1PTZA

Crystal structure of the human cu, zn superoxide dismutase, familial amyotrophic lateral sclerosis (fals) mutant h43r
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
b'ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLRGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title ALS Mutants of Human Superoxide Dismutase Form Fibrous Aggregates Via Framework Destabilization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ptzA00
2AEOA 1OZUA 2WZ5A 2Z7WA 1YAIA 2ZKWA 2JCWA 3CE1A 3CQPA 2Z7YA 3H2PA 3PU7A 1YSOA 3ECVA 4L05A 3GTTA 1SXSA 2GBUA 3KM1A 1OAJA 3GZOA 1F1AA 2APSA 1MFMA 1F18A 1XSOA 1EJ8A 3MKGA 2WYTA 1SPDA 3KBFA 1DSWA 2ZKXA 5KBMA 2VR6A 3CQQA 3T5WA 1EQWA 1YAZA 3HOGA 4OH2A 3K91A 4A7QA 2WKOA 1JCVA 2R27A 3HFFA 3LTVA 4BD4A 2AQSA 4A7TA 4N3UA 1HL5A 1U3NA 2WWOA 3ECWA 4OJAA 2AQRA 1OZTG 4A7GA 2E47A 4A7GF 1SOSA 2AQTA 1SXBA 2AQNA 2WYZA 1N19A 1XTLA 4U4IA 3KM2A 1BZOA 1N18A 1KMGA 1F1GA 2ZOWA 4A7UA 2Z7ZA 2XJLA 1DO5A 1E9QB 2V0AA 3L9EA 1RK7A 1IBDA 1UXMA 2K4WA 2WZ6A 3F7KA 3QQDA 1E9OA 4N3TA 1IBFA 3QQDB 1E9OB 5KBKA 1UXLA 3SODB 1E9PB 2WWNA 5KBLA 1OALA 2VR8A 2GBVA 3HW7A 1PU0A 5CU9A 2AQPA 4A7SA 2AQQA 1JK9B 2E46A 1S4IA 1XTMA 1TO5A 1ESOA 2LU5A 1SXZA 3ECUA 2C9SA 2SODB 1CB4A 3GZQA 1BA9A 4MCMA 1PTZA 3RE0A 1E9QA 1SDYA 3F7LA 1AZVA 2C9UA 1Q0EA 1FUNA 2Z7UA 1SXNA 1SXAA 4MCNA 3MNDA 1OEZW 3GTVA 1E9PA 4FF9A 3GZPA 1COBA 3KH3A 2NNXA 1TO4A 4BCYA 1HL4A 2XJKA 1IB5A 1Z9NA 2C9VA 1JK9A 1Z9PA 3GQFA 1P1VA 4B3EA 2AF2A 3KBEA 1CBJA 1IBHA 3L9YA 2JLPA 1IBBA 2ZKYA 1L3NA 1SDAB 1F1DA 2VR7A 2WKOF 3KH4A 4A7VA 1SXCA 1B4TA 3H2QA 1PZSA 1B4LA 1SRDA 2WZ0A 4BCZA 2Q2LA 1QUPA 2GBTA 3S0PA
chains in the Genus database with same CATH superfamily
3CFEA 5BW7C 2E59A 3TWYA 1FPTL 4ZYKA 3Q13A 4NN5C 4NRXA 3I75A 3ARDA 4FQHA 4QPEA 5CZXD 3SPCA 4HC1L 5EZOL 1XGQB 2WOYA 1SPDA 5IQOA 1JNLH 3MRPB 4JFUA 2L7UA 3FFCA 5ID0A 3HI5L 4XNUH 1E2VA 1A1NA 1CR9H 1UM6H 4LLAA 3LSOA 4PJBF 2EIEA 4PIBA 1NGWB 1T3FB 5D96B 4QXTB 3VRIB 3DRTA 2RMNA 1XDTT 3FUKA 2ODIA 1U8CB 2J6EA 4PWHA 1OCZB 4F7KA 2X09A 5EEXA 2VXQL 2C9PA 1AQKL 4YBHA 1E8YA 3NRFA 3FCGA 1L0XA 5SWZD 3UZEA 1OE2A 4U3SA 3HI6L 3PAUA 4UV4H 5JDSB 1N18A 3B2VH 2R69L 4AJ0A 1KXQA 2E75C 5SX5H 1NCCH 5HHME 4LFHG 3Q6GL 4D0CA 2EIZA 1KT2A 3FPXA 4YDMA 4QD2E 2VZOA 3AJ7A 1ODAA 1WWBX 2Q8BL 2VLLB 3HC2A 5IFHH 4NZUH 3KCPB 1KLUB 4NXKA 3LQAH 5B3JE 2R1YB 4W9ZA 4PJAA 2E9BA 3QWRD 3GXMA 1HESA 4LF3B 4QRUB 5GGSY 2GSMB 4NLAA 3CSBA 3P0YL 3VFMB 3TBCA 4C58B 4CUCA 4URTB 2X3CA 1XH0A 4HWBA 2VXTL 1O5DT 4PV9A 1LHZA 1ZHBA 1B6UA 1IUZA 1YG9A 1C16A 1TZIA 2G0LA 4RNRB 3NRPA 3L7FB 5KG9B 4OLZL 2DBLL 4EZJA 1PTZA 3EJTA 3GXFA 3LEYH 3ROLB 4XO3A 2FWOB 2R83A 5E7BA 3ABKB 1KZYA 2C9UA 3F5WA 32C2A 2YUXA 3ES6B 4HS3B 1FNHA 1RZQA 2QVIA 1NAMH 5JW5B 1IAII 5DK0B 5IUCA 2BY0A 1E90A 3ZDXF 4XVSL 1CYXA 1Z32X 2AEQH 4O02H 4LKCA 2E8ZA 2Z64C 2ZIDA 2IAMA 3O2WL 1GOGA 3F7YA 4HK0B 4PEEA 5FEBA 2HVJA 2WANA 3BP6B 4JPKH 3JT0A 5EU6E 4PVBA 4BQ6A 1BEYH 1AG0A 1R5WA 1E50A 1KJVA 2JKXA 4Y4KA 5SX5K 5MP6H 3B9DA 2AJZB 3TH4T 3X3GL 3O6MH 1W6WA 2CBOA 2DLTA 3GJFH 1NZRA 3P73B 3NJVA 4P4KA 5K93A 3OSKA 2OYMA 4ODXA 4HLZG 2BC4A 3QQ9C 1YMHA 4GMTH 4U4BA 1F58L 5IB2A 1Z0NA 2WLLA 4Y4HA 5IB4A 4MMXC 1YUHA 5EFIA 2UZIH 3O2DL 1CTNA 1N0LA 2AEOA 1PKQA 4HHGA 1I7TB 3JWNG 5CEZE 5IUSA 2PYEA 4IBQA 1CDIA 2J1KA 1VEPA 4JFEB 5E8NB 3F58H 3WG7B 1BJ1H 4I77H 4IOSD 4YWGL 3V4VH 3I84A 1MUJB 2G9KA 5JOEA 3GSNA 1F00I 4YQXL 3EJPA 3D0LA 3DI3B 3ZL4H 2XBTA 4NYLB 4MMZC 1N2RA 2Q1EA 2VZSA 4LLMA 3HPJB 5HGAB 1J5CA 3OHXA 4NZ8A 1I1CA 1KWGA 2IH8A 2J1YA 1UOKA 3VDCA 4ALAH 5L9DL 1QATA 4ILDA 1A6ZA 2NXZC 3LD8C 3C9NB 3IJEA 3NJNA 1CJYA 1IKFL 4CKQA 5H35A 1MI5E 4H4NA 3CX5K 5LXVA 2CUMA 1JDDA 4HIHA 5LAPA 4FTVD 4IKLA 1QNIA 2VW4A 1JGIA 3QUYA 2GY7B 1UWXH 4KI1A 2WLMA 1S9VB 3SQBB 5E56A 3LAFA 1QTSA 4I87A 1EGJH 3QQ4A 4AC4A 4HX1A 3CTTA 1XO8A 3ZTEA 5JW4N 5JIQA 4JGMA 3RY5A 3VX0A 2F7OA 3L9RB 2FT7A 4NQDD 3M07A 4IMKA 1QW9A 1TEGA 5T5NF 2HCZX 5GRJL 1UWEL 2ADIA 4YBLB 4NUMA 2H8PB 5AYUH 4LNRB 3S35H 4D0BA 4L3EE 3GUTB 2X3BA 2ZWSA 4Z7WF 2BINA 3RU8L 2W95A 4P46A 1F6AA 4YO0A 4XHQA 1KTCA 2Z31A 4PR5A 1SDYA 2WSKA 4K7PL 4YXHL 4N6QA 3CV5A 5IHUL 5M7QA 3OV6A 4IBZA 3VTAA 4X8JB 1GL4B 3QUZA 5C0DA 2CGRL 5E99L 2LVEA 4ZUUA 3SY6A 2GK2A 4BK5C 4RX4A 1YEIH 3G5YA 5DFTA 4ZI8A 3MOAL 3WD5L 1RPKA 4RGNB 5DFVC 2ICEA 1AS7A 1KY6A 4KKNA 4HGWB 1FYHB 3ABLB 3AREC 3P4OA 1FYTB 1U93B 3SJVA 5JW4Q 4G6FB 3KBEA 3OPZL 3IGUA 5DFVD 3QZWA 5C6PB 3SE6A 5IOKA 2LLLA 1NL0L 3C8KA 5AW1B 1IGCL 4XMUA 3U9PH 5TE7L 3INOA 3G3LA 5IB3B 3ARED 4QNPF 1XIWA 1CFTB 1QKZL 2BM3A 4ZUWB 3QEHB 4H2AA 1FZJB 4Q56A 3U4EA 3BZ4B 2DJ4A 2FSDA 3S3SA 3VNZA 1LILA 4F8OA 3FT4A 4RQQB 4N5EC 4BGDA 2Y3AA 1GXEA 1MOEA 3FO9B 5KYXA 4KO7A 2XKUA 4TSCL 5B38A 1HZHL 1MAMH 4P9MH 5ACZB 2M8XA 1BBJA 2EYSB 2K78A 5DJZA 4ZXBC 5J1AA 4OIFA 3KYMB 3EYSH 3TA3D 1T21B 2FX8H 1EA9C 1AE6L 3QIBB 1GAFH 1RKRA 5C09A 4A39A 1A47A 2I7SA 2XIDA 3BIKA 4QEGA 1I9IL 2Z91A 3AG2B 3THMH 5KWYC 3BT2L 3SBQA 1OZTG 2X6BA 4ZXBD 1AHMA 3C60C 3MLSL 4U1KA 2D9QB 1CLYH 2FTAA 2F1AA 4OFQA 2CA4A 2VITB 3GXTA 1D3CA 1F4HA 5BOJA 1V3LA 4WKZB 3DUSB 3K74B 1LEGB 