1PTZA

Crystal structure of the human cu, zn superoxide dismutase, familial amyotrophic lateral sclerosis (fals) mutant h43r
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLRGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ALS Mutants of Human Superoxide Dismutase Form Fibrous Aggregates Via Framework Destabilization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 39
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ptzA00
2APSA 3QQDB 4A7SA 1HL5A 2AQNA 1OAJA 4A7UA 1E9OA 1DO5A 3GQFA 3KM1A 1PZSA 2Z7YA 3H2PA 2JCWA 2NNXA 2ZKYA 2AQSA 1RK7A 1SXBA 3MKGA 4FF9A 2ZOWA 3ECVA 1AZVA 1JK9B 3F7LA 2WKOF 4BD4A 3RE0A 3SODB 2WWOA 2ZKWA 2R27A 1F1AA 3CQQA 1S4IA 1OALA 5CU9A 4BCZA 3S0PA 1SXZA 2K4WA 3GZPA 1KMGA 1HL4A 1BZOA 1SXCA 3GTTA 2AQQA 3T5WA 2VR7A 2Q2LA 2WWNA 3KBFA 1P1VA 2AEOA 2WZ0A 1XTLA 1SDYA 1B4TA 3KH3A 5KBKA 1YSOA 1OZUA 2LU5A 2V0AA 4U4IA 1FUNA 4A7TA 2C9SA 4A7GA 3KM2A 4OH2A 1SXSA 2Z7ZA 3PU7A 3ECUA 1F18A 2C9UA 3L9YA 4L05A 1F1DA 1B4LA 1IBDA 4MCNA 4MCMA 1Q0EA 3HFFA 1U3NA 1MFMA 5KBLA 4N3UA 2WZ5A 5KBMA 1OZTG 2JLPA 1IBFA 2VR8A 1SDAB 2GBUA 3CQPA 1OEZW 2E46A 1Z9PA 1JCVA 1F1GA 2AQRA 2C9VA 2ZKXA 3GZOA 2Z7UA 1SPDA 1IB5A 3MNDA 4BCYA 2AF2A 1N19A 1BA9A 1SXAA 1SOSA 2VR6A 3ECWA 2WYTA 3KH4A 1COBA 1Z9NA 4N3TA 1E9PB 2AQPA 3K91A 4B3EA 3KBEA 1TO4A 1UXMA 1SRDA 2AQTA 1YAIA 1XSOA 1CBJA 1E9QB 1IBBA 2WZ6A 1N18A 2GBVA 4A7VA 2WKOA 3GTVA 3F7KA 1CB4A 1SXNA 1ESOA 4A7QA 3GZQA 4A7GF 2WYZA 1QUPA 4OJAA 1E9QA 1PTZA 3CE1A 2Z7WA 1L3NA 1TO5A 2XJKA 3QQDA 1PU0A 2E47A 2SODB 1YAZA 1IBHA 1XTMA 2GBTA 3HOGA 3L9EA 1UXLA 1EJ8A 3H2QA 1JK9A 1DSWA 1EQWA 2XJLA 3HW7A 3LTVA 1E9PA 1E9OB
chains in the Genus database with same CATH superfamily
2CUMA 2HFEB 2CGRL 3CDZA 2OZNA 5CU5A 5I1DB 1P7KA 1CXIA 1SJMA 3L5XH 1SLWA 3CHOA 2CPCA 3DBXB 2YD2A 3MAWA 5C0EA 1FNEB 1OCOB 3QDHA 4RRPG 5TE4H 2XPGA 4YDJB 4PH8A 5INDB 4OF5A 3ATFA 1WWAX 2OPCA 2D3NA 3Q3GB 4P23B 3BXNA 2CU9A 2R29A 1DJWA 4K94C 4MNGB 4XAWL 3UJIL 1N6QL 4LMQE 5AYUL 4KZCA 4ATWA 4L1DA 2HWZL 1PG7L 3L17A 5HPMB 4PRBB 4I4WA 2ESVE 4DZBB 4JFXB 4RDBA 1CTOA 2E0PA 4G2AA 2XZZA 3VXOB 2MPAL 1MCPH 2UZYA 4NRXA 2C4FU 3T0EB 4U4IA 1AE6L 3JUYA 4EI5B 3OHMB 1T4KB 5B1AB 4UQIM 1XGTA 3NEXA 4UV7L 5F3HB 4R4ND 1FFNA 4M8QB 3QEHA 4RAVA 2ATAA 4WGKA 4DKEL 1N0XL 1O6TA 1K8IB 2VE6A 3TO2A 5LAXA 3CZLA 3CHRA 1OGTA 3SY0B 4HIQA 4M4RA 3C12A 4ELKA 3T08A 4QRBA 1BWWA 2DQUL 5D7IB 3RUGA 2ZUQC 5IQOA 4WENB 3CDFA 3QVAA 3HZMA 1M7DA 1OARH 4MDIB 4Q8BA 5JUEH 2JKRM 5AKRA 3M8OL 1IAOA 5I1GL 2DV6A 3ECWA 5LBSL 4LPCA 1V3JA 3B83A 1BWMA 4LCUA 5ANME 3GMQA 4EI5D 2I5YH 1H6UA 4R90L 3T6XA 5IG7A 3CZGA 4K7FB 4M7KH 4ZTPL 4UT9L 3QG6A 1E4WH 1TZGL 4HUCA 4XMKH 4F2MA 2WUCL 1X5HA 4X8JA 2E9IA 3OBAA 2Z7WA 3KR3H 4I13B 4Z5RB 1JGLH 3UZEA 4V1DE 3EUUA 3T0ED 5CAYB 4OJFL 5ERWB 4XMWA 2VR9A 2OYLA 4NM4H 2FSEA 4ONHA 3WMPA 2VDNL 5CZVL 4LBEB 3EJRA 1EFXB 4FZ8L 2OMVB 3AWEA 2ATPB 2HG5A 4LLYB 3OWRA 3RZCD 1B0WA 3LDBB 1HQ4B 2OCCB 3FQTA 5DR5H 3OKEB 1RUML 3WCYA 4YBQC 4RISH 1LQSR 1CLYH 2QPEB 4QMEA 5ID1A 4IRSA 5AVZB 5C6PB 4X7SL 3Q44A 3BGMA 4P0DA 3DRTB 3M45A 5FUCC 5DZOA 5IB2A 1UWYA 3LHPL 3T0AA 1T20B 3BVVA 3C5JB 4QI3A 1U4FA 1BM3L 5BCAA 1RFDL 4EUPH 2N7SA 2YXWA 1CGYA 1UCBH 1EAPB 1R3LB 5E8DL 1JCKA 2JIXD 2VAJA 32C2A 4TXVB 4FQCL 1UZ8A 3HB3D 2WZPA 1HHIA 5FA4B 5ENWB 3PWPE 4IGBC 2EEAA 3VCLB 1V7NL 3KG5A 1WAAF 4FTDA 1HILA 1CZ8L 3BDYL 4G8FA 4HS3A 3KAAA 3FW6A 1TENA 2Y24A 5HBBA 3RVXD 2NY7L 2YD6A 1DQLH 5CJQL 4I77L 4IBWA 4NKQB 5B7MA 3LN4A 3MCYA 2ROXA 3DO7B 3GBDA 4QHLA 1OVZA 3ARYA 1NICA 5HVGB 5I16A 4V11A 1ZLDA 1G9HA 1PY0A 1DVSA 4X4YB 1YQ2A 2IG2H 3S3DB 1WFNA 3NRFA 5AVVB 3GSXA 1XGZA 2EP6A 3P4NB 3OTTA 1DJHA 2AJZA 3GSUB 4YNYB 5IGXH 4B50A 4YXHH 1EO8H 4NO0D 5IMLA 3BPCB 1ML0A 3RY4A 3CX5J 1UVQB 2MPAH 4KTDL 5FYLD 4PRPE 5EZOH 4U6TA 3V0HA 1R5WA 5EWIH 3AT9A 1RERA 2IMMA 4JM2F 2F08A 4MAUH 4AL8C 3DIDA 1SUJA 2WKGA 5EEXA 3QNFA 4IDJH 2OLDA 1IM3D 1UJTA 1XXFC 4OVVA 4B9CA 3H1ZA 1LLAA 1A4AA 1KCRL 2EXYC 2HFEA 3CDZB 3NDYE 4ZYKA 3QW9A 4OU3A 3OB0K 1MCOL 3MLTA 4LRNL 4OZGF 3PXLA 2WXPA 1QZ1A 3NTCH 3VXUE 1X5LA 4Y2DD 5B7FA 5KOMC 1IBGH 2AEQL 2EVGA 1TQWA 3P4LA 4OCRL 4QLRA 5FGSA 5BRZD 4BFFA 4NPJA 1QO3A 4MB1A 3FH5A 2IANE 1RURH 5T5NF 3RFRA 2IH1A 2YFNA 2YGOA 2YHGA 4B9ZA 4DKTA 1FCCA 2NCEA 4MAYC 2LW3A 2A9BA 1AOHA 1JK9A 1H15B 1C9SA 4XCEA 5A2IH 1QFHA 4BDVA 3BP7B 2XG5A 2YBRB 1MIEH 2Z4TA 2FBOJ 4JUTA 4P23C 3IEAA 1FVDA 2X0VA 5F1KC 4FI6A 4YHNA 2V5TA 2ZYRA 3S4SB 2ZOTA 1RHFA 2IXQB 5DUML 4Y4FC 5IW1A 3V6ZA 1WV7T 2Y07H 3FO1B 1DLFH 1C08A 4EDWL 1F4HA 1Z9LA 5A2CA 4Z78B 3HI5H 3VXPB 4G8AC 2CALA 4JJ5B 5DRWB 1BD2B 4PRNB 5GSRB 2YEZB 4QTFA 1A4CA 3CIQA 3MV7B 2BNQB 5DCCA 4OW6A 2Y36L 2M1KA 5JZ7C 3FFDB 3PPEA 2W9EL 2DJUA 3VGBA 3Q5OA 3WFBH 3C5ZA 4PAZA 4HWEH 3P2DA 2Y2YA 3JWNG 4U1KA 3WE6B 2EKSB 4HU2A 2CGRH 3X1NA 4JDTL 2BP0B 2I9LB 4GUPA 3L7EB 5IMOB 4A38A 2UY7A 4JPKH 2D7TL 2CO4A 4LVOC 1TTRA 3GMQB 1MCQA 1TFPA 4U4BA 2OFQA 4U0QB 3ROLB 2FX7L 3FQWA 3MRRA 5I1IH 4X8CA 4RMRA 4HDIB 3V9FA 1U93A 2Y7QB 2DIEA 2X9XA 1EFXA 5C6WH 2AJXH 1WA2X 4FS0A 3DMMD 1ONQB 1VB9A 4XPBH 4ATTA 4BRVA 5I6PA 2IWEA 4G6AC 4NUGL 3V0DA 3TYFB 4JZJC 