1PTZA

Crystal structure of the human cu, zn superoxide dismutase, familial amyotrophic lateral sclerosis (fals) mutant h43r
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLRGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
publication title ALS Mutants of Human Superoxide Dismutase Form Fibrous Aggregates Via Framework Destabilization
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ptzA00
1EQWA 1S4IA 3H2PA 2Z7ZA 2APSA 2LU5A 4A7QA 2SODB 1YAZA 1PU0A 2AEOA 1IBHA 1N19A 1P1VA 3K91A 2ZKWA 2AQPA 2AQQA 2WZ5A 4A7SA 3ECVA 1SXBA 3KBFA 3MKGA 1SXSA 1E9PB 1OZUA 1B4TA 1IBBA 4A7GA 1SDAB 2XJLA 3H2QA 3GQFA 1MFMA 2C9VA 1XSOA 1JK9A 3LTVA 2JLPA 3MNDA 4BD4A 5KBMA 2ZOWA 4FF9A 2VR8A 3KM2A 1HL5A 3L9EA 1OEZW 2WZ6A 3QQDA 1DSWA 3L9YA 2WWOA 3CQQA 1BA9A 3QQDB 1OALA 4B3EA 1Z9PA 1TO4A 2Q2LA 1L3NA 3RE0A 3GTVA 2WWNA 4OH2A 3GZOA 2NNXA 2AQSA 1UXLA 3S0PA 1IB5A 3SODB 1QUPA 3GZQA 3T5WA 1SRDA 3CQPA 2WYZA 2GBUA 1TO5A 1CB4A 2GBTA 1EJ8A 4MCMA 2AQTA 1PTZA 4A7UA 1SXCA 2K4WA 2WKOA 2E46A 1CBJA 3HFFA 3ECWA 3PU7A 1COBA 1JK9B 2R27A 4A7GF 2VR6A 4L05A 1YAIA 3KM1A 1PZSA 4N3TA 1SOSA 2WYTA 1E9QA 1SDYA 2AQNA 4U4IA 2Z7YA 1F1GA 1IBDA 4N3UA 3KH3A 1OZTG 2Z7WA 1F1AA 3HOGA 1JCVA 1YSOA 1OAJA 3KH4A 5CU9A 2ZKYA 2AQRA 3F7LA 3HW7A 1KMGA 1E9OA 1RK7A 2GBVA 2XJKA 1E9OB 2V0AA 1FUNA 2C9UA 1XTLA 5KBKA 1IBFA 1UXMA 1Z9NA 2WZ0A 1SXAA 1F18A 1SXZA 1XTMA 2AF2A 3F7KA 4MCNA 1U3NA 2WKOF 3KBEA 1SXNA 3GZPA 1DO5A 2C9SA 2VR7A 1B4LA 1AZVA 3GTTA 4A7VA 1E9PA 1ESOA 2Z7UA 4A7TA 2ZKXA 1F1DA 1E9QB 1BZOA 3CE1A 5KBLA 2E47A 4OJAA 2JCWA 1N18A 1Q0EA 4BCZA 3ECUA 1HL4A 1SPDA 4BCYA
chains in the Genus database with same CATH superfamily
2YBRB 4HJUA 4ZDHB 2AV7A 2XACC 3DMMA 3W9EA 4RMBA 4XH2B 3UTZB 3AG2B 3P4OB 3ZE0F 2V5YA 1J8HD 3P11H 2R4RH 3LZFL 5IFAH 1LM8V 2DQUH 3N2JA 1D6EB 3MREA 2VCOA 2FSEB 3EJYC 4D8OA 4NPYB 3PWUB 3D85D 3KBFA 2APWA 2P5ED 2WB1A 4C4UA 5DI8A 5E6IB 1PZ5A 1YNTF 1S7TB 1OGAE 1BREA 5JIMA 3KS0H 1R5WA 2I60H 1GR7A 1MCOL 2AXWA 2VLRB 3F6IA 4R5VA 4WI4A 2IH1A 4HS8H 1RIVL 2OR9H 4HIIB 1N12A 5CMAB 5JUEL 5H4YA 2ATKA 2QVMA 1Z9PA 4EO5A 2Q2LA 4FFZH 1DCLA 1C8PA 3GB7A 4MAUH 2J1XA 1XEUA 2B5IC 3SKJL 2FT6A 4YWGH 5B1JA 2XVLA 3E1F1 4WHTB 5E99L 2WWKT 5EU6D 3B5GA 4HWBH 4JM0A 1ORSB 3FSWA 4TVPH 2VABB 1MEXH 1NOLA 1T1ZB 1VFBA 3BGFB 2IGFL 2ORBH 4GS7B 5EU4B 3GXDA 5LAXA 4AEIH 2AAVA 2UWEE 2VZ3A 1YDPA 2AI0L 3EZJB 1I8LA 2J6WA 5B39G 1VZIA 1COBA 1TUPA 1A1NB 3X2QB 3D39D 1ZT1A 1K5WA 1PDKB 2AJSL 2YXWA 3IXAA 1T4WA 2UZIH 4TQEL 1FORL 2HVKA 3MRPA 3U48A 3QDGB 5C0BD 3VXTA 5ISZB 3PIQA 1WO2A 4JFUA 4ZOAA 1UWGH 2H3NB 3U9WA 4DAGL 3ARDA 5KVDE 1BQSA 1MRCH 2VM4A 1G9NL 1O6TA 5D7IF 4A39A 4S0HA 2YC1A 3GZKA 2C4XA 4G7YH 2EUZA 4XMTA 1XWVA 2V0AA 3ULUH 3BP6A 1N70A 3ZTCC 1A21A 2AANA 4ZFGH 2AVFA 4OM0H 2IC2A 3T0AA 3T2QA 2VC2L 2YWZA 3SPGA 3WIFA 1G4RA 4NN6B 1J5OL 5AAWA 3VVVA 4R0LB 4UZSA 3D0LA 5M94B 3PWJA 3COOA 1TQCB 1VZGA 3ZU8A 3VGHA 4HEPA 5IROA 2JQMA 1JZJA 1MWOA 2Q9OA 4GPVA 4JM4L 5AD0B 4L29B 1LTXA 3RHWK 2PR9A 1FVCA 4JRYE 2C1PB 2GJPA 3L4YA 4MD4A 1T0MB 1OAQH 1SHWA 5GSVA 2W07B 4NWUL 5KYUA 2ZOTA 1P1ZB 3OKEA 3IRCA 3ZDXF 1ORQB 3DV6A 4EN3D 1TZGL 3BAEH 4RAVB 3L1OH 4LOVA 4ZYKB 4L9LA 4QXTA 5D7JD 4GW5B 1BF2A 1Y1UA 3V4VH 2DBLH 3F7PC 3L9RA 1IE4A 1A7QL 1NAMA 4IRSC 5F1NA 3UJIL 4EE2A 3V52H 1QKZH 1RJYA 4M5YH 5C0NC 1UZ6F 5T1LD 1U41A 1MCLA 2HT2C 3HC4L 5FPIA 4A7GA 3ULVC 4GAJL 2ENJA 1GH7A 3MV7E 5DI8B 3CFIC 3NIDB 3LQAH 1E5BA 1FZJA 2CBPA 4R26L 1L0XA 2A9MH 4JDEB 4WV1A 5IW3A 4G2AA 3IPEA 3H42H 3EYQC 2IH1B 2Y5QA 1TMCB 4B5ZA 4GP8B 2BNQE 5B3JF 4MXVE 4OUOA 2ATKB 3SDDA 5LGHL 1KGCD 2QGDA 1QLEB 1VSCA 4NQXA 3VWKD 4I3SH 5I71B 4XNYL 1ND0B 2Y7MA 1ETZA 3BKMH 3GXMA 4BK5A 1K8DB 1J0ZA 2A9AA 4NKOB 1VFBB 5LO7A 3VI4F 2VH5L 4WIQA 5E94A 1N5AA 3SY0A 4GINA 3GRGA 5E6IC 4XI5C 1DVXA 3Q1SL 2XWEA 3BAJA 1TQTA 2E7BA 2C9QA 5F89A 1CU4H 5BV7L 2WLIB 5CGYD 4D9RD 3T65A 3LMJL 4ONHA 4QR7A 4QRRB 3H85A 5T5NG 4DKEH 3BH4A 4KKAC 2HVKB 4X99B 1D5XA 3MRPB 3OMZA 4AYGA 5LBSA 3S3CB 3IGFA 5LCVH 3WMSA 4HWZA 2NZ1A 2R0ZH 1CL7H 3BGFC 5C3TA 4ODTH 3RZWA 3UAEA 4AYFA 4DT2A 4GS7C 4N1EA 5IFHH 4XBPA 3LSOA 1BQRA 3OWRA 5KJRL 5MEPA 3O4LA 2XXFA 1CD1A 5DQ9A 3KWTA 1DZ0A 4Y1AD 4XPTH 4AGOA 2F1EA 2DQGH 2FIRT 3GMOB 3RWJB 2ATPA 1CLOL 4LRNH 3UZEA 3VFWB 4W1TA 4NZDA 5J1TC 4ELDA 5C0AA 5CKAA 5DS2A 3D0LB 1DQVA 3MROA 3PWJB 4ZD3H 5IKCB 2ZX9A 2OKMA 3QXAA 5DYOA 3UTQA 4XHJD 3O41A 3WTUA 1TSHA 2E47A 3EOBB 1YEFH 1FVCB 3T0EE 4ZODA 1HDMB 5GSVB 4PB0L 3RNQA 3Q01A 2YN5A 1QSED 3OKEB 3MRMA 1HQ4A 4LIQE 3K6SA 3DV6B 2BVQB 1A5FH 4CDHA 5ICYA 2CBTA 2OMNA 2BY2A 4Z18A 1W15A 1UATA 2VDNH 1G7JA 3C5ZA 3NIGE 1OAXH 4HK3J 4Z7VB 3EHBD 4NN6C 1SN0A 2WYIA 1W8OA 3UBXG 4R0LC 3TO4B 1NAMB 5GZOD 4EOWL 1XB3A 1NGZA 2F9BT 1RJYB 1TQCC 3QCVL 3OZKA 5T5NF 2VJ0A 1DBBH 1MREH 5PCYA 5A2AA 4KQ0A 3MLVH 4AKPA 5CKGA 1JFQH 2D9QB 4KAQL 4U6VL 1DBMH 5DJ6A 3BSZA 2BIMA 3CFNA 2Y0SA 2D0GA 3F00A 4RRPA 4WV1B 4GY4A 2XBTA 4GBXD 3VQ2C 1NCHA 3MRLB 1X5AA 3TU6A 1L3NA 4NLAA 5J12B 5KWYC 2NY7H 1HJCA 3AUWB 4LE8A 2NMSA 4PJXA 1J5HA 3SDDB 1A9BA 5L8LB 4LVHB 4G80B 1IB5A 3DSNA 4FP8L 5GGUB 3JSSA 1THCA 2BLFA 4O2EB 4UB0H 1AGEB 