2JQMA 3V7MA 3QC6X 4E9VA 5I1DB 3C60D 5HXMA 5IVXB 3QS3A 5BRZA 3T08A 5I73C 1WISA 4HKBA 5ALCH 5KVFE 4MB5A 1EFXB 1XH2A 5JHDE 5CFAA 1F8TH 2WAQA 1NA8A 4E42B 3EH4B 2NY0B 3V5HB 2R59A 4ODWB 4HGKC 1T6WA 5FDYA 2TAAA 4X6FA 4Z0XB 3ML9A 4Q7DA 4X7EC 1BVKB 4PJGF 1HSBB 5BW7A 1UASA 2ZUQC 5EIIG 4S1SH 2CJTA 1SBSH 4Y2DC 1XR8A 3M45A 3MCKB 5EIIB 1BBDH 5LAXA 2IADA 3W9DA 1FVEB 3HHSB 4A7SA 1LXMA 1JN6A 1RK0B 4HDIA 4LSQH 3MXVH 5ID1A 1YYMH 3D2TA 3MRIA 3O45A 3LMJH 2XQYK 4Y5YC 5IEHB 2KLRA 1EEYB 3QDJE 1JBJA 4Y2DD 5D5ME 2HAZA 3AT9A 4I5BB 3SQOH 3ZO9A 3SY0B 1YN7A 4Q58C 3DX9A 4FJZA 2ZG1A 6TAAA 3GK8H 3BEVA 4YFDB 4AGOA 1O9ZA 1A6AB 4GEJA 1BOYA 5K59F 2R2HA 1WA0X 4TOYL 2VLJE 2ZOOA 4ZFOB 4I48B 2EDBA 4RGOL 4Y1AE 3N0AA 1FGVH 4IHOA 4IYKA 2IC2A 1K85A 3JWDH 3MCLL 2LLGA 2BWDA 3R4RA 3NCMA 2CCLA 1CYGA 1USQA 2VXSL 3QFDB 4OJFL 5LXGL 1J88A 4DKFL 1SY6A 2ZWZA 5KEZA 1JRHL 3TF4A 1IGYB 3AQDA 1DBJH 4JHAH 2H47C 4L4TD 3H0TA 1CU4L 2A3TA 2PW1A 1Q72H 1MW1A 1ZPLA 3J07A 4M5SA 4G42B 3DROB 1MQKL 2DQJH 1G9MH 3T4AC 1A0QL 4Z7QF 2ODHA 4YSOA 3ZE0B 5C07E 4C56B 1E4XH 1KELH 1Q38A 1KCRL 1OL0A 4HCGA 5HDRA 4PVLA 1D5MA 4FEIA 2CCVA 4P0DA 4FYSA 4LLVA 2FX7L 2H3NB 1E67A 4RA3A 2G9HB 1LYQA 3N6YA 3Q48A 2BSBA 1X5MA 3CVHA 3QSKB 4MJIA 5TQ2L 2XX0A 4NQSA 5BJTA 2C9AA 3QEQD 4I85A 1M71A 5ISZA 5JO5B 5HYJE 2D8KA 5I75C 4EI5C 4UTBH 4NWUL 3KPRD 3DA0A 2VWEC 3L6FB 1MRFL 4HUCA 5E08H 5DJYB 4JDTL 5EC1A 3NK3A 4IGBB 2HXAA 1E30A 1KN4L 2G4GA 2VXVL 3FF7A 2XFXA 4PW9A 3RX5A 2I26N 4WU7B 1RZIB 4JKPL 2MQCA 1D2PA 1RZKL 3FUNA 3R18A 1ID2A 5F89B 3TT3L 1UG9A 1RUMH 3E8VA 2DMHA 5AVXB 3SZ6A 4QAMB 1JGEA 4PJIE 5C0FB 3NABL 1N8ZB 3RLSA 3T9WA 5EU6D 4YFEA 5IZ7A 3MXWL 3Q9PA 3RB7A 3C87A 3ZZ1A 3BVXA 4WZ9A 1HNGA 2L0DA 3KEDA 4OUUA 1H5BC 1FCCA 4EN3B 4S1RH 5D2NB 3K2IA 2Z4QB 3C75A 1GZQA 2JIXD 4HULB 4B0MB 4G8GE 2IH1A 4DVRL 2J4WH 5E5RB 3PWLB 3OLGA 4H20L 2WVTA 4L4VE 3V9FA 2BSED 1I8IB 4FTVA 4YN3A 4H26B 4KZDH 2ZZUT 3EDKA 3IF1A 4PJHB 1JF5A 3FO0L 3DMMB 1WUZA 5CEZD 5AW5B 5F93C 4KKCC 1BJ8A 4Y8AA 4KHXH 1OKEA 1QMUA 3TT1H 4X99B 5DD3H 4Q74A 4RMVA 3JV4B 3HR5B 2MSPA 4KKCD 5ANMB 1D7CA 3UJTH 1XSJA 1Q1JH 3IMSA 2YKKA 1AKJD 1A4CA 1HINL 3ENEA 1PX4A 3P0VH 3PXJA 4PSRA 3EXJA 4I2XA 4WU5A 1QLEH 3BKMH 3HNTL 1T0MA 1Y0LB 2FYYB 1UGNA 4GW4A 2Z35A 4M62H 4AYFB 1QFUL 5DWPA 5LKNA 2K3TA 1LE5B 2KZWA 2YPKB 3JTTA 5T33L 3KM1A 4XP5L 1F1AA 4FJYA 5JHLL 2J5WA 1TKWB 4OQTH 2AEWA 1RULH 3UGEA 2V3FA 2DTSA 1E4WH 3DX1A 4JDEB 3MUHL 5FXCH 3K2MC 2VDKH 3EBHA 3PDDA 4N20A 3LHAA 1G6RB 4GW1B 3HAEG 4WW2B 4BK5A 4FFZA 1U0QA 4PTTB 5F1NA 2VIRA 3P2TA 4JFZL 2FQFA 5JIDA 3BXNB 5B1AB 4L3ED 4UTCA 1R6VA 1JYWA 4MYPA 4FYTA 3Q05A 3AREA 1JV5B 5E03A 2Q86B 2B1OA 4XMPL 3GMRB 5JPNC 5DUJA 5FGRA 4BUGA 4F15C 1KCWA 2BOCB 3JXAA 4FQQA 4AEEA 1G9NH 3QHZL 4XI5C 1KOAA 4TSBL 3V7AG 3H9HA 1OARH 2A6IA 3TN0B 1BQLH 1ONQB 3FHAA 4XB8A 5CP3H 3BWUF 4BSJA 4K9EH 2YD3A 5CEYA 2DWXA 3GS0A 4P5RA 4QRRB 1H3PL 1HJCA 1BWMA 3IRZA 1JPST 4PTUA 5F96H 1ZV2A 4IEFA 1U42A 3UP1A 3MV7E 2FNWA 2OMWB 2FL5A 1C1EH 1KIUA 5DJCA 4WI2A 5T1LD 1NCGA 3W56A 2VMFA 3RVUC 3LKNA 1G84A 3EGDA 4GG6F 4HF5L 3QPXL 4GMSL 4KO9A 3F7LA 1EAPA 2AK4A 2O5XH 1G7QB 3GI9H 35C8H 1KFAH 1AGCB 1MIML 1SDDA 4ZUTB 1CQKA 4PRIA 2WNKA 1RD6A 3V0HA 3RVUD 2B9BA 4DKEH 1ZLSH 4TQ8A 2ITCB 1COBA 4ODVL 1DZ0A 1TO4A 1CXEA 4G7QB 1MRCH 5FHAL 5H37A 3RTLA 4KJQC 5C9JB 3ZE0F 2JB6A 2X87A 4Y4FC 1JGVH 2XZZA 1ZDSA 4W4NA 4N2LA 5BV7L 2RH0A 3LN5A 1JNHB 1A64A 1E4HA 5ITFA 5JQIB 4KJQD 5EU3B 1R0AH 4JPWL 4YDLC 1J48A 3CLFH 3IDXH 4LSPL 5AG8A 2WZ0A 5J1SC 5I74C 5KJRL 1EAJA 3CZNA 3FT3A 3NN8A 3QJOA 4ALAC 2J8UA 4HKJA 3G5VA 4R90L 4Z1PA 1R3KA 3LRLA 4FQ1L 2C7UB 4K3JH 5DI8A 3UABA 2I07A 2X38A 4ZW3A 4L05A 4H2CA 3MNVA 3FOMB 1QQDA 2GJ6E 4YZFF 3LN4B 1JGUH 2FBJL 4NNXB 5CINL 5JHDD 1NFAA 1R3IH 4U1HA 4BFBD 2GKIA 3L3IB 4X8XA 2R29A 1P5UA 1HHJA 2WLIA 3LDBC 4LP5A 5D7JB 3SOBL 1L9OA 2JSFA 1FVCB 4I3SH 1QFWH 3ECWA 4YPGA 4WNJA 1S3KL 1EHLL 1BQHG 2NLJA 3GXPA 4S0HA 3J8F7 4WFFE 3U2JA 1BQHB 4DP6X 5CEXB 5C0EA 2LLNA 1FORH 3QORD 3ROOA 4JM4H 1LK2A 4QXUH 4ZRGA 4WHTB 1FZKB 3QDJD 4UOW1 2X28A 5I5JA 3IFLL 2XTJB 3T1FB 4JDVB 1JD9A 3QUMA 2EDFA 2VDLB 1B4JH 3VGAB 1YNTF 2VC2B 2PTTB 3U6RB 5I1HH 3PPSA 3EYQC 4PJHF 3UIYA 4U7SA 4XP6H 4AIZB 3IDMA 1PFCA 1TPXB 3BP5B 3KPPA 3MRQB 3WHXA 4DUVA 4QHMA 4BWTA 5K1VA 3FRPG 1IQDA 1ZLWH 3T4AA 5FHBH 5KANG 1IAOA 3FRPB 5IMKA 2DQCH 2HVKA 3T2OA 1XT5A 4WF7A 4M00A 4YUEL 4DPCX 4P3CL 1MNUH 3SB3A 3ZDXE 2OJ1A 1UZ8A 1LDSA 5EN2B 2PP7A 4TMPA 1EFQA 5DHDA 4J1UB 5J12B 3FUIA 3TVMA 3IWVA 5D93C 3IU3A 4EI5A 4ODSH 1LQSR 4FKHA 4MDIB 2YR3A 5JUEH 2EDTA 4PBWD 4YGVA 4WV1B 4A6YH 2DQFA 2AABH 4O00A 4AVJA 3NJMA 3I9GH 2BSSA 2ZTBA 1ACXA 3NYKA 4PIRF 1NOAA 2QQNL 5E5MA 3DURA 5CD3A 5HHQA 5EU6A 1RZ7H 2RHEA 3VDAA 3H3PH 1I9RH 4TUKL 2VDQB 5IG7B 4Z3EA 3DVGA 2NNAA 4WW2F 2OMUA 2FAUA 5DD0L 2CO2A 5GRWA 4KX9A 3SPGA 1X5HA 5F3BA 5HYJD 1RPQA 4LEXL 1CTOA 1ASPA 1E27A 1RQ5A 2JIXA 1BIIB 3F84A 4AYSA 1KF9B 1ZLWK 3T2NH 1PF3A 1K5NA 4LCWE 1KXVC 1IC5H 1NFDB 1H5BA 1Q9LA 3UBHA 5KSVB 1H15B 4DW2H 4N86A 1O7DE 3BUYA 1VPOH 3OQ3B 4ZSOE 1CDJA 2ZICA 1FFQA 2YPLB 1LD9A 4XCYA 1BFVL 2OCJA 2VDRL 4ZAKB 1Q9WB 2C34A 4J3VA 1XCTA 3VFOB 