1PTZA

Crystal structure of the human cu, zn superoxide dismutase, familial amyotrophic lateral sclerosis (fals) mutant h43r
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLRGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title ALS Mutants of Human Superoxide Dismutase Form Fibrous Aggregates Via Framework Destabilization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ptzA00
5KBMA 3KM1A 2GBVA 1JCVA 1U3NA 2ZKWA 1B4LA 1SPDA 3GZPA 1E9OA 2SODB 1CBJA 4BCZA 3S0PA 1SXNA 2AQTA 1F1GA 4BCYA 1SDAB 1IBDA 3CQQA 2AQNA 1SOSA 1Z9PA 1SXBA 1E9PB 3MKGA 5KBKA 1E9QA 3QQDB 2AQPA 1IBHA 3GZOA 1PTZA 1L3NA 2WKOA 1HL4A 4A7VA 1MFMA 3KH4A 1BA9A 1OZUA 3F7LA 2VR7A 2VR6A 3H2QA 1PZSA 1XTLA 2ZKYA 2WYZA 1F1DA 1OEZW 4A7GA 1Z9NA 2VR8A 2AQSA 1HL5A 1RK7A 3KBEA 1FUNA 1P1VA 3RE0A 2AQRA 1EJ8A 3GQFA 4BD4A 2AQQA 2E46A 2LU5A 2WWNA 1KMGA 1OAJA 2WZ6A 3LTVA 1CB4A 1N19A 3GZQA 2C9UA 3H2PA 5CU9A 2NNXA 2WZ0A 2WZ5A 1F1AA 2K4WA 3HFFA 1QUPA 2XJLA 1OZTG 1XTMA 2AEOA 1PU0A 2Q2LA 2Z7ZA 1IBBA 2WKOF 1JK9A 2XJKA 4MCMA 3GTVA 3CE1A 3L9EA 1F18A 3HOGA 1OALA 4A7TA 4MCNA 1E9OB 5KBLA 1TO4A 1UXLA 4OJAA 1ESOA 1BZOA 1SXZA 3SODB 4L05A 3T5WA 2ZKXA 3PU7A 4A7QA 1B4TA 2C9VA 2ZOWA 3GTTA 1SXAA 3CQPA 4A7SA 1S4IA 2Z7WA 2JLPA 2Z7UA 1YAZA 1SXSA 2WWOA 3F7KA 4U4IA 4FF9A 1E9PA 1E9QB 3QQDA 1COBA 1YAIA 4A7UA 3KM2A 1TO5A 1IB5A 2E47A 1SRDA 1DO5A 3MNDA 4B3EA 3HW7A 2V0AA 1XSOA 3ECWA 1EQWA 4OH2A 4A7GF 4N3UA 2AF2A 1YSOA 2GBTA 2Z7YA 1UXMA 1IBFA 1SDYA 3ECUA 4N3TA 1SXCA 2R27A 2WYTA 1Q0EA 3ECVA 2JCWA 3KBFA 1AZVA 3KH3A 2C9SA 3K91A 2APSA 3L9YA 1N18A 1DSWA 2GBUA 1JK9B
chains in the Genus database with same CATH superfamily
2FSEB 3J07A 5CJXC 1YNLL 4CMMB 2C7UB 4ONHB 2LQRA 3SY0B 5KYWB 3P4MA 4DP9X 4AT6B 5JHLA 3U2SB 3EDDA 1IAIL 4HKJB 3GXPA 4LVHB 2H2PD 4NBXB 2AXWA 3HNVH 3STBA 3U30B 4PJ7B 1JHLH 2BSSB 2P8PA 2G9HB 1QACA 3NZ8B 1NBYB 1DDHB 1U92B 1KBKA 4JGNA 4DKEL 2IDCA 1JZ4A 2WAHA 1THAA 1T6BX 1MCFA 1UACL 1XB8A 1IBHA 3SGEI 4LLMB 5HYQA 3G5XB 4U1NB 3SDAC 3T2NH 2Z64C 3NFPB 2CJUL 3PS6A 4P5TB 2XZZA 3FF7A 3V4PB 3WFHB 1IAOA 4MJIB 4H8HA 4PJ5B 3KPRD 4QEGA 5IQ9A 3VXUD 3VXTA 2GEEA 2NY6B 4PV1C 1I1AA 3PWLA 1OEZW 3DIFB 3DI3B 4XP1L 4OY9A 4BDVB 5HYJB 4J3BA 4WENB 2CWRA 2AJUL 4ZNCD 3VDAA 1DQJB 2CLRA 2NOYA 2HLFC 1UT1A 5IROC 1YEDA 1IM9A 5D7KD 5HJBA 3MV9E 1HEZA 2F18A 2D8KA 3V5DA 4OLXL 5BNXD 2YSSA 1M9SA 3PRZA 2ESVB 2J6EA 1FNEA 3IFPB 2X6UA 3GS7A 5F0PB 3MN8A 3HS0C 4OLWH 2AJVL 1T20B 3HC0A 4MCNA 3DDGA 3CX2A 4JB9L 4L29A 3M1OA 4X7TA 4D2NA 2ERJB 4PBXA 3FSVA 4EQ2A 1X5MA 2VXQA 4N2KA 43CAB 5SX5H 3FCUB 3DO7A 5LNDA 1WBYB 1B0IA 1S4IA 3MJ8A 2NX5B 4EI6A 5F88B 5DZ9A 5DMGD 3A5VA 1CFNA 1DVYA 1OCCB 4EIGB 4NHCL 3GKZA 3BUBA 3ZHLA 1Z9LA 2V7HB 4QHNB 1G0YR 1DJWA 4NDMA 5GRYA 4JDZA 3ZX1A 4ZFGL 4TNFA 3TBWA 3QZBA 2EH7L 4RA0C 2JWYA 2J5LB 4XP6H 4DEPC 4FQLL 1D5ZA 1CL7L 2FECI 2LE9A 2ZWZA 5CEXA 3QXDB 3ML8A 2A6JA 1ZA6A 3CVHL 1A02N 4AMKH 5GRWA 3S37X 1UWEL 4LHJB 4AZUA 1DQDH 2CPUA 4N20A 2NY0B 2MEJB 4H4NA 3KH3A 3HZVA 1MW3A 2LAAA 1I85C 2OULB 3DMMC 1DSWA 3P9LB 3BISA 4LP8A 1MCNA 3RJDA 1JUFB 2CO4A 2WBXA 5D8JL 4EXKA 4XNDA 2Z35B 4KXBA 2X2JA 2NY3B 3NQIA 2JKIS 1A6PA 4MNQB 4JPWL 1E4JA 5C92A 3Q5TA 3KVQA 3QFJA 4YO0B 4JRXD 3MUJA 4F92B 2AJYL 1FN4B 2JELH 3VYOA 2YGNA 4XB7A 4XR8C 3KPOA 4W6WB 4YSCA 3KLHD 1HE8A 3DI2B 1OVZA 3E2HB 4JDEA 1B6UA 2PMZA 5I1GH 2WKOA 2WKGA 2DMKA 4JPVH 3DWTA 3SBPA 4GSDL 3GYRA 1NEPA 4J4PA 3IGLA 3WFDH 1FCGA 1F4XL 1ZHBA 1H0DA 1KJ3L 3QDMD 1QP1A 2FL5A 3QXUA 1M57B 1AFVL 5E2VH 3LKSA 4E0RA 3E7JA 3FO2B 4EI5D 1BQLL 5HHOA 3QJHB 2WZ6A 1UKTA 3WFEL 4L1TA 5D7LE 2BMKA 3WV0A 4HLZG 4QYOA 3RJOA 3WS3B 1G7MA 1JYVA 3C8KA 1AYOA 4MDRA 3FHEA 4Y1AB 2A77H 3LIZA 3NIDB 3GTNA 3LS5L 5GGRY 1E27A 1ZS8A 1UGKA 2WKOF 3RZCB 4F5CA 1XIWB 3QULA 3EO1B 2A83A 4PJBB 2R9HC 4N0CC 1KIRA 5DEFA 4LLWB 5I19L 3K8LA 2CO2A 4IU3A 2QBWA 4MA7L 4CN1A 3BUYB 3I6KB 4FNUA 4M7JH 3BSZA 3QUZB 4Y4FB 3IJSB 1A6TB 3RTQB 4R7NB 1SXSA 3BZFA 5T33H 4JN1H 2GK2A 3RWFB 3MLTA 3D7PA 3TNNA 4AQAA 1YAIA 1IIIA 3BP5B 3TWCL 3B7RL 4YGVB 3MRKB 2W91A 5IWLA 1Z9SB 5IVXA 3JYCA 4NM4H 1MWAA 1MCBA 3GXMA 5CBAA 4IIQC 4NGHL 5D96C 3WTTA 1UM4L 4TUOB 4MWFA 5D9SB 3Q1EA 4KQ0A 1DFXA 4HGWA 4JKLA 3KDMA 1K6QH 4QAMB 4URKA 1A9VA 4L37B 2FD6H 4TULL 4PRNB 2YBGA 2OR9L 3JXAA 2B5IB 2DWEB 3UZQB 1J5OH 1CGUA 2OMUA 4LCCC 1AS7A 2XZQL 5F7UA 4J2QA 4J6RL 4ADIA 3QORC 3OAUH 3QYMA 3RKPA 3GBMH 3DX4A 3WHE0 2ADFH 2X3BA 3GI8L 4NQEA 3SYOA 4YGAB 5EZOL 4MAYA 5BS0D 4AYDC 3BVXA 2VLKA 4X0KB 1N70A 5DC0A 3FC8A 3JWNG 3NYKA 5C71A 4Z77B 3N41F 4LLVB 3IFOA 1CD0A 1S7SA 5DMIL 1OAUL 1GS7A 2VWEC 3STZB 5IREA 2SEBA 3NRFA 2DEWX 4FZ8L 2B1AH 3KXFA 3MKGA 3ZSSA 3QA3A 4FP8L 4M93C 4PGBA 2I7OA 3Q8FA 1JXKA 5FYJH 4HMDA 5I8EA 4ZUWB 4YE4L 5H94A 2KH2B 5TE6L 5DD0H 3MLRL 3GSXA 4U6YB 2K6WA 4LEOA 2OQJB 5D2LB 1ZHLB 4L5FH 2BRQA 3DTXB 2EVIA 1FDLL 2EDBA 3KPSD 1OB0A 4I77L 2Z4QA 1MFDH 2XN0A 3QDGE 4ABVA 5HHPA 1I3VA 5D72H 1RUKL 5FYJE 1VB9A 3AT8A 3OF6A 5CU9A 1BXXA 2KUTA 1NFDB 1ZV5A 2YMOA 2ICCA 4ODSL 5LCVA 1O6SA 4BQBA 4D94A 2IGLA 1V27A 2AJZB 1NCNA 4NOFA 2GG1A 3QI9C 4EIUA 5B1CA 2PO6C 4PW4A 4MCMA 4FKEA 5DRXA 5TH2A 4QIRA 4DVBB 