4X80L

Crystal structure of murine 7b4 fab monoclonal antibody against adamts5
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPASLSASVGETVTITCRTSENIYSYLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYSCQHKYGTPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IgG1 7B4 FAB Light Chain
publication title Translational development of an ADAMTS-5 antibody for osteoarthritis disease modification.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x80L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x80L01
1R3JB 1ZLUH 2DQJH 4HUVB 4DUXA 1DBAL 3O9WD 4AQOA 2BERA 4HFUH 5ICZA 1G6VK 5I6XC 4WFHD 1XGTB 3TCXA 3HTLX 1KEML 4S1RH 2VWEE 4HPYH 5FYLD 4PGDB 1JWMA 4DGIL 4NZUH 1GC1L 3HA0A 2HYMA 4HQQH 3ARDC 1RFDH 2VWEC 5DYOA 2GUOA 3HNTL 5C0FB 4CMHC 3SGJA 3O6FA 2B7DT 1BFSA 3IYLW 4F8QA 1FYHB 2YD2A 1FNSH 4NKOA 3D39E 4D0CA 4EDXB 4YHZH 3VXQA 1MWAA 4HH8A 3ILPA 4HWBL 5HHOA 1YNKL 4R7DB 4NKDB 4OQTL 4PJEB 3RL2A 3O3AB 3UYOD 1H3GA 4YIQA 4ZOEA 1JBJA 4PRPE 2R4SH 5ACLA 4PJDB 4LF3A 3CJJA 1T80A 4P4RA 9CGTA 5E2JA 4JQIL 3SGDI 1D5IL 3BQUC 5HHPB 4QRTB 3P77A 3HE6D 3UPCA 1MRCH 3OPZL 2ZNWA 1CZ8L 4I18C 1MRFH 1JGUH 3S35H 1XF4A 3BPOC 3QISA 3P0VH 4MXVE 1AO7B 1RMFH 1TJHL 4HK0B 4JFFA 5ERWB 5C0BA 1FYTB 4QRQA 4HFWB 1RJZA 3QO0B 4XNZC 2VDPL 1E4JA 2XWBB 1K4CA 2VISB 3GJFK 4WCYH 3G6DH 5DT1L 1ND0A 2A1WH 5IMKA 1YEIH 5ICYA 4P4KA 5J8OA 3VWKA 1J0ZA 5C0AE 1N4XL 3RKDD 4JM2F 3FTGB 4F7CB 1UZ8B 5D2NA 5C3LD 1GAFL 4CW1B 4MA7H 4IEFB 8FABB 2KUTA 2WANA 3BRGC 2QSTA 2FJGB 1Y0LB 4MDJB 5ISZD 3L3KA 2E7LC 4OZGA 2W9EH 4NGHL 1FPTL 3MV7D 1CE6B 4F7EA 5DJ0A 4P5TB 2MKWA 5B38B 1A6TA 2OZ4L 1X5XA 4OCXL 4KJYB 2Y5EA 3RX7A 2KBGA 1EERB 3F7PC 3PL6A 5DUBA 4WO4C 5JIIA 3IJHA 5IK3B 1NAKH 3EOTL 4GBXA 2W07A 4OGAC 3DVGA 1DZBA 1FE8H 2DQEL 2FHCA 1QQDA 2VE6A 5KSBE 4XVJL 5C0JB 1JPTL 4R4FL 4U1HB 4PJHA 5L8LB 5CJXC 4JFPA 1MJ8H 1RZ8B 1JZ6A 2BVPA 1EDQA 1DANU 2BNRB 5C08E 5DD1H 2VABB 5EBMB 2FX9L 4DVBA 4TTDC 5FO7A 4K3GA 4J4PA 5EO1A 5K9JL 1I1AC 3TT1H 4NJ9H 3MBXH 1TZHB 2DWDA 1U8KB 2AEIT 2FWOA 2DQJL 1FCGA 5TDPA 4G6KH 1AD0A 1VA9A 1XAUA 5ALCL 3UTSE 5ETUA 3F65A 4EI5A 5FGCE 4EUPB 4IDJL 4JFEB 2YPLB 1LO0H 4Y4KD 4QCIA 3EOAB 2ZP0T 3QWRD 1MHHA 2JIXA 2ZUQC 4HQQL 3WO3B 1IM9A 1GCFA 2MQ3A 1RUKH 1RFDL 3MRPB 4JVUA 4OD2B 5I66A 4R97B 1B4JH 1N6VA 2WLYA 4XH2A 3L3JB 4FQQA 3MJ8A 2E6QA 4X6DF 5DRWA 2GJ6D 1RIHH 4BQBA 4FQCH 1CGTA 4GKZA 2Z31C 4Q9RL 2Q20A 4OSUH 3L3IB 3CZFB 1Q0XL 3MCKB 1MCDA 5D2LB 3RGVB 2OR8A 4NO3A 5DGQA 2FATH 4KKBC 3ULVH 4AG4H 1S8DA 3TN0A 5JIKA 4YDVA 3BD3A 3WJLC 5KSUB 2R4SL 4H88L 1U9KA 5I30H 2X70B 5IVNA 4F80A 1JN6A 2XY1A 1IL1A 2DQCH 3EBAA 5KG9B 5I1CH 4QRPA 4KUZL 3I2CH 1MRCL 2OR9H 4TSAH 3MLSH 1XZ0A 1JGUL 4KKLD 5C1MB 3ARFA 3BP7A 5HYJD 4CL7A 1UWXH 2F5AL 4LPTA 1JTTA 2BNQA 1KIRA 5L2KD 4E9LA 1S9WB 1DTUA 3TBSA 4CMHB 3G5YA 3GO1H 3CAFA 4Z7VB 2XG5A 2AJ3B 4CVXB 3B6SB 2ZPKH 2P8PB 3UBXG 4RAVA 3G6DL 4P2YA 1CDUA 3UTZA 3VGGA 4GXUN 4LPVA 2A1WL 5TF0A 1W8NA 2FSEA 2WBJD 4MD5B 4OLEA 4QXWA 1S9YA 4YNYA 5LCVH 1U3HB 5ANMB 2HJLA 1BJMA 1U8OA 2ZNXA 3D39B 1XGPB 1QSED 4MA7L 1J10A 5EN2B 2LTQB 2D9QB 1ZLWK 2VDOH 5E6YA 4Q58C 4ZUSB 3PQYA 4K7PX 3RGHA 3SCMA 4LL9A 1N6UA 4ZAKB 5BRZE 2Z8RA 5JNYA 2PO6C 1CICC 4P5MB 5F7NC 4PRPB 4PTUA 4JAMA 3BQUB 3VD5A 1LD9A 2W9EL 4LLYA 4QHLA 3O9WA 1AP2B 3SE4A 4JM4H 1R3HB 2CGRH 2D0HA 2FD6L 3BVNB 3V8CA 4WUUD 5GS3A 1KXQE 1VPOL 4BQ8A 3HI5H 3TBYB 2DB8A 4V1DD 3DMMC 4CN6A 4G7VL 2NXZD 2P5EB 1CDYA 1NEZG 4HV8B 1A6UH 4I0CC 1SMOA 3SO5A 3EFDH 3CFKA 5EBLB 3RY4A 4NQDB 1BMGA 5IVOA 2VDKH 3H9ZA 3QZWA 4X0KB 4LIQH 1T1XA 1MIEH 3WNOA 3OL2A 5CINH 1TENA 2H32B 1U91A 1NBVL 1JNJA 1T1ZB 4N0CC 1SJEB 3LPWA 1A14H 1QSFE 4KJPC 4ZFOB 5EU6D 5DD1L 4JO3H 3T3ME 4OZ4A 4D8PB 3LRSA 4CUCA 1KCSH 3CFCH 5K9QI 4LPYA 4QY8A 1KFAL 1RZ7H 2C1PA 2NXYD 4MSWA 1V3KA 2DL2A 1JJUA 4IRSD 2ZKHH 4IIQC 4NJ9L 4OAWB 5I1DA 3HE6A 4G6KL 1HKLH 4WU7A 3MOAH 3AREB 3QFJB 5GSRA 1PEWA 1MJ7H 3L3HA 5FUOH 1LO0L 2EO1A 4G9DB 3VFUA 1I1FB 1J8HE 3UO1L 4Q6IC 4WFFE 3JV4A 1RUKL 1Q94A 3VXTA 5KANI 1C5DA 1EX0A 1AR1D 2JELH 4BK4A 4Z8FH 4MZ3A 1UB5B 3UTOA 4FQCL 4ZXBB 4PP1D 4H1LA 2DJSA 2XPGA 3REVB 3VXOA 4AQ1B 1H3XA 3BP5A 5EPMB 1KNOA 1FO0B 1XGRA 2DBLH 4DEPC 2C7UB 2E8YA 3SGEH 2NQCA 5D93B 3HKFA 4F9PA 2EDHA 3O3EB 3ULVL 4TSBH 4AG4L 4LCUB 3VA2C 3ULUD 1IAKB 2RCSL 5ISZA 4ZFFA 2EDJA 1I1AB 1XEDA 1TVHA 4JJ5A 3D5OF 2CRMA 1ZA3B 3RKPA 3MV7A 2DQCL 4H1LG 4PV9B 1Q9WA 3I2CL 2OR9L 4TSAL 3DETD 3RWGA 2E3VA 3V7AE 4YFLF 3HCVA 1RU9H 4IBLT 5C8JB 2QHLA 1KT2A 3QB7C 4LU5H 1KGCD 5TFSH 1K8DA 1M05B 3GO1L 3KLHD 1U92B 5CJOL 2ZPKL 2M26A 4WV1C 3MREA 4GAJH 3BGFC 4R0LC 2Z31B 1J0YA 2R2EB 2HFEB 3DROB 4U3CA 3K4ZA 2I60H 1KEGH 5LCVL 3EDFA 5GZOC 4LOUD 3OR6B 4RMSA 5E6IB 1S7VA 3V5KB 1ZGLM 3W81A 1RUPH 4OZFA 1NMCC 1CLOL 5DC0A 3L3OB 5A40E 1AFVH 1Z9SA 4F3FA 3TH2T 3EOBB 1R3IL 3C6SB 4NFDA 2CSPA 4Y1AB 1OW0C 4Y8AA 5CP3A 1JNNH 1R3LB 3L95B 3LEVH 3WFHA 1KXTB 1M7DB 3RJDA 4J3UA 3R1GH 1OAYH 2UWEE 3O11B 4JM4L 3TC9A 5D7IE 4Y4KA 2HVKB 1NCNA 3I6KA 4NQVB 3HI5L 5AWNL 1P4LA 3A6BH 4Q9BA 4DAGL 2AGJH 2VZSA 1OP9A 1S7WA 4KZEH 1YY9C 1A6UL 4JJHA 1NBZA 1HI6A 4IHOA 2BOCA 1NGZB 2GJ6A 3WLBA 3EFDL 5CAYB 2BXYA 