2XG5B 4DP4X 4DOHB 3GLEA 1ICTA 4MWFB 3ZMNA 2ZNWA 3UAFA 1SLXA 3EGSB 1T1XB 2C26A 1F11A 1ZKAA 1WBYA 1XGYH 3GBDA 4I4WA 3IDIB 4PGDB 1MHHA 1KJMA 4HIJA 4U1IA 1CLZH 3GBNL 1AKJA 2BOLA 3MACL 4XXDB 1PSKH 2V9RA 1NDMA 2X4UB 3DJRA 2F5AL 1E4XI 2I9TB 3T0EB 2WVVA 4G8GD 1JPFB 1U8JB 4HCIA 4R7DB 2ITDA 1VGKB 1DVQA 2HH0L 5F0PB 4U31A 5BO1H 3VCLB 3VFVB 3BVNA 5HYSG 4JO8A 4L4VD 1MI5A 1E9QB 1EO8H 1FPTH 2BOBA 5E6IC 5F44A 4DN4L 5JORA 4KH2A 2BW4A 4JG1L 1FL5A 5DFAA 4J8RB 5IQ9B 4NJ9L 3H85A 4HC1H 5EO0A 5EZOH 1KYOJ 2G0KA 2LFGA 3IN2A 1WAAE 5AVWB 4KMQA 1RUAL 5KSAC 2ZOUA 2HFTA 1C12B 3DX8B 4FABL 1IFRA 1HCZA 2X1XR 5E4EC 1X5AA 1JI1A 3CGTA 2DBJA 2HRPL 1UD6A 1R3LA 2V7NA 5I1LB 2PPDA 2VXQH 7TAAA 2ZWYA 5KSAD 5I8CA 2CLRB 4L3EA 4GT0A 2COQA 3PRZA 4XNZC 1N0XL 1XGTA 4NKMB 2IQ9H 3HNSL 3EKCA 1AQDB 4Z77A 2ZNXA 4AM0Q 4XN7A 2AS5M 3UTZB 1ET8A 3Q6GH 4N2EA 4DSYA 3IU4L 3ABGA 1S7WB 4R2GC 4CMHB 4JDZA 3BN9C 5DMKB 3KVPA 5JPNA 4JRFA 3DK0A 1G9MC 5C8JB 1C9SA 3P3TA 3HE6B 1CFSA 3MODH 2WBXA 3E3QC 3T71A 2ZOKA 4QNPE 4R2GD 1HTYA 3BN9D 3D1MC 1I7ZA 5F6HI 1A9VA 4OCYH 4CC0A 3FW6A 4FGMA 3CHQA 1KTDA 4YAQA 4KTEL 5FO2A 1T04A 3EDFA 3TM6A 4XB7A 3NJLA 3CFBA 5IROA 4N9GA 4X8CA 4JFPA 2X2JA 4OLZH 2DBLH 3AWEA 3AAZA 4GP5B 3RNKA 5IGXH 1P53A 2P45B 1PFOA 4KXDA 2DEWX 4PJCB 4BFOA 5FYLE 3IETB 2IPUG 4KK8C 1CI3M 1D6EB 2J88H 3EGXA 5A2BA 2JELL 4XVSH 3A4AA 1NGQL 4DP0X 3WYRA 2IV9A 4N6RB 1JZ4A 3CZFA 1GS8A 3AGWA 3VD9A 1WZAA 1KXTB 1HKLL 4L37B 4KK8D 1ZT1B 3RGVC 2YA0A 3HLAA 3JQOB 4JM2B 5E6YA 5F1IB 1WD8A 4LKXA 4B9KC 3MJ8A 2XU9A 2QV2A 3QWOA 1XZ0A 5HHOB 4KX7A 3PWUA 3X3GH 2RFXB 1GKOA 3F7VB 4P07A 3VFSB 4YSQA 2Q8AL 3MV7D 5A2FA 3Q43A 3G5XA 4Y4FA 4OFVA 1K2DB 3IS0X 3WFHA 4E9WA 3V4VA 3PFQA 4U4IA 1RK1B 2PCFB 4L2YA 3X1GA 4IOIA 4WUUD 3E6HA 4APXB 1I7UA 2K3HA 3KLAB 4GSRA 4U1MA 4A2EA 2L04A 1A4JB 4ZS7L 4PJGE 1TT6A 5BRPA 4PGCA 2DMGA 2X0VA 5DUMH 2A74B 5GIRB 4PS7A 3NSFA 4YWGH 4XBGA 3DNKA 3RWDA 5DZLA 2WXJA 3P4MB 5JHDA 1CDBA 4YQXH 2DICA 4WHCA 4UTAH 1DP0A 4MS6A 2VZUA 1YECL 2EUZA 1IAKB 3TCXA 3KPTA 5D1QD 3UBXA 4BFJA 5CU5A 4ZMXA 1IEAB 1RJZA 3KBPA 5L9DH 1EGJA 3RWEB 3D0AA 3DJZA 5K59E 3MNZB 2AZAA 2CDFB 3VXQB 5B4MD 2AXJA 4X50A 1MXDA 5E6ZA 4IKNA 1IJNA 4BH8A 2XXGA 3QDJA 2X89D 3NCEB 5D5MA 4DF9A 1J5HA 1NFDF 1U4EA 3O3UN 5HYQA 5CMAA 5FM5O 4K5NA 4Z3TA 1TSRA 2BMKB 5DSCB 2GJ6D 1P7KB 1QSFB 4NQCD 1HL8A 3RWGA 2P48B 2AJVH 4M6ML 5EBGA 5EZPA 2OMXA 3OKMB 2P80D 5GRJH 2VLJA 3DWTA 1UWEH 2WTRB 4DQAA 4M4PA 2VO8A 5FM4A 1L3NA 4TNVF 2B4CC 4ZFGH 1YYCA 2ZOLA 2H7WA 4Y1AA 43CAB 1S9XA 1BVLB 4EJ1C 1J1PH 3I85A 4ORGA 3RI5K 3WO3B 3FNKA 3I3DA 3NT0A 3KPQB 3X13A 4WFFD 4ZPVB 4R4BA 3ZTDC 2YRZA 4FFTA 1A4KB 4LPTA 3QI9B 4CBPA 4CC4C 3D87B 2V2XA 4ATTA 1YZZA 1OCRB 5F0JB 4FLHA 5IMOB 2O6EA 1FZOB 4HW6A 2CGRH 2X2YA 1O6SB 2OJZL 1JZFA 3AS1A 4HBQA 5IBTL 1HL9A 1TZ8A 5E8EA 3VI3B 1G9NC 2VZTA 1TVHA 4IJ3B 4KNTA 1AP2A 2JVUA 2OTWB 5I1EL 2XWEA 1DJIA 2VR6A 4OU3A 5GRVL 2CAKA 4AJYV 1NCHA 5K1JA 5MERA 5C07A 4K9EC 4XPFL 3IYLW 4EPSA 3LPFA 2IANE 3OPZH 3SOTA 4Y5XB 2VJXA 4HG4J 2W80C 3BFQG 5IW1A 1NL0H 2UY7A 3ARSA 5DRXA 4LE8A 5TE7H 1R19A 3MX0B 4JVPA 1KCLA 2VLKE 3H3KA 1WIPA 4UYQA 3GBML 4R83A 3WKMH 2GT9A 1FDLL 3EJZC 3MLVH 4HKZA 1A7RH 1DVFC 3ZXAC 3ALXA 4ELKA 5I8EA 4IU3A 3PWNB 5HYJA 3FCSA 1XCXA 3HZVA 5ADPH 3HS8A 3U7YL 1F1GA 1OHQA 2XQYA 3RFZB 1J11A 1XF2B 3FFOA 2FR4B 1UXSB 3EJZD 3O6FA 1DVFD 3PHOB 2AEPL 1B2WL 2OSLB 4JPIB 1M2VA 1HZHH 2K4WA 5AW3B 4MKTA 4ODUA 4N5UA 1KXVA 5EU5A 1JL8A 3PL6A 1JSYA 3I02A 4LARL 4RMWA 4LDOB 3W1ZA 1TR7A 4Z3FA 1U30A 2XVGA 4PJIA 1IGMH 1NEZG 3ZZQA 4FQIH 1AE6H 4KRPD 2OPCA 1R17A 3PIQA 4P5TC 3ZYOA 1NEZB 2QSQA 4WFHD 1X5ZA 3M17B 5DYOB 3DDGA 3BT2H 1N5YH 3C6SA 4DEUA 3PV6B 2CQVA 3VXRB 1DBBH 3E9UA 3O9WC 1Q0YL 3GZQA 1HE7A 3K6FA 4AL8H 3VI4F 1DVSA 4H25B 4JCLA 4XZUB 5GJSH 3PQYB 4X0KA 1O7DC 3MV9E 1HYSD 2ZE0A 4G8GA 1Z3GL 1TYRA 1KC5H 1DVXA 4LCWD 3O9WD 4WTZG 3MRGA 4PJCF 1SHMA 4I88A 2XA3A 4M03A 2WINA 5DRZA 4L4VA 4NCDA 4TUJA 4F37F 4QRBA 1KFGA 1U2HA 1KYDA 2AAVA 5T1KB 1LNUA 3FH8A 3PDOB 3WY2A 3PGDB 3VXOB 1UTDA 5K33A 3NTCH 1HH6A 2R39A 3B2UC 2FO8A 4G71B 4LLUA 2YEQA 2BNUA 4LRIC 3T0BA 5E6IA 4N0YL 1LO0H 4DT2A 2OL3B 3CHSA 3KH4A 4K94L 4XC3L 4UILL 2MKWA 1EDYA 1ZSDB 2QEJA 4AEIH 2CLZA 1YNLL 2FJSA 3B2UD 3IDNB 4GRLB 2X9XA 4LDCA 4P2QB 4BRJA 5F7UA 3WAJA 4GSDL 4JEGB 4L23A 3US0A 4NGHL 2AK1H 3MRFA 5DJ2B 3W0WB 3VNYA 1AZRA 1BDYA 3WXWH 5GGRB 2NDGA 4AGLA 1UOWA 4IS6B 5DJDB 2YD6A 2EDYA 4F7MB 5L2KE 2J73A 4GKSA 2OP4L 4OM1L 2PABA 1KPVB 2YQ3A 3EZ8A 1OT4A 4R97C 3MLTA 3MJWA 2A73A 4G8EA 4TOYH 4ETQA 1MIEL 2NTSP 5F7DB 3GXDA 4FLSA 3C6LA 5F3FA 4RRPM 5DD6B 3RWHB 1GZHC 4L9DA 2E7LC 1MCKA 1MFAH 1NCJA 4R0LA 1UA6H 2DI8A 5CR8A 4TLTA 5I5IA 3S5LA 3ASOB 5JLZA 3LS5H 2UX7A 5LXGH 2Y36L 2XXFA 2VQTA 1KTLB 2C3HA 1S7XB 4OSUH 2CM6A 1HOCB 4XPHL 1RLBA 4NBZB 5TE4H 1I8LA 3TBWB 2ZOWA 1CU4H 4Q9BA 4XVOA 3A3YB 1FBIL 1DQJA 2BY1A 4YJZL 3KWUA 5D96C 4WDIA 5TTRA 4UTBA 2Y07H 1KCRH 2WJ5A 2FQGA 2J5LC 4MQ7A 4XVTL 3VVVA 1LEKB 2LGNA 2FX7H 3MRKB 1R24B 3HPLB 4BWUA 4KNUA 4X6CF 1AC0A 3T09A 3DV6A 3HW7A 1L4IA 5TQ2H 3MRHB 5LJYH 3NJXA 3KPNB 3RGVA 1S4IA 5CCGE 1ESOA 3CPLA 4N4YB 3DC0A 4N8CH 3MJ9H 4DK6A 2VTFA 