1SY6A 2MMXA 4I8DA 3RJQB 4AK2A 1A66A 3T77B 1SXZA 1ZV9A 1MN4A 2O1AA 4ODUA 2YGPA 1OOAA 1GGUA 3INUL 5MENA 1SVCP 3QPKA 1CGXA 1YDPA 4NZUL 3QJSB 5DJ8A 3CFBA 1DLFH 2WLLB 4KX8A 3UZVB 4AM0A 4K9JA 4XMPH 3QQDA 4MMXC 5DMKA 4F7TA 1DCEA 3ATAA 3JUYA 3PF2A 1J5DA 5C0BE 1N5AB 1YECL 4QRUA 2RAMA 1KCUH 4N90D 1AIZA 4OGQC 2H3XC 3OB0K 1ZEAL 3LH9A 1KTCA 2XI9A 4TN9A 1RZ8B 3AVEA 2FJHA 2CKBL 5LGKA 1XF5B 3C60C 3WXVH 4XCYA 3D0VA 3WHE1 4M48L 4IRSB 4XP4H 1I9EA 3N04A 3MRPA 1KLFA 1JPTH 2C4FU 4LCIL 3NCFB 3OGCB 2OL3H 3IU3A 4Y89A 5LAPA 4PS3A 4X6CB 1RXLA 1XWVA 1FJ1A 5E2JA 3RIFK 4K3EL 4IRJB 3NN8A 4KJYA 2H45A 3CXDH 3MRCB 1Y6KR 1WFUA 5SWSA 4DP2X 1A5FL 2ITCB 2XWTB 4RWYL 4NO2A 1KWKA 3IMBA 2BP5M 1CBJA 1KIUB 3CDZA 5EU5A 4BCZA 3IJ7A 2DQEH 4K3DL 5C6WH 5D5MA 1G5GA 4HJIA 5EH1A 1GGCL 1ORSA 1P6FA 2BP3A 3BO8B 1WIPA 4OGZA 3SCMB 1IGTB 1QR1B 2Q86B 5EUKA 3BPNB 2V2WB 4GI9A 5I74C 3HRZC 4EN3C 1KCVL 3PFQA 4U1GB 3UC0L 3EG9B 3IGAB 1LE5A 4OD2A 2UUDK 3NIFF 2D9QB 3WSQH 1JNNH 1CU4H 4H8PA 4FA6A 2I60L 3WUWB 2FX8H 3WJMA 3FMGL 4ZS7L 5CD3A 2XICA 2FLRT 3TN0B 3X11A 5DZAA 32C2B 1ADQL 1CDCA 2VZVA 5ICYA 5D5MF 4R6UA 4KRNA 4OIFA 1GAFH 2PCFB 5DD6B 3ZE0B 4UINL 5D1XD 1IEAA 1CJYA 1I8UA 1N2RB 3DRQA 4HS6B 1UXWB 4H40A 4QKXB 4OUUB 2C3VB 3ZUNC 1F11B 1OAZH 2JQZA 4HAKA 5BV7L 4UIMB 4JFEA 4XTRD 1OANA 3LY6A 3N55A 3LS4H 4OIAA 4AC2A 2ZOOA 4D9QE 1DVUA 4MD4B 2W07B 3ILEA 2P5EB 4PJAB 1KYAA 5HVGB 1M2VA 4UOQA 3CIAA 4G7VH 2Y23A 2AXGA 2YMXL 2V6HA 3L1OH 3UTPD 3QO1B 3F7KA 3UTZA 2O5YH 1OARL 2YAQA 2NY5L 3FQUB 1ZHNB 3AG1B 4M6OL 4NNYA 3QEUB 2ADYA 3B2DC 1QZNA 4GRLA 1VGEL 4HGKC 2LR4A 1BMZA 1ACCA 1JP5A 4FQQA 4AMXA 4MJ5A 2OX5B 4TNWF 2DQGL 3CZLA 4W9DC 1MFBH 2YAMA 3KNBB 4PY8J 3PNWB 1CICA 1AZUA 4OM1H 2NYYC 3TBSA 3OC5A 3NCJH 1SDDB 2R15A 1RZJL 4P23D 4J7RA 5GGRA 1KPVA 3HBQA 4I9WD 2XN9A 4UDTA 5SWZD 1ZOXA 2OJ1A 3FH5A 1UWGH 4H20L 3D69B 2ZKMX 4KO7A 4PJFE 4JM4L 5D7KE 5T1MB 4APXA 5B38B 3QISA 3HCVA 2AVFA 1Z3GH 4F33B 3T6ZA 3NJJA 3EHBC 5CIPA 5T8IA 1NOLA 2ICES 4ZJ9A 2Q7NA 2AK4B 2X6CA 4B0MB 3O81A 5E5RB 2UX7A 3SDCA 3W0WE 3TESA 4B5EA 4AXWB 3DBXA 4PYGA 5DRWB 1WEJH 1JHLL 1JCKA 4XBPB 2NW2B 5G4MA 1S8DA 1EAJA 1UG9A 1FL3A 1ND0A 1V7NL 3MU3A 4BCXA 3WU1A 2ZX8A 4XVJL 4ES9A 1USZA 5EEYA 1KGUA 1X3DA 3LEVH 4J4PC 5J1SC 2X41A 2YZ8A 3IKCA 4X5XA 3NOIA 1E8ZA 2GTZA 2K6YA 3EBHA 4BZ1H 3V6OE 2EDKA 4XNUH 2ZUTA 4HKZB 5D96B 2DQUL 1BOGB 3LZOA 5ADPL 4ZMAT 2CUMA 5I66B 5F3BB 3BD4A 3DBSA 3QDJA 3JWNC 5C3LD 3DX2A 1RAMA 3P0VL 3B1TA 4ESKA 3O41A 5I1JL 2BVEA 2ITDB 3R19A 3PFUA 4N2FA 3BWSA 4KROB 1NUDA 1IARB 3F5WA 2A0LC 2DI9A 3NACH 4OLWL 4P4RB 1M71A 1A6VH 4PRBA 4PWIA 4R97B 2K6ZA 4Z6AT 2OZ4H 2RGSA 3EH5B 5B4MC 5EU6B 5HI5C 1A8JH 1RULH 2V8LA 1BZOA 1L3WA 3ZYIA 4B60A 1GYAA 2VLRD 4JFQB 3MO1A 2W88A 5BRZE 3PDOA 4ZMYA 3EJQA 3U4BH 4RGNB 5A7EA 4GMTH 3B6SA 5IWLC 4JRXE 4F80A 35C8H 1EDHA 4B50A 3PNRB 4MMZA 3H6AA 4Z7AA 4LOFA 5DHVB 4Z7VF 4UTAH 1T80A 1Q38A 3F83A 1VADA 4OKVB 3TXAA 4M93B 1TTFA 2EDQA 5G55A 4F37K 4GUCA 1FNLA 3MJ7B 2EDHA 3U4EB 3NAAH 1XSOA 3DV6A 3HMWL 3PGFL 1RCYA 5IB3B 1OF2B 5FA4A 3QDME 2FCBA 2GBTA 1OM3L 3SE4A 4IOFC 3FQNB 3W1ZA 4N6QA 4I2XE 1JFQH 1YEJH 1DQDL 2GIXA 4M9OA 4BFNA 4JLRB 1H5BB 2OA9A 3QJFA 1VGKA 4PB0H 1G7JA 1TOXA 1KTBA 2Y69B 5D7HA 3BPCA 2DTSA 3HLAB 4JFZH 1YEFH 4JRLA 4OIIL 4N2DA 5TTRA 5JYLA 2WLZA 3RVUC 4H26A 2PO6B 5C3TA 5K39B 4JQVA 3LHPL 3QIUD 1RURH 1SMOA 4Z7QF 3NP3A 5H37G 3WNNA 1QR4A 3O4LA 3CHPA 2VDOL 4JM2B 2QR0B 4KFZC 3U9WA 4XMWA 2JELL 4FRWA 4KTEH 3G04A 1EHKB 1ET5A 3GT6A 4U6HB 3ZDXF 4P9HC 2ZPKL 3CDCA 3Q5OA 4QT5B 1CDBA 2WD0A 3AS3A 2G0LA 3LZQA 4DHLA 2JKRM 2GHWB 2CBPA 1AGDB 2HMIC 1NCOA 1RH8A 3CHOA 4RQQB 5I1GL 3ZL2A 1UT9A 2EC8A 2GJ6D 4JPVL 3BT2L 2HFGL 4U7MA 3GIZL 3O6KL 4Y1SA 4FFVC 5BZXA 5DUBB 5FYLL 2IEPA 3WFDL 4QUOA 1C8PA 4AZ8A 1G1CA 4OZHA 1DUYA 3QUYA 3D33A 2NY4C 3KLQA 4I1RA 3L1EA 1X5AA 2O61A 1YCSA 4QYAA 5LKNA 4JFDB 1UADC 3C60B 3OL2A 3UAJC 1KACB 1W8EA 1BDYA 5T3XE 1FAKT 1ZLUK 1W0WB 3B5GA 3BZ4A 1MHCB 3LQAH 2OMZA 3MUUA 4FFWC 1HH9A 2EDWA 1TSHA 2FGZA 5GGVY 5T5FA 2HKHH 4HPYH 2RTTA 4QGTA 3ZE2E 4IDLA 4P5TD 1MIMH 4WDIB 4MQ7A 3P4MB 4MJID 5EZLA 4PJ5D 1KLUA 3PY9A 1L6XA 5A40E 2QZ5A 5BS0E 3AT9A 2NY6D 1PG7H 4LLYA 7PAZA 3UXFA 1OV8A 4M7JL 2BFVH 3ZKQD 5HYJD 2KDYA 1U93A 3A6CH 1RU9H 1YY9C 1PPIA 2D2CC 4A63A 5T33L 4JN1L 5TF1H 4UILH 5HYQB 4JFWA 4KJQD 1CGSH 1OLLA 2JXMA 4X7DC 2JKXA 1C7SA 1IAOB 1D5RA 4NM4L 1TTAA 3ME0A 2ESVD 5IQ9B 2CCWA 4GSUA 3VXTB 5DEGA 1I1AB 1PY0A 3QNXA 5F6HJ 1EH9A 3EH4B 2WXPA 4PVBA 1UQSA 1ZD6A 1VFUA 4RLDA 2AGJH 4MS6A 3VTTA 2NTSP 1OK0A 2CLRB 2PYFA 1UXMA 3HUJA 1E43A 1QLEL 2HH0L 3DX1A 4G11A 5JHBA 2IANE 3US9A 3OXSA 2A5UA 1YEDB 1IM9B 4NERA 1J5OL 3D0LA 1HEZB 5AW6B 2NX5D 3WTWA 5DQDH 5EF1A 2YSSB 3D5OF 1OL0A 1FNEB 3OAUL 1UCBL 1MCDA 3GBML 3DK0A 3KM1A 4K3JH 2ZKWA 4R4BA 4QRTA 4AGMA 4LSVH 4LNVA 1OP9A 2HPTA 3RY6A 4XXCA 4X7TB 3WLWD 3D48R 5K1JA 3H4HA 3Q2WA 4OFQA 3DO7B 3HUJF 4ANVA 1MEXL 3VD1A 1QNZL 5KVFH 2VC2L 3GM8A 1CFNB 3OXRA 5HVHC 2B1AL 3PQYA 1HH6B 4JKNA 3ARFC 1YLBB 2NY0D 1CIDA 2HT2C 1ZE3C 4NDMB 5FYJL 4JDZB 5AVWB 3TBWB 5DD0L 3RTLA 1RUAH 3ZXAC 1MNNA 3G6JE 2QFPA 1DR9A 3B7TA 1NGPH 4N90E 5KVFE 1MW0A 5CEXB 