4LMQI 5KOMC 1QOKA 4PG2A 3FQNB 3HPLB 3RDTD 5KN5A 4LIQL 5E24E 1MIEL 4GW5A 2P24B 4KK5D 3PDOB 5CINL 3CFEB 2EXWC 2VDRL 5DA0B 4FQ1H 4U1SA 3VMPA 5ESQA 4BH7A 5EZOH 2B5IC 4B5EA 2VZUA 2PO6B 1KCSL 3QWOB 4NUGH 4OF5A 5JQ6H 1F42A 3I84A 4X6FB 1RZ7L 5DQ9A 5T1MA 1NDGA 2VLLB 2DIBA 2I9TA 5GRVL 2IMNA 3NABH 1NKRA 5HGDA 5E8EA 2VLMD 1IAIH 2KQMA 2BOBB 1P7KB 1QRNB 4AL8H 2X1WL 3MOAL 4K7PL 3I85A 4D9QE 3KLAB 3N1QC 5HYJA 1ZA6B 5FUOL 3WUWG 3KXFD 2R29H 4NQXA 3SE3C 3IKCB 2V2WA 4MCZB 5L2KA 1H8NA 3ARZA 3ULVE 2GT9A 2A77L 4HD9A 4OD1L 1WF5A 3KYMB 4WENB 3LKRB 5HY9B 5JHLH 3ISWA 3ULVC 1U8IA 4ZS7L 3HPJA 4HH9B 1GZPB 3MBEB 4L8SB 5GJTL 5T1KD 4Z8FL 5DK0A 2WBJA 5FM4A 3X13B 1XGUB 5DRXA 3MX0A 1NCCL 4Z7NE 5E00B 1QSEA 2IPKB 4HK3N 5IVXE 3LEXB 3X11B 4AENA 2BVQB 4G8GE 4OZHE 3GKWH 3TBWA 3OKOA 4TSBL 2PYED 5IBUB 3LD8C 4PV8B 2Z8SA 3UTTE 3V4UL 1KTLB 4IIQB 2WBWB 3G6AA 2X7LB 3GRWH 5ACZB 4L4JA 2Q7NA 4GRWB 2YUZA 4WUUA 1I9JH 4YR6A 5D6CA 1F11B 3M8OL 3MROA 1B0WA 4V1DA 3VXPB 4ERSL 5JXAL 5IKCA 4MB4A 2IEPA 3ALPA 1IMHC 1RU9L 1S9XA 3GMPB 3S37L 3AC0A 4PFEA 1BIIA 4LU5L 5TFSL 2E9IA 2R0ZH 4PJAE 3TBTA 4MQXC 4KJWD 4NQCE 1ZHNB 5IOPB 4S1QH 4GAJL 3WHXB 5ID0B 1ZGLB 3DECA 3MJ9H 1Q9KA 3DRQA 3RVWC 2OMBA 5J3HD 3MRKA 1KEGL 3S8WA 3RZCD 4DEPB 1F8TH 1FZKB 3HUJE 1GRWA 4J3VA 4Z7WA 4F7PB 4YZFF 3VI4F 3DUSA 3RWEA 1RUPL 5EU6A 1E4WH 1EIBA 1MQKH 3LSOA 4FQHB 4LHJB 3ZE2E 4MX7A 2A73A 3VD9A 4IRSA 4XVUD 2EE3A 2J8UE 5D7SH 1BQHG 1PBYA 1ZHBB 4YHNA 1FZOA 5M95B 3R1GL 1OAYL 2QQKL 3U79A 1JPGA 5FHAH 5BMFL 1FG2A 5LAXB 1BLNA 5FDWB 3A6BL 4L4VD 3I6GB 5DRNB 4Q97A 1A7QH 1F2QA 4KH2A 3MRJA 4Y8DC 4KZEL 4HJGB 3FFCE 5IIEA 1D5XA 5EUKA 2YSSA 4R0LB 5JLZB 2ESVB 4MB5A 1YNTB 3BKCH 4YHPA 1HH9A 2JJWA 2IF7A 1BZ9B 4OZGF 5D1ZC 2NZ9D 1UXWB 4IJ3B 5IFAH 4FQ1L 1UXSB 4JFOB 4TULH 3ORJA 1RZGA 2AV7B 3Q1SH 4GUPB 3PJSA 5EZOL 1JGDB 1H3PH 1NAMA 5I1AB 4UOJA 4ZPTB 4NUGL 1NQBA 5JQ6L 5CUSH 4NC1E 3ABZA 1JV5B 2ZUYA 5D7JC 2JJTA 4Q9QL 3NABL 4X9FA 2XRAH 3PV7A 1H8OA 1I8MB 1S7UA 3JSSA 4NC1C 1IAIL 4NO5A 4U1KB 3S34H 4AL8L 5D7LA 3B9VA 3VRJB 1G7IB 5FCUH 2BVTA 3EFFA 2LVCA 2R29L 1VKXB 2XXCB 5EC2B 1FVCA 4WFEE 3NTCH 3QIWC 4E42A 1CXEA 1ZEAH 2HN7B 4HIHA 4HLJA 4JFDB 4AT6B 3DHMA 1QD0A 1INQA 2FZ3A 5L88H 5E95B 4LCWE 3NFPB 1XF2A 4ZUWA 1CCZA 4I2XE 2VKWA 3IDNA 1LE5B 3BP6A 3AS1A 4ZS6C 4QHNA 5T33L 1CFNB 1AO7D 2Z92B 4LEXH 3F58H 1ZK9A 5FYJH 5MEOB 2DMKA 1FYTD 1ZLUK 3GKWL 2P44B 2X4TA 3PGFH 3CC5A 2HVJB 1CTNA 1IC5H 5GIRB 3FT4A 2R0WH 2G5BB 1WBYA 5F21B 2DJUA 5J6HA 1HHKB 1JNHA 3KNBA 1UG9A 3F7YB 2VDNH 2XV6B 1WFTA 1KLFA 3GRWL 2ICEA 4ZFZA 1KENH 4L8DB 4JZJC 3QDHA 5KVEH 1I9JL 1HYSD 3QCVL 1E4XI 1JK8B 2CLZB 3WEXB 3QDMB 4PJ9B 5I0ZA 2B1AL 3U4BL 3SDDC 5DGRA 2XWJA 1JUFA 2R0ZL 5DMGC 1G9NH 2X4PB 5F9OH 4KAQH 4PUBL 2BJMH 1Q9OA 5EBGA 3RDTA 4PJ7A 2E9BA 5FYKE 4P5TD 4JO4H 1WITA 4Z95H 3LN5A 1RIUH 3SJVE 1F8TL 2CIKA 1EMTH 4R3SB 1BVKB 1U8HB 2YPVH 5D1QB 4JHWH 3CVHB 2P5WE 3R0MA 1MQKL 5BZWA 4IOSD 5IQ7H 1G9MH 1IQWH 4OZHB 5CEYB 4PRDA 1MCNA 2YA1A 3O41B 4WU5A 4B7IA 1G6RB 5D7SL 2VDLL 4I0PC 3UDWC 3FOLB 3HG1E 4NZTH 1JMZA 4TN9A 5J13C 3KXFA 5FHAL 4HWNA 3ARGD 5J6GA 5C0NC 2BNRD 4CAGA 1QPXA 2ERJC 3KYKL 1BD2D 2CUMA 4S2SB 3BUYA 5CHNB 3BN9D 3QCTH 4A6YH 1E4KA 4XT1C 5T1KA 3A67L 4JDTL 1K2DA 2UUDH 3PE9A 4S10A 3SDAD 3GB7A 1T7VA 4HG4J 5ICXA 3RIFK 2WUBH 2VAJA 5T3ZD 5DC9B 5FM5O 2FIKA 2PNDA 2N4IA 4JFYA 1R3KB 3GMOB 5F3HB 5SWQA 2YPLD 4PGCA 1YJDH 1XH3A 1T0PB 5E1AB 2XQBL 4TULL 1J18A 4JLRA 2PYEA 4N0RA 3GDBA 3W82A 4OT1H 3MPCA 5CUSL 1CGWA 3BMWA 3QIUB 1TQBC 5C2UB 1OLZA 4HJ0C 4NM8H 2XRAL 2R0KH 4ONHA 4KV5E 4XCCL 2WIIB 3S34L 3AMLA 4DZBA 4P2CG 4LEOA 3FL7A 3RGVD 3FONB 1MCOL 5TDNA 1NANH 5HI3D 1OAUH 3OGCB 3VGHA 2P43B 1NUNB 2EYSA 3K8MA 3QI9B 3FT2B 1JZ5A 3BP4B 1RZFH 3L3GB 3O2DH 4OFIA 1W72H 4GRMA 1JF5A 1YDPB 1FFNB 1E0OB 2A9NL 2IBBA 5D1ZB 1ADQL 4O2EB 2WWKT 3GHBL 4LEXL 3F58L 3AROA 4QXUL 3RWHA 4JZOB 4Q2ZA 3B3IA 5HPMA 5D7JB 2R0WL 1INDL 1A0QH 32C2B 3WN5A 1J0IA 1J7VR 1GZQB 3M1BA 3MFFB 5EO9B 1RURH 2GJZB 4MNGE 3QCUH 3EYFA 4NOFA 4CADA 15C8L 2C9AA 3IETA 3VFVA 3D39D 5KVEL 3UPAA 5E94B 2QL1A 4LCIH 5HI4C 1ACYH 5IG7B 3H9SB 3UROR 2Q8BH 4C83A 4ZAKD 1LP9A 1MCPL 4LSQL 5ADPH 1JFQL 3HR5A 4PRPD 3ZSTA 3MV9B 3BQUD 4R90H 1R3JA 4HUVA 5FUZH 2DQGL 8CGTA 1C12B 3LS5L 5F1IB 3UYPA 1XGYL 1XGTA 3WDJA 2EDDA 4L3EB 2VNCA 2JJSC 4JO4L 4LCWB 3IDXL 4PGDA 3N1PC 1TTGA 1EMTL 2ENSA 2YPVL 4JHWL 2BDNL 5CCKL 1CGUA 2P5ED 2IPUK 5HVHC 2QEJA 1EGJH 5IQ7L 4JR9H 1IQWL 3DX8B 2NLJB 4YDIL 2WLZA 4HUMB 1U8PA 3DBXB 1UWXK 4NQDD 3ROLB 5DR5H 4OGYH 5GGTA 5E9DB 1Z9OA 4EDXA 1KYOJ 2CLVA 2V17L 3TNNB 4EZMA 2DRUA 4NZTL 2NY6C 1QBLH 1IGJB 1HHGB 1SY6A 3ESVF 4U3HA 5FO8B 5HYEA 3DSFH 1VFUA 4R26H 4R7DA 1CTOA 4PJEA 3CSGA 3OJMB 3O3AA 2CRZA 2R8SH 1E6JH 1S78C 3GSNB 5FUCE 1BVZA 4PJDA 4U1LB 1QFWM 4LHQB 5KAQG 5FUCC 4QTHB 3GHEL 5HHPA 2N1KA 4QRTA 4JANB 3Q48A 3L3DB 2WAHA 2WUBL 3ARED 3IFLH 3QFJD 1F4XH 3C08H 3CFBA 2RBLA 1AO7A 1QHOA 4HK0A 2R1XB 1FYTA 4HFWA 1LEGA 3QO0A 2VC2H 1SVCP 2XWBA 4P9MH 2QADC 4OT1L 3ZYJA 1F00I 3MRFB 4I0PB 1KG0B 2R69H 2F74B 4ZXBD 4F7CA 4NHUB 1UZ8A 2HA1A 2R0KL 4CW1A 4Y4FC 3ZKMD 5E2WL 3WLWC 4KRLB 4LQ1A 3RY6C 8FABA 2AJXL 2ERJB 1GYAA 5FYJE 