3MV7A 3S2CA 3UAEA 1MRFH 2VMDA 5IHBA 3LKOB 4CKVX 4JDTH 2G2NA 3MLPA 1KN4H 2VXVH 5AOZA 1NUFA 1I1AC 4K8RH 4JE4B 4XZ4A 1OAYH 2Z0UA 5FYLD 1RZKH 4LFHD 3MUGB 1EDHA 2WM0A 2B1HL 3HG4A 3TT3H 1I3RB 3MA7B 3QS2A 2ICES 4GUCA 4EZMA 2XNAB 2F8OA 2CRYA 1G4RA 3O41B 4MA8L 43C9B 3HUJE 1J10A 1DQQB 2DW5A 1I1AD 3EDDA 5AVTB 2JI2A 4L1SA 4OZHB 4R7NA 3NABH 1FV1B 1P2CB 3UG5A 2IWGA 3MXWH 2AVFA 4TPRL 1J0HA 3VJ6A 3R7QA 3EAKA 3GIVA 3C5SB 1NMAH 5IOPA 2ICWB 1R5VB 4QY8B 1NAKH 1B4LA 4OCMC 4YXLH 3VXME 5ESVB 2X9ZA 3K2KA 4DVRH 4U3CA 1PVHA 4YZFE 5FFGA 1P4UA 2KL6A 3ARVA 4PCKA 1MLCB 3QJZA 4ATWA 1Z5LB 5GGTL 3BKCL 4K0OA 2ZXWB 1AGEB 5C0BE 2YD1A 4YSTA 2IWFA 2X89A 5H94A 5KS9E 1HSAA 4UAOC 3O4LE 1FL3A 7PCYA 4OKVB 4Z7VF 3P3YA 3SKMB 4MFHA 3T1WA 1MZYA 5CGMA 1W8NA 2GJ6A 2PCXA 3K71B 2DQTH 4XAKD 1HHIA 3DARA 4NZDA 4NKOB 1T22B 1DVTA 1T2XA 3L3GB 5KOVC 1ERNA 2IVFC 1S7TB 4XNMB 2VDOL 5J6SA 2P80A 5FFOA 1UXWA 3UPRA 4FX5A 3P9LB 5HHPB 1HINH 1M3IA 5E00A 4JZOB 1P6WA 4HCRL 4OQTA 3HNTH 3ESVF 5CJQL 3EW3B 2JH2A 4YOKA 2XC8A 3AG4B 1AQHA 3QG6B 1AIFA 1HXYB 2JMRA 3N5AA 5FOBB 1URIA 2KKQA 3ECBA 5DS2A 2P28B 3D25A 2HLFD 1NBZB 3HZYA 2V0AA 3KL5A 4CN4A 1XGRB 4XP5H 3H3BC 3RAJH 1NMBH 2DH3A 4CC4A 1EMTL 5C6TL 1A4BA 1K9TA 2WMPB 5EULV 4HOZA 1NIDA 3BQVA 5C2BH 3QB7C 4GQQA 5IMMB 1W2KT 2PN5A 2J3SA 3B6SA 4QHLA 5DVMA 4ESKA 1SJHA 5CSGA 3QAZB 1Z7JA 4H0GA 5HDWA 3UYRL 4GKZB 4LVHC 5HPOA 3K81A 3NIGE 5B1JC 4QT5B 1WS7A 3WLWD 3TYGL 4MCNA 2DEYX 4YK4B 4NZFA 5FW8A 2DWDA 4OZIE 3GMOB 2K4AA 3PY9A 3F6JA 3B3IB 4Z5RA 1CE6B 4W9IC 2NNXA 4FXTA 4Z76B 1RZJH 5HDBF 4APQC 2J2ZA 3SKOB 4HSAC 2FDBP 3MNWB 4M8VA 3BH8B 5HGDA 3ZZSA 3W5MA 1A9BB 4OF3A 4BFFA 4FZ8L 3MLRL 3HC0A 2D03L 1F1DA 2BZCA 2IAND 3Q8FA 1SXCA 4YHYB 4APQD 3IGAB 2BH0A 2CJ3A 5GGRY 2YQ2A 4XO5A 3GSOB 3KXFB 2IG2L 2UXFA 3VD2A 5J9PB 4YDKH 3QPXH 1YEKL 1MCQA 5J11B 3OGCA 3BX7C 4P5TA 1WICA 4K23L 4LVNC 4LBEA 3EFOA 2ADGA 3QBTB 4OF7A 2GBUA 1W9XA 1QSZA 4LCWA 1R75A 5AKRA 5DEZA 1I1FB 5F3HA 1EXGA 2FEEL 2VJ8A 1DLFL 1SJXA 4XPBL 2A9NH 2A99A 4ZSOA 5FHAH 1XCQB 1P4LA 4AIXA 3HOGA 1KJ2L 2F6AA 2VT0A 3KLKA 1FYTD 1ORQA 1J0ZA 1ZTMA 2ZJSH 2V33A 2VQ4A 4G6FD 4EUPG 3KJ4C 1XH3A 5CF3A 4K3EL 4XOEA 4NDMB 5LBSL 3SKNB 1SYSA 1HC1A 2UVEA 3CJJA 1SOSA 4ZODA 3SYCA 4UYPA 4JS7A 2TSAA 4NJAL 1JXKA 4M8QA 3APMA 3PG2A 5DEGA 2XI9A 2O5NA 4L48A 4LRIA 3BUDA 1PBYA 1QSEB 4R90H 1BX2B 2XZQL 4FQ1H 5ACLA 5KSBB 4QTFA 4N25A 2G75B 4HV8B 2H2SD 4DUWA 3FQ2A 4DFHA 2UXVA 3L1EA 4WHYH 5F1OB 2K6YA 2NX5E 3PPEA 1LWJA 1CDCA 1INDL 4XAWH 4XOAA 4JHWH 3BGMB 3MRLA 3X2QB 3BYTA 4JR9H 1F3JB 3SOBH 2H45A 4OZHF 1WAAA 1ZIAA 4OGXL 2XG4B 2I60L 3JUYA 2WWKT 3G6AA 2PO6C 1S3KH 3HMXH 4HD5A 1EHLH 1XTMA 5DUPL 4HBCL 2JK5B 3HR6A 7PAZA 1TFPA 3S36X 1TSHA 2B5IB 2O5ZL 1UD2A 1ZMYA 1E7UA 2AC0A 1GZHA 2NUPB 2E7LA 2NY6C 2PO6D 3B9VA 2ATKA 3QUXA 4OBRA 4LPUA 1S6NA 5CHNB 2BHUA 4JFQA 1Y18A 1OK8A 2YGQA 1II4E 1AJ7H 3O6LH 2EXTA 4X7CC 4LL9A 5L2KD 4HFWB 5GS1C 4KNQA 1W8EA 1O5PA 3KD4A 3FHQA 1FSKB 3DTDA 3EJUA 4UANA 2VQUA 5DUBA 1FI8C 4HIXL 4QJ5B 1KV7A 1H3WM 1ES0A 2ARJB 2CE6A 4YIQB 3KCWA 1OPGL 2X4SB 2F1EA 5I1IL 2C4FT 4KDVA 1BPVA 5ILTL 3LXBA 4YUEH 3BWUC 3VXNA 1MN4A 4IBLT 4A6YA 2B7DT 3DRQA 3MR9B 4M56A 1OAKL 1ZCRA 4HK3N 4R96A 5B39A 2YO3A 2HN7A 4I1NB 1FLRL 1UEMA 5FO9A 4IRJC 1HH9B 5HVWA 3MLYH 5DVNA 1XEDA 1KIRA 2E6JA 1EDQA 1WHOA 5I30H 2EECA 4K55A 4TYUA 5ABZA 4IRJD 4WSKA 4MQSB 3ZUCA 1DJHA 1P5VB 3VFUA 4EDXA 4AUUA 1BM7A 4A7QA 3K91A 4TNVK 1DYZA 2WKOA 1G0DA 1XXFC 2QQNH 5J6HB 2EIBA 2DQHH 3C6EA 3BJLA 4Z8FL 5ICYB 2AJUH 3JSSA 3MLXL 1AGFB 4TUKH 1ZVHA 4UT6L 1TYEB 5DD0H 5JHAA 1T1YA 4PG9B 2E9IA 3G5ZB 2LAGB 3HZ3A 4LEXH 1JWSA 2JXMA 3ILEA 3QH3A 4JVWA 2XPGB 1ND0A 1NMCC 3HE7B 5C0JA 4E2OA 2IXQA 1GJIA 3I6KA 1BFVH 4C56D 4S0SD 3IFOA 3PNWB 1KCUH 3SPVA 1DCEA 4JCWA 3OR6A 3FUHA 4OLWL 4PJGA 4EXKA 4AG4L 5DZNA 2XWDA 1JRHI 1F4WL 5E23A 1ORSA 2F2HA 5DS8B 4PHZA 2EO9A 2QTVA 4JFFB 4V2BA 1TTFA 4MCYA 1LWHA 4QLRA 5LNDA 5CLTA 3O4OB 3FCUB 1U8KB 1X3DA 2SODB 3BSZH 3G6DL 4KGJA 2AKRB 4R26L 3GBNH 3TEYA 5HJDA 3SDYH 5IHHA 2WQVA 4HC1A 3VXMD 2DQDL 4IGBD 5AVRB 4OV5B 1XGUB 1UB6B 3WJJC 4F58L 3MJ7B 2HH0H 4TULH 3L3HA 5IM7A 1FO0L 3QZMA 1NFIA 3L5JA 4GY4A 4ODTL 4HFUL 1MW3A 5DJ0B 4GXVH 5I6XC 5FYKH 4Z0BL 3D5OF 3VD7A 2FVNA 4MSWB 1CF8H 4RGMC 1X6LA 4PGBA 1LO2L 2OCFD 2IOMA 2C9VA 3KYKL 2VXQA 4PRDB 3WTXA 3FT9A 3O4LD 1KYUA 2DLEA 5TH2A 1RUAH 2XN9E 4MNQB 2R8SL 1A25A 1WT5C 2R69A 4KI5F 4UINL 4WO4C 3ARFB 5EZLA 3OKEB 1B0GA 3TF7C 4RFNC 4UQAA 1UB5B 4BKSC 4GI6A 3R7RA 3DMMC 1U95B 1GHFL 2HFEA 5E8DL 2BNQE 5AVUB 4HUKB 1N0XH 4PRNB 4WO4D 3CQPA 1L3WA 4U49A 5KBPA 1L7IL 1S7SB 2XICA 3RVWC 1SM3L 2IBZY 3DMMD 3IU4H 5B1JA 5KSBF 4O2EB 4HUUB 5FO7A 1K8IA 2WKGA 1Y7VA 2CO6A 3RVWD 3WFEH 3HS0B 1KG0A 1CYWA 1CBVH 1AO7E 2NSQA 1KPUA 3WHE1 2BFGA 1JERA 3SO3C 3ESOA 3GSQB 4WFGE 2IANA 3N41B 4KJYB 4APQA 4LCCB 15C8H 2AXWA 4JZJB 5E1QA 1MFEL 2ZYIA 2F53E 3KLSA 2BCKA 2VLKA 4U6XA 1S7VA 3NCJL 3U30B 4BRVA 2R56L 2F54E 4M6NL 1PG7L 3AFLA 3G08A 2JELH 4RLDA 1NGQH 4N8UA 4WW2C 3RZCA 1RZKC 1UZGA 3NFSL 2H32H 1A7QH 1ETZA 1RJLB 3RIKA 4XBMA 1F02I 1PY0A 5BVJB 4NENB 1OP4A 1WTGT 3OJDB 2DD8L 1W72L 3QFGA 1A7OL 3O2DA 3VI4E 4UOW0 4G11A 