4X80L

Crystal structure of murine 7b4 fab monoclonal antibody against adamts5
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPASLSASVGETVTITCRTSENIYSYLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYSCQHKYGTPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG1 7B4 FAB Light Chain
publication title Translational development of an ADAMTS-5 antibody for osteoarthritis disease modification.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x80L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x80L01
1E4XH 3IRPX 2AEPL 3V5KB 5JDSB 2BOBB 1P7HL 2H1PL 1I1FB 4CVZB 2XZAH 2VXUL 2ZCKL 4KI5C 4IBLT 3BWAB 2Z8VC 3V0WH 2Y23A 3KPQB 2GEEA 3QQ3A 5EUOE 3HNTL 1DE4B 3HR6A 2R2EB 3WFHB 1JPTH 1S5HA 3VFUB 5JDJA 1YY8A 2YSSB 3VRIA 3OKDB 3HAEG 3UO1L 3SPVB 3Q6GH 3QUKB 4EUPA 3QUXB 1XF2A 3T8XB 2XQBL 1SY6L 4ODSH 3QQ4A 5F8QC 2FB4L 3BQUB 4HMEA 4HX1A 1YEEL 3BP7A 5B3JE 2DN7A 4M1CC 2R9HC 5HHOE 1NDMA 4NCC2 3JZ7A 2VZVA 4S0SD 5KG9A 3HFMH 1CFTB 4GH7B 4G6AD 2YUWA 3LIZL 4RBPH 3AM8A 5H8DA 4PJDE 2BFVL 3VJ6B 2ZP0T 3MRJA 5IVZB 1NCWL 1KIQA 5C0RH 5DJDA 1SYSA 4G43A 4Y16C 5E2UL 2CH8A 3EJYD 2V9TA 1IGCL 3CFDB 5BQ7B 4U1LB 4GAJL 4HFWA 1OGAE 3QEQE 3HNVH 3PDOB 4KY1L 4OZFH 3WNPA 5L2KA 2FBOJ 5DEFA 1JPGB 3GMRA 1IKFL 1H9VA 1HCFX 3SQOH 4K71B 2AJZA 5AYUL 4OZFB 2EZ0C 3RKDC 3SCMB 2OBGA 1Q9WA 3MNVA 5GPRA 4G6ML 5EOTA 2LU4A 5TDNA 1EO5A 5CD5C 1J8KA 5DZLA 5D2LA 1VB9A 1MQKH 3KPSE 4R4BB 4RAUB 2FH6A 2I5YH 3UPCA 3WKNA 3HC4L 2GTWA 4JN1H 4NT6B 2F58L 2F19H 4HBCL 4ACPA 1UB5B 4X6BB 1LP9B 3CDFA 1D5IH 5CZXC 4HMCA 4WWID 3BW9B 5F7UA 3HUJE 3WSQH 2AQ2A 2XG5A 2Y06H 4HCRA 2Y7QA 2NW3B 3BGAA 1A3RH 3V4UH 2ICWI 2HKHL 3L3IA 4PUBL 3I3EA 1G7HA 4ODVH 3KHQA 1U3HC 3MRLA 3MRBA 4BSVA 1HI6A 3OF6A 3T3ME 1QQDA 4YGVB 1ADQH 3GUTA 4R26L 3PWLB 2Z31C 1EGJA 5E8PB 1EJ6A 1CWVA 1BFTA 1IEAA 5ID0A 1E0OB 1OT2A 3KVQA 1II4E 3DBXB 2JIXA 5IROC 1BBDL 4FS0A 5DK2A 3DHMA 5TPWH 3NCYP 1NBYA 5IVXF 5C0BB 1L9NA 2DLEA 5C09E 4UBDC 3OWEA 2BVYA 1EERB 3D85D 1X5LA 1B0WA 4Z7UA 3X3FL 1PKOA 3LQZA 3UTSA 1TZHB 3C2SA 5F44A 1NBVL 3QIBA 2AAVA 3RGHA 3OGCB 1OAZL 3SY0A 2EDYA 5E6ZA 4K3DH 3ZE1F 4YE4H 1W72B 3NAAL 2J4WL 1AGFB 5SWSB 4HK3N 3FB7A 1BJ1H 1RZIB 4PJBA 3CFEB 3HN3A 1J1PL 2ZOLA 5BMFL 5JO5B 3O2DL 2X89D 3PUCA 4IJ3B 4X6FB 1J1OH 1IBGH 2J12B 3INUL 3VXRA 4G80A 1NMAH 2H9GB 4FTVB 2Q86B 1JGDB 2R2BB 1LK2B 4C56E 5KSAD 2N7AA 1NCAL 4FG6C 5TE6H 2BVEA 3FRUA 4F37K 4PRPB 3EOBA 2E27H 1MFAL 4YLQT 3QSKB 4X4XB 1JPST 4NOBA 1H3XA 1EUTA 3TVMA 3C5SB 4I18A 5JHLH 2C4XA 3DO7B 1XIWA 3OKKA 1Q0XH 2BC4B 2HN7B 4P4KC 1MI5B 5EUOF 3TN0D 1NFDB 4JFYA 3TO4D 4Y16B 3RI5F 4D0DA 5FCUL 3S9DB 1WF5A 3RUGB 5J13C 5TQ2H 3PWPE 1PKQE 2FL5A 1PYWA 2R0KH 1XGYH 3K1DA 2JB6B 1C16B 4WV1C 3EYVB 1BVLA 3U9UB 3NMEA 4BQBA 4MD4A 3K8KA 5TDOB 4WI7A 4RMSA 2O26U 1HKLH 2GJJA 3FZUC 3JWOH 5F93C 4UDTA 3CZFA 4ISVB 2IAND 3Q6GL 3DWTA 5HI4C 2BP3A 1XF3A 4X4ZA 2DWDA 4C4KT 1X6LA 4IOSD 3O6FD 3OKMB 1H15A 8FABA 3ROOA 4PJ5E 5SWZA 3SKNB 5MI0C 2JTDA 3LAFA 4DAGL 4PJDF 5FYKD 2OM5A 2X4QB 3ZL4H 4CJ1A 2M1KA 3JXAA 4Y5VC 2VO5A 2GIYA 3HFML 3RPKA 2EDRA 2DAVA 2A38A 1G6VK 3PQYD 5D7JA 4P2QD 5I6XC 2P5WE 3VXMD 4WI2A 4YHLL 1WZLA 2VZSA 1MLBB 3C6LC 2RCSH 3B9KD 1U3HB 5ICYA 5IEKB 4NCC1 1A4JB 2Z31B 1QRNB 3SQOL 2CDFB 5I1EH 2XXCB 5EPMA 3UTZB 1AIFB 4CVUA 3HZVB 4P5KB 4ZTPH 1S5IL 4KZEH 3L5HA 5LAXA 3T2QA 3WKML 1B6DA 3WD5H 1HSBB 1J0JA 4JN2A 4M1DL 4LK4A 4MD5A 2YK1H 3HG1E 3FQTA 3V8OA 1CF8H 4ETQA 3KNBA 1D5IL 5GGRA 4EBQL 1U8LA 3QDJB 3WSQL 2EIEA 4KGLA 5J1SC 4HEPG 3C5JA 5I1JH 1A7RL 3CC5A 4WW2C 5F6IC 3ULSA 1MCHA 4TSCL 3T3MF 4E9LA 4FQXC 1V3MA 2MQCA 4KH2A 4TVSa 3IDMA 1F6LL 1G9MC 3E6FB 2PR4H 3MNZA 5D1ZC 5C2UB 1FNGA 3FO1A 3MREA 5IGXH 1P53A 4DWHA 5EOCL 5FGCE 1X5YA 4R90H 3RL1A 1CFQA 3DROA 4Y2DA 1VACA 5F7MC 5KOMC 3RWFB 3T2PA 1CIDA 4K3EH 4HV8B 4IOIB 4DOHE 1IAIH 2OK0H 4PJ8A 2QSQA 3CUPA 2GAZB 3SBWA 1IGYA 4X5XA 3WJLC 1N0XL 4BH7B 5MEQB 3TJEL 2R4SH 1EEZB 1FIGH 1M71B 1NSNH 3ARGD 5ANMB 5GGVH 4P4KB 2XKUA 1W72L 4KKBC 1RHHA 3L3KB 4ONFL 4C54A 4ZOEA 2VISB 5E08L 5J13B 5DA0B 1L6XA 4M8QB 4JKLA 4LGSB 4X9FA 4R7DA 2EE2A 3OAZK 1P7QA 4J4PA 4MS8D 4RGOH 3MGTA 3VFNB 4KROB 2DRUA 1UH2A 2RQ8A 2C3GA 4UINH 1XCQB 4P46A 3HRZA 4MWFA 3MUY1 1J1OL 1IBGL 3WS6C 3T08A 2BVPB 1JHTB 1NMAL 3WN5A 4JQVA 5AWNH 2A1WH 3GDBA 4IMKC 3S5LG 1EVTC 5TE6L 1IILE 5EBMA 3CFJA 5MI0B 4YAQA 5F1KC 2HMID 1BD2B 5E1AB 5D7LE 4X6CF 1DANT 4DVBB 1I9JL 1ZHKA 4LLAA 4Y5VB 3H9SA 2GFBB 1J8HA 3LHPL 3V95A 1EO8L 2AK1H 4UT7L 5I6XB 4H5SB 2AJXH 3PGDA 1LMKA 2CJUL 4KQ3H 4RRPG 1K2DA 3RY4A 5BVPH 4I0PA 3C6LB 4U6XA 4U1IA 1U93A 5A1AA 2D0HA 1AXSB 1TIUA 4JFZH 3I02A 3X14A 5E70A 1G9EA 1BIIA 3UX9B 1HEZA 2D31B 2ICES 2OQJB 2YD5A 3SDDD 1KJMA 2XZCL 1Y6MR 2IFFL 4JO2H 1YEKL 1I7ZA 1MJUH 3WNMA 1WT5C 1HKLL 5EZLA 5CZKA 2R1WB 4HS3A 2HAZA 2QQLL 1QR4A 2IPTH 4MNQE 4M6NH 1FO0B 5C6TH 5D7IB 5IFAL 2Q76B 1WZMA 2AXGB 4N8VB 3X3GH 1ZEAH 4MA7L 4LP5A 4EVNB 1RZFH 5GS1B 1WAAA 4ONHB 3BUYA 1RJYB 3DVNB 3QULB 2FBJL 2FO1A 4MJID 3WUZA 4MDIA 4HWNA 4QCIA 4YDLC 5T1KD 1I1AA 3SO5A 3DYOA 2A77H 2Z4QA 1OM3L 1CE6A 2J8UA 3KWWA 4WW2B 3DGCR 5F1NB 3S37L 4FQXB 3FFDA 1JZ7A 1IAMA 4EI6A 4QEGA 1T1ZB 4ZYKB 