4UAOC 4HG4K 2FJGA 1BWMA 1Y0LA 4MDJA 3O4LB 1I1AD 3JV0A 1FBIH 5DJ6B 1MHPH 1CE6A 3W11C 1VEMA 5MERB 3T3PF 3O2DL 4P5TA 1W72L 1XR9B 5B38A 1RAMA 4TSCH 4UDUB 2Q86B 3TIDB 5E2TL 3PHQB 4KJYA 5DVLA 1NFDE 2HKHH 4OLXH 5EU3B 3SE9H 1YEJH 3EOYG 5ENWB 5IK3A 4Z0XB 1A0QL 2Z31D 5I18H 2AK4E 1MELA 5C0JA 3UJIH 1G9NC 2QBWA 1UKQA 1OF2B 4U1HA 3H7BB 5B38G 3RQ3A 4YAQB 4EQ3A 1RZ8A 1EJ6A 3IU4H 3ARGA 3WL9B 3P11L 5E6ID 1S3KL 2BNRA 2VABA 5HYQB 3OX8A 3V4VL 4LCIL 1I7ZB 1ACYL 1BD2A 3GM8A 3JXAA 2HJFA 3VXSE 5CD5C 3CLEL 4Y1AD 4R2GC 1TZHA 3SDAA 5TE6H 2ZCLL 1U8KA 3GM0A 1G9MC 1BOGB 1S5HA 5FUZL 1A1MB 3NVQA 2L7JA 2F8OA 1HQRA 3MGOB 4UNTA 1JHLH 2YPLA 1CL7H 3EOAA 4JQXA 5HD8D 3PV6B 4OD2A 4G43B 3MRPA 4S1SH 4DN4H 1RZKH 3L3JA 1TQCC 3DARA 3QXWA 2I26N 3L3IA 4X7SH 4N5EC 4OGYL 4DCQB 3CZFA 3MCKA 1IC7L 5D2LA 1PX3A 3RGVA 1QBLL 3CMOH 3T0WA 4QLRA 2DLEA 3DSFL 1REIA 4R26L 2ZUXA 2JJVA 4URTB 3VXRE 2R8SL 5GS2H 5KSUA 2PO6D 1YJDC 2GTWB 2IANE 2XTJE 4MAYC 4M8QB 4Z7WF 2X70A 3BO8B 5BRZD 4P9HH 2BNUB 2BSSB 4M03A 5KG9A 2XTJC 1QRND 5DURB 3IFLL 1TZGL 2EDTA 4MLIA 4YQXH 1AKJB 3C08L 4AM0B 4LAJH 2UZYB 1Y18B 3T77B 1JYNA 1S9WA 1JHKL 5HVHB 4HWEH 1KYOK 2VC2L 2AJ3A 4CVXA 3B6SA 1T7XA 2IWGA 4M7ZC 2P8PA 1N26A 3TT3H 1G1YA 1YQVH 5I9QC 3MBED 4MD5A 3U7WH 1ZAGA 5ANMA 4KFZC 4N0CD 3D39A 3RWDB 1A7NH 4QO1A 1V3MA 2QV2A 3ARVA 2X4RB 3O2VH 5DFVD 3VFWB 3FQUA 4N0FB 1PFCA 4ZAKA 2BZDA 4P5MA 4WGWB 2EIBA 4ENEC 4PRPA 5IF0B 3OB8A 2HTKC 3BQUA 1JPST 3I9GL 2HTLD 4NO2B 3ULUF 1AP2A 1MHPL 1R3HA 1KLUA 4J6RL 2UV3A 3MLXL 5T3XH 3DGCR 1PVHA 3BVNA 2M1KA 3D25B 2OK0H 3LQAL 4JPIA 4JM2C 1M1SA 4TSCL 3TBYA 4PGJA 5B3JE 2HKHL 4NUJB 2P5EA 4K3EH 4HV8A 4F57H 5CKAA 5DD3H 3BPLB 1YEJL 3BKJL 1UCBH 3BWAB 5I73B 4Y4HB 1NGPH 5B4MC 5EBLA 5D1XC 4NQDA 6FABH 4P99A 4K3HA 5F97E 4L3AA 3LVEA 1Z0NA 3DX9B 4X0KA 3NBNA 2VXSH 1T1WB 3GSWB 4G8EB 3UJIL 3P4NB 2H32A 2YD3A 3C8DA 1T1ZA 4G6JH 1SJEA 5JORB 2EC8A 3IU4L 3PF2A 4XXCC 1I1YB 1TXKA 5EZLB 4MHHI 4D8PA 5E8OB 4RSVA 1MLCB 2E7LA 1P7QB 2GQHA 1AHWB 4OAWA 1AXTL 5TE6L 2R9HC 4EVNB 3AREA 3QFJA 5E7BA 2W9DL 2G60L 4Q0XH 1OB1B 4G9DA 1CL7L 3U6RB 2K9UA 1I1FA 5IMMB 2HKFL 5CZKA 5CEZH 4PRIB 1UZ6F 3CK0L 1CF8L 3EKCA 1MFAL 1NGXB 4HCRH 1JTPA 2DIAA 3KPLB 2ZSWB 1UB5A 4PJ8B 2ESVD 4RA0C 4ZXBA 1VACB 4N68A 5MEPB 4P2RE 4X7SL 3HAEB 5CJXA 2Q3ZA 5E8DH 2AK4B 2FDBP 1RK0B 1FO0A 1XMWA 1WFNA 3CMOL 3EHBD 2C7UA 3GI9H 5LGHH 3VMNA 4PJ7F 1FNAA 4X8JB 1L4IA 3QH3B 2A74B 4C55A 3O3EA 5IB5B 5H8DA 4LCUA 1OTSC 5DJDB 1IAKA 3LEYH 4XPAL 1HH6B 1I1AA 4EXPX 4R2GB 5HDQH 5IB1B 5BV7L 1MIMH 2WIMA 1ZA3A 3MUJA 5FKPB 4P9HL 1B6UA 3VCLB 4XX1E 1G7HA 2W0PA 3GMNA 3QDGE 2DLFL 4YQXL 2XZAL 2AJYH 12E8H 2AQ2A 5FDYA 5C09B 1JYVA 5C8JA 3I02B 2JK5B 4BSJA 2X1OA 1HHJB 5HGGS 1YY9D 1M05A 4OCRH 3QUXB 4HWEL 1TQCB 3L5WB 4BSWB 1U92A 3QPXH 2EYTB 4FTVE 1YQVL 4LHUB 2Z31A 1RSFA 3SO3B 4MD0B 2EYRB 3VU2A 5IB4B 3DROA 1CD0A 2W38A 5EUOB 3U7WL 3C2AL 2EXWD 3BKYL 3OR6A 5E6IA 3V5KA 2Y6SC 4HHAB 3O2VL 3QWQB 3GMLB 1CBVH 2DWEB 3EOBA 3JWOH 3C6SA 2IGFH 4Y1AA 3QNZA 5KTEL 1R3LA 2C26A 3L95A 2IANB 1M7DA 2FGZA 3X12B 5IHUL 5DRZB 3ZE1E 3O11A 1CN4A 1KCRH 1T3FA 4FXGB 3UJTL 2OK0L 3V52L 2W60B 4NQVA 2H3NB 1UADC 4Z0BL 4D9QD 3QDMD 4PJ9D 2DIJA 1MWAH 1FNFA 5T5FH 2V7NB 4M7ZB 4F57L 1AGBB 3QAZC 1T5WB 4AH2B 1NGZA 2I27N 3X3GH 1NGPL 4U1MB 5C2BH 1F4YH 4XCYB 3QUZB 3HPLA 2YWZA 1H3UA 3ARXA 1YMMB 1A5FH 5AZ2H 2CDGB 3VD3A 6FABL 5ITBH 5JOEA 2VXSL 2ZOKB 2P24A 3CFEA 2QSVA 4ALAH 4X83A 1ORSA 2XFXB 3THMH 1CFSB 1MNUH 2F54E 4K3JH 2NY3C 2PO6A 3KYNB 3KR3L 5I71B 3QWOA 4X6FA 1QO3B 3QDJE 5IWLA 3OG6B 2VLLA 3DURA 5BRZA 2Z91B 1I8KB 3UTTD 5F7DB 3LH2L 1RZKC 1P7KA 1QRNA 3ZO0A 4M6OH 4KDWA 2GSIB 5E8NB 2XZQH 3KLAA 3S4SG 5MP6L 4PY7B 5HDBE 3IKCA 4MCZA 4XMPH 5CJBA 5MI0C 1BFVH 1AGDB 5LGKA 4KDTC 4NZJA 4G9FE 4HUWA 3G9AB 1BBDH 4FQ2H 3KYMA 3LKRA 5HY9A 3ZTJG 1OSPH 2ED7A 4MQXD 1EZVY 3RUGB 3BH8B 4HCRL 4HH9A 4U1JB 5D1XB 1GZPA 3MBEA 4L8SA 3SHSA 2OTWB 4MZ2A 3OSKA 4JKWA 3X13A 5F7LB 1V3LA 1XGUA 1N6QH 1LP9F 3IDYC 5E8DL 5E00A 2IPKA 5JHDE 3LEXA 5KSVB 3X11A 5GRZA 4YHMH 2BVQA 4JRWA 5GISH 1JRHI 2VLJB 4U6TA 5EFIA 1U8LB 1OAZH 3E0GA 1KIUA 3LEYL 4DKEH 4PV8A 3RA7H 1KTLA 4IIQA 5HDQL 1A6WH 5C0IB 3C8KB 1MIML 1BHGA 3LQMA 3QIUD 4A2MA 1EAJA 1FGVL 3W2DL 3D18B 3O3UN 2X7LA 4NO0B 4PJCE 1MCJA 5ACZA 1ZXQA 4WI6A 5AZEH 4LVNB 4CMMB 3RPIB 4PBXA 1A2YA 1F11A 3VXPA 5DK3A 1PKQE 1Q0YH 12E8L 1HN1A 2AJYL 4P2OB 3GMPA 5CGTA 4C4KT 5J1AB 1OD7A 5IBUG 2FX7H 3T0EB 1VFAB 3FHAA 5E4IA 3B9EA 3NH7H 1AGEB 4PJEF 1AE6H 1ZHNA 1L9NA 5B8CB 3QI9D 3WHXA 2JKXA 4BFEA 4LARH 1ZGLA 4PJDF 3PP4H 2ED9A 2V5YA 4N1CA 5T3XE 5DD6B 3NFNA 1GPOH 2CDFB 2FBJH 3HZMB 1HQ4A 5D1ZD 1FZKA 2A38A 4X7DC 4F7PA 1DANT 5GHWH 4LP5A 4UT7L 4RMRA 3V5HB 2UUDK 4FQHA 1CBVL 4PGZA 3G9VA 3WJJC 5FYJU 3RWCA 5D7JD 5L8JB 1L7TH 2G75B 1ZHBA 1QBMH 2H6PB 1HIMH 4XMLH 2E27H 1DCLA 1ERNA 1HEZB 3IDGB 1KCKA 2ZUUA 1KCRL 1QLEH 3VGBA 5LAXA 3Q0HA 4XCEB 5FDWA 3GBNL 3LAFA 3I6GA 3V95A 4HUUB 4N0UB 3KPRB 4H26B 3QR2A 4HJGA 1WEJL 5J12B 4HZAA 3UZVB 1N5YH 5T5FL 2C3VB 2HT2D 4KRPB 1WZ1H 4R0LA 5JLZA 3MV9D 2BSRB 2ESVA 4N8VB 4BZ2H 3U36B 1YNTA 5C2BL 5LJYH 1RIVH 4BH8B 1OP3H 5ITBL 1AR2A 1BZ9A 1ZANH 4L3ED 4ALAL 4MMXC 1UXWA 