1PTZA

Crystal structure of the human cu, zn superoxide dismutase, familial amyotrophic lateral sclerosis (fals) mutant h43r
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLRGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title ALS Mutants of Human Superoxide Dismutase Form Fibrous Aggregates Via Framework Destabilization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ptzA00
3KH4A 3F7LA 1MFMA 1COBA 3CQPA 3GZPA 4FF9A 3GZQA 3CE1A 1QUPA 1CB4A 4BCZA 1IBDA 2NNXA 3H2PA 2JLPA 2ZKXA 3KH3A 1SXAA 3L9EA 1HL5A 5KBMA 1KMGA 1OZUA 2AQTA 1EJ8A 2XJKA 4OJAA 2WYZA 5KBKA 1E9OA 2GBVA 1SRDA 2K4WA 3ECVA 2WZ0A 4BD4A 1YAZA 2AQNA 1XTLA 3LTVA 4A7QA 4A7SA 3L9YA 1YAIA 2Z7WA 4A7GF 2WZ5A 5CU9A 1B4LA 1SXSA 1SOSA 3GQFA 1E9PB 1YSOA 4MCNA 2AF2A 2VR6A 2Q2LA 1CBJA 2LU5A 4A7GA 1N19A 1EQWA 3GTVA 1ESOA 3QQDB 1F1AA 1TO4A 1XTMA 1TO5A 2E46A 1FUNA 1JCVA 1BA9A 3MNDA 2V0AA 1SXBA 3CQQA 1JK9B 1HL4A 2VR7A 1E9QB 1BZOA 3KBFA 2WZ6A 4A7VA 2Z7UA 1PTZA 2Z7YA 2C9UA 1Z9PA 1DSWA 1F18A 1DO5A 2C9SA 5KBLA 3KBEA 1IBFA 1S4IA 3GTTA 2R27A 1PZSA 1AZVA 4A7UA 3HW7A 1N18A 2AEOA 4A7TA 3ECUA 1IBHA 2ZOWA 1RK7A 2AQPA 2WYTA 3KM1A 3KM2A 2XJLA 1IBBA 1F1GA 1IB5A 1SPDA 2WWNA 2SODB 1XSOA 2APSA 2AQQA 1SDAB 3K91A 4BCYA 1Q0EA 4U4IA 2E47A 4B3EA 1U3NA 2VR8A 1OALA 1E9PA 1OZTG 4N3TA 2C9VA 3SODB 1E9OB 2GBUA 3QQDA 1UXLA 2WKOF 1B4TA 1SXZA 3HFFA 1UXMA 2AQSA 2Z7ZA 2ZKYA 3F7KA 4L05A 3S0PA 3RE0A 1JK9A 2AQRA 1SDYA 3T5WA 1Z9NA 2WKOA 2ZKWA 2WWOA 3GZOA 1E9QA 1F1DA 4N3UA 2GBTA 1P1VA 1OAJA 2JCWA 1OEZW 1SXNA 4OH2A 3ECWA 3H2QA 4MCMA 1PU0A 3HOGA 3PU7A 1SXCA 1L3NA 3MKGA
chains in the Genus database with same CATH superfamily
2ICWI 1EDYA 3FSWA 4OFVA 3I3EA 5CEXB 1G7PA 2OCCB 2KERA 3A6BH 3ZRSA 3KW7A 2XWXA 2G5UA 2FJFB 1TQVA 3W9EB 3JYBA 3JTBA 2IPTH 2BVUA 2IQAA 4PJGB 5PCYA 4Y0GA 1CGWA 2FSEA 2VZVA 1OE3A 4K5PA 2BDNL 4G72B 2BFGA 3RUGB 3O4LE 4ZOCA 3D0AA 3ZMEA 3V52H 1AXTH 1N26A 1YAZA 3I6GB 4GKOA 2ICEC 3B1TA 1CE1L 3FC8A 1LGVA 1QHQA 2FE0A 4WEMB 4LHUB 2GITB 3QXAA 4R0LA 2PCPB 3GLAA 3WNLA 3CXFA 1VFUA 4NKIH 3T6QC 3K71A 3BWAB 3IRZA 4POZD 2DAVA 2GFBA 3FYEB 2JKLA 4I0PC 1W72H 5I2IA 1DBBL 1KEMH 5BRZA 3RL2A 4XVJH 2RGSA 1NM4A 2NZ9D 1SLUA 3CDGA 5E2TH 2B9AA 3FQRB 5HGGS 3HR6A 4K3EH 1FNHA 1I7ZB 1JVKA 3CC1A 4IRJA 5JOFB 4PG2A 4ZTOL 1BIHA 3MJ7A 2DQGH 1JPSL 4R8WH 1I8IB 1ZY9A 3U9PL 4ZMPA 2AI0H 4JPWL 4WO4C 2YPVA 3MLVH 5CIPA 1YDPB 4RAUA 2A5UA 1ROCA 5KUKA 1Q9KA 4PW9A 3P4NB 3NSCA 3SCMC 4PCKA 4PS4L 2KH2B 4UBDC 2IAMD 4Y16A 3N1PC 5GZNC 3KJ6L 1CVRA 1AGEB 2FB4H 3VXSD 1IFRA 2Y7QB 3OAZH 3ARBA 4L5FH 4L1SA 2QELA 5AD0B 1TENA 2E8YA 2FO4B 3SKNB 4ZQKA 2FX9L 2MPVA 1WAPA 3NEEA 5DQ9B 4ZFOL 4ELME 2VIRA 3U36B 2ZX6A 5I18L 4G9FB 3OXSB 5D72H 5BV7C 1KBGL 4JRYD 3JTTA 4PJEA 4QT5B 4TL4A 3ABMB 1NJ9B 3WY4A 4G5ZH 5D7LE 4A6YH 4K9EC 4FQLH 3GPEA 1AQMA 5LDSA 3RIAF 4PY8I 4FQXA 1TSHA 3K46A 4WK2B 2X4QB 5KZCD 2Q10A 4HHGA 1X5AA 1PU0A 4JK0D 3HC4L 4U1KA 1SVCP 4NUGH 2C9RA 3R1GL 3KCWA 3F2LA 1V7NL 4KI5E 4RMBA 1Z0MA 4HPOH 1OP5K 3EYSH 1I3RA 4GI6A 4NN5B 5T5FA 2ZUVA 1T1XB 5B7MA 4TV3A 1J05A 5EU6A 4YSSA 3C87A 4CGUB 4ETQB 5GSRB 2ZJSH 1VFBA 4P46D 4YWGL 3INUH 2XUWA 1KIUB 3RGBA 1BLIA 5KBMA 4BA8A 1T1ZA 4XPAL 3V4VB 3CIAA 4NWUL 1ZPUA 3JV4B 2EECA 1F8TH 4U6YA 2YSSA 3HC0B 4XHQA 3GEWB 3ES6A 4OZHA 4AEEA 1NICA 5K9QI 3AS3A 1TQSA 3B7RL 3TO4D 1W16A 4TOYL 5GRWA 4ZMNA 2IFGA 2QADC 5DHMC 1YVLA 1AS8A 1QLFB 4MGXA 1SOSA 2XWEA 3MTXA 3O3AA 3BIAX 2BVPA 4GW5A 3DGDA 3EOAB 1XIWB 3BIKB 4AMKH 1QI4A 2P45B 2R29A 4ZMOA 5D93C 2FNBA 4QRUA 2LLNA 4W9IC 2R0LH 4GUPB 2R15A 2WXIA 3QUXD 1NL0L 5IG7B 2V0AA 1HYRC 2XICA 5ESVB 4XVUC 4H1LA 3MLUH 4WI4A 4MDJA 3GWJA 4OLYL 2X38A 2FQFA 2F1EA 3FT1A 3HN5A 1GA2A 1WFJA 5D2NC 3KLKA 5HYSG 3AMLA 3DVNA 3TXAA 1PYWA 4AG4H 3HIZA 5DSCB 2JMRA 4WFHD 4Y5YB 1QZNA 2DN7A 3L95B 5I1HH 3AREB 2R0KH 5LQBL 1NAKH 5IROD 1NCWH 4FQJH 3QFJE 2F7QA 3EYOB 1ZGLP 3UG4A 1LQBC 4LHUD 3V5HA 4NQCE 4QLWA 4KZDL 4RSVA 4ZFFB 5A3IC 2P80D 1FO0H 4XHJC 3VFMB 5C2BL 4OFPA 2NY5L 1AQHA 1GOHA 1Y6KR 4Z7NE 3IMWA 4IKLA 3BGFB 4KXDA 1A6ZA 4JQIA 5K9OB 3HFFA 4I77L 3LZNA 2Y7NA 5IREA 1BIIB 1Z32X 1SBSH 1D6VH 1Z5LA 3UAJD 4ZAKB 2VR4A 4AEIL 5I1JH 4N3UA 3OGOE 2GT9A 2XU9A 1DLHA 4MB3A 2EDDA 5C0JA 2UX7A 2CIIB 3BXNA 1GKEA 5C09B 4PG9B 5GGVH 4P2QB 2KQNA 3B9VA 1IZJA 4XP9L 