1FYTE 4RA0C 4PB9H 7FABL 2DQUH 5D1ZB 1IGJB 5C7XH 4JFDA 3PDGA 1CG9B 2P4AB 4EXPX 4N8CH 4HG4J 3TPUB 1FL5A 3RVUC 3AREC 5EU5B 4S1QL 3EFFB 2BNRE 4M8VA 5C8JA 3WNKA 3UYRH 3E0GA 2A0LD 3O3AA 2NY2C 3O6ML 3GJFB 3LEXB 1RIHL 2DMKA 3VXPA 4HJGB 4U1NA 5HGAB 2VLMD 4OF3A 1RQ5A 2PO6C 1R5VB 4O9HH 2VE6B 1UA6H 4ELMA 1EBAA 1KB5A 1C8PA 3PWJA 2HLFD 4Z5RB 2R0WH 3QDME 3VRJB 1LK3L 1WLHA 3V5DA 1MFNA 4WI6A 3I6LD 4LCWB 3K4ZA 1TXKA 4ODHH 3ALWA 1A2YB 4BZ1H 3F12A 1NGWB 1YY9C 5C3LD 4Z8FL 3CLEH 3L3DB 2I07B 1IGFL 4BK5A 1PD6A 2DTSA 3MA9H 1LD9A 2G60H 4NO3B 1U8MB 1T5XA 4ZFOA 4HUUB 4O2EB 5TFSH 4WY7L 1DQDH 1HQRA 1LEKA 4NO5B 2AJYH 4O51B 1RJLB 4D0BA 4QOKE 5JOEA 2PYFB 2V2XB 5DJ6B 3PL6C 5CKAA 1U92A 1P2CA 3QDGB 1QNZH 1C08B 4LHUA 4Q9BA 5I1GH 4K3EL 4NKDA 5D4QA 4QRRE 1KJVA 1E28A 5LXGL 5ACMA 1FYHB 1CL7H 1Q0YL 4X8JB 1PG7X 3I50L 4TUJA 4XB8A 1FIGL 5FF6B 3TIDA 3WLBB 2VDKH 3HS0A 5D5MF 4W6XB 4NKIH 3MPCA 1F8TL 2EIBA 4N1EA 1U91B 1UG9A 3HNSH 4Y1AA 2BSSB 5CINL 5I1KH 2FEDC 3GBLA 4OIBA 3U4AA 4GAGL 1MHCA 3REWA 5K33A 3EHBD 3D9AH 3VD5A 3G5VA 2E9JA 4PPTA 1A7PH 3P0VL 5JLZB 2X5PA 1GIGL 4ZPVB 3DX9B 2A1WL 1X9QA 3ME0A 4D9RE 3UPRA 3N1FC 1I3UA 1EAJA 1NC2A 3WIFB 4BFEA 1CR9L 1WJ3A 4YPJA 4NQCA 2XKSA 1YNTA 4LVNC 1JNJA 1O7SA 4YPGB 2YEZA 5IQ7L 4G8GA 4PS4L 1WGOA 4GG8B 5J8OA 4OZIA 2AK1L 3VXUD 3VFTB 3RWIB 2L7JA 4XWOC 1QLFB 4NNXB 2AJXL 2Y1VA 2L4OA 3GJEA 2OR9H 4KQ3L 2X4TB 3OB0K 2WWKT 3MACL 4PP1D 3STBA 3AMKA 3FOMB 4PJ7F 1L7TL 4OKDA 4JHZA 3ZT6A 3GSNA 2WZPD 1YEGH 1VSCA 5ESQB 5ADOH 2VKXA 3GMNB 1QYGH 4W6WB 3F7YA 5EIIB 3G9VA 4QGYA 3BPCB 4NFBA 5ETUB 4GQPH 3MRDB 1FO0L 1XF5B 4HDIB 5DD1H 3LH2L 2YA0A 4JKMA 4BYHA 4NHUB 2OLDA 4HZLA 2BY1A 2FGWH 4GG6E 1BFOA 5C6TL 1WCBB 1HOCB 5I76B 4K7PH 1A64A 4IDJL 3W39A 4LASH 5GIRA 3X3GL 3NBNA 2NY2B 3P9LB 1RJCA 1RZFL 4CN6A 2F9BT 4WHDA 1ZLWH 2BNQE 4X4YA 5ESAB 5F9DC 4XGZB 2PO6B 1Y0LB 1M1SA 3WHXB 1RI8A 2NZ9D 3HAEB 1AKJD 1INQA 5HHME 3GHBL 5KVFH 3RZCD 1G9ML 4YHIA 3GI8H 4OAWA 2C7UA 2OZ4H 3H3BC 1WBZB 4RFOH 3O4LE 15C8H 3IETB 4PB9L 1KPVA 1UM4H 5LG1A 4G6AC 4X6DA 3QO1A 5GRUH 2OS7A 1G9NC 2KKQA 4GBXD 1PEZA 3PL6B 4QHMB 3SDXA 1ED3A 3T0BA 3GKZA 4F80A 3JSSA 1YDPA 4DW2H 2ED7A 4CKVX 2GQHA 2GY5A 3DUSB 3PGFH 4HK0B 2X4RB 2ARJA 1OD9A 4MNGE 1Z9LA 4XX1G 4MB4A 3P4NB 2D3VA 4W81A 1CDBA 3HMXH 1QSEA 4O9HL 4YNYB 4XTRD 3THMH 1S9XA 5H94A 5FM8A 1KT2A 1NANI 3CD4A 5DVOA 3BP5B 3N1PC 4UZGA 4IM8A 3EYUL 4Y2DD 3CLEL 3UJJL 2J3SA 4F57H 5JPNB 1P1ZB 4P57A 2AQ3A 3FFCD 4JHWH 1NLBL 3U2SB 2J8HA 2NY1B 1YMME 2AJYL 3OTTA 2GJZB 1ZWIB 3QDAA 3OR6B 1KIUA 5FV2A 4XVSL 2XWTA 3VFMB 3QNZB 4LVNB 5IQ9A 3PJSA 1H3GA 4IMLA 1IC5L 4ALAL 1MRFL 4HWBH 4CVXA 4QY8B 2IWGA 1UYWL 4NC0B 1YMHB 1JNLL 1CYGA 1G7QA 1CU4H 2VDKL 2WM0A 1YN6B 3ZDYE 4CMHC 1E4KC 2Q8BL 2Q8AL 2ZKHL 3WIHH 1NGXA 2B1AH 4LEOA 1MNUH 5HY9A 1NC4A 1MSPA 3HR5A 3KPOB 4G42A 4L8CB 3ARFA 1I8MA 5C71A 2VZ3A 5E9DE 2IJ0C 3MV7A 5J4MA 3IKCB 4F7MB 2DQHH 2HVJB 2HT2D 3HLAA 3O81A 2NCMA 1W8OA 3W2DL 1ONQA 1NL0H 2XTJD 1PDKA 2R1XB 4CU8A 4KVCL 4LAJH 5DZOA 4Y4HA 1ITBB 3D25A 1MVFA 2IPKA 2WIIB 4PGBA 3WYRA 4B41A 1EEYB 1MOEA 1SJXA 1XR8A 4OUUA 1DBAL 1IGIL 4NO2B 3MRPB 1FNEB 3ILPB 1MVUB 2F5BL 5KSAC 1MUJA 4XNQB 3DURA 3H7BB 4IHOB 2VB5A 4FXKB 3QR2A 3LZFL 4OZHF 3BE1L 3VXNA 1NFIA 1V05A 4XXCC 3MLVL 4QRQB 5FGBC 3S4SG 5C07B 2IH3B 1UQSA 1DVFA 4TSBL 1MWAB 5EIVA 2D2OA 5IW6B 3TN0C 2VR4A 4H1LA 1F3JA 3TO4C 4GG6F 5IHLB 3FQWA 2J88H 5D6CA 1AGDA 4M7LL 4FRWA 1QD0A 5DD1L 3O45A 4PJCA 5SX5K 1KTLA 2FGWL 5GRJH 3WXVL 3F65A 4K7PL 5B38A 3EGSB 4LASL 5JR1H 3VFGL 4WGVB 5LQBH 3EO1B 3PABA 3AC0A 2JE8A 3ZKXC 3RIAF 4OFIA 5GZOD 3NCJL 3O6FC 1TVHB 1FHGA 2G2RA 5DC9B 2XIDA 1A7NL 1N59A 4JLRA 32C2A 5KVFL 4WI3A 5FO7B 1H3TA 3HC0A 4KDTC 1AGCA 1WISA 4AM0A 4ZPTA 2DQEH 4OLVL 3CU7A 4TTDD 2WLZA 15C8L 2FLRT 1TDQA 3VMNA 3DV6A 5DDHA 4J1UB 5DJXA 3ZHDA 5IOPB 1Q94B 1ZLUH 3O6KH 4V1DD 3B9KC 3IXTA 1T20B 4LU5H 3ZE0E 3MCG1 5DJYB 3FQRB 1KELL 3CIQA 4HKZB 3FKUS 2FSEB 3UTPE 1DQJA 3PGFL 1LO0H 1KNOB 4QXWA 2WW8A 3S5LA 3B2UD 5I16B 1VFMA 4XT1C 4XVJL 4CMHB 3LQAH 4EOWH 1OAXH 4UV7H 1BZ7A 4Z7VE 2C26A 3MLTB 4NUGH 3OKNB 2VLJE 4ODBD 3S34H 3THML 4M02A 3VA6A 3D85B 4NQXB 1FJ1A 5I73C 3CDCA 1FL3A 3T77A 1DFBL 1G6RH 1OB1A 4F57L 4MSWB 4R8WH 5GGSA 3V7AG 4JHWL 4HH9B 3RGVA 2OTUB 4TQEH 2VLRB 3LEVL 3GSQA 5DS8B 4PREB 1T2QH 4HKBA 3OKLB 4LSTH 1LEGA 1IC4L 4TOYL 1BHGA 2PYEE 1VFBB 4JY4B 3ZDYF 5I66B 5KW9L 5FKPB 3QH3B 1FC1A 1CDUA 1UWXK 5D9SA 5FYLD 3BN9D 4H26B 1ZTXL 3CVHH 3PV6B 2Z91A 1TCRA 1KYOK 3DPBA 1FFPA 3ARWA 1TQCC 3CVHB 2APXA 1WZ1H 3C9NB 3F5WA 3QQ9D 2Q3AA 3WIHL 4HPYH 4JGUA 4PRIA 3ARGC 3FQXA 1IRAY 1SJEA 3MA7B 3P73A 4TVPD 4HIHA 4S2SA 1N7MH 4NQCD 2YD8A 3SDYH 4R6UA 1QFUL 1NL0L 4LVOC 3BMVA 4MS8C 2OTPA 2NXYD 2ZZUT 3P4OB 3OQ3B 5EIQA 3PWVA 1BEYH 3KS0H 5IVOA 4IRSA 4OZGA 4KGJA 5FGRA 1UWEH 3N85H 1FG9C 2ARWA 5JHDD 2DQFA 2ZSVA 3ZKXB 5ICXB 4X5WA 4DGVL 1XGQA 1GHFH 2EKSA 3O6FB 5KANG 3BP6B 1S7QB 1AC0A 4WU5A 2A6KB 4LNRB 4Q9CA 1F4XL 1A5FL 5ILTL 2MMXA 4OM1H 4UT6L 2HMIC 1RIVL 3BN3B 1T22B 2X4NB 1BOGB 3BGMA 3MLYH 1MWAL 2PN5A 3I9GH 4L4JA 2YD2A 2KBGA 2JELH 2DM2A 1G9NL 1S7SA 3PQYB 2DJSA 4P2QB 5GSVA 3WNLA 1FZKB 4Q2ZA 5IB4B 3LKQA 4YX2H 3RVVD 4I2XA 