1FO0B 2EO1A 2WIMA 5LNEA 2HX9A 2ERJC 5AVYB 2Z93B 1MELA 4JZNA 4QDGA 1YMME 4QO1A 4RFOH 5EZJA 4AIOA 4A67A 4N2FA 2X1PA 5IB1B 5KAQF 4LLQA 5L2JB 1JI2A 2G3MA 1ZE3C 4ZNEE 3RTQB 3L08A 2UWEF 4DCQA 3LNEA 4FXLA 5C0CE 4RMQA 1E28B 1KBBA 3TN0D 3WNOA 2FSEA 5EUOF 1BVZA 1EXUA 1WS8A 2BHFA 3MV9A 1E9PA 4ZTPH 4AW4A 4DAGL 5J13B 2YHGA 4AENB 4AM0B 4FG4A 4LLDB 3T65B 4PLNC 3EO0A 5JOPD 5MENB 4LEEA 1V3MA 1XGZA 5GGVL 1JWMA 5ANHA 3TNMB 3IGKA 2H2PC 2YAHA 2EABA 3UTQA 1YECH 1SJEA 4LLYA 4L9LC 2JLPA 1F41A 2KYIA 1A6WL 2KERA 5E2VL 2A38A 5B7EA 1T0OA 4Y16C 4GI8A 1DQLH 4OGYH 1V55B 4GAJL 1B4TA 2WLYA 2QQKL 2H2PD 1BAGA 3AG1B 5KZCD 2I9LB 3V0DA 3B7SA 4BUQA 1ZRUA 4B0MM 1Y1UA 3LV3A 4Y16D 4B53A 5FF6A 4PB0H 1ZHLB 2PO6A 2A83A 4MX7B 1HI6B 2X4TA 4E68A 2G5UA 2Z34A 3J2PA 1P7QB 4U7MA 1ZD6A 5DK2B 5DRNA 4DP5X 2LR4A 3FH5A 1CQYA 5IQ7H 1UFUA 2BVEA 5DJ8B 3W38A 5L2KA 2YAMA 2HKHL 3TYFA 1JF1A 3CUPA 3QJUB 2BIQA 3HN5A 4UBDC 1U8NB 4DZBA 4JKKA 2F5BH 1RIUL 2IDTA 2BXZA 4YHIA 2IDFA 4LHUG 5EEVA 3GRBA 2HSIA 5GS1A 3LH9A 2IPKB 5KANI 4NC0B 3KJ6L 1SHWA 4UBDD 4P04A 3V4LA 3DIFB 4X2UA 4IIZA 1F4YH 1RLWA 4A66A 1QVOB 4LMQI 4BBWA 2OMVA 1FAIH 5DQJB 3ZSSA 4R4FL 4WCYH 1H3VA 5KN5B 3BD4A 3MRNA 3ARGC 2P8LB 5F0MB 1QEXA 5I16A 5DDHB 1EZUA 1N59B 2JTDA 3FTZA 1X7SA 2P52A 3M1OA 2EDMA 2OJZH 1EX0A 3QRGL 4UUJA 1KSRA 1UACL 5J6GA 4Q9RL 3FQXA 3VSVA 3REVB 3V6FA 1A3RL 4X6CE 4BFIB 2GFBA 4HIIA 3ARGD 4NQEB 4QTIL 1WBXB 3IJHA 3GEFA 4OFYA 1A8ZA 2H1PL 4ZD3H 5I1EH 1YO4A 4IRJA 4P2RB 2NSXA 1QX1A 3DX7A 3KYNA 4JRXB 9PCYA 1J8SA 2WXQA 2YMXH 5HVHC 3FL7A 2P47B 1F42A 3Q8AA 1I1YA 4HJIA 3K8MA 3DOSB 1MJUL 2BVPA 3US1A 1XQ4A 1QRNB 3LN9A 4P4RA 3K2UL 3GBMH 3VM7A 1QI4A 4GBXB 4RZKA 1FDLH 3QISA 4F2MB 3L4CA 1BMWA 2ZXEB 4GW5B 3RGBA 3S34L 4L1DA 3IKCB 4NBYB 4MAYB 2AEPH 1B2WH 3ILQC 3HLKA 2PCPA 3T3PB 1V27A 1PL3A 1ZLEA 5CSZB 3CPUA 1OGPA 5IMLB 1AHWC 2Y7OA 3O3AA 5BCAA 3V0GA 4JG5A 3HUJA 4XOCA 3ILQD 3EYVA 2XA8L 4F3FA 5BV7C 1OGTA 3E7JA 4HEPA 5AZEL 3QDMD 4RA0C 4WI0B 4P5MA 1YY9C 5GRVK 2AANA 4BZYA 2NY5H 1BOGB 3H9SE 1Q0YH 4LAQH 1KTBA 5I6OA 3FUDA 5D1XC 3VXMA 5DQDL 3NAAL 3DTUB 1TUPA 3D39E 1GGBH 3W82A 4DP7X 4Z7VE 1G6VK 1WVZA 4Y5YA 4PJ9C 1OANA 3U36B 3TA4D 4ZYKB 2ALWA 5D1XD 4YHLH 4NRXB 3FULA 3C5ZC 3CHRA 3I75B 4TL5A 1SOQA 3ARDB 4FQHB 4ZS6C 3ARQA 2O5YH 4HAKA 1G5GA 5C0BA 3A4DA 1HHKA 4R5XA 1XFPA 1RFDH 2Y7QA 5GSRA 3PJSA 3FFCB 5ID0B 3B9KA 3CMOL 2Z1KA 4IMLB 3O4LA 1A1NB 1BXXA 1EANA 3C5ZD 4HSCX 4LCVA 5FM8A 3T3MB 2OXGA 4ZS6D 3LSOB 2XKNA 1MCRA 4H0LC 4GT7A 2ZWKA 3JUZA 3ZKXB 3DRTB 3PF2A 4K94H 4XC3H 4NNPL 3V0WL 1CT8A 4UILH 3LS4H 1LMKA 2GYSA 2Z4TA 1QASA 5B22A 1FIEA 2ZUYA 1GMIA 5FOJA 2V5RA 1IIIA 4ETYA 4NGHH 2VDPH 4QXVA 4ZAKC 3QQ3A 4U3SB 4RAHA 5D1ZI 1UD8A 3IXTA 4E9SA 4XP1L 2PETA 3CVIL 4WO4A 4D0CB 2EIZB 1KT2B 1YNTA 5T3XL 4ZAKD 2E6QA 2OP4H 4OM1H 1KCVL 3QIUC 3IMVA 1X7TA 4YS4A 4PJAB 4B5ZA 1MIEH 3OAYK 1CUOA 1VRSA 4JG0H 3WENA 1DUYA 3QIUD 2C3GA 4FG0A 2F58L 3LJ3A 4IK7A 2EH7H 4PV9B 4X5WA 1XD1A 2H5UA 3ESNA 1ZHBB 4JREB 4QJ4B 3FUMA 5FIEA 4LSRL 3IDGB 1GW0A 2DM7A 5EU4A 1DR9A 1S2EA 5C9KA 2AI0H 4U6VL 1YEEL 2ADFH 5ACMA 3MN8A 3F5WB 4ZOBA 1NC2A 2MPAH 32C2B 3WFCL 4NQVA 1QYGL 5D6DC 1J5DA 5AEAA 5HDBE 2ZCZA 1EBPA 1H3XA 1NICA 2JV6A 1BVNP 4LKCB 1SUJA 3EADA 2KH2B 1QBML 1RHHA 3F7YB 2FE0A 2V7HA 1PX3A 2HVJB 3FO1A 3MJ9A 3PLYA 5LVEA 4OZIA 4XVTH 4BQ9A 5AB0A 2VM9A 1R5WB 1KJVB 4Y4KB 3Q1SL 2E7MA 4BHUI 4U1JA 4QRPE 2DV6A 5D1ZC 1KYOK 4J6IA 3U1PA 4GAAA 4M48L 1AO7D 4P4KB 1OHZA 2Y9RT 3IJYA 2GPZA 2YGPA 5E2WL 3WIHL 3CBRA 4LCYA 4ODXB 2BC4B 1MCEA 2O30A 3L48A 1YMHB 4XCFH 4WFGD 3UEQA 1X44A 4OJYA 5D1ZD 5IB2B 2WLLB 4Y4HB 4YHMH 5EF0A 5IB4B 1TJMA 1YUHB 3QDGE 3M46A 4OZFH 2C9XA 5EFIB 1HE8A 1N0LB 3NGBC 3OF6D 2F53D 3HE6C 1MHCB 1PKQB 2WXRA 5DLMH 3U4BL 3AABA 5KVGH 1O75A 3HJ0A 2A4ZA 2PYEB 1FC1A 2F54D 1I8KA 1LTXA 2B1HH 2RGSA 3H2WA 3JWOH 3NZSA 5PCYA 3SDDC 4G7YL 1GOHA 2QKIC 3N1GC 1G7HA 3CAFA 3LRKA 1AZNA 2PYFA 1CGVA 3HE6D 4X9YA 5GJTH 5SV4A 2PWEA 3GSNB 2Q7AA 2WQ8A 5ECGA 3WNNA 3D0LB 1ZLDA 1U41A 4XVJL 1B9KA 3SDDD 3QUGA 4TPRH 1TJGH 3V2AR 4LP8A 4E41E 3UOAB 1N2RB 4LLMB 3GSXA 3HHRB 4G43A 2FH8A 2G2RA 1S8DB 5FA4A 5DJ6A 1DDHA 5E4IA 4EBQL 1A6ZB 2A77L 3KM2A 1OAUL 3IJEB 5H35B 4L9LA 5F7EL 4XP9L 2OYKA 2ENYA 4A37A 4Y16A 4QLWA 5GGTH 1IFHH 4G80A 3QUYB 1FE8L 3GHEL 1JK8A 5C0CD 3ATAA 2N3JA 4JKWA 5DEFA 1YEWA 5D8JL 5FA3A 2APBA 4ZFZA 5I15H 3FB6A 5CN2A 1JPGA 3GXNA 3QQ4B 4F7TA 1R1CA 4HX1B 5DHYA 2AV1A 5LGJA 1A22B 2J57A 3CU7A 4LPXA 1E42A 2L7QA 3O81A 5E24E 2NX5A 2N7SA 3SE3C 5EF1A 3NCXA 4XOBA 2ADIB 2EQDA 4HU2A 3BI9X 1QA9B 2W1NA 4ZX3A 5EDXA 1E43A 4D0BB 1P9MC 3DX3A 3IDJA 3PAVA 3AXHA 1QHPA 4P46B 1F6AB 4YO0B 4HOWA 2Z31B 4JN1L 1KEML 4AYGA 4N24A 4PR5B 5CJQH 1PEWA 1Z9OA 2Z7UA 1VF5C 4OM0H 3QUZB 4MJ5A 4U1GC 3SSGA 2G60L 2HPTA 3F2LA 3LNHA 3BFWA 2L8AA 4X5RA 3G5YB 3AMLA 5D7KE 3RDJA 2IF7A 2P7TA 4FQCL 1BM3L 2ICEB 1EMTH 2FHFA 4OBSA 5C6TH 4D9LL 3ARGA 3SJVB 3P4OB 5GZNC 3U6XS 3QZWG 5I1KL 3DDFA 4U0RB 2QSCL 3QZWB 3EJJX 4R7LA 2JJTC 4ZMQA 1ADQL 3C8KB 4M8RA 2IOOA 5LCVH 1FHGA 1MRDH 4XTRC 3UC0H 5L6YH 4NBXB 1XIWB 4ZMYA 1PZ2A 3PP3K 5DMJB 1QD0A 3JV5A 3TEZA 3FO2A 4HLZH 3U4EB 5I0XA 3MAWA 3OMAB 1EHNA 