3MBEC 4FQ1L 1K2DB 2ED7A 4JFQB 5HHPA 3IAPA 1KXTA 4OIFA 5C0RH 3ZGHA 5D7LD 4CVWA 3C75A 1I7UB 5DCCA 1A1OB 3M46A 1Q0YH 4GFXA 5BXFB 2KL6A 2O6PA 1UJ3C 4WUKL 5KSAA 4KJPD 2ZKXA 1L7TL 3PWPA 4U6HA 5CR1A 1J8HB 4MAYA 3NSXA 5E8OA 4E9XA 1KZQA 3E7JA 1YEIH 3QEQE 4KI5D 4UTAA 4MNQA 4XC1L 4X8XA 5D71H 3FQ2A 4G9FD 3FCTB 2OK0L 3SE4A 2D7OA 5TK4A 4BELD 4PW3A 3MREA 1YO4A 1B90A 1A9BB 3J27A 1F6AA 1H15B 1U8PA 1YEWA 2A6JB 3TT1H 4AQEA 3RTQB 2YXVA 4X5LA 2GW5A 1TTAA 4DCQA 1R9FA 2XKUA 1GVIA 2H9GB 3QR1A 3OLEA 1AS7A 3CQQA 3ZRFC 2WXFA 3ARDA 4X42A 4FFYH 5JZ7C 2GY5A 1L9PA 4S1RH 1OAXL 1F4AA 2NDFA 5FO7A 4O5LL 3TCLA 1J1XH 1Y18A 4RFOL 1OAZL 2NY1C 1E5YA 3A22A 4AE0A 2UWEA 2ZOTA 3GIVB 1DR9A 3B56A 1NOLA 4KMLB 2ZUQB 2CNYA 2MQ0A 4YHLL 1SDDA 2LQRA 3D69B 2Q5BA 1G6RH 5KBNC 4P3DB 3K6IA 3WXWH 4PJHA 4ILDA 4FNSA 5I28A 2HLEB 2AABL 1PDKA 4A68A 1RZPA 5I6XB 1GS7A 4IU3A 4NDMB 4X6DA 3BDYL 1M1XA 3FU3A 1XIWD 4XNUL 1ZLVK 1NANI 5F96L 1TG8A 4P99A 2VUKA 3KPRB 4AW7A 1ZT1B 3RWIB 3ECBB 4UM9D 3CPLB 3QWRA 2Z1KA 3CDZA 2NY5C 1RUKL 1KJ2A 3BWUC 1OTSD 4OZFA 3LHAA 4KI1A 3PIQB 4IGBB 2JB6B 5MP6H 3SD2A 1A8ZA 2X6BA 4D2NA 3EUDA 4ZO9A 3ZKQD 5HI5D 1FNEA 2OQJA 4ZOBA 3VWKC 2I9LB 4G7QB 1PJ9A 3G6DH 1LO2H 2JWYA 3T3MF 3DO3A 3PDOA 4U3SB 4KNSA 1KENH 5AOJA 4R2GB 3CK0L 1A6UL 3UYRL 2ETWA 2M2DA 1MEXL 4JFTA 5F7NC 2DZEA 3ARED 4PGDB 4C4KO 1U9KA 3G5XA 4XO9A 1KCWA 3DC0A 2BOLA 2IOOA 1NGPL 2B5IC 2JKIS 5I74C 3DMMC 3OR6A 1KXVC 3ELAT 4RQQA 1NDGA 4GRLB 2F8VA 3FRPA 3VW3L 4G71B 2F8OA 1MN4A 3HHMA 5DEGA 1BBJA 1MLBA 5JORB 1P4BL 1OAKH 2AXJA 3MLYH 3WTTA 1CLZL 3H9YA 4OM0H 1CDCA 1U8NB 2X87A 3QUKA 1P9MA 4ZS6D 1EZVY 1BM3H 2X10A 3ZR5A 3BVXA 1RK1B 3GS4A 2O6EA 2RCSL 1CI3M 4M5YL 5D7SL 4GBXC 4DP1X 4WENB 4ZAKD 3FQNB 5EBWB 5DMKB 1KLUA 1BWWA 2ZP8A 3B2DC 2ADFH 4QLRA 4KTDH 4ACTA 2JNZA 5EN2B 1XF4B 5C09D 2F7PA 4P2QD 3L4YA 5FYJE 3QEQD 4APXB 1J87A 2VXTH 4WWID 3FCGA 1TNMA 4OCRL 2V9RA 3O41A 1GJWA 3BN9D 4N2OA 2VC2L 4CC0A 4PV8B 4DKFH 1AQDA 1P5UB 4EXKA 1G4RA 3LNHA 5F7DB 5AZUA 5I0DA 2OZNA 4WI9A 1U8OB 2FLBT 2C8NA 3BSZL 3ZUCA 1MAJA 2BIPA 1J8HD 2MPAH 4ZUVB 3VTAA 4Y4HC 2IPKA 1R19A 3ECUA 2NTSP 2YGPA 1BVNP 1KJ3H 4OGAD 5FOBA 2DWDA 4IJ3C 2AXWA 1QFPA 1T6BX 2KS0A 1H9VA 2VXUH 1XMEB 4OIAA 4QXUL 3VFTB 4KK8D 3WJMB 4OF0A 1OSZB 1EHLH 2ZUXA 5CKAA 4Y7OC 4KXZI 5AOKA 5JW3H 1YNLH 3DURA 4R26H 4U2ZA 2VMCA 1GIGL 4UU9B 4YHKL 3LRLA 4AQ1A 3K6FA 4MB1A 1DFBH 5DUMH 4Z7OE 4ZNEE 1X4XA 3MBWA 5I16A 2Y24A 4XMKH 3IKKA 4NNXA 2G5BB 2YAFA 1AJ7H 1CC3A 1UT2A 2NX5B 4KUZL 1X7QA 1FQ9C 3HE6B 3N04A 5IKCB 1XV8A 5TDPB 5I5JA 1V3KA 4UMGA 4M48L 4Y9EA 5D9SB 2EDFA 2UXVA 3FTSA 5GHWH 4BDVA 1PAZA 3GDCA 2Y9RT 5IJVA 1VGKB 4MJIA 2MNWA 3EFOA 3UZEA 4ZMYA 5LXVA 1N10A 1K8IB 1UXWB 5KN5B 4CVUA 4KX7A 3EHBB 3QH3B 1E28A 3MJ6A 3U7WH 2JCCB 1B0GA 5FCUL 4C83B 1XR8B 1KULA 1FYTA 5SX5K 3T4AB 1KYFA 1ZANH 1JTOA 3IDNA 1XD0A 1H0DB 3DX9A 2EE0A 3NIFE 3QXWA 2KLSA 3PP4L 1GOGA 2W88A 4GI9A 3ZXAC 2ERJB 1OF2B 5J56B 1UA7A 4F9LA 2ZKHH 5EBLB 1WFIA 3QNZB 2V3FA 1Y0LB 4KDTA 3CTTA 2DQFA 3SDCC 1JPEA 3ARSA 4DP6X 4WRLA 3ASNB 1R5IA 3CAFA 2L3BA 2X89D 1I4FA 3NA9L 5I24A 2BPBA 3TEUA 1X44A 5F9OL 1T7ZA 1G7HA 2FIKA 4IGBD 4A7QA 5E4IA 2VDOB 3BUIA 1RY7B 5B3JF 2HJLA 4B7LA 4XBMA 3WFCH 3WS6C 2YQGA 2FAUA 4XMVA 1OT4A 2WIIB 1KC5L 1V54B 2WKGA 3CFJB 3BUQA 5AOMA 4ONFL 4MA1C 1ZIBA 4KK8C 5I5RA 4A7GA 3NABL 1UZ6F 4PSRA 2NY3C 3CSPA 4ISVA 4R2GD 2OMXA 4AGQA 4MVBD 3HR5B 3V0EA 3ABLB 1G87A 1N0LB 2Q0ZX 1Q1JL 1IGFH 4AEHL 2B4CL 4J4PC 2Y2TA 3PNWB 5IUSA 2WP3T 2XVBA 3LAFA 4XODA 3W38A 1BFOA 3P0YL 1A6TA 3I50H 1CXEA 4OZHE 3TV3H 4OJFH 3DVGB 2WY3B 4BFGA 5DXWA 5FYJD 3L4UA 1A8JH 3FXIC 3WUZA 2ZAIA 3PHOA 1IJNA 5SWZE 3MRKA 3TV8A 4L0PB 4Q6IB 3CZUB 3Q2CA 1IQDA 3BW9B 1XX9C 3GJFB 5CEZE 3MLWL 4HX1B 3FQTA 5C0CB 2C3HA 5L0QB 4MA7L 4LESA 1IBBA 4PJ8A 4FEMA 1CLCA 3FTGA 3MACL 5CBEB 3WHE1 1Y1UA 1DLFH 1QBLH 1WJ3A 4IEFB 3KPQA 3V5DB 3TBYB 1S7RA 2YPVL 4WTZA 1QEWA 4O2EB 3ZL4H 2O61A 1MCOH 4LOVA 4BGDA 3BPCA 2COQA 4HOXA 2WBJB 3FT2A 4F9PA 3VFUB 4FG0A 2Q86B 5CLYA 3TBSA 4F8PA 1P7KA 2D4FA 3ARZA 1R3HA 2OXHA 1QBMH 1F97A 2H0EA 3D06A 1KIRB 1CK0H 4V1DE 2SEBB 2OMZB 2O5YH 4PI2A 4YMPA 1N0XH 5HYEA 3DXAE 3O0LA 4Y19A 1HYSC 3QZWB 5K1NA 5JA8B 4UTBA 1IC5L 2ITCB 4F2FA 3I6LD 3NFSH 3NP4A 5E2WH 3VD3A 2WC7A 4KJWD 3HG1A 3UH8A 3FONB 4F3FB 2J8UE 4OLZH 3D85A 