2EDNA 3I6KA 1OP3K 5CSGA 3B9KB 5C0AA 4QXUL 1M6OA 1MRDH 4AEHH 3T1FB 5HDLA 3X13A 3SDDC 4JDZA 3VWKA 5JR1L 4PGCB 1FGNL 2X1WL 4AIZA 4AEFA 2R23A 3DVIA 5CJQH 5IB1A 4C83A 1VENA 3NH7H 5J57B 3ZYZA 3F7VB 3D5OF 1MPAH 3EYSL 2YD3A 5LBSH 5C9JA 2EDQA 3AM8C 1MY7A 5I0DA 1YQVL 1K4DB 2AEWA 5DSCB 3ISWA 2Q7YB 1FVEA 3MUHL 4LIQL 3V5HA 1KTDB 3GB7A 5C0EB 2CQVA 5JQ6H 3LN4A 1QSVA 4HHAA 3DVGB 3B9EA 2EYRA 3FB5B 2FX9L 3SHSA 3OXRA 5HTSA 3S96A 2NTFB 3ZE0F 4ODXB 2P8MA 5GISL 2HT3D 5D70H 1PX4A 1AJ7H 2B0SH 2H32A 2IEPA 4LU5L 4JY6A 4LPUA 4PJ9D 2EO9A 3Q6FB 3SGJC 1LO0L 5E94A 4Z7VF 1SEQL 2CLRB 3OX8A 1P5UA 3W0WA 5FOBB 4X4MA 4YEEA 4FN0A 4HS8L 2PW1B 1R3IH 3RWGA 1TQCB 1K5NB 1BPVA 4NUGL 5I9QC 3S34L 2A0LC 1HIMH 2APTA 3V6OE 4BFGA 1HILB 2AV7A 1IAKB 2HG5A 1LO3H 3TNMA 1KN2L 4JZJB 1QBMH 3CLFH 3DSNA 3ARDB 3ZTNH 4LCYB 4X7DC 4XP1H 2HLFC 3D69A 4KI5E 4OLZH 1YEHH 4CNIB 3G6AA 4BQ6A 2FHFA 2MNUA 5DMIH 1QSFA 4ZDHA 5CEYB 2V2TA 3PHOA 3PWUA 4GS7C 4Z7OE 4FNLH 3IFPB 5DJ8A 5BV7C 5KAQF 5F97E 2ADGB 4X80L 3V4PL 3VCLA 4JQXA 1W0VA 5FAAA 3QWOB 2A6JB 3GSXB 3WO3B 5E2TL 3GIVB 1HE7A 4WTZG 1ZANL 3JVGC 5JPMA 4L8DB 5KSUB 1NEZA 3EJZC 1MJJB 1YNKH 2BVOA 2X4PB 2DYPD 3NZ8B 5CSZA 5CMAB 3LV3A 1AD0A 1CS6A 3RL2A 1KLUB 4XWGL 5MHSD 1EEQA 1U8NA 5MEPB 1I9RL 1WZ1L 5HYSB 1BAFH 2UWEA 2CDGB 4JKKA 5F9WC 4HPYL 2YRPA 3QQ3B 5CBAB 5EOCJ 4APQA 1FZJB 4YDIH 4YH6A 2YUZA 3D39A 5D2LE 1B3JA 1MI5E 1NFDE 1R3LA 4EUPH 2CLVB 3PGCA 1RD6A 4JO3H 3SDYL 4EUPB 4JO4H 1EBPA 1YJDC 2I9LA 1XF2B 2Z8RA 4ORGB 3ARPA 3EHBC 4YDVA 3SDDB 4PRBA 1N4XL 1IGTB 4PRDB 1AR1D 1SHMA 1I8KB 5IBUG 2LU3A 3RI5K 3G6JA 4GUPB 3RBGA 1A9BA 1V3KA 1DQQA 4AEEA 1GGIL 2QSVA 3P77B 4KHTH 2FHBA 2EEAA 4FQQA 4OB5H 1GHFL 1V3LA 1JZ5A 4JFHD 5DUPH 5FYKL 2AJVL 3FCTB 5T5NF 1X5KA 3NFNB 1WIUA 1FV1B 3WFBH 5FA4A 2XXMB 3CH8A 2HFEA 4MJIB 1V7NH 5T1KB 3I9GL 4HFWB 3U7AA 1CQYA 1AHWC 4UV4H 2JELL 4NQEA 2DQDH 3T0EA 1D5BB 3GHEH 2RHEA 5IM7A 4JFXB 5IEHA 1XGPA 2XG4A 4PP1C 1P7KA 3BH9B 4HUWB 4Y19D 3UTSE 5EOTB 4Z7QE 1AO7D 3TIEA 5D7SH 3MGAA 4U4BA 2AV1B 4DVRL 3WFDH 1QRNE 2WUCH 3VXSD 1UJTA 3MCLH 4NP4L 2HFTA 4PV8A 2WANA 1RIUH 2YC1B 3IDNB 4IOFD 3ZHKA 1GC1C 2XPGA 2WINA 1LP9F 3HI1B 1MPAL 5I9QB 2Y7QB 5IW3A 5LBSL 2X70A 3AGVA 1U8KA 2IQAA 3KHOA 1E4WH 4PTTA 4JPVL 4WFHD 2OTWA 1HH9B 1MCIA 4JZNA 2NYYD 2DQIL 2NX5B 3G08A 5GS3A 4FFYH 3KPPA 4AQOA 3MRBB 5KSBA 2J2ZA 1EGJH 2NZ9C 4Q58C 3SDAA 3STZB 5BV7H 1UVQA 2MHAB 2RFXB 4P3CL 3E1F1 4NIKB 5K9OB 3RZCC 3O6LL 5BV7B 2VQTA 1AJ7L 2BNUB 4XMLL 2ED8A 3ZO0A 3EYFB 1N6QH 4A6YH 4IRZL 3BUTA 3GMOB 3U4BH 1ZHNA 5JOFA 3FQUA 4A6YB 5HVGB 2BSRA 1HXYA 1FZOA 4MD0A 4GBXC 3LQZB 4OFPA 5CHNB 1OOAA 3R1GH 4ODWA 5E2VH 1FRGL 2EE6A 4EDWH 1JYVA 3RAJH 1N0LA 4P48A 5LGHL 3WIIH 2DKMA 4WNQA 2VLKA 2VLLA 5MENA 3QHZH 1NANH 3QRFM 1HIML 3RGVD 4OZ4A 5F9WB 2IH1B 4G8EA 1IAOA 2AVGA 1I3VA 3H0TA 1R3JB 4KI5F 1F45A 1LO3L 3FB7B 1MH5A 1QBML 4OCRH 4N0UB 4Z7OF 1T1YB 1JNNH 5SWZE 4XTRC 3OHXB 3ZTNL 2DTML 3L5WB 4XP1L 1TVBB 4G80B 3MUJA 1X5HA 2A9NH 1OAUL 2ZCLH 1B90A 1ZT1B 1CXKA 2CUIA 4OBRA 3ZT7A 4I48A 3FRUB 1RZ8B 4Y2DC 1DSFH 4NOFA 4MVBD 2ATPB 3KYNA 4LARH 2D7TL 5E00A 3DRQA 1ZHLA 4Y8DC 1G1YA 1R24A 4WWKD 3S3JA 3UTTA 2G9HA 2DIAA 4PRID 3UC0H 1I9IH 1P9MA 3UDWA 4XRCA 1PVHA 4U1HB 5E8NB 3JWDH 4JFPB 5DD5L 1BD2E 3CMGA 1NFDF 1CDJA 1BAFL 5BXFA 4G9DA 3VGDA 3DTXA 1F2QA 2R1YA 1AHWB 3RUGF 3FO0H 5IHUH 3VXUB 3BAEL 4YDIL 4GW5B 5H2BB 5IB3A 3U4EA 1OAYH 2EO1A 2UYLB 1NLDH 2G5BA 5AD0B 2QR0A 4L4VA 1A21A 5CJ8A 5CGMA 5BVJB 1T1XA 3KXFA 2W9DH 3RWHA 3MOAL 4JR9L 4UDTB 1KJ3H 1UZ6E 1KJ2A 3LKNA 5M7QA 1WIOA 3WN5C 1KGCD 3DX6A 1XF3B 4JPKL 2I25N 1MEXH 1U8JA 5EU7C 1CCZA 1NCDH 4XH2A 4NKMA 4WFFD 5IR1B 3C2AH 3K7UA 2HT2C 1MFBH 3IXAA 3GSVB 2OSLB 2XTJC 4C57C 2V17H 4GAYA 4DTGH 2J6EL 3VU2A 5KJRH 3BKCL 5DUPL 4XBGA 3ALXA 2D7OA 2AKRB 3BDYL 5FKAB 1DLHB 3S35L 3DO3A 4NWUL 5IFJB 4FFZH 1H8NA 3WFBL 3U9PH 2D7MA 4K07A 2VDQL 2J1KA 2LE9A 4FQ1H 4OLUL 3EDDA 5C0AD 5DO2D 3U46A 1AKJB 4UU9B 1NMBH 25C8H 4JFOA 4Z7QF 3QZWA 5TQ0H 1ZGLM 2DQDL 5D1QC 4NM4L 5HGDA 3RZCB 3EO0B 2YPLA 4JB9H 4FQIH 2ADIA 2JB5L 4ERSL 4RMUA 3Q3GB 3LSOA 3IU4L 3S4SB 1FLTX 4QT5B 2WUCL 4EDXA 4GBXB 5KSVB 5FCSH 4LEXH 4N0YH 4ETQB 3ULVL 4MJ6A 3KYOA 4U7MA 5I0ZA 1I3GH 3IAGC 3RWEB 3HZYA 1T7WA 1NCUA 1T7YA 3JV5A 4QF1B 3UPAA 1FPTH 4XC3H 1KLGB 3T2OA 4PB0H 4YQXH 2X4SA 2RGSA 1I7TA 5GZOC 3HHRB 2CRYA 4OD2B 1WC7B 3MNZB 1AC6A 2EDHA 4QXGL 5BV7L 3MLWH 2MTPA 4ZODA 4DN3H 3SJVD 5DJZB 4JREC 1A6ZB 1DUYB 2CGRH 2BCKB 5EZJB 3A67H 1WBXB 2V6HA 2XWBA 4TTDC 3FFCB 4A6YL 1Q1JH 1KOAA 2Y5EA 3CUPB 1D5MA 3D1MC 5IVXA 3OKEB 5SV3A 1JJUA 4N1HB 4NO0A 4WI9A 4ONOA 4U6HB 2YRZA 2LTQC 4P5TA 3C6SB 3R1GL 4MA8L 1ACZA 1EMTL 3TWCH 1KXTB 4EI5A 3FOLB 1BLNA 3QHZL 1D9KD 5I1IH 1YQ2A 3B2UC 4U1SA 2XN9D 3IGAA 2NR6D 3FJTA 4F9LA 3MGTB 5IESL 1QSFD 3P9WB 5J3HD 3NN8A 4JRYA 4KU1A 2CKNA 5CILH 4OCRL 4Z78A 1EV2E 3MRGA 2F15A 1JNNL 4IDLA 1YJDL 1S7UA 4U7KA 1P4BH 1XF4B 3FMGH 4Z77A 5EN2A 5HYQA 3IAQA 4LSQL 3TT3H 3WN5B 3IDJA 7CGTA 4PBXA 3ZTJG 3BEVB 2L7UA 1QZ1A 5GRZA 3CFJB 2F8OA 5AUMB 3BKYH 3JTSB 5AYQA 1TFHA 3RNKA 1UXSA 1ZS8B 4NCDA 4QTHB 1KACB 2Y72A 4F7TA 1ZHKB 2XTJB 1BFVH 1LE5A 5IBLD 1D5ZA 2E9WA 1DLFL 2QKIB 3V8CA 3MJ7A 