4RAUB 3FN0H 1G7JB 5HYFA 2CLVB 5I1EH 5KSAC 4LL1A 2OTWA 3IDIB 5DURB 1ZHNB 1Z9MA 2BJML 3B6SB 3EIFA 2FSEB 3IK2A 4ZMXA 4NAJA 4YDLB 4WFEE 5LXVA 3MCKA 2G5BB 1M56B 2M2DA 2LR4A 2Z8WC 2IAMD 1IARB 1O6SA 1BBDH 5SWQA 2OZ4A 4O5LL 2DTMH 4WI9A 3LB6D 5ECJE 5IB3A 3HE6B 3B5HA 3U6XS 3E80A 4X99A 1PKOA 5IW6B 2F5AH 4PJBB 1FO0H 1JF1A 1K8DB 1ODAA 1UFGA 1OGAE 2YBGA 4CA4A 1U8PB 3ETBJ 5T1LB 4RA3A 3RAJL 3T3PB 3REWA 1HQRA 3QUKB 2Y5QA 1A6UL 4NZTL 3V6BR 2EAEA 2QADD 1UT9A 2GK0A 3BT0A 3IS0X 3FB6A 3NFPB 2VMJA 4JO4H 4APQD 5CLTA 1E27B 1IVLA 1M3IA 3TTSA 1UWXK 2X9WA 3G6JE 3G5ZB 1MJ7L 5E7BA 3N43B 5LN4A 3FSOA 1AXIB 1XQ4A 1A25A 2EE3A 4R90H 3GMPA 3ZRFC 4DKFL 4DPAX 2GTZB 4H0LC 1DQQA 1DJSA 1KZYA 2Z93B 4MB3A 4AYFB 3BPCA 1DE4B 1EJOH 5EU5B 5F93C 1DVFC 2WB7A 3EJYC 3VX0A 3FC8A 1JHKH 4YSUA 1G7MA 2X12A 4PJAE 4A2HA 4RDQG 5IVXE 1N8OE 2XWZA 5T1DH 4NENB 4CMMA 2E27L 2VE6B 5E4IA 4OLWL 1UD8A 3GSWB 4MJHA 3RE0A 2YZ8A 4LT7A 4DW2H 1RK1A 1I1AC 1KGWA 3FRUB 4Z7WF 1KCUL 5FUCE 3BKCH 3GXUB 5EC2B 3FUEA 4TOYL 4MD4A 3T5WA 2X1PA 2IIJA 1M7IB 5KBPA 1HJCA 4NN7B 3UGXA 1MHCA 1KEML 1XF1A 3WIHL 3WO3B 4A7TA 3OF6D 4KRPD 2JB5L 2WJ5A 1G6RB 1KIQA 3F64A 2IDCA 4IKKA 3FT3A 2WQAA 2Q3AA 1E5CA 3G6AA 3CZUB 5T1KD 1N2RB 3STLA 3RYMA 4OD2A 1S5HA 1LDPH 5KS9A 4BK4A 3EADA 1SEQL 2AXFB 3W0WB 2ISDA 1TKWA 5ACZB 2W0KA 4YHMH 4KKRA 2HJKB 5FFGA 3ARBA 5IJKA 1V7NH 1QSFE 1UB6A 3NJXA 2J5LB 2YR3A 4HS6A 4I2XB 3PGDB 3VWJB 2WXIA 4LCCC 4N5UA 1TLMA 3AZUA 4LLVB 4M9PA 2OR8A 1B0RB 5KYNA 4L8SC 4PY7B 3EGDA 5CGYD 2H32A 3TBYB 3DECA 5K39A 2DQIH 4ZXBA 1UJ3B 1ORQB 1P4BH 2R2EB 4QO1A 5FB8A 4QRPE 3WJMA 1AH1A 5E2TL 3HNVH 4KRPB 4ODVH 4JPVH 4KMTL 3AAZB 1T22A 1KCLA 2WZAA 4QJ3B 3DGGB 3VMPA 2CLRB 4XXWA 1INDH 3EXLA 4KJQC 3VG9B 4HXAH 5T1LD 2V2WA 4NQDA 4BE6A 4EBQH 4H4NA 1HQ4A 3IXTB 4MB5A 5GGQL 1M1XB 5D7LE 3CH1B 3WFEH 1JUFA 5BUGA 4NKMA 2J72A 1FHNA 2AGJL 4BBWA 2BIHA 2BP8A 4W9KC 4PI0A 1B90A 2F15A 4JM2C 2V5MA 3MCLL 1AI1H 4G7YH 4XZUB 1JRHH 2ZX7A 4XP9H 1U8IB 3NJHA 2EC8A 1TCRB 1QQDA 2XJLA 3DYPA 3PXJA 3GB7A 3LNFA 4MDRA 2WLLB 2NNAB 4XNXH 4BZ1A 1FAIH 4IMLA 5J1AB 3BH8A 4FEMA 2X1XR 5E5RB 3KXFB 4L9LA 4LAQH 4G7QB 1CU4H 5AW2B 5SWSD 2H2PC 4R0LC 1EDHA 1MHHB 4AGMA 1KV7A 1A7OH 4OIFA 1LK2B 4IM8A 1BM3H 4LLQA 1A47A 5LG6A 3C2AL 4JKMA 4JGNA 2YPKB 5DUPH 4OFVA 5EFIA 2BK8A 1AGBA 4F15C 4AZ8A 5FIEA 2WQVA 2O5ZH 3NCXA 3FO2A 1YMME 2BDNH 5C1MB 1YN7A 5AVWB 3X11A 1FE8H 3VUAA 3RWDA 2IH3B 1OL0A 1AG0A 2JMRA 3NZSA 4R7DB 1LK3L 3RBGA 5I1HH 3Q9QA 4E41D 3AG4B 3X12A 5C0CA 3UROR 4LU5L 5DI8B 1MUJA 2OMWB 3EOAA 3QXUA 4XB8A 4ACPA 3MFFB 2PR9A 3CIAA 4PD4K 4L37A 3TTYA 1BLNA 3U30C 1F6LL 2IANB 5E8OA 1FZKA 4JN2B 4NM4L 1ZK9A 1MY7A 2Z35B 2YJQA 3ECUA 3HI5L 2AMGA 3U2SB 1HYSC 2QGCA 3ETSA 3MBEC 4KJYA 3PXHA 2EDYA 4ZQKB 1UVQA 3EZJB 4PS8A 4OI9A 1Q9LA 2QVFB 3DSNA 4OBRA 1KIRB 4QF1A 1JYNA 2N01B 1AYOA 4PR5B 2O30A 4RX4D 4DEPC 4HD5A 2Y2WA 5T5FH 2R15A 3ZKSD 1W8NA 2CHNA 1E27A 3BVDB 3NCJH 5JIKA 4ZW6A 4OZHF 3G08A 3VXMA 5M94B 1FGNH 2C1OA 1C12A 3X17A 4P04A 1JZGA 3TJEH 3ULVE 4F7MB 3HC0B 5EF3A 2PMZA 3BUIA 2EVHA 3ZTDC 2WXRA 4AJVA 5I19H 4XP5L 1T89A 1MRDH 1BOGA 4FCHA 4NENA 4CMMB 4UCFA 5JHDD 4OZGA 4WI4A 3POHA 3RZCC 1XSOA 5DS8A 4AQZA 1RK1B 1Q0XH 4KKBC 4GMTL 1UOWA 4BWUA 3MA9L 2B08A 1D7FA 4DO4A 5I1CL 3F00A 1RV6X 1LXMA 1HYSD 3VFSB 3QIWB 4OD3H 4XBEH 3WENA 1U3ZA 4QTHB 1MWAA 3L9EA 2F9BT 4IU3A 5DSCA 3OKMB 5BV7B 4QD2E 1MJ7H 2CPUA 1Q90A 2VLJD 2WIIB 4Z78A 5HGAA 4J1UA 1AXTL 1KELL 4K23L 3ZDWA 1M7IA 3T6QC 1BVOA 3OX8A 3ABMB 5DJDA 2ZOWA 4QRRE 2NR6C 3N42B 5FGCB 1R5VA 4N2EA 4X6EB 3IGKA 2JH2A 3D30A 5DO2D 4N1EA 4P99A 3FTXA 4NZJA 4YXLH 3QH3A 2MPVA 1X7QB 3UZQB 3DOHA 4N1CA 4HEPG 5T33H 4E2OA 5FO9B 3JUZA 5GS3A 5HGGS 3ZDXE 1CICA 1CVRA 3K46A 2WOBA 1QSVA 4OFYA 5E4EB 3S97C 3TS8A 3GWJA 3W57A 2YD3A 3OSKA 2P80D 2XTJE 3EO1B 1GHFL 4N2LA 5D55A 4LRNH 5D6CB 1YMHB 1Y6KR 1OP9A 2NNCA 3FXIC 1W0VB 2GQHA 2XQBH 2NW2A 3IFNL 4HS6B 3VGFA 2OMYB 4ZAKB 3Q2CA 2MCAA 3KLDA 3BQUD 3MJ6A 1SHXA 1I53A 2C3GA 5I0DA 3CFJA 4XC1H 2AJ3B 2DWDA 2J1ZA 2BCKB 5ITBL 5CILL 1AKJA 1A6AB 1GKOA 2ZUTA 1HX0A 1XCQA 1X7SA 2W9LA 5EZPA 1UKSA 3OZLA 5FDYA 1NCDL 3CVIH 4BUQA 2EYRB 5FC9A 1KJ2H 1U2HA 1ZK5A 1KBPA 1I3UA 3MRFA 3VWJC 4A39A 3BP5A 3EO0B 3QRFM 5I1AB 5B7EA 4XZUA 2DOCA 1QSED 4LPTA 3PP3H 4YHZH 1NUNB 2V2WB 1S9WB 2P9RA 1AD9B 3AT8A 3VXQA 4TUJA 1ZJBA 1O6SB 1IILE 4WFFD 1JUFB 3R1GL 2EUXA 4WI7A 5IHBA 4XT1C 3MRQA 1DQJA 3WXVL 4BFGA 4RIRB 3AMKA 1MHHA 4WU5A 4IBYA 2J43A 1CGWA 3B4NA 5BZWA 5A2BA 4O2CB 4UUJA 5EBLB 2GY7B 4XBGB 2ICEC 1WAAA 1T2JA 4J3XA 2OTPA 2VZOA 2NNAA 4NC1E 1Z9NA 4LMQI 4N5EC 3HNVL 4ODVL 4A2GA 1YLBB 5I1JL 2XN9E 3O3DA 2GK0B 1FL6B 2VMFA 4PJ7B 3VFRA 4JRYE 3OMNB 3FTWA 3Q2LA 1GGYA 4XN7A 3M7OA 1R9FA 3KPNA 4GRWE 3O11A 5IFAL 4J3OH 3BO8B 4GW1B 3M8OH 5LHDA 1SYSA 2Z4QA 3FULA 1I7UA 3P2BA 4PRHE 3U46A 1N12A 2GAZA 4HKBB 5F0JB 1UM6L 3E9TA 3W39B 2VRAA 4N8VG 3WDJA 4XP9L 3UO1H 2ZUVA 3X1GA 1EEZB 3L3HA 2ZJSL 2XUWA 2BY2A 4JHWL 5HGDB 3O8XC 3HW7A 5JQHC 5BV7H 3SOBH 2H1LM 2VXSL 4U6XB 4N2FA 2EDDA 2OTWB 1OPGH 2FVNA 1Z6JT 2EH7H 1KPUB 2J88L 3QFDB 2W65B 3IGUA 4WI0A 2CIKB 4YHLL 1D6VL 4JG9A 4EBQL 4Y89A 4JPSA 1F2XK 4XE0A 3V0WL 2VSDA 3GMLA 3KM1A 