5D7HA 1K8DA 3M6DA 3DX2A 1CD1B 3QISA 4Q74A 5ID0B 4KK6C 1GSMA 4N2AA 4XOEA 1RPKA 3KNBB 2JB5H 4BE5A 3TBWA 3H8NA 2HP4A 3VXUB 4FNLH 2PTTB 4J1UA 4NP9A 3HFML 4YDZA 4UT9L 5EZIL 5T1LA 3PPSA 5HHNA 1AS6A 5DRXB 1T21B 1JAEA 3BX7C 4D3CH 2WLIB 5B39B 3PWJB 5BCAA 5T5FL 5JYMA 1DVYA 3LKOB 3OJDA 3MRHA 3OAYK 2NX5D 5H4ZA 4MNHB 1BVKA 4XRCA 4BFBD 3HE6D 4AZ8B 3L3HA 3VWJD 1FJ1A 2VLLB 3Q0HA 4WIQA 2H0PA 3ECVA 3UO1L 4R5TA 1BDYA 1HC1A 1FFPA 3VFVA 4JFYB 2R83A 1MF2H 5D96C 4JS7A 1IQWL 1JCKA 2AK4E 4MD5B 5DF0A 4PWJA 1QSZA 2AP2A 3U4BL 2JJTA 4ORGA 1FC1A 1KOAA 2Y5QA 1C7TA 1MZZA 3BUPA 1D7FA 3EHBD 1BXUA 3HNVL 4L48A 3VFPA 4D8OA 4EBQL 4JKWA 4LQ1A 3T6ZA 3OBAA 2AAAA 3RVTD 5BV7H 2DMCA 1UA6L 4K9EH 2R29L 4UIKH 3GJFK 1QYGL 3VI3E 2CUMA 1LNUA 4HGWA 3MV8A 4L8CB 2Z6FA 3GLZA 3ZTDC 3G5YB 2RA1A 4PIRF 4NO0A 4JN1L 1AQKL 3RVWD 1FVDA 4F2MB 4QXGH 1FLRH 2V5SA 2EC8A 4G8EA 5INDB 5BUAA 1KIQA 2ZNWA 1WFNA 4JDVA 4XX5A 4H2CA 4LOUD 5CFAA 4M00A 3W57A 1H8SA 3MUUA 4OJCA 4OCNC 4J2QA 3HMXA 5IVNA 3B43A 4HAKA 4IRJC 1CE6A 4PG2C 5INCA 1WBXB 4YR6B 1YEFL 4HWNA 5SWZD 4HPYL 2WTOA 2Y2WA 1XCTB 2BNQA 1NUFA 2FO8A 5CEZD 4P4KC 2OJEA 2LU4A 4DP4X 3BVDB 4Q9QL 4HH9B 2BDNH 4S2SA 4Y9CA 4EQ3A 4LPVA 3CH1B 3TN0B 3IE4A 5EB9A 3ARBC 3BDXA 2ED8A 1CE1H 3AUVA 5KOMC 5AW4B 1IU1A 1XVSA 1PLAA 3HZ3A 2MOVA 5IQLA 1EHXA 2ZAHA 1IGYA 3S5LG 4LCIL 1B9ZA 5DHEA 4X99B 4BSVA 3QIWB 3L2MA 4N87A 2W07A 3FSAA 1EJOH 2OW6A 4LP4A 5D4HA 4V1DD 3BC9A 1KYUA 2APBA 2FEEL 3LEYH 4G7SB 3CFTA 1P4IH 5BZXA 2YUWA 3DXAD 3T1FB 1DBBH 1MUJB 1PCSA 4FQXC 1TJMA 1CB4A 5ESAB 2EJ1A 2BWIA 1Z3RA 2NUPB 5I9QB 3EDKA 2IWGA 1QMUA 4G1EB 5FUOL 3HRPA 1JPSH 5FIEA 3WAKA 1YN7A 3U9PH 1KJMB 4JPWH 4ZSOA 3SOTA 1XH3A 3GS7A 1WUNT 3VXNB 4WFED 4WI2A 4PS4H 4MXWL 1S7XB 3KJ6H 5BVJB 1NTDA 1ZHLB 1M2VA 3DROB 3W9DA 2XWTA 1KB5H 1XAKA 1ZT7A 4YHML 4MJJA 5FK9A 1M7UA 2CPCA 3IVKB 3DJRA 2P24A 5C0AE 1NCAL 1BPVA 3BVVA 3CIQA 1ODAA 4LEXL 3CD4A 4DEWA 4LPTA 3NIDF 4P8QA 4XBGA 5FF6A 3MRCA 1E8XA 5F7FA 1KG0A 1U8MB 4HKXB 1KBGH 4TQHA 5DQDL 3DX3A 1QSVA 4Y9BA 2C9XA 3ZDZF 3PP3H 4NI3A 4UOW1 5EWIL 1DVXA 4YHOL 1U2CA 2DLIA 2B14A 2CM6A 3T8XA 4AQ8A 4ZYKB 4YDJA 4U3XA 5IFAL 2EIZA 4MD4A 5GSVA 3HC4H 3HCVA 3KM2A 4FXLA 2CO4A 2JKSA 3ALWA 1QEXA 3QORC 3R1GH 4RGOL 3SGDI 1V7NH 3Q44A 3UZVB 5JW4N 3R0NA 3SKJL 2QR0A 3WEOA 2QQNH 1NC2D 3T0DA 1HK6A 1CDBA 2EIJB 4C8XA 3B9AA 4HAFA 4U2YA 3BP4A 1FPTH 2IDQA 5LNEA 5CGYC 4YWGH 2BH0A 4NNYA 3JVGA 4PJIA 4NB7A 4WVRA 3ARVA 3R7RA 5DLML 1W9XA 2CJSA 3IFNH 1DN0B 1SM3L 4ZFQA 4XPAH 3QUHA 5FCSH 4KKPA 2F74B 4NWUH 1TFHA 3NN8B 5DZPA 5EG6C 3F6LA 3WV0A 1KCLA 1N5AA 1CGUA 4TOYH 4R4NC 2OMBA 5HY9A 2CR3A 5IOPB 2HVJB 2X53A 3JQOB 4Z7QE 4Z77A 3RU8L 2YAQA 5FAAA 3N9GL 4NYLB 3JYCA 1D5ZB 2P7TB 3SOBH 2YAMA 3MKGA 1HOCA 1PGRB 1WH0A 1LO3L 4FXGA 5AALA 4X4ME 3MOQA 1FFNB 2C4FU 4ODWA 4G8GB 3TJEH 2BNRE 1T7WA 3I75A 4JO8A 4OLYH 4H8QA 2PPAA 5DJAB 3LKQA 4HUNB 4RISL 3QQNA 1AO7B 2P47B 5A7BA 1I8UA 2GBVA 4BHUI 5JIMA 1YY9C 1DFXA 5GGVY 1H8OA 4G80A 1FH5L 3TN0D 3CX5K 3JV6A 2D7MA 5F7LB 1HEZA 4K7FB 3WFZA 1YMHB 1AD0B 5IVXA 1XZ0A 4FP8L 3RNQA 4B95C 1CFQA 4L1TA 2OAAA 3BH8B 4FFWD 2GHWB 3DJ9A 3QRGL 4MAYC 4KZDH 3TU6A 1ZHNB 3OQRA 4FULA 4HIIB 5KVFE 3EZJB 3ZBMA 3QDMA 3CDCA 3BVUA 3QIWD 4RMUA 1KPVB 5E8NB 3RGVA 2NY5H 3ZVVA 2NY0B 3ZKXB 4BFEA 5C2BH 1CF8L 1L6XA 3IU3A 1M05A 4IDJL 4PB9L 5E5MA 5F89A 4I77H 5EO9B 3QI9B 1FBIL 4A7VA 4TPRL 1S7WB 1WAAA 3VGHA 4EUPH 4ODSL 4AEIH 2FJFA 5F71A 5I8CB 2FBRA 3W9EA 1KWGA 1JXGA 4M1CC 1H6TA 2ADGB 2CQVA 2FNWA 5DC0A 2MEJB 4FCAA 4QHPA 4PJFB 5C0AD 4PJGA 1ADWA 3D1MC 4O02B 5GRUL 4G6KL 2Q3ZA 5JIHA 5F7BA 4U31A 4D0BB 4XP9H 3ZE2F 4N26A 1BG9A 4FQ1H 1QHPA 1PG7X 3C2SA 4RFNB 3RUGA 4YDIH 1AGBA 3NZ8B 1TNNA 2APSA 2VNCA 3HBZA 3KYMB 4QO1B 5AZ2L 5CCKL 3I6GA 2HJFA 4FQPA 3REWB 3SPVA 2XT1B 3HPJB 3IJ8A 4H1LG 1I8LA 4P59L 5F3BA 2GITA 4WUKH 4PCYA 1J9SA 1UENA 5JIPA 4BKTC 4JNXA 2PCPA 2P80A 1L7TH 4PJFE 3H1ZA 4F7EB 1FCGA 3CFMA 4KK9C 5FM5M 4EPSA 5BMFL 3FHAA 3WS3B 4X9YA 4YLBA 1X9RA 2OK0H 3UBGA 5C6TL 5J6GB 1FNGA 3ZSSA 3OD3A 3T0EA 4RBPH 2VW7A 1T20B 3ARGB 3O2WL 4JFSA 2N01B 3BSHA 3SPCA 1I7ZA 5JOFA 3VRLF 3QXVA 2PN5A 2OSXA 3F64A 1ADQA 4QIRA 1I8IA 2GB2A 3QUGA 2C26A 4BXSV 1GZQB 2CIKB 3CU7A 3QWOB 3IRCA 4F5CE 5GZOA 1YDPA 1EAOA 2WLLB 4QRRE 5E8DL 5DHYA 5EORL 1HXYB 1OAXH 2VLJE 4O5LH 4PUBL 