4ZS6D 1UXSA 4LCWD 2MOVA 3IGAB 4JFOA 3V7AG 2AV7A 4GUPA 4FFYH 5CEZE 3OG4B 4K3JL 4TOYH 2B2XL 1JGDA 5F9JB 5I1AA 2KL6A 3ES6B 2R2CA 1HOCB 1JV5A 1Q72L 3U30B 1T83A 3CFDA 4FFWC 5D71H 5EIVA 1I8MA 4D3CH 5J0BA 5E9DD 4U1KA 3RVUD 4M6OL 3VRJA 2XZQL 3B2VH 5HGBA 1G7IA 1KOAA 5F1KC 2J2ZA 4PB9L 3EYQD 2Y5TB 2O5YH 1BFVL 1VKXA 4Y16C 5EC2A 1P1ZB 5GRUL 4X6EB 2YK1H 1IGYB 3OB0H 4ZDHB 2HN7A 2JB5L 3VG9B 2RAMA 2HLFC 1VFOA 4AT6A 1DUYB 2I25N 3NFPA 1N6QL 4OKVB 3C6LB 2I5YH 1LE5A 5FYKD 2Z92A 3IDUA 3J7HA 4P3CH 4YHML 5MEOA 5GISL 3SJVD 1ED3B 1OAZL 2YD4A 3QEUB 5GIRA 3WFBH 5I8CA 1WVZA 3IAQA 3MZGB 4XWGL 3W0WB 4DKEL 5KVDH 2G5BA 1CDBA 1A6WL 1ZV5A 1HHKA 4I0PD 3F7YA 4JY5L 2AXJA 5AAMA 2W0FB 3LHPH 3I3EA 4L8DA 5AZEL 1JK8A 3SE3A 2CLZA 3WEXA 5MI0B 3QDMA 4WI9A 4PJ9A 1NMBH 3MCLL 4MA1C 1Q0YL 1WIPA 1GGUA 3VWJC 4N9GB 1PG7X 2GCYB 5MENE 4CGTA 1ZT1B 4NHCH 5D2LF 1Z6JT 5C0RH 2FEEL 2FX7L 3O4LD 2X4PA 3NH7L 3I75B 1AE6L 3JWOC 5K93A 4YXKH 4LARL 4W6XB 1CDJA 2ORBH 5D4QA 3PP4L 2Q7YB 4D9RD 3OF6D 1GSMA 1GPOL 5HSFA 2FBJL 5IB2B 1TNNA 4DK3A 2HFGH 3ARBC 1G7QB 3SGJC 4R3SA 1BVKA 1U8HA 3JTTA 5GHWL 3BPCB 4WI5A 5GS1B 1BQUA 3CVHA 5LWYL 2X41A 4ODBD 4OZHA 3LKNB 1JCKA 4KTYA 5CEYA 1KSRA 3BZEB 3O41A 5D5ME 5ABDE 4HJ0D 4UUJB 2NY1C 3UTTA 2HWZH 1RJLB 5BJTB 1QBML 3P73B 4HIJB 4Z7VF 5DZOA 1T2XA 2E27L 2IPUG 2Y4SA 4PJCB 1S7QB 4YZFE 2YN3A 2ZUTA 1TCMA 4H1LH 4DKFH 4Y5YB 4RGOH 2FLRT 1MEXH 5JIPA 1S7XB 3GEWB 1X5FA 3MJ6A 2ZWLT 4S2SA 2X10A 5CHNA 1FP5A 4PJAA 4LKXB 5GGVY 4MJ2A 4MQ7B 1S7SB 3CFJA 3H9HB 1R3KA 3GMOA 5F3HA 5KS9B 4JHZA 5B21A 1X5KA 1JRHH 5DJ8B 1J8KA 3QJFA 3SKUD 4W68A 4YO0B 5C6TH 2OTUB 5E1AA 5D2NE 3ARYA 3H3PL 4P4KC 4FFYL 3SDYH 3VWKC 4K8RH 4JRYB 3I50L 4TOYL 1KB9J 3GMMB 5D2NC 5F96H 3QIUA 4R7NB 4KHTH 4MXVF 5DD5H 5D71L 2IBZY 4D3CL 5GRYA 4NDMB 2DQUL 4WFGE 4ZTOH 4OZGE 2QJDA 3B2VL 3FONA 5JXEC 4D9LH 3TJEH 5HI4D 2Y1VA 1B0RB 3OGCA 2CK0L 1T22B 2V9RA 5E99L 4OLUL 4OZFH 3X3FL 5HVFB 3MUHL 3FT2A 3QI9A 3BP4A 1I9IH 5J9PB 1A1NB 1TPXC 4XC3L 4P57B 5IM7B 5AEAA 2KH2B 1LGVA 3FHQA 1YDPA 5CP3H 1FFNA 5DURD 1HDMB 2OI9C 5D1ZA 3AU1B 3PL6C 4XPGH 1F58H 2I5YL 1AKJD 2CD0A 1FH5H 1NJ9A 4MD4B 5A2IH 4O2EA 1FZMB 2ADFH 5J06A 4N1HB 4P3CL 1S9VA 4TRPH 3BRFA 4S1DD 3K1KC 4XBPB 4JZOA 5CBAB 5FYLL 2ATPB 3LDBC 5D7JA 3CXHK 5J11B 32C2A 3PHSA 2A6KB 3OKKB 1R5WB 1TTFA 5EO9A 1NKOA 4FXLA 1S7RB 1QFUH 2GJZA 2NY6D 2MCG1 2O61A 1QACA 4XWOC 5JMOC 1YECH 4J4PC 5DEFA 1FQ9C 5IHBA 1F6AB 2F53B 5E94A 1NMBL 3MNWA 5IG7A 4KVCH 3ARRA 3KJ4B 2CKBL 4NHCL 3LY6A 3D6GA 1B2WL 5C0RL 3IDIB 1WBZB 4EI5C 3MV9A 3G6JE 3RVXC 3IDMB 1BBJB 1C12A 3VFGH 2ORBL 3NCJH 4L3EA 4E41B 2UZIH 5IW1B 3CU7A 4EBQH 4LCWA 3O3BB 1ZOXA 3IFPA 4TVPD 1YC7A 5H2BB 4ZNEA 4QHMB 2B1HH 2QQNH 1EEYA 4ZNCD 1T66C 3DX8A 1D5ZB 2NLJA 4Y4HD 3HI6H 1RUAH 3ROLA 2WZPD 5E9DA 3TNNA 2VXTH 2PYFA 1SHMA 3TN0C 1IGJA 5FO8A 1BJ8A 4WWKB 3HC4H 4PR5B 4LVOC 3U4AA 1UM6L 4DKFL 4H8WH 3QT2A 4MA3B 2JLLA 1MEXL 3GSNA 4P59H 3MLZL 2BFVL 2RJMA 4U1LA 1QHPA 4OB5H 5MENB 4WI2A 3IXTA 1P7QD 2BNQE 4QTHA 2VH5H 3ARFC 1N59B 4JANA 3W11D 2UZXB 3L3DA 1OGTB 4BFIB 3FO2B 1PG7L 1NLDH 3ARBB 2A0LD 4OD3H 3UYRH 1W8OA 2NW2B 1RD6A 2R1XA 3O0RL 5C6TL 3SJVA 4PRID 5DK2B 1I7TB 5JR1H 1YUHB 2APTA 1NGQH 3SDYL 1YEKL 3QEQE 1QNZL 5FF6B 2NY7H 5F96L 5EWIH 3MRFA 4I0PA 3PQYE 4KRMB 2X1XR 4PJ8D 4PLKC 1YEFH 2F74A 5DD5L 5D5MB 4NHUA 1FZJB 4Z7UB 3RTQB 3SCMC 2AK4D 4ZTOL 2Y9RT 1FV1B 4YHOH 4D9LL 3MSPA 4WFHE 3TJEL 5F3BB 4LKCB 3RU8H 4N5UA 3O9WC 5CD5D 4HS3B 3SE4C 3O4LA 3IXAB 4R2GD 3PWVA 4KTEH 4L8CB 4BQ9A 5DJ6A 1A9BB 4OCYH 3VXNB 5CIPB 4NCDA 5DUPL 5DQJB 1T7YA 1XR9A 3OF6A 4UDUA 4FFVD 1KB9K 4XPGL 3TIDA 4V2CB 1F58L 3TO2B 4BM7A 3PHQA 5HHXH 5I8OL 1B3JA 1W0WA 5C09D 5EU3A 4NRXB 4JDZB 1A6VH 2AJUL 5JTWA 4TRPL 3MGAA 3QUXD 3OJVC 3V6OE 3EW3B 5ENWA 4E0RB 5CEXB 3PDDA 4LHUD 1NMAL 3V6OC 4HULB 3WIIH 5K59E 1CE1H 1QFUL 1OF2A 5I0DA 4HAFA 3H7BA 3ZKXC 3EDDA 4QHKJ 2ED8A 4YAQA 3NCMA 1JPSL 3V6ZB 2VITB 3RRQA 3WL9A 5GRJH 3QXAB 1CXLA 5DA4A 5HYQA 4ZO9A 1ETZB 1I7ZA 1CVRA 4KVCL 3HE6C 4K71C 5LXGH 3BEWA 2EE6A 4MAYD 3VXRD 4WHTB 5EU5B 1KN4H 1PLGH 3MV8B 5TPWH 3VFOB 1U6AH 5EO0B 3ULUH 2IAND 1NAMH 1BOGA 4M6AA 1A1MA 1ITBB 2AJZB 5B3NA 3MGOA 5DHXB 4WTXA 3DLQR 3L6FB 2UZIL 5F6IC 4OTXH 3TO4B 1QUNA 3IFNH 4K94H 2GFBB 4G43A 3BT2H 1GGCH 1KCVH 2BC4B 1M71A 4HJJH 4OJFH 4FQXB 5IQ9B 3QUZD 2IALB 1RUAL 1R24B 1YMMD 3SN6N 4F9PC 2VXTL 3MJ9A 4LLWB 2FCBA 4MNGA 3HC4L 3MV7E 3HMXA 5H94A 5SWSE 1F6LL 3OKNB 1WTGT 5GGRB 1UJ3C 2GTWA 3GBLA 5T1DH 4M8QA 2PTTB 3DHJA 3QUKB 3DTXB 3A6CH 3BO8A 3BIAX 3CX5J 4PJIB 4KMTL 4K8RC 4U31A 5CSZB 2BNUA 4XPHH 3G6JB 5IESH 4NCC2 1AKJA 1NLDL 1Y18A 3T77A 2GHWB 3NFSH 5HJ3B 4LFHD 4Y5XB 5TH2B 5K9QG 3EYSH 3DV6B 1KB5L 2FIRT 1KXVC 5B4MD 2BMKB 2LQRA 5D1XD 3R0NA 2NY7L 5EWIL 3GSVA 1OL0A 1EHXA 1EO8L 3RWDA 5I1HH 1CFQA 2X4RA 4YBLC 1P4IH 4YHOL 1UWGH 2X4SB 1M7IB 1F02I 4HSQA 1GOGA 3FT3B 4N0FA 2VLJD 4YC2C 3C5ZC 4R9HA 3FQRB 5IF0A 4G7YH 3DVFA 5ESAB 3P3YA 4Y4KC 5CJQH 3BD4A 1CGYA 4NO2A 3S7GA 4OCYL 3MLTB 2IAMB 1FIEA 4R4ND 3D25A 2OP4L 4LLVB 4OBRA 1P6FA 1IC4H 1AQDA 5C9JB 5HHXL 3Q2CA 1WCBB 5IGXL 4P2OD 4NUJA 3RWFB 5EU4B 4OCWH 4PG2C 2G2RB 1FLRH 3T0ED 3BWAA 4Y4HA 3WCYA 4M61B 1MHEB 2ID5A 