4H0IA 3FB6A 4WFGD 3WUWG 4GRLD 3QXAA 3D39D 5EUOA 3WDJA 4H25A 4JFFD 4G3YL 3SKMA 4NYLB 3FN0H 5BS0D 4K9EC 2ZSWB 3GBML 3T2NH 2ID5A 5ID1B 3BN9C 1UZ6F 5IHUL 4GXVH 2E6JA 5DRXB 3BZFB 5D1QB 4V2BA 1OAYL 1HEZB 4M3JA 4E41B 1OSZA 1X5JA 4PBWD 3BKMH 2EXWD 3DHJA 5DVNA 2YMXH 5FA3B 2W9DL 4U33A 5L8LB 1J10A 4HS3B 3JBG7 1MCOH 5DUBB 5EH1A 5F3HB 4HG4K 2ITCA 2MKLC 4XP5L 4AENA 4XP6H 5HHOA 5HPMB 3JUYA 5E8DL 1FVDA 4ELME 5FECA 3KJ6L 3C2AL 1GC1L 2VDNL 3BUYB 3P0YL 1LE9B 4P2CG 4PJDA 2VUOA 4K7PY 4OF7A 2N7BA 3AY4C 2NXYC 4DTGL 3UZEA 2X42A 4NQED 2Z92B 3MTRA 1VA9A 1OGAA 3JV6B 3QEQA 5IB2B 5C0JB 2E6QA 1PZ5A 4WW2F 1HCVA 2DBJA 1IE5A 5TGBB 1N2RB 5KS9B 5F72S 3OJVC 4MZ3A 4MLIA 3WBDA 4HIIB 1NMBL 25C8L 2GJ6D 2VAAA 2GW5A 4WI5A 5FUZH 1UKSA 4ZTOH 1J7VR 4XNYL 1OLZA 4FQIL 3G6DH 4JREB 4MQTB 1SBSH 5GS0L 3KPSA 1FZMB 4PRNB 1JPSL 1LNUB 3CVIH 4QHKI 2V7NA 4DZBA 2NY3B 4P3DB 2XICA 2HJFA 4QHUB 4F7EA 2B20A 2AABL 2DM7A 3FQNA 5EWIH 3RVVC 5EU3A 2LTQB 4LEXL 3VH8G 3E6HA 1RY7B 4V1DB 1KB5H 5DTFB 5EZIL 3LMJL 1I3GL 3OKOA 3MRMA 4GLRI 2ZNWA 2IQ9H 4O4YL 2P1YA 3I3DA 3PWJB 3X12B 2KZ1B 1JN6B 3ARBA 4XC3L 1ZLVK 2NY4D 3QHFH 1Q9KA 4J6RH 3WDIA 3G5ZA 1LO4L 2VIRB 1REIA 3EO9H 4PB0L 4O5LL 4U31A 4YHNA 4WCYH 5HHQA 4RMQA 4KPHH 1NAMA 3H3PL 1LD9B 3S7GA 5T1MA 2FR4B 3GSRB 1UZ8A 1T89C 4EQ3A 2VXVH 2XV6B 3MLWL 1HQRB 3MV8D 4MJ5A 3SOBL 1FAKT 4LSRH 4G8GE 4Q6IA 5B8CA 5F1IA 4GJTB 5C09A 3VDAA 3GK8L 1I85C 2XA8H 5CEXB 4LLQB 4NKDB 1VADB 1WZKA 4YIQB 2CIKA 3V4VL 1DN0B 4HC1L 1OVZA 1XH3A 2VDOL 2VLKD 1QBAA 2ZJSL 5MEND 1UCTA 2A6DB 4OCLC 4U1MB 3ROLB 3U30C 2HT3C 3C60A 3MV9A 3HCVB 5HGBA 3LKPA 1EFQA 2UZIH 4ZFGL 43CAB 5DHVB 5ESVA 1KG0B 4K9EH 4RSVA 1C5CL 4ZQKB 4NPYA 2DQTH 4PJ9C 4BQ9A 3QHTC 5FYLH 3GM8A 4KDVA 2IADA 3K8LA 4NSKB 3TBWB 5I1IL 5HYJA 4R96A 4OCWL 3OPZH 4MAYD 1GL4B 1R5WB 2FX8H 3GBNL 3L3JB 2YA1A 4KRPC 5C0CA 1XR9A 4XZUB 2FIKB 5CILL 4C56A 3NA9H 5IV2A 2OCFD 5HGHA 4NQUA 1NAKH 1AI1H 2AXJA 4H20H 4H8WH 5CKGA 4PGJA 3KPTA 3MRQA 4TVPH 4LDOB 3LQMA 3QG6A 1GOGA 2OJEA 1U2HA 3BKYL 2XZQL 1JRHI 4NQCB 1KBGL 4X98A 4ZUVA 3N9GH 5TH2A 1K3ZA 4HQQH 4NZUL 1HSAA 1MCDA 4X6CA 4TPRH 5FYKU 1BFVL 1UCBL 5T3XD 3RDTA 2NXYB 3CXHK 4S0TD 3TBVB 5D1XB 1C5DB 4OZIB 2A73B 1QG3A 5ENWB 3OAUH 1NMCC 1FFRA 1ZLSL 3PWPA 1PKQA 2NW2B 1T1WA 3GJEB 5JHDB 3GSNH 1JF5A 1Z9MA 5BRZD 4KV5E 4L4VD 3KXFD 4WFEE 5IKCA 5JW5B 1K8DA 3SE4C 3T2NL 3L3GB 1WCQA 2VDPL 5I1CH 1OPGH 3VXTB 1HINH 1U8QA 1ZAGA 5GRVK 4LPCA 5C07E 4PJ5A 4GMTH 2I9TA 2VDMH 4ZUSA 2GITB 5I1DB 2A74B 3IU3A 1QSEE 1YECH 5DVLA 4XC1H 4XVTH 1T0MA 2YN3A 4F8QA 5LGKA 5GGQL 1CIUA 1FGVL 2PTTA 1H3UA 5HHNA 1S7TB 2K1MA 2NXZD 4AYFA 4MZ2A 1IAIM 2P5WA 5IB5B 4KHXH 2CK2A 4M7JH 1S9VA 3KGRA 1T0PB 3VWJB 4Y4KD 1AR1C 4PJAE 5T1DH 3IDGB 5J11C 4GT7A 4R3SB 2CKBB 1QVOA 5IBUB 2SEBA 2GSIB 1CLZL 3WFEL 2JJSC 2OL3A 5C0GA 4NNYB 3O3BB 2BY0A 5K59F 2QTEA 1JWSB 5GS2D 2H3NA 3KPRD 2QQNH 4YR6A 2H26B 2W65A 4ZTOL 3T0XA 2D7PA 3LKOA 3VFWB 3G6DL 5FV1L 1UACL 1EFXD 3L3OB 1MFCH 2IG2H 4K94C 2XRAH 3RIAK 3CVIL 3KYKL 2AK4D 1J18A 1I75A 1OGTA 1YDPB 2DL2A 2R0ZL 2V2WA 2BSTA 2EE3A 4R7NB 3HG1A 4LIQE 5FYJD 4RIRA 4LPXA 4LLMB 1M7DA 1A6AB 3U30B 2ARJB 1T7VA 5LWYH 5BO1H 1VGKB 1I1YA 3NZHH 4D0CA 1P6AB 5DQJB 4OGAD 3CZJA 5BJTB 3A6BH 3S88H 3MGOB 4PJ9B 4JPWH 1BFSA 3GMQB 5JIIA 3TT1H 3V9FA 1ES0A 3RQ3A 5TJWK 4QO1A 1WK0A 2DLHA 2MQ3A 4KRPB 3WEXB 1F6FB 5JTWA 4IOFC 2VL5A 1AD9B 1HHGA 4KKAD 3BJLA 2X6MA 5TF1L 1TMCB 5GHWL 4P57B 1DCLA 3EOAB 1H3VA 2IAMD 5JQHC 1R5IA 3BEWA 1NFKA 4HGMA 3TYGL 4KRNA 1U8PA 1EXUB 1S7VA 3MROA 2O5ZH 4TUOA 5JOPD 2NYYC 3HI5L 2P49B 3STLA 2AI0H 3FT4B 1B2WH 1C5BH 2Y6SD 2I27N 2XA8L 3LRSA 1VEOA 4NJAH 1ORQB 1RSFA 1PG7W 4XBPB 1HHHA 4GKNB 3V6ZA 3MRIB 5DQDH 2VLRE 3U0TB 3WL9B 1JYNA 4Y5XA 1NPUA 1QPPA 4L5FH 4YUEH 1NMCB 1OT1A 2BRRH 4KFZC 4JRYD 4Q9RH 2Z93A 4UMGA 5IG7B 4K9EL 5DD3H 5D5MA 2R2HA 1H0DA 1TTGA 4YHZL 1KEML 1Y18A 2DQTL 4QHNA 2IPUG 3TYFA 3RWDA 4G6KL 5HY9B 3HR5B 4G42B 3T4AB 1GYAA 4L3CA 2FX8L 4P59L 5IMKA 5CEZE 5HI3D 2DYPB 4HUKB 4NDMA 4OFYA 5IMMB 1GPOL 3BIKB 3RX8A 4YXKH 4E0RA 2OP4L 2GT9A 3BHBB 2VH5H 4K23H 1NAKL 1T5WA 3RGVC 4H20L 3QNXB 4XMKL 1NCTA 3MJ9A 4D9QE 5FM5M 3QIWD 2X10A 1MCSA 3QNYB 3D25B 4QRTB 4NQVA 5DJ2B 1BM3H 3DX8B 2EIDA 4PGBB 5IF0B 4WHYG 2NY5H 5E5MB 4XHQA 3QUZD 4P9ML 3ARTA 4ZMAT 1HXMB 4F2MB 2DIJA 1FVCA 4MHHG 3CFKA 3GRWA 4KV5F 1BX2B 4RNRB 3OAUL 5J11B 1S9WA 4X6EA 3NFPA 4MVBC 3ECBA 4HUVA 3QEGL 5AZEH 1A7BA 1IM9D 4WWKC 1F11B 1OAKL 1CICD 4PJ7A 4UILH 4H1LH 3AS0A 1NGQH 4J12A 2RIKA 2CDEB 1RZKH 5I1CL 5T3ZH 2KPNA 4QRUB 5T33H 1OPGL 1JF1B 2EH8L 5FYKE 1XGUA 4GKSB 1HINL 2P8LB 4ZAKC 4GMTL 3MRFA 3KLAB 4OT1H 5FDYA 4KDWA 4JHAH 3RZWA 3PP3K 1YEJL 3CSYA 1JUFB 3OZ9L 1E6OL 1RMFL 1BBJA 3PQYE 4HUXB 4OCXL 4NKOA 3D18B 3MUGA 4WDIB 2YPVL 4YWGH 5HDQH 1OGAD 3QEQD 4Y19B 4B7LA 4PJAF 4XNMA 2AEQL 1AO7B 1C12A 1QLRB 1N26A 3WDHA 5IHZB 4G9FB 3PDDA 4M7JL 1AQDA 4DKEH 3VXSB 1FYTA 4JQIH 2CKBL 3DX7B 1UJ3A 5T1DL 4HT1H 1QPXA 4BZ2L 4KJYA 4FZ8H 4JAMA 3KPSD 5J9PB 3NABH 5AAMA 3MO1B 2CLZA 2VXSL 1S7RA 2GTZA 3X11A 1MCPH 3QEHA 5I74C 4ZUUA 5KZCD 3VA2C 5J6GA 1B4RA 2HWZH 1HH6A 1JGEA 4ZXBD 1NGYA 2XRAL 5J6HB 4L3AA 5DO2C 2PETA 2W07A 4P2OD 4PGEB 2Q1EA 5FIEA 