4K3GA 5BS0E 4P59L 1UFUA 3NQIA 3WL9A 4M1GL 3UIYA 2DQCL 5MI0B 3K81A 1MHCB 2Y7NA 3HBZA 4G1EB 1J87A 1S5IL 1J1OH 1TKWB 1JRHL 1XGTB 2E56A 4NC0B 5F3HA 3WJLA 1VEOA 2BZ7A 1K3IA 5C8JA 2KI6A 3LEXB 2DJSA 4K23H 4HKZA 3WUWA 3C5SB 2R1XB 2AZUA 4KI1A 4N2NA 3FFCB 4NI3A 3BN9C 4GXVH 1G7QA 1NBVH 3TL5A 4MHHG 5EU4A 1AD0B 3P3UA 4HFWA 3O8XA 4EUPB 2BSSA 4GW4A 5JIHA 3PU7A 5C09D 5IESH 2DPKA 2SEBB 3TESA 2XWBA 3DURB 2EDHA 4MCMA 5EOQL 3H85A 3HN3A 3S3SA 2IBZX 4LLUA 3E9UA 3AREA 2QDWA 1F3RB 4LQFH 4Z7WA 3AM8A 3TN0A 1DN2A 2WINA 5GJSH 3VYNA 4HS8L 4PJEE 2E9JA 1BQRA 3T0VA 3UBXB 2GJ6D 1XBRA 3LB6C 1JPTL 4KRPC 3P9LB 5GISH 1EA9C 4BFEA 2M8XA 4LVEA 3K6SA 1F2QA 2X88A 1U8JB 4JAMB 4FLOA 2V7NB 3RVVD 4P8QA 1HINL 2EXWD 1DHKA 1DL7L 1EV2E 2H32H 4NSKB 5C7ZA 3O6FA 1CMOA 4PWFA 2R0KL 4G72B 2DLTA 2J8OA 3MRKB 1KIUA 2CR3A 4R2GC 4FQXD 3SDCD 1DN0B 3JV6B 3PV6B 3B2DC 5FECA 3NABH 4NGHH 3V4UH 5JPNA 4GI6A 2ICCA 4HZAA 1ED3A 4QCIA 4XCFH 3UJTH 4XWOC 4ELMF 2NY6B 1YY9D 3BWAB 1U8HB 4LEBA 3T04D 2Y5EA 1J0JA 5CHNA 4YDKL 1SF5A 3IDXL 1ZDSA 3SKMB 1QQDB 2B0SH 5F8RC 4FQJH 4IBZA 1HHKB 1KYDA 1Z66A 1KJVA 3N1GC 1D5ZA 2NUPA 2P5EB 2PNDA 2L4OA 4KROB 2F54A 4KZ0A 4YHPB 5JHDE 4JY6A 1DUZA 3OAYH 2Q86B 1J0YA 2LLLA 3MQIA 3OXRA 4QT5B 3RTQC 4I5BA 1R3HB 3A21A 4XVTL 4MYPA 5SWSE 5IMMB 2MKLC 1U30A 3G6DH 1FG9C 2JKWA 2JI1A 3GNML 1Q9WA 1Q9KA 2BO0A 2D9QB 3P4MB 5I19L 1R47A 4GRLB 5MEOB 3HG2A 2AXGA 4IBUA 1UZ8B 3MHZA 4K15A 3TPUA 3ZE1F 1G7LB 4MZ3A 4FZEH 4Y4HB 4XN5A 1WEJL 4KVCL 4DHLA 2OMXA 4N9OB 2EH8L 3NACH 2EXWC 3EUDA 2HRGA 4Y9BA 4DAGH 4UDUA 3QARA 1WT5C 5CJOH 4L4VA 4TKWA 1KCWA 2AJYH 4MAYA 2VWEC 3C6LA 4Y9FA 2K8QA 1G6VK 2X5PA 1LL1A 5DDHB 4DJMA 1S4IA 2DQMA 3BKJH 3VM7A 4O2FB 5F89A 3UBGA 3ASNB 3NEOA 2KKQA 4MZIA 5FA3A 1T83A 4KVPA 4NWTL 4XCCL 3MLUH 4PIRF 4ODHH 3NAAH 4E68A 3WEOA 3FQXA 2IWFA 4D2NA 2G5UA 1CTNA 3AU1A 1CG9A 4M5TA 4TVPL 5TDOB 1SBBA 2C9XA 4L9DA 2B9BA 1CFSB 3C75A 4QOKB 4UNVA 5IB1B 3GBEA 4JR9H 1II4E 4FFYA 2HKHH 3ZQ9A 4JFTA 1S7UB 4KK9D 4AGLA 2BWDA 3HC0A 4Y5YB 3H9HA 4FQLH 4NN7C 2H3NA 5F6IC 1ES0A 3DVGA 4M6NH 2G2RA 4UIMB 2ZWSA 4EN3A 3RZCA 2HRHA 2C9VA 1PZ2A 5AG9A 1S7SB 2GIMA 3WKMH 4OZHA 5IBTL 1PZDA 1T0OA 2H41A 2JELH 1MG3C 1IEAB 1E5YA 2VDMB 2NY2B 2WTPA 5GGTA 3ZKND 1GZPA 1FNFA 1Z0NA 4G1EA 2X05A 4G5AA 1QBAA 3EOAB 1MFEH 1WFOA 5TE7L 5TQ0H 1ND0A 3ENEA 2ZOUA 3UP6A 4BFIB 4F93B 1XEUA 3PHQA 3QRGH 2UZIL 5E1HB 2NX5E 2XA8H 4BZYA 4OT1L 4EVNB 4J1UB 2W0LA 1L9PA 3TX4A 3L45A 1QLRB 3TFKD 1G4MA 4OD3L 3FSWA 4JM4L 4XBEL 1UWGL 1EGJA 5KVDH 1UURA 3EFOA 3K4ZA 5JW5B 3OG6B 3AJ7A 3FB8A 3T6ZA 5E4AA 5KSBE 5AL0A 3APCA 4PRDB 4PS4H 2QELA 5FYLE 2QQLH 4BFJA 5T5FL 5E99H 3A24A 4XX1E 1YMHA 2V3EA 3QJUB 4OFYD 5GIRB 1JHTB 2DRUA 3T4AB 3BSZL 3C60C 2JKIS 5D7JC 3B43A 2RCSL 1I9IL 1M9SA 4FG6C 5ETUB 4DPBX 4X6FA 4LLMA 3GLAA 2E76C 2YAHA 5IFJB 2X40A 1FHGA 2DEXX 2DW5A 3GSQB 1J1OL 2I69A 4H88H 3QNZA 4JM2D 1OALA 1HE7A 3DGDA 5I6XC 1CFTA 3P2TA 3TO4D 3SCMB 1LEGB 3SE9L 3D06A 3CDCA 3D0LA 4R3SA 3S36H 1VGEL 1UOKA 4LP5A 1D6VH 4KKCC 1XT5A 5C0GA 1J5CA 3QJHA 3RX9A 4ZNEE 2PPDA 4RWYH 3AXLA 1N7MH 2HSIA 4PUBH 1F4XL 3UOAB 2PWFA 2VSMB 1YEFH 5CFAA 3D9AL 1KJ2L 2DDQL 5DHXB 2TAAA 2F54E 5JHDA 4QRPA 3BQUC 2A2QT 2IQAA 1BAGA 2LFEA 4HOZA 2XNAA 2GJZA 1BCIA 3MR9B 4LBEA 1R5VB 1A7NH 2NY1B 5DJXB 5IIEA 3BJ91 2R83A 4K3DL 1RQ5A 2IWKA 2XKNA 5DHVA 1IFHL 2YPVA 3FQTB 2EEXA 4FQIH 4HA1A 2V2XB 3CLFL 3BZEA 5DJAB 5HJ3B 1NLDH 5L9DL 1TPXC 1JTTA 1OGAA 2FLRT 2OI9B 5CMAB 1QR1B 4IBSA 5MENB 1BAFH 3KLQA 3QUYB 1YHPA 4IOIA 3QUXB 3UPRA 2CUHA 2FJSA 5IJCC 4KTEL 3L9RA 3VXPA 3MOAL 2IDSA 1E5BA 2VR6A 5DU7A 2VDPL 3MLZL 3HR5B 2NDFA 5D7SL 5CO1A 1XWVA 3OAZK 1T0PB 4WCYH 5J6SA 3VJ6B 1I7UB 3PAUA 5IHZB 3BI9X 1V10A 2H0PA 3CVHA 4XMUA 4XWGH 1I9RH 2DJ4A 3QT2A 3VI4E 1AHWA 1OWWA 4PVBA 3TGXA 3DJ9A 4ZPVB 5IK3A 1VEPA 4LVOB 1J8HD 4J3WA 3MRFB 1X5XA 1OQOA 3O45A 2CIIB 2VERN 1CFQA 2Y1ZA 1Z3GH 2WLIB 3GNMH 5C0AA 3MLRH 2CGYA 2K7PA 2Z92B 4NO3B 1FIGL 2H1XA 3KPOA 4UV7H 2BSTB 3TNNA 5GRWA 1LMIA 2FUTA 4I87A 2IADA 4JHBA 1R6VA 4EOWH 1NCUA 3BZ4A 1EEYA 3IRPX 4ZS7L 3T09A 5E8NB 3WFBL 2X4TB 3ZDZE 5F7HA 3L5XL 3S8WA 5D9SA 3EZ8A 4D9RD 2FYYB 4Y2OB 4FL4B 1KXQE 4DGVH 4NKOB 4ZOAA 1E9OA 3VNYA 1KYOJ 5KVEH 3RWCA 1HU8A 2CCVA 2R23B 4P2OD 4V1DA 1GGCH 3PRZA 2GEEA 3FAXA 2X4UA 1KGIA 3TJHC 5BO1H 2AQ3A 3VW3L 3WEXB 1NAMA 3DO4A 4UNTA 4LSVH 5D2NA 1WUZA 3B7UX 1DVFA 2J5LC 5ALBL 4FFZH 3VWJD 2P1YA 2E7CA 2XWJB 4TN9A 4P9HC 1C1EL 3D0VB 3PDGA 4UAOC 3D2UD 4BKTC 1J0ZA 3GK8H 1C7SA 4Z77B 3FONB 5T1LA 3DHPA 3E7JA 4HOWA 2VZUA 4LIQH 3CN4A 3TN0D 4X9HA 2PP8A 1RZFL 2HN7A 1RPUA 3Q6FB 1LYQA 3LKPB 3TOPA 4Z7OB 3MUGB 3ZYOA 4CKQA 5BOZG 4U49A 3W2DH 1T5XB 3MV8A 2CHZA 4ERSH 4RNRB 5C09A 2Q9OA 2YK1L 4WU7A 4LCWE 5ABZA 1CFVL 5DWUH 4HKJA 1FYHB 3CPLA 4CKVX 4EI0A 3CQPA 1MDAA 4UMSA 4HWNA 5CINH 1PY9A 2IPTH 2FEJA 2WBKA 3W5NA 3SYCA 4YZWA 2OSXA 3KS0J 4MXQC 5GS1C 3WEMA 1XGYH 3ABZA 5FUZH 1H0DA 2HPOA 4GKNA 2EYSB 3SQOL 2GUOA 1LEIB 3EOBA 5AKSA 1OY3B 1WD9A 2E9BA 4ODWB 2KERA 5EO1A 3RJQB 5LKNA 4OLYH 3ULVL 2R0WH 2CO1A 1P5UB 4JO8A 3MV7A 5EUOE 4XMLH 4K5PA 3SYOA 3MPCA 1IGTA 3GIZL 3LNEA 3H4HA 4OGXH 1OTUC 1U8NA 3HS8A 4Y1AE 5FYKE 4CMHC 5B8CB 4HUMB 