4XTRD 2Z7YA 4QGYA 3TYGH 3PHAA 3FT4B 1J9CT 2ZX5A 4I7ZC 4ZPTA 1QO3A 1OSPH 4F1SA 4J3OG 2APSA 4U33A 2GJRA 5JDJA 5B38G 5KYXB 1PLCA 1LO5A 1U21A 3OKLA 5B38B 1T2JA 3EZJB 2J7LA 1P4BH 1WPCA 1OB1A 1QSFD 1K5WA 1BBJB 1SY6L 1TQTA 3CFKB 5DJZB 2OKMA 1FFPA 1ET5A 2F08A 3A4EA 3E2HB 5C09B 2YN5A 4O2CA 1U3ZA 4IKIA 3BIKB 4D8OA 2Z91B 3EO1A 4ONFL 4QHKI 3LRHA 5CO1A 4Z3IA 4U1KB 1J0JA 4M3KB 5BRQA 3S96A 1AHWA 1FZMB 2EADA 1LK3L 5F7YC 1EAOA 2IG2H 3FTXA 5B7MA 4P5KA 5FV1L 1YEKH 5ESAB 4CSZA 3OKYA 1WAPA 2A5UA 5GZOC 4K23H 3CVHL 5BRZB 3ILPA 3TJPA 1CD0A 3CFNA 3W39A 3T77A 2ZKHH 3VE0A 3MFFA 2H41A 3BWAA 3QZOA 5A2JH 3EFDL 1MVFA 1QZNA 4XPBH 3FMGL 2JNZA 1J7VR 1CDGA 1X5FA 3FXIC 4W6XB 5AAMC 3BGFC 4X6FB 3NJFA 1SN0A 4N0RA 4HPYL 4AKPA 4PJ9A 3RY6C 1HILA 5E2TL 3T0WA 1KGJA 4EAEA 4NN5B 3C5ZA 4AQ1C 2BP0A 4PFEA 1SHXA 1XR8B 3DUUA 3VVWA 5DD1L 5LBSH 5LAXB 2IADB 3W9DB 1JZ8A 1JN6B 4HDIB 1HN1A 5D6CA 4B5EA 5ID1B 2CKBH 2R0WL 3MRIB 3O45B 2IFFL 3N43B 3VU2A 1KCKA 1A66A 5EMYA 1UZ6F 4HG4K 5GPRA 3P30L 3VG0L 1OM9A 4G82A 3O6KL 3CDZA 5F7WC 2V8LA 1YN7B 5SWZB 1T83A 3DX9B 1UM5H 2XZQH 1G43A 3NIDB 1JTPA 4KJWD 3D39D 1WO2A 3Q5OA 2R2HB 4Z95L 4X98A 1BYPA 1P1ZA 3HMXA 5FB8A 1TLMA 1G1OA 4N22A 2QDVA 5J3HC 4KI5E 1INDH 2H26A 3INUL 1KCSL 3POCA 3E80A 4XC1L 3VB9A 4IHOB 5K9JL 5J89A 1JZIA 25C8H 3DXAA 1SBBA 3LX9A 1SZNA 4OGXH 4WQOA 3QIUA 5J3HD 1XAUA 2I60H 2CCWA 3WIAA 2XN9A 2VH5L 4GP8B 4TNFA 5CJOL 4F7CA 5I0VA 2XCMC 3RIFF 5HD8C 5IF0A 1DJYA 3GLDA 4XNXH 2HFFA 2DQ6A 3S3BB 1G7PA 2QDWA 2P26A 3CDCA 3H0TB 2PW1B 1T7XA 1DLHA 4JKMA 5I6LA 5LQBL 1ETJA 2A4CA 3HVNA 2BNQA 5HD8D 2OR7A 3LH2L 2D7QA 3EIFA 5HYSA 1HHHA 3NVQA 3LZFH 3CQQA 1D5MB 1WC7A 4FQJL 2ISDA 3UP6A 4LLVB 1P84J 5D6DA 2AJXH 2X4QA 1MF2L 3QXVA 4HIXH 1B4RA 5AL0A 5PAZA 1B6DA 1VEMA 2DWSA 3N04A 4MJIB 1OPGH 5I1IH 2R0KL 4NQSB 3DHJA 2D73A 5BJTB 5ISZB 1M71B 4NOBA 1AD0A 5ILTH 1DQML 1AO7A 4P2QD 1T03L 3AMKA 4Y9EA 2OTUA 4TQPA 1A3ZA 3HTLX 3N50A 5EC1B 1DHKA 1OLLA 4MNHA 5D1ZA 3AWGA 2WP3T 3PWVA 5CILL 2VXUL 5F9WC 3K0YA 2VKXA 1OGSA 1DQVA 4PJXE 3OF6A 1YEHL 2CALA 2F53A 3MTXA 5AYTA 4ANUA 4AYBA 4CMMA 1PYWA 5DR5H 2F54A 1DL7H 3EH1A 1JGEB 3ZT6A 1FNEA 4LIQL 3H4HA 4ZX6A 2YC1A 1GGIL 3BVWA 2EUWA 4XMLL 1MJJB 4WW1A 3P4NA 1SMAA 3SDDA 1JPSL 1IGFH 4QRPD 3WN5C 4HJSA 1AXTL 2UWEE 2Y0SA 2NR6C 2ICWI 3VI4A 5KVEL 1GZQB 3ULVL 3SKJL 5I28A 2IH1B 3EHBC 5EUOE 4FNRA 3DX4A 4E36A 3QG7H 1GCFA 1T6VN 3X1BA 3IMTA 1YMMA 1JJUA 1WAEA 2NR6D 3EDJA 5TF0A 1JPEA 1KLFA 3QDGD 1CCZA 2Q9OA 4IKJA 1S5IH 4FTVB 3UGUA 4KH9A 4ZNEA 2MHAA 3IF1B 1M7IA 2OQJA 3NG5A 3LD8B 2NXZB 1OB0A 5C0CA 2D31B 1AXIB 3P0GB 1E8ZA 3KPSE 3RA7L 4J3OF 4QYOA 4P2OC 4ZOCA 1KULA 3LVEA 4OLWH 4O9HL 4JO3L 2FO1A 3IVKA 2XY2A 3TV3L 2BRRL 4P2OD 1NWOA 1TETH 1I8MA 3AROA 1HWHB 1R3JA 4Z7UF 2O61A 4WU5B 2Q2LA 3G6DH 4HS8L 3NZHL 2B0SL 2VZVA 2OZNA 3LZOA 4K94C 1T0MB 5I18H 4P8QA 3SE3A 3G6JE 1BZDA 1NOLA 2DQDH 4GW4B 4M7JH 4B9CA 4PYGA 2Z35B 1GS7A 3WDIA 4XE5B 4F58H 1G87A 3PCYA 1P9MA 4M1GH 1M56B 2XPZA 3JTSA 4GI9A 2N01B 4HFUH 1XSOA 2HWZL 1RXLA 3FU7A 4Z0BH 4LZKA 1LO2H 4NZTL 5AB2A 2YOCA 3KYKH 3ZE2B 4LRNL 3RG1C 3VD3A 4XODA 1E3ZA 1F4XH 2VW6A 4OD2A 4R7XA 4WWID 4KY1H 2WO3B 3UO8B 5LGHL 1XBDA 1U8OA 3ILDA 2R8SH 3RVXC 12E8H 2DMKA 2VSMB 5F1NB 2VIRB 1VFBA 5C0AE 4UINH 3ZJAA 3V95A 1E6OL 3W37A 1CG9A 5JW4M 1CLOL 4PRHE 2ZXAA 3AREB 2N7BA 2XKSA 5GZNA 3RVXD 3ARPA 4D9QD 1GHFH 4RGND 5E8DH 1KTRL 3N43F 1IU1A 2JJTA 4TVPL 4FQQB 5B1BB 2RQ8A 1Q0XL 4HAFA 2P5WE 2WB7A 4MBRA 1G7IA 3H9HB 1DQDL 1PG7X 3SE8L 2Y23A 1VFOA 3DK2A 3NIFB 3WFBH 1W16A 5LN8A 4L1HA 1QWHA 2BP8A 5I0YA 3ZW3A 1RIVL 2UXTA 2ZXDA 3RHWK 4AEFA 2BHZA 4Q6IA 4ELDA 3RNQA 1ZK9A 3GB7A 3OJ2C 5AWNL 4X6CA 4PTUB 3DVNA 1A14L 5EBMB 3ZR6A 4NRYA 4IEFB 4XX1G 5DZOA 3OXSA 5T1MA 3TJHC 1DFBL 2FL5B 2FHCA 1KIUB 2C9SA 5DJCB 3LKNB 1OF0A 1YEJL 1E8XA 2H32A 2OSYA 2GAZA 4P48A 4CN1A 3A67L 3ULAB 1W0YT 1SDDB 5TQ0L 7FABL 5KVDL 3VGEA 1KLGA 1FNSL 4W6YB 1H8LA 3C60B 1ZHNB 3CVCA 4KMTH 4AV4A 3OAWA 4P49A 3P11H 4BDVA 2JI1A 2AJSL 2WCSA 2ZF9A 5H37G 4AE0A 5AVQB 2B8OT 2JB6B 3SYAA 3B43A 5GZOA 4R4NC 1GY1A 1MW2A 5JXAL 2EKJA 5EWIH 1DQTA 1PAZA 2NY4C 2DD8H 1I7RA 3OL2A 3RL2A 3T0XA 5ITFB 3PGFH 3IAGC 2UVFA 2QMKA 4R4ND 2TRHA 4J12A 5AAMA 3I3BA 5C71A 4BJLA 1QUPA 3RY6A 3CDFA 3FT3B 3NN8B 2C1PB 2ZUQB 3VWJC 4XO9A 4HKJB 2GC4C 3G5VB 3MRJA 1H3UA 2XV0A 4MA3A 4UZSA 2Q6WB 4Y2DB 3H9SA 4AQ1A 3AGVA 1R3KB 4CVUA 2C8NA 4IJTA 5DI8B 5DJXA 4ABVA 3RQ3A 1MCNA 2Y69B 1QQDB 4OI7A 3D39A 5DQ9B 3VWJD 4Y5YB 3ASNB 4OFIA 3TP4A 4ANWA 4Z7VA 3S37X 3MUZ1 2JKRM 4U1HB 3AACA 4YHYC 4MDJA 2BS8A 1P5UB 1HHJB 1G1KA 1DEEA 5FGCE 4FULA 2BXYA 4NI6A 3K72A 3ZE1E 4BK4A 5L0QC 2EIKB 3LQZA 1A6WH 1G6RH 5E2VH 4BCXA 4YPGB 4A7GF 5CBEA 4ZTOH 2NLJB 3FFDA 3DKHA 2QQKH 2CWRA 3KXFD 5C0EB 3ROOB 2P4AB 1LK2B 2D7MA 1ZIBA 5CLWA 1INQA 1FWXA 3L5XL 5HDQH 2YS4A 5L8JB 2Q10A 4IBTA 2NOYA 1OK0A 3QUMB 4KI5C 4HUNB 4IHBA 3MBXH 3KVQA 5HHMB 1R3HA 8FABB 1KY7A 4PRPE 1MPAL 3GHBL 3KMDA 4KI5D 3BAYA 3KPPB 3WHXB 3A24A 1U6AH 4QHMB 3RY4A 1CR9L 1EEQA 1NUGA 1IQDB 1UM6L 2ZP8A 3T4AB 1HZKA 2IQAA 4H1LB 1RIUH 1IAOB 5IMKB 1A3QA 2HVKB 3WTVA 1A7PL 2VOTA 3W57A 3KJ6H 3RE0A 3UO1H 4HS6A 4JBSA 4PYHA 3TEXA 1IILE 1NPJA 