1L7IH 3C75A 3FTSA 1CYXA 4UM9D 3TYGH 4UDUA 4C56A 4EVNA 4WGKA 1BCIA 3T3MB 1AIZA 4PG9B 2YD1A 4FFYA 3KJ4B 4XOCA 3SBWA 4QYOB 2NYYC 1J0JA 2HFEA 3HMXH 3IS1X 4S1RL 3V6OA 1HIML 4GAYB 4RA0C 4GSDL 5DEFA 3T65B 4HIJB 4PRHB 1H6EA 2ADIA 5DD6A 1KGJA 5I0VA 3OSKA 5A2BA 4RSYA 1DQIA 1UC6A 2EDWA 3KYOB 3IE4A 4YZFE 3VI3E 5I71C 1MDTA 3S4SA 5EUOF 4WEBH 4LIQL 2CHWA 5AW5B 5IBTL 1ONQB 1KPRB 4GUQA 4NXSA 4YBHA 2ZF8A 1UVQB 4X6FB 2FCBA 3MRGA 4KXZH 5DK2A 5T5FA 1Z9SB 4AXWA 3UJJL 3LSOB 2NRDA 1N6QH 5ADOL 3QG7H 5MEPB 5JOPD 4EBQH 2F7IA 1CD1B 3FNKA 2DQCL 1XH3A 5GGRB 4MCNA 3BVTA 8FABA 4B60A 1DFBL 4PY8J 5TE6H 2YKLL 4BFJA 3LPWA 1R34A 2VR7A 4P5MA 4NKMA 2EDJA 3OHMB 2X4TB 4XNDA 3H2WA 3MROB 4J3UA 3GHEH 2FZ3A 4B9KC 4L4JA 1KJMA 3HG1D 5DYOB 2VRAA 3N1FC 3O41B 2IV9A 2V37A 1SMDA 5EBMA 4JFHD 3W57A 5B3NA 5J06A 3FQNA 1I53A 4P2QA 4YNYB 5GGSY 4R7DA 3U25A 2R2BA 4CVZA 1HQ4B 2Z7ZA 3QDME 4I9XA 1G7IA 3DJZA 4DGUA 4A38A 3AS3A 1JK8A 1NL0L 1P1VA 3KBPA 5DTFB 2P8MA 3C5ZB 2DQHH 1M05B 2PO6A 4G6FD 4HJEA 5J3HD 4HS6A 5AAWC 1ZLDA 4OBRA 3HUJE 2LR4A 2M1KA 4GRLA 4OLWL 3S34L 3R06A 4ALAC 1NGZB 3DJSA 3MRHB 4H13C 4X6DE 4JX0A 1T7ZA 2ERJB 3DI3B 2C9XA 2OXGB 1D6VL 1A6VH 1VPOL 4J6RH 5J7CC 3CFJB 2JVUA 3DTXB 1P84J 3GO1H 1FCCA 4K7FA 3UZQB 4Y1SA 4XX1G 3EYOB 5CFHA 3RL2A 5DJ6B 2P9RA 3LKPB 2LVCA 1BFOA 4UAOB 1QBLL 1SY6H 3IFPB 2ED7A 2FLBT 4HPYH 3BPNC 4HUXA 4OH2A 4PWIA 4XP6L 4D0BA 4CSZA 1KIPA 3DSNB 4HSAC 4PJ8D 3U0PA 1FG2A 3VXSD 4JPSA 3TO4C 2GI0A 3EGSA 3MJ9A 4NT6A 4EUPG 1HJBC 4U7SA 3QEUB 5DFTA 3WTYA 2XTJD 4DHLA 3WKML 4HGWB 4AMKL 1XMWA 1XH1A 4FG6D 4EVNB 3DO7A 5AW3B 2D2CC 3PRZA 4NDMA 3F83A 5LGKA 1CTNA 5TE7L 1KCWA 5CUSH 1C5BL 2R1XA 5EC2A 5KBPA 4WV1C 4LLWA 1GPOL 1JZ5A 1AXSB 2G3NA 3VFRA 2ADIB 5DD6B 2X1QA 5J12C 3ZYIA 3ARYA 4IOFC 2CHDA 3HE6D 4N22A 3SDDC 3SQRA 1NTDA 4XMKH 4LVHC 1WFUA 3QIUA 5KUMA 3AFLA 2XY2A 3ZGIA 1E9OA 1TG8A 3S4SB 3GYRA 1NGXA 4JY5H 3NJHA 2QSCH 2BOCA 3LNFA 1KTDB 4PS4H 5EEYA 4G70B 4H88L 1RULL 3MRGB 3V0GA 5DK2B 3FU0A 3HG2A 1PQZA 4XGZA 2JJUA 3WMQA 2XYCA 3KJ4C 2CRIA 3TN0A 1OW0C 3L81A 4DKDC 5ERWA 5MENE 1XH3B 3KPRD 4UMSA 5DJDB 2B1AH 2B59B 2OV0A 3MBWB 4QAWA 4OD2A 1F6LL 2NX5E 1OO2A 1SQ2N 1UOKA 3GUFA 1IIIA 2DIAA 3JWNG 4NOFA 3DOHA 2AJVH 1YC7A 2VLKB 5AKRA 5JMOC 2CO7A 2XN9A 2FWOA 1G6RA 2BS8A 3OMNB 3STZA 4YDKH 2ZG3A 5C08A 4ZMVA 5DHXB 4P2QB 3BESR 2OW7A 4ANWA 2R2BB 4CVZB 1GOFA 2A77H 3MA9L 2NZ9D 2X9XA 4PY7B 4XOEA 1G7IB 1U42A 2K6WA 5TQ0L 4U1MA 4LP8A 1YY8A 4OLXH 3UZEC 5I6KA 4B9PA 2FVNA 1GZQA 1OARH 3MJ8A 4DTGL 3HG3A 4ES8A 4WK4B 1QLEH 2B3RA 1EVTC 1Y18B 1F90L 1Q9OA 3OKNA 3R06B 5I1EH 3SJVA 4GG6B 3ZDWA 1UJTA 4I48A 1OB1A 4PJCA 4MYPA 4M61A 1Q1JL 1I1FA 4JLRB 4ZMXA 1RIUL 3MBXL 1MHPL 4H2CA 3RL2B 2O26U 2DICA 1KLUA 3OAUH 4H26A 3KAAA 4IKLA 5EDXA 3W2DL 3FMGL 5L9DL 3BDBA 1BFOB 1GY2A 4WW2F 1BZEA 1T0OA 1V3KA 4WJ5A 1DVQA 4AQ8C 2VR4A 1JZ7A 3ZSTA 1H8OA 3OZLA 3C5ZC 4OF0A 4RDBA 4D0BB 4JGNA 4NQDA 1UJ3A 4PU2A 3V0VA 1KIPB 2XFXA 3SKUD 1FG2B 2GBUA 5DZLA 4C4KT 3EGSB 3SBPA 4NT6B 3Q8AA 4UTAA 2ERJC 4QRPA 5EU7E 1I1AD 4M9PA 4CMHC 2R29A 1A7NH 4ISVB 1DSYA 4NDMB 4YHMH 2CGYA 3WE1A 4MKMA 1ZPLA 1X5HA 4F2MA 3WYRA 2R1XB 1UEMA 5EC2B 4GAAA 4LLWB 4UAOC 1XGRA 1P6AB 4LHJB 4OZHA 3VFRB 1TENA 4GKNA 5GS2H 2QDVA 4GO9A 3GBNL 3EJPA 2CKBA 1GAFH 3FPYA 3NFNA 4Y4KA 4KV5F 4PBXA 2GVYA 1E9OB 4FHBD 1FF5A 1MXDA 3GHBH 3V4LA 3CPLB 1MCNA 1P7QB 5GRVK 3LY6A 2BOCB 3DIFB 4L4TA 1GL4B 2AERT 1F3JB 4JM2B 4CC4A 2YD3A 2YFNA 3POHA 4LCCA 1PQZB 4YHLH 2D03L 1ZA3A 2R0KL 1MFBL 3NTCL 5EEZA 5AAMA 2XY1A 3SBWC 1A6AB 4RGND 4MNHA 1YO4A 3VH8A 2Z7UA 3VGGA 4OD2B 1U8QA 2DD8L 4HJ0D 1TIUA 1Z5YD 3LNDA 3QHZL 2HRLA 1BG9A 1MIML 1DVSA 1RZJL 1NAMH 3JWDC 5IJVB 5KYNA 1J8RA 4A67A 1I7ZA 4O2FA 4PJHF 2XN9B 2FWOB 1FGNH 3G6JE 4BCYA 2VRKA 4GQZA 3GSOB 1XIWA 15C8L 1OE2A 1UM5H 5TFSH 2XWBA 5C2BL 1JWMA 1YEEH 2CDEA 3CK0L 2EDKA 4JZJA 4AQAA 5HGAB 4KRMB 2V2TA 1NFDA 1QD0A 3QZMA 1A3ZA 5I76A 2BRQA 5SWSE 3NZHL 5HDWA 3KPOB 4U1MB 4I1PA 1E5AA 1MF2H 2GCYB 1I3GL 1GZQB 3WU1A 3KYKH 4FXGA 5EU3B 5LQBL 4MAYA 4TLKA 3W0WD 2HG5B 3HC0B 1Q9OB 2E59A 3FXIC 2F2HA 3SJVB 4EUPB 5EBLB 2PW2A 1OB1B 3AM8A 2ALWA 4PJCB 3ATAA 1I1FB 1XVSA 1U3YA 1DQKA 4JPIA 3OR6B 4G8GD 2JJSC 3ZTJG 4HLEA 1KULA 3PAYA 4KVNH 1AQDA 1S7QA 4W6WB 4X6EA 3ZYZA 3DX3A 1KLUB 4FTDA 4R96A 3ARVA 5F0PB 4AH2A 1MHHA 1XGTA 2G30A 1AMYA 3H9HB 3QULA 1OP9A 3RUGE 3KNBA 5CLZA 3U4EB 3PWPE 1LO0L 4WKXA 3L3GB 4QWWC 3MRJA 4UDTA 4XMZA 5HVWA 2P24A 1PIGA 5GRUH 3V0VB 5LBSH 2XFXB 4XC3L 2EXWC 4W9ZA 4G83A 4R2GD 3DNKA 3ZKMD 1XH2A 3BFOA 3VXRE 1NMAL 1QWNA 2C26A 2ZPKH 2QMKA 1QUNA 2F7PA 5F9WB 4NHCH 2B77A 4MMYB 3D0VB 2FJSA 1DQDH 2Z6FA 4LCUA 1WWWX 5HGHA 5IFJA 5HJ3B 3I6GB 3O9WA 4BKTC 1AH1A 4L9DA 1F58H 2BVTA 1XGRB 3BVNB 4OZHB 3KPSA 4TLSA 5GRXG 4PJFB 4PJEA 2UZXA 3QSKB 4JRXA 4EI6B 5I0WA 3NFNB 4M29A 4Y4KB 2EVJA 4JY4B 2HRPL 3C5XA 4JFOB 1ZHKA 2XV2A 5E4EB 4L4TB 2O6FA 4BV1A 4JFFA 1VDGA 5TE4L 4H8WC 3OF6D 4F5CE 4LCCB 2EDYA 5C07E 3VSTA 3SE8L 1OE1A 2EE6A 4QRQA 1CL7I 5EB9A 3NK4A 1L0YA 4EDWH 3BH8B 2M8XA 3L3KB 3QUKA 1XD1A 3KLQA 4PLNC 1DQQA 5E6RB 2JCWA 3FQTA 1FNGA 1UASA 1CVSC 1URZA 2BOLA 2VDMB 2A6JB 4JN2B 4W9KC 1I7ZB 1EQWA 3CH8A 1BXVA 4YK4B 