3PXJA 3IFOA 5BCAA 4WIQA 3MJ6A 3CDGB 3ARBD 1JWUA 1TJHH 4YHPA 4OGZA 4HIXL 3QDMA 4K8RH 2ATKB 4PG9B 4PRAA 1F90L 4JPWL 4L8BA 1BZ7B 4KJWD 2CD0A 2FX7H 1GZQB 1FJ1B 5EO1A 5C6WH 3GSUB 3BPOC 4GO6B 4L9LA 1LGVA 1GGBH 3GFUA 1OB1B 3V0VB 2YWYA 1HHIB 5GGSB 4QOKA 3RWCA 2VERN 4OZFG 2PW2A 1DQLH 5J89A 3FO9A 4A2MA 4QRRA 5GRYA 3C60D 5I8KH 2DI7A 1OARH 4HKBB 4JO1L 2AI0L 3EBAA 2D7QA 2IALB 5JNYA 3G5XA 4YHKL 1DEDA 1FFQA 3AVEA 4U3HA 4PYGA 3U0WL 1FH5H 1CFVH 4HIJB 4O2CB 1MHPH 1CVSC 5TDPB 1JF6A 1PBYA 4N0FB 4Q9QH 4JANB 5DJAB 1ZA3B 4Q9RL 3HI6H 3P0GB 1X4YA 4KTEH 2C1PA 4C56D 3GEWB 1IKNA 1VDGA 5I30H 4AMKL 4WWKB 4CADA 3DMMA 1OW0C 4PRIB 5J12C 5D2NA 3UBXG 4ZO9A 3O2VH 3OB0H 1KEGL 4D3CH 1UFUA 4H88L 2YBRA 1D9KC 5HJ3A 4ZAKB 4LRIA 4Y0GA 2GUOA 2KZWA 2NR6C 1GAFL 3B9AA 4I4WA 1DQTA 3RDTD 5J3HC 2B4CC 4M6ML 3K2UL 4KJQD 2P42B 3KPLA 1BM3L 2HJKB 1INEH 3PWPD 3QPXL 4FQHB 4EN3D 1CLOL 1LO5A 1I7RA 2DQFB 3MRCA 2R8SL 3I2CH 1NCBH 3VDCA 4ODTL 4XP9H 3TH3T 3VFOB 1F6AA 4KAQL 3GIZH 2EDTA 1JWMB 1A4KA 4KKCD 3TNNB 4UQ3A 4OZHA 3IDIB 1CE1H 1JNHB 1AXTH 3J8F7 5AZEL 3ULUH 5JMRA 4F7PA 4L9DA 3RFZC 2F5AL 3GMLB 3QCUH 4GMSH 4Z95H 4YEFA 3VFRA 4MJ4A 3PHQA 4PJ5D 5IBLC 2E8ZA 3HE6A 2Q3ZA 1A0QL 3TFKD 4GRLC 5GSVB 3OKYA 4K94L 5I74B 1A9EA 5EU6D 3WE6A 4F9PA 4GG6A 3WUWB 1ZT4A 4MJIE 4PD4J 4RGNE 5C0AB 4LSSL 3W0WE 5L2JA 1SM3L 2WP3O 3V52L 3L7EA 2P5WD 4JHAL 2VXTL 4Z0XB 5E8EA 2BNQA 3QI9A 3BT2L 1V5JA 4JDZB 4UIMB 1LO2H 4AIZB 1BGXL 2EXWC 1OP9A 4Y5YA 5HDQL 1RVFH 4ENED 3W9DB 3JUZA 5I18L 5IW1A 2VAJA 3R8QA 4JRXA 3MLSH 5IWLA 5GGTL 4FQCH 3UTQB 4LLWA 2AXFB 4U1GC 4KUZL 1DEEB 4YXLH 2JKXA 3O4LA 4J3UA 5K93A 3I3BA 5DGRA 5LKNA 1AFVH 3Q5TA 1HDMA 3MR9B 1J0ZA 3ULVE 3HG1D 1N5YH 5C0ND 4XPFL 5FOJA 2HVKB 2ZOKA 2H32H 5D93C 1NJ9B 1PGRB 4FQLH 4UQ2B 2MOVA 4MQ7A 4K55A 1UM5L 1U8IB 3EKCA 2NX5E 2VLME 3MRHA 2H32B 1ROWA 1PSKH 4MNGA 2DLFL 1A1NA 4Z9KB 1YA5A 2MCPH 4DKDC 3R8BB 2VUYA 3SJVB 5KVEL 1T4KA 3RPIB 3L5XH 1PQZB 1TJHL 2Z35B 4WEBL 3DV4A 4GLRH 2FEEI 2L0DA 3RNQB 3U36B 1SVCP 4GKZA 4E42A 1QO3A 3OMZA 4IS6A 1C7SA 1I3RA 2IBGA 1FFNA 5A2FA 5J12B 3L3HB 5EOQH 5DHYB 1TVDA 3ARZA 3MXWL 3HC3L 3UP1A 2O61A 1GGBL 4UUJB 4PRHA 1CGUA 4CAGA 4M00A 2WBJA 4ONGL 5EO0A 1D9KB 1ZSDB 2EIZA 2B4CH 1ZE3C 2NY4C 2XN9B 3G6AB 1T7XA 3DYMA 2V2TB 1A02N 3A0OA 4DGYL 1OARL 4TNWF 4OIIH 4N0UE 4Q0XH 5IMOB 1UB6A 5I17B 4XX1E 1VFAB 3QCVH 4Z0BL 5K9KA 2WNGA 2VRAA 3RHWF 3RVXD 1FH5L 2VKWA 4Q97A 4OCYH 1RAMA 1MHPL 3K80A 4U6YB 5HHXL 3P4MA 4Q9QL 1KCUH 3MZTA 1UXWA 2VTFA 3HI6L 1JI2A 4OFYD 3T0EE 3LV3B 1AD0B 1JCKA 1KIPA 1H3PH 5E9DA 4XPAH 3BKJL 1Q9LB 1FFOA 5CGTA 4QWWC 1Z3GL 4FXGA 1YUHA 5F70A 4GRLB 5D7LD 1H5BB 2V7HB 3U0PA 5SWQA 4NUJA 4M5YH 3BZEB 4JFFB 4LCUA 5ITFB 2R0LL 1CGVA 3LS5H 4LP4A 5BS0B 1I8IB 4ZO8A 4XPGL 2BMKA 3QJHA 1UT9A 4MAYC 5F71A 1SJHB 4NZRH 1DBBH 3MMEA 2EDWA 1MJ7L 3ARRA 3VXUE 5FB8B 1KENH 3MRRA 4X7TA 1YEDB 1NUFA 1XGRA 3QUYB 4RCAA 1INEL 1I1RA 3QCTH 5JXED 1IEBA 5I8EA 1M7IB 5SX5H 1OSPL 3QFDB 5A2LH 2HJLA 2VNCA 3P11L 5FK9B 4NN7C 3UROR 3TJHD 1SY6A 1C1EH 4U1GB 2CMRH 1MHHA 2B2XL 5J1TC 3UDWC 3VW3H 3O8XA 2ICEB 3T0WA 2FO4A 2DQCL 2DBLL 4K3JH 4MNQD 3TCXA 2QSCH 2R56L 5BZWB 5DRZB 3NTCH 4Z95L 4JG0L 4M5ZL 4K3GA 4DGIH 1WV7T 4OI8A 1S9YA 3H9HB 1DANU 1MJ8H 4LDLB 4OUOA 2XWJA 4O2FB 4LKXA 2WQRA 5EC1A 3SGKA 1L0XA 5D93B 2F74B 1FNSL 1AP2A 1CD1A 4PGDB 2H2PD 4L8SC 3DECA 1MLCA 4OLEA 1QA9A 5E6IA 5IJKA 3LB6C 1RHFA 2GJ6B 2YPKA 1PLGH 4RFEA 1LO2L 1UEYA 1A6WL 4AG4L 1FYTD 1P4IH 2EDXA 3L95B 1A1OB 1MRCH 2X7LB 4ZUWA 1RVFL 4X7CC 5EDXA 3NCEB 3SGEI 4OD1L 2NY6C 4ZFZA 3T0VA 1U3ZA 1ACYL 4XCNA 5ICZB 2OJZH 2ORBL 3ULVF 4CMMA 1DBKH 5ACZB 2BNRD 2OTWB 1DDHA 2NXZC 4RQQA 3G08B 4LLVA 2HLAA 3MBXH 4QRSB 4HIEB 4Y4KC 1IC7H 4MCYA 4OGXH 5GJSH 4F33B 3FONB 3M17B 2NY4B 1E27B 1MCEA 4D9LL 1W8NA 2O5XL 4N9GB 3UTTE 3QA3B 4PR5B 4BKLB 1U6AL 5CJOL 5DEGA 1T6WA 2CIIB 3QDMD 1PSKL 3HZKB 4QTIL 4KZDH 3HZMA 3S36L 2MCPL 3HE7D 3MV8B 2F54D 4DFIA 5AZ2L 5C0IA 4MD0B 3FO2A 1RFDH 1RUAH 5CP7B 4Z7VA 3O3EA 1YN7B 1ZT7B 3L5XL 3OXSB 5T1LD 5ABDE 3DGGB 3D0LA 4KMLB 2B5IB 4P23A 3EAKA 1S8DB 1P4LA 3TBTA 3FFCE 5LGJB 3V6FB 2CO7B 2VLKB 3G04A 3WJJA 4OFDA 4M43L 3IF1B 1UWXH 3P4LA 1PY4A 1SYVB 4QRRD 3CXDH 1BQHG 1CK0H 4OGAC 1P84K 4PJIB 4UOW1 3LKRB 1A7OL 2W60A 1ZHBB 2A6IA 1KYOJ 3BZ4B 4OLYL 1G7IB 4P5MA 2WK2A 4MAYB 3T65B 2PYEA 2H6PA 3LRHA 3KG5A 4KKAC 3O2DA 4P49A 3REVA 3FL7A 3L9RB 4PTUB 3RTQD 1WTLA 2IAMC 4Y4FA 1TETH 3QCVL 4I77H 2ZUWA 2Z9TA 5DMYA 5INDA 4YHOL 4NN7B 3VG0L 4OCYL 4FQPA 3IVKA 3DXAB 2Y6SC 5F3BB 2JJWA 3TV3L 1F2XK 3IJYB 5TE7H 1U8HA 1BQLH 2XQYG 1H3PL 1FE8H 5E7FA 2PXYC 3V5KA 5BXFB 1F3DJ 3DJ9A 4G9DB 5JDSA 2BOBA 4WHTA 3V7AE 1JZ6A 4I0KA 1MFEL 4M5YL 43C9B 1CXIA 1EZVY 1KJ2H 1I9EA 3AFLA 3KPQA 4U6TA 2BRQA 2FIRT 5BRZB 4L4VB 1ZKAA 2R2EA 4L8SB 3WFHA 1KJ2B 3LKNB 3MLXH 3VFUA 3DX6B 5I1AB 4PY7B 3MYJB 1DBBL 1U58B 5HI3C 2OXHA 1TZGL 1U8JB 3IFLL 2YSSA 5TF0A 1M05B 2DMCA 3SPVA 2X40A 3QUKA 4AIOA 4E41E 3QUXA 1OP3H 3OJ2C 3D3VD 3T8XA 4P4RA 1FNHA 1LVEA 3L1OL 3C8KB 3BQUA 2NY6B 3VG9C 3VMPA 4GAYB 3QIWC 2W0LA 1T83C 5ALCH 2A9MH 3QFJB 3U6RA 2CMRL 4BUHA 2BOCB 2PCPB 3DOSA 3EYOB 3QUZC 4ZNEE 4LNVA 3VJ6A 4DGIL 3T4YB 3H8NA 5IVZA 4Y4KB 3B9VA 4OJFL 