2X3AA 4H7VA 1DCLA 3QA3B 3RWHB 4F37F 5C86A 3IDXH 4R3SB 1QUPA 5L9DH 5IBUG 2LT9A 4BUGA 3W37A 3NEEA 5IMOA 1OP3K 2I07B 1QRNB 2FJGA 2A9ML 4N6QA 4PTUA 5EU7E 5IHUH 3ABKB 4DP6X 2WV3A 4JFDD 4JMNA 5TDNA 5D1ZA 4M00A 2VMCA 1F02I 3SCMA 3QEQE 1HI6A 3DHMA 2OW7A 1AGBB 1Y6NR 4Q9CA 4PJ8D 2VMDA 3VWKA 5DT1H 3L1OH 5I66B 3D34A 2B4CC 1ICTA 4LSPH 4U1IB 1YN7B 3QJXA 1SMAA 5L4IA 2WP3T 4KRLB 1A6PA 5D5ME 5IQNA 3ZMNA 4M6ML 3UG3A 3ZTEA 5T1MA 1UYWH 2Y9RT 3KPRB 3W5MA 2R2BB 5A2FA 4YDNA 1L9NA 2EC9T 2UXFA 1XMWA 5GGVY 1RUPL 1A8JH 2ZYIA 4QNPF 4JM4H 3T6WA 3ZIMA 2GJZB 2PPCA 1O9ZA 4NNYB 5DFVD 3REVB 3UTQB 3KYKH 1ET5A 1YPZF 1ZHLA 4IGBD 4R26H 5C0BB 3O2DL 4H88L 3VFGL 1S7UA 2FQEA 3KWWB 4EN3D 1PD6A 4AE1A 1QD0A 1NCBH 3CUPB 1YEHL 5E8EB 2CLVA 2XZCL 4NQSA 1BZ9A 2X0UA 5EIQA 2OX5B 1CG9B 2VDLB 4YUEL 4LRIA 3LSOA 4U1NA 5I8CA 1NPJA 4MQ7A 1E3XA 3TU6A 4IKIA 3TIEB 1TVHB 3HBGA 4WFGD 2Z31D 1S7XB 2Z9TA 4N6RA 5K59F 3BUDA 43CAA 3H9HB 1P6WA 4Z0BH 1VGKA 1ZTXH 4ZUUA 1IGIL 1ZV5A 2Q8BH 2Y23A 2ED7A 2HUHA 3KGTA 3RZCB 2P8PA 4F5CA 4ELDA 3W82A 1SFDA 4ZOEA 3JQOB 4BFIA 1TEFA 3M7FB 3IB4A 2WLIA 5C0AB 3UC2A 4XCNA 1NFDF 3ZE0E 4KOCA 4K3DH 3THML 3EF4A 3HCVA 1YCSA 1HQRB 5ITFB 2FATH 4M6NL 1AZNA 1BJ1J 4P2OC 1M53A 3KXFD 4C57C 1RMFL 4NERA 4CC1A 1UH4A 4R6UA 1VESA 3RI5K 5ACLA 3BN9D 1J5DA 4OM1L 1F4XH 4HPYL 5I0XA 3EGSA 3LQZA 4JDEB 4NIYE 4ZJ9A 3S3BB 4F8LA 5DJZA 4NBZB 4JMXA 2IPKB 1JTPA 2YUXA 1EDQA 3PABB 3QP3A 3QAQA 3SBPA 2YAEA 1AI1L 4G7YL 1ADWA 1LWHA 4MFHA 4MQXC 3SKNB 4MZ2A 1XGRB 1YDPA 4KDVA 5HHOB 4ZMZA 3QHFL 4A6YL 5BJTB 2WYZA 3HC2A 3S2CA 5L0QC 1RP9A 3FUMA 4ISVB 4U6VL 5I71C 2ZWKA 5BPPA 2BFVH 1OP3H 5ICUA 3QIBB 1OTTD 4N85A 3NP4A 2VLRB 4YFLI 3VGHA 2DH2A 1GZQB 1MIMH 3F62A 3FRUA 2UWEE 1VZGA 3KPLA 1O0VA 4QHNB 1B0IA 5AAWA 1G5GA 2C9QA 4IKJA 2ILLA 3D0LB 1ZLWK 1F0LA 1SY6L 3L1GA 5EU6E 4PJIA 4OGYH 5D1QC 2ADIB 5AZUA 2OK0L 3AXLB 3QDMD 5EOTA 1FAKT 3QNZB 4A7UA 2PTTA 1UGNA 1PD0A 1FFRA 3WLWD 1WZMA 3NSFA 1GGIH 3DV6B 3MRBA 3SPCA 2YWZA 2C9AA 3QWOA 5C0JB 1T5XA 2WJ7A 3UYRH 4F37K 4OD2B 4RETB 4ENEC 3EGDB 2IGFL 3R7RA 3QJHB 3EFDH 1UQSB 5F9JB 4Q9RH 5C9JA 1LM8V 3QRGL 4Y4HC 1NEZA 2FZ3A 2WSDA 1EZVY 4LXFA 1KN4L 2UXTA 2N56A 5AOIA 5TPWH 1T80A 3K2IA 3FCBA 5E6RB 2FH6A 4J39A 3HG4A 1I9JL 3ME0A 4P4RA 5F9OH 3DDGA 2PYEE 1ZPUA 2ICEB 5CBAA 4Q97A 4AK2A 2YEVB 2O5XL 3F7QA 5H35B 4MAUL 2BOCA 1GTNA 3QDMB 4GI8A 4LIQE 1UD2A 5IKCA 4WUKL 1DJGA 4E9QA 3CPUA 4EIBA 4LSSL 3FTGA 2A73A 3KYMA 2AZAA 4XB7A 4WSJA 1MRCL 4R4BA 3D2UA 1IBFA 5KANI 1MCFA 5FW7A 3MROB 3MLYH 4N2IA 4MCZA 5D1QB 3S4SG 4IS6A 2XYCA 1KTDA 4KDTA 4KXBA 2ZX6A 1BVZA 4KJWD 3UH8A 2QJDA 2XVGA 4GKSB 3EO9H 5BVPH 1WISA 2IJ0C 4OZHE 2ESVD 2MSPA 1T89C 7TAAA 4UM9D 2GBAA 4TUKL 5ELIA 2K7QA 5DLLA 3TLRA 2OXHA 3D07A 4N2BA 2Y69B 5SX5H 5IUCA 4OZIA 5K9KB 3ROOA 2J20A 4JPIB 2XOTA 5T3XH 2XV0A 2HVJA 1A4BA 2ZSVA 1BZEA 1NEUA 1TR7A 3CUPA 4GUOA 4DKAA 1QRNE 1MFCH 3GT6A 2QADC 2RIKA 4RZCB 15C8H 1CGUA 1GGBL 3I50H 1DJXA 3PE9A 4FRWA 4QRPD 5E8PB 1E9QA 3O2VH 4HQQH 4O4YH 5EZIL 5AYTA 2WWKT 2HRPH 3ZE2F 4YXLL 1WPCA 4XGZB 4YLCA 1GXEA 4HPYH 4MNGE 3LZQA 4BH7B 1T7WA 3Q05A 1GCYA 1GKEA 1NTDA 4KX7A 1FLRL 3QJQB 4AENB 1RZKH 1P2CA 5DFTA 1CD8A 4PWJA 2B5IB 4AMWA 4D9LL 1WGOA 5EZJB 1XDTT 2C7FA 3WUWB 2CM5A 2X4QA 1EAPA 1IC1A 2BMKA 3A4FA 1IV8A 1PG7W 4IRZH 3U7YL 4XX5A 4MMZA 3WIFA 1UJ3C 4CVZB 2QVIA 2V9UA 2CK2A 5HHXL 2MQCA 3LQZB 4JDEA 4LASH 2B1AL 5TJWK 5C71A 2FJFA 2LLGA 4HKJB 1IKNA 1P4BL 1LE5B 5E0FA 4WWKD 5ANHA 3PUCA 3N6YA 3FT1A 2WBJA 4PJ7A 3T0EA 4N2DA 1I7TB 5E2UL 1F3JB 1LO2H 2X89A 1KB5H 2APTA 4U1MA 4Y1SA 1F90L 3CVBA 3L7FB 3WY1A 4WI8A 2VDRH 1MCRA 1YSOA 3DOSA 2A9DA 3MCG1 5IVOA 3SKUD 2CJUL 3SDCB 3CMGA 5JHLH 4NQCE 3UTOA 3WGVB 4ONOA 3FB7B 5BRQA 3H3KA 4AV5A 5AVQB 4C55A 1XGRA 3OZKA 4D3CH 5LQBL 3GSNA 5AOMA 1TVBB 1XCTA 3GSNH 4WEMB 5IQ7H 3S37X 5D1QD 4X7CC 3HN5A 3RGVB 3HZMB 3ZXAC 1L5GA 4KROD 2AK4E 4J8RA 3EYUH 1TUPA 1KPUA 3QFDA 2J57A 5JPMB 4Y2LA 1FAIL 3SY0A 2VLRA 2HVKA 1JGEA 3DYOA 4I8DA 4ZYKB 4Q2ZA 5ECGA 3T1FA 1CK0L 3KS0H 2CE6A 4U3CA 1ZTXL 3BAEH 4ZX5A 1NMAL 4OLZL 4K55A 3VWKB 1DVYA 4G11A 4Y4HD 2CMRL 3L4UA 5AVSB 1GJIA 1U8KA 1J1XL 4CN6A 4YBQD 2BIPA 1X5YA 5DJDB 2I32A 3ASOB 3DPBA 1GHFH 4KKAD 2JJWA 2F7RA 4D0BA 4CJ1A 2VKXA 4HHAA 3RPIA 3O6LL 2HJFA 3GIZH 4OGXL 1FO0A 4GQ9L 3LRSA 5CZXC 5MEQB 2NW2B 2XN0A 1AO7E 3ULUC 4NWUL 3LKSB 2RH0A 4ONGH 5TK2A 2BSRB 4HAFA 4U1IA 3RL1A 2OAAA 3TASA 4FTVE 2VXTH 1MAMH 2BVPA 3CFBA 3DXAA 5T1KB 4F2FA 5AW3B 2D2OA 5HHMD 4ELMA 4Y4KB 3CVIL 3KPSD 1BDYA 4NN6C 3ES6B 3BPNB 3PP3K 4QHKJ 5C0AE 3ZLQC 2DQCH 4N0UB 4PM1A 3PP4L 4F27A 1G7IA 5DEFB 1UG9A 2DWDB 4Y5XA 2VDKH 2VL4A 4ZX3A 2RQEA 5DMYA 4KX9A 1TMCB 1BJMA 4UYQA 4A6YH 1NJ9A 1I1AA 2YC1A 4UQAA 3IFPA 3MA7A 1UM5H 1ZGLA 3GMNB 3DRTA 2BFVL 4AQ1C 2X4RB 4WV1A 2NY7H 3QIUD 1D2OA 4C56D 2ATKB 5AYQA 3KVPA 5LAXB 3FQXB 3O2DH 1L6XA 3ILPB 3RWEA 1MCWW 3Q01A 3LD8C 4IYKA 2F5BL 2WLKA 3U6RA 3H3PH 2BY3A 1HL4A 2NY3D 5GJSL 2VL5A 4KK5D 3V0VB 3TA3A 1E28B 2JKSA 3QIWC 4PJHE 1YYCA 1QRNA 3VCLA 4OSUH 1FN4A 5DJZB 5D1ZB 4YGAB 4PS7A 4PBWD 4CN1A 1KNOA 2ZX8A 4N8PA 3APFA 2Q86A 2G3ZA 2Z4QB 1L0XA 3V0FA 1MSPA 1MRCH 4PV1C 3B3BA 1E7VA 4L4TD 4A2DA 4ACTA 4O02A 4Y2DC 