4S0HA 2YAFA 2A6JB 1ZA6B 2QGBA 5C0EA 4FX5A 2NY3D 1MFDL 3GQFA 3ETBF 3WY3A 4WFHD 4MNQD 2ZXWB 1C16A 3MA9L 2WZ0A 1I7TA 3V7AE 2X9XA 4P3WA 3HZVB 1K2DA 2QHRH 3B8YA 4WEUD 1OPOA 1E5UI 1XXDC 3K80A 4KRPC 4LRNH 5DZNA 4PRDA 1NANI 2QKIC 3LIUA 5DS8A 1T5KA 4UYPA 2XC8A 5BCAA 1HZLA 4LAQH 3H3BC 1DJGA 3EHBB 5FGSA 2FWUA 1FFQA 4QOKA 1CGYA 3BAJA 4OFIA 3SD2A 1EZVX 1KY7A 5DZVA 1G9MC 2I9LA 3G9AB 2BHFA 3QFJB 3SPIA 1CO1A 1CDHA 1SN2A 4YBHA 5DLMH 2LHAA 4ICXA 4RGMB 1DLFL 3HE7A 2GW5A 4R5VA 4XMPL 2VMCA 2BY2A 4RAUA 1A2YA 1FLRH 3BGAA 4JDEB 4ZMLA 3D4CA 3QAZB 2RB8A 4Y1AD 4HWEH 1OWWA 1EIBA 5E03A 1URLA 4H25A 3QWRA 4QXTA 3RZCD 1BSIA 3FTSA 4GKNB 1ZHBB 1M2OA 3HG5A 4PIRF 3UGEA 1XIWD 4OGAC 2FL5B 3M1BA 3UJTH 3QSKB 4WK2B 3QUKA 1PX4A 1Q8MA 3LKSB 5FOJA 4E0RB 3NPSC 5KJRH 5HHOB 1SOQA 4XP4L 4K5LA 2EIBA 5LO7A 2BMKB 3JWDH 5DO2D 5KS9F 4QYOB 4W81A 3QUZD 4Y4FD 4X50A 3RTQD 1D6VH 1G7MB 3CZGA 2ZAIA 5DC2A 3ZTJH 4MNHA 5D1XE 2IFFL 3MA7A 1D5BB 1EZSA 5KSAC 1WFMA 1E27B 1ZS8B 1JCVA 3TASA 3QULB 3CXDL 5IT2H 4XO8A 1KIRB 5DEFB 4IU3B 3OLDA 5BPPA 2KL6A 2V17H 4K71C 5HD8D 1H3VA 1PZAA 3ILPA 2WOBA 3BZFB 3WOVA 5EU7E 3MLTB 2EVHA 1H6EA 3TNNB 4AQAB 2E76C 3KZ8A 4UT9A 4GH7B 9PCYA 1PZCA 3DOSA 1TQVA 5HDOA 5IVXB 4FQIH 1CLOH 5F97E 4A6YL 1MWAB 3BSGA 4F91B 3B9KA 5FUOH 3V52H 3WSQL 5CBAB 1JNNL 1CU4L 5IFAH 1KDJA 4MWFB 3BCFA 3TEZA 3ZT6A 1T7XA 4OU3A 1ZT7A 3KDMB 3NZHL 2DD8H 3CDYA 3MLXH 3WO4B 1BZ9A 2NNRA 4JQIH 4N2LA 2V5MA 2X12A 3FTXA 2ZYRA 2CNZA 5F8QC 1MH5A 2FJSA 4AYFA 3DPBA 1P7QA 1WHOA 2J57A 2OMUB 1NLDH 1F1AA 1YQVL 4I9WE 4JW3A 4F93B 1CFBA 1H15A 3ZDZE 4Q9RH 1L7TH 5D1QB 1F4WH 4NQEB 1OAZL 2VNCA 2OKMA 4MAYB 1OALA 2KT6A 2VLKB 4LXFA 4Z78A 3U6XS 3LS4L 5IVOA 4KK6D 3IFOB 5I28A 3Q9PA 1S7SB 4MMZC 4G7VL 5DD1H 4XCFH 2SEBB 2NSMA 4P0DA 5DJZA 2HUEA 4RMTA 4XC1L 3KXFB 2C26A 2O5YL 3QA3B 1COBA 1QASA 1SBBA 1R3KA 4XT1C 5I8EB 5H94B 3SE6A 5I6OA 8FABA 5LG1A 2YPVL 4E41E 3GSXB 2N59A 4HIXL 5ID1A 3FUHA 4LEOB 3DYPA 4IMLB 1J9RA 4R3SA 1TMCB 4DETA 1DJZA 3IU4H 2Z4QB 1MI5A 4Y16A 1ZLEA 1R17A 1S7UB 4ZSOE 3N91A 1KN2L 3NCJL 4HXAH 1LNUA 4R8WL 2J56A 4KNSA 2P46B 5JPNB 2Y3AA 1QLRA 1O6SB 3HI1A 1VFMA 1KB5H 1UWGL 1J48A 3KYOA 1DBAH 3W82A 3GXDA 4YBQC 3RILA 5JW4Q 4FXKA 4QRQA 5J11B 3F6JA 4KO5A 5E5LA 5DRXB 3MUY1 5TH2B 4ZS6C 2QMKA 3BWUF 3PV7A 4P2RE 2OJZH 1I8LC 5C8JA 1A7RH 4ALAH 4ODUB 2XHNA 3IS0X 5ITBL 4MDJA 4S1DD 4F3FA 5MENB 4IOIB 1YDPB 3BEWA 4RCAA 1N0LA 2A7BA 2VLRE 4HQQL 5C0CA 4L3AA 2AQNA 4MQTB 1MFNA 1G6VK 5DJ8B 2XDHA 3CFBB 4I3RH 3V4VA 4AQ8C 6PAZA 4HULB 2P80A 4IRSD 4QTIH 3X12B 3QQDB 4F7TB 5DMKB 1ICTA 4B7IA 4HHGA 2MJWA 3NCYS 3QIWD 2YWZA 4QRUB 1F90L 3QUYC 4FCHA 4FEIA 1PNCA 5IROD 4Z7VE 1B2WH 1O5PA 3B5HA 4BZ1L 1FV1A 4FNSA 4IRJD 1GPOL 3QG7H 3CCHA 2FJHB 3MOAH 3O6ML 4K2UH 3OKMA 4XCYB 3D0VB 4YVNA 4XZ4A 5I6PA 4PTUA 1NBZA 1E4KC 1P69B 4KHTH 3U7YH 2W0KA 3QJTB 2RCSH 3EFFA 3MRPB 1KLFB 4GKOA 3NCXA 4ZT1A 2ZCZA 3T3MF 3H0TA 3SCMD 4F8NA 3IU3B 5I5JA 5IGXH 2ED6A 2IOOA 2BNUB 4ICWA 4KO6A 1FJ1B 3NIFB 1JK9A 3T0DA 1MFCH 1CTNA 4KJYB 4OKDA 1UD6A 3CBKB 3FB5A 4Q97A 5SWSB 1O9ZA 3HG1E 4G43A 4L4JA 4NO2B 5CS7A 3O8XA 3EGDA 3QZMA 2OZ4L 3CDZB 2QVMA 5EU5B 3K6OA 1RULL 4PJDA 2JJUA 3POHA 2D7NA 3TN0D 4WHDA 1XGYH 2XN2A 3EJTA 3QAQA 1T7WA 1EEZA 1ML0A 1ORSB 4TUUA 4K7PY 2QVIA 2VDML 1D7FA 1DVZA 2Z7WA 4NZJA 4QWWC 3U4BL 3VFWA 2FEDD 1DSFL 3MV7A 2HX9A 5EUKB 3CAFA 4DGWC 4PEEA 35C8L 2WUBL 1F97A 1PJWA 4LRIA 3PJLA 5A2KH 1LE5B 4OD2B 4O02H 1ORQA 2CRMA 2E75C 5HVHB 2OW7A 4YNYA 3ZDXE 1KXHA 1JI2A 1P4UA 2ZSWA 4MNGE 1MHPL 4NC1E 4J2XA 2ZX5A 1KJ2A 5CD3B 4JDVB 3X11B 4MSWA 4PJDF 5ICYB 5LG6A 4KKPA 1I9JH 3S36L 1IIKA 3QXTA 3W11D 3HI6H 2VXTL 2P5ED 4NI6A 3TTSA 5HYFA 4IEFA 4DPRA 3V4PH 1O7SA 5A6MA 1IEAB 4PJ7E 1IM3A 2EVGA 4PB0L 1LO0L 4LLAA 2AS5M 1I82A 2XETA 3WS6C 3FQXA 3SKJH 4JFZL 1AR2A 1YEFL 4FI6A 3RY6C 1FYTA 4JRFA 3GMPA 3L17A 4JFEB 3M07A 1MG3C 5CJQH 3QZWA 1I3UA 1AS6A 1F45A 2GFBA 2R39A 4FQ1H 2FWLB 3JV0A 1M2VB 1GGBH 4PBDA 4J3WA 4WU7A 2AXGB 2E4FA 4JQXA 3KGSA 5E1GA 1GOHA 1U8JA 5HYJE 4KTEL 3UTZB 1Z9PA 3II1A 3RWJA 2J8OA 3WTYA 4GRLB 1O75A 3ERXA 2J3SA 3LQZA 5FHBH 2Q10A 5T3XL 3IJ9A 4DGIH 4MLSA 4FQQB 2ESVE 4YHIA 4MD0A 3KL3A 4MJ5B 1G94A 1U3HA 4Y2DC 3AACA 3JVGA 1NCCL 2BSEA 3L16A 2ICWI 5I26A 4ZW8A 3SBRA 1CICB 1QFOA 3SKNA 1B0GA 3TBSB 1A21A 1G6RA 1WV7T 2YJLA 3T4AA 5GGRB 2DY2A 1KPVB 2XN9B 3FO9B 4UDTB 2HX7A 3FAXA 2VE6A 2X28A 3NPSB 3LMJH 1T1XB 3EFDH 3CVBA 3QUXA 4DERA 4IJ3C 1FFNA 1FFPA 4GLRI 3ARYA 1KYOJ 3HCVB 5CZVL 5CIPB 4HPYL 2Y5EA 5IUSA 4PJ9A 1MIML 2VJ8A 4A7TA 3SDCB 2Z4TA 4OJAA 1C7TA 4YHLL 1EANA 3T2LA 1QX1A 3DBXB 3Q1SH 4KX7A 5FGRA 1SJEB 1PG7L 4KKNA 5IMKA 2CKNA 3HE7C 3V0WL 1S8DB 2BFVL 5KEZA 3VGAC 4HOWA 1H9DA 3A6CL 2K70A 1FL3B 1ND0B 3RGBA 4NOBA 5KTEH 4K71B 3QXAB 5AZEH 1VSCA 3TP4A 1BXUA 1B90A 4M00A 4UILL 1VCAA 2A4ZA 3AM8C 3DPDA 2BP0A 3OSVA 3IKCB 4X5XB 2OLDA 3NJFA 1AGFA 4A1RA 3LJ3A 2GTZB 3ZKMD 4KROD 5IQLA 5KSVA 4OH2A 3MUZ1 4DO6A 4B9JA 2C5DC 2PXYA 2AGJL 2LLNA 3QDJB 4TSAL 4APQA 5I73C 1IFHH 4J3OF 1KYOK 2EDRA 5HI3C 4MNQE 2X89A 4PLJD 3QH3A 3RIAF 1ODUA 4NZRH 4RGND 3ZN6A 3O41B 5TJWK 4ZTOL 3PXHA 5DQDL 4PFEA 5DMYA 4X6BB 4AYGA 4EVNA 2X42A 3TFKC 4MQXC 3F5WB 