3DX9A 1ZLVH 4OI9A 3T3PE 1T1WA 4LGRB 3SKJH 1VDGA 3G5XB 3GSWA 4G8EA 4WTZA 1CE1L 3P4NA 4J2XA 3WMSA 4C56E 5JORA 2HJKB 2C1OB 5GS0C 1I1YA 3OR7B 5GRJL 3PHOB 4LCCB 4K23H 3TJHC 4WDIA 5EZLA 3KPMB 1OTSD 2HRLA 4K9EH 5HYJE 5E8OA 5FM8A 1MLCA 2X4NB 2VLKB 5LXGL 3LZFL 3KJ6H 1P7QA 5TPWL 1PLGL 5DJ2A 5L2KE 4KKLC 1U6AL 3C09B 2WQ8A 3ULUL 5MEQA 3EGSB 1NAML 4EVNA 1MCWM 4WTZG 1D6EB 3K8KA 5GZND 5CZXC 3ALXA 1E27A 1B4RA 3SDCC 2BX5A 1OB1A 3U6RA 3LQZB 5IMMA 3ZMRA 1AI1H 1UKSA 4FRWA 3GUTB 4QRRB 4K94L 4PRIA 3BT2L 1JZ3A 1NGXA 4H8WC 1GGCL 3KPLA 4KRPD 5T1LB 1CR9L 2ZSWA 4M6NL 2OJZH 2J88L 4BK5A 2DBJA 1X7QA 4PJ8A 1ZS8B 4YK4C 4OJFL 4Y2DC 5IB3B 5MEPA 1VHPA 5I15H 3HAEA 4HEPG 4Y2OA 2AK4A 2DTSA 3TWCH 4YFDB 2YBRB 1CLYH 3VD4A 1QKZH 4X8JA 3QH3A 4RFEA 5IB5A 4WUUE 5DHVB 1D5BB 5DJDA 4L5FH 4YDJB 1HH6A 4V1DE 1X5AA 3U9UB 5IB1A 1BM3L 4QOKE 4PJXB 4CVUA 1KPVB 3A6CL 3MRLB 3HNSH 4PG9B 5FKPA 2EH8L 1U93B 4Z18A 2APVA 2ICWI 3H3KA 3FO1B 3VCLA 4XPHL 4OZHF 2BHZA 5I74B 3MJGX 4IMKA 5DFTA 5C09A 4XHJC 2JK5A 2Q8AL 3TA3B 1HHJA 3T0VA 3QUXA 3EYSL 1MAKA 4Z7WE 3L5WA 4BSWA 2J5LC 4ZO7A 4AEHH 3S88H 3C60B 4LHUA 4X9BA 4MD0A 2EYRA 5IB4A 4LSSL 5GGQH 2VXUH 4OZIB 5EUOA 2X1QA 3C6LD 4MVBD 5C92A 3G5ZB 3ZE0F 1BEYL 5DMKB 4PJAF 5I1HL 1A1OA 4HHAA 4QKXB 3CX5K 2XKSA 1P4IL 1HNGA 3GMLA 1UWGL 2DWEA 4S11A 3N85L 1IT9L 5SWSB 1OP3K 5HYSG 1U2HA 4DVRL 3W0WD 3MOBH 1HZHH 1RHHB 4G7YL 2DQTH 2IANA 4LHUG 3X12A 5DRZA 3QDJD 4G6AD 2CLRB 3OZ9H 1ORQB 5IJKC 2FR4B 3W9EB 4GLRI 3DRTA 4FXGA 3BGAA 4YE4H 1IEAB 3ZE2F 2H3NA 1IC4L 4JQVC 5F7YC 4UV7L 2H8PB 5GGTH 1MCWW 5CKGA 3W5NA 1A02N 4NNXB 2VR4A 3DO7B 1SY6H 4OCWL 4PP1C 2V7NA 4XP1H 2MWCA 3IF1B 1AGBA 3ZT7A 1T5WA 4AH2A 4G9FD 4YHKH 3FN0H 4OF6A 4U1MA 4P46B 4CVZB 2B0SH 2GAZB 4XCYA 3QUZA 4ZUTB 1YMMA 2IPTH 2CDGA 3NMEA 5SX4H 2V2XB 1EZVX 2ZOKA 3SKJL 2E6JA 4LVHB 4NQEB 3TVMB 1B88A 3JWDL 4YBLB 2XFXA 5F7MC 1SVZA 3EYVB 1CFSA 3OB0K 1KTDB 4K23L 2G9HB 2JJTC 1DN0B 1NSNH 5D7LE 3C5ZB 4L1HA 3KYNA 4OGXH 3UZEA 3ME0A 4OGZA 3NGBB 1QO3A 3KGRA 4K94C 1NL0L 3VFMB 3KJ6L 1FC1A 2Z91A 1I8KA 2ZCHH 1ZMYA 1KGCE 4EN3B 2Y7QA 2DLTA 5F7DA 3T0AA 5CZVH 2GSIA 3DIFB 4I0KA 5E8NA 5TQ0L 2OCFD 4PY7A 3KLHC 1NCAL 2D7PA 4OF0A 1AGDA 4WUKH 1AI1L 4P3WA 4X9GA 5GGUB 2HH0H 1E28B 3D0LB 4U1JA 3HN3A 5D1XA 3FB7A 1AD9B 2ZCKH 2OTWA 2OJZL 2EDKA 1AY1H 2OXGA 5I15L 4M48L 2YUVA 4JPKH 5KSVA 4YHYC 3LIZH 5T3XD 1NUGA 2WWKO 1CLYL 4LFHG 5ELIA 1QKZL 2WV3A 1UZ6E 2VLJA 1EBPA 4I4WB 4TQEL 4L5FL 1INEH 2Y23A 5DWUH 3C8KA 1ZT7B 2R0LH 2ZSVB 3KVQA 1IFHL 3UBXI 3HNSL 3D18A 5KVMC 2EE9A 3T2QA 2HT3D 2HAZA 3RPIA 3SDCB 1X5HA 2AJSH 3U7YH 2AXHA 1UENA 4P2OA 1W0VB 4OFYD 4PPTA 4EXKA 2WWMD 5J1AA 3RDTC 1PAMA 3T0EA 1VFAA 4U33A 1KPUB 1AGEA 4AEHL 3S88L 5B8CA 2WP3O 2DS4A 1NC2B 4GFTB 4YK4B 4Y2DB 4GMSH 3MLRH 1L0YA 2FH8A 3MLVL 5IR1B 4XAWH 4RFOH 4JG0L 1V7NL 3AB0C 5GGQL 1PY4A 2CDFA 3SOBL 5J89A 1I7UA 2VLME 5EC1B 5T3ZH 1X5IA 5I75B 1NC4B 3V5HA 2BHUA 4EUPH 4G5ZL 4KRNA 4NWUH 2R23B 1NCWH 3GK8H 3UPRA 1EJOH 2G75A 3MOBL 4X9IA 4FFWD 2BRRL 2DQTL 2HMID 1BFOA 2Z8VC 4UNVA 3MZTA 3TV3H 2H6PA 5JDJA 3OZ9L 5DD0L 1HEZA 4YE4L 2APXA 2P46B 4LRIA 3MRDA 1SBSH 4JFXB 4QXGL 4XCEA 5FO9B 1E4KC 2F53D 2FB4H 4HUUA 1F4WH 4N0UA 4H26A 2CO7B 2HRPL 3QUMB 1KULA 4XP1L 4ZOCA 3H6JA 3WXVH 2C3VA 1KV3A 4YHKL 3FN0L 2BSRA 4K9EC 3S5LG 3U36A 1GGIL 4BH8A 4YXHH 4TPRL 5IW6B 4L3CB 2JCCE 4OCSH 5IT2L 2VL5B 4WI8A 4XX1G 4E41D 5EOQH 1TCRB 5I8KH 1TJGH 3IGAA 43C9B 4HC1H 1YPZE 1T2JA 5I1IH 1NSNL 5F9JA 1DQLL 1LK2A 4OGXL 3VGAB 3ES6A 1HOCA 5I16B 3B8YA 3RL1B 4ZYKB 3DUHA 3FQTB 4H25B 1PZUB 4U49A 3GNMH 5CZVL 3CVIH 4GW1B 3BPNB 2P4AB 4WWKD 5E6ZA 3VH8A 1BAFH 5TE7H 2Y5TA 1T0MB 2OJEB 4KJWC 4YBQD 2NTSP 3WDHA 1Z3GL 4WUKL 4RGNB 3BI9X 1I8LA 4V2BA 1SM3H 1P1ZA 2VSCA 4BSVB 4EQ2A 1UM5H 5C3TA 4KV5F 5MEND 1IGYA 4PB0L 2XA8H 5H37H 4YHLH 4Y5VC 4RMVA 5I1GL 3VDBA 4OKVA 1MAJA 3C6LA 5JZ7C 4LQFH 4JPKL 2Y36L 3ARBD 4WEMB 2GW5A 4LASH 3VH8G 5HYIA 3LIZL 4JFZH 2NY5L 4XVUC 4I8DA 3UJJH 1F3DH 1P9MC 4YHIB 5ALBH 1ED3A 3QEUA 3W0WA 1INEL 4IRJB 4UMGA 2WUCH 1AQKL 3O8XB 2J3SA 1ULVA 1LP9E 2K7PA 2W0FA 3OHXB 2XZCL 1LDSA 4OFPA 2VQUA 3V5DB 1FRGL 2AJVH 2AJSL 5IMOB 4KDTA 4H0IA 4PLOB 2H32H 4N9GA 2GCYA 1OGAB 1ZT1A 2PW1B 1T2QH 4P5KB 4D0BB 2A83B 2DOCA 1EBAA 4PRNB 4G9FA 1CT8B 1TJIH 4RRPA 5EU7E 3IS1X 1Z9MA 1ZLSH 3N1FC 3I75A 4L1DA 2NZ9C 3T2NH 4HDIB 3AVEA 5JOFB 1IAMA 5EU7C 4XAWL 1WT5A 2Q7YA 2XWTB 4UB0H 4PY8I 5IB2A 1G7QA 5D9SA 3DOSA 4LPXA 5T3ZL 3BPCA 5FK9A 3VA6A 5GS1A 2OSLB 1PYWB 3RPKA 1EVUA 1QFPA 1AH1A 3OJDB 1A7PL 3ECBB 4NWUL 1CGSH 3LKNA 1NCWL 3GK8L 4BFGA 1R5IB 4PJEE 4RRPG 3BZEA 4Q74A 4UUJA 1ZHLB 1RJLA 4PJDE 4HIJA 1JGEA 3TV3L 4WY7L 2P49B 4LBEB 3OKMB 2CDEA 4F9LC 4PJCA 4LLDB 2H2PD 1S7QA 2ZUSA 5JXED 4YGAB 3WFDH 1ES0A 4WFGD 1SBSL 2VZTA 3NA4A 1PDKA 1S7XA 2FB4L 1H0DB 3HRPA 4PJFB 1F4WL 1FO0H 3WD5L 3LN4A 1J5OH 1DBJL 1AO7E 1IARB 1SJVA 4FZEL 3WXVL 3MV8D 1I8IB 1FYTE 1O5DT 4KJQC 5TF1L 3VXME 1C16B 4MQ7A 1S7SA 4X7FC 4O00A 2X4OB 3H9HA 2LU7A 1OSZB 5KS9A 2Q3AA 3Q5OA 4ZO6A 3GFUA 5EOQL 3MO1B 4YO0A 5I8KL 4KTDL 3TO4D 2OTUA 1TJGL 3CUPB 3MUGB 3WJJA 1EFXB 3GMMA 5IP4A 2FX8H 3OGOE 2IADB 1HYSC 4R7NA 1RQ5A 3RHWF 1F3JB 4NKQB 4FQXD 4TNVF 1A4KB 4J3OC 