3ZO9A 4QKXB 5I1DA 2X10A 4JM2C 3FTUA 5DQDH 5FYJE 2XWBB 3LDBB 4NGHH 1HX0A 1JWMB 3AT0A 4AQAB 3F3HA 3RVUD 1X4YA 1PJ9A 4P06A 3K2MC 4ZK8A 5I76B 3QI9A 1S7UB 4I87A 5IVNA 3BJ91 4CNIA 4XBMA 2NW3A 3C6SB 3MHZA 4XWGL 3CN3A 5D7KD 4MAYB 5F96L 3DX8A 4HBCH 3CU1A 4WNQB 1EHLH 3NGBB 5DS8B 3FT4A 1L4IA 4F20A 4HKJB 3KWUA 1LDPH 2F58H 4PP2A 3DK0A 5C6TL 1S7QB 4BUQA 1EMTH 4BFNA 1UXLA 5M95B 4R96B 4P2OD 4ZX6A 4AH2B 1MHHB 1XGTB 4JN1L 3QULB 4M7LH 3KNBB 3RKDC 2ZJSL 1TEGA 3TTYA 2GC4C 3DWTA 3T1FA 4LOEA 3WFDL 3HI6L 3JWDH 3ZT7A 5I5MA 1T3FB 4QXUH 4QMEA 2CPCA 3ABGA 4XRCB 1MNNA 1AS7A 3NT0A 1UWYA 4AJYV 4W9EC 5F70A 3IMBA 2VXTL 5JTWA 1UGNA 1QUNB 2PTTA 3EJCA 1CXIA 2H5UA 5DO8A 1A6UL 2Z34A 2QQKH 3TBBA 4JFEE 5IFJB 1PW3A 1ASQA 1NIAA 1WZMA 2EC9T 2GIXA 4LCUB 5E2JA 5HGHB 1GGIH 2GY5A 4RVBA 1YSOA 1WBXB 4FFVD 2WB7A 1KTLA 4FQ1H 3I6LE 4GXUN 3W11C 3TZVA 4E36A 2NYKA 2NUPA 4UM8A 3JWOC 4JRXB 5FYJL 4Z77A 3N9GH 5EO1B 1NCAL 5CJ8A 4JDZB 3WCYA 2WLNA 1HOCA 3OMAB 2XWCA 1ZHKB 4TOYL 4BZ1A 4CKVX 1P4BH 4PW9A 5KYWB 1AQKL 4LU5H 4FQXA 3CHPA 4JO2L 3E6HA 3VQ1C 3WJJA 5F9WC 4BQ6A 4KKZA 3JVFC 1UB5A 4WO4D 3QO0A 1HWHB 1PVHA 3QS3A 4NRXB 1HYSC 3KGUA 4ICWA 4RQQA 4KXZI 5B3SB 1FBIL 2AS5M 3QJRB 1J8HE 3UYRH 1DQQB 1U8IB 1GS8A 2ENQA 4XCCL 3FQTB 1FNGB 1CGYA 5KSAD 3V0EA 5ETUA 5C8JA 4FQLH 4PGDA 5F9OH 2EE0A 3FCSA 4Y4KC 3JWNC 2P5EE 3DX7B 3BZ4B 4BH7B 2GBAA 1ZA6B 3CFUA 3BT2H 3T0DA 3N43F 5E4EC 1ZHNA 4DZ8A 1U6AL 1JZ4A 4XVSH 5FOBA 1MAJA 3EG9B 3O0RL 4LCCC 4B3VA 1H3VA 3CXFA 1UXWA 1T20A 3P77B 1IVTA 4YAQA 4N2EA 4XB3A 4IM8A 1I3VA 3ZLQC 3P0GB 4A04A 4MWFA 5EZJA 2D7OA 5F7MC 3E7JA 2BSCA 1BIHA 2JLPA 3F7YA 3ULUF 3D7PA 1FGVH 2XQBH 1A66A 5EU6E 4JG0H 5AW4B 3HKZA 3G5VB 5E9NA 2RH0A 3MJ9H 4WTWA 4NC2B 3B7TA 4QTHB 4CGUB 3AG4B 4YK4C 2BP3A 4J3WA 1MRDL 4Y2DD 1N7MH 1ZRUA 4H8WH 5FGRA 4PP2B 4UWQB 1L6PA 2EDXA 4N28A 2JELH 4JPQA 5DUPH 5MERA 3LDBC 4NCC1 3RWHB 1KCLA 2YAFA 3B9VA 3D39E 3LNEA 4HCRL 3UAJD 2E7MA 5DLML 4Z7NB 4PVLA 5D7IE 4PJ5B 4PLJC 4K9EH 2DW5A 2R4SL 5C0BE 3TPUA 2R7EB 3B2PA 2X6AA 3KHQA 4QGYA 4MAYC 5DC0A 2EXYD 4X9IA 4E41A 3T1WA 3HCVA 3NGBC 3AM8C 4PPTA 1F4WL 1DHKA 4WTXA 2JB5H 2RGSA 4XP4L 5BUGA 3EJSA 3QUYD 1F8TH 3GK8L 5CN1A 2P45B 4H44C 1AE6H 3CXDH 2L7UA 4HIXH 4L37A 4LL4A 3FB8A 4F8PA 1P7BA 2ZNWA 4X7TA 1M7IA 2QADB 1OD9A 1XDTT 3RGBA 1F86A 2HVJA 2J4WH 4Z77B 2JJWA 2W81C 2EICA 3TASA 3S3BB 3ARBD 3IN2A 4CADA 1QLRA 4JJOA 3PHQA 1ZSDA 3A4FA 4YXLH 5A43C 1EJ6A 4HGMA 2WVTA 1KC5L 4J1UB 1KFAL 5CBEB 1X5YA 2JB6A 3QO0B 4I85A 1T66D 2X88A 3S9DB 3HZVB 2ZOKA 3UIYA 1KBKA 4RQQB 3CH1A 2WNGA 4JPWL 4X80L 3DXAD 1SN2A 4K8RC 1JF6A 3JT2A 3AT8A 5HTSA 3CIQA 5B1CA 3EJYD 5C8JB 4PGDB 2I26N 4LSTL 5EZPA 4YLCA 1JGIA 3P9LB 1IFGA 1VADB 2FWSA 4EUPH 1MVUB 4ZX3A 2BJMH 4X0KA 2VDOL 1DLHA 3NCBB 3V0JA 1RSFA 2CNZA 3NCWA 4M5ZH 1JUFA 3P4NA 5HGBA 4XP5L 5FCUL 1MFDH 4FZ8H 1SBSL 2GW5A 4PTUA 1U8NA 4QXWA 2MHAB 4OIIL 4U05A 1HKLL 4YAQB 3WEMA 5JYMA 4G7VH 3C87A 1S9VA 2PWGA 2WM0A 4L3AA 2X70A 2YD7A 1M42A 4MWFB 2DMBA 4QXGL 3UDWA 1KGCE 2YAQA 4IKKA 4RMVA 3TBYA 4GQ9L 4O5LH 5HHMD 2FUTA 3ULSA 4YHNB 1QYGH 3MYJA 1FNAA 3SGDH 4KNQA 1CE1L 3U30B 5BUAA 2ADFL 2OJZH 1DO6A 4NQED 1TVHA 1USQA 3WTSA 5HYJD 5JQ6L 1T7VA 2Q0ZX 4RBPK 4Z0BH 1ETJA 1UA3A 4D9RE 4AZ8A 1SEQH 2YQ3A 2AFNA 3RAJL 2VR3A 1RHFA 2YN3A 5AL8A 4YMPA 1QSFA 2EKSB 2Z4QB 3B9KB 1CWVA 2DAVA 3DC0A 1ZGLA 5IW1A 2X87A 3TPUB 1EFXA 1Z2KA 3QDHA 2Q8AH 4P4KA 2CKBH 1EA9C 2QKSA 3Q2WA 1ASOA 4OGYL 4MCYB 2WTRA 1ZY9A 3O8XD 3JWNH 3V7MA 4YS4A 3CZFA 4CU7A 1CK0H 4WK2B 4JG1H 1EGJA 1TETL 3WGUB 5C9KA 4HUWB 1A2YA 1HCVA 1IKNC 2VW4A 4TNGA 1JDDA 3M86A 1JTOA 4Y1AE 3SGKC 5LUMA 2X4QB 2ZOLB 4JFZL 4P48A 3IB4A 2LAGB 2J6EL 4OZIF 4KXCA 2O6CA 4G9DB 1M7IB 3D25A 4NQVB 3BN9D 3T77B 3NCYS 4RWYL 2Z35B 2QQQA 1FIGL 2QL1A 1WTLA 1S7RA 2YQBA 3KWXA 2HVJB 1HTYA 5FDWA 2A0LC 5ALCH 2VDMH 5F7EH 3NG5A 3JUZA 3OPZL 4MJIB 4LLDA 2IPUG 1Y0LA 1FNSL 3K3QA 4CADB 2P5WB 4HXAL 3MO1A 1AG0A 3O2VL 3FF7A 4AV0A 3PHQB 1S5HB 3QEHB 1W80A 2AK1H 1GJIA 1QSEE 5C1MB 3N1QC 3CLEH 4OZGE 3S2CA 3ZDZF 2FLMA 1IBGL 3QIWA 4K94C 4ZAKB 1LE5B 2Y07L 5ABDE 3E3QE 4LHUA 4B41A 1EXUB 4J2XA 2AZAA 2RFXB 2H1LM 3KPPB 1S9WA 1T1WA 1XGUA 3VA6A 3CH1B 3KW7A 3BWUC 2QADC 3LRGA 2IMMA 1IARB 1SPDA 2LAAA 3TFKC 4LGRB 4ZQTA 1LO5B 4X8JB 4ZUTB 3TBVA 5IMMA 3KR3L 3MUGA 5C0ND 5C70A 1UD6A 5TQ2H 2XQYA 4ZQKA 3TGXA 2KH2B 2HT2D 4BSVA 1ED3A 1NFAA 4L2YA 3ULVD 5G5DB 1P4IL 2B4CL 1IRAY 5EEVA 4X0KB 5CILL 1DLHB 4OD3L 4W70A 1JUFB 4MYWB 2JKWA 5F7BA 4PTUB 5I1IL 3QYMA 5E8DL 3WJJC 4I18A 1OPOA 3EYQD 5IB3A 3EO9H 3BRGC 1WGOA 3GSQA 4X4ME 3RVWC 3GRBA 1W2KT 1JZDC 4XBEH 3KM2A 1JWUA 4NO0D 3TBYB 1T80A 2K7QA 5B7MA 4XXWA 5FR3A 1I82A 3ULSB 2YGVA 1CLYL 3MYJB 4FNUA 5IHLB 4G5AA 4G5ZH 2EYRA 1V5JA 2R56L 4M8QA 4HU8A 3CZSA 5IT2H 4Z7IA 12E8L 3CFBA 3J27A 3IDMB 4N8UA 4N0YH 1CQYA 2GBTA 2KLRA 1ZHBB 5FHBL 2F5AL 4D7BA 1QFWM 2HTKD 2BCKB 5DLLA 1QSFB 1HI6B 4JE0A 4K8RH 1GGBH 5I9QB 4FHJA 1RFDH 3NEOA 3STBA 1CMOA 2WXMA 1A6PA 1A1OA 3TVMA 4P4KB 4IIZA 3NA4A 1KBBA 4HJTA 1SUHA 1JNLL 3BP7A 3H7BA 3KLLA 3U30C 3HR5A 1NCBH 1IM9B 4MNGB 3Q48A 1A2YB 3MLYL 3FU9A 1C08A 5JOPE 2W9EH 3FN0H 1GXEA 1OAJA 3KGSA 3QORA 3LZOA 4F9PA 4O58L 3REWA 