1Q9WA 5E94B 1EAOA 2FYYB 4K3JL 5C2BH 1F6LL 2ZNXA 3PHOA 4PRBB 1M71B 3FBQA 5E2UH 5G5DA 1FRGL 3SBWC 5MHSD 4GAJH 4G83A 1EBAA 1IC7L 2YPKA 1X5GA 2VLLA 4B9KC 3OB0H 4JFFA 4W9KC 4C57C 4FS0A 3MO1B 3FN0H 1DQLH 2H0EA 3FUJA 5KVFL 3B6SB 1P7HL 4MMZB 5J5EA 1VERA 1JF1A 2YQ3A 3GS4A 2DLFH 4JG1H 1WA1X 1BEYL 1VADB 2HB0A 5K9QI 3C6LA 5ISZE 5I1AA 2ZNWA 3O0LA 5LBSL 4J3OG 2VM9A 1OZUA 2NY7L 3FU5A 5AENA 1QTSA 1RUAL 5JXAH 1G4RA 3I2CH 5JIIA 5F7EH 3ILQC 1Z9NA 3DV6B 5IQMA 5T3ZD 4F8PA 2KLSA 5FA4B 3W39A 1RFDH 2PO6D 4PJBE 2XWCA 1E5AA 3IN2A 3GUTB 4HCRH 3RL2B 4BFRA 1FA4A 4R7LA 4I88A 4X8GA 4JM2D 4RMQA 1JYWA 3K5RA 3QJFB 1VGKB 4P3DA 1J1OH 1G7JB 1LEKA 1X5ZA 1DLHA 3CZEA 3REVA 3MGTA 4UT7H 1DBMH 5F1OB 3HG3A 2EABA 4I5BB 5KS9E 3BPCB 2CBQA 2XQYA 3LDBC 4PJEE 2IMNA 4LRNL 5K9OA 1G7IA 4M1GH 1JVOA 1QWHA 3TV3H 2UUDH 1DJYA 3GSOA 1J88A 4H26B 2N3JA 3FSZA 1WP6A 5KVEH 2WZPD 3O4LB 4LVNC 1Y1DA 5J6GA 2GIMA 3WFBL 3G04B 4JFDD 5L9DH 2DQHH 4DP8X 4E9VA 3HTLX 4PRPA 4HIQA 4LCUA 2ARJA 1JWUA 4NPKA 3BWUC 1IB5A 5DI8A 4YH6A 1XSJA 2J4WH 4HWEL 5J4MA 1WE5A 5KVEE 4JFOB 2BNRA 4IBQA 5J8OA 2ZD0A 1PNDA 4IMKC 4Y16C 5I75C 4ONGH 1JTTA 4OBSA 3P3SA 4OZHB 1DUYB 3ZL4H 3QUYB 3LEYH 2WBJA 3GWJA 1UT2A 3HZ3A 4H0LC 2Z91A 3VGFA 2B77A 2Y6SC 5IJCC 2O61B 4DZ8A 4YS4A 5HJ3A 1AOHA 2C7FA 5PCYA 1JZJA 3FUEA 4PJHF 3I9GH 5BO1H 4WW1A 3JWDL 5HHNB 2VUKA 5AW7B 3WKPA 2X2UA 2ZSVA 3U4KA 5LLIC 1LEIA 4P57A 3BZ4B 2OMZB 2XXCB 1HH9B 3NH7L 4LMQE 3CHQA 4HSAC 1PZ5A 2EEXA 1SEBA 3TBCA 4HJ0D 1AACA 5IT2L 4MQ7B 5EZLB 1MRCL 5DK0A 4R4NC 1KLUB 1I1AD 1F4AA 3ARDA 3LOWA 2ZUWA 2XQYG 2Z9TA 2IWFA 1QABA 1R0AH 2V17L 2DB8A 2WBWB 3HHSA 1KXQA 1YPZE 3FH7A 4WU5B 5CHNB 5JIHA 1LK2A 2QGEA 3WFCL 1QI3A 1QO3A 1QW9A 4JY4B 4GW5A 3CZNA 6PCYA 5CJ5A 5GJTH 2AV7A 1IM9D 2JXMB 1QBAA 1P4IH 1CLOL 2QADB 1NFDE 5HXMA 4PJIA 1ID2A 5DYFA 3RKDD 3ME0B 1I1FA 4BSVB 5IFAL 5B1JC 5DEGB 1JMXA 2EEAA 3QNXB 4UOJA 2EP6A 2YAHA 4M1DH 3U7WH 1I1CA 4LCWA 1Z0NA 3QPXL 1UOLA 1KZQA 1HN1A 1UQSB 2DD8L 4M7LT 3EJSA 4DN4H 3MV8A 1NCUA 1XAKA 3MLXL 4QO1A 4JQIL 5TDOA 2PYFB 5BW7A 3IVKB 3CVCA 4GY4A 4CVWA 3A23A 1YC8A 4NRZA 3WTXA 5DS2A 3OXSB 3VWJC 5HDBB 4XC3H 5E6IC 4HUMB 4YDLB 4XAKD 3WGVB 2IBGA 1FCCA 4FQHA 4ES8A 3E9UA 1SJMA 4LVEA 4R4BB 4NZTL 4Q9RL 1AGCA 1EK3A 1L7TL 3AQZA 1F4WL 4GG8A 4OFKA 4QRTB 4ZO6A 3FFCA 4F2ME 3O4OC 1NIAA 2NYKA 1FO0A 2UZXA 3NCBB 3BDBA 1G9EA 4YDMA 1JK8A 2ZIDA 4P99A 4XI5C 1EXUA 4FG2A 4A7SA 1W2KT 3NJKA 4TVPL 3WNIA 3INOA 5HI4C 3OXRB 3VXPA 1VEMA 5DZPA 5D70L 1JYXA 3PQYB 2MRYA 1EZVY 1I8AA 5KVGH 5I17A 5CAYB 4PRAA 2YWYA 3JYBA 1OSPL 4L4TA 2LU7A 1NUFA 4X6CE 1ZANH 4S1QH 1RIVL 4YJZL 3FPXA 1XH0A 5DWPA 4A2LA 4FABH 1UWFA 5C0EB 1R46A 3K46A 3OJDA 2GJPA 3EHBD 1ERNA 1T83A 2QDVA 1JV2A 3CPLA 2WLMA 5KVGE 1C16B 4I3SH 4HXAL 1D5XA 5FV2A 3EUUA 3QFJD 1I7TB 2AXFA 3UO8B 1K2DB 1YZZA 3MBEC 1KB5L 3T3ME 5D71H 3W5MA 4XCEA 3COOA 1PVHA 1U8CA 3MGOA 1HJBC 1KIPA 2Q76A 3KBHE 4HC1A 5DS8B 3ZMEA 4CVUA 1D3CA 1T7YA 2OJZL 4JQXC 5EC1A 1A7RL 3E6HB 1GKEA 4QOKB 5EFIA 4ALAL 5IJVB 5JXEC 1WBXA 1XZWA 4RSVA 5KW9H 5FK9B 1FL6A 3BN9D 1H8NA 2W81C 1MCOH 5DJXA 4XPHH 5HHOD 3HE7B 2QLVB 3I6LD 4QTIL 5KAQF 4RAUB 3VGAB 4M1CD 5FM5O 4WWNA 1A2YB 2RR3A 1HEHC 3FCBA 3ZE0E 4HUXA 4F8LA 2EDXA 2CO3A 4N0UA 1UWXK 1LO4L 4H25B 4QXTB 3U0WH 1DP0A 4GQ9H 2GY5A 2KLTA 3ARTA 4DT2A 5JMOC 1DANU 3M1BB 4DP6X 4XCNA 2CCVA 5AAWA 4HIHA 4CW1A 4OGYL 3F6LA 1WIUA 3WO3B 4KHTL 3QUXC 2BXZA 2RCSL 3GZQA 3WKQA 4DNLA 4MS8C 4RVBA 4GP4B 4PJAE 3SKUD 3DO4A 2UWEE 5I6KA 1CE1H 2DYPA 3MA7B 3N6YA 5IGXL 4ZX6A 4DKAA 3HI5H 1QYGH 4LU5L 3UAEA 2R1YA 4XVTL 1A14H 3FOMB 2VZOA 3JQOB 2MCAA 1CYGA 1DTUA 4QXUH 5KAQG 3EDJA 3CK0L 3DK2A 4L8CA 3IDIA 4J3OC 1I8MA 1IT9H 1XGYL 3OKOA 3ILPB 2DLIA 3BVTA 5IW3A 5IZ7A 4DGVH 3MZTA 1ILSA 2CH8A 1SUHA 4WV1B 1DVXA 1W6LA 5F7DA 1JXJA 1MPAH 2MPAH 3EUDA 4PRIA 4U2YA 1A7QL 1MCWM 2FHFA 4O02L 4WO4A 1ZLUH 3B9KB 1YYLH 3SGKA 5AAMA 1WFJA 3UH8A 7TAAA 1YUHA 3OBAA 5D1QD 2JK5A 3ZSTA 3AWEA 1ZT7B 4PJ6A 3KCPA 4MAYD 4RISH 3B56A 4LHUA 1BZ9B 2VLKD 3DTUB 1I9JL 3BVNA 3VWKA 5KOMC 1MH5B 1JWSA 3SPHA 1XDTT 3HI6L 1MCLA 4AYFB 1J5IA 2Q2EB 1CXHA 3DPBB 3RGHA 1GSKA 1MREH 1J9SA 1P7QB 1PGRB 3VQMA 4CMHB 4CN4A 1MCEA 1Q1PA 3FQRA 1B2YA 1H15B 5C0NC 3KXFD 4B5ZA 5JW4R 5CZXC 1KXVC 3PPEA 3VG0H 1FGNH 3SKJL 3TIDA 5ID0A 1WUNT 2W59A 4JRYB 3PAUA 4JJOA 4QRBA 1NFIA 5DVMA 2KQNA 4AQOA 3DHJA 4Z78B 4KZCA 5CJQL 4DW2L 2OM5A 3ABLB 3WIHA 3T04D 4IOSA 5A1AA 2HMID 1JGIA 4KU1A 4FQ1L 1LMIA 2APFA 3DUHA 1GGBL 4NHUA 3OV6A 5KBPA 1IZJA 5FCSH 2DMGA 4AG4H 4DK5A 5DJZB 3MVSA 2EADA 3QYCA 3C6LC 3LZFH 4PJGA 2VN3A 3OF6D 5LDUA 1CN4A 5MEQA 1ZGLP 1TSRA 1DE4A 1R3KB 2OXHB 3E80A 5DT1H 1H19A 4YFLF 1UJ3C 1HQRB 1R5IA 2WTPA 3OZ9H 4G42A 4NENA 4YHMH 3H3PH 8FABB 5FHBL 5ID1B 3NEOA 3MLPA 2G9KA 1II4E 2LLGA 1MAML 4R3SB 4IBUA 2YXWA 2AI0H 5FUZL 1TEGA 3BAIA 1MI5B 4Y16B 2ORBL 1VJSA 2OYLA 3ZTCC 4GAFB 2D0GA 2FB4H 3D8MA 3NSFA 5CCKL 5MEND 4JFXA 1D9KC 3AROA 1QLRB 2TSAA 3HI1B 2Y7SA 3AJ7A 1H3WM 3B34A 5KANI 3LMJL 4LHUG 3EFDL 1TQUA 3KYOB 4PGZA 4N86A 2CALA 3MROB 4FXKB 4QRQB 1GZHA 1SLUA 3ABZA 3KLSA 3DHUA 5C8JB 4ACPA 2ZAGA 3ARVA 4JZOA 3IEAA 1T66D 4K3GA 2Y9RT 5MHSE 3BOVA 1X5JA 4AYBA 4F3FB 