1JRHI 1KFAH 3P0YH 4MGXA 4WTZG 4KH2A 3UXFA 4CGUB 4BGDA 1OAQL 3QULA 1KYOK 2WSKA 3OQRA 3BWUF 4PBVC 3TCXA 5E1AA 1RU9H 2CLZA 5FOJA 4X50A 4WVRA 3ZL4L 3FTVA 5J06A 4JCWA 4JREB 1SBSH 3MSPA 2DQEL 1NLBH 2BIIA 5KS9E 4DGYH 1KGJA 1FYTB 1SXAA 4IJTA 1AQHA 1BQUA 1X5GA 1D7DA 3MCLH 3U1PA 3IFLH 5LCVH 2CDFB 4F3FA 3BGMB 4XNUL 4QAMB 4DCQA 1QW8A 4F80A 3RRQA 3QEUB 3RHWK 1ZS2A 1E90A 4X9BA 1SOKA 3F05A 5JYLA 4ETQB 1HXKA 3K8LA 1NL0H 43CAB 2LV4A 3COOA 3TFBA 1JZDC 3G5ZA 3MOAH 4NUQA 2P8PB 4JRYD 3ZSTA 3QDJD 3LPWA 4IJ3B 4YVNA 1MAJA 4HBCH 1NCDH 1CL7L 3C5ZD 3VFWB 5F21B 5FYLL 1FLRH 5EDXA 1ZLUK 3AG3B 4X8JB 2VLME 4HIEA 2PLTA 1B2WL 5DEJA 1T66C 5TF1H 3EH2A 1DEEB 3SN6N 3TBVB 3VX1A 3L3KB 1EXHA 1F6AB 1U21A 1NWPA 4LQFL 4YHZL 5LXGL 3EXJA 5D7LA 4RGMB 2W9DL 3ARDB 3U0WH 1QZNA 3MGTB 3X3FL 5H37A 3P30H 1GYUA 3BQUB 2IQ9L 3BT2H 3VXUD 1S9VA 4RMSA 3ULSA 1NIDA 3CVDA 2AJZB 1D6EB 5JHDB 1KT2A 2I24N 1RSFA 4M7ZB 1RVFH 5L6YL 3TEXA 2I60H 3IXAA 3RX8A 2DQJH 4ZFOA 3SPJA 4YHKH 1TF4A 1PIGA 5I28A 2PO6D 3ZTJH 2O5NA 2XT1B 2JB6A 1EMTL 4PMFA 4QXWA 1PD1A 4FLSA 2VOTA 4OJCA 4RZKA 5G55A 5JPNC 1A6WL 2EKSA 4NFBA 1ROWA 1U92A 1TJIH 5I1EL 1TZHB 3DX9A 5JO5B 5AOJA 3INOA 1BVNT 4XMTA 2ZSWA 3LIZA 5HD8D 3WS6A 5ACZA 2EACA 4NUMA 3ILQD 5I26A 5JOPE 5BZXA 1AFVH 3RFZA 2VLJB 3KBHE 3ZL1A 2X70A 2ZXBA 3L3GB 4FABL 2WVSA 3P11H 2EO9A 2PYED 3MV01 3C8DA 4R9HA 3MRLB 2VXVH 3HUJB 3P4OB 2GBUA 3WI9A 4HJTA 3SDDA 2XLLA 4NO5B 4HWZA 2D03H 3Q2NA 2P8MB 3TBTB 5HHNB 4CILA 4OCWL 3QXAB 4AITA 2FHCA 3G04B 1LO5A 1KLGB 1P5VB 3VI4A 4CGTA 3JWOL 1HWWA 3AREC 1ZT4A 1T3FB 4KUZH 4NQVA 4GMSL 1DBML 4JANA 5SWZE 1A7PH 2FQFA 1WCBB 3GMOB 5LDUA 3GRGA 1GMIA 4UF7C 4N3TA 2UX6A 3ZGIA 2X2UA 3EJZC 1BF2A 1W8OA 5L2KA 3HJ0A 3MVSA 5CSZB 5D5MA 5JZ7D 2XXGA 3IJHB 2UZPA 3FTSA 1JWUB 4LRIC 3TURA 3GMMA 1Z2KA 3QUMH 5K59E 3TA3B 2VZVA 1B9ZA 2FD6L 1A66A 3RKDC 3PCYA 1U8IA 1VENA 2EE2A 1Y6MR 4FLQA 2GIXA 1S7TA 1QRND 1Z5LB 4E42B 2YAFA 1M71A 1AO7D 1IAIL 2NZ1A 5C08B 3H2QA 3RTQB 1J1XH 5FKAA 3KVQA 1YEIH 2J71A 3GJEB 4IDLA 5GRYA 4ODTH 1HSBA 4X6DE 2VDKL 3I6GB 1G7PB 5DD3L 5IIEB 2OP4L 4OCLC 1NIAA 5DHEA 4FNPA 1L6PA 4NN5B 5HHME 5EFIB 2MTPA 1C8QA 1K3ZA 5DYOB 4FQLL 4N2OA 3FO2B 2ZONA 4W9DC 4XO3A 3PIQB 1BVLB 4WJG3 2OXHB 1VPOH 2QEJA 4PJFF 4ZSOE 2VXTL 4MD0B 5IB1A 5DJYB 4PJEB 5I8KH 4MXVE 3NPZB 3NN8B 3TCLB 1T5WB 3CZSA 2VCOA 1G9MH 3TYFA 4ZMAT 2AKRA 3D9AH 2P5WD 2HT4C 1WLHA 3J07A 1ZA3B 4RGOH 2B59A 2X6AA 3JWOC 4BSWA 4FLRA 3U2SA 2ICWA 4HJIA 3GI9H 1N59A 2IALA 2X4PB 1QR4A 3P0VH 5JLZB 3RKPA 3DBSA 3STLB 1J8RA 5C2BH 3NIGE 4HX1B 1WA1X 4JGMA 3FCTA 1GZPB 5JHLA 4GS7B 5DD0L 2F8IA 3SDXF 2Y36H 2QV2A 4WW1A 3VXRE 3RI5F 1KTJA 2WLJA 1UWXH 3CZEA 1KXVC 4YUEH 1P5UA 6FABH 1UD5A 4KO9A 5B8CA 4LL9A 2DKUA 1QNZH 2Q76A 8FABB 3IMUA 5E8NA 2XXMB 5HHVL 4A68A 1SN2A 1WEJH 2HJKA 4KVCH 1ZLSL 1KG0B 1OTSC 1ZCRA 3RU8L 2HZHA 4HXAL 2GIYA 3DWTA 1L7IH 2P43B 4HIPA 2X4SA 5F0PB 2W59A 1DVFD 3PGDA 2VXQA 3BQVA 3VWJA 3GZKA 1NIEA 4OF0A 1T22B 1A4JA 3GJFB 5FM5O 1SOSA 1B0RA 1FRGL 4KROC 1R3KA 2E8YA 1JD9A 1IGMH 3DIFA 1VFBB 2E4FA 4FDWA 1I7TA 5E2UH 1ORQA 4RVBA 3H42H 3B56A 2QKIA 3D52A 4W1TA 4OKDA 3VRJB 1AP2B 1XB6A 3QORA 1OAQH 4PJ9B 3AAZA 3BKJL 3PWLB 4MHHI 5L4JA 3K71A 2DD8H 2V7HA 4JFSA 1G7IB 2OULB 5HHOD 4M4PA 4I89A 4JGJA 3MGAA 3JWDC 1KYUA 2PO6A 1M2OA 1YZZA 3FB5A 3QZWG 4IRZA 4NP9A 4WWKA 4L4JA 5GS0D 1XH1A 4K8RL 2NPLX 5BQDA 4ABVA 4AVIA 1FFQA 1YYLH 1JSYA 4JJ5A 5F6IB 4FTVD 1K6QH 3F8UB 4UMGA 3RY6A 5HGBA 5TGBB 4ZS6C 4YHOH 3SBQA 4YSCA 1FN4B 1G6RH 2KDGA 4M61B 1BEXA 3B9KC 3F58L 3C9NA 2AMUA 3H7BA 3P69A 4XNQA 4D0DB 2FEDD 3CLFH 3W11C 2NY2C 3RIKA 3H2PA 1E4HA 5BUPA 2HYMA 3EDKA 1A65A 3JVFC 4B0MM 3AXIA 3SGDI 1T21B 1HL9A 3BAXA 3CG8A 4L0YA 5FO2A 4HPOH 2P8MA 4OGYL 4NWUH 4HS8H 1BW8A 4I9WD 1TYEB 1NCWH 5D7IF 4CMHB 2F53A 1MFUA 3HAEB 5DJ2B 4FQ2H 1ORSA 1FI8C 2BSRA 3UJJL 3UBFA 1OB0A 3ZJAA 2RD0A 4C8XA 4ERSL 5L2KE 3EG9A 1CJYA 4L8DB 3GSWA 1I8KA 1KZQA 3F83A 3IJYA 4TL5A 1FZJA 3LIUA 3U0WL 3CC5B 1EJOL 1I9RL 4NRYB 1KPVA 1TTAA 2X2HA 4KNSA 4WHTA 1IBZA 3SO3B 3MDJA 2F53D 3X14A 1JHKL 2BS9A 2MJWA 3PWUA 4MASA 4UM8B 5ESQB 5AYUH 2TSBA 1KWGA 3C6EA 4FJYA 2APBA 2AXWA 2P46B 3TIDB 4FABH 2X2YA 4PRAB 5KBMA 4KKBD 3QQ9D 3GEFA 35C8L 1FZMA 3GBML 1IL1B 4LDCA 4R7NB 4YHKL 3LHPH 4DKDC 1HKFA 4XNBA 4PGEB 3CFDB 5I71B 2JFCA 4P46D 1AR1C 4FQJL 1JGUH 2K9FB 2P3YA 1WZLA 3OXSB 4TRPL 1YPZE 3JTTB 3QFJA 1F42A 2CO3A 4GO8A 4KQ4L 4XP4H 3SQRA 1O7VA 3TO4A 4YDLC 5KW9L 5E9NA 2ZCHL 3HI6H 3TT3L 1E43A 4F1SA 1CIUA 2FO1A 1DDHB 2P26A 3DJSA 1G7PA 1CLOH 4F8NA 3B3IB 3HEIB 3O3AA 1NSNH 2V2TA 2Z91A 2PWDA 3BGFC 2ZE0A 4OUOA 2ALWA 1LILA 4JQIH 1DLHB 4OIAA 3OKLA 4JG0H 5AKTA 3D6GA 4MNQD 3F5WA 3CHQA 4LPWA 1HHGB 2OM5A 2A99A 3L3HB 5HGDA 1GY1A 4MBOA 5IT2H 4K07A 2NTFA 4JO4L 3DROB 4NP4L 4QXTA 1YEGL 5F2FA 3H2WA 4UU9A 4HK0A 2NY6D 1FRGH 3KGSA 5CJXA 1DSWA 4ANWA 1DQDH 3G5XB 2WLNA 4OD1H 2D0HA 1KB5B 4C59B 4O02L 4R0LA 4O51B 1FNEA 1O5DT 3IBOA 4TQEH 3BSZH 3PAVA 3V6FB 3UTTD 2DIJA 3VFTA 5F1SA 3HRPA 3IGAB 1LVEA 5M7QA 1PIFA 4L1TA 3V8CA 1Z32X 1OAXL 2DLFL 4GAFB 4ZW7A 2G3NA 4Y9GA 1ASQA 3PFUA 4HIXH 5B38B 3CXDL 3ISWA 5CLXA 1YEIL 4HJEA 1MF2H 2F18A 4J6IA 1CGTA 1C5DB 4M1DH 4X7SH 