2EDOA 4LVEA 1IQDA 3TIDA 3DTUB 4JGMA 3D25B 4QHNB 5EO9A 3B9KC 1UM6L 5J11B 4Y7MA 3LOWA 3SDXA 1URIA 4MDJB 3CDFA 5I24A 4KGJA 3SGEH 5ISZD 2DWDB 4JFDB 5FDWB 3HG1E 2FQGA 1IX2A 3GZPA 1OGAA 4B96A 3QZOA 4LLDB 4KKBD 1Y0LB 5DVMA 4JFHE 1CLVA 5EOQH 4LDOB 4BSJA 4B95C 1I4FA 4ZO7A 2FD6L 3GLEA 5KBLA 2FHFA 3TURA 3B8SA 3PWLA 4L3EA 3ZL4L 4LHUB 5DUBB 3IDUA 2E86A 2CE6A 4CVXA 1KACB 1I7RB 2EYSB 4JGUA 4NEHB 3WE6A 3ARFC 5DD0H 3FYEB 5JW4Q 3R1GH 3BIBX 3UJTH 1KJ2A 1QA9B 1MIEH 2ESVD 3B1TA 1R3IL 4Y2OA 4PS7A 3MUGB 2HKHL 2Y23A 2UWEA 2XI9A 3HN3A 1M2VA 3K6NA 3EYFA 4Y8DC 3ZL2A 2EDQA 1ED3B 4TLUA 1SLWA 5E56A 2XA8L 4DUWA 4XMXA 5CR8A 3PPEA 5ESQB 5CGMA 1AO7B 3O6KL 1I85A 3DARA 3K72B 3CHSA 2JJVA 4ZAKC 1I9IL 2XXCB 1N8ZB 3JUYA 3LB6C 1HINH 5J6SA 5KANG 1TJIH 4XNXL 2D4FA 5H2BB 4A2MA 3VXSE 2EVGA 1IMHC 1OALA 1QBBA 3GTVA 3IJYB 3DDFA 5BRZD 4BQCA 2XTJE 1MDAA 3FO2A 2JTDA 3GZOA 4F57H 2MKLC 3NZSA 2AABH 4OF6A 5CBAB 3QRGL 3ZDYE 3P2BA 2LOEA 2AGJH 1EDYA 2EYRB 4M8QB 4ZTOL 3OHXA 4K94H 3G08B 3QH3A 5BCAA 4NLHA 5JW4N 1AS8A 1E40A 3QA3A 2FYVA 4QHLA 3UPRB 4XN4A 1U92A 2MPVA 3T4AA 2R27A 4JQXA 4ZTPL 3NIDF 3V4UL 1IV8A 5ENWB 3RNKB 3NSYA 3UDWC 1HHJB 3TVMB 2V17H 4JRYA 4TSAH 4YOKA 1FCGA 2XZCL 1HH9B 5TGBA 3HS9A 5ESVA 1SOSA 3H7BB 3HR5B 4X6CA 3KYAA 4BZ1H 3L3HA 5JXAL 4F7EA 3N1PC 5L4JA 3OKKB 3MX0B 2WSKA 3V0DA 1E28B 1LVEA 3DUSA 3M7FB 5CAYB 1ZV5A 5A16B 1OTUC 1PLGH 3KPRE 3V5DB 2HMIC 2IV8A 3F7VB 4NUGH 4OFDA 1BQLL 4BKLB 2DRUA 3A3YB 1IQDB 2YPLA 5F1KC 3TIDB 4QRRD 3GJFA 3IFNH 1IC7H 1XTMA 3GF8A 3SDXB 5I9QC 4F3FA 4P4KC 5AWNH 1FVEA 2DLTA 2G3MA 2GITA 2R69L 3KYNA 1OGAB 4H5SB 2G9KA 1MPAH 4AE1A 1ICTA 2G9HA 3LHAA 5K1JA 1UWFA 2YEZB 5G4MA 3V6FA 1Y7VA 2BNQA 1XSIA 1CR9L 1HH6A 1PGRB 4ADIA 2J1KA 3PWLB 4L3EB 1HL4A 1IGJA 2I5YL 5C0GA 4O00A 1EZSA 1G7QA 4OFQA 3UAFA 1BLNA 3WE6B 5DJ2A 4A2FA 1FFTB 2IAMA 1R4XA 5J11C 1MHCA 3DIVA 1DVFA 2R59A 3HAEG 2C3VA 4PBDA 1A3QA 2EDLA 5I8OL 1NBYA 1H3PH 2YUXA 4U1JA 4Y2OB 3HFML 5DSCB 5JHLL 2B0SL 4P59L 1S9KC 1NCCL 1SXBA 2G75A 4LGSB 4FABL 3VYPA 1LL1A 4OBSA 1MRFL 4NQTA 3RWDA 2ADJA 3ZO0A 5AOJA 7CGTA 2PTVA 4G6MH 4NRYB 2YXMA 2EUWA 4FMFA 4NZRH 3ZR5A 1R24B 4NBYB 1E4KC 1S8DA 2VXQA 5JIIA 4XVUC 2NCMA 5AYUL 5KVGH 1Z3GH 3TNMA 1QX1A 3INUL 3WXVH 3MV9E 2A3TA 5D5ME 3WFBH 1M1SA 3TO4D 2DWXA 1BGXL 4YC2B 1YEGL 3GM0A 4X6BA 4IDJL 3FO2B 4X5XA 1JV2B 1JP5A 3O6LL 1DE4A 1U91A 5CJXA 2M2DA 2J8UB 3CVCA 2K6ZA 3APMA 3S48A 2V9TA 4B53A 3M45A 1FE8L 2GTZA 2Q6WA 2W1NA 3QH3B 4HXBL 4L1LA 3ZHKA 2NY3B 4M3HA 1L5GB 3EFDL 5E24E 4F8QA 4KMLB 3VM7A 5BV7B 1KTCA 3QDAA 1U92B 1ZXKA 2CJSA 3N44B 3QRBA 2HX8A 3KLDA 5F7DA 4A7GF 4BEIA 3LS5H 3T4AB 3OKYA 4DP7X 4MJ5B 4IS6A 4IOFD 4KHXH 4KTEH 4N2HA 5FYKD 3T0EA 4JRYB 4N2AA 3RY6A 4JG9A 4HFUL 3IJ8A 5INCB 5B7EA 3QJFA 1AR2A 2Y24A 4OGQC 3KD4A 3MRNB 4X6CB 3U7WL 1M6UA 4WI7A 4DP2X 5DDHA 4HKXA 4F1SA 1FDLH 2F18A 4M1GL 4F7EB 2VIRA 4M4PA 4YX2H 2WYHA 4ZI8A 1RUML 4N85A 4OU3A 4RGNE 4DP6X 4NQCD 2X3CA 3JZ7A 3K8LA 1IQWH 3E38A 3K0YA 3MLWL 4PP1C 3NCJH 3CDGA 4PRHD 3FQRA 2YPLB 1ZHLA 3TBWA 2GHZA 3BE1H 3DSFL 3CDCA 1K2DB 1KEMH 3N40F 5T1DH 1FVEB 5EEXA 1ANUA 4M1DH 3KYNB 3U9UA 4MMXA 2WQSA 3U6RB 5KJ7E 5CEZH 2PR4H 4WZ9A 2NY4B 1B6DA 2BNQB 3NACH 2BWQA 2DQEL 3TYFA 1KLFB 5BOJA 3IBOA 3CX2A 3QAZB 1IGJB 1NGQH 5E9DD 1RIHH 5I6LA 4TUJA 3IDGB 5E2UH 1G7QB 3BRFA 3B2UC 1OD7A 5DJ2B 5BMFH 2D7MA 1GIGL 2IAMB 4Y16D 1QFUL 4RX4D 1MHCB 1OKEA 5F1OB 5AZEH 1KB5L 1URLA 2C3VB 1WLHA 2WKLA 1NBYB 4U1JB 4NHUA 2BVUA 3SGJA 2P80A 3D3VD 4XCFL 1LEGA 2G75B 1ID2A 5DT1L 4G8GE 4F27A 3LPGA 3MI6A 2CO6B 3VNZA 2C9VA 4I13B 3RWDB 5CZVH 2IFFL 4NZTL 1H3TA 1JPSH 5IBUG 4N2IA 5F8QC 1KEGL 4D9QE 1NCDH 2FJHB 5CINL 1OAUH 1WEJH 4JY6A 5EPMB 3TNMB 1W0YT 4GW4A 1IZJA 1MOEA 4PI0A 1UT9A 1M7DA 4PJBB 3NCCB 4X6BB 4X5XB 2CLRA 3ES6A 5GZNA 1Q72H 1K4DB 2D3JA 1CFMA 2UY7A 1DE4B 5T3ZH 4FQQB 4I4WB 1NUFA 1UURA 3M88A 5I18L 4Z76B 3SGDI 2Q6WB 3U0WL 2UXGA 1FIEA 1BV8A 1O7VA 1B2YA 5BZDA 1UHVA 2DWYA 3DHJA 3CZJA 4M6NL 3VDBA 2K1MA 4S11A 2UVEA 1BQKA 4U3SB 1QBAA 3EYUL 5F71A 5F7DB 1OGSA 4ZXBA 5K9QG 2CO1A 4IS6B 3WEBA 1H15A 2G2RA 4OCSH 3V10A 1NGPL 4L3FA 4MFHA 3U6XA 4HWEH 1XF1A 4YC2C 3FQUA 1IJNA 3CX5J 4QO1B 3H3KA 5DZOA 2VDQL 3LVEA 3HEIB 3G04A 3QDMA 5I1KL 4LB8A 1OXYA 4PJXF 2F7QA 2YGQA 2ZONA 3CSFA 4KK6C 5DDHB 2OYKA 4HKXB 2WUBH 3NIGB 2V7NA 2CJTA 2D9CA 2VIRB 2ARJQ 3NAAH 5DVPA 5IVZA 2NY3C 3QUGA 4MX7A 3HUJA 2ZUXA 3EH2A 4MS8C 5KG9B 4N2LA 5BV7C 3CDGB 4H20L 5L2JB 4X6DA 1AANA 1EHXA 5CSGA 3T4AC 3OVUB 4J23A 4H8PA 2ITDA 3EYVA 4QT5A 3LZFH 1W0WA 4NUJB 4ZZKA 3HAEB 1AYRA 2WLLA 3BXNA 4G11A 3ME0A 3PGFL 4KJQC 1AHWA 3K4ZA 3X13A 2YOAA 4MMXB 4LCIL 2QGBA 3HG4A 3VFVA 2YQGA 1RU9L 5E51A 4PJAE 3QHFL 3TYFB 2IOOA 2ZSVA 1MCOH 2OL3L 3EDJA 1U8HB 3BVDB 1RIVH 5JUEH 5EOCJ 4I0PA 5D7KE 5HDOA 4OCNC 3BW9A 3K0WA 3V6ZB 3WIHA 4B0MM 3VG9B 3KW8A 1Z0MA 3PP3H 3SKJH 3BAWA 3V7AE 5J9PB 4Z7UB 1CI3M 4GQRA 5E99H 2VLKD 4G7RB 1JF1B 3BZFA 4LPVA 4DOHE 2X7LA 1QRKA 4GIOA 1Q1PA 1X9UA 2IGFH 2AXGB 2IO5A 2KC0A 3HC3L 2GK0B 3ELQA 4ZUSB 1FRGL 2CBQA 3Q05A 2OMUB 3QQDA 2UXFA 2AI0H 2Z31D 5SX4H 3GIVA 4WNSA 3QAZC 4CMMB 1ZVSA 4JFQB 4ODUA 5IB5A 1X7QA 3DETD 2AJSH 4U1GB 4QWWD 2NXYB 4JY6B 4TQEH 