2XN0A 3BAIA 1WD9A 3KPRB 1UZ8B 4MS8C 1CI5A 2QGEA 2IGFL 1MCOH 3P9WB 2EVGA 1NCCL 3IU3B 1I8UA 3IJ9A 4EI5B 1QFHA 5C0IA 5I75B 3EH3B 1UACH 5FGBA 2NQDA 4MS8D 4YGVB 1HVXA 4DO6A 3SKUD 1VKXA 4HQQL 4Q9RH 2DQFB 3SDAC 5I6NA 4QTIH 4NZUL 2BSSB 3LQAL 3OWEA 4JFYA 5T3ZL 1OF2A 3DURB 2N7AA 3FRUA 5HHQB 1IBBA 5EU6B 2P24A 3KPMA 3SDAD 3VXPA 3WEMA 1SLUA 1WF5A 4Y5VA 3L4TA 2NNAB 4OLXH 2OMUB 4QRPA 2DQMA 3GDBA 5ELIA 4K5LA 5F3BB 4ONHA 1E27B 2JIXB 1SMDA 1WFOA 4OIBA 4AVHA 1KCBA 3FHEA 1KNOA 1K5NB 2EH8H 3LEYL 2Z9TA 4LU5H 3KWVA 3WL9A 1H5BB 1Q9LB 5IHLB 2DAVA 4HIPA 3S34H 2NR6A 1NAML 2GTZA 3BUYB 3QDGA 2AEQL 1LD9B 4O02L 4ORZC 5EDSA 3H8NA 4G6KH 1U9KA 3CHPA 3HG2A 4H8WL 5F7KC 3TONA 3K8LA 4CRPA 5E94A 3NIFF 7CGTA 1XCTB 4GIPD 1QPPA 2DIEA 3Q3GA 3ZZLA 2WB1A 3ULVF 2R2BA 5T5FH 3EXLA 2KPWA 5MP6L 4TSAL 4DTGL 1F11B 2GSIA 4ZO6A 4MD5A 3MUUA 1WBYB 4X9IA 4E5XA 2CUHA 2W0KA 3HMWH 5AZEH 1MHHB 1KJMB 4HIJB 4U1IB 4E41A 1PPIA 5ENWA 1AKJB 3L13A 1NDMB 4KQ4L 5DYFA 3EYOB 5C0RH 2WVVB 1AOHA 5DQDH 3VA6A 5IHZA 1M2OA 2VN3A 4NI3A 3OKOA 4X6DE 5E6RB 1U33A 3BVNB 1U4FA 4MXWL 1MI5B 1ZAGA 2ESVD 1A9EA 4XWOC 2BOBB 2VDLH 1XHHA 1FL5B 3V55A 3WIFA 3F58L 5EO0B 4I77L 4S1DD 3V4VL 4YE4L 5CJXC 3OAZH 5INCA 1D5ZA 3CMOH 5D7IE 1QI5A 3MROA 3SIKA 1LJMA 3CN2A 1OP3H 1IT9L 1JXGA 3OAUH 2W94A 2Z1PA 3AS3A 2V7NB 1R3LB 4UM8A 4C54A 4D94A 1AZVA 5I8CB 4L3EB 4RSYA 4B7IA 2A9MH 4WEEA 3BMWA 1XGTB 4BGLA 1OCWH 4HHAA 5IQMA 3C5XA 4Z77B 1OW0C 4XP1H 2J8UF 2E5EA 5EIVA 2CK0H 2XN2A 3IBEA 4YFLF 1X9LA 4JDZB 1EGJL 5JPNB 2B39A 3WKQA 3L7EA 3VFWA 4F15B 3VRJA 1CFSB 1ZJAA 4NZRH 2ZOKB 4R8WH 4LVEA 1I7ZB 2F58H 1YQ2A 3GSVA 4FHJA 1KTDB 4YAQB 5AYUL 3WLBA 2VDQH 1T04B 3LKQA 1KYFA 2HX8A 3DYPA 5C0AD 1OP5H 3CFBB 4LSRH 2EC9T 2SEBA 3OAZK 4JFPB 2DQGH 5T1LB 3T6ZA 3AAZB 2AAAA 3RNKB 1NJ9A 1YEEH 3H2PA 4PRHD 3PU7A 3JYCA 5IR1A 1UFGA 5TDNA 2AXFA 1YDPA 3WXVH 3EGXB 4IIQC 4E0RA 5E1AA 1GGYA 4WI8A 4XPAH 4B9FA 2P5WD 3CZFB 5FUCC 3K6DA 4HD9A 1QBMH 1V3KA 1A6TB 3HLAB 4MCZA 4LKXB 4NLHA 3ASWA 1LGVA 3QWOB 4J3BA 1PZUB 3Q1SH 4PRBA 1XZ0B 3OZLA 4O58L 1I9EA 4OZFA 3RBSA 2OSWA 5GS0H 3TEUA 1O7SA 4CVXA 3PWUB 1QHQA 3NZUA 2HTKD 4ZX4A 5HGHA 1XD0A 3DHUA 3ARFD 5B3JF 3EF4A 4DGVL 5KVMC 4JPVH 3G5XB 3KW8A 4Y4FB 3WIHH 3KL0A 4X4XA 2OMNA 3WFHB 5AW4B 1VACA 1PY4A 3EH5B 4DO5A 4IOIB 3D4CA 2EE3A 3GO1L 2JKNA 4OLVL 3E6HB 1I7UB 4YDLB 3U4BH 3F65A 3LHPH 2R23B 4U1MB 2DH2A 4BA8A 1T2QH 1OP5K 1T3FA 4OVUA 4WK2B 2CDGB 1WIOA 3HN3A 5I74B 3N42B 4PGCB 3S36H 1MAML 2AXGB 3VWJA 1ID5I 4XBGB 5GGQH 3RWDB 1TTGA 5JHDB 3EOBA 1I4FA 1MCHA 4KKAC 9CGTA 5F9OH 1FNLA 2XZCL 1N10A 4XVJH 2FX8L 3UBXG 1NFKA 1UZ6E 2WXGA 3I9IA 2FBRA 3MV11 4ZG1A 3PNRB 2EYTA 5GGTA 3UBXB 5A7BA 4LOUC 3LKRA 4XR8C 3THML 1FG2A 4FNPA 3J7HA 1RJZB 4GLRH 4KKAD 1WA1X 2Y1AA 3R19A 3MNMA 4HH8A 1VADA 2PTVA 3LDBB 4EBQH 4FA6A 1CLYL 3NESA 2UZYA 1KBGL 1RHFA 2A77H 2MH4A 2O6DA 3KCPA 2WK2A 4QAWA 1MJ8L 6PCYA 4LOUD 4DP1X 3KS0H 3QUKA 4XP9H 1WDAA 1UD3A 3FQNA 1U8PA 4BH8B 5CJ8A 2CO1A 3QDJB 5D5MB 5HYFA 3B7TA 1P7BA 2EACA 3ZR5A 5JW4R 5D8JH 3QZLA 5CMAB 1F8TL 4NFCA 3WTSA 5IBUB 3A47A 4CSSA 2EE9A 4HCRA 2N1KA 3RWGB 4BSVA 2YD8A 4XRCA 3D4GA 2ED7A 1GYAA 5T3XE 1B9ZA 2OMXB 5FW6A 2VLJB 5D70L 3TTYA 1YJDL 2ZOLB 1DN0A 4OD3H 1S9XB 4KTGA 5K5YA 4LSQL 4ORGB 1YYML 3U2SA 3MGOB 2EEAA 3X13B 4F2FA 4R4BB 2B77A 1OAZL 2J55A 4XH2B 2V2XB 1GVIA 5HY9A 3BEWA 2WXMA 2AJZA 3P9MA 1UT1A 3GK8L 2QZ5A 2F61A 1RJYA 5IJKC 1OIOA 1UEYA 1KGYE 5E8EB 5MEND 1TVHB 5EIQA 4AX3A 3P73A 1AP2B 3DGCR 1ANUA 4ES9A 3OTTA 1BM3H 5DVKA 2J21A 2XIBA 5JZ7C 4FQXA 4J6RL 2OLDA 5MERB 5A7EA 5C07B 2FIKA 1RZGA 4WJKB 4PRPD 3DOHA 5BXFA 2OX5B 3DHPA 1CN4A 4NQQA 1FGVL 2DM4A 2QSCH 3JWDL 5IW1B 3WEXB 1ZSHA 2UY7B 5JZ7D 5DRXB 3SDAA 1W15A 3D0VA 2DLFL 2BP5M 1FCGA 4B9IA 5IWLA 5KUMA 3U46A 2WJ7A 2AQ3A 1HCYA 4GH7B 5C0GA 2GT9B 4ELKB 4HKZB 4FDWA 2XQYG 1MG3C 4IU3B 5FKAA 3FCSB 3HZVB 2CDEA 5I8EB 5HYJB 4XNQA 4JHAL 1WGVA 1Q72L 3F12A 8CGTA 1FGNL 1UC6A 2CIKA 2QGBA 2VB5A 3L3DA 1M2VB 3GIZH 3HN8A 4PJXA 4C83A 3VGHA 4ODUB 5EU5B 4P9HH 1QWNA 3SODB 2VN4A 4JAMA 2YJLA 3CFDA 3I02B 4JPQA 4GEIA 3PUCA 3S8WA 4MJ2A 4PJIB 4WFED 3T2LA 5EF3A 2FGWL 3PIQB 5J5EA 2O26U 1FG9C 2CJUH 1H6EA 4R3SA 4Q9QH 3QFJE 3REWA 4LHUD 3C6SB 2YRPA 1NKRA 4J27A 3H9ZA 3OKNA 1LK3H 1ZK5A 3S3DB 4W4OC 2UWEA 4X0KB 3HZMA 4G8GB 2JQAA 2Y5TA 5EUOA 3STZA 4KOCA 2D7OA 3WFZA 2WINB 4LNRA 5DRZB 5LBSA 4L4VB 4NQED 2DIJA 2CKBA 4J2QA 2GTQA 3FMGH 5CZRA 2QGDA 3ALPA 3ELAT 3NJKA 4QRTA 1LNUB 4B3EA 2EE6A 3NOIA 4Z7UE 4P3DA 1HH6B 3X14B 3KPSA 1IX2A 2VLRE 2BNUB 3ZYJA 1U8HA 5TDPA 5E6IB 1HWGB 4WI5A 1NC4A 3R06A 5DD1H 4BXVA 5F6IC 1PAMA 3KLDA 2F0CA 2CLZB 4D9RD 3IE9A 5CJXA 2IFFH 4MAYC 4U05A 3CZUB 4X83A 4Q6KA 3KYOA 4NO2A 4FJ6A 3EYFA 5IIEA 1VA9A 5E4EB 1IKNC 2WZAA 3GTTA 1U93A 3G6JA 1F18A 4PWFA 1OSYA 4MAYD 5A2CA 2KZ1B 1ZGLM 4GKSB 1Q90A 3P4LA 5IV2A 4KZDL 2WYTA 2GQHA 2APTA 4Z7OB 2G3XA 1DN2A 4XNZB 4G8EB 1IL1A 2A73B 3GWJA 4WI3A 5HPMA 4ETQB 1RIHH 3INUH 3N42F 1HCFX 5DD3L 2YK1L 3BAKA 3TT1L 4F8LA 1N26A 3C6LB 1NCAH 1XB8A 3N9GL 2BIHA 3C12A 3S5LG 2PF6A 4AGMA 1IMHC 3D3VE 4R2GB 3D09A 3ZKNC 3S5LB 1N70A 2FCBA 3UJTL 3FO9A 5TF1H 5JLZB 1Q1JL 5T1JA 4HA1A 2Z6FA 3P0VL 4XBEH 4MXVE 5CJOH 