4DF9A 4RFOH 2VITB 1OAZH 1AGEA 1T6WA 5L4JA 1EXHA 2NCEA 2Y7QA 3NJJA 1H3PL 3N91A 1L9NA 3FDWA 2I07A 4IBTA 4YHLH 2P5WB 1PJWA 2HB0A 1QKZL 3SKNA 5DQ9A 3RVVC 4F80A 4D94A 3OJVC 1TQUA 1PZDA 4W81A 1LEKB 1BM7A 1C5DB 1CR9L 3F7YA 4OD3L 4G9FA 2HT3D 3OXSA 5A16B 3ULAB 2BNRD 4AGNA 2AABH 1IUZA 2YKLL 1NJ9A 3ZN6A 2XYBA 4ODVL 1CMOA 1FG9C 3BDYH 1E2VA 1ETZB 4XNUH 4BK5A 1R3KB 4LVHC 2FSDA 3VYOA 2X4QA 4JHWL 4PJAE 5TE6L 4Z7WA 3ABZA 3K74B 3A4DA 2CXKA 2GSGB 4PJCE 1JHLL 4N0UA 1PKQE 1RUKH 3CBRA 4YSCA 3K6NA 4DEPC 4XNQB 3LB6C 4WW1B 1A7PL 4XVSL 1JDCA 3N41B 4ETQA 1NIAA 3X2QB 4L4TA 5EU4B 5L4FA 1KIUA 5DFTA 4M02A 2Q76B 4NZRL 3US0A 3CK0H 3T3PF 4HA1A 1MEXH 3LQAL 3ABKB 3JV4A 3LH9A 3HC0A 1A3RL 1NMAL 1HHJB 3B3IB 3B9KB 4R3SB 1A25A 4OW6A 5GS0D 2FGZA 1NGPH 4WUUB 1G0YR 4XP5L 1QLFA 3FUNA 3GXPA 4ZMZA 4M62H 3T71A 4YQXL 4NCC2 3EOAA 3BIKA 3T77B 4N20A 3MJ9L 3VW3H 1MW3A 2DQIL 1WFTA 4XB8A 2NY0D 4KZEL 1PZBA 4GUPA 3O45B 1CLZH 5DMIH 2E86A 5I5MA 2JJSA 4HK3J 2YAHA 1VA9A 3QI9D 3HG4A 2CKBH 4XCNA 1QFWL 2P3YA 1YUHB 5LBGA 3N44B 4XN7A 3CN1A 3MRGB 5D7SH 2RQEA 5JMOC 1V05A 1OGPA 1Z1WA 3MRRB 1AHWA 1VCAA 3SDXE 2HT3C 2WJ7A 2MMXA 2QPEB 4A39A 3P4OB 5DJCB 2PETA 2PXYC 3WLWC 5F1IB 4YS4A 5HJ3A 5BOJA 1CVSC 1NPJA 1TVHA 4Y5YA 2UZYB 4CSPA 4POYA 3IDUA 1E5UI 2X4PB 3M07A 4MAUH 3O8XC 4OCRH 3L95A 2CBOA 3AREA 3CQPA 1YY8B 2HT2D 3N1MC 4G5AA 3H53A 3EYOA 1QPPA 3N6YA 1HN1A 4OZFG 3ZKMC 2DBLL 3QULB 3ROLB 2L7EA 2BSSB 1GHFL 4ZFFA 2W0FA 1KTBA 2WUBL 1MJ8H 1MFAL 3M86A 2J43A 3VFMA 2Y22A 2VAJA 2B08A 3HI5L 3NMEA 5K9OA 1BMZA 3PAYA 5IHUH 1G7QB 4RH4A 1IFHL 4QXUH 4PJDE 1R75A 5KAQG 4F9LC 2D3JA 1KPRA 3VJ6B 5IM7B 4ZAKA 3OLDA 4TUUA 1J8KA 4KDTC 5C9KA 1MQKL 1GIGH 3UXFA 4IW4C 4PG9A 4AYDC 3KEDA 4HKJB 4HWEL 4P2QA 1N5YH 1GS6X 4PB0L 4M93C 3BAEH 2DYPA 2MQ3A 3FRPG 1SJEB 4JCWA 1JERA 1K2DA 3K5SA 5HYQB 4JFQA 3FT3B 4M48H 4MD0A 1KB9K 5AAMA 2A9NL 4B50A 4MYWB 4XOAA 1A1MB 3QAQA 1I7UA 1HINL 1M71B 4LBAA 2GIYA 2NW2B 2VDKH 5BXFA 3QNYB 5EO0B 2QHLA 5IB2B 4NI6A 1IGCL 1KBVA 4X80L 2P5WD 1J8HA 1ZOXA 1A9VA 1T1YB 5HHME 2F68X 1S9XB 2N0KA 1WFMA 5HP5A 1MVFA 2WXOA 5FA4B 5ICUA 2Z0BA 2MCAA 2YPLE 2B59B 4L37B 3NH7L 4I2XB 2CR0A 4BCYA 3LQAC 2VDQL 4RX4A 1SEBB 5HBBA 3PP4H 2YKKA 1J7VR 1WZLA 1A9BA 1TU2B 1LJMA 1H15A 3VGBA 4KZ0A 3RBSA 3W11D 2XWZA 4GT0A 2A6JA 2OI9C 2EVJA 5D7JB 2FR4B 2YXWA 1QACA 3D2UD 3RTQA 3SN6N 1FFQA 4U05A 5DFVC 1QWUA 2QZ5A 3K80A 2H9GA 3O6LL 4FNPA 3ZZLA 2DWTA 2V9QA 5FYJU 2WKOA 3T8VA 3ESVF 1NOAA 1JZFA 3NCBB 1OAJA 4ABVA 2YZ8A 3UFIA 3KPSE 3ECWA 3GIVA 2BY0A 1FDLL 4JPKL 3WN5B 4ONFH 2QSCH 3Q8AA 1JZ8A 3L1FA 1WS8A 3NABH 4F93B 2HXAA 3D69A 1AD9B 4YSUA 3KH4A 3TBBA 1QSEE 5LGJB 3RWEB 4P3DA 1ZHKB 3OPZH 3IE9A 3ZHLA 3QIUB 3E8VA 1Q1JH 4UM8B 1MI5E 4AEHH 3QJVB 4WUUD 3KR3L 4WFGE 1GYCA 43CAB 2Q9OA 4KPHH 3P0YH 4NDMA 4F2EA 4EVNA 2JLLA 4XNBA 1N67A 4M8UA 5F6HI 1JE6A 5FS5A 3UGXA 3KPRA 3LH8A 1ZT1A 1J88A 3ECBA 3RWIA 2Z4QB 3CPLA 3MLWH 1H6EA 4H2AA 2ZKMX 4AX3A 2CG9X 2X89A 3DV4A 3HAEA 1DVFD 2FH6A 1VLXA 1LO5B 5DHVH 5L4IA 2FT7A 4LGPB 3PIQA 4IGBA 2JB6A 3MACH 5CIPH 1KGXA 2I9LA 1KEGL 1JPGB 1JMXA 4TUJB 2O72A 3TJHC 3BN3B 4U3SA 5E6ZA 2V5TA 3TNMB 1KN4L 3GSUB 2GHZA 4J5VA 1IAIL 2DQHH 3E9UA 3L7FB 1CCZA 4XN8A 5HXMA 1A6AB 3BISA 1B2WL 1KCRL 2EINB 5BQ7B 5I1DB 2ROXA 4PRIB 5DC2A 5C07A 3UTPD 4OZGF 1Z9PA 3CSBA 4IU2A 3E2HC 5BS0E 1NKGA 2IALB 4B5ZA 3EDJA 5GIRB 3CN3A 5CP7B 5FGBA 4ETYA 4GRLA 2BVEA 2Z35A 3KPLA 4OGYL 1UH2A 3LRHA 1QVOA 3NT0A 1TZOA 3BWUF 4Y2NA 3VQLA 1MLCB 3OZLA 1R24B 4X0KB 3VMOA 4J3OD 4TLTA 4LVNC 4BFIB 1EBPA 3HKFA 1U8NA 3S34L 3FW6A 4BFRA 1JNHA 3C5ZA 1RK1A 5EZIH 3WFBL 3HFMH 4UT9H 1I1AB 3FQNA 5DMKA 3MUZ1 1G9ML 2F7OA 4N3TA 1EMTL 5EN2A 1ULVA 1NFDB 1XF4A 2F5BL 2JKWA 3N1GC 3OB8A 4GO8A 5T5FH 3ZW3A 5HHMD 4APXA 5J9PB 2OX5B 1IIIA 5CCJA 3MCKB 4Y9FA 2YPLD 4UZGA 3UO1H 1DQDL 1GGIL 5JOPE 3GSNB 2VSDA 2YD8A 1W6LA 1JK8B 1HE7A 4P9ML 4YDLC 3ZDXE 4PV8A 3KLSA 4EIBA 4MJ2A 2GSIB 1F0LA 4G8IA 3EBHA 1QRNB 2XG4B 4G11A 5F7DA 3UO8B 3CFEB 3EYVB 1DQIA 3O3EB 3WFDL 4PP2B 2EILB 3GJEB 2W38A 3HNVH 4EBQH 3KW8A 3EJSA 5CEZH 1E2WA 4J7RA 5HJDA 4PRNB 4J8RB 4HQQH 3ZKND 1UA6H 4XCCL 2R29H 4C57C 2PLTA 2P1YA 3WJMA 3TESA 3KPSD 4DVRL 1OSZA 3KBHE 5EZJB 5B1BB 5MHSD 2UUDH 4WI8A 4EDWL 4UU9A 3SGEI 4JN1H 1AQKH 1PZ3A 2VERA 4PBXA 5D7JD 2ICWB 4YEEA 4ZW7A 2EIBA 2G5BA 