4X9HA 1FORH 2IAMC 3DX1A 3AMKA 3PXHA 2Q3XA 5TF1L 4DAGH 2Q86A 4WWKA 4UCFA 1CDYA 1MJ8L 3ES6B 4LNRA 1SDDA 1BZ7B 1SUJA 2UY7B 1G9NH 5KS9E 1A6ZA 2ED9A 2K4WA 4OJFL 3MDJA 1LP9E 3L17A 1O7DE 3K71A 1WISA 3PU7A 4IMLA 4W9HC 5AZ2L 4BHUI 3E6FA 5A7EA 1BEYL 5BRPA 4X42A 3I02B 4YSCA 2E76C 1KZYA 1UACL 4L5FE 5E9AA 3TCXA 1J5OH 1OQOA 1NLDL 3U46A 1U9KA 2G2RB 2XKNB 4O2CA 4PSRA 2IADB 3MLRL 2EDRA 3EIFA 5CLWA 2ZUQB 5MEQA 5T33L 5ABAA 4JM4H 2X6CA 3G04B 3MZTA 5ABZA 5J1AB 4UQ2A 4HJGB 5CJXC 3VXME 3US9A 3J2PA 3FTGA 1CXFA 5JIQA 4MB4A 4NWUH 1EEZA 4GXVL 4ZG1A 2SEBA 3EBGA 1YYLL 1DN2A 3ARXA 3MLSL 1KPUA 1AP2B 2MQ0A 5FGBA 1XBRA 4NM8L 4X6DB 1R0AL 2DQDL 2O93L 1AZVA 2OMYA 4Q6YA 4QT5B 3EYVB 1GTNA 2EDDA 2H1PH 1AZNA 1N0LB 1A7QH 2O6EA 1W0WB 3UJIH 2XX0A 4ZRGA 3B2VL 2WLLB 3BXNB 4Q58C 1A7OL 5DMIL 4PV1C 1P7QD 3FQWB 4BFGA 4PRPD 5IHZB 4YSTA 3HC4H 2UY6A 4JM2D 5EA0L 4GAJH 3SGEI 32C2B 1AHKA 4RDQG 3T3PB 4MASA 5FB8A 3UACA 4R26H 4QNPF 5A6LA 2FGWL 4IU2A 4BDVB 4YQXL 1NDGA 3SE3A 3IJ7A 1IC4L 2E6PA 3LKQA 1KTRL 1N19A 3O6ML 2ED8A 1IIKA 3IMUA 4LCYA 1WFOA 1S7WB 3FSOA 3BW9B 2N0KA 5LGHH 4AEFA 4ZMLA 3PDGA 1JV5B 2VMEA 1BJ8A 4XNYH 1LYQA 3L1EA 3HS0A 2B3IA 4MTMA 1FO0L 1CG9A 4BBWA 1ADWA 1MFMA 1TU2B 1CLZL 3S8WA 3RLSA 3STLB 3DI2B 1G43A 1E6JL 2NR6A 3I6KB 4AITA 5DHVB 5IOKA 4MMXC 2VH5H 2VR8A 3RG1C 4L5FL 2AEPH 5TH2A 1JPFA 2WXNA 1BAFL 3Q1SH 3KLHD 4MAUL 2H2PC 2J73A 1NC4B 2BSSA 3BH9B 3QQDB 3NQKA 5FUCE 4JRWA 5BV7H 3FFDB 4Y88A 2OQJA 3GIVB 1ZVSB 3LMJH 1EO7A 4YFEA 1C5DB 2CCWA 4ODUB 3X1EA 1G84A 4B9ZA 5F7LB 4HH8A 5E1AA 1X44A 4L4VD 1BBJB 1FAIL 2VAAA 1P9MA 1TZIB 3VG9C 5HDBB 4R4NC 5AG9A 4APQA 4MCMA 4WRLA 2P5PA 4LNRB 1M56B 3IDIA 5IP4A 3MJ6A 3C08L 1A6ZB 5FO7A 1BVNT 3SPHA 2QJDA 1RZ7L 2BSEA 2VLMD 1SJHA 4ZS6C 4F2EA 1M2OA 3TT3L 2ZOUA 3E6FB 1VJSA 4WI2A 2DL9A 1JN6A 3U83A 5KJRH 3GSRA 4PJCF 2E6JA 4RDQF 1CLOH 2YRPA 2AJXL 5F9JB 1JYVA 1JD7A 2JI2A 3W11D 3G6JA 4U1GC 3VH8G 4ZMAT 2NXYC 3QXTA 5DVOA 4HUCA 3SYOA 3LAFA 3R0MA 3Q8FA 5ACLA 3B3IA 2VXUL 3MOBL 2Y7NA 5B4MC 3R4DA 5H37H 2KBGA 5HP5A 5FECA 4D0CA 4ABUA 4UQ2B 3UERA 3ZL1A 3MXWL 1MH5B 3FTGB 1SJVA 4I8DA 3S3DB 4G71B 4OD1L 3NRFA 2Z8RA 2SEBB 1HYSD 3C8KB 1OAZL 1JPEA 3DXAE 4AJVA 1F4AA 1ES0A 3V5HB 5JOFA 4EOWH 3A6CL 1WH0A 4QHKI 2ZUQC 3QFJE 4UT6L 4WKZA 3QCVH 4OZHF 4QUOA 3SE6A 5JDJA 4F7TB 4YO0A 5LGYA 2W80C 3RUGA 3WKNA 2UY6B 3EFOA 3IXTA 4F15B 4F7PA 3ESUF 5GGTL 2PPCA 4KAQH 3U4KA 3V79C 4G42A 2JKXA 2LW3A 4NFBA 4U6VH 1I3UA 2BZ7A 3Q8BA 2JIXD 3ZK0A 1KELL 1NDGB 5AFAA 4NUQA 4XCYA 2V9QA 3RFZA 3SKNA 4CW1A 2A4CA 2APXA 4LLQB 3VXRA 1KWGA 3ATEA 5F72S 2XFGB 4FP8H 3DO4A 3VG0L 2JMRA 2A9ML 1NM4A 3HS0B 43CAA 4E9YA 3L3DA 4PJ7B 1RJZB 3ZHLA 4BD4A 4E42A 4U4BA 2JF1A 5HI5C 2ZWLT 2PWFA 2OTWA 1AY1L 5G4NA 4O51A 2PYFA 4S1RH 1ID5I 4P23D 3QBTB 1D5IL 5BVPL 4CKQA 2X6VA 4Q4IA 1R5IA 4GSDH 1USZA 2FO4B 4PLJD 2X4PA 1RLWA 4JDVB 2TAAA 5E1AB 4WI3A 1XB6A 4GSRA 2VAAB 4QF1A 5BXFA 3BDYL 1NFDF 3T8XA 3HZKB 3BRDA 3FC8A 2CIKA 4J7RA 4XWOD 4F5CA 1E65A 5C07A 4APQB 3KDMB 4LIQH 3S3PA 1JI2A 2E7CA 3S35X 4PGCB 3IDIB 3HKFA 3IS0X 3QWQB 4PTTA 5FO7B 3VD1A 3UJJH 1JNJA 5ADOH 4NJ9L 4NPJA 4XNUL 4BZ2L 3BQUA 4N3TA 3OB0H 4HDIB 1X6NA 4PEEA 2DQCH 1JN6B 1ZTXH 3RX5A 4P8QA 1DFBH 1INQB 2YKLH 3BUIA 2BIOA 3HOGA 5D2LB 5INDB 1H9DA 5IFHL 2ATAA 1YY9C 1MWAL 1GGYA 3HAEH 3KEDA 4AIEA 3FCTA 1JZ2A 5K1VA 4DO5A 2QPFA 2DQGL 1BEXA 3KLAA 2C9UA 4WDIA 5I16A 4D0CB 2AV1B 3IFOA 2VZOA 2BSRB 2ZYRA 4LEXL 4LFHG 5JHDB 1LD9A 2CO3A 1WYJA 3NJFA 1QEXA 1M57B 4MQ7B 3ZE2E 4EQ3A 3T0VA 1F6AA 5HI4C 1ES0B 1MG3C 2NNAB 4DKAA 4X7EC 4PWGA 4P4RA 4UIMA 3GLAA 2WV3A 3TV8A 4OLWH 3WS3B 4AOFA 1XZ0A 2ICES 2EIBA 1LK3H 2Y5TA 1A5FL 3E80A 1HVXA 3ULVE 4ZUUB 2I9TB 3BDXA 4WKZB 4BFEA 1D6VH 3LXCA 3FN9A 3QIBB 3TC9A 1VPOH 1GHFL 5ESAA 3GMMB 4PJEF 4MZIA 2NY1B 1WBYA 3WTXA 1HK6A 3FT3B 4HSQA 4G42B 4ONFL 5AL0A 2NLJA 1P5VB 3VWJA 2K8QA 4XCYB 1QBLH 3RFZB 3QO1B 2K78A 5FGBC 4CW1B 2VSMB 4XP6H 4MXQC 3FQYA 2EXSA 2DYPB 2D2OA 5DFAA 1RZJC 4U0RB 1JIBA 4H1LG 4AQ1A 43CAB 3RWGB 3L3DB 4JFEA 3WENA 3ZZSA 5ITBL 1IKFL 3WKMH 5FUZL 4AMKH 1LO2L 1F13A 1NBZA 4F15C 2VB5A 1KLGA 4DP5X 2VLRE 1JAEA 4KK9C 2PYFB 3I9AA 3ZKNC 2QZ5A 1C5BH 1TTAA 3ZE1B 3IGLA 1CO1A 4HCRA 3RBGA 1GGTA 2CDFA 1GPOH 1S7XA 1IM3B 5K69A 1QUPA 1EZVY 4KKNA 3SE3C 4JJ5A 4KMTH 4XPHL 4OR1A 3QR1A 4JHWL 1TO5A 5EZIL 3T8XB 1WDAA 4KKRA 5AVWB 3OKOA 2OSWA 3DHUA 4ZO9A 3S7GA 1CUOA 2GAZA 3HS0C 5D2NB 5C07B 5CCJA 4MMZB 1KB9J 2WLYA 4KJWC 4JANB 3OXSA 4H88H 3OJDA 1RULH 4HIPA 1NPJA 4GRMB 1J8HA 5FKPA 4JFSA 1M3IA 3QZWB 1YYCA 3BQUB 1Z0NA 2AP2A 2E6QA 3D85A 3MA7B 3JV4A 4KUCF 2YD8A 4R4FL 5GJSL 2P5EA 4PJ5D 3ULVL 2CXKA 2H6PA 3QDGE 5CSBA 5ISZE 2FO1A 4PJGB 1Q9WB 1ZLUH 4Q52A 1Y6MR 3NZ8A 1WWAX 1P9MC 2JJTA 3VX0A 5ECJE 1U58B 3FB5A 4Z7NF 4DK3A 4APQC 4WDIB 3KLAB 2F19L 1FHNA 3BGMB 5I16B 2VTFA 1J0IA 3II1A 4LLYB 3IFOB 2VDLB 2BMKB 2VYRE 2ZCKL 1DO5A 2VITA 3DX0A 1QMUA 3BGAA 3MA9H 5EU6A 2UUDK 1E9PA 5C3IA 5TQ0H 2X2JA 2OYLA 2HX7A 3V8OA 5M7QA 5I17A 1KGYE 1NM9A 4DTGH 4AK1A 3L2LA 4KVCL 4JE4B 4BCZA 4P4RB 1BOGA 2HP4A 4UIMB 4E9SA 1GSMA 1F90H 1V54B 4Z5RA 1XZ0B 4H0IA 1MLCB 2Y5TB 1E3XA 3MUZ1 2CAKA 4IEFA 5BW7A 3D39A 3DVNA 3OGOE 5DHVH 1Q1JH 