2IAAC 4OCWH 1CXKA 1QLEL 3BKML 2HJKA 4X6BA 5C0AA 3SE4C 5B8CC 2XV6B 1G7MA 5IB5A 3ZKND 2M1KA 3S8FB 3I3EA 4NHCH 2NDFA 2VRAA 3AXIA 3DVFA 4PRHA 3WBDA 5DD5L 4MA7H 1CIDA 1AFVH 3QIBA 1WYJA 4W9JC 3ARDD 1U8QA 3ISRA 4HMDA 4OQTL 2P5WA 4WDIB 5EZIL 4Z7NF 3CDGA 3VFNA 1RULL 4MQ7B 4ODHL 4X8GA 3NZ8A 3CG8A 4MD0A 3UCRA 5I1JH 2ID5A 3TFKC 4FG6C 1E4WL 4NWTH 4X5QA 3WNPA 3A0OA 4IIQA 3DUSA 3DV6B 3BVVA 3M1BA 2A4EA 3P3SA 5BZZA 5AB9A 2R0KH 3CC5A 4Y19E 1OGAE 3RGVB 1B88A 4PI2A 4FG6D 3MV7B 4OB5H 2HLEB 5CCHE 4CADA 3UYPA 2OTPA 2PPFA 4Z0XA 3VRLF 3M88A 4E9QA 2DJSA 1UENA 1U3JA 1BVKA 1CFNA 1HSBA 2VXUH 3GTVA 3VFPA 4DGUA 2DL9A 3LKSA 1OARL 3PFUA 5DMIL 1BQLL 1CDHA 3MCKA 2Y6TE 4P05A 2XRAL 5DTFB 5LB1A 4EZKA 4WUKL 2YUWA 2MMXA 2VMCA 3COOA 3OZ9L 4UT6A 1ECZA 1YYLL 3GF8A 4BA0A 1MY5A 1TDQA 3N85L 4R7NB 4JREC 4NUPA 3UADA 2Y5EA 1T6BX 3OC8A 2P44B 4NC2B 5F96L 1V10A 1CGYA 2X6AA 5F88A 3L3KA 3TJEL 3VJ6B 3ORJA 3GIVB 4A7VA 2OL3H 5BOPA 5IOPB 1AQ8A 2NSMA 1A6AA 1PLGL 4KO5A 4PS8A 4AT6A 2LU3A 2J44A 5KVEH 2OMBA 2NT0A 2IAMC 3P1VA 4O51A 5I6MA 4ZFOA 4JN2A 4UIKL 5DZJA 2O5XL 1AR1C 3BAEH 3Q44A 1E3FA 3O8XC 1PX8A 5L4JA 4J5VA 1WCBB 3ZTNH 4HJ0C 2CH8A 2E9JA 4DKEL 2IAMD 1ZLSL 2EIJB 5A2AA 4JFWA 5H94B 1KN2H 1HSAB 4D0DB 4OGAD 5CGYD 4IOFC 2K9UA 1AYOA 4Y9BA 2FJUB 3O8XD 3RA7H 1MRCL 4P4KC 1KGCD 1PLAA 3HB3C 4HJ0D 2GJ6B 1JGVL 4O9HH 2QJDA 1IGYA 1TQCC 3Q6FB 3JV6B 1HHIB 1USZA 4PJBB 4EO5A 1HEZA 3S2AA 4W9DC 1GH7A 1UQSB 4K07A 2O4EA 4PJIF 4P4KD 1UXWB 3TH3T 3DROA 5HP5A 5G5DA 3HB3D 4EIGB 3RKPA 3H56A 1BJMA 5E00B 3IDXL 3UERA 1RI8A 3D52A 2IV8A 4HS8H 4HVBA 2OXHA 5D55A 3C5JB 4BFNA 3U2IA 3HC4H 1AIFB 1PGRB 5CXPA 3GRWH 4Q4IA 2VDKB 1LLAA 3ECBB 3D25B 3HZYB 4K3JL 4ZO7A 3M7FB 5TD4A 3VGDA 5EBLA 4EVNA 5KYYB 1LM8V 1HK6A 4TS6A 4MZIA 2CU9A 2WKLA 5GRYA 1I8AA 5JO5A 3Q8CA 3QARA 1RZ8A 3OHXC 4JO2H 4NZTH 1R3IL 4LRNH 1FVDA 1JZ5A 3FB8A 2A6KB 2VDNL 1QRKA 2XVLA 4ABWA 2UZXA 4UDUA 5IJKA 2E46A 3B6SB 4PRPA 4QHLB 5C7ZA 5T3XD 4I3SL 3RRQA 3QZPA 4BV1A 5I76B 4P57A 1QFWL 1MCDA 1SXZA 3KHQA 3S8GB 5EA0H 2YXVA 1E6OH 4JLRA 4QXGH 2EDNA 5AW2B 1TFHA 3MTRA 1ZVNA 1EZSA 4TVPH 3NFNA 3ZDXB 5MHSE 2DWDB 3SE8H 1ULVA 2EXWC 2XJKA 4Z5RB 5JIMA 4XN9A 4LGSB 5IFAL 4LQ1A 1H8OA 2FT6A 4EN3A 1LE9A 1CK0H 1DVFB 1RIVH 3WSQH 5I1HL 1TU2A 1MW0A 4PGEA 2J2ZB 1HJBC 5AWNH 2EXWD 5CFHA 5HGDB 2XBZA 3ELQA 2AW2A 1B90A 1G0XA 3QJFA 1TZGH 3HC0B 3L54A 5JIIA 3GMLA 3BPOC 3HRZC 4LIQE 2WTPA 4G6AC 2Y1YA 5AW0B 1RUPH 1WZ1L 4HIEA 4C59B 1EUUA 4TTDC 1WWAX 3CHOA 3OGCB 4P5TB 5TQ0H 2JJSA 2D0GA 5MEQA 3GPEA 3TC9A 5KVDH 4LBEB 3EFOB 1FNSH 4L8BB 1W72A 1BFOA 1TLKA 4F8NA 1CFQB 5KVEE 3ULVE 4LCWB 4NUGL 3ETBJ 3O9WB 4ODSL 5CGBA 4AIEA 4TTDD 3K46A 3MJ6A 3QVAA 4QI3A 4W4OA 5F3HB 2XWCA 5JUEL 4RAVA 5CN3A 2QPUA 3X17A 2AABL 3HFFA 4S11A 1P4LB 4KHTH 4UIMB 3I9GL 4OAWA 1Y0LA 1FIGL 5I8OH 1ORQB 5JXAH 3VSQA 3MLZL 3RJOA 5FDWB 1XH3B 4J2XA 1BQUA 4AYFA 1RZ7L 2E47A 1NANI 1SYSB 1LE5A 1DANT 3D9AL 4LCIL 3BWZA 5IHWA 5B3NA 1T7ZA 3QFJD 4M8QB 3BDYH 3BC9A 3NP4A 4F1ZA 4X6EA 3BZDA 2RQEA 2VJ0A 2NUTA 3BP7B 4J3OC 1M6OB 3VFTA 3ZIYA 4AZUA 3RVVD 3T2NL 1Q9KA 4BFKA 4JDEA 3KWTA 5LUMA 2NZ9C 1N4XL 2VQ1A 4TL4A 2OV0A 4OF6A 4PBVC 2E27L 4DW2L 1VPOL 4J3OD 1ZS8A 3KWWB 2QFRA 4U1SA 1X5IA 4X6DA 3BXNA 4JK0D 1JP5A 3E1F1 2NZ9D 4HK3J 4Q9CA 3MRLB 1IKNA 4NUJA 1BVOA 3NJIA 1J1OL 2ZCLH 4YX2H 2XQ0A 4JFXA 3QCUH 3II2A 1U3YA 2VLRD 3G6AB 3D05A 4R97B 4XCEA 5D7IA 1XGYL 3TCLA 2FATH 2NMSA 5EU7E 2UY6A 3ZYIA 4CSPA 2EXYC 2J8UE 4KKQA 3DECA 1PSKL 4KZCA 1EK3A 4I8DA 5EH1A 2OYLA 1Z9SA 1WFUA 3L5WA 4YLBA 2ATKB 1XX9C 5AW9B 2GY5A 4JFQB 2WN3A 2EXYD 3PJNA 1Y18B 2WTOA 5BO1L 1XSIA 1C7SA 3SDXF 1BPLB 4GAYA 4XT1C 3SO5A 2HKAA 4YBQC 3RWFA 2OK0H 1EO8L 3SE4A 2G5RA 5B8CA 2R1XA 3K0WA 2VR9A 2ZAGA 1XMEB 2MOQA 2VLME 2K9FB 4JO5A 4KROC 4TVPE 1MPAH 3GHBH 5CIPB 2E74C 4YBQD 5DUBB 1G7QA 2HKFH 1ES0B 3CIQA 4ZUTA 1WBZA 2YD7A 4KROD 1PJ9A 3D3VD 4HKXA 4HZLA 1A7PH 4RESB 5IJBC 2J5LB 3VXNB 2V2TA 1ZHKA 3BQUA 4A6YB 1T1ZA 3DRQB 5B39G 4C8XA 4H8UA 2Q3ZA 2ZKWA 4LHJB 4R96B 5B39B 4J39A 1NCNA 2HN7B 1XF1A 1YC7A 5FO9B 2IGFH 2IQ9L 3CFJA 1NEPA 2FGZA 4EIUA 4XGZA 2O93L 3TBVA 4ZFQA 4MJJA 1T5WA 1EUTA 4LLWB 5CP7A 4PN6A 4HQQH 4L2LA 4XNBA 2OMZB 2XYCA 1VHPA 3VFUB 4EDXB 5KVDE 4UMGA 5T3ZH 1S9KC 1I1AB 1E2WA 3MODL 4WWNA 3RX7A 4GFTB 2NYYC 2BIOA 5MI0C 3MV8E 4OCYL 2NW2A 4KC3B 4KFZC 5FLVA 4RVBA 2WYZA 2C4FU 1T1YB 2NYYD 4UQ9A 1E0OB 4Y19D 4HJTA 2O6FA 4UAHA 4F8TA 1JWSB 2JXMB 3QH3B 4PBDA 4M3HA 5DXWA 3FTGA 5IGXL 5SX4I 1A5FH 1CDUA 1ND0B 5GQBA 5EORH 3JTBA 2Z92A 3T6QC 2DF3A 5C0JB 5SWQA 2J88L 4PJFF 4L3CA 2LV4A 3MBWA 4DERA 3HA0A 3CXFA 2WWKO 2JKJA 3QEGH 4L4JA 1AXSA 3B4NA 2EYRA 3IFOB 3V6BR 4H8WH 4JY4A 3IS1X 2VKWA 3SPVB 3BO8B 3OR6B 4PJGB 3O8XA 4PWIA 3TTSA 4F2EA 1RAMA 5EOCJ 1MJ7L 1X4YA 4MJID 4TSAH 4DTGH 2K7QA 4MJ6A 1DVYA 4UAOB 5GISL 2X6MA 5ISZD 4FLQA 3DYOA 2A9BA 1W91A 3FUJA 2NNRA 2ZXBA 4WY7H 1BYOA 4KQ4H 2X0UA 4FP8L 3BP5A 4WTWA 1Y6NR 3L3HB 4RMSA 4D3CH 1MY7A 2O6PA 4I0KA 5IM7B 3D85A 1NFIB 2ROYA 4MXWH 3QQ9D 2C3WA 1LP9E 4PGBB 3QHFH 2R0ZH 1GJUA 1L9RA 2ZXQA 4FLOA 5DUML 3CXHK 2I5YL 4YE4H 4HIQA 3ZLQC 5DMYA 5TH2B 4UTAL 4HH9A 4TQHA 3T6VA 3GMMA 3QYCA 1CL7L 1FJ1B 4OCRL 2Q3AA 2L7JA