2P52A 3ILDA 2GC7C 3DUUA 3BEWB 4S1RH 4BHUA 2Z1PA 4Z7OF 5IB4B 4GMSH 3IMUA 5HTSA 3V4VB 3JVFC 5I71C 1G9NC 1YQ2A 4PI0A 1GZPB 1DJIA 5EIQA 2VN5A 5CCJA 2P49B 2W1NA 2FX7L 4RGOH 5AZEL 5GISH 4DUVA 1KTJA 3ETSA 3WKMH 2HVKA 3FCSA 1HTYA 2H1LM 4YQXH 1INEH 2IQ9L 4Z7UA 3TNMA 2W65A 2WBJC 1BVNT 3L08A 3OLEA 4B3EA 4LBEA 4Z3IA 4YMPA 3IRZA 1FV1B 1BM3L 1XF2A 3CCHB 3GLZA 3L4TA 4OZ4A 5GIRA 2E9BA 4A38A 1YN6A 3ATFA 3OKMB 3QP3A 4XNQA 3Q0HA 4HJEA 5IF0A 4PTUB 1EZLA 2B1HL 1NBZB 3HBZA 4FD0A 3VTMA 4FG6D 4GNKB 4ENED 1TR7A 4Q9CA 5MEOA 1IFHL 4YIQA 3H0TB 4X4ME 4RRPG 2NT1A 3CMGA 3PGCA 1X5FA 4Y5XA 5AW8B 3K91A 4NZRL 4YSUA 4FTVB 3LB6C 4X9IA 3S7GA 1MQKH 1L9MA 1JK9B 4Z7UF 3EO9H 2BP8A 5EF0A 1SGKA 4PG2A 3V9CA 1IC0A 5CGTA 3TU6A 1BX2A 2IAMA 3QR0A 3ARDC 1SPDA 3ZPDA 1GXEA 4G43B 3WIIH 3CWGA 3O8XB 1KDIA 2P44B 2BCMA 2P47B 4PJDB 1NAKH 1HKFA 4S10A 2EXWD 1EEZB 3O4OB 4Y9FA 4EE2A 1KYUA 1UA3A 1DQLL 3C5ZC 2B9AA 3MV7B 4GG6E 1WZMA 1AOZA 1E3ZA 1IGMH 1JNJA 1USQA 5JHLH 4JFDE 1KJMA 1ORQB 2IADA 2G0KA 2VAAA 3HZMA 2Z92A 2XX1A 1JDAA 2X4UA 4UB0H 3GDBA 4OCRH 3T0VA 1KJ2B 1XXFC 4XNAA 4AV5A 2B20A 1R24A 2JI1A 4M8VA 3GRWL 3UDWA 1T1ZB 5F7EL 5BW7C 1WC7B 5J13B 4NN6B 1S7VA 3DVGA 1OAJA 3VSQA 4HCRL 4IEFB 5C0JA 3GJEA 3J8F7 1IM3B 3C75A 4TTDD 3DGDA 1I1RA 1J1OL 2J8UA 2WC7A 3FQXB 1DBML 1MW1A 4UT7L 2VQ4A 3LKQA 1FYTB 4X9GA 2E6JA 3GMPB 2H7WA 3TV3L 3GRGA 4GRLD 4PJ8A 4AOFA 3QZWB 5L88H 5DURB 1UXLA 2GFBB 3U1SH 2J44A 3SGDH 4LSQH 2VL5A 2Q0ZX 1JRHH 3MLSL 4KKBC 4N0FA 5BO0D 2BWIA 3BIKA 2PN5A 1CVSC 4WU7B 3BFOA 4YFDB 5TGBA 2J6EH 1NAMA 1U8JB 2IF7A 4RNRA 1CICD 1ETJA 3GB7A 1UOVA 3RWJB 4P8QA 2X4RA 4C47A 2DQHL 2H1PH 2J8UF 2XN9D 2DDQH 3ULVF 2PLTA 3BVWA 5GS3A 3NEXA 3S5LG 4DUXA 3CG8A 2UZIH 3LQZB 3K7UA 4R5XA 2YUXA 2VXQH 4UIKH 1FIGL 3QBTB 4RZCA 2B08A 1YHPA 4YHIB 1C5CH 2DWXA 3MJWA 4MD0B 1EQWA 1WT5A 5IK3A 4UV4H 3SGJA 3V5HA 1U3HB 1T2XA 3LEYL 4TQHA 3SDCD 4K55A 4B0MM 4C55A 3SKNB 1B0GB 1G6RB 2G2RA 4OTXH 3NIGF 3T4AB 1HKLL 2W9DH 3I9GL 5BO1L 1AZVA 4QJ4B 2VE6B 3IXAA 5HYEA 3DX8A 4OF0A 5D1ZC 1E7UA 1FFNB 2JF1A 4HFUH 4XX1E 1MHEA 4AV4A 4YSQA 4XMXA 1MOEA 4UAOB 4PJ9B 4CU8A 4ODTL 4ODXA 3ZKND 4K0OA 4CNIA 4BKSC 3BAYA 5FB8A 2WOYA 4Y4KA 5HP5A 5IMKB 1T4WA 2CHNA 4YDNA 1R0AL 3H9ZA 2YK1L 4S2SA 5EOQH 3MNWA 1NM4A 3QDJD 2N4IA 2X1PA 5DGQA 4N4YB 5GJTL 2BP0B 5IHUL 1P6WA 2EDTA 4QJ3B 2BNQB 3DXAE 4QRRE 4KUCD 1AGFB 4KITB 3SOTA 4HAFA 4ZMWA 3FCTA 5EWIH 3VVVA 5KSVB 3GMMB 4M1DL 4A7GA 1NIBA 4AUYA 1ODAA 2CDEA 1IV8A 1DJHA 2PXYB 3O0RL 4UQIM 3BAWA 3KPLA 4NO0A 4APQB 5JHAA 2FQDA 1MXGA 4O2CA 5E9DA 5CZRA 4PS8A 1J0HA 1FIEA 1HHIA 3QH3B 2ZG3A 4LOUD 1KEMH 1JDCA 1OGSA 3QFJE 5I16A 3RVWC 4KXZI 1M3IA 3RWEB 2BWDA 4EVNB 3NBNA 3FYIB 4XHJD 1YYMH 2ENQA 4GRMA 3SJVA 1J05A 1BBJA 5G5DB 3PE9A 1OGAA 4K9EH 1QPKA 2X1XR 1BHGA 4AH2A 2YPKB 2WTOA 5GGSY 2WY3B 3M45A 2DF3A 3IBEA 4JFFB 3NTCL 1G7QA 4ZUSA 2F7IA 5HHQA 1U36A 4RSYA 3LIZH 2R23A 4M8QA 3MLZL 4JFPA 4N2AA 4K5OA 4TUJA 3N43F 3W38A 5TQ0L 2V7NA 3SGKC 2PCXA 1FWXA 4EIBA 5HHOE 2ICWA 2BWQA 4DP7X 3CGTA 5KVGL 1JERA 4L8SA 3C6LB 5IFHH 5I1AB 5M95B 3SDXE 3M6DA 1AHWA 3BSZH 1AQHA 5DTFA 3M17A 2CGRH 4JL1A 1QSEA 3SPCA 2UXTA 2ZUUA 5SWQA 4Z3TA 4FABL 3WTUA 3ULSA 1E4WL 2WWKT 3O4LD 1MWAH 1Q72L 4I3SL 3TOPA 2P42B 1FORL 1RIUH 2JQAA 4P3DB 2KPNA 1LEKB 1R3LA 2DTMH 3QWOA 1DLHB 3MGTB 4N2CA 1KN4L 1BMWA 2ROYA 3V4LA 3OR7A 5D71L 5KBMA 4X5WA 1EGJH 5K9OB 3I9AA 1G7IB 1VHPA 3MYJA 3PYCA 4JZJC 4N1EA 3A67H 3HB3B 3GSOB 1E8XA 5A16A 2R1XA 3PABA 1UD4A 3KWWB 4N2GA 5IVXE 3LNEA 1PKQA 3OKEA 5ITFA 1OSEA 1SXNA 2GT9A 3UTTE 3R4DA 2GHZA 3Q48A 4GEJA 3MLVL 2ZF9A 4LSRH 2G5RA 3QUYD 4MBRA 4OQTA 4RDBA 4WSKA 2X1QA 5KW9L 2YD8A 1KCBA 5J6GB 2YD5A 2XKSA 3RVTC 1MCOL 2DEXX 1SXBA 3VH8B 1MCIA 2WP3T 5FW7A 5BMFL 1QI4A 3CVIH 5I71B 4PRPB 2R69H 4LCUB 2ARJB 1JWUB 4ZPVA 4BFJA 5DI8B 3WUZA 2Q3AA 3IWUA 1TUPA 2BNRB 1P7BA 1WITA 2Y5TA 4X80H 4PSRA 3R1GH 4MMYA 1INQA 2WBJB 3M88A 2FNWA 1EMTL 2UZPA 2Z91B 5D1QE 1YYCA 3FTZA 4U1KA 4CBPA 4DZ8B 1ANUA 2XY1A 2YPLE 5HJ3B 1VFOA 4QKTA 4JG9A 3N40F 4HIJA 4D8OA 5F7BA 5A6LA 4GS7C 1LEIB 4P57B 1NFAA 4XO9A 1CE1L 1HI6A 3CVDA 4UBDD 1PZ5B 1QYGL 4QWWD 4MA1B 2J43A 1SEBB 1YEIL 2VLJE 2VO5A 1A14L 3KXFE 3LX9A 5E1QA 4WUUE 3NJIA 2QADD 3FTYA 5DK0B 4YXHH 1A4CA 5FX3A 3W9EB 5KBLA 2X3AA 4QXUL 1TLKA 2O5ZH 3ZHKA 5CXPA 3ARDB 3L3GA 3P4NA 1FBIH 3NESA 5A2LH 3QXWA 4NQSA 1IC4H 2GY7B 5INDA 3T8MA 3MMEA 2XVGA 4DGVL 3D87B 1LK2B 3BKCH 1QO3B 4GINA 4GW5B 3VI4F 2NR6A 5J56B 1BQUA 4M61A 5JQ6L 2AV7B 2ZUVA 3W2DL 2DQDH 2C4FT 1ZDSA 2D3NA 4PJIB 5IHLB 1YYLL 1I1FB 1U8NA 4JO1H 1LP9F 3C08H 2VUOA 2O4EA 5CFHA 5MERA 4L1LA 4W9FC 2OMVA 1WD8A 4LCWB 4P06A 4F7PA 4CSZA 3V4UH 1OTUD 1TQSA 4RISL 3MV8B 2QVTA 5TDOB 4X8XA 4Y5XC 1C5BL 1I9RL 4NRZB 3FU6A 4YXLH 1AJ7H 1WGOA 3SO3C 1PF3A 1MREL 5MENE 4HEME 2IWEA 2BY3A 3L4YA 3AY2A 4PJCB 4X4ZA 2CO7A 4LCYA 5F6IC 4FQHB 4XWGL 4LSSL 3FXIC 3PQYD 5EEXA 1XBDA 5IMMA 1FGNL 1AGCB 4GG8B 1ZGLM 1AYRA 2M83A 1QTYT 2O72A 4FGMA 3FFCB 5D4JA 4CGUB 3ZT7A 5KG9A 3VFNA 3ZT5A 2UZXB 2ZP0T 4UI2A 3VGHA 1BFSA 3N85L 2AQTA 3IGFA 3VXMA 1BGXH 3S4SA 1OD9A 2YO3A 5JO5A 1MWOA 1KFAH 4CAGA 1TJIL 3VXPB 3DO3A 4E68A 4Z7OE 3LZFL 1RP8A 4QRPA 1RK1A 5I17B 