4G3YL 4NDMA 5F1NB 3RI5F 2Z9TA 1CD9B 2YA2A 5DO2C 4M9PA 1OY3B 5TE7L 4OFYA 3F7VB 3VRIA 2W0KA 1B0RA 3QRGH 1MOEA 3OXRB 1T22A 1CIUA 1CFBA 1SM3L 4PJBB 3LV3B 2V5TA 1UM5L 4M6MH 3BGMB 4P5TC 5L7XH 4LGPB 1PEZA 5GGSB 5J9PA 1F6FB 1A1NA 2FBOJ 2XA8L 2ENYA 4YHLL 4P57A 2A6DB 5IM7A 1XF1A 4N1EA 2D7TH 3T2OA 1U3JA 2CPCA 2P8MB 1JWUB 4MYWB 1HDMA 3AU1A 2DQDH 4LQFL 4GAGL 4MD4A 4LASL 2JCCB 1FZMA 1RVFH 4N0YL 3UJJL 1R0AH 4ODVH 5ALBL 5CBAA 5CGYC 3GIZH 2ATPA 2IFFL 1F4AA 1YPZB 4UILL 1V5JA 5L0QB 3TZVB 2WUCL 1JHTB 1R5WA 3OKKA 1FJ1B 4X4YB 3FAWA 1HE7A 4UNUA 5IV2B 5LBSH 1T21B 4JN2B 1SQ2N 3BN9C 3P4OB 1F6AA 2AJVL 2F53A 5T3ZE 1LE9B 3GGWA 2LU3A 2UYLB 4JFEE 2YPLE 1T2QL 3IDIA 4KI1A 3CX2A 1NPUA 3BJLA 1TJIL 1F3RB 4HKZB 4Y5VB 5FA3B 3SPVB 5M94B 1URLA 1OAQH 3T2NL 4WJ5B 3RVVC 3VG0H 2WM0A 3BFOA 3WIHA 3ZTJH 4JQXC 1BBJA 5JO5B 4AZ8A 2IAMD 1NGYB 3HI1B 1T20B 4E41A 5CBEB 1J1PL 5IW1A 4MS8D 4WW1B 4R97C 3O3BA 4KKAD 4M7KH 4ZUUB 2X2YA 4GRLB 5H2BA 4QHMA 1DVFC 2VAAB 4GXUM 5BV7B 3PWPB 5D2LE 2QHRH 1G0YR 1T4KB 4QRSB 3TBVA 3OQ3B 2FH6A 3MUY1 3LRGA 3RGVC 4PJGB 2W9LA 3QEQD 1HKFA 5EZJB 1A7RH 1K8IB 1WV7T 1U8NB 3MRHB 5HI3C 4ELKB 1CGXA 5E0QA 3CDFA 3S35X 4MXQC 2DDQH 3B8SA 4WWKA 4TVSa 4PGEB 1X4ZA 4PR5A 4DOHB 1PX4A 3DPBA 2VKXA 5HPOA 4UU9B 2J6EH 4HWZB 4AEFA 3DXAB 5EUOF 5F6HI 2H41A 1J5OL 5MENA 2YKLH 4M1DL 4P23B 5F8RC 4JN1H 4LPWA 5CD3B 4Z7VE 3FO2A 1DP0A 3HE7B 2QQQA 3G04B 4LSTH 4YFEA 1E6OL 4MB3A 3ARBA 3JTSB 5DF0A 1EPFA 4EOWH 2NW2A 4GRWH 4M43H 4QRRD 3MV11 5ANME 4XBGB 1I7TA 1YUHA 2N7AA 1I7RB 4HXAL 3LPFA 1U3HC 2FECL 1S5IH 4KGJA 5T1LD 3RBSA 1WJ3A 4HIXL 4YX2H 1JNLH 1Q9LB 2LTQC 4QRUB 5GGVL 5D5MA 2VN4A 1FZJA 3M45A 2YA0A 4Z7UA 1T5XB 5JPNB 4ZAKC 3OAUL 3P9MB 3S9DB 4PRHB 4HBCL 1FV1A 4XXDB 1I9RH 3LS4H 2MHAB 3V6FB 1N64L 1LMKA 5F3BA 4FQJH 4LKCA 5HGHB 4IDLA 2R1WB 1UGNA 4HS3A 1ZLVK 4JKPH 3IXAA 1X6LA 4F7MB 3UAJC 1U58B 4XNYL 4BELD 2P5EE 2WSKA 5L7XL 4L8CA 4ORZC 1U36A 2CK2A 4ODXB 5E1HB 3VXNA 5CIPA 2D7TL 3PUCA 1WIOA 1HWGB 2YN5A 1CQKA 3VXMB 1SJHB 4NQDE 3TO2A 4NJAL 2P42B 4IMLB 2DLGA 3WKNA 4NRXA 4DK6A 3MODH 1RVFL 4JDZA 1K4DB 3TA3D 3TF7C 4ODVL 2PR4H 2N7BA 1DBKH 4E0RA 5TJWK 3N50A 4NT6B 4F7TB 1W0YT 3MRBB 3WUZA 1LO3H 3C60D 3BZFB 3C9NB 3T4AB 5K9OB 5B3JF 4L9LB 5DLML 3GSXB 3RUGF 3QDAA 5JXEA 5ID1B 5LBSL 2HFFB 2VITA 3V6ZA 1LO2H 3QXAA 3U0PB 2BVYA 3QHFH 1K5NB 1FG9C 3QFJE 3V0WH 1ETZA 4NBZB 4U7KA 1HCVA 2LE9A 3SKOA 5SWSD 4HUNB 4WHTA 5EU5A 3AREC 3MV8A 3VFOA 2APBA 5EO0A 2DD8H 2ZUWA 4K8RD 4M5ZH 1WZLA 1EHLH 1OAQL 1V3JA 4M93B 5C0GB 1YEHH 2XNAB 2AJZA 2CUIA 3DYOA 3L6FA 3TO4A 4M7KL 2GFBA 3MRRB 4KQ4H 5KJRH 1V7MH 3KS0H 4ZXBC 4XBEH 2QHRL 3SQOH 1A64A 2AEPH 2NX5B 4L4TE 2BC4A 3ZKMC 3MXVH 2J12B 1FC2D 4APQB 4FQXA 3O4OB 1R24A 2YD1A 2PCPB 3DGGB 5D93C 4FQIH 5SX5H 3UC0H 4LLWA 1RUQH 1FN4B 4K55A 2DDQL 4NQED 3TVMD 5K9KB 4JKLA 3FFDB 4HWUA 2AI0H 4PP2A 4DN3L 3OKNA 5C07B 1XF3B 5GGRA 1FIGH 4X5LA 3C5ZD 4HFUL 3SKNB 2QKIB 2PTTA 4G8FB 3QUKA 4ZUVA 1UH2A 4HGMA 4S1RL 4PJIA 1F13A 4HPYL 5CSZA 5A2LH 4NZUL 4EN3D 3G6JA 3KPOB 3DJ9A 2YHGA 4LSTL 3FOMB 1TDQA 3INUH 5ICZB 5FGBC 5HJ3A 1DVFB 3LMJH 4EOWL 3U0TB 4C4KO 4UTBH 4Y5XA 4MHHG 5GSVB 3K74B 1VEOA 5TH2A 1PSKH 4CJ1A 1FNSL 3AXLB 3VXUE 4YHZL 5DYOB 3MACH 5L6YH 1XIWC 2BMKA 2V9QA 1JE6A 1DEEB 5E6IC 1EVTC 4YX2L 1MVFA 1WGOA 2HT4D 4MAUH 4NN6B 4Y1AE 1OQXA 4NZRH 5BZDB 1X5GA 3B9KB 3BHBB 4I9WD 3NPSB 4ELMB 5GS0D 1HINH 2I9LB 3TJHD 3X14B 2H9GB 1M7IA 2X4SA 4W4OC 4C56D 5HHOB 3LS4L 3FT3A 3JWNC 4OBSA 4FQJL 3H0TB 4RMWA 1F90H 3FQRA 1MRFL 4FQLH 5ESAA 4PBWD 3S35L 3CVHH 3WHE0 3P0VL 4BQ6A 1RMFL 2ICWB 3MLTA 2IAMA 3SBWA 5HD8C 5INDB 1XF5B 5CZXD 4LLVA 3SDCD 1G6RH 4WCYL 5C9JA 3T0BA 1WCBA 1XF4B 3RWFA 5EU4A 1YEIL 5DZLA 3MODL 4JFFB 3ZE1F 2AXFB 1RJZB 2PR4L 5AUMB 3QEQA 4M61A 3MLUH 1MHEA 1NC2D 2YOCA 4Y2DD 4BUHA 1UQSA 4GAYB 3G5XA 5I1JH 4ODTH 2HJKA 2C1OA 1MFBH 3OR7A 4WEUD 3PHOA 2CR3A 5IWLC 4LCCA 1QRNE 4MJ6B 1FSKB 1NC4D 3J8F7 5DVMA 3KPMA 1C8PA 3O6MH 4IOIB 1F5WA 3MLYH 2X4NA 2NY4B 5F44A 5CLWA 2NY2C 4B53A 2DD8L 1KTRL 2OTPA 3EGSA 1X44A 1QBAA 1MCQA 4QOKD 1EHLL 1LEKB 3ZYOA 1D6EA 4YDLC 3BSZH 3IKKA 3CDCA 3CD4A 3ZDXE 4ZOAA 3LQZA 2V9TA 1NAKL 1XGQB 2OR7A 1FE8L 4XHJD 4QRRA 3MBEC 4L8SC 3GUTA 1ZVHA 1MAMH 5KJRL 3C87A 3TH4T 2IJ0C 3QO1B 4J3TA 3NACH 5FV1L 4KPHH 5DUBB 2VQ1B 1UEMA 3U82B 5T1LA 3BIBX 1QFWI 4Q7DA 2E7MA 1MJ8L 5HDBF 3V6OA 1OOAA 2DN7A 5DFVC 1KC5H 5IB3A 3MLWH 3OBAA 4Z78B 3RAJH 1FLTX 2CO6B 3SGDH 1BWWA 1RUQL 2X44D 3D0VB 3R8QA 4PJHB 2YBRA 3TT1L 3MBXL 4KDVA 4GRWE 1FCCA 1D5BA 2HTLC 3QZWG 5FIEA 4YDJA 5BS0E 2IFGA 3JV6B 2VUOA 3U9UA 4DVBB 3RVTC 3OMZA 2MPAH 1KPVA 5HYFA 3MRLA 4PG9A 3L5XH 1U93A 3FO1A 2DWDB 2VOTA 2FWOB 5F88A 5TDPB 3GSRB 1B4JL 5EOTA 4KGLA 4W81A 3LMJL 1RIHL 4UTBL 3TA3A 4RGND 1PSKL 4PJCF 4OSUL 5CFHA 4WHYH 3B2UC 5L6YL 3CLFH 5DI8B 3C60A 2Z4QB 3MJ8B 4L4TB 5BQ7B 2FATL 2XOTA 4G42B 3EDEA 3C8HA 4MAUL 4OZIA 2XG4A 5F72S 4NZRL 3MMEB 3UZQA 3G5ZA 5DMKA 3RJQB 1DQDH 3FRPA 1H8SA 2PXYC 5I30L 3LKOB 2W92A 4OUOA 2BCKB 3MXWH 1UJ3A 1U8MB 1I75A 5SWSA 5I1CL 5KS9F 5IFJB 3MLSL 5D7LD 5DEGB 4FQLL 1RHHA 4IRJD 4NKIH 3CVHL 4XPBH 3O8XD 1TITA 3UBXB 5JW4Q 2CLRA 3H3BC 1ORQA 4FP8H 2FR4A 3W9EA 4GSDH 3WKMH 3QQ4B 1NEUA 1IEAA 