3N43B 1CFSB 2NX5A 1K4DB 1F6LL 2A74C 2BJML 2XG5B 1GMIA 4FHBD 3HE6A 4XO4A 3FQXB 3CFUA 5IKCA 5KANI 2VGLM 3L7EB 4HJIA 4YBHA 1SZNA 2H3XC 3CLWA 5D9SA 4V11A 1SXSA 4X6CF 1NIEA 4ACPA 3L16A 2WBWB 3TEXA 4FERA 1S7VB 3ARFB 1OGAA 3A24A 1VGKA 3F7VB 5ACLA 3I9GL 1UXWA 1KCVH 5FDYA 3RHWF 2XVKA 1FUNA 1UOLA 4HPYH 4RGMC 4FKKA 5IT2L 1KB3A 3QH3A 1FORL 3UBXG 1O9ZA 4DSYA 2JCCA 4LCYB 3R8QA 4C83A 1XR8A 3HE7B 4JZJB 1PG7H 1T2JA 1FN4A 3VSTA 4JFFE 5AB0A 3QIUD 5GQBA 2EEFA 3VVWA 4AITA 4XB7A 1CPUA 1H0DA 4FQIL 2BOBA 5KVEL 1I7TB 2J8HA 4N2LA 1OF2A 3K2UH 4HYTB 2ADJB 5EBLA 4CMHC 4OZIB 4LCIH 1AE6L 3QNZA 4NFBA 4PJ7B 1FNSH 1LXMA 4A7TA 5DJDB 3WFHB 4WWNA 4JHAL 2XJLA 3B8YA 3B2PA 2DH3A 1ACCA 2ZWZA 2HH0L 2NY2C 3DBSA 3DRTB 1JNNL 3VNYA 4P49A 5BS0D 1KCKA 4LO9A 3WKYA 1HDMB 4AQ8C 2WIIA 5GGSY 3WD5H 3CFJA 3DSNB 4KH2A 2K3HA 5GGRY 2CA3A 4NJ9L 4S11A 4X9FA 5HHQB 1G9MC 1ZLWH 1YEDB 2JTYA 1DQTA 4Z5RB 3P4LA 4MBRA 3CHPA 3MDJA 3HR5A 1IKNA 1PLBA 4N4YB 1HEJC 1N0LA 4IBSA 3EO9L 4PBDA 5ISZA 5FW6A 4PRID 3GMOB 4MXWH 2WO3B 3PNWA 5IJKC 1IAIM 1IEAB 2EDWA 2H41A 3B7UX 2WM0A 3QNXB 4QXWA 1ZLDA 1M57B 2Q6WA 3DVGA 1ZK9A 5KYWB 1ZEAL 1INDH 2A9AA 1NCAH 1CG9B 4Q6IA 4I18B 4LEXH 3GJFA 1MRFL 3ZPDA 3P3SA 5C0CA 1HQ4A 1CURA 5JOPD 3RDTA 3GZPA 1ADQL 1N3NB 1YC8A 5CBEA 3MZTA 5A7EA 3U1SH 2YJLA 3SO3B 1S3KL 3V5DA 1WHOA 4FEIA 3TBYA 2HJKB 1I1AD 3BP6B 4O2EA 5EWIH 1L3WA 1MCSA 1XDTT 3FQYA 4X6FB 4YHOH 4FXGC 3U9WA 1MNUH 5IFAH 2WBJA 4IHBA 4TVPD 1IBZA 1RUML 3FB8A 4ZDHB 2Q86A 4JMXA 3CFBA 1BFSA 4RGOH 5B8CC 2EDQA 1Y1DA 2P48B 2ZXAA 1KIRA 5JW4M 2BVYA 2WZ5A 4R84A 2SEBA 2OMZA 3SKJH 4HU8A 4BK8A 1ACZA 4PR5B 1P2CB 4G43A 3ZTCC 3MR9B 1QRND 2EEDA 2ITCA 2A9ML 2JK5B 3MGOB 1DVSA 1S7UA 2K8QA 1QPXA 3FONA 4FLOA 4H88L 3CXHJ 1ZD6A 2DI8A 3I9AA 5DLMH 4IBYA 4ZUUB 1HL4A 1KFGA 3N40F 1CD1A 5ID0A 4DIXA 5TDNA 4H44C 5IBTH 1TETL 3CFDB 3VGFA 3VXUA 5I15L 1B2YA 2AGJH 2PTTA 5F2FA 1LWHA 2R9HD 5E94B 5IEHA 4PJ6A 2FLRT 1UT1A 5DRXA 4L8DB 1W80A 2PTUA 2WLIA 4XMXA 2F8XC 3V79C 3PWJA 4CSSA 3RU8H 2GBAA 1JL8A 3B34A 1YNTB 3LKOA 3N9GH 4QWWC 3S5ZA 1WWWX 4GNKB 4HIPA 4MNHA 3A47A 1FNAA 3QZBA 1AIZA 1LO3H 2V6HA 4AZ8A 2VLLA 4IRZL 2ALAA 2CUAA 2WUCL 2XRAL 5CR8A 3MJGX 3TEYA 4GRMB 4MD5A 3ARFD 4HIXL 4OFDA 5ANMB 1AP2B 2APXA 4UV7L 3FFOA 2E7CA 3ULVD 1YPZE 3Q2NA 4RISH 1IVTA 1CF1A 4WW2B 1NCGA 1G0XA 3OJMB 2WVSA 1QNIA 3PWLA 3HE7D 3TFKC 4UOW0 1CJYA 4QXVA 5F1NA 4NHCL 4EN3C 3EJPA 1L9MA 2WQAA 2XWBB 1FH5H 1BQKA 3PQYA 1J1PH 4U1HB 4FP8H 4C55A 4JJ5B 3TCTA 2OR7A 4I89A 2CO6B 4BQ8A 1T83A 3G5YA 1E2ZA 3QRGH 1FE8L 1HXKA 2ZYSA 3TYGH 2J3SA 3H54A 2XZQH 5E1AB 4G2AA 4AV5A 3QXDB 4F2MA 5TE7L 5IF0A 4Y1AA 1T5WB 2NCMA 1BVZA 2AJ3B 1CF8H 1PCXA 2H32H 4IDJH 1B3JA 3SDDC 2EEAA 4S10A 3T0EC 1FBIH 1YYLL 4DVBA 3KD4A 5CS7A 2EE9A 4WO0A 3GIZH 1I8MB 1BGXH 3CBJB 1PPIA 4PVLA 1NGYB 3RJQB 2BWDA 3BI9X 1WBXA 2V37A 2X42A 5I23A 2XX1A 4YR6A 4WSKA 2L04A 3WIFB 4JRXB 5GZOC 1NFAA 1XCTA 2E8ZA 3TONA 3V6BR 5GRUH 4ZMXA 5T3XE 5GRVK 1H3UA 3NCWA 4PWHA 1QO3B 3AC0A 2YD7A 4A7SA 4HH9A 2X2IA 2LFEA 3QDJB 2XVGA 3CH1A 3PDDA 5KJRL 5CCKH 5AZ2H 3IJHB 1J0IA 1CU4L 1AIFB 3MLXL 1I9IL 2PO6B 4P59H 5EZPA 3VU1A 1UYWL 2GJ6A 4Z7UE 2DLGA 2ZG2A 5IHBA 2X2JA 1WK0A 3S2AA 4X99A 3QIWA 4BZ1A 3LNFA 4EE2A 4CDHA 4HIQA 3KHQA 1CS6A 5EZLB 1B4RA 4B9YA 5BMFH 2EE3A 3FSZA 4XP4L 2YZ1A 4NC0B 3C60C 4XN1A 3IGUA 3T1FA 3QDJE 5C6TH 1Z3GL 2PW1A 1MUJA 1XBDA 3QZMA 2R2EA 3ELQA 3K1KC 2K4AA 5HVWA 3O2WH 2D7TL 1ZA6A 2NUPA 4KRMB 2A0LC 1FZKB 2RHEA 2VLRB 1REIA 5L6YL 3HVDA 4I4WA 2Z8SA 1KJMA 1F1GA 4DAGL 1UCTA 3V4PB 2LTQC 4F7PB 5B38B 5EF2A 4NO5B 4FZEL 2KDYA 4Y4FD 5LB1A 3L5IA 2N59A 5EORH 1S7XA 2XPGB 5JO5B 2X2YA 4PUBH 4ADIA 1THCA 5DVLA 5BVJA 1ZHLA 3DROA 3EH3B 3FN0L 1D7CA 5FYKE 3V10A 4PJEF 3IVKA 5ICZB 3G6JB 1QKZH 2Q2EB 3S0PA 4A2LA 2FWSA 4GQRA 3EXJA 1A64A 2AV7A 2VDPL 3I02B 3VX0A 2IXQA 3FULA 4OD3H 4H8WH 2AANA 1B0RB 2XZZA 2YKLH 3AS0A 2J7LA 2WGXA 4ODVH 5C8JA 2MTPA 1TTRA 1T89A 1MCRA 3ZZSA 1G84A 4NLHA 3H9SE 4YDVB 4ZYKA 5TE6H 2CH8A 3GSXB 3QNFA 1QAWA 4FGMA 2X4TB 4Z95L 3UZVA 1JHLH 2HFTA 5FEBA 2NY6C 3ATBA 3QXUA 3X1BA 1MWAL 1AHWC 2AXGB 5EA0L 1WZKA 1A7PH 3QO1B 4XVSH 5JPNC 2JLPA 5DD5L 4OZHF 3W39A 4KAQL 3WO4C 3MRFB 2ESVE 1DANT 4EIUA 2BIQA 1OZUA 1MOEA 3BSGA 3ZYIA 4FQQB 3MZGB 4YZWA 1HCYA 2CRIA 3IU4L 1E3FA 2VJ0A 4WHCA 5J3HD 1LP9E 1MXDA 4OSUH 