1PEZA 4PRAB 5K9QG 1I7UB 3UDWC 4YHML 3H3PL 2FR4A 4L4TB 3GLEA 1G84A 5DUMH 4WKZA 3QARA 1OGPA 2OTWA 2XV0A 3D9AH 4WW2F 2AI0L 1CD1A 3HC3H 3OJDB 4I9XA 4KXAA 3HEIB 2CR6A 3F12A 3CPLB 2KZ1B 1JV2B 3BJLA 3L5JA 4H1LG 4QOKD 2FB4L 2CHWA 2Y07L 4LPTA 4NBZB 3ULVC 1D5XB 3GSQA 4J3SA 2AXFB 2VDLB 2BPBA 4KQ3H 1ZK5A 2W9EH 3JBG7 43C9A 1QPXA 3ZYZA 1XCXA 3HE7D 4PUBH 4XCCL 3QR2A 4RA3A 3P3TA 4XCEB 1J1XL 1U8CB 3TYFA 3MXWH 1KIPB 1A8ZA 1ZDQA 2Q76B 4XMUA 5K9JH 2DH2A 1EFXB 4TUKH 3P2DA 4S1SL 3SODB 2VR5A 5EC1B 3P4LA 1WBXB 4R0LA 1FL6B 4G82A 1U33A 2YXFA 1N10A 2ZCLH 5DJXB 2BX5A 2H3KA 2R2CA 4ILDA 1VF5C 2B8OT 2ENSA 4H2AA 5T5NF 5KJRL 4A2DA 3WKML 3U9PL 2BOBA 1JZIA 3L8QA 1INEL 4G9FD 1A9BA 1NGZA 1BYOA 2HRPH 4HUXB 2GABA 3T2OA 4EQ3A 5EUOA 1WT5C 3BQUA 4N0UB 4UTBA 1T3FA 2XCMC 3EFOA 4IHOA 3HRPA 4N2HA 2VZTA 3LCYA 3F65A 5JHMA 4AGPA 4N3UA 2N01B 3QUML 4HIHB 4CW1B 4MQXD 2PW2A 5B22A 1S9YA 2EJ1A 3QEGH 3KPQA 2XSKA 2VDPH 4OCMC 2G4EA 2VT0A 4NI3A 5ENWA 1GGIL 2DQTL 3CDFA 2OBGA 2HXAA 3CSPA 2DYPB 1JNLH 2DI7A 3BZDA 2EVJA 3QRGH 3S5YA 3VD4A 4KI1A 2P8MA 4E9XA 2XXFA 1TXKA 2R1YB 2GBVA 5EUOF 4DUWA 1VZIA 3B2VH 5HY9B 3FRPA 1NBQA 4G7YH 4Z7WE 1QBMH 5GGSA 1V8HA 4NAJA 4ZAKA 1I31A 2VGLM 4N9OB 3B9KD 4YN3A 2W38A 5T5NG 4KKCC 3ZE1B 3LPWA 4L8CB 3BH4A 2OP4H 3IDIB 1W0VA 2OYKA 3PP4H 1NAKL 3ETTA 2LVCA 1F3DJ 2GYSA 2VITA 2B4CC 2HJKA 5MEQB 3DARA 3GMLB 4B9YA 5CIPH 5F9JA 2OMXB 3AADB 3GHPA 1IGML 1P7QD 4PRIB 5JHLL 3DETC 4WO4B 3I02A 1HL4A 1M53A 4K15A 3LRGA 3HVDA 4OCRL 1OHZA 5JA9A 1YUHB 2JK5B 4WEMB 5BQDA 1JZDC 4JRYD 3T3PB 5E4EC 1SVZA 2Y2TA 4FNPA 4LHUB 5KYYA 3T0EA 2VMFA 2ZQKA 1FUNA 3ESMA 4WVRA 3VWKB 3BVNB 5L0QC 2JKTM 1U8OA 3S35H 3FTGA 4M5ZL 3BYYA 3CLFH 1NEZA 2ZWYA 5IBLD 3KE0A 3WG7B 2EH8H 1JXFA 2LTQC 3FQRB 2HT4D 4POZC 1PMYA 4WK0B 3TIDB 5ID0B 3RGVC 1NFIB 2V4LA 4JEGB 3K6SA 4UQCA 4OT1H 4M03A 5ESQA 4MQSB 2XG5A 4WI2A 5CSZA 2X4TB 4LSQL 1JRHL 3FRPG 1IGYA 1MI5D 1GHFH 4Y16D 2J6EL 4FA7B 2RH0A 3ZKXC 3E8UL 3BD5A 4I4WA 2EUXA 4L8SC 1DFBL 4PJGB 2KKQA 4H8VA 4KK8C 2PPFA 4YC2C 3CHRA 3T2PA 3AW5A 4LB8A 2L7QA 3MRIA 2H1PL 1S7TA 3QDJE 4RIRA 2GUOA 1DE4B 2APXA 2D4FA 2DDQL 2VXVL 5C09A 3SO5A 3ZJAA 4NENB 1SZNA 1R5IB 4KVNH 4G42B 4YHNB 3GSNA 4KK5C 2IDFA 1FZKA 4IDJL 1D2PA 1C5CL 1CURA 4UV4L 1VEOA 2P7TA 3VGDA 3PPSA 3ZDYB 3VYPA 2YSTA 1RJYA 4PJXA 5FAAA 2HWZL 3OWRA 4OTXL 2P45B 4JFXB 5CLYA 1MJUL 1BEXA 3MFFA 2E4TA 4NJ9H 2W0PA 4XGZA 1MXDA 4ZYKA 2ALWA 3RWDA 1WZKA 2HTKC 2LFGA 3LXUX 2E6QA 4JHAH 1NEZG 5I8OL 4TXVB 4Y7MA 4TV3A 5B7EA 1JG9A 2R29H 1G1KA 4JZOB 3VCLB 4Z3FA 2EDFA 4R83A 2XKNA 3S0PA 4CKVX 2FK9A 4HUWB 4TM9A 1A3LH 2I32A 4LESA 3DUUB 4PJXF 3MLWL 3EZ8A 2ZF8A 2WUCH 4YDVA 3OD3A 4LIQH 1R3HA 5EOQL 4NXSA 4F7EA 3HE6A 3MYZA 3O45B 1LHZA 2HVKB 3FCSB 5FW6A 1YJDH 5E51A 1FHNA 3GEFA 4FFZH 4Q6KA 4Z7UB 1EEUA 2FYVA 4FTVD 2W65B 4HAGA 3MQIA 3TNMB 4NP4H 4LBEB 3SDDC 2YFNA 5KBDA 1OAKH 1PZSA 3Q13A 1XF2B 4HPOL 4JANA 4OZ4B 5GIRB 3GBDA 1YN6B 4LIQE 4P2YA 4RH4A 4U3SB 2VZ1A 3O8XD 4XNQB 5IF0B 4OI7A 1RMFH 1C08B 4PV9A 4KVPA 4NYLA 1EWHA 4FNRA 5MEOB 1E5CA 4J8QA 3E3QE 3PGCB 3O4LE 4I18A 4KKAC 1DVFC 2AW2A 1FG9C 4YLBA 4XI5D 3KPNA 3RPKA 4JKKA 3CFJB 3ZTNL 2BP8B 4NQXA 4NUGH 1KY6A 1YYML 1BX2B 2IAMB 3J7HA 5DRZA 3NRQA 4WKXA 1DN2A 1T22A 2H3NA 4K9EL 1UWXH 1L5GA 4JR9H 5JOEA 3E1F1 2GSIA 2WSKA 5ABAA 5I76A 2GK0A 1M6UA 5E24E 2NR6C 1Z9OA 3WKYA 4ZMXA 1IMHC 2CK0H 2DW5A 4YSAA 3RWGA 2EKSA 3DIDA 1IJ9A 3NDZE 1KJMB 1IM3D 2IADB 2VMDA 2VAAB 4NQQA 3HZMB 2Z92B 4PGCA 2X4UB 4PLNC 2AJ3A 4JPIB 5IFHL 1XF1A 1W91A 1LK3L 2VXSL 1PG7W 2IOIA 3PWJA 3BSZL 4FG0A 1E28A 1MIEH 1FYTD 1R24B 3CZFB 5CD5C 2EZ0D 3MV11 4YLCA 4YHOH 3EOAA 5DURD 1S7VB 2WN2A 3F84A 2VW6A 3DVGB 1SDYA 1E3FA 2AJSH 4RESB 2N0KA 3GJEB 1XF4A 3CVHA 4CN6A 5J12B 2IDQA 3TYGL 4RFNC 4CVXA 3UGUA 2DTML 2J8UB 1JZGA 3KWUA 2NZ9D 5K5YA 3UYOD 2CZNA 3LKQB 4G71B 1ZT4A 1EGJL 4WW2C 4G80B 1NFKA 1AHKA 3A67L 2YGOA 2DQCH 3TWYA 1BAFH 5DVPA 4PJ8B 2JV6A 1WCBA 2Y1YA 2WXOA 4WJKB 4LP4A 1JZ8A 1AO7E 4N0FB 3BIKB 5AG9A 1U3HD 2R4RH 4XWOC 5TGBB 2BSED 5TE4H 1NAMB 4RNRB 1X5HA 3GB7B 4M56A 3E6FA 5AWNL 1KGWA 2X4RB 4NN5B 3CVIL 3VUAA 2R69L 1NQBA 2VQTA 3V0VA 3UJIL 1EHXA 3VI4E 3OTTA 2GBAA 4BK4A 4KH9A 2PCPB 2YEZA 2ZUSA 3QEHA 5HDBE 3ZUCA 4RZCB 2A6KB 4MRBA 1YUKB 2V5YA 3ESVF 1M9WA 3V5HB 3R1GL 5CJBA 2AQSA 2E7CA 4PJ9D 3US0A 1U4EA 1ZXQA 4YPGA 4TNVF 1FZJA 2G2RB 2OI9B 3LTVA 4AMWA 1W9XA 4U1JA 4M43H 1QUPA 4I7ZC 3IXAB 4J3OD 5KANG 3RNQA 2QLYA 3DX8B 4FFYL 4J5VA 3VXRA 1Z3RA 1HXMB 2P43B 3PAVA 2YRZA 1MHEB 4L23A 1JD7A 2BLFA 2G3NA 3AAZA 1HOCA 1GS6X 2A9DA 1S9VB 2D7OA 4JZNA 2D2OA 4MB1A 3PQYE 3IKKA 4P4KA 2BNQD 2IV9A 3ATEA 4LASH 4MRCA 5CSGA 5C0AD 4CNIB 3N9GH 2Y36H 4L05A 1VKXA 4OSUL 1J9TA 4MJJA 5FB8B 2YA2A 4Y4KB 3O9WA 2CG9X 2X6VA 4FI8A 3VD0A 5A2CA 3EH1A 2YHGA 4X9YA 5TQ2H 3EDEA 3OHXA 4S2SB 2PXYD 3FUFA 5DUJA 3MJGX 3MNWB 2Y5QA 4APQD 1IKFH 3TVMA 3WLBA 2XVKA 4EUPA 3PHQB 1A7NH 2DQDL 3PHSA 1BVKA 4H13C 2YLKA 4XMLH 3FCTB 3LKOA 3KWXA 4U3HA 1WZLA 2A1WL 5F1KC 1SOXA 3D3VA 1TJHH 1QWNA 1KT2A 2CDEB 4LLUB 3V4UL 4EZLA 2YKLH 1J8HE 4KUZH 4KTYA 4M8UA 4EBQL 3IAQA 4XN2A 5E1AA 4YDKH 2EC9U 1M42A 4P46A 2Y1AA 3KPLB 1VENA 1EXHA 5BZZA 4JFFD 5E9DB 5CZKA 