 4P2QA 4KRPC 4DP2X 3FMGL 2UWEE 4P46A 1F0LA 3R8QA 3PHOA 4FHKA 3WIAA 2FH8A 4BELD 3FO0H 4IIQA 1S9VB 1TMQA 1K3ZA 4L5FL 2CJUL 4PUBL 1K8IB 1DBBH 4KRMB 3CLFL 4G9DB 1Q9OB 3BH9B 1RHFA 3LMJL 1DANU 5BUAA 2Q9OA 4PJCB 4WUUB 3V9FA 32C2A 1IUZA 3ATDA 3IDNB 1A6VL 4YH6A 1OM3L 3TLRA 4IOFC 2YXVA 1YMMB 4HIPA 3CZUB 1U8CA 3SSGA 4M5TA 1MCSA 3ZL2A 3C87A 4JFZL 2WP3T 1V27A 4XZ4A 1H3PH 1TEYA 2XWBB 4F8QA 2GTZA 3MPCA 4M7JL 4POUB 3PREA 2QLYA 4MZ3A 3WLBA 2AV7A 2DLFH 4PY8I 3GEFA 1MJ7L 2X2HA 3B1TA 4OGQC 3E8VA 3MCG1 5AZ2H 1E2VA 2FWSA 4G8FB 1H6FA 3D0LA 3QVAA 1S5HB 3NACL 2HP4A 5DJ8A 1A6TA 4MD4B 1MI5E 4WTQA 5D7SH 5CGBA 2M2DA 3KLAB 1SXNA 2Y6SC 2H1LM 4X6DA 2BVQA 4NQSA 3S2CA 4EOWH 4H1LG 4LO9A 3WL9B 2WBJD 2BP8A 4Z3EA 2H1XA 1L7TL 3HHSA 4N90D 3STLA 4A66A 3RWHB 2RQ8A 1JVKA 3POHA 2IFFL 4JGJA 5I16A 5DD3L 4WRLA 3SDAA 2WW8A 4N9OB 4AYMC 2HT4C 4MNHA 4ATTA 2Q6WA 3MLXL 3O6FA 4M61A 4I48B 3EZJB 1X5AA 2CLVB 2H47C 2DQTL 1ND0B 4P5TD 2AJZB 1E9OA 1TZIB 1XGRA 4Q56A 4W9IC 3T4AC 2VDMB 4JKPL 1CGSH 5FUOL 3IETB 3O3BA 3UC0L 4YEFA 3V0VA 1LEIB 4NC0B 2VCOA 3N1QC 2A83B 1KGXA 1OLLA 4H1LB 4W9KC 2CD0A 3R0MA 5FW6A 1DQJB 2CGRL 3T8VA 1NCCH 4MBOA 25C8H 4X7SL 1PCSA 3VXNA 5L8LB 2BIPA 2IAMC 1R5IA 4ZODA 2AQ1A 4PQXA 4UILL 3RZWA 3ASOB 2DWEB 4YS4A 4LCWA 4ZQKA 5E2TH 3P9MA 4N2BA 3BZDA 1Q94B 1T22A 2CCWA 3AT9A 1S7QA 3HA0A 4NRXB 5IJKA 2ITFA 3JVGC 4MHHG 1A7PH 1HQRB 3VXMA 4HPYL 5KSUB 3GXDA 4X9HA 4WI9A 3V4PH 4GO9A 3BAJA 3T0ED 1W8EA 3RHWF 1GZHC 2R2HA 2FL5A 2WXMA 2I5YL 4GMTH 3AGVA 4TNEA 3AAZA 3QDGD 4LLDA 4LGRB 3X14B 4Y2DC 4FFYA 1JXDA 3GHEH 5AOMA 4I0PA 5FUZL 4HIEB 3KJ6L 4LPWA 1KPRB 1EH9A 3FSZA 3NK4A 3B9EA 3HUJA 4PJHF 2OZ4A 2WUCH 3ZRFC 5HGHA 5D1XC 5CCJA 3UP1A 1HWHB 2NY7H 3SBWC 3VRJA 3OKMA 1CD1A 4HLZH 4DP4X 3LTVA 1YEDB 3CG8A 1VPOH 2R0KH 3D25B 2ZZUT 3O41A 5EUOB 1DJYA 2EIEA 3R06A 1EANA 3ZTNH 2CKBH 1MAML 3I9PA 1Q1PA 1A7OL 4M62H 4K3EH 1KGCE 1MRCL 4CVXB 2ZNWA 2VAJA 4LAQH 3RJQB 4M8RA 2ZAIA 2OMXA 4F91B 2P26A 4Y9GA 1GGCL 3KBPA 4P2AA 1DVSA 1FLRL 3SDDD 5IMLB 3GSWB 1MFEH 2VN4A 1N59B 2P42B 3QXUA 3RP1A 1RKRA 3FQWB 2FH6A 4TL5A 4Y5YA 2CM5A 2O5NA 2KBGA 1MUJB 2Q86B 1P4BL 3UO1L 7TAAA 3GJEB 3MCLH 4TULH 1MHCB 3BOVA 4Z1PA 5D7IE 5J6GB 1CE1H 2WLNA 3MV8A 2XDHA 4CMMB 3AROA 5C09D 4ZG1A 4Z7UA 2R4RH 4KI5E 4Y5VC 3N40F 1KCKA 1AQKL 4HBQA 4LLYA 5E03A 3UBXI 1KJMA 3IFNH 3BLPX 4FJZA 4M7KH 4M7LT 1N10A 2OMTB 1JJUA 1CURA 4LLUB 4HOMA 1K6QH 4KZEH 5BV7B 3BDYL 3TYFB 2X4QB 3IYLW 2YLKA 2BHZA 4PU2A 4WEBL 5ESQB 2JLPA 3B3IA 3QXWA 2VUKA 2N7AA 3ASNB 3KPLB 4DW2L 1OTUC 3B2VL 5J89A 4UQEA 4DTGH 4W6WB 2FLRT 5IQ9B 3VFUA 3G6JF 1TQTA 2VXTL 4I3GA 3RTQB 3VGHA 4HSQA 2EEBA 4KQ0A 1HOEA 2AABL 3NBNA 2PO6B 2HLAA 3RWDB 5ES4B 1NUGA 1N5YH 3H55A 5D2NE 5H4YA 1OSPH 1UA3A 2YGVA 1ACZA 4TSBH 1AHWC 1H6EA 4P06A 2OTUA 2VABB 5DJCA 1QRND 4HGWB 4KRPD 2XZAH 1L0XA 1MFDH 3NAAH 4GKNA 3FYIB 1QTPA 3HVNA 4GXVL 4AGNA 1OE2A 4YGVB 1DBAH 1E8YA 2EADA 4BFGA 2XPZA 4XX1E 2NX5D 1T03H 2BCKB 1E43A 4YDLC 1NUFA 4XNBA 2VJ8A 5HHPA 5JOFA 3NCJL 3IRZA 5HGBB 1Z2KA 4L4TB 1J5OH 2J71A 3MRDB 4AGLA 1DLFH 5CILH 4XBMA 5D6CB 3V9EA 4KNUA 3N2JA 4H0LC 5GIRB 4NC1E 3HE6B 1J05B 3IGFA