2ESVE 1OARH 4HZLB 2H8PA 1P5UA 3BP7B 1FFOB 4TUKH 2NZIA 4NNXA 3DO7A 2APWA 1XIWB 3IF1A 4ZSOB 5A1AA 1KLGB 2X6MA 1WAAF 5CLTA 3VXUB 4CVZA 1KJVB 1RZIB 3GSNH 2GAZA 1H3WM 3EHBC 3TESA 3MLUL 4IJ3C 4ZUTA 4OCLC 2VDOL 2V2XA 1MLBA 2GTZB 5I1JL 4NQEA 3TVMA 1CXKA 2DM3A 4YNYB 1U8OB 2D0GA 3EYVA 3IJSB 1KTDA 4R4BB 2G9HA 3PP3H 2F58H 1T83C 3C5ZA 5IEKB 3O6ML 2P8LB 4K3DH 5FYKH 3LCYA 1FNLA 2CGRL 1NEZB 4JFQB 3VFMA 2VIRA 5JNYB 4MJ4A 1MY5A 2ATKA 2EDQA 1BOYA 4EN3A 4OZFG 4MA8H 5GJSH 4JO2H 4QGTA 1ADQA 1DFBH 4YXLH 4GG6B 3DIFA 4GO6B 3BSZL 5BW7C 4JFDE 5BVJB 2Z8WC 4YUEH 4LPCA 3R4DA 4HKXB 1MAML 1LNUB 3IAGC 2VDKL 3JUZA 1BFTA 1E28A 3NACL 3GI8H 4KPHL 1AD9A 1DUZA 2FO1A 5DMJB 1A14L 3MR9A 3MLWL 3Q6FB 1MREH 4JO3L 3RAJL 4M5YH 1MCFA 4XP4H 1DL7H 3CFCL 3P9LB 5AG9A 1T6WA 4UZGA 5F7HA 2CKBB 4C56A 2ZKHL 2L4OA 4NN7B 4J3XA 2M2DA 1HKLL 1EFXD 3QDME 1VFMA 1MJ7L 2NY2B 3PGDB 4JPVH 4HAGA 1ZT7A 2ZSVA 4YBHA 2ZZUT 1KIQB 4PJ9C 3JVGA 2X09A 4YDLB 1X4XA 2VDQH 5HHMB 3SDCA 2X89D 2YRZA 1MCLA 2JELL 1W0VA 2OL3B 4HGWB 3VFPB 4ZQKB 1SEQH 3JV4B 1KPUA 4U4BA 4U1IB 5HGAB 3CLFL 3VXTB 1NC2A 3QXDB 4Y2DA 2DBLL 2K7QA 5IR1A 3ELAT 3U9PH 3ARPA 5I2IA 5D1QC 3U0WH 2XPGB 4X7CC 1KNOB 3B5HA 4U3XA 3RIAF 1DQDL 5KW9H 1NC4A 3P4LA 1IVLA 1FGNH 3LPGA 2R23A 3IU3B 3DNKA 5ISZB 3TZVD 5BS0B 2DTMH 4KK9C 4NKIL 4YWGH 2RGSA 2WMPA 4QOKA 4POYA 2D03H 3CIQA 4GSDL 3WKML 2BP3A 3ZE0E 1Q9WB 4ETYA 1OARL 4JFXA 1CI5A 3MC0A 5GRWA 3BYTA 5D5MF 2BY1A 2IQ9H 5FEBA 4Z7UF 2PTUA 4TUKL 2DQFB 3HCVB 3QUMA 3BDBA 3T08A 1QFWH 3HMXH 2I60L 1Y6KR 3LKQB 4Y88A 1LO5B 4RDQF 2MSPA 4NQTA 1HK6A 5EBWB 3GSNL 2AXGB 5KVGH 2H1PH 5IW6A 1FNEB 1AFVL 4L3CA 5DEZA 5JZ7D 2EDOA 2VL5A 4O51B 1X9QA 2PXYB 1JP5A 1TCRA 1A8JH 1JNNL 4GRLD 3LEVL 43C9A 1S7VB 3QIUC 1FAIH 1EXUB 2F58L 3PWPD 3V0VB 3AAZB 4YEEA 5FYKL 4RNRB 3S36X 2X1PA 1CD8A 1JMXA 5I16A 3RL1A 4ZYKA 5IJKA 3FJTA 2AGJL 3FQTA 5GJSL 4H25A 4CNIB 1O7SA 1DFBL 2VL4A 1SYSA 3MA9H 4JQVA 3D48R 3EJYC 5EOCH 1T0MA 4YPJA 3QI9C 5HHQB 1P4LB 4XVTH 3DXAD 4BSVA 1N3NB 1WLHA 4MDIB 1EHAA 2XKNB 1U8QB 3FKUS 2CIIB 2DKUA 1A6AB 4U6YB 1ODAA 3T1FB 4IHOB 2GJ6B 2GSGB 3EYUH 1G7LA 1I1RA 3BN3B 1MREL 3HE7D 1JPFB 1DL7L 1AIFB 1T04B 4ODWB 3WUWB 3GJEB 3KDMB 3U7AA 3EO9H 1DBMH 4TVPH 4IRJA 5E4EC 4OFVA 4XP5H 3O8XA 4LAQH 1DQJB 2NTFB 3H9SE 5GXBB 2AKRB 3EIFA 5IBLC 2YMXH 4JHBA 5DJYB 3V79C 3OHXA 4WEBH 3MV9E 1JF1B 4ISVB 4OCNC 1MCIA 4OIAA 3V5DA 3S36H 1MHCB 2HT2C 1EO7A 4PRHD 3VGFA 5JHLL 3K8LA 5IMOA 1I3GH 4X4XB 4OM1H 4DQOH 5LVEA 3ZL4H 3N1MC 2PW1A 4L3EE 2A83A 2VZVA 5I1LB 4PRNA 1CT8A 1A9EB 3QA3B 3AY4A 3WO4B 4ZNEE 3DUUB 4LLUB 4GXVH 4HDIA 4KJQD 4AIOA 1Y6NR 5JOFA 3U9PL 1KELH 2XWTA 3FN9A 2WBJB 43CAB 2B39A 2NY0B 3U0WL 1HWHB 3VXMD 4PJIF 2R56H 5SV4A 1QSEB 5E9DE 3G6JF 4H0HB 2OSLA 1PYWA 4WI7A 1FGNL 3OJDA 3ECBA 2RR3A 3RVUC 3TBWB 1H3TA 2O5XH 1DE4B 3FRUA 2DI8A 2DTML 4OLYH 1EH9A 1ZHLA 2KZ1B 3EYQC 4YWGL 2X4UB 4LBEA 3OKMA 4K7FB 4LLDA 5C7XH 3TFKD 5DO2D 3DX7B 3F12B 1BPVA 2CRYA 1KB5B 4N8PA 1TLKA 3HAEH 3MROB 4DZ8B 4BZ1H 4S1QL 1H0DA 4PJFA 2IQ9L 25C8H 1N7MH 3MJ9L 2NXZB 3BH9B 1GGTA 1QVOB 2DLIA 4MJIE 3HMXL 2FLBT 3VJ6A 1CK0H 1I8IA 3TBTB 1QR1A 4L29B 1C16A 1BQHB 1E4WL 2X4OA 1OSZA 4MCYB 2JTDA 5IVZB 4PLNC 4DGVH 6CGTA 3MO1A 1NLBH 3CUPA 5EB9A 3MUGA 1FAIL 3UCRA 3HC3H 5CGYD 1LVEA 1EFXA 1YYLH 4F8TA 2IADA 2NX5D 5D8JH 5FHBH 2NXYB 3FQWB 1F3JA 1CFVH 1FNGB 1LK3H 1T6VN 3O4LE 4OI8A 4NM4H 2DM4A 5F1NA 1A7QL 2X89A 2XTLA 3HZYB 3MA9L 3GBMH 5EOCL 1JPGB 1MJJA 4D9RE 3F7VA 3MJ7B 1BLNB 1P6AB 1GL4B 3QHZH 3VI3F 3BKCL 4XVTL 2F15A 4PJBA 3LV3A 4HF5H 1SMAA 3L7EA 2EKSA 3BGMA 4JFED 3N9GH 1C08B 5GGSA 3RVVD 5IFAL 5EUKB 3LKPB 4X6BB 2A6DA 1SYVB 5JA9A 3EYUL 4F33B 3Q1SL 1JWUA 1SJXA 2YD6A 1H3PL 3BMVA 2E9WA 4KI5D 2YEZB 1JL8A 2JCCA 1DVFD 2AQ3A 5MHSD 3MRMB 3SEPA 4XP6H 1YPZA 3EO9L 1DBML 3TZVA 3WNNA 1JHTA 1FJ1A 5FCUL 4X4YA 1CDIA 4O2FB 1TZIA 4LAQL 5FB8B 2X05A 4ONFH 3TCLA 5IV2A 4MXQD 1S7UB 1KJ2B 3B9KD 1T21A 4WEBL 3BKMH 1YY8B 4UT9H 1JWSB 2LAGB 4JN2A 4PRBB 3S36L 3P4OA 1LE9A 3NTCL 1ZEAL 2MKLC 2UYLA 4OM1L 2W1NA 3ZL4L 5K59F 5L88L 3SKMB 1FVCB 4J23A 4W6WB 5SX5K 5J1SC 3B83A 4HKZA 4Y5VA 5FA3A 3SPVA 4GXVL 4WJ5A 4HIHB 5JO5A 2EZ0D 4IOFC 5FYJL 1NGYA 1KELL 3HI1A 4J12A 5SWZB 4PJXF 3PGFL 4XNQB 1MSPA 4WW1A 1IC5L 2C4FT 1XF2B 4ZUUA 2YD9A 3UTPE 2R56L 3IDNB 3QUYB 3BP6B 4GRLA 1P9MA 2FHBA 2VAAA 3PWPA 3MLPA 1LO4H 3VFTB 1T4KA 4QRSA 2VDNL 5E4EB 2PF6A 4O9HH 1U3HD 3AS2A 4Z6AT 1KENL 3K2UH 4PJGA 1KN2H 2B8OT 5EZJA 1K8IA 4KU1A 1U8NA 3MRHA 4UQ2B 1JNHB 4XB7A 4PGEA 4S0SD 1UYWH 4DWHA 2PN5A 2C4XA 2P48B 1G9NL 4EDWH 4UU9A 5F9OL 4HWZA 4KAQL 4OZIF 4ODSH 3DXAA 2WP3T 2BJML 1N7ML 4FXKB 3UAJD 2NY4D 4KXZI 3ARWA 4Z95L 1RI8A 3O3DB 1RIUL 1HXMB 3BEVB 1YEEH 5CD3A 3RNKB 4Y19B 3HE7A 1Q9OB 5C0FA 3G04A 4S1DC 2W59A 3JTSA 1G9ML 4UI2A 1X6NA 2SEBB 4DGIH 4BQCA 1NLBL 3IFOB 2CIKB 1GC1H 4XBGA 1HSBB 4HXBH 3HC3L 1I7RA 1YYLL 3NCYS 3T09A 4FFZH 5FHBL 5DDHB 2ZUVA 2ZJSH 1Q9LA 2E6PA 4NKDA 4LGSB 1CFVL 5DVOA 1IKFH 1LK3L 4F9LA 1T5XA 4JGJA 5JPNA 3Q6GH 4UIMB 1WWAX 3P9MA 3L5IA 4PRHA 1UB6B 2A6JB 4XXDA 3QCTL 4A6YL 4HWBH 3GBML 4PTTB 1FVEB 1OAKH 2MHAA 3V6FA 4C57C 3U48A 5HGHA 2R1WA 4M4RA 2D31B 4TVPE 4F7MA 4QWWC 1KCUH 1IRAY 1U58A 2CRIA 