4R2GD 1DBMH 3DSFH 1CLYL 1T7ZA 5BQ7A 4U1LA 4P0DA 3PDOA 4XP4H 5IT2H 4GRWH 3ORJA 3VXOB 2JCCB 4D8PB 1QBLL 4KKNA 1JPGA 1YYMH 2EYTB 5GS2H 2VDRL 5KS9E 1CICC 4OZFA 1Z5LA 4GRWB 4MXWH 5HHMD 5B39A 1NCCL 2GCYB 3SCMA 3KPRB 5H37H 5F96H 4GSDH 5F7EL 3SE9H 2R29H 4XXDB 4RWYL 1ZGLB 5F88A 3O4LD 1EFXB 5JXAH 1HHJB 4F3FB 4RAUA 2DWEB 2AK4B 2W9EH 3GNML 4U49A 4NZTH 2I60L 4NT6A 1NBZB 4IIQC 1UB5A 1LP9A 3MRKB 3BW9A 1CT8B 4I13B 1GRWA 2KQNA 4O58H 4V1DE 1A1MB 1MHEB 3MBXL 2ZG2A 4JJ5B 4YDJB 1OCWL 3RY6C 4YGVA 3CFBB 3PWLA 2XWBB 3GJFK 1IT9H 3O41B 5E8PA 2IAMB 3LVEA 3QWRD 4G7VH 1S3KH 3VGAC 3DBXA 1A7QL 4AIXA 3NCBB 1TNNA 4PJFB 1RFDL 4PIRF 1RUAL 3LEYH 5EBWB 1JGUH 2XQYK 4ZXBC 1CD8A 3V6OA 2ZG1A 4P2OC 3FRPA 1TZHA 1HK6A 1YMMD 2OI9C 2DKSA 1P6FA 2Y07L 2C1OA 2PXYB 3OGCA 4R0LC 3ARBC 4K7FB 1CGTA 3OJDB 1F4HA 1N64L 4K2UH 1EHLH 2P8PA 5F7DA 1W72A 3CXDL 5F6HJ 2XYCA 3L5JA 1CK0L 1YYLL 3MLZH 5CAYB 5I8OH 3IAPA 1AGFA 5KVDL 1FAIH 5SWSA 4KJWC 3A6CH 4RWHA 4XAWL 1EPFA 1RZIA 1IM3B 3QIUC 3CFEA 1FG2B 1HZHH 3T0DA 5A40E 1MIEL 3NIDE 1NUDA 2H9GA 1JHLH 4FTVA 1CD9B 4ZG1A 1JGDA 1OF2B 3MLUL 2R2BA 1LK2A 2F53D 3JWNC 4NRXB 4UDUB 1TETL 4PP2B 4LSPH 3SDCD 1AY1L 4PRPA 3VG9B 1KIRA 3QIWB 3EJJX 4Z7WB 3MJ7B 4X4XA 1PAMA 3C5SA 5TE7L 2FJFB 3KPMB 5T3XL 3VFPB 3DO7A 2P24B 3QUZB 1QFWL 2BC4A 3JWOC 5MP6L 4S10A 2HN7A 3SE8H 1MI5A 3TPKA 1NFDA 2CUHA 4MNHB 1RUQH 4G5ZL 3RUGA 1B4JH 1JFQL 2IBZX 1S7XB 4MJ2A 4X7SH 1VGEL 2VITB 5JHDE 1KSRA 1IFHL 1IM9B 1C16A 1CICB 3EYVA 3HMWH 3U9UA 2A83A 3MLXL 1INDH 5TDOA 1KCSH 4XPHH 1KPRB 3KJ4C 4ISVA 1VPOL 3UBXB 3OKMA 5D8JH 5M95B 1QR1B 3SKNA 2NMSA 1JI1A 4IIQB 4JM2D 1MCQA 3RDTC 4LQFH 1GGTA 4U6VH 4XCCL 5F9OH 4ZUTA 1KLFA 2X4QA 4KJQC 1MCRA 2FECL 3BRDA 1OGAB 3QEQB 2Y4SA 4EN3C 4QRPB 1WITA 1FP5A 2DDQH 1D6VH 4I9WE 1Z9SA 5E6ID 5KS9F 1MLBA 4E5XB 5L88L 5C08D 4KKCC 3DSFL 3DI3B 2ZPKL 5IEKA 3BP4A 1QLEH 2G75B 5IT2L 1YEFL 4XBEH 3N1QC 3KPSB 1D7FA 3MV9E 4GQ9L 2Z31A 1QRNA 4LKCB 4QLRA 2CDFA 3IJHB 1GVIA 5EO9B 1JYWA 3UTZA 1AIFA 3TFKC 3TEUA 5F96L 5C2BH 3VGAB 2NNAB 3B4NA 4P5KA 3EZ8A 3HUJB 3CFCH 5FYJL 5HYJE 4OQTL 5I75C 4ZXBB 1WWWX 1HSBA 2V9QA 2CXGA 5C0CE 2MKWA 1JZ2A 4P2OB 2N4IA 1KN4H 3Q5OA 2BHUA 5EBLB 1Y6KR 4LLUB 4R0LB 2AJUL 3KDMB 3QDJA 4MA3B 1F4AA 4PJXB 5CWSB 2J8OA 4ENEC 1NAMH 3B43A 3QXWA 5HHQB 3ARSA 3UTPD 1GZPB 2EH7H 1Q72H 3QO0B 4BSWB 2AEIT 5T1MB 3QIUB 3BXNB 5I1HH 4L4TD 2P5ED 1E4XL 4KTDH 4MJ5B 3E6FA 4X6CE 4JFQB 5C6PB 2VLJD 2XZAL 1IL1A 1FL6B 2BVQB 3PIQB 3P2TA 5C0NC 3MBED 3V0WL 5DJCB 4KKLD 1N5AB 3RWFA 3F7QA 4G7VL 2C9AA 1S3KL 4HV8A 4IOIA 1ITCA 1JPTL 2VWEE 3GKWH 4YHMH 2GAZA 4YBLC 5HDOA 5MEQA 4BH7A 4LPTA 4NPYB 1EEZA 1M71A 4M1GH 3PG2A 1WWBX 4P4KA 3M45A 4R96B 1TTUA 1ZVSB 3L3KA 4ODSL 2PYED 5SX4I 1XR9B 2PF6A 1C7TA 4I1NB 4M8QA 2GK2A 1FAIL 3NIDF 4C56B 3VFNA 3BWUC 3R0NA 4HAFA 3BO8B 4Y4FD 2EC9T 2X1PA 4I5BA 4X0KB 4Y2OA 1MCLA 2BVPA 1JHTA 5C0RL 3KJ4B 1JGLH 4KWUA 2XFXB 3C08H 2P45B 3MOBH 3WHE1 5CGYD 1NQBA 2HFGH 3HNVL 1I4FB 4P99A 4LAQH 4N0RA 3RDTB 3TBSB 1BD2A 5E1AA 1HQ4B 1CN4A 4DVBA 3RP1A 2WBWB 4EN3B 2GFBA 3CAFA 5I19H 4NQDE 1DUZB 5IBTH 3RVXC 4H5SA 1K9TA 2JLLA 1MQKL 3AS2A 3DIFA 2I5YL 3GGWB 1URLA 1RUQL 4M9PA 4JN1L 3BH8B 3C6LA 3X17A 2F19L 2CXKA 4X7SL 4XHJD 1MAMH 3LN5B 5J56B 3E8UH 1NGZB 2Y06L 2D31A 2OQJA 3HMWL 2BERA 3BGFC 5L7XH 5LJYH 1ZMYA 1KCSL 1A3RL 5JZ7D 1CGWA 3V4UL 5A3ID 2R1WA 5EU6B 1HNFA 2VQ1B 5EZOH 5I75B 1FO0A 4WEUD 1KCLA 4ODVL 1A6UH 2Q76A 4LSVH 5DT1H 5EULV 1KCRH 2AJSH 2AXGA 4N8VA 1ADQL 4EVNA 5GS1A 4GOSA 4ONHA 2R4RH 2ZNXA 1RJYA 3DVNA 3QXDA 2E7LC 5DA4A 5ISZB 3OB8A 2YKLH 1K8IB 2DICA 4Y19E 5JXEC 4OGYH 2OL3H 1R0AH 5DQ9B 5TPWL 2DDQL 3G5YB 1AO7E 2FZ3B 4WW2A 1D6VL 5F1NA 5J0BA 1MF2H 4FQXA 3TJHC 4WEMB 4G9FE 3VD7A 1XCTB 4L29B 1T1ZA 4ZYKA 3QT2A 1IQWH 5D1ZA 4YHZH 1IGJA 3F6IA 3LKOB 4K3DL 5CJXC 4YE4L 1JP5A 1KUMA 2QADD 4CW1B 4W4OC 2F8VA 1KCVH 5FGSA 2AQ1A 3TPUA 2E7CA 4H0GA 5D5ME 3TZVD 5C2BL 5EU5A 1JGVH 3SKOB 4WV1B 1BP3B 1RUMH 3EFFA 1DL7H 2HA1A 4GXUM 4JGJA 5HI5D 4H0HB 5J06A 3MSPA 2H2PC 4YBLB 3CX5J 3RIFK 1BQUA 1FN4B 1CDHA 2ADJB 3ZYJA 1JHKH 3GJFA 3LEXA 4AJ0A 4B53A 2Q20A 4HJGA 2X4UB 5HGAA 3I75B 3OR7A 4LF3B 2OMNA 5DD6A 3H42H 3WS3B 1R5VA 5C0FB 2VC2H 2VE6A 5DR5H 2E27L 4Z5RA 2UZYB 3VRJA 3CMOH 3I85A 4HS6B 5FGCB 4AEIH 1Q72L 4LCWA 5JHLL 2AP2A 4BFIB 3GMPB 1OTTD 1NGWA 3BEWB 3L3DA 1Q0XL 1ZLUK 2I07A 4AH2B 1KTRL 1U8PB 4ZOAA 3WS6A 4NO3A 1U8MA 3O3DB 4HUUA 3QG7H 4O2EA 1VKXB 4UT9H 3QRGH 1RJLA 1U3JA 5TQ2L 3VGFA 2XNAB 4ZFFB 2PYFA 2V2XA 3GSOB 4IMKA 5DJ6A 5CBEB 2R0KL 1C08A 1XGYL 2VR5A 3F6LA 2W92A 3O0RH 4PJ7E 5MEOB 4HPOH 1EHAA 3JWOL 1RUKH 4X8JA 1H0DB 1T2JA 5FF6A 5B4MD 3HE7C 3JTTB 4M1GL 3WLBA 1QEWB 4ODUB 3CX2A 5BW7C 4L3CB 4OQ1A 4RAHA 2ENYA 4M7KH 2MCG1 3EW3B 1PG7H 4L9LC 1SEBA 3NACH 3QJFB 5GXBB 2BSSA 3ZL4L 3KPNA 3MJ9H 4WGWB 5CD3B 1T5WB 4U3CA 5L2KD 1CBVH 3BGFB 3CCHB 5DRWB 5F6IB 5D7LB 2HT4D 2EDOA 2ARJQ 5HYEA 4R97C 5EU4B 3IJSB 5FUCC 5JLZA 2R9HD 4ZPVA 4ELKB 3VDBA 5F89B 4NQVB 5HXMA 3DX9A 4M61B 1F00I 1MIMH 2RCSL 1CGSH 1MFDH 1BQHB 3GRWH 5C1MB 3O2WH 4LMQI 1CTOA 1YPZB 4LAQL 3BVNA 5DFTA 1OQXA 3BOVA 5I1EL 5KN5B 1X7QB 4YPGA 2P43B 2QQQA 4KQ4H 6FABH 3RTQC 1EA9C 4GG8A 4YFEA 5IK3B 4ZTPL 4KZEL 