2QELA 3MBXH 1G5AA 3PJNA 3IPBA 4LSQH 4NUPA 5C0BA 2Q7NA 2VE6A 4CU8A 2YD9A 1ZV2A 1CDGA 3VWJB 3TCLA 4YPGB 3W2DH 2EKJA 3FMGH 4XO5A 5JA9A 5L9DH 4ORGB 3HNVL 1PAZA 4DNLA 5IEKB 4A2DA 5BRZE 1DEDA 4ZW3A 3RGHA 2DJ4A 5HHNB 3DGGA 1S9XA 1VGEL 2XWDA 3UC0L 4AQ1B 1UD5A 3VYNA 1OOWA 4YFLI 1BQHB 2MRYA 4HPYL 3NIDE 2IDFA 3QIBC 3VGFA 2V2WA 3QJUB 1M71A 2NY1C 4P5SA 1KLGB 5IHWA 1QNZL 4ZO6A 1XCWA 4YDIL 3OKMA 1XF2A 1TEYA 4K4KA 2CDFB 3T5WA 5I6OA 1FYTB 3BUBA 2V33A 4X8CA 3RFZC 5SX5H 4XPBL 3G6DH 4GRWF 1CB4A 2GIMA 2JI1A 5JORA 2P8PB 5SX4I 1E67A 3PF2A 4ANKA 2YR3A 1VCAA 4AENA 4Z3JA 2HA1A 4EN3A 4U0RC 4KI5C 2GAZB 5I6MA 4M9OA 3VFPA 1EAJA 2CXGA 4CU6A 2DIJA 5D7JA 2X12A 2H2SD 3P9WB 3KL3A 2EZ0C 4LAJH 1S9YA 1HZKA 2J56A 3TS8A 3CSPA 3OJDB 4P5RA 2D03H 2R0KH 3NTCH 1MFBH 4JMXA 3SZKC 4ZSOB 1VGKA 4JO8A 1KTJA 4QRRE 1HZLA 4GG8A 5T1LA 1Z5LA 2MQ3A 1V8HA 2FQFA 3B9KD 3JV4B 2P5EB 4WQOA 2AQRA 2DI9A 2H6PB 2DD8H 4PRIB 3A67L 2YGNA 1EWHA 3QHZH 4LKXB 4TM9A 1RZJH 1MIMH 2WP3O 3T71A 2XTSA 2PTUA 2VO5A 5CU5A 5D6DC 2CBMA 3AXHA 3FB5B 1RHHB 4B9GA 4HWUA 4M6OL 4JPVL 5D2NC 3TEZA 1F2XK 4MMZC 7FABL 4FN0A 15C8H 2CIIB 5F6IB 5C2BH 3L9BA 3CK0H 2C3WA 2UX6A 4J3OC 1EDQA 2VITB 1D2PA 4OFKA 3VWKA 5JHMA 2VDKL 3BQUC 4J6IA 3DRTB 3ARFD 1RZGA 4AKOA 4WHYG 1Q0EA 2O5XL 3HI1A 1I3GH 8PAZA 2K3TA 5LXVA 4DZBA 4F9LC 3M7OA 5LQBH 1CGVA 1UB6A 1HSBA 2JV6A 2EUXA 4MJID 4Z5RB 5DEJA 3ZZ1A 4N8CL 2P5WD 4H1LB 5E8NA 1R3KA 5I23A 1I31A 3PQYB 4P2AA 3D39B 3HS8A 4OLXL 3Q43A 2VDOB 4DN3L 5GIRA 4IRJB 5KVEE 4ZAKD 4PJIE 5IB1A 2Y2YA 5IVXB 3TCLB 3LB6D 5I1EL 4N4YB 3APDA 4Z7VE 3UPCA 4X4YA 2MPAH 2CR3A 3CN4A 1JMZA 1LO0H 1TTBA 5KYXB 4ODBD 2XWZA 4Z7OB 3PNRB 4JKNA 4XC3H 2WWKO 2J20A 1DLFL 4Y1AA 2NT0A 2MOVA 2YWYA 3K5RA 3ZKXB 4GUOA 4BSWA 1E2WA 1NMAH 3CSYB 3DX2A 4PG2C 3W3BA 1HILA 2H4EA 2V2WB 1M71B 3CN1A 1BM3L 4B9YA 1OGPA 3ALWA 4WENB 3EFFA 3SODB 3S96B 1U8OB 2FBJL 4PN6A 3VXNA 1XCTB 3HPJB 3OKMB 4NAMA 4OGZA 3VWJC 2X1WL 1PD1A 1NANH 3N42B 1JHKL 5FYKE 2DM4A 4YGVB 4R7VA 1JJUA 2Y36L 3LH2L 3UBHA 5JORB 3BZEA 2WVUA 1QSEA 2WGNB 4AENB 4OZGA 1E5CA 1GGCL 4I2XB 1BF8A 3QQ9C 4MA3A 4AQ1C 2HRPH 3VFPB 4L8CA 3WJLA 5D7JB 1OGTA 1KFGA 1Q94B 3T3ME 4V2BA 1S9YB 4TUKL 5TE4H 1UM4L 1E9QA 2GPZA 4OJDH 4L0ZA 2P42B 2E7LA 4N2NA 4NS0A 2HMID 4ZT1A 5GZOA 4ALAL 3BP5B 4ZMNA 4XB8A 3WY4A 4PRHE 3SE8H 2CK0L 2IFGA 5DD1L 5T1LB 3WKYA 1IEBB 1Z5LB 1PMYA 2OX5B 4FJZA 5D4HA 3VRLE 3ILQC 4GI6A 4K15A 2AZUA 5CXPA 7PCYA 4QCIA 3VJ6B 4JHBA 3GWJA 4YHLL 3QJXA 1BVKA 1A9EA 3MOQA 2DKMA 4PVNA 2F6AA 4GBXA 5KVEL 3T6WA 1IM9D 5CZKA 5HYSG 2FL5A 3X1BA 4MBOA 1N10A 3L7FA 4X4MA 5E7FA 2FJGA 5T3XD 5J5EA 4W9GC 3U9PL 5E9DE 5IB2B 3VWKB 1JGDA 4HH9B 3BEWB 4RZCA 4I9WE 4LSRL 1BW8A 4Q56A 1M1XA 5EO0B 3JTTB 3QQ3B 1WT5A 3K8KA 2BRRL 3IMWA 4UUJA 3HI1B 4UM9A 3KCPA 1UM5L 4RETB 4XWGH 4JFDD 5F96H 1UB6B 1UUSA 5FM5O 3RKPA 2EVIA 2WTOA 4KFMA 5FS5A 5T1MA 4A7QA 3OAWA 4U1KB 1R3KB 1MFAL 2WGXA 4IJ3B 3RX8A 1OE3A 2ISDA 3FT9A 2AQPA 5FYKL 3MKKA 5F6IC 2WNWA 5C6TH 1QQDB 4APXA 2ARJA 4Z3FA 5IB1B 1EIBA 2L8AA 5TK4A 4U6XB 1OK0A 2X44D 3W82A 1IBBA 2VN3A 4JN1H 4XVUD 4F33A 2ZJSH 4X4YB 3AWGA 5FIEA 1JPGB 3QDJB 2C9PA 4PS8A 1WIOA 1SYSA 3R0NA 3WFDH 1G9ML 3NQIA 5AYQA 4XMPL 1BYNA 2QHLA 3HI6H 4K73A 1NCOA 1PYWA 1XCXA 5I0DA 2NW2B 1NCTA 3QK0A 2YEVB 3BI9X 4FKEA 3H3PH 4NM4L 3SE4C 4BSWB 5BW7C 2VXTH 3PV7A 4K7PL 1QSVA 1HILB 1AO7D 4IGBB 1DSFL 4J3OH 4DGVL 3NCEB 5GRUL 3ZMRA 3LKOA 1A6UH 4IRJC 3EFFB 2IALB 2VKWA 3GPEA 2X41A 3HG1A 1RUKH 4KXAA 5BPPA 1CF8L 1AS6A 5I66A 4I77H 4NXKA 5GGQL 1LEIB 1YLBB 3SO3B 5D1ZB 3VXOA 5I1LA 5FKAB 2BWDA 2GIYA 2I32A 5FYJH 1QSEB 4ZUWB 1NCAH 4HOMA 2ALAA 4MA3B 1X5LA 1KB9K 4YHZL 1R3HB 1RXLA 4JFVA 1PEWA 4TULL 4TOYH 1OGTB 1N68A 2XIBA 3ARRA 3ZKXC 2WYTA 4MDRA 5AW1B 1YUHB 5C6PB 1MFCL 1AQKH 4HG4J 3ABMB 5HYIA 5JHBA 4JO2H 3KH3A 1OQXA 3KH4A 1R46A 4HK3N 2RHEA 3PL6D 5AVZB 1FBIH 2IBZY 1JMXA 3UTPD 2PCYA 3VSVA 3X14A 3GT6A 2HPTA 1D5MB 4XCCH 3QEQD 4GP5B 2XPGA 4UOW0 1HE7A 1KXTA 1YJDL 1V27A 1A9EB 5KAQG 4YJZL 1XF5A 2OM5A 4U1IA 5DJXB 1I7TA 4QHUA 5D7JC 5HDLA 5FFGA 5GSRA 1U6AH 3IJ9A 3O0RH 1YECL 4PJ8A 3VXSA 1K5NA 4RZCB 3X11A 3ABKB 2WQWA 2DEXX 2ICWA 1M1XB 2DQTL 3KE0A 3B2UD 4NSKA 4TSCH 2Q7YA 2ZUWA 1L9OA 5H35B 3LKRA 3PY9A 2LU3A 4UM9B 3KCPB 5KSBB 3IVKA 3UGXA 4NGHL 3MFFA 1EEYA 2VLKE 4FLQA 5JHLA 5ILTL 3TEWA 4G82A 3D4CA 5MEOA 3Q44A 5BS0B 1W16A 1NFIA 3FTVA 1SJEA 1MRDH 4MQXD 4ORZC 5BOZG 1A4AA 4A7SA 4BELD 2QPEB 3MKGA 4LPTA 4Y1TA 5IV2A 2FDBP 3HE6A 5CIPA 1F4XL 5I1AA 3MR9A 1DCEA 3VWKC 2WPGA 1KPVB 3MNZA 4QTFA 4U7KA 4HCRH 3DKHA 1HHGA 1TQUA 5GGVY 4F33B 5DLMH 4EKJA 3OG4B 2R4SH 3VFUB 2OR8A 1SYSB 2F58L 4FJYA 5AOMA 2AXFB 2Z92A 5KYYA 4GG6E 2X4RB 1VHPA 3TH3T 5EMYA 4OCRL 3KPRA 3SQBB 1DYZA 2B4CC 4IJ3C 3RIKA 3PNWA 2DTML 4K9JA 5AEAA 3GK8H 3NK3A 4LKCA 5KAQF 2VN4A 2UWEF 3CVBA 4YHPA 5DFWH 2YJQA 1KCUL 1JFHA 3I75A 4OZFG 4HJJL 5A2JH 2GJZA 1ZLVK 1MW3A 1WCBA 4U1SA 1ET8A 2E56A 3FUJA 3P73A 3VXOB 2D3NA 5DC2A 5I1LB 2Z91B 3BZ5A 2Y25A 2EC9U 4JR9L 1PZSA 5I1JL 1INEL 4KK6D 4QHKJ 4PQXA 1OAYL 5HYSB 4X98A 1KC5H 5DZPA 1KFAH 4G6FB 2O6DA 2DQ6A 4IGBC 5AB9A 2NY3D 2VMFA 1NEZG 4MS8D 4N0UB 1ZJBA 4N2MA 5HD8C 4CVUA 4LLMA 4PW3A 1J9SA 5DMKA 