2A6KB 1JZ2A 4HWEL 2VUKA 4W6YB 2ZUWA 5KVGL 3RFZB 4RMUA 4H8WC 5D1QA 1F4WH 3N44F 4AC2A 2WWNA 1T4KA 4YDIH 4WK4B 3BPOC 3AT0A 1K9TA 1PFCA 1UT2A 3AXHA 5D7KD 2FO4A 4AVKA 3JT2A 4Y16C 3D18A 5BO0D 2O6FA 3WGUB 3GLEA 4G9FA 4MDIA 1LEKB 5F9AC 3UBXA 2F2HA 4L37B 4UOZA 4JK0D 5C08E 2PCXA 1WYJA 3L5WB 3DARA 5KBLA 4OF8A 4HD9A 5JOEA 3RNQB 1F3DH 1RH8A 4UQEA 2J8UB 2FL5B 1T1YA 4OVUA 3JBG7 2NZIA 4ZFZB 3HVNA 4K7FA 2P5WA 3UGEA 3C8KA 2H6PA 1NLDL 1QI4A 3QI9B 4RWHA 3N1QC 1JI1A 1W8EA 4P4KC 3AS1A 2HFGH 3IN2A 4PJGA 1EFQA 1UA7A 1MCIA 2HKFH 1FL5A 4JFPA 3H56A 2DL9A 4OLUL 2ZXQA 3IM1A 5ILTL 5DRZA 5HGBB 2V17H 2WHVA 3LN5B 3HG3A 2OMBA 2ZWLT 1FQ9C 4NAMA 1T21A 4U6HA 3GHBL 3D48R 5JXAH 2ZX5A 3QH3B 4GXUM 5C09E 1KJVB 1SRDA 5GZOD 4KWUA 5C6TH 1T0MB 2DJMA 1DANU 4KZEH 4WZ9A 2XWRA 3MXWH 3O6KH 2DD8L 3T0DA 4KAQL 3U46B 4WGVB 3E6HA 1THAA 4OFDA 5D71H 2YUVA 4Z7NB 4XTRD 5GZOA 3DVNB 2XN2A 1QW9A 2AKRB 4AEHH 5I75B 3L5HA 4UQBA 3NPSB 3FO0L 3TVMD 3RURA 3S5LB 5DJ2A 3OKKA 1AKJD 5CLYA 1JZHA 3VFSA 1TZIB 2BNUA 3IDMA 1V05A 1WT5A 3QUZA 3CFCL 1XEDA 1LP9B 4G8IA 1WHOA 4NQEB 1T20A 2RR3A 3HZVA 4FKEA 3ZZ1A 3U0PA 3QB7C 1T7ZA 1KN4H 4DH2A 4ANKA 3Q8EA 3WL9B 4YL9A 1NANH 3T2PA 3KPPB 1XB3A 5GS0L 1V5JA 3GMOA 1GGCL 2FDBP 3UERA 3WELA 1SMOA 4G6ML 3QDGA 3V7AE 1QWUA 4K71B 5CSGA 4PV8A 5AWNH 1TLKA 3WNNA 3FB7A 4JFFE 2LABA 3SODB 4AUJA 1TT6A 2XPGB 4YDJA 4MD5B 3S3CB 3CQQA 4XX1G 5CU9A 1WUNT 2PR4L 3I6KB 4IK7A 2CKNA 4XPGL 1BZ8A 2C4XA 4P3DA 3BUYB 1BZOA 4N22A 2OA9A 1PAZA 2NRDA 3QRLA 5FEBA 3QPQD 1YDPB 3PDDA 4K9EC 3S8FB 4AXWA 2YD7A 5D70H 1HHGA 3PJLA 1JZ8A 1YEKH 2A74C 3QIWD 3FT2A 3KPQA 4MJ2A 2O26U 2BCKA 3I3DA 2R4SH 3GSRA 1NC4D 2J21A 1ROCA 4OZFA 1IC7L 2QKIB 3K2UL 5IM7B 4OUUB 4AT6A 1RZIB 2C1OB 1VAHA 4AKPA 1CZ8H 3U7AA 4H1LG 4K7PL 1U2YA 4X6CE 2BNRD 3QJZA 4MDJB 1NCJA 3O8XD 5DVPA 5A3IC 3EJZD 4QHNA 5GRVK 1H3WM 1Z9PA 4JLRA 5I1AA 4NSKA 3UTSA 2C7UA 5E2JA 2WTRA 4OLVH 4PJ8A 1SHWA 4XH2B 3AM8C 2ZXAA 3DSFH 4NN6B 3BVXA 2WUBL 1QI5A 1MEXL 1MQKL 1J9RA 4JG1L 5FECB 3KYNA 1KFAL 4O51A 4LOVA 3FCUB 3QS3A 1K8IA 4IRJB 3TO2B 3FB5B 3TONA 2F19L 5C2UB 4M1CC 4WF7A 5IWLA 2OMUB 2VLLB 3HA0A 1CLZL 3O4LB 3HFML 3BW9A 4P2RB 3OKMA 1NCBL 1AGFB 1PBYA 2UYLA 4S0HA 1JHLL 1JGUL 1BQSA 2ZUQB 2KC0A 3TZVD 2ZCKH 5D1QE 2ODIA 5HVWA 1ET7A 5A2KH 3A6BH 4AIXA 2DIBA 4DVRH 4TL4A 1A21A 3NJKA 4DN4L 3WG7B 4G9FB 3DX7A 2FBRA 3QUYC 1N68A 3EFFA 4I7ZC 2WOYA 3MBXL 4TSCL 4WUKH 4B53A 3HN8A 4KRMB 1AZRA 5AB9A 3EG9B 1HEHC 1HTYA 2C3VA 3D87B 1NEZG 4I1NB 4KMLB 3QQDB 5IP4A 3TA3C 5D7IE 1CDIA 3O8XB 3F01A 2EIJB 1Z0MA 2XZQH 3SPVB 1G6RL 2G4GA 3BAYA 5FWRA 1HIMH 3OB0H 3MJ9L 1CURA 4FI7A 3QUZC 4GOSA 5HVHC 5JPMA 2BHYA 2P8LB 5DA4A 4R4BB 2CIKA 2WWMC 5DZPA 2DMHA 3LZNA 3TBWB 4FYSA 3V7AG 4YS4A 2W88A 4AQ1A 1FZMB 4JFHE 4QGYA 2Q5BA 3C5JA 4XAKD 1N6UA 3VB9A 5BW7A 1X5IA 2MFNA 4AMKL 5FM4A 3SDXE 3PHOB 3V79C 3DUHA 4WIQA 3BHBA 1G43A 3NCEB 3ET9F 2GVYA 3QULB 1IMHC 2FHBA 3OHXA 3TP4A 1JS4A 4JG5A 3FPYA 5TDPB 1QHPA 5GS2D 2CKBB 4LHQB 2AJUH 2XQYA 5EHFA 4AJYV 1QKZL 2EDFA 3CHXA 4TF4A 5DEGA 4B95C 3MRNB 3T71A 3AU1B 3ARTA 4JO3L 4F7TB 2F7IA 4TTDC 2WZPD 4XXCA 2MWCA 2ZX9A 4G8GB 2YD0A 4W9FC 1GR7A 1FYTA 4LLWA 5DD1L 3BKCL 3HZ3A 4DEUA 2CNZA 2D3VA 4JY5H 2VABA 2ZT9C 3FHAA 3QR1A 2JQMA 3LXAA 2FNWA 2VB5A 2X4NB 1NFDB 3R0NA 4HYTB 3RY5A 3U36A 3QUZD 3V0EA 2JKNA 3I02A 3O3DB 1MVUB 1VKXA 1QPPA 4PTTA 4R96B 3QWQB 2YD8A 1SMDA 3GIVA 3ISRA 5DVKA 2K3HA 2W0FB 2W60A 2PUQT 3KYOA 3P11L 1CIDA 1GGIL 3TWYA 3U82B 5EEWA 3IF1A 2B16A 2BRRL 3WY3A 3FTZA 4G8EA 2HH0L 1MRDL 2M83A 1QRKA 1MZYA 4WJKB 2GCYA 4TNVF 2ZD0A 3MRHB 3U4BH 3FFOA 3PJSB 3PWJB 1QEWA 5AUMA 4YH6A 3JWOH 4XMVA 1K4CA 3ZT5A 4L23A 4BFOA 3QEGL 3PPSA 3QDGB 3KEHA 3LKOA 1B6UA 1YC8A 4X2UA 1JPSH 3MRJB 3VSTA 3EJTA 4LCIL 4UOW0 4MWFA 3BQUA 3FBKA 1PFOA 4NQEE 1UD3A 3MREA 2FUQA 2CBMA 1KJMB 2OBGA 1YG9A 5FLUA 3VI3E 4TUUA 4BWTA 4MJID 1OB1B 4BZ2A 3GI8H 5DLML 3BEWA 3QUGA 1H6FA 4JZOB 4ALAL 5D2LA 1G9NC 4PJXE 1HH9B 3VAEA 2HJLA 2GEQA 5I15L 4DKEH 1IFRA 3MI6A 1RHHB 4N87A 2LTQB 2WBJC 1IX2A 4LLMB 3DUUA 1JYXA 4J8RB 2H6UA 4HG4K 3DX3A 3GLDA 3RWGA 3ZMRA 3UZVA 5CJXC 2ZKYA 3BAKA 1RZIA 5FO8B 5KYWA 1N7ML 3GJFH 2TSAA 1E0OB 3KD4A 4LGPB 3OLGA 2AK1L 1WRFA 4DEWA 1TEYA 4WHCA 1K5NB 4MD4B 1AR2A 1F1AA 2CMRH 2JKTM 4BCZA 2WD0A 3WTUA 2K4WA 4JFDB 1V8HA 1IM9B 1PQZB 3W3BA 3C60A 5ADOH 3QWRD 2CO6B 4FFYH 4OZHB 3OKDA 2DQFB 5DK0A 3AGVA 2OSWA 4Z7WB 1NCIA 3FN3A 5MEQA 1OZUA 2KHAA 1JVKA 4BK5A 3WHE1 2EO7A 3L08A 1F1DA 2EDLA 4MZRA 4Z7UB 3QDJB 1ACYH 2N1TE 3FOLB 2R2EA 1BXXA 4TQEL 2XX0A 3GHEH 2PR4H 3SHSA 4IRJC 4LLVA 1D7CA 2CRMA 3DGGA 3EJCA 3A23A 3EOBB 4XNUH 3TBYA 3S37L 2J8UF 1IJ9A 4Q6YA 2EKJA 5AZEL 1IQDA 1NJ9B 2YC1B 4D7PA 1YEKL 3MNDA 3WFDL 1GS8A 2A4EA 1EHLH 4HEPA 2XV6B 1TZIA 4KKAC 4JFFB 5BS0A 1WWCA 3IAPA 3SGKC 3V6OC 3POCA 5L8JB 2JQZA 5E6IC 3APMA 1EXUA 2YPLD 1OPOA 4P57B 3T77A 1KOAA 3APDA 3ZO9A 3PHSA 1MI5B 4ZD3L 5IUSA 1G7JA 4L4VD 4XCFL 3UJTL 2ZUUA 1C5CH 4JO1H 2MKWA 1U42A 3V5DB 3MA7B 4IMKA 4X6BB 3O45B 5KSUB 3OHXB 4EEEA 3JWNC 4WO0A 2PTVA 3OKOA 2XJKA 4P46C 4WUUE 4JFQA 2F7OA 1QSFD 1PNDA 3X3FH 3ILPA 3CWGA 3RL2A 4PLNC 1A6VH 2BLFA 1HCYA 4GRMB 3BHBB 3MBXH 4TSCH 3U6RB 5AD0B 2KBGA 