3LQAH 4X4XB 2F74A 2JI1A 3NN8A 1JD7A 1A3RH 4PGCB 1EANA 2V7NB 3ZZ1A 5LBSH 1BD2B 4W9HC 3LD8C 4XP5H 1BFVL 1J5DA 2EUWA 5IOPA 2HVJA 1RZKC 2F0CA 2YBRA 4PWGA 5IHWA 5DZJA 4G3YL 5T3XD 3MJ9H 2R1XB 3BGFC 2DQIH 3FRUB 5E4AA 4NYLA 3RZCC 4OKVB 2P7TA 4G6AD 2GK2A 2PYEB 3STBA 3QZNA 3WOVA 1SFHA 5JIQA 1JYXA 3VFSB 1FFNA 5JXEC 1NMBL 1QFWH 3EKCA 4G8GA 4UDTB 3LVEA 1KTCA 2Q87A 1F4YH 4L8SB 4MCZA 3TBTB 4X9HA 4ADGA 1H3GA 1EZLA 3VG9C 2ENSA 3ULSB 5C92A 3CLEL 1OB1B 4TULH 5MEQB 2QLYA 2DM2A 2J8UF 4JRXD 3DTXB 2GCYB 3DIFB 1AO7A 4ORZC 1LM8V 4JPSA 2VL5B 4XGZB 2NXZB 4ZMQA 2IBGA 4PWKA 3QDJD 4WV1B 5E0FA 4DERA 4R97C 2E47A 2EDMA 3RVXD 2VWEE 4S1DD 1AD0A 2EDLA 3TTSA 2AJYL 4NQDE 3BH8A 3IB4A 1QQDB 1QX1A 2DBLH 2PO6D 1IV8A 1SFDA 4O51B 1GHFH 4AYFB 4HIIA 2WUBH 1OY3B 1SXZA 1MFAH 3B83A 2G2NA 4NNPL 4W68A 5E8NA 5KWYC 2EYSB 2PWHA 5FM5O 1BXXA 1U8HA 2VLME 2BRQA 3DYOA 2X6MA 5EO9A 3QI9A 3VGGA 1IFHH 1S7WA 1GRWA 3STLB 3ZL1A 2W8CA 1LMIA 4WWKC 4ZMAT 1UATA 3RTQC 5FYKD 1IBGL 3UJTL 2WZPD 1G4MA 1KF9B 2P5EE 2VLRD 3LPOA 4WNQB 5AVUB 4AYBA 2HKHL 4L1LA 3ZRCC 4O02A 1OP3H 4HWEH 4PB0H 2X88A 4D0BA 1ZTXE 4QHKJ 5C0BB 3APMA 3S6CA 5D6DA 5L8JB 1MIML 3Q06A 4OFIA 3CG8A 3X11B 4QTIH 1WBYB 3NK3A 2R7EB 2PPEA 4GKNB 3GEFA 3KYMA 2A9NH 4HUUB 4Z1PA 3FTYA 3DX7B 3QWNA 1LEIB 2ZUQC 3TT3L 1BQHA 2X6VA 1C5CL 4IMLB 3HN8A 3LH2H 5ISZE 4HKBB 4X80H 1HZHL 2PCFB 5CJQL 1T2XA 4RZCB 4F7EA 3S8GB 1BAWA 3LS5L 2ARJB 4I0KA 4PN6A 3WS3A 3CQFA 3NH7H 4ZD3L 4MCNA 4LL4A 2D03L 4QGYA 1M2OA 2VDQH 3KVDD 4IIQC 3WNPA 5J6GA 5AL8A 1T20A 2B20A 1TO4A 3ARGA 4MNGB 4NCDA 4WGKA 4IJTA 3SE6A 3MNDA 5DYOB 3EH4B 4A2DA 1YNKH 3U25A 4KQ3L 4HS6B 4AOFA 3HUJB 2BY3A 2OPCA 2UWEF 3QWOA 1BOGA 2CIKA 3ETBF 2GJRA 4I3SL 1RUPL 4J23A 1OE1A 1MAMH 2WLLA 5EMYA 3MYZA 4HEMA 1IRAY 1CDIA 1HXYA 3N55A 5I73B 3CVDA 2VITA 1VZGA 1N8ZB 1FDLH 2NXYB 3FB7B 4JPKH 4AEFA 1OAQL 2IVFC 5EDXA 5K9QG 2HLFD 3RFZB 4JFDE 2ZX7A 2P5WA 3EFDL 4X6DF 4JREC 4PRHB 3BQUB 5KW9L 4G6FB 4R90L 1LEKA 1C5DA 4JE0A 3VAEA 4G7YL 1V7MH 2D3NA 2J4WL 1JRHL 1BD2D 1QLEB 4JKKA 2V9UA 3KR3H 5A2CA 3EW3B 4XPFL 1HCFX 5LCVA 2CLZB 4YXHH 5KUMA 4YBLB 2ZT9C 1I1YB 1ETZA 3KEHA 2OP4L 4XXWA 1R3KA 4KKQA 4W4NA 4MDRA 3Q05A 2AVFA 1ZTXL 5AKSA 2PYED 5C08B 3CFIC 3C5ZC 4K15A 2GSGA 4J3TA 4O58L 2MQCA 3DX0A 4MB4A 3SDAB 4FLQA 4QNPE 1N6QH 4XNQA 5KAQF 1FGNL 1BZQK 2BRRL 4WW1A 5HJGA 1NBYB 2A4ZA 5E5LA 2E7LA 4M4RA 1KEGH 3OKDB 2PWFA 4HG4K 5EU4A 4MMYB 5KOVC 2MJWA 3RL1B 2Q76A 2H2PD 1KN4H 4DOHB 1QD0A 3ULUE 1IAIH 2VLMD 1UM4L 4LSQL 2DLFL 2NXZD 3PS6A 3SB3A 4NQUA 1QUPA 4YDMA 1HHJA 1B2WH 1KCRH 1ZRUA 2R69A 3B3IA 1FZOA 3B9KA 4R3SA 5I8EB 1O9VA 3K4AA 1EH9A 4MS8D 2ZG3A 4GRWE 2XWRA 3VXRB 2H0FA 1A4AA 3G6AA 4OGYH 1KMGA 1EK3A 3T77A 3Q9PA 4HD9A 5DVKA 1YEKL 4PRDB 3MRBB 5AKTA 1Q72L 2H1PH 1XMWA 2D3LA 5I71B 4OCYL 2WLMA 2XWDA 3MJWA 4Y2OB 3Q2VA 3B2VL 3S34H 3WEXB 1YUHA 1NGZA 3WFBH 3MRGA 1LWJA 3LV3B 4KC3B 1LE5B 1KY6A 1G9MH 3MRRA 4BUQA 4L4VB 4RAVB 1IL1B 1OHZA 1CIUA 1D9KD 2AJVL 4FXTA 2F5BH 4M56A 1MHPL 1JZDC 2E7BA 3P4OA 4XWOC 5DJCA 5DK2B 4M7ZB 5F1IA 4AT6B 1M53A 3AWGA 2XNAB 4DGIL 2UZYA 3N1FC 2X4PA 4QF1A 1DQDH 1BLNA 1GGIH 3DPBB 1YY8A 2B7DT 3A0OA 4HIJA 1SOKA 3HAEG 1JS4A 2TSAA 3VYNA 4W9DC 4X5RA 3QULA 3HW7A 5JPMB 3ROLA 3UPCA 3FSVA 3K2MC 3WFDH 2X12A 2BSSA 3QAZC 4AC2A 2FBOJ 4E9WA 1FCCA 3V7AE 4PFEA 5J1TC 3N0PB 3LVTA 2R2CA 3WJLC 4HJUA 1DJYA 3ASOB 1G7QA 1NBVL 4XCCH 2WQXA 4I0CC 1KBBA 2RIKA 1F4WL 4KX8A 2JXMB 3WLBB 4EQ2A 2VN3A 3GHPA 3O11B 3ML9A 5JHLA 2CK0L 4DVRH 5IM7A 2NDGA 1ZPLA 4M7KL 2C9VA 1XSIA 1H3VA 4EDWH 4GAJL 2WTRB 2I24N 3BT2L 4PS3A 1EV2E 3SE9L 3VXOB 2KKQA 4IKKA 3OR7B 4QY8B 2OMWB 1YCSA 2JTDA 3ULUL 2BJMH 4URTB 4HJJL 2ZXGA 5HYQA 3D6GA 2CBPA 3FT3A 4HBCL 4JGJA 3MV9E 5AUMB 5LG6A 1A1MA 5AAWA 2DLHA 2EXWD 4B9IA 2NW2A 1E6OL 3G3LA 2NXYD 3QNYA 3I9GH 5EO0A 5IB2A 4ANUA 4FNTA 3TA3B 2V5RA 5IT2H 1FORH 1IKNC 4WK0B 4K5LA 3WIHA 1G5GA 1T1YA 1S9XA 4XNZB 5FA4A 4QAMB 4YSDA 3ML8A 5FR3A 2WKLA 2XXCB 4PRHD 3BQUD 4G6FD 4HUWA 5KVGE 5I8KL 3QDGB 3ESMA 2B59A 1MVUB 1J86A 4I2XA 1GZHA 3CHQA 4TNGA 3KWUA 2NSQA 1RIHH 4H8PA 5F1SA 5HGDA 1RI8A 4LDLB 3U30C 4EEEA 4FXKB 1HSAB 4KHXL 4DK3A 1DQVA 2CDGB 3LKRA 5GRYA 2FR4A 5D7JA 3NCXA 1KTLB 5L0QC 4JHAH 3RDTC 2AQNA 2FT6A 4M8QB 1LDPL 1NBQA 4A7GF 2HH0H 1WWAX 4NEHB 2CGYA 4Q2ZB 1BQLL 1JNNH 1FAIL 2A9DA 2PP9A 