5GSRB 5IBTL 3VFTA 1U36A 3RWIA 1VHPA 1QLFA 4NNPH 4OLWH 3WD5L 4NNXA 2YR3A 2X4TA 5ERWB 1DQMH 2YK1L 1CQKA 3FOMA 4TRPH 1CF8L 5L6YH 1EAPA 2HTKD 4MNQB 5ESQA 1L6ZA 4DKFH 1JV5B 3GMNA 4AK1A 3O4OC 2FJHA 1WEJH 3MCKA 3OF6D 4OI9A 1KFAH 1K6QH 1KC5H 5F7LB 5EIIA 5I1JL 5L7XL 3BPCA 4JCLA 4P2RB 5ETUA 3MRDA 1XF5A 2K7QA 4HDIA 4NHUA 4NKQB 3C09C 1WCBA 1HOCA 5D72H 2JIXD 4S1SH 3DRTB 2PR4L 4LSVL 4KI1A 5DT1L 3VFSB 1BMGA 5LCVH 2N1KA 5IGXL 3P9LA 4Y8AA 5C0DA 3IKKA 4R90L 3VE0B 3BSZH 5ESAA 4XGZA 1FYTB 3UTSD 4AL8H 1Y0LA 3QIBD 3WHXA 2YKLL 5ADPH 5HYSG 3LKSB 1JL8A 3HAEA 1IAIL 3LPFA 1NDGB 3UJIH 2B1HH 1MQ8A 1QRND 3Q1SH 4WUUB 2OK0L 3CH1B 1GJIA 5FFLA 2R4SL 1WBZA 3H6JA 3X11B 4YXHH 1NSNL 3B3IB 5GGVL 2BNRB 3IETA 4QNPE 5B21A 2CR3A 4KK6D 4EUPG 1JZ3A 4UI2A 3VXRD 5FHBH 3W9EB 1R3HB 3PL6A 1KCVL 4R2GC 4RGOL 2HH0H 1JGVL 2UVFA 2W0KA 4UINL 3DUSA 4HK0A 3GSWB 5GRWA 5FO8B 1MCCA 5D2NE 5DMKB 5AWNL 3TLRA 1RJZB 3TVMD 1XZ0B 3HE7B 2EDKA 3P4NA 2F54B 4YDKH 1A6TB 5I1LB 1XIWD 3LDBC 1N3NB 5T1LB 3SJVE 4YNYA 4MYWB 5DR5L 2JJTA 4L9LB 1D6EB 2EDBA 2QHRH 4JY5H 2K9UA 2FD6H 3K81A 4J8RA 1UWGH 4JHBA 4AEIL 4BQ8A 4YDLB 3BP5A 3RWJB 3K4AA 5CJ5A 2Q6WB 4AT6B 3MC0A 5JPNA 4QRRB 1P1ZA 4CU7A 4R97B 4U1KB 4XCFH 2AJ3A 3U2SA 4MMXC 5BVPL 4Z18A 3VGGA 2C5DC 2GJZA 5CCKH 3G5XB 4OZHE 1ZWIA 4JFZL 3OR6A 2CPCA 5CP3H 2XN9E 3NIGF 4F15C 1VEMA 4FP8H 4WJ5B 3TCLB 1LDPH 1T21A 4W4NA 3O0RL 5E8OB 3VFMA 3QNZA 5SWZD 1JPFA 4JO2L 4HPOL 1MJUL 1B0RB 3MV01 3RTQB 3AREB 2OXGA 4QY8A 2IPTL 5J1AB 5FDWB 1JTPA 5HHPB 4M6NL 3IT8D 4KROD 1YN6A 2E7MA 3VRLE 3CGTA 4B50A 1ZEAL 5D7JD 3CXHJ 4R4FH 4TNWK 3MLRH 4PV9B 1PG7L 2WBKA 2LU7A 3NACL 3VI4E 3KPOA 4L8CA 3TH2T 1FBIH 3O4OB 1AGEB 4Y88A 3WIHA 3RHWK 3KR3H 2A77L 2P48B 1M7XA 4LBEB 3IKCA 3L7FB 3MFGB 4F7MA 4I4WB 3SE3C 2HVJA 3GMMB 2I26N 2WLYA 3H7LA 4JRXE 1BD2D 3RVTD 4PD4K 5I15H 1QFPA 3MRNA 3QISA 4JFFE 1J1XH 2R1XA 5HPOA 3NFSH 3NPSC 1MFDL 1CXHA 2DQUL 5INCB 5C7XL 4PJEB 2WIIA 4MMZC 1EEYA 3K4DA 1LHZA 4TUKH 1AGBB 2FJGB 4N8CL 3EJYC 4NO2A 3MRPA 1B6UA 1AQKH 1FNEA 1MVUA 3ILPA 4UQ3B 5KBNC 3D3VB 4XNQA 3H7BA 4IHOA 1TJGH 3SDCC 2ESVE 4FXKA 2RAMA 3F58H 5CIPH 3UYRL 1I8LA 4QRQA 5CIPB 2LVEA 1DQML 2HKFH 5C07A 2IH3A 4JVWA 5EUKA 1MWAA 5IW6A 1UA6L 3BD3A 3JV0A 4U1JB 4OLXH 3PWNB 2R0WL 35C8H 4YZFE 5FYJU 4R2GB 2ICWB 4ODHL 1CDGA 4BZ1L 4ZO7A 4RDQG 2Q87A 5DWUH 2WV3A 2BJMH 4QHLB 1CFSB 3EGSA 3MA9L 4PJAA 5HHMB 2G60L 3QDHA 5LCVL 1Z0MA 3MXVH 3L6FB 4PJ8D 5TFSL 3EO1A 4CN4A 1DQDL 1SVZA 4PRHE 2GJ6E 2GK0A 4QYOA 1W0WB 1UADC 3LDBB 2GSGB 4HGWB 4U0RC 1QNZL 4BH8B 5I1GL 1TVHA 2ZUVA 1A47A 4URTB 3D0VB 3K3QA 2FYYB 4OCNC 5H35B 1OTSD 1Q9OB 4JM2C 1CL7L 3FB8B 4QNPF 5FO7A 2DM3A 5F8RC 3O11B 1P7QD 4J4PD 2C3VB 3SGKC 3O9WA 12E8H 1IARB 3OAYK 4JKPH 4HAGA 4NKIL 4P46D 4PJHE 1UENA 4L3EB 3LQAC 4J1UA 4MNGB 4XNZC 1F58H 5E6IC 5IOPA 3HNSL 5D71H 3BPLC 1Q94A 5I1KL 2HH0L 3VXQB 4F15B 5JW4M 1T20A 2XI9A 5DJYA 3FQRA 4HKZA 3D9AL 4HXAH 2FSEA 1OL0A 2LQRA 1KNOA 4DQOH 1A7PL 2PTVA 5I16A 3H9SD 4C4KO 1YNLH 2MQ0A 4IS6B 3MV8E 4YDKL 1J8HD 1I3RB 3DUUB 3MLPA 4GW4B 3UYOD 3MUZ1 3PNWB 1Y6NR 4OF6A 2W0FA 3UJTH 1W0YT 4M93C 3MLTA 3AAZB 3OKNA 3D85A 4NQXA 1UWGL 2E9BA 4I0PD 1YMMB 1HYRC 2EIZB 3C8DA 3EOTH 2BX5A 1OP5H 1AR2A 4MSWA 3NOIA 4BFBD 2OR9L 4HH9A 4XCFL 2OTUA 3IFNH 1T0NA 3TO2B 4I8DA 2VLRA 2DD8H 5IIEA 2FGZA 1J11A 5DLMH 4PJIE 3SKJH 5DS8A 1BOYA 4PREA 2EECA 1YEGL 3OKLA 2C3XA 5L8JB 5ADOL 2X89A 4FABH 4S1DD 4FP8L 1LDPL 1QYGL 4ZSOB 4W70A 5HHVH 1VFBA 3L5IA 4JY4A 2UVEA 3VRLF 3V2AR 1QKZH 5FKPA 3QH3A 1OLLA 2F53B 3C5ZA 1GSMA 5FUOH 3MBEC 3SDCB 4HFUH 4F7CB 4KKLC 4H26A 2AEPH 3VI4F 1CGYA 1I1AD 1NBQA 5BZDB 2H1PH 3KYMB 1YUHB 2VXUH 2ZCKH 3C9NA 3DXAE 3H2WA 1G7PB 3HNTH 3R06B 3P9MB 3QUMH 3U1SH 5T3XE 3MA7A 2Y9RT 5LVEA 4JFDD 4LLDB 3QUMB 3ET9F 3MRRB 3UO1H 3HPJB 3GI8L 1AE6H 3S97C 2OZ4L 4RFOL 3ZDXE 5I15L 4OV5B 1J1XL 5BRZE 3P4OA 2XQBH 4Y4FC 1UM4L 5I8EB 2FB4H 1WQVT 5GRUL 2N56A 3PP3H 4UOW0 5EORH 5GGUB 5F7HA 4PG2C 2JK5B 2BDNH 3ZE2E 5K9QG 4CJ0A 5FO9B 2EYSB 2Y5TB 4CL7A 5CGYC 4U0RB 2B39A 3O6FA 1SQ2N 4OKVB 3LIZH 4DW2L 1S7QA 2BFVH 4RZCB 1IQDB 2A6KA 3AB0C 4JM2B 4LNRA 1JTTA 5E4IA 2XKNB 4JFEE 1J05B 1S9YB 4LDEB 5E2UH 3GM0A 4KDTA 1ORSB 2X4NA 1BOGA 1IGCH 2HKFL 4HWZB 1GGYA 1ND0A 3QFJE 4GAJH 4YZFF 5EC2B 4KY1H 3HMXL 5DJ0B 1BECA 1IKFH 3PQYA 4P2QA 3WV0A 5AYUH 1FZKA 5IB4A 4XNZB 5E6IB 1RK0B 1U8OB 35C8L 5C08B 3BPLB 5E2WH 4G6MH 2OR8A 3B9KA 1T3FB 3JV4B 4RRPA 4XHJC 3T1FA 2D0FA 2JCCE 3BIAX 2COQA 4LHUD 4ZOCA 4OM0H 2BJML 1G6RB 3HC4H 4PGCA 2D4FA 2F58H 4HKJB 5JZ7C 3KPRE 5A3IC 3F7VA 1GGUA 1G7JB 2HFFA 2D03H 4RAVB 2AK4E 2NLJB 4HH8A 1UH3A 5FYJE 1BZ9B 1K4DA 3HPLB 5DSCA 2Q7YA 5CLTA 2X4OB 1LEIB 1D5XB 2HKHH 5KSAB 1KTDA 4PJHF 4HWBL 4PUBH 5C0EA 4Y1AD 5F7KC 4OIAA 3DVGA 5DUMH 2BVTA 4C59B 1CU4L 3FB5A 4XCYB 1HHKB 4R26H 5DEGB 4K71C 4ODXA 2QHLA 3QB7C 3TC9A 2B1AL 4L4TB 1MNUL 3BZDA 2P5EB 1JMZA 3TN0B 1BBDH 5C0IB 4HBQA 4XVUD 3TO4B 4Z7VB 1NC2D 1B0GB 2VLJB 3Q6FA 1IEHA 2QADC 4JDVB 2DQHL 4PJGB 1RK1B 1P4LB 3D2UA 2CLRA 3MBEB 5FOBA 4G8GD 3TZVC 1EK3A 1Z2KA 1YNLL 4J2XA 5E4EC 1G1CA 3MX0A 1OAZH 2PW1A 5HI5C 5JOPE 1K5NA 5KVGH 3NAAH 3MQIA 2J4WH 5IMLB 1ZA6B 3BMWA 1WVZA 1IAKA 2IANB 5A16B 2NY1D 2EDFA 