1HHIB 1AJ7L 4F1SA 4MZIA 5I16B 4LKCA 4WI8A 4XNMA 5FPIA 4WGWB 1TZAA 1ZSHA 2LTQB 3Q9QA 5AOLA 5TPWH 5IHHA 3K6IA 4M5YH 4M6NL 4YHYB 2BS71 3UTOA 3D18A 3SJVB 3P30H 1J05B 1BBJB 2D0HA 2IH9A 3C6LD 4XVUC 1OGAB 2JJSA 5DWUL 2BZDA 4OF6A 4AH2B 4N8CH 1PD1A 3MCLH 3DNKA 2OTPA 5GZNC 3B2XA 1G7QB 1BGXL 2NQ3A 3GBNL 3GO1H 3ISRA 4ZUSB 5HHQB 4KZDL 2R23B 4M8QB 1PG7X 4JFPB 5E1IA 4X83A 1KFAL 2MHAA 2ZX7A 2QPDB 4TUJB 2ETWA 3H1ZA 4K23L 2V7NB 3NJGA 3GF8A 5IQ7L 2LLLA 2D7TH 1W15A 2ICWB 3QPQD 1IFGA 1PEWA 1P9MA 3ZKXB 1BQKA 3T6WA 4L8SB 5HVFB 1S7XA 1SOKA 3OAYK 1MJ7H 1AHWB 4G9FE 2EE6A 3CH8A 2EXYC 4WTQA 3T0EC 4KJWC 3HBGA 2FRGP 4PG9B 5KVDH 5DTFB 3ARZA 3CDGA 3M17B 4FHKA 3HB3D 1DZ0A 3D9AL 5SWQB 5C9JB 4DQOH 1T4KA 4ELMA 4UT9H 2QKSA 4ZNEA 3ULSB 4K73A 2F5AH 2KLRA 4LK4A 4EO5A 3FTWA 1SMDA 4RX4D 1SF5A 4RZKA 4OAWA 4UNVA 1R3LB 3QWOB 4XPAH 4Y9EA 3DLQR 1U8LA 2YARA 5KVDE 2XPZA 5GZOA 3OR7B 1DBKH 4U31A 1QSFA 4NWUH 4PUBL 3ZW3A 4HKBA 3MYJB 4PRPD 3WN5A 1JYNA 4MJHA 4QHLA 1Q9KA 4U4BA 4TUKL 1PKQB 3OKEB 5PAZA 3RDTC 5ITFB 4CGTA 4NB7A 3N44B 3L3KA 3JV6A 2WBJD 1TLMA 1NOAA 1KFGA 1NH6A 2FUQA 4JREB 1ZLVK 3I6GA 2Y25A 2G60L 4X6DF 3MRRA 1B9ZA 2V9QA 1TETH 3JWOC 3EJPA 5FFOA 2XQBL 4KVCL 4D7BA 3S8GB 1NSNH 2CNYA 4G1EA 2HRPL 3N0AA 3S48A 1ZV2A 3D39E 2NXYB 2PWFA 3QHZH 4PRHE 5LGYA 3B2PA 4Z18A 2L7JA 4I13B 4MMYB 1INQB 1MCKA 3NSJA 1J8KA 1MRDL 4AJVA 4P9ML 4U1KB 12E8H 4JRYE 2CBOA 2D3JA 2F9BT 3FN3A 1ZVSA 2IDSA 4OZFA 2VSCA 3RFZC 3SOBL 4ONFH 4GXVH 2CKBA 4HIJB 4Z7IA 2VDPL 2YD4A 5I0XA 1HJCA 3AXLA 4FQ2H 4E42A 1HI6B 1QBLH 1JNLL 3LRMA 2Z6FA 1E2WA 3UBHA 5J6HB 4HEPA 3MRBA 2YUVA 3FT3A 1LE9A 1O7VA 4QLWA 2VZ3A 3B2VL 1EEQA 4HIEA 4N2IA 3RIKA 3CSGA 5E7FA 5BRPA 2XG4A 2I5YH 1Z6JT 2E7DA 3O6LL 2FSDA 2QQKH 4I3GA 5GGVH 3WHXA 2OP4L 2P3YA 3KVPA 3L3GB 5GHWH 3P4NB 3PP4L 2Q8AH 4LCWD 4NQSB 3ULVL 5INDB 4C4KO 2DKMA 3MMEB 3MV8D 1YNKH 2WSPA 2ICWJ 4L3EA 5F7HA 1MI5E 4U7SA 3AWFA 2QPFA 3KYMA 4HZAA 1MUJA 2K3TA 4M61B 4JKPH 2ZXAA 1AVAA 2OV0A 1XFPA 4NAQA 2F54A 2F1EA 2LOEA 2YA0A 2Q7YA 1A1NA 2QQNL 1U8NB 5HGAA 2VR6A 4JUSA 5JNYA 2J20A 2IV8A 2OPCA 5MERB 1UZ8B 3NCCB 3V4VH 2OMVB 3PG2A 3V8OA 1S2EA 4AVJA 3FFCD 4GO9A 4M5TA 3HA0A 4LEXH 3UZEC 3IPBA 3OJ2C 4WHCA 2LU5A 4HCGA 4JG0H 4ONOA 4Z0XA 3VQLA 1ADQA 1IAMA 3I3BA 4ZXBC 3V8CA 5JPMA 1UVQA 3BKYL 1OP5H 1ZAGA 1ACYH 3K5SA 3NSYA 3RRQA 5EDSA 2RALA 2X2YA 4DTGH 4NO5A 2OR7A 4WHTA 2VDRB 4GRWB 1RP9A 4N2MA 4OCXH 1ET8A 4CU7A 3W56A 5IMMB 2VDQB 4OZFG 4L4VE 1NCDH 5BUAA 4J23A 5EF2A 1UASA 1ZS2A 1HWHB 5J0BA 4MHHI 2Z31A 3W9DA 2XWBA 3VFNB 5KG9B 1EV2E 4OJCA 1JPST 1TO4A 2DQFA 4OT1L 1YEEH 2DM3A 4L4TD 4Y2NA 4V11A 2ZZUT 2ZKHL 3VXMB 3ARGC 1NUGA 2P28B 3S4SB 3VFRB 3L5XL 1XO8A 1RZQA 3I3DA 3NA9H 5JO5B 1ZKAA 5GRVK 5D7IF 2AMUA 3C5JB 4FYRA 1OAQH 2O6DA 4JJHA 1OD7A 5KUMA 3O3BA 1NWOA 1QFWM 4YXKH 4B9PA 3M86A 4QRPB 5ADOH 1T03H 1RK1B 2AEQH 5DC9B 5AVSB 3DSNA 5BOPA 4ZODA 4KVNL 3APNA 4O51A 1T1WA 2FR4B 4DKFH 1PY4A 2EECA 3IDXH 4FTVE 4WKZB 2O5NA 4ADGA 2OTWB 5E1HB 5CF3A 5FOBB 1LWRA 5I30L 1CD1B 4UQDA 3F7QA 1EFXD 3CUPA 2B4CL 3UP6A 2I25N 3F12B 4KK9C 2VR9A 1JBJA 3ARBC 1MNUL 1MJ8H 4QGYA 3ESPA 4C83A 5IMLA 4L1BA 2EINB 3BDYL 3HMXL 4GFTB 3KPMA 2PP7A 4NJ9L 1KJ2H 1OT2A 2WXKA 4OLVH 43C9B 2FQGA 4HGMA 5D7JA 1J18A 2X0UA 1GIGH 2WVVA 3TONA 3QFDB 4HIPA 4KV5F 3TYFB 5A6IA 1AI1L 4JHAL 1ZXKA 1TPXB 3Q2CA 3AGWA 4OZGF 1ZVYA 1C1EH 2R29L 1HNYA 3FU9A 2Q5BA 1MCJA 1BECA 1A3LL 4R0LB 1GMIA 4WFGD 5E4OA 5FHAH 4BCYA 2MOVA 5C0FB 2NY2B 4Z3EA 1GOFA 2J88H 2WJ5A 2X2IA 3TA3A 3VXSE 4P3CH 2DAVA 4HA1A 2XU9A 4NUQA 1EUUA 3B9DA 2QGDA 1ECYA 1FAIL 2BOBB 1DQML 5B39A 1A9BB 2BHYA 2DYPD 3CBRA 4FFZL 4HXBH 3BQUB 4AIXA 2FGWH 1T3FB 3OZKA 2D0FA 3EFOB 4NP4L 4OJDH 2NQCA 1AR1C 1TFHA 1OAKL 4NFDA 2X05A 4MJ2A 1GOGA 3GJFA 4U1IA 1FYTE 5L4JA 3MV9A 2PW2B 4RWHA 5JIMA 3GPSA 25C8H 1S9YB 1RMFL 2ADJA 5EOCL 4F2FA 3KPQB 4LDEB 4TKWA 5E8OA 3T6QC 1PAMA 1UFGA 4ZMZA 5ENWB 4Q56A 3GINA 4G6AD 2P4AB 2KDGA 2XZCH 4LEEA 4M3KB 4TYUA 2H9GA 5DFWH 1XCTA 2C9PA 2P8MB 3HLKA 4YDJA 3FSOA 4OJYA 3WAJA 3FRPB 3H6JA 4PRID 5GGSB 1LO3H 4WO4D 4YSTA 4NUGL 4ZAKB 3VYNA 4I0PA 1NCAL 1G6RH 1GGYA 1N64H 3VG9B 1CGWA 1SUJA 2ZG1A 1BVLA 4JFHD 3OHXC 3PU7A 1W0VB 5LNEA 3MNVA 2O5XH 4PTTA 1HQ4B 2OCCB 4KAQL 1U8KA 2XA8H 3TVMC 3AS0A 4LHUD 2BXYA 2VITB 4L0ZA 2VQ1A 3L6FA 2Z7UA 2HJKB 1R5WA 3VWKD 4DF9A 2NRDA 1HINH 4MXWL 5F9JB 1TYJA 2ZYIA 5GJSH 3I02B 1QG3A 2C4XA 2ZX6A 5D2NA 4JBSA 4RBPK 4XNXH 3ROOA 3DX3A 3BKMH 1IE4A 4GO6B 4J3UA 3K4ZA 2JQMA 1FG2A 2VM4A 1MVUA 3ECWA 1UWYA 2M2DA 4JX0A 5KYYB 3T0EB 4OD3H 2YZ1A 5B39G 4YHOL 1DBBH 1U8OB 2Z7YA 3FTGB 5I1CH 1NCIA 1NEZB 4GUPA 1RI8A 3FQWA 3AG3B 1A6UH 5IQNA 4KI5F 4MA8H 3QNZA 5GSVA 1J0JA 3BAEH 1NGWA 1KG0A 1XB3A 3KGUA 1X5YA 4LPCA 3A21A 1UA7A 1CMOA 3T8XA 4JO4H 2EIEA 3ZIMA 3MGAA 1XBRA 2JJSC 1FVDA 2F7RA 3SDAA 1P2CA 4TQIA 3G08A 2XYBA 5I6NA 2DQCL 1UENA 3K6SB 1MCCA 3TPUA 2EIDA 1HK6A 2BNQE 1V54B 3VB9A 2ATPA 2XG5B 3BRDA 5CSZB 1XHHA 5C0AE 4E36A 2GIYA 3P54A 5E99H 4RFOH 1CE6A 1IGYB 2XV2A 3OM3B 1U3JA 5TE4L 1CIUA 4M3HA 1JI1A 2AV1B 2ZUQC 4UQ3A 4I4WB 3SE8H 1NIDA 4RIRB 3MRIB 1HCZA 5C09B 1J87A 2GUOB 2BHUA 1PAZA 4NN7B 1DQKA 2JIXA 3M46A 4Z0BL 1BA9A 4GKLA 