2HH0H 3HE6A 5DA0B 2DI7A 2ICES 4GMTH 3EAKA 1JAEA 2JTDA 3L4TA 4K71C 5GS0C 2ESVA 4Y7MA 3N85H 1U6AH 2I60L 2AJSL 4PJAB 1RUKL 4PYGA 1WBYB 4FNQA 2BPBA 4MD5A 5IFHH 2EEBA 4ZMWA 3VO0A 1OIOA 3ZDYB 2HKFL 2HT3C 3PY9A 1EEYB 4A37A 3QXVA 1IZJA 25C8H 2EDTA 3A6BL 4U1SA 5D9SB 2Z35A 1BX2B 3GIVB 1A14H 4QY8B 1AZVA 4P9ML 2C26A 1YEJL 1A9EB 5E1GA 4XBPB 1JJUA 2WWOA 3BDBA 2D8KA 1KY7A 4HUWA 4B9YA 3V9CA 3DSNB 3O6KL 4YJZL 1E4XH 3TEWA 3UMTA 2XWXA 2WO4A 3M1BB 3S34H 1DQQB 2Z93A 5GS1B 3MOQA 1FFTB 1MI5D 4GJTB 4OZFB 1M6OB 4XH2A 3RX5A 1F90H 3WEAA 4LHJB 3DVNA 1QKZH 4JFHD 2WWKO 4FQHA 2XTJC 2BNRE 1JERA 2NZ9C 1JZ5A 3JZYA 1NAMH 5GJTL 3UC0L 4G9FE 4MWFB 4JRXE 5AVRB 2NY5C 4DT2A 1QSFB 2WTRB 1XR8B 3GXTA 3CVHB 4PGDA 3D25B 4NS0A 5DD1H 5E2WH 4AV4A 2I9TA 1D3CA 5DRXA 4WO4B 1EBPA 2AW2A 3QHZH 1N9PA 2XHNA 5ADOL 2ZUYA 4JZOA 5E6ID 3NFSL 3MYZA 5IB5B 1R5IB 2WYIA 4FHBD 4JKKA 1XF2A 4FHJA 5KTEH 3LDBC 1B4RA 4ZK8A 1KXVA 3LH2H 4UTBA 3TYGH 4G43A 2ZXWB 2A3TA 3KJ6H 3C6SA 3OKNB 2QVKA 1TCMA 4NO3A 3CC1A 3P30L 2XWEA 2OSYA 3BT2L 2HJLB 2LHAA 1X5FA 5CMAA 1LNUB 1XIWA 2C3WA 3HC3L 4FFTA 2Q7YA 1HOCB 3BDYH 4P48A 5E1QA 5EO1B 1WIPA 3NFNA 5BNXD 7FABH 5CCKH 1JE6A 3WFCL 5J11B 2Q20A 1BVNP 1XF4A 1NFAA 5F7BA 4OJYA 5F3BA 4P4KB 5L7XL 2FJGB 3WTWA 3B9EA 2E9WA 1BEYH 1P7QA 2L7JA 3BAJA 4BUHA 1RZGB 5K39B 2PYFB 3EHBD 4AQEA 4L8BA 3UCQA 4KZDL 5KYYB 4AL8L 1NSNL 3GYRA 3IKCB 3WFHB 4Y2DB 4ZPVA 3EBGA 1X4ZA 5IK3B 3TT1L 1KENH 4PVMA 3UTSD 3W0WE 3EDDA 5I1IL 3D51A 2XY2A 2WLZA 4YQXL 1GAFL 5MP6L 1YNTB 1P84J 4CBPA 3GSQA 1D5MA 4XWGL 3ULVD 2BZCA 5F7LB 3LS5L 3RWFB 1KJ3L 3CZNA 4F7TA 2X1QA 3DSFL 4G83A 2NXYC 4B97A 4UOQA 1BFOA 1FG2A 2GITA 5D7JB 2ZF9A 1NC4A 2NLJB 3KYNB 1OGSA 3M88A 3WJLC 1U91B 4X0KB 4QRQB 4K0OA 1MFNA 3BDXA 5D1XA 5AW7B 2QTVA 3CPLB 1SDDB 4LDOB 4NBYB 1P84K 2E86A 2DQGH 5K1VA 5ISZE 3IDGB 2IV9A 4Y9EA 3NT0A 4YHLH 3H3PL 2NSQA 4ZMLA 3SPGA 4YIQA 2EDOA 2PABA 5F71A 3WS3B 3ZRCC 1P4LA 2YKKA 3OKEA 4PGBB 4MXWH 3GSOB 3EYSL 5KVEE 3UTPD 4RWYL 1EERB 2CH8A 3MRQB 4EZKA 3UEZA 1VFOA 2NY4B 5JA9A 4Z7QE 1J8HB 2KH2B 3HI1A 3QJSB 4WU5B 1N5AB 1Y1DA 2YRBA 1S9WA 4XPTL 3TWCL 5HYSB 4R5XA 1NGWB 3DMMB 5CEXA 5F7YC 5BRPA 2YFOA 5TE6L 5E6IB 4UINL 2XG4A 1D7BA 4RSYA 1ZVSB 4DGIH 4YFLF 4N5ED 2WXQA 3IMWA 4RFEB 4RIRA 3VXTA 3FUJA 4G70B 5CIPA 5C0EB 3E6FA 3KCPB 3OGCB 4JFZL 4GIAA 5CD3A 4PLKC 1GYWA 3ZW3A 2D7NA 1A7RH 3MNWB 4HS3B 4KY1L 4EZLA 4OZIB 3QPQC 4XMPL 2BP3A 1S78C 5DYOA 5HI4D 4DTGH 4AEEA 3LMJH 5G5DA 3VQ1C 1OM9A 2WNXA 4KI5F 3HZKB 2DS4A 5BRZE 2EDRA 3OPZL 4Q4IA 4D8PB 3VD1A 4N2MA 1A9EA 2H2SC 2EVFA 2YGPA 3N40P 4ZTEA 2VISB 1ZSDB 4XO8A 3LCYA 2IOOA 4HCRA 3SE8L 4YBLB 1AHMA 2RBLA 4ZT1A 2X53A 4RAVB 2EXYD 4OY9A 4WDIB 3NFSH 3LS4L 2CM6A 5FS5A 2HFGL 2XTJD 5EF1A 3ZE2E 2EC9U 1L0YA 3GZQA 3NOIA 4R83A 5I5RA 1CUOA 1U8NB 1L3NA 1X5MA 1SJEA 5CUSL 3LKQB 2LQRA 1TJIL 1FNLA 1M7DB 3N91A 4P2RD 4AOFA 2VN5A 3VD3A 4X0NA 1EAQA 3ESVF 3RA7H 1QBLH 2GKIA 4J4PD 2ADIA 2VKWA 5E5MB 5F7FA 5F9WB 1OGTB 3WAJA 1IE5A 1KN2H 4EZJA 3OJDA 4ZI8A 1BZ7B 1NAKL 3HKZA 4LNVA 1NKOA 1FZOB 2RJMA 4OFQA 5TPWL 1RAMA 3QWOB 5AKVA 1AGDA 1UZ6F 1XV8A 2AVGA 2EE6A 2LAAA 4E36A 1NGXA 1CDCA 1J9SA 4HUKB 1DO5A 1DYZA 2FNBA 2IQ9H 3QG6B 4QTHA 1GC1C 4YPGB 3TZVC 4EUPA 2JLLA 1ZLSH 2ZPKL 1BMGA 4FQXC 1D5IL 2WQWA 2X4SB 4NJ9L 5FYKU 3HCVB 3V5KA 2IXQA 1MDTA 1XD1A 4PD4J 1I1CA 4BYHA 2EDBA 3UYPA 3AY4A 3DDFA 4KUCF 4DAGL 4CAGA 2YBRA 4Y8DC 1NOFA 3V0WH 4G7SB 1R19A 3TV3L 4Y1TA 1D9KD 2FQDA 4X4YA 2P5WE 2MOVA 3Q3GA 1QX1A 3G5YA 1PZ5B 4OH2A 3P9MB 1OT2A 3L13A 2ORBL 4ONHB 3SBRA 3BIKA 2JF1A 3MU3A 3QCTH 3SKNA 1RPQA 4MNQA 4I18A 1MFDL 4OIIL 3FQUA 3L3DB 1G87A 4P4KA 3PWLA 3AUWB 1PSKH 2D0FA 4B7LA 2OL3H 3DTUB 4R7VA 4ODTL 1ZGLM 5FCUL 5A16B 3HC4L 2YPLE 3HUJF 4MS6A 5I17A 3JV0A 4MCZB 4K8RD 4TUJB 3CQFA 1PL3A 1BFOB 1FG2B 4C4UA 3A67L 4PRIE 2GJ6A 1JP5A 1NAML 3SGKA 3V6OA 3WFDH 5C9KA 2VNCA 3SDAB 1H3TA 5D1ZI 2QHLA 4K7PH 2VDKB 2FJHA 3QYMA 1F11A 2G60H 3U1QA 2D0GA 3VXQB 4B3EA 2COVD 5IQMA 4HV8B 5EOTB 4QPEA 2J55A 1DBBL 1OSZA 1R3JB 1RJYB 3P77A 5FPIA 1G7LA 4J4PC 5IROD 4J3VA 2ZG3A 3EBHA 5HY9A 2MCMA 5KTEL 4ZW5A 5IG7B 5JHMA 4BQBA 1E42A 1I3RA 1QHQA 3CE1A 5IMMA 1ACYL 3MC0A 5T1MB 1DP0A 3KJ6L 4QRTB 5J12C 5KZCD 2AK4D 2CKBH 4LSUL 4XBPA 1J8HA 3HI1B 3MBEA 2FH8A 2NXYB 3NABL 1A1NA 4ABUA 2VDOB 4S1DC 2FCBA 1FL6A 2W9EH 4JUSA 4A2EA 1T7VA 3GSUA 4YNYA 4JEGB 4LK4A 1I8KB 4WUUD 1N8ZB 3PWVB 4HLZG 2D7PA 1ETB1 1LE9A 4FQHB 4HW6A 3WSQH 1PNCA 4QHPA 2V3FA 5GZND 1F4WL 1IGYB 1O7DE 1PZSA 3AMLA 1AANA 1NIBA 2ITCA 4O00A 5K1NA 5KAQG 3KYKL 3BGAA 2YRZA 4JRLA 1E4KC 2VQTA 1EEZA 2DQDL 2Y06H 5EIIG 3CV5A 1W80A 3SDAD 3VGAC 5B1BB 1C5CL 1IKFL 5I82A 1INDL 3GRWL 3KCPA 4PJEF 1CFSA 4QOKA 3TVMA 5KVGE 2YUZA 1BD2E 2ARJA 1SHSA 3MGOA 1QSFA 4U33A 3GXDA 5E2VH 4F8QA 4HU8A 4LB8A 1P69B 5C9JB 1KNOB 3QYCA 1EZLA 4G9DB 3FQ4A 4PCTA 2V0AA 2A9AA 3RL2B 4A2FA 1R5IA 1AGCA 2QQKL 4NB7A 5D4QA 2WCPA 4ORZC 1R0AH 2A7BA 1LNUA 4YN3A 2VQ4A 1KJ2A 4AMKH 4YAQA 4ZUSA 5IMKB 1M9WA 5EU4B 3NFNB 4OTXL 4A67A 1HL8A 1P4IH 1MCJA 3AWFA 4KV5F 1XR9B 5IEHB 2ERJC 2APFA 2O61B 1HZLA 1SDAB 4OGZA 4C56E 5I6XB 4NWTH 2A4CA 3K2KA 4NJAL 1I8IB 2FATL 4XXWC 4PUBL 5D72L 4NNXB 5F44A 3VXSD 2IPTL 3ZHLA 