4I5BB 4YL9A 2HT3D 2EVHA 2AJUH 4TNEA 4JPWH 4X80H 1MCCA 4XHJC 2NY0B 4XO9A 4X4XA 2HXAA 5BO0D 3QISA 4OCYL 4OCWL 3SO3C 2WZ0A 3FZUD 5D1ZC 2F8XC 4YBLC 1FL6B 2F53B 4A37A 1H0DB 2ADGB 4KJQD 4LSTH 1KXTB 4AEHL 4PRPE 3D2UD 5CZXD 4POUB 4LPXA 3E3QC 2PW1A 3ROOA 2VDOH 4CAGA 1CT8A 4NO3A 5GSRB 1ROCA 2AW2A 3FOMA 3QCUL 5FCUH 1B88A 4FC3E 1D5RA 2BSBA 4OIIH 3WLBA 5D5MA 1K5NB 1HKLH 4GIPD 3FPXA 4NSKB 3CFKB 3HB3D 2LHAA 4MRCA 4MRBA 4QXGH 2HTLC 1I1AA 3IJSB 4RAUA 1JVOA 1RH8A 4GQ9H 5I26A 4WHDA 3MFFB 1EEYB 4LPYA 1NAKL 2XWTA 1CE1H 2ADFH 3FRPA 1BZ9A 3MLUL 3VD9A 4FJ6A 3GEWB 3LEVL 5C0EA 4O4YL 4BWUA 2A1WL 1U8KA 2EIEA 5JQ6H 1A7BA 1NIEA 3X3FL 1CDHA 4EIBA 5IV2B 3HE6B 5CIPB 3WUWG 4NI3A 5I8EA 3BHBA 4U33A 3MNZB 5AVTB 4WNJA 3RAJH 1IEHA 3SCMB 4MXVF 1UQSB 4O02A 4RMTA 4HZLA 1X7SA 5DUPL 4OGYH 2Z92B 5GXBB 2NUTB 3HPLB 3N41B 4JUSA 3VRIA 5AAPA 3KPRB 1TETH 1WIUA 4W6XB 1GC1L 1AGCB 3BCFA 5IW6B 2ID5A 3SBRA 4J8QA 2VLME 2PLTA 3PNWB 2UVFA 4N8VA 3MV8B 2OMZA 5ACZA 4P2RD 2AQTA 4JFZH 5IJDC 5DR5L 3OGCB 3HJ0A 3I75B 2N56A 2J6EH 4HCGA 4IBVA 2GJZB 1NICA 3OKLA 5E4AA 4RWYH 5EFIA 3S5LA 5F1IA 1FIGH 4YXHL 2WN2A 3R19A 4QRTA 4R8WL 3M46A 2BFVH 3VQMA 4Q6IA 3VB9A 3OPZH 4KDTC 5DJAA 1CGWA 3EH3B 1FNSH 5JNYB 4HXAH 5DQJA 5MHSD 1F1GA 3O2VH 5EC1A 5GHWL 5ICXA 3RTLA 3S88L 4V2CB 4NWTH 1TZOA 4MAZA 1NCNA 4X98B 5EUKB 4QRUA 1IBGH 2Y07H 4N0FA 2JKIS 2E9BA 3W0WA 3UH8A 1ZANL 1SMOA 2IEPA 2LU4A 3QJHB 1EZVX 3QEGL 3D0AA 4OZHE 4F92B 2JXMB 3CSBA 4PJFE 4UU9A 3FTWA 1A0QL 4IK6A 4X4XB 1LK2B 6PCYA 3FSVA 4G8GA 4N9GB 2N59A 3JWNE 3AY4A 3IAGC 4DERA 1GA2A 2XVGA 2FIKB 3KR3H 1GW0A 3C5SA 1IGCL 1Z66A 4FXKA 1P4IH 2B4CH 2PW1B 1WPCA 4HF5H 3FO9A 5CILH 3ROOB 4AYSA 4OD3H 1CT8B 4NO3B 3CZEA 5B22A 5J3HC 3DGCR 1IC1A 3JXAA 4ZOCA 5E8DH 2OL3A 3BYYA 3WLBB 5I1IH 1MW0A 4M4RA 3M17A 5FA3B 2X3BA 4BJLA 4U3XA 3NIGF 3ZW3A 1I3RA 2YBGA 5EF2A 2NY0C 1I1AB 4TTDC 3GMLA 1KB5B 1WSST 3DYOA 2FH6A 1CLYH 3B9EA 2XWTB 4GMTL 2AMUA 4G7VL 4F7CA 2HZHA 1DUYA 2O5YL 3FFCD 4R6UA 1DDHA 2XYBA 2R56H 3E9UA 4M7JL 4NFDA 4WHCA 4FGMA 4HMDA 3JWOL 3NJKA 3MTRA 4F58L 1LEKB 2VQ1A 4NQSA 1IT9L 4Y2LA 5FHBH 5I8EB 3Q2VA 2F5AH 4GKSA 3VGDA 3L9EA 1SHXA 4WFGD 1JWSB 4K3GA 4ZX5A 3P69A 3K8MA 5JDSA 1P53A 3RWCB 2BS9A 3SKMA 3U0TA 3K5SA 5IIEA 4FG6C 3OF6A 1KT2B 4U0QB 4C4KO 1OAKL 2N01B 5I19L 3LZPA 4R4ND 1R33A 4PCYA 3ZY7A 1FPTL 4OKVA 2GUOA 2O5NA 4RGNB 1AQMA 1PY9A 4RFOL 2E9IA 4OSUL 2VM3A 2VQ4A 3Q8EA 3MLYH 1JZGA 1N59A 1K3ZA 3VSQA 6PAZA 4AYID 1E3FA 3HE6C 5ACZB 1ZWIA 3F84A 2X2YA 4O58H 2AJ3B 3WHXB 3ZZQA 4UF7C 3S97C 4PJDB 5HDQL 3G5ZA 4OUUA 1CZ8L 1UM6H 1ASPA 2NXYD 1ETA1 5EFIB 3S5LB 3SCMC 1T1XA 2HPOA 2W60A 2MCPL 4QRTB 1LXMA 4J4PD 2X1PA 1NPNA 1G7LA 2TSBA 4Q6IB 4YZFF 3VI3F 1NANI 4PJAA 2D3VA 4TRPL 1WS8A 4QOKB 4DUXA 2VDQB 4ETQA 4LEEA 2GSGB 2IPKA 5EOTB 5ICXB 3APCA 1D5BA 2FD6H 1WA1X 3B56A 2WLMA 3ORJA 4N24A 4QRUB 3VYOA 3AROA 3ZL4H 1DBAL 1TFHA 3W0WB 3O3BA 4WFHE 4BCXA 3U82B 2B2XL 2PN5A 5LN4A 5DFVD 4IBYA 3WJMA 5E5LA 3FSZA 1XX9C 2P4AB 2ZOOA 5DXWA 5ID1A 3CZNA 5KJ4A 3ARSA 5IUSA 1KXHA 2AK1L 1XHHA 4JRXE 1O7SA 4G8GB 1F4YL 1MJUL 1R3IH 1KCVL 3FTYA 2HKHH 4P2OA 5E7BA 2NZ9C 3LXAA 4XAWL 1F1DA 3P9MB 1WWBX 2C7FA 3KEHA 2QTVA 2XA8H 3FO9B 2XN1A 2H41A 4R3SB 4XMUA 4AMWA 2IWKA 1A7RL 3O6KH 1NDMA 2Q8BL 2EIJB 4E9TA 3POCA 4X83A 4XCNB 3GJEA 1TQVA 3IDJB 2WQ8A 4LOUC 3MRRB 4XNXH 1I3RB 1KBPA 2YO3A 1ZSHA 1LP9A 3HUJF 4ZNCD 3WOVA 1XL4A 4PV9B 3EO9L 2B7DT 4X6DF 3QRGH 1J9TA 3EUUA 2XJLA 4P2CG 1JGLL 3MCKA 4ZTOH 4FFZA 3ZTNL 5D1QD 5EIIB 4HEME 4F7MA 4NQUA 3CLWA 4JDTL 4YDJB 2VQ1B 4BXVA 3US1A 3WN5A 1GYUA 4N90D 1PZUB 4ZTPH 3QUXD 3V4UH 2HT4C 2X28A 3KVQA 1I1AC 3HZMB 1DQTA 2XZCH 1PIFA 2H6UA 3S0PA 5B8CC 1P7HL 4WO4A 4LP5A 4OKVB 4JW3A 3IF1A 2XVKA 1DVTA 4EAEA 5C0FA 2PP8A 5HYQA 1V3MA 5JXAH 1PTZA 3TWCL 5AW0B 5KSAA 1N59B 2LLLA 5E00A 2YUVA 1NC4D 4G1EB 5CP3A 3THML 1ZWIB 5CNHA 4HW6A 4XXCA 3U6XS 4Z7NE 1P0SE 3AQZA 4PJ5E 5D7SL 1OWRM 3D05A 1BQLH 5JOEA 1CGSL 4C83B 1ERNA 1TTRA 2BY1A 5IMOB 3KJ6L 2PXYD 1YY9D 2QSVA 3RJDA 3K1KC 3CFCL 4S1SL 5CJOL 4YHKL 1G7LB 3WNOA 1JBJA 2R69H 4HWNA 1ZIAA 4ETQB 2X53A 4JO4L 4OCMC 4RGNC 1MJJA 3HRZB 1NUGA 2IPKB 5CU9A 3WNPA 4K5LA 4DGIH 2EDMA 4AEEA 2HFFA 1CR9H 5A6IA 4HJ0C 1I8MB 3LNGA 4QJ5B 1KNOA 3QZBA 4HIEA 2I5YH 3DBXB 3IDNA 4FQJL 4ONOA 5EIQA 4ERSL 1YHPA 2FWLB 4Z7WA 5ID1B 3LZLA 3HI5L 5HI4D 4Y2DA 1MVYA 5HY9A 3W5MA 5C0RL 4Y5YB 3KWVA 2W0PA 2F7RA 3AWEA 1VAHA 5E2WH 1JD9A 1F45A 5I8OH 5HHPA 1Q9KA 5JHLH 2I9LB 4C8XA 2B0SH 4P59H 4Q6IC 4HIQA 4XN9A 4P2OB 3NSFA 1NCCH 3DBSA 3NZUA 3UAJA 4LF3A 5D6CA 4YDVA 4FABH 3O3UN 1VRSA 1PKQB 2OMTB 2WSDA 4M1CC 3V4VA 1SJMA 3I2CL 2R1YA 2R0LL 4U31A 1NDMB 5CIPH 3F05A 2P7TA 3BSHA 3IBEA 5LJYH 2DLEA 3GJEB 4FNRA 1H19A 1QEWA 3T4YA 1ETB1 5EZLA 3V0AC 3L5HA 5AYUH 1K8IA 3IGAB 4JMNA 3INUH 4G9FD 1HXKA 3QUYA 2YARA 1ADQL 1C5CL 2QPUA 4X5WB 4D0DB 1BGXH 1WS7A 2ZNXA 3FO0L 1LP9B 1YEGH 4IDJH 1FO0B 3CQFA 5F6HJ 2OYPA 5BJTA 1U4FA 3O6LH 2XV6B 3AQYA 4OIFA 1JDCA 4N2CA 2VLJB 3ARGB 2JH2A 1FE8H 3MRCB 4E5XA 3N5AA 4HXBH 4KK9D 5E1QA 3ZKND 4F7MB 3EFDH 1ZLWH 3LN5A 3MJWA 1WP6A 3PWVA 3ARBA 4WU7B 1T5KA 3ZKMC 4Z7QE 2FJFB 1UD2A 1W0VA 3ATDA 4OF7A 3EAKA 4HLJA 1D7CA 3EDDA 3RA7L 