4MJIB 4JQIH 5D7KE 1YJDL 3ARSA 1P5VA 4ODXA 5ERWA 3NIFF 2YD5A 3VXMA 1SJHA 2VISA 4NQUA 4AJ0A 3ARTA 3BPLC 3QHTC 2OLDA 1II4E 3MRCB 2VSDA 5I73C 4IMLA 4Y4HC 3GJFB 1TJHH 1K4DA 4JREB 1E4XH 2B20A 3FTGA 4NM8L 4LLQB 2NR6D 4C59B 3BRDA 4XP6L 2AS5M 2VDPH 2XQYK 4NT6A 4F7TA 4PJ5E 3MRBA 1IGMH 5F9WB 3BZFA 3C9NA 4L4TD 3T4AA 5K9OA 3T8XB 3L5JA 3U46B 4CN1A 4L9LA 2DQHH 4HT1H 3WDIA 5HVWA 3GSXA 1OAUL 5ID1A 2HFFA 3BKML 3U0PA 2A6IB 3CH1B 3KPSE 1K5NA 3V2AR 4LEOB 3H9YA 1AHWC 2X4QB 1RZFL 5TDNB 2D0FA 2ICES 5JIHA 3VRLE 1CFTB 4Q9CA 2A0LC 4PRIE 1FPTH 4ODUB 2XNAA 4ETQB 4LMQE 4U6VH 1IC1A 5JOPE 3RZCB 4UDTB 3QIBB 2YXMA 3MRRA 4JVPA 2CQVA 3L1OH 4OM0H 4PJ8C 4DFIA 1LO4L 1RURL 1XIWD 2NX5A 3QCUL 4O9HL 2XN9E 3VXUD 1KN2L 2DQEH 1L6XA 2PCPA 3DGGA 5EBMA 3M1BB 4XVJH 5DMIH 3WBDA 2Q8BL 1RZJH 3DYMA 5K9KA 3FFDA 5ADPL 3EYFB 1A3RH 1UYWL 3IETB 1R6VA 4R90L 4HUXB 1XF3A 1LILA 4L4VB 4ODSL 4MNQB 4N8CH 2FX9H 3DWTA 2QKIA 3SKNA 3RZWA 4G8FA 3JZ7A 4EUPA 4JFEA 4C83B 5C09E 5DJAB 4FFVC 4HKJB 5LG1A 4IMKC 2FJFB 3MV01 3EJJX 1QFOA 1YEEL 3KPOA 3K81A 1ZSDB 5D96B 2X9YA 5ALCH 1FFPB 5HI5C 3W5MA 3FOMA 5EULV 3QUXC 1EGJL 3QXTA 3BZ4B 4IDJH 4JR9L 2ZG3A 1DVFA 3U0TA 4RFNB 5GSVA 5EUOE 3ZT6A 3SO3C 5DR5L 3QQ9C 3AXLA 2ADGB 4HXBL 5CILH 3K80A 4EUPG 1VFBB 4X4ME 4J3SA 1DEEA 3GMQB 1CLZH 1D9KB 3QQNA 4FFZL 4YDKH 2LAAA 2ZJSL 4I3SH 4Q9RH 1IKFL 1BIHA 1U8PB 5BZDA 1E6JL 3B9KA 3BHBA 4ELMA 1Q0XH 2CLVB 3Q6GL 2I9LA 3FAXA 4NRZB 5EOCJ 3X14A 4F37K 5BVPH 2H9GA 4HW6A 1OAKL 3H0TA 2PETA 3K2MC 4MNHB 1NFKA 4HC1A 4H88H 1F4XL 2NY2D 1KCUL 4J8RB 3FCTB 2ICWA 3PP3K 5INDA 1XF5A 4KUZH 2P1YA 4Z7VA 3MTRA 5HHMD 2A9MH 3C5JB 4U1GB 5I1EH 4P9ML 3UEZA 3CFBB 1YMME 4CJ0A 2F5AH 5IHLB 3MCG1 2R69L 1EEQA 1VENA 3QUZC 1E4XL 2AXFA 1U3HA 1LEGB 4BFBD 5EDXA 5AUMA 1XGPA 4RAUB 5EN2A 2DKSA 1KCLA 4POZD 1IGML 2P7TB 4LLMB 1YEGH 3WV0A 1T7ZA 4NNPH 4GAYA 4ZUSA 1EO5A 3V8OA 2D3VA 2DQHL 4HT1L 4RCAA 5I71C 4X98B 4MJ6A 4R96B 1OT1A 5DTFB 1FBIL 2Z93B 4IOIA 4KXZH 2J1KA 2XXMB 3MRQB 3RVTD 3ZT5A 3ESUF 3SGEI 3WE6B 3FMGH 2BVEA 5BS0D 1XFPA 3E6FB 3WNMA 2AV1B 2WNGA 1LEKA 4OLXL 1D6VH 5H37G 3RUGE 2VMFA 4A2LA 3VW3H 3ZLQC 2FD6H 3SE9L 5GGSY 7CGTA 4U6VL 1VPOH 4RMTA 1XGQA 2YR3A 1OD9A 4R8WH 4JY4B 4DKAA 4G7VH 5I18L 3L1OL 4OM0L 1IEHA 5J4MA 2V5SA 3QO1A 3B2UD 2VQ1A 3FB6B 2X40A 2VLJE 4S0TD 3N06B 2CR6A 4QHUB 2CXGA 1T7WA 4ODHH 3Q3GB 4Z78A 4ZFOA 4PJ5B 2J8HA 1P2CB 4GJTB 3K7UA 3IJYB 4H0GA 1VSCA 5DMIL 1LDPH 1RZJL 3D0VA 1NBVH 2PXYD 1A3RL 1ACZA 1PQZB 3ARGB 4P2QE 3KPSB 4N8CL 3OX8B 3JV6A 4AYFA 3KPNB 4R4NC 3I3BA 1BD2B 4QXTB 1KFAH 1GC1C 1GGYA 1JHLL 2HJFB 4LVNC 5FYKU 4DFHA 2OXHA 3P4MB 4GG8B 3L7FB 3SDAB 3D2UB 2EIDA 4P2OC 3T0EE 3D69B 3V9FA 1S5HB 4S1SL 1X5YA 4DN4L 3GSRA 3LKSB 1HQRB 1RZKL 3T0EC 3NZHH 3S96B 5A2JH 3UO1H 5B8CC 5F9DC 4UOW0 1DBBH 4ZO8A 3REVA 5EPMA 4U1NB 2JB6B 1QLFB 2BRQA 5CILL 1H5BB 5DI8A 5J56B 2Z4QA 1CLZL 4L4TA 3ILQC 4PJFF 4YDKL 4Z5RB 1TIUA 5BQ7A 5C9KA 2XN9B 4G42A 4I3SL 4JDVB 2NPLX 3MMEA 4PD4K 3ARUA 3WIHH 3LKOA 3ROOB 2EE2A 2BCKA 5BVPL 3I3DA 3WHE1 1U8MA 4I13B 3PXHA 3FO9B 3K1DA 4PV9A 2X9XA 5TDOB 4JG1H 5KSAB 3BDXA 5IFJA 2RCSH 5GZNC 4HS8H 5DEGA 3T2PA 4I3GA 5C0EB 4N0UE 3GIVB 3KPRE 5DJZB 1T89A 3UBXA 4WV1B 3ZYIA 4LRIC 3I6LE 1HXYB 2NW3B 3QQ4A 5I6XB 1ZT4B 5J12C 4HZLA 5FGBA 2A9ML 5I1EL 4TNWF 3TT3L 5EG6C 4KRPC 1IAII 1FFOA 3ARDB 4JFDD 2R2EA 2HFEA 4P3DB 4X4ZA 1XIWA 2EXYD 1NUFA 4ZSOA 1KLGA 1DQMH 3WSQH 3VXUA 5CJOH 1KJVA 1RZIA 1A7NL 1ZVSB 1CYGA 3L3OA 1YEGL 4PJBF 4NNPL 2GTZA 4JY6B 2NY0D 2WW8A 4DKDC 5DS8B 4NOBA 2OM5A 4W4OA 4LSDA 3IJSA 2IG2H 4R4BA 3U30C 3TYFB 4GQ9H 3OKEB 1CLOH 4G80B 5IEKA 2P8LA 4XAKD 3FQUB 1NEZA 4JFQA 5T3XL 1R3IH 1IBGH 2JCCF 2HVKA 2AAVA 3FMGL 2LV4A 4DW2H 1D5MB 4GG6A 1BF2A 1D6VL 1YPZF 4K3EL 3VW3L 1WTLA 4I18B 1I8LC 1KLUB 4O5LH 4O02H 1VERA 3PABB 5DD3L 2MFNA 5BVJA 1BZ7B 3BPOB 1UCBL 1QA9B 4JPIB 3RHWK 1ITCA 3E2HC 1TFHA 4HKXA 4JE4B 5AWNH 3VG9C 1RZJC 4R8WL 3FQNA 4DAGH 4TNVK 1LNUA 3N0PB 3ULSB 1MH5B 3NIDF 4XNZB 3RI5K 3PDOA 1EEZB 3C6LC 4MVBC 4G6JL 5LGJB 4LCYB 1OWWA 2W65B 5D1QD 5B39B 3Q6FA 4ODHL 2D4FA 3W0WE 4DGYH 1N0LA 4X99B 3P9LA 5KVFH 2ARJB 1LDPL 5C0AB 2KDGA 2VDRH 5BXFB 5CIPH 5FM5M 2CKBA 1L6ZA 4KK8D 4HGKC 2EDWA 5CS7A 4G6AC 2BOBA 3W9DB 2R15A 5ITFB 5SV3A 1QBBA 5I76B 1GIGH 3B4NA 4KKCD 3PGDA 5C0CE 4KK9D 1ZA6A 4Q0XL 1BJ1H 4WTWA 2VUYA 5FA4B 1TETH 1KIQA 3TYGH 3S37X 5CEZL 3T1WA 1MVUB 4K7PH 5FGRA 3R06B 4PJGF 4MMZC 3NZHL 1L0XA 2OL3A 4HGWA 1XR8B 3VFPA 4ZQKA 1VCAA 1DBBL 2A77H 3RWJB 2J6EA 4WO4B 3KLDA 4HLZG 1WT5C 4OD1H 2EICA 5HGAA 4U1IA 3QXDA 4ZS7H 2ZG2A 5GJTH 3GI9L 5LGHL 5KZCB 5GS1C 4N9OB 1FNHA 2AABH 1NCCH 4UT6H 1NCDH 2Y25A 5KSBB 4GQPH 4Z9KB 3WIHL 4RISH 5AD0B 1A21A 2WBKA 1MJUH 4PYHA 3IU3A 4ZFGH 4JG1L 2KQNA 4P2QB 2BY0A 5ESVB 5C08B 4PREB 1X3DA 4M62H 4HS8L 5BS0A 3V4UH 5F7UA 3KYAA 4BYHA 3BZDA 3ALWA 1FAKT 1Q1JH 5J1TC 1V8HA 4Y5YC 1O7VA 4M1CC 3ZHDA 2OMNA 4OCRL 1B9ZA 3EJYD 1G7HB 3GMNB 3QPXL 3UTSB 3M8OH 4IS6B 4ERSH 5JXAH 5IOPA 3TP4A 5ID0A 1XCTB 3DX6B 4FABH 5FGCB 3F62A 2ZUQB 4GKNB 2DQFA 5KS9E 3S37H 1IKNA 3LKQA 1LO5A 1DQML 3QULB 3WSQL 4JHAH 5EBWA 2AXGA 4JRYE 5HHVH 1FNEA 5SWZD 3JWOL 4O51A 2IGFL 2PXYA 3DVNB 3PWJB 5JW3H 3QUYD 4LLAA 2IG2L 1EXUA