2Q7YB 5HDBE 4GKZA 1A7QL 4HK3N 4D0CA 2B7DT 5J1SC 4P2OB 1M2VA 1ZWIA 2J1YA 3V4PH 1JYWA 4GI9A 1YEJH 4Y7OC 3VFTB 3ZN6A 2R7EA 3KYAA 2WNKA 4E0RB 4MJ5B 5FX3A 3V0GA 1S6NA 3U83A 4GBXC 3HZYB 4G1MB 5DWPA 5ISZB 1JTOA 43C9A 2GUYA 1SLVA 4NX0A 4AQEB 3CXFA 4HGKC 3O6FB 2MHAB 1TU2A 3MTRA 3SQBB 3ZTCC 1QLRA 4DN3L 3GK8L 5GGSB 5C92A 3SZ6A 3GGWB 1YUKB 1SLUA 2B77A 4TUOA 1CB4A 1U8JA 4NDMA 3DXAB 5T1KA 2KZ1B 5AG8A 3Q1EA 2ED8A 4DO6A 4KJQD 2AJVH 4GNKB 1XR8A 1RP8A 4OGAD 1IBHA 1E4JA 2Y4SA 1V27A 2XVLA 3HHRB 3Q6GL 3H9SB 2V9QA 5KN5B 1WIUA 2X89D 2DF3A 5LGHL 3TBWA 3T3PE 3T4YA 4RDQF 4AYFA 4POYA 1UJ3A 2YRLA 3DJRA 1ETZA 3PDOA 2BIQA 4GAYA 4I0PB 3MRIA 3OB8A 4KGJA 3KLHD 3QPXH 2H9GB 1QAWA 4JO5A 3HNSH 3OHXC 2N3JA 5DQJB 3GPSA 4DUXA 4GXUN 3NJLA 4JY4B 1ZHKB 4F2ME 2AABL 2CR6A 1YRKA 1JPGA 5G2NA 1NFKA 2NNXA 1IAII 3CFQA 5DS1A 1ZA6B 3HG1B 3DPDA 2F6AA 2LLNA 5SX5K 2GJ6B 2OJ1A 4AI7A 1L5GB 2JB6B 4QRUA 3IETB 4HETA 1I4FB 1QBLL 4PN6A 3UO8B 1QTSA 4LEEA 4X99B 5MI0C 2OMUA 4LLQB 1ZDQA 1U8PA 4PCYA 5KVEL 4RH4A 3PNWA 5KSBF 3QYNA 1AGFA 5TD4A 2XCMC 3BWSA 4DUWA 4QHUA 3ULUH 3BZEB 4JFYB 1S5HB 2J6WA 2OSLA 1WICA 2D31B 5EBWB 1F11B 3HUJA 4H13C 3LZPA 3O2DA 4N20A 1XD0A 1J88A 5KVDE 4FQPA 1VFUA 2DQDH 4YK4B 5IB4B 3QR0A 2R69A 1CC3A 5KSVB 1UYWL 2NY3C 1F8TL 1NM9A 5D7KE 3FSVA 3N5AA 4GSUA 1UA6H 4HSQA 2QSCL 5GHWL 3V4VH 3NCMA 4I3GA 4ABWA 3PJSA 4IOIB 3C2SA 4S1QH 4XAKE 2A5UA 1IO4C 1PVHA 3PL6A 1V3KA 4TRPH 3TV3H 1NQBA 3GZOA 1RZFH 4MA1B 2DDQH 1A3RL 1JWSA 2W1NA 1QSEB 1A3ZA 3DOIA 4J3OF 1L4IA 2DLEA 5TDOA 3ARSA 4FQQA 2XQBL 4M56A 4MX7A 4KK9C 5I18L 2FJUB 1E3FA 4NQEA 3NDZE 1E65A 4OJDH 5E4EC 3TXAA 5B4MC 1K6QL 4YE4L 3FKUS 4XN9A 1BIHA 1U58A 2I7OA 4HZLA 4X83A 4AYBA 2BHFA 2WKOA 3IRCA 4TS6A 2OV0A 2I7SA 4ZOBA 1CGSH 1G6RA 1EHLL 5IW6A 2CJTA 5E23A 3TN0C 2PWHA 1FORL 3CSYA 1FA4A 3C2AH 4YHYB 3L2NA 3GBNL 4BINA 3V5KB 4KKZA 4Y9CA 4NYLA 2KPWA 4KJPC 3P54A 3LQAL 1UC6A 1MCSA 2PPAA 4IBTA 2YSTA 1A3LH 4TVUA 2HLFD 2YSSB 5DJ8B 3ARBB 4G9DA 5JW5A 5SWZD 3K4AA 5DMGC 1LK2A 1E9OB 2B5IC 2CK0H 1A1OB 4NEHB 4B9JA 5JIDA 5DJ0B 4Z76B 4XE5B 1N10A 1Q1PA 3CSBA 2D73A 5A1AA 1N64H 2ZQKA 1TQSA 1PY4A 3NIFE 4J27A 4NLAA 4PJ9C 4XXDB 4ZG1A 3U25A 2R1WA 5AAWC 1F6AA 3ZYIA 1EMTH 4AQ8A 1T04B 1PG7X 5D93B 2AJVL 5FYJD 1JBJA 4JFVA 3NG5A 4KO6A 1DE4A 2E4TA 1ZA3A 4AGQA 2D7TH 2XWJA 1P7BA 2R7EB 3QXTA 3OZ9L 5CN3A 3KMDA 1DVZA 3M17B 4M5ZL 3IFPB 4ICWA 4WNQA 1DBKH 1J9CT 1RCYA 4BV1A 2B1HH 4HFUL 2JK5A 5DR5L 4WI6A 4JLRB 5KVGH 4RISL 2CO7B 4YGVA 2A77L 3BKML 1MCDA 5MEPA 3FCTB 1H3PL 1ZE3H 4GP8B 1KB5L 3GB7B 4W4OC 2FEEL 2VDML 3NIGF 1CFTB 3UACA 1JZFA 4KNUA 3IMBA 4OCYL 1E28A 5CGYC 3WKML 3P73A 1Q0EA 3MUJA 3OM3B 3I85A 1XZ0A 1EZSA 1D9KA 3SQBA 2WZ5A 3OLDA 3VXOA 5F7UA 3QG7L 4ODBD 3HHMA 5IEKA 2G0KA 3IJSB 5D7LD 4U1JA 4NNPL 4QRRB 3CFCH 1YYMH 2NUTA 2V5SA 3HC4H 4GRWH 5DZ9A 3S6CA 2IAMC 3BIAX 3K5SA 3QUML 1WF5A 5JUEL 1HSAA 3J27A 2F58H 1SVCP 4I2XA 3ZDXB 4CL7A 2V2XA 4PJDE 5IW3A 5D5MB 3O41B 2EZ0C 4Y19B 5EH1A 4PY7A 5BRZA 2H4EA 3W0WA 1RI8A 2R9HD 3GXMA 4X6DF 2EQDA 1ACXA 4OB5H 2E74C 5K9OA 2NY1C 5C6TL 3VG9C 7PAZA 4M7KL 4I85A 4ODUB 4ZTPH 3SDYH 3DETC 5IGXL 4HMEA 1YPZA 4ALAH 3NZ8A 1PZ5A 5IZ7A 5D7HA 3ZL4H 1PTZA 5F88A 1BYOA 3LY6A 4DCQB 1N5YH 2CKBA 1JF5A 2BWQA 1W72L 2H26A 4ZZKA 1ZT7B 4FADA 3IDJA 2UZXA 1HKLL 2CXKA 1OCRB 2GI0A 2Q3ZA 4TNEA 4TULL 4AUYA 2PCYA 2ARJB 3DI3B 3EKCA 3CMOH 4N8CL 4XBGA 4ZO7A 3AG2B 5DQDL 1PG7H 3GTNA 3V9EA 2Z6FA 4DN3H 2X28A 3DX9B 4QYOA 3WNKA 3L2LA 4XZ4A 5C7XH 5LVEA 3VXMB 2J2ZA 2Q6WB 3WN5A 2VT0A 3S36L 4ECNA 3K0YA 3EJUA 3VWKC 3FAWA 2A6DB 3MOBL 2X7LB 4JM0A 4LLWB 4Y8AA 3ARDA 4M7LT 1TITA 3OMIB 4S1SL 2Z31C 1YN6B 4AIEA 1CL7H 4OF7A 1UUSA 2B1AH 3RZWA 1AO7A 3IDYC 1HT6A 4ZO6A 1NFDA 4FNTA 2YIHA 4ZUVB 5EEUA 12E8H 4PJ7E 3BMVA 6PAZA 2E6PA 3X1BA 5GRXG 4GG6B 3FO9A 3CSFA 4O02B 5DUMH 2UZIH 4QRTA 2H1PL 1ZPLA 3I75B 4NHCL 4FD0A 3TM6A 2OTUA 2PCPB 4N2GA 3MBEB 2ZWZA 1RUAH 1DBJL 1DFXA 3BLBA 4XOBA 1ZGLP 4N90D 5H94A 4PPTA 1VADA 1MFMA 2VDQL 3EOTL 4N9GA 4NZRH 1KDJA 4Z77A 4P5MB 2R2HB 4D3CL 2IH3A 4DN4H 5ICZA 1MN4A 2KZBA 2GYSA 2YS4A 1Z1WA 3MYJA 1NPNA 3RX7A 5GSVB 1M1SA 2FAUA 4NCC1 4KFMA 2QQLL 3F7RA 1HVXA 1X7QA 3LKOB 1NBQA 4Y88A 2PW1A 4NRZA 2AQRA 2OMYA 4DPRA 3Q06A 1HCZA 2VLRE 4GRLC 4LFHD 4F91B 1UXSB 2JQAA 3WD5H 1NMCB 3LV3A 3WO4C 5DGRA 2R1WB 2Y06L 4OJFH 1SJHA 3EO1A 3L2MA 2O5YH 3GS0A 3MNZB 2JJTA 4QUOA 2ENQA 2HVBA 1H6TA 1DQTA 3RNKB 1A1OA 3D39D 4FL4C 3WNOA 2EDNA 3MJ8A 2AEIT 2DYRB 1AQ8A 1RUMH 5AOKA 1WQVT 2FRGP 4XVUC 3D7PA 1UA6L 1ZSHA 2JK5B 2OR7A 1IBBA 2VDRL 3MV9B 4PJIB 1H5BA 4C83B 4I0PC 5AW6B 3AS3A 4H8WL 2GAZB 2C8NA 1ESOA 1GYAA 4EI5A 3JYBA 2APVA 3ILDA 4JRYB 3IAQA 1RUKH 4LKCB 3KR3L 1T1WB 4W81A 4H44C 5DJCA 1YAZA 1NC4B 1BP3B 3N41F 5F3FA 2DEWX 2VH5H 2XXCB 1U36A 4QXVA 2VM3A 5D1XB 5KVMC 2FGWH 2W65A 2Z1PA 2YAOA 1AACA 1TJHH 5I1KH 3RGVD 4KHXH 1U4EA 2H7WA 2O5ZL 4OB5L 3A4DA 5C0ND 2K4AA 1CLYL 4M93C 5HDWA 4FFZL 2QGDA 4YIQB 4NKIL 2ZP8A 3HRZC 5IOPA 3S88L 4G8GE 1KCSH 5TGBA 1L7TH 4NN5C 2AXGB 4YO0B 2JXMB 1MFAL 1NGQH 5DVMA 3D3VD 1NCTA 3L6FA 3QAZC 3ARWA 3QXDA 4X42A 1VRSA 1KY6A 4Z7VE 3DVFA 3VE0B 4M7LH 2OL3B 2BM3A 3T8VA 1X5AA 4J3TA 3V6ZB 1E4WL 1QFWL 1TZGH 4M7JL