2FYYA 3AITA 1A4JA 4OI7A 4HFUH 4WO4B 1K4CB 3AJ7A 3H4HA 3U7WH 5LKNA 4NCDA 3H9SB 4G1MA 5AVRB 3DXAA 4PBWD 3FBKA 4M1GH 3NJVA 4OTXL 5IMKB 5KSAB 3UO1L 5E00B 3TESA 4JCMA 1RUMH 1TVBA 4OIAA 4MXWL 4BZ2A 5LCVA 2BHZA 5CO1A 5J6GA 4H25A 3MLWH 4HKBA 3ZT5A 1WC7B 1ZT4B 5KVGE 5GS0L 3GSVA 4M8UA 3DSFH 5E1HB 4PIBA 4NP4L 4AM0Q 1B0GB 1F56A 4X4ZA 3T2NL 1MZYA 1T03L 3GUTA 4JFPA 3IFNL 3CHQA 2MNUA 3HVDA 1M6OB 4F24A 2YMXL 1RUAL 2DQEH 3M1BB 3JV5A 1PCXA 1WQVT 2WBKA 4GSUA 5KBKA 1BF5A 1LQSR 1YQVL 2WCPA 4HIEB 4BYHA 3IDNB 4NQEA 3VQLA 2IBGA 4Z7WB 5HYJA 1FQ9C 1GIGH 4QTIL 4PLOB 5HY9B 1QFUH 3W39A 4HOZA 4HOXA 4MJIE 1KB5H 4WFEE 1EVUA 2NPLX 4KWUA 2P5WE 3UYOD 2LFGA 4G8FA 4XCFH 3G6JF 1TFPA 2J1ZA 3HRZC 5D6CB 5DT1H 4YDVB 4IBQA 1KYDA 5E0QA 4FD0A 3WI9A 3B6SA 5JHDD 4GMSL 2IFFH 3FAXA 4NZTH 1EERB 1OCZB 3O8XA 3J07A 3CBJB 4QHMB 3D52A 4MHHG 1KEGH 2BP5M 1DQJA 1QEWB 2AEOA 1WD9A 2IH8A 4XX5A 5E5MA 1ET5A 2G5BA 1K8IB 1TZHA 2ZSWB 3OR7B 3MFGB 3QUYB 2JCCA 4Y5YC 2I85A 3B5HA 4JQIL 4LNVA 4OVVA 3V0IA 4NB7A 2WQRA 2W0LA 4Y89A 3OKDB 2DMHA 4AYEC 5BJTB 4P2OC 3QIBD 1JK9A 2W91A 4MA7L 4MJ4A 1MCHA 1E90A 5CP7B 5I18H 2GSIB 2X9ZA 4YDZA 3WXVL 3U0WH 3ZOAA 4AT6A 3JTSB 2OJEB 1EZUA 1N5YL 4M6NH 3LN5B 2X4SB 1OM3L 3ZZLA 2HLAA 3II2A 3ARBB 3EYUH 3RUGF 1CGTA 1NKGA 3TJEL 2ZWZA 4LXFA 3NRPA 5IGXL 4ACPA 4XPGL 2EIKB 2DYPD 1NGPH 1U8LB 1XFPA 4ELME 3WMPA 1A4JB 4J8RA 4KI5D 5J13B 3HMXA 1U0QA 1X4ZA 2Y7LA 4K3HA 4BA0A 2VDQH 3W9DB 1DQML 1T4KA 4WLCA 1FZKA 5CLXA 3X1NA 3Q7JA 4A2HA 4FFVC 4Q2ZA 4X50A 3DXAB 2YMTA 4ZTEA 3TBSA 3IDYB 3ARGC 4KROB 2XU9A 4KDVA 4W4OC 5J6GB 1QSFE 1JCKA 4V1DD 4HKBB 2HRHA 5J6HA 1IM3D 2AKRA 4H20H 1G9HA 2OMXA 4XZUA 3DURA 5CD3A 1HHHA 3ZE1F 4IQHA 3VFGL 1MWAB 1CF1A 2W0FA 3PGCA 4PRBA 4MNGE 1C12A 4WO4C 1BXXA 2YBRA 4LCIH 3NFPB 4XH2A 3UTZA 3H1ZA 3P4OA 4O9HL 2EIDA 4NO0A 3PDOB 1RU9H 2IMNA 3ROLA 2G5RA 3QHFH 5HHMB 1QABA 1D6EA 1SN5A 2GHWB 2XQYK 2OL3H 4QDGA 5F88B 2FSEA 4M1DL 4NPYA 3ULAB 3PWUA 4XXCC 1VENA 2OK0L 3U79A 4NQEB 4YDNA 4FS0A 5FK9B 5HYJB 4J3OF 4JFDE 4ZMPA 3HZ3A 3WHE1 5TF0A 5FDYA 1A47A 3GBLA 4ABWA 4N86A 4Z3GA 3RY5A 3AACA 2ITCB 2A6IA 1BJ1J 3LRHA 4HIIA 4XN5A 3HC3H 3B6SB 1FRGH 2F0CA 5GRWA 4NOBA 2X05A 3WY1A 1RVFL 4WHTA 1AOHA 2XG5B 3MQIA 3O8XB 5LB1A 1ORSA 3AS1A 4UNVA 1BD2B 1DQJB 2OULB 1NIBA 4ECNA 1JTPA 5EU4A 3UC2A 2VN5A 3X1FA 1F02I 5DRXB 1F3RB 2JCCB 2UYLA 5TF1H 4IW4C 5IVOA 2IQ9L 3GQFA 2XBDA 4KHTL 5E2VL 4GB9A 1MJ8H 1KSRA 1SY6A 5FUCC 2AXHA 3UAJC 1AO7E 1A8JH 1CYWA 2V3DA 4OJFH 3SOBL 1ZOXA 3AXLA 3L95B 5ISZA 2H3NA 3P3YA 1BEYH 4UQ9A 3OQ3B 1R47A 3FT2B 4LL9A 4ZFFB 5E1GA 2HLAB 3CIAA 2Z0UA 1UACH 3DUUA 2C4FT 1FI8C 1NLBL 3OLIA 1HNGA 1NLDH 2FTAA 3HG0A 5KW9L 5T3XL 5I82A 3QUYC 2AK4B 2BNUA 3MLRH 2GQHA 1DJGA 4FYSA 3QYCA 2ZP8A 1MI5B 4YSRA 5T33H 1T4KB 5D1ZI 2FX8L 1FZKB 4Q2ZB 4EPSA 4L0YA 1WZKA 1ZDQA 3TBSB 1GS7A 3K7UA 2ESVA 4GXVH 3NIFB 3QC6X 4YIQB 5JXED 3MLSH 5AD0A 1FYTD 1HHIB 3ARBC 4L29A 4NM8H 4XZUB 1R0AH 4H8QA 2DQDH 3KPLA 2C1PA 5CD3B 1HHHB 1OPGL 4WTZG 1UH3A 1O9WA 3B2VH 2W0FB 1OIOA 5DK0B 2ZYIA 3RP1A 4DPBX 4ZYKA 1A7OH 4OKDA 5DMIH 2KPWA 5J13C 1T66C 3MXVL 3QNXB 4GW5A 3KWWA 4IJTA 4B5EA 4B7IA 5HPOA 5EA0H 1DJSA 1Z9NA 1JGVL 1QWHA 4NO0B 4Q6KA 3ROLB 4PRNB 3IDYC 1AD0B 2FEEL 3BKJL 4KROC 2FGWH 4H2AA 4LFHD 4YQXH 5BRZA 2CJ3A 5E6SB 2F1AA 1QTPA 3WY3A 1IC4H 2GT9A 2PCPB 3O6MH 2GJJA 4YGAB 3H7LA 3LRSA 3SDXE 1CXEA 1XMEB 3VFNB 2IXQA 4CSSA 4PRID 5E6ZA 3ETTA 2WOYA 1U8MA 2XPZA 4R4BB 4JDEA 2DM2A 2H0PA 1FO0H 3GSNL 2A6IB 1CLZH 4F2FA 1M53A 1E6JH 3RL1B 1QSZA 5CSZA 4L5FH 5HXMA 1OT4A 4YBQD 4L3EE 1U4EA 1BAFH 4WWID 4KKQA 1J0HA 2WAQA 1ND0A 3RQ3A 1A25A 2GEQA 4DESA 4A2EA 1K8DA 4NKOA 5F3BA 1PY4A 1WK0A 3ALPA 2YAOA 43C9B 1T22B 1FAIH 1NIFA 4HVBA 3ESVF 4TUOA 3K4AA 2UYLB 3N0PB 2WZPD 3ZRSA 4X7FC 5F7UA 2WD0A 3LTVA 2WLIA 2XIIA 3PQYD 4XO8A 2V9UA 4QRRA 5C0IA 3C08H 5F0MB 1BA9A 1MCIA 1KGIA 3DPDA 1RZ7H 3AXLB 4IRJD 4N20A 4X99A 4Y4FB 4FQCL 2YK1L 3TT3H 2BY3A 3FW6A 5CP3H 4JO1L 2EAEA 2HN7A 3O8XC 5C0DB 2N0MA 3T04D 5E6YA 3FONB 1FFOB 3C5JB 2AJXH 3DUUB 2F54B 3FU3A 1ZPUA 2G4GA 5HYFA 4PR5B 1YVLA 2IDQA 3V9EA 3QJTB 2VXVL 2BNUB 2BINA 5JW4R 2VW7A 2VXUH 3MOBH 4UV4L 5EU5A 3L5WB 2J8UE 3GMOA 5DJYB 3RWJA 2HRGA 3GJFK 3P3RA 3VFWA 4K23L 4WI0B 5KTEL 1JTTA 2RJMA 3EO0A 2DPKA 2UZYA 4U1NB 4Z7OF 3BN9C 3MXWH 3UEQA 1KJ3H 4XC1L 2P26A 4U6HA 5IKCA 2BNRD 2ESVB 4OD1H 1JF5A 2WQVA 5IHHA 2Z7YA 1OAZH 2K3HA 3PFUA 5LVEA 3EOBA 1V3LA 3BLKA 1MCPL 3KPLB 1HDMA 3B2DC 1QR1A 2HH0L 5IBLC 1H3GA 5EOCL 1F3DH 1BQUA 3LPOA 3NP3A 5IEHB 1NC2D 3X12B 3A6CH 2BVQA 3OC8A 4X6CE 4W6YB 4UT6H 3NH7L 1TJHL 4PJIA 4DP8X 3CC5B 4CN6A 4PWEA 3KWWB 2AF2A 3L5XL 4Z7VA 3MGTB 1L6ZA 5DJZA 5GGTH 3QP3A 5K9JL 2BX5A 1KG0A 3L45A 2H1PL 3TO4A 4ODXA 2D31A 1DJYA 5BRZB 1KELH 5DRZA 2YPLE 1GMIA 2VDKB 2C3GA 2I07A 1O6VA 4N6RA 2GT9B 2GTWB 4BFFA 3RWEB 3LRSB 1P7KB 2IXQB 4R7LA 1YCSA 4AV4A 3RIFF 1U8MB 4LRIC 3ZPDA 3FUHA 4Z3EA 2ICWI 3OJVC 4EZLA 3VG0H 1K85A 3D6GA 4AL8C 4P5KA 3ZE0B 3MRLA 1PAMA 1MFNA 2ETWA 4FQ2L 2WBJB 5DUML 2XLLA 1A02N 5CSZB 2SODB 4PW4A 4R5TA 4G80A 1R1CA 1AY1H 5GGUA 3KZ8A 2YS4A 2MFNA 4A6YL 5BVPH 1D5IH 5HGDA 3RJQB 4O2EA 2EDHA 1AGEA 1L9TA 1NEPA 5HHQB 5D4IA 5F3BB 1S78C