4JZJA 5BMFH 1J1PH 4PJIF 3OV6A 4U7SA 3INUH 4LMQE 3ARDA 4U2YA 4LCYA 4CNIA 3IFNL 4DEPC 3B9DA 5DRNB 5IP4A 3AU1B 5CEYA 1NCAH 4Y4FB 3SKJL 3IFPA 1OTTC 2W38A 1WFTA 2ADGA 4XWOD 3VXMB 3ZYIA 1MFAH 1S78D 4GRMB 5HHVL 2J88L 3QWOA 2A6JA 3GSXA 3OJMB 3GIVA 4L8DA 4LCIH 5KSUA 5FUOL 1MJJA 2DKUA 4HFUL 3W5MA 4G6FD 5GRJL 3AB0B 2X4PA 4LLYB 3NZ8A 5CMAA 1LWRA 3AS3A 4NGHH 2H8PA 4WHTB 5FCUH 1KLUA 4Z7WE 5KOVC 5LQBL 5MEPA 5HYSA 1G7LB 2CDGA 4YFLF 5CBAA 2Z8WC 5B4MC 1FZJA 3MODH 3QUML 4MGXA 3ZDXF 3U1SL 4LGRB 4G8FB 4IJ3C 5M94B 2CLVA 4LHUG 5I73B 5JORB 5SV4A 5C86A 4HLZH 1LP9E 2ITDB 4WFED 3ZE2F 4J3VA 4HF5H 1AE6L 5I2IB 2VXQH 2VZTA 2DQEL 4ORGA 4P4RB 4TYUA 3SDDA 1BJ8A 1IGTA 4PRDA 1CFNB 2FWOB 1I8KA 5EORL 4GUPA 2HT4C 4DAGH 2BDNL 2QV2A 1I7UB 5C07D 3U6RB 3P77A 4XAKE 5L0QC 3O6KL 4XNUH 4C58B 4JKWA 1QSED 3FCTA 2VMFA 2J6EA 3NFNA 1S7WA 1R3KB 1FV1A 4YHLH 2DLTA 4FXLA 4MJIA 5F9JB 4EIZC 3FHAA 4QXTB 3E3QE 5T1KA 1L0QA 4JPIB 4QRPE 3LQAL 3IRZA 3VFVB 4EOWL 1OAXL 4NRYA 4UV7L 1D5BA 5C0BE 1Z5LB 4G8IB 2JCCF 2CR6A 1TPXC 5B39B 3K74B 4JFXA 2P47B 4HUWA 3BH9A 4ZS7H 4GRWF 5E2WL 3ARGB 1S5IH 3T3PF 4DUWA 2HTKC 5F88B 1G6RL 4WW1B 3WKMH 5EFIB 2AV1A 2QADB 4R8WL 1UKTA 4U05A 3SGJA 4OM0L 4M1DH 1BVKA 2YC1A 4LVOB 3IDNA 3TZVB 1EJOH 4TQEL 3B6SB 2W1NA 5SWSE 4DFHA 5E4EB 4X99B 4EBQH 4JZOB 5FEBA 1VERA 1T2QL 3EFDH 4LSTL 3O9WD 4KUCF 4GKOA 3HI1A 4XCEB 3RY5A 2D03L 1G7MB 1A7RH 4TSCH 4Z76B 4L1HA 3D87B 4FTVE 2WMPA 1HH9A 3ELAT 2JF1A 2NX5A 1NC4D 2KDGA 5DUML 3ARFD 3N06B 3QIBC 4PRPE 3CVHL 4PJXE 3MV7D 3STZA 5CSBA 4DEPB 1SJVA 2MHAA 2RFXA 3KAAA 2WWKO 4M4PA 5EOCH 5K9OA 2YHGA 2BNUA 1A6VH 3EYFA 4D94A 4Y4HD 3WMSA 1S5HB 3GMOA 1W2KT 4KK6C 1YY8B 1N7ML 4A6YA 3JVGA 4PJFF 4QGTA 3VRIB 3RUGE 1N0XH 3TJEH 5CHNA 4B7IA 2C4FT 1BF8A 1WSST 4FFWD 4BQCA 2C1OB 5E1HB 1W72H 3QQ4B 4N1CA 4ONFH 3RKPA 1BEYL 4HX1B 1MAKA 2H2SD 5KVMC 3R4DA 3BP7B 5E08H 2P8PB 5F7DB 5KVGL 1UWEL 3N85L 2IH1A 1NDMB 3TVMC 1R3JA 2VLRD 5JW4R 5KG9B 2D9CA 4I18C 5EB9A 4NN5C 4OTXH 1XIWC 2W59A 4N0UA 1DVFD 1T1YA 1BJ1J 3MRJB 3OHXA 4OM1L 1KIQB 3L5WA 4WUKH 1TVBA 5DJDB 1SYSB 1TCMA 4G43B 1H8SA 4CU6A 1KB9J 3MLYL 3C5ZD 1ZT1A 3JWDC 5T3ZD 5L2KB 2UUDK 5CEZD 5DEFB 1CFBA 1RZ8A 1U95A 3GMRB 1KIRB 2AJZB 5E56A 2ATPA 4MQXD 5HD8D 4YX2L 3KLHD 1I9JH 3EDKA 1Q9WB 4P9HC 3MNVB 4EKXA 5L0QB 4Z7WF 2PUQT 3LHPH 4LCIL 2MJWA 1EO8H 1QP1A 5TDNB 3UAJD 4D9QD 1MRDL 4AEHL 4UT7H 5D2LB 5E8NA 2CJUH 4U1HA 4JFPA 1T6VN 4NGHL 1NKRA 2GTWB 1G84A 1OWWA 1J87A 1QUNA 5CJQL 4HCRH 3NH7L 1AHWA 1F4YH 3VXUA 3MODL 4GW5A 5H2BA 4KROC 2BZDA 3QXVA 2UYLA 2A83B 1TPXB 2XZCH 2IFFH 4DCQA 1YEKH 2YA2A 3KLDA 5D7JC 5AD0A 5BVJA 2Z8SA 3RJDA 2QQLH 5B3JF 3L3IB 5JQ6L 4N0CD 4HF5L 1G7HB 2BHZA 2VXQL 5F7YC 3QDJE 3MRLB 5IFAH 4BSVB 1HI6B 1QQDB 4MA7H 3GUTB 5IR1A 5D7KE 4DK3A 1IZKA 3RVTC 3GSVA 2OSLA 4GS7B 4ZUTB 2FBJH 4G7YH 5D70L 1IEAB 5EU6E 5ID0B 5DK0A 2B0SL 4XNUL 2DOCA 2JIXB 5DK2B 5JW3H 1OM3H 5E24E 1NBYB 4P2YA 3S37H 4NWTH 2AKRA 3WHE0 5FKAA 1DLHA 4K8RD 5IFJA 4Z7UB 3UTSB 3HB3D 1HKFA 3QIBB 7FABH 5ISZE 3BP4B 3SY0B 1AKJA 1R3IL 4UU9A 3RZCA 3EO0A 3ARQA 5GGVY 4ZS7L 4S1QH 4PJBB 5ANME 2ZOLB 3Q3GA 2GYSA 3S4SA 3CLFL 2XOTA 3HUJF 4QT5A 2X2YA 4JDTH 3VXRB 4GBXA 5KSVA 4OLZL 1YEHL 5GS1C 4YO0A 3O6MH 1RIHH 3UXFA 5DMIL 1EJOL 3BDXA 4FNLL 4F58H 4Q6YA 5EA0H 3OBAA 3RWEA 3TA3A 3EFDL 2EC8A 3VGHA 3EOBB 4QF1A 1KLGA 1LK3H 1QFWM 4PJ8C 4PJXF 1T03H 3TVMB 3SBWC 4H1LG 4I18B 4NN5B 4RA3A 1XIWB 5IFHH 4Z8FH 3OKKB 1YNKL 1IGFH 4OD2A 3S3SA 1WC7A 4JFYB 1X6NA 4D0DB 5AG8A 1OTSC 4WY7H 4LL9A 2DJUA 1IL1B 4MXQD 3D2UD 5B38G 3WNNA 1P84J 2FL5B 5DZNA 4PBVC 5DJZA 4J4PC 1A6ZA 1DUYA 1PYWB 2BCKA 5EZJA 1A6VL 1WBXA 4P9HH 3FFCA 5LXGH 1BVLB 4MD4B 1CZ8H 4P46C 4IRSD 1Q0YH 1PY9A 3OKEA 2NPLX 3I50H 4JO3L 4HC1A 1EEUA 4FQ2H 3CZFB 4U6HA 4JQVC 3C6SA 2DWDB 4JO4L 2NY0D 3T0AA 1EDQA 3TBYA 5A2KH 1H15B 8FABB 5CS7A 3ROOB 2CRMA 2YXFA 4WO4A 5SWZB 3FOLA 1F8TH 3S37X 3ARDD 2HRLA 5CINH 3KLSA 3DI2B 4KHTL 4GAGH 4OB5L 4OTXL 3ULUD 4KK5D 5D7IE 1FQ9C 5A2IH 1QACA 1MCWW 5D7JB 3MFFA 4I5BB 3P0VH 1XF4A 3W81A 1GIGH 4WUKL 4I0PC 1V7NL 2DI8A 5ICYB 3BEVA 1MCWM 4UV4L 5AUMA 1CR9H 3JTSA 3W11D 3GHEL 1ZS8A 5EPMB 1M4KA 4QTHA 3VWKD 3AROA 5IQ7H 4PS4H 3IYLW 3BDBA 1KULA 2QKIA 4PFEA 5LAXB 4GAFB 5D7SL 4S1DC 1YPZE 3DIFB 4JN2B 3WFDL 3MCLL 3MACH 4MD5B 1KPUA 3FQTB 1RIUL 4NYLA 1Z0NA 1L7TH 4NC2B 3KNBB 2AGJH 2ZSWA 3B5GA 4HCRL 1NH6A 5ID1A 5GGRB 1F4YL 1KV3A 1U8LB 3DLQR 4HGKC 2YD4A 4DK6A 5DRXA 3BZFA 1I1AC 5D1QA 5HDBE 4E41A 3C5JB 3ULSB 3CC5B 2BHYA 1E4WL 2UV3A 1CDCA 1FO0H 4W6YB 5FA3A 3LH2H 5DUBA 5F3HA 3K46A 3ZSSA 4TULH 3IDMB 1K4CA 4FFYL 5HPMA 4IDJH 1EGJL 1FNGB 3FO1B 3GI9H 3MREB 3RVWD 2IFGA 3RU8H 2YOCA 4P2RE 2OYPA 1S9KC 1LE9A 3RL1B 1CFQB 3QXDB 4ZNEA 4LCWE 3DROB 4G7YL 1T04A 3CX5K 4RGND 4Y2DB 3GO1H 1VACB 3W0WD 4KK8D 2E6PA 3FTGA 5JW3L 1HYSD 1N6QL 1H8OA 1B88A 4OFVA 3GHBH 3U4BL 5C92A 2Z92A 4PJ8B 3OG6B 3JV6A 4NWTL 5IB2A 1IGYB 5C0JA 1G9MH 4X5XB 5TGBA 1N2RA 5KS9A 5E2VL 4EDWL 3RAJL 3NCMA 3S6CA 3QDGE 1EUUA 3WIIL 1RHHB 4HIIA 4J3WA 1RZGA 3WO4C 3IDYC 4UNVA 4WUUE 4KVNH 4R7DB 1P7QB 4PRNA 1FZMA 1LNUA 4X9IA 2ZUTA 4P3DA 4QHUA 1BF2A 3ULVD 4P46B 4WU7A 3HRZB 4MWFB 4W68A 3GJFH 4JDTL 2A9NL 3K1KC 3TESA 4V1DA