3SDAD 3QR0A 2DM3A 1BPLB 4UCFA 3V0VB 1UXSB 1DQJA 1A9EB 2BOCB 5HVGB 3ZZQA 1Q94B 2EH8L 2I5YL 5D1XB 1FC2D 2HX9A 5D1QA 2G2PA 4YN3A 3GI8L 4DKTA 1AD9A 3HJEA 4RRPA 4ERSL 5LGJA 4JDEA 2V33A 1PTZA 1ZHKA 3D39E 1UOKA 5CLTA 5J6HB 4KY2A 3EO9H 4UM8A 3BVWA 4HULB 1E4HA 5K59F 43CAA 2P42B 4O2CB 4HDIB 1ZV2A 4ZOAA 2W9EL 3VFNB 3X14B 4YBQD 5D1XE 5AVXB 2DICA 3MGAA 3V9EA 2HLAA 1GYWA 1ZEAH 1DBAL 2A77L 1IB5A 4KQ4H 4M1DL 1CICB 2WXHA 2Z4QA 2BSBA 5DYFA 2QVMA 5AVSB 5DS1A 3H55A 3NGBC 5ID1B 4U4IA 1LO5A 3VI4E 4UT6A 5IGXL 1E8ZA 1ORQB 1S3KH 2YA2A 1ZA3A 4F24A 2Z91B 4L4VD 3IGAB 1JPGA 4TUJA 1DCLA 2ID5A 4YZFE 1RSFA 2VISB 3AS1A 1U3HC 4PYGA 5ECJE 1GMEA 5FWQA 3TNMA 3GSUA 2Y1YA 5EUKB 4BKLB 4N28A 3MMEB 3L7FA 5EUOB 4J3UA 1A6AA 3AJ7A 5KVGL 5F7MC 3ULUC 5BQ7A 4PRIA 3FO1B 2ODIA 3AROA 3KCPB 3GM0A 5GIRA 2VN7A 4GP8B 5CP7A 2I7OA 4K55A 3ATAA 3MQIA 4AIXA 4AJVA 3NEXA 1MCWW 2NY4B 3PWUB 2DQJH 4H0HB 4JMNA 3KVQA 4X0KA 1HTYA 2HVBA 3MX0B 4BQ9A 3KLAB 1TETH 1TF4A 4X0NA 5I15H 1T83C 1UH3A 4PH8A 2DMGA 4CW1B 3Q8EA 3DA0A 5FGCB 1NFDA 3U6XS 4XP6L 4EI0A 2ZZUT 5DZLA 5J9PA 3VRIA 5IUCA 1QBBA 1S5HB 2CNZA 3MCKA 4L3EE 4RWYH 3X13A 3V6OA 4IRZH 2XRAH 5FB8B 1YMMB 3GSNA 4XNDA 2RQ8A 3D18B 5E51A 2GSIA 4ZRGA 1X7TA 1QRNA 2XG4A 2F19H 3NDZE 4FC3E 4HIXH 3CFEA 4YGAB 3EYVA 1LLAA 1T0PB 3O3EA 1NBZB 2ZYRA 1JK9B 3GJEA 3ETTA 4PP2A 4R7XA 3MLZL 5A2FA 3O6FC 2YPKA 5C86A 2ADIB 1PLGL 1TT6A 1U8KB 4J8RA 5TQ2L 3BUDA 3QCVH 5EU5B 1TYEB 3LZOA 4JQVC 3ZTJH 4X8GA 5I6PA 5FO8B 1JYVA 4BWTA 1AKJA 3SDXF 4A7UA 1TZGL 2DV6A 5EZJA 1WWBX 2GEQA 3MKKA 2YHGA 1SY6L 4RCAA 3US1A 2V2TA 2BS9A 3PFUA 3W56A 2QGDA 3FO0L 4FNUA 5TE7H 4YUEH 1S78D 3CVHH 5IOKA 3D39D 3I9PA 1K4DA 2CWRA 4N5UA 3RIAK 4DW2H 4P5TA 4B9KC 3L7EA 4NZUL 2HRHA 2NY7H 5F72S 3FU7B 1YYLH 3GXNA 2OSLA 3D0LB 2BK8A 1FVCB 4NIKB 5IQ7L 4YHNA 4ALAC 3EYQC 1P4LA 1S7VA 2IV9A 2F5AL 2W60A 3ARFA 5B1CA 3VDCA 35C8H 4EI5B 3QEHB 1Z2KA 2NQDA 3QPKA 5D1XD 2OR9L 3DGCR 1E40A 1LMKA 3I6KB 4JKLA 2WV3A 4L05A 1TCRB 4LCYA 1N59B 3IDIA 4PJDF 1Q9OB 4PAZA 1PZ2A 4DKDC 5JIKA 3FO2B 5KJRH 1RZKH 5DFAA 1I7TA 1NEZB 3MLXH 1MCEA 2NZ1A 2ZX8A 1XCWA 2LAAA 5D7IB 2ADJA 5HGAB 1TJIH 1M1SA 4OZIA 1V27A 2AW2A 3CN2A 4PJ7A 4DJMA 5DJDA 3WFHA 4AW4A 3OMNB 1IM3B 5ILTL 1HHIA 5KTEH 3MJ8B 4LFHD 3QEUB 2DS4A 3DRTA 2JE8A 2X0WA 4XP4H 3RNKA 2VR9A 2DI7A 2EZ0C 3OZ9H 1WE5A 4ZW3A 5T1KD 1T89C 2R2BB 3FU6A 1EGJH 1S46A 3FF8A 2NYYD 1KLFA 4N2DA 2D7TH 3K8MA 3SO5A 3BO8B 3BRFA 1VADA 1FA4A 3EGDB 1ZDSA 4OZ4B 1EERB 3DECA 5D2LA 5HHQA 5C0EB 5L6YH 2WB7A 1TMCB 1NCJA 1YEDA 3NG5A 5D5MB 4CN6A 4P5KB 4Z5RA 1DQLL 1RH8A 1YAIA 2NR6D 4DAGH 4EZMA 2F18A 1ZT4B 1G1YA 1MIEL 3Q1SL 3RVUC 5F8RC 4B9CA 3LRSB 4L1DA 2PMZA 3GMOA 1DJSA 4YGVB 1RMFL 5C6PB 4XNAA 3W37A 1IT9L 3GB7B 2OSYA 1TO5A 4HMCA 3UMTA 3QYMA 3ARRA 2XI9A 3QNXA 3WDIA 3FN0H 3WAJA 3OKOB 5K39B 2L0DA 5KYWA 2NY4D 4UB0H 1CG9A 3GT6A 3IDMB 2UY7B 1WO2A 4L3ED 4I18A 3WNMA 5HHOB 3KPOB 3P73B 2X9XA 2YMXL 2GUYA 3PV6B 1SLWA 2VDPH 3EJZC 3QC5X 5EIIA 2B1AL 3DSFL 2QVTA 1UACH 1HNYA 3K2IA 1ZS8B 2GIMA 4FFZA 5DHXB 1J11A 3PWVB 1SMDA 1WT5A 5DD0L 4QOKB 2HJKA 3NRPA 2ZD0A 3BP6A 1L9SA 4LCVA 5KEZA 3W2DL 4QXTB 4X6FA 4WZ9A 1LO0L 3NZSA 5EO1B 1GL4B 4FL4B 2FIRT 2HRLA 3A4FA 3DKHA 4MXVF 5DC4B 2XA8H 4Z95H 1EFQA 2E4TA 1VEOA 4PJIF 2EACA 4MJ6A 1YMMD 5IQ9B 4KVCH 2N0MA 1MWAH 4L29A 5B1JA 1OZTG 1UKSA 4ZODA 3D4ZA 5EA0H 5SV3A 3SKOB 1OSYA 1P2CA 3CV5A 3AB0B 5DD5H 4KAQH 3HZKB 2P28B 5LWYH 1RULL 3QO0B 1OB0A 1X4ZA 4K71C 3MGOA 3MGTB 1CFTB 4FA6A 3T3MB 4ZUUA 4KKLC 4P07A 2HZHA 3L3OB 1ZGLA 3L9RB 5C3TA 1F58H 2AVGA 3VDBA 4YC2B 4W9LC 4PPTA 3CFDA 3CZFA 3F58L 3S5YA 1A3QA 5E94A 5F89B 2ZXDA 3APCA 1BFVH 1CL7I 3D4GA 4L8DA 1MJ7L 3T2LA 1JV5B 3HAEH 5DURB 3RWHB 2OYPA 4LPYA 3EJYD 3TA4D 2J1ZA 1YNTA 5CD3B 3SYAA 1CFVH 3MUY1 1J1OH 5T3ZD 1T22A 2VDRB 5G2NA 5I1EH 3Q5OA 2FBJL 4FG6C 4PRPE 1FHGA 4PJBB 2UY6A 1XO8A 1NMBH 1KJVA 1IARB 4GRMA 4N2FA 3IDXL 3C09B 1G9NH 3OXRB 1BZ7B 5ANMA 4EI5D 3S36L 2F58H 1JTPA 4Y2DC 2O26U 5IVXF 5D6DC 1A2YA 4R6UA 4WW2A 4GIOA 2YN5A 4PREB 1TVBB 2VQUA 4RFNC 5FYKU 5CJ5A 1OAYL 4BKSC 4GSXA 2OULB 4J27A 3SDYL 5ITBL 4FA8A 2LLLA 2OFQA 4Z3JA 2I27N 2QKIB 3S8WA 4FMKA 5CCHE 4Y4KC 5J13C 2AJYH 2HG5B 1FL6A 2CO6A 4IRSA 5CZKA 1GC1L 2K7QA 5E1AA 1NBCA 3PWNA 2VN4A 4NNPH 1IM3D 4QTHB 1I8KB 4E9SA 3WSQL 1T5WA 2EDKA 2CDFB 2AJ3A 3G04B 