2ADIA 1FZKB 2Z8VC 1RV6X 3HS0A 3POCA 4K8RD 5JOPD 1K5NA 3OMNB 2AK1L 5D7LA 2P7TB 5L2KE 1NBVL 5I1DB 1PCSA 4BD4A 1RJYB 4N87A 4HZ1A 2AAAA 15C8H 1RUQH 3AB0B 4XPTH 5I6XB 5KYXA 3ULUD 1AIFA 1KTRL 2WZAA 2WVUA 4JDTL 2MPVA 4ZX3A 1K85A 4JFFE 4M43L 4ZYKB 5EBLA 4XBGA 4UZUA 3RWDB 4DJMA 3MR9A 1BIIA 5B3JE 1IQDA 4ZMNA 2NXZD 4FXGB 4U0RB 2ITFA 5JDSB 5IESL 1F6FB 3ARWA 3LD8B 4LASL 2FO1A 1WLHA 2XKNB 4R2GB 3V2AR 2Y36L 3S96A 5JZ7D 1WA2X 1CWVA 2ISDA 4Y19E 2WWOA 1I3RA 4YDVB 3CSBA 1NL0H 1ETZA 2J1XA 1R3HB 4F7EB 1INDH 3HE6B 4XNZB 1D5MA 1IKFL 5EU3A 4WFED 1HC1A 5K59F 1A7NL 5IJKA 2HVJA 2R0LH 5GGQH 1CXLA 1I85A 1E4XL 3DMMA 4IRZH 4MZRA 4AVHA 3FQ2A 4OCSH 1N12A 4JANB 4P07A 4CBZA 2IAMD 1TJHL 4X6FA 4X98A 4KUZL 3QO0A 6FABH 1HSAA 4YDKL 3CV5A 4LSPL 4PV9B 4QCIA 1CG9A 4NYLB 1DUZA 4NT6A 4BFIB 2J1WA 2IBZX 1Z9MA 1ONQB 1WZ1L 2W5PA 2O93L 3HAEB 4I18B 5EHFA 1JNHA 2HKFH 4IBZA 5IJBC 3NCEB 3IPFA 3GGWA 3KPNB 1W72H 3APMA 1F41A 2XNAA 4G8EA 4NQXB 5TPWL 3V0AC 4AKPA 3L2MA 2KHAA 3BP6A 3D05A 3T1FA 5DRZB 2FBJL 4PRPE 3P30L 4BZ2L 1E9OA 1T22B 2H3NB 3ATBA 1L5GB 4A67A 1AGEA 2QPUA 4N8CL 2G5BA 5L8KB 2BIOA 1QEWA 2GSIB 1B3IA 4TQEH 5T1DH 3GNMH 5I76B 2GK0B 3PWPA 3ES6A 4RETB 2WLHA 3CU1A 5F7NC 2HJFA 3RWGB 4FI7A 3GXNA 1N5YH 1RUPL 4N5UA 4DFHA 4K7PH 2D7TL 1P4BH 4IGBC 3R4RA 4OW6A 2X9ZA 4HUKB 2AJ3B 2CQVA 1IKOP 1MJ7L 3F7LA 3QDGA 3PWJB 1BVZA 3FZUC 1E28B 1U6AH 5TF0A 5KVDL 4KZEH 5FYKU 4D0BA 3H4FA 1AC6A 1O0VA 2K3HA 2O30A 2YUZA 3S6CA 4E9LA 4PJ8D 4WI4A 3EOAB 4WUKL 5JPMC 5FM4A 4DQOL 1NCWH 2JI2A 1CR9L 4K94C 5MP6H 4NUPA 1X7SA 4PR5A 4GBXA 1FYHB 1ZRUA 2WN3A 3EJCA 4RMBA 2F5AL 3S3JA 3EYFB 3CVHB 4FLSA 1B4RA 3LXCA 2KYIA 5ECGA 4CVXB 4HBQA 2Q2LA 1XTMA 1XGQA 5D4QA 5LNGA 1A3RL 4W9JC 3CHSA 3VA2C 2JKJA 1DBKL 2AXJA 1DJXA 1ZT4B 2BVUA 1RVFH 5L4IA 2XWEA 3EYUH 3RUGB 1RIHH 2ZOLA 4IIQA 3T65A 1WCBB 3PV6A 4HBCH 5ACLA 4UV7L 2H32H 2A9CA 1Z0MA 1F58H 1B4TA 3EOTH 2NY1C 4MBOA 2EDMA 2I69A 1FH5H 1HFUA 2NQDA 5C0BA 2AC0A 4LPUA 1D5IH 3MV8E 1HXYB 3E6FB 2AJXH 4MVBD 1GZQA 3OLIA 1U8MA 2NY5C 1TETL 4OV5B 4LCCA 2F53A 1GA2A 3L3DA 3V0VB 4KKZA 3QORA 3JTBA 3EYVA 3QCVH 5AZ2L 2YEZB 1EO8L 3BFQG 3QEHB 1ILUA 1HNFA 3PP3K 4PJCE 1RHHA 3QHZL 4Q6IA 4YSOA 1OTSC 3F01A 3CN1A 4X9HA 4KHXH 1J7VR 3L5WA 2A3TA 4TSBH 12E8L 1F3DH 4JFYA 4Y4HA 4YPGB 1FZJB 3FSWA 2DKUA 4Y4KD 4U1JB 3L7EB 5D7JC 1RZJC 4ONFL 1HSBA 5L2JA 5LAXA 4C56A 3EGSA 2OMWA 3VXRB 1FP5A 4XOAA 5DDHA 3MCG1 4WQOA 3LNGA 1HOCB 1P53A 4JCMA 4ATTA 2KC0A 4P4KB 3LH8A 4AIOA 3VNYA 2OFQA 1HYSC 3CLEL 1YEKH 1E6OH 2QQKL 2WPGA 5GGVL 3TA3C 1VKXB 3O9WB 2VDLH 3AU1A 4L4TE 1ITCA 5F9WC 2Q8AL 4X2UA 1NPNA 5E6SB 4EI0A 1DANT 1J5HA 1SOSA 3OHXB 2P8LA 1YNKL 3H55A 4JKWA 4KX9A 2WVTA 3HNSH 4GO8A 4HC1H 3QRBA 3WLBB 5A7BA 4BK8A 3UEQA 4EUPB 1NLBH 4JKPL 1BVKB 1X4YA 4HF5L 3QR1A 5I1LA 4NKMA 1KBWA 3IFLH 1HWWA 3LKOB 4AI7A 3QI9A 4KKQA 4UT6L 3A3YB 3HN8A 2BOLA 5DK2A 3V6FA 3D3VB 4A6YA 2WLYA 2DH3A 4X7SH 1KT2B 3SJVD 3NFSH 5J3HD 1OGAD 5K69A 2B59A 2UYLA 3I75A 1AAJA 5J9PA 4PGEA 1MCPH 3GS0A 4P46B 3TJHC 1EHAA 4DP0X 4JG0L 1NGXA 3FQYA 1GCFA 5BVPH 4X0NA 3JWOL 4XRCA 4PY7A 1ACYL 4HWBH 4LDOB 4LKCB 2WQUA 3SN6N 5I8KL 4DTGL 4XNMB 3HHRB 4YK4C 1C8QA 4MMXA 4ZD3H 3E8VA 4OCXL 2UXGA 5HSFA 4WNSA 1NCDL 2VUYA 3D18B 4L3FA 4Y9GA 4D9LH 2PPEA 3EADA 3F8UB 1ESOA 1X5LA 1YEEL 4XN7A 4N0UE 3Q8BA 5KSBB 1TU2B 4X99A 4KI5C 4U1HB 3HJEA 2V3FA 3NA9L 4F2EA 2DLHA 2MHAB 1EO7A 4OJEH 4N85A 1OAQL 5IFJB 2VLMD 4YXKL 1T1YA 2ZUQB 1S7RA 3KGRA 2ZXBA 5ADOL 2AEQL 1QFWI 4PVMA 1AQKH 2V37A 3UBXG 1ACXA 3NGBC 3TPKA 3IDXL 4ANXA 3CDGB 5HGGS 2EACA 1AQMA 4PLOB 7FABH 1AD9A 2Y22A 2YPVA 3UL4A 5C08A 1T4KB 1W6WA 4ELMB 2MH4A 5DU7A 5MI0C 3ZE1E 1DN0A 3BJ91 3U83A 1MJ8L 2YEVB 1P4LB 4OAWB 4Q9QH 2VYRE 5E8NA 5JYMA 3L1GA 2WQWA 1U8LB 3HRZA 4EN3A 3O2WL 1GIGL 1QSFB 3W0WA 3RWHA 4G72B 4HKBB 2C9AA 1CFMA 3WN5B 4UOW1 1YNTA 1EVUA 4QHKI 1Q9KB 1NANH 4PRIE 3DX9A 2NXYD 4WSGA 4AEFA 4NLAA 1P5UC 3L3KB 4JFHE 3JV6B 5KN5B 2HT3C 4PJFF 5FHAL 1F3RB 4DZBA 1HAWA 2J88L 3AITA 3BHBA 3T3PE 3DDFA 5ETUA 1LO2H 3I6GB 3FO0H 1JZHA 3MRRB 1QA9A 4J6IA 5TDNA 3H42H 3V6OA 5D55A 5CP7A 4LF3A 3QCUH 4G1EB 2XTJB 5DHEA 4OZIF 1A25A 2VXUH 3R0NA 2F6AA 4HXBL 1OKEA 1YNTF 1M7XA 4GEIA 3WEAA 4O5LH 2DIEA 1XL4A 2TRHA 1HL5A 4KDVA 3KBEA 4XMKH 3RFRA 2A2QT 2F58L 1UFUA 4BZ1A 3KHOA 5C7XL 2V2TA 1ZVSB 1N19A 2VTFA 1O6VA 2KZBA 2CKBB 4OCLC 1ZGLA 3HKFA 1A4JA 1KCLA 3AXLB 4BQCA 1OT1A 3ML9A 4E42B 2JJTC 4YAQA 2F5BL 1XF3A 2XOTA 2XZCL 4Z95H 3UO1L 1IBBA 1X5KA 4MASA 4KI5E 3ECBB 4F58H 2EDYA 2NR6D 3CH1A 1U30A 3FT3B 1AZBA 3MRBB 3P11L 4EXPX 3NFNA 2Y2WA 4HIEB 4AQZA 1GL4B 1RZFH 2APTA 2DWYA 3DX6A 5LN4A 3U6RB 2XG4B 5BRZA 3GRBA 1N64L 4OLYH 3KHQA 4G8FA 3WHXB 4MXQC 3VMPA 4A7QA 2VJXA 2VW7A 5HHMB 3UYRH 2XA8L 4U6XA 3FQTA 2OZ4A 4PMEA 3F7YA 5EC2A 1LYQA 3EZJB 4K8RH 4L3EB 5IJKC 3ZDYE 1TKWA 1HINL 2VISA 4P2QB 5CD5D 5IEHA 2IGTA 2LFEA 2NDFA 1MUJB 2DOCA 1JJUA 1F4YH 4PVNA 5GJSL 3CN0A 1GC1H 1MFVA 2X40A 2XIDA 2H0PA 3FU3A 1JGUH 1SRDA 5E70A 2HJLA 3QDMA 1KTDA 1TQWA 1K3ZA 4GB9A 5HGAB 3KJ4C 1T5WA 5JNYB 3ULUH 4I2XA 5E6RB 1J5CA 4Y5VC 1SJXA 4FHBD 5IJDC 3DSFH 4D9RD 4OD3L 4AITA 5INCA 3BZ5A 1N7MH 4P04A 1DBBL 1T89C 3AABA 2B16A 2VL4A 4YVUA