4QHUB 2A1WL 2Z7YA 4TLKA 1WIOA 4XBEL 5E1IA 4HJGA 4L3AA 1VESA 4PJGF 3ZDXF 1W72B 3ARGC 4KQ0A 2WMPB 3D8MA 1F4XL 3DNKA 1C1EL 1I8MA 2IH8A 1A4BA 4OI9A 1NANH 4D7PA 1IE5A 1NGYA 1I3UA 1USZA 1SHWA 3RUGF 1TPXC 1IBGH 3UJTH 1URLA 3KM1A 3WIFA 2NTFB 3WEAA 1XGTB 4U49A 2HKHH 3BP5A 5DVNA 2G0KA 2NSXA 4W4OC 1QO3A 3L3GB 4JM2C 1MIMH 5A6IA 1S9WB 5JIIA 1BSIA 1X3DA 43C9B 3G9VA 4JZNA 1ONQB 1U4EA 4JFPB 1LK2B 1E5AA 2CSPA 4X2UA 3ILEA 1CD0A 1AIFA 2ZUSA 1HH6B 2PO6A 4LLDB 3MRIB 5HDRA 1XH2A 2OLDA 3VE0B 3HZMB 1HZHH 3IWVA 4ZXBB 5H37H 5HHOD 4U1GC 3V2AR 2BM3A 4BZ2A 3LS5H 3F01A 1JPTL 2HTLC 3UP6A 1IAKB 4ZD3H 3MNVB 1NLDL 2D03H 3BPNB 4PJ5B 2VJ8A 3PJNA 2DQUH 4XXWC 4QOKD 4A6YB 2AS5M 4CN4A 3QZPA 5KYYB 3F7LA 2WZPA 1RZFL 1FZKA 4N6QA 2WNGA 3G5VB 3V0IA 3ZX1A 3KXFB 32C2B 1JV2B 5E08L 3BZFB 4NO2B 3WMPA 5HPOA 2L7JA 4I3SH 3V4PA 4F7PA 5B38A 5I30H 4HF5L 1N4XH 3FFCB 4XAKE 2H0JA 2E7LC 3IXAB 5TQ0L 2XSKA 2XPGA 3QUML 5JO5A 4OGXL 4PJ5E 3BP7B 2JF1A 1YUKB 1RUAL 3UTZB 1OCOB 1A1NB 1XL6A 1TTUA 5ICZA 5I1LB 5B4MD 4Z6AT 3G6JA 1EX0A 5C0NC 3TIDB 1GR7A 3MRMA 4AUUA 4HU2A 3GM8A 3B9KC 1WFUA 3I02A 5IBUB 4KY1L 5KW9H 4R90H 5GGTA 1DZ0A 1AG6A 1HWHB 3DIDA 4Z7WF 4G7YH 5A2JH 1J5IA 4FKHA 2J4WH 3QQDB 3LZQA 1OOWA 3IMTA 1IC0A 4XPFH 3OWEA 1JWMB 5B3JE 4PYHA 3I85A 1WHPA 4WK4B 2OP4H 2P49B 1JF5A 5DURD 4CNIB 1OF0A 1S8DB 1O7VA 2O6CA 3O0RL 1BQHG 3HVNA 4YDVA 2EYTA 1NEUA 4QRAA 3GSXA 2P4AB 1GC1C 2DKUA 4EXPX 1ZTXH 4FQCL 1UZ6E 4Q89A 2QTEA 2YRBA 5BOZG 1E7UA 1S7TB 4O58H 2O93L 4NN7B 1TTBA 3IDGB 2G75B 2AXGA 3LZFL 3QO1A 4HH8A 1C8QA 3HZVB 1SGKA 1XGRB 3QWQB 4MQ7B 3EOYG 4P5MA 4J3XA 1HE8A 2W9DL 1B0WA 3MRFA 4ECNA 3ARWA 4I85A 2FQDA 2I26N 5I1GL 4FQQA 1AY1H 1OCWL 4OLWL 4S1QL 1AZRA 1BQSA 5GISL 3CCHB 3H7BB 3OAZK 3TWCL 2QSTA 3HPLB 4LSQH 1UM4H 4LEEA 1MCPL 4X4XA 3V8CA 1RLBA 3SBWC 2VMDA 3U4AA 1PZ5B 4L0YA 3GUTB 2QMKA 5FHBL 1VSCA 4PGCA 2QFRA 3D05A 1BD2A 2Y7LA 1E9OB 4XTRC 4N8VB 4Q9RL 4N5EC 4I8DA 4L9LB 4ZPVA 1SMAA 3H42L 6PAZA 1TZ8A 1H5BC 1FO0B 2GTQA 2R1XA 3FRUA 3UTTA 5KJ4A 4OKVA 3IDYB 4GMSL 2PYEA 5KVDL 1Q72H 2DJMA 1TITA 4F20A 4QJ4B 4OCYH 2J6EH 3VFSA 3B2VH 1JVLA 3QZLA 3BZ4B 15C8L 1D2OA 4UDTA 4I9WE 3WUWB 4DESA 5KYUB 4BV1A 3ZJAA 3IN2A 3FN9A 4BRJA 1AKPA 4L8SA 3TBTA 3QIBC 3OSKA 2NQCA 4LNRB 3ULSA 1OB1A 5MEQA 1RJCA 3JUZA 2AJVH 3S36X 3O2DL 3D2TA 4JZOB 1LVEA 3DTXA 2GCYA 3DIFA 2LFGA 2B0SL 2F7RA 3IEAA 4WHTB 4HD5A 2VL5A 1MCJA 3H85A 3ZTNL 4HWZA 4KGLA 4WV1A 3GFUA 4I5BA 1YJDL 5C3LD 3LHPL 4CDGC 4LDCA 2IANB 4KKCC 1QQDA 1DJZA 2QPUA 4KITB 1RXLA 3PHQB 4P23C 4O51A 4PGEB 3PRZA 3SYPA 4ZXBD 1R5VB 4EOWH 2EYSA 2XTJB 3LS4L 1W0VB 4RMQA 2GI7A 3BD4A 4XAKD 3IF1B 3MUJA 5EC2A 2HVKB 2RMNA 1NBVH 5AW9B 4B9PA 3O9WC 4D9RD 4PJ5D 3STLA 1Y7VA 2YR3A 3ZHNA 3Q6GL 2CK0H 5B21A 1I75A 4NFDA 2NYKA 2TSBA 4M7KH 5IHZA 4GAJH 4M9OA 4FTVB 3SE9H 4APQB 3BT2H 3GSNL 3R19A 2R4RL 4WNQA 3P2DA 4Z3EA 3P77A 4WKZB 4P2OD 4BSWB 3S48A 3ULUH 5C0BA 4UINL 3NEOA 1QLRB 4IOFC 4NN6C 5DT1L 2CMRH 2K0RA 3MA9L 4JL1A 2VRQA 4DZ8A 1ILUA 3X11A 4XI5C 1AYOA 3FFCD 4FCHA 4HBCH 3SEPA 2R7EA 4FNQA 4NZJA 2XACC 4GKNA 4HUUA 4DO6A 3P11L 3OMAB 1LEIA 5D1QC 2LVEA 4FLRA 4GRWH 1E6OH 4IMLA 2FECI 4HKBA 4F1ZA 4ENEC 4FTVE 4RMVA 2PCFA 2XN2A 4XCFH 4RZCA 1G6RB 2BINA 2YD1A 4N6RB 2ARJA 2D73A 3KG5A 1AG0A 1RJZB 1WFOA 2OJZL 3GSWB 1K4CB 3PXJA 1FZMB 3CPUA 1R3IL 2WKOF 4MNGA 4KHXH 1YN6B 4XPGL 1AOZA 3RURA 1RP9A 2G3ZA 4NQVB 1QNZH 2AQSA 4MZIA 4H25B 5IJDC 3GSOB 4OBSA 4M6OL 1CDYA 1GH7A 1OPGL 4HS6A 2CJUL 3HUJA 5JUEL 1JGEB 1TJXA 2FHCA 1LDPH 2FJGB 4K8RL 1BQLH 1FAIH 1CXKA 2W91A 4JY6B 4J3OG 1K5WA 1CDUA 5FC9A 2DWXA 3PU7A 1AYRA 3IJYB 3NQIA 3BZEB 4XNXL 2EH8H 1N8ZA 1NCBH 3FB7A 2HTKD 1XGYH 5F9AC 5HDOA 4Y5VA 3GI8H 2C9AA 4ERSH 1ZVHA 5ACMA 1IKOP 4XE0A 2EE6A 5E6IB 4PRHA 3BQUA 2JI3A 3FU0A 1B6DA 4DGYL 2E59A 3PXLA 3WIAA 1KGUA 1FHNA 2CLZA 4LCWA 4OJDH 1SOQA 3AGVA 4FMFA 2W9EH 1YJDC 4DEUA 1L0PA 4R9HA 1OCZB 5C0FB 2HMID 4AWJC 1UB5B 1G9EA 1DBAH 3KWWB 2A77H 4M1DH 2DRUA 1VHPA 3NPZB 1XGQB 5C08A 4TTDD 4ALAH 3GBLA 3NIDB 5DJXB 1MSPA 3UBHA 5IGXH 2NNFA 3VH8B 1NBYA 2K1MA 4OF3A 4M5ZL 1YEJL 3QW9A 1QFWI 3GZKA 2FYVA 3CMGA 4TUKH 4C59B 2JKRM 3GKWL 4MMYA 1D5MA 3RL1A 3V6OC 1AXIB 5E4OA 4ELKB 3NSDA 5KVGH 2FH8A 5I8EA 1G94A 4UQAA 1B4JL 2W95A 3BPOB 2VH5L 1WC7B 2WYTA 3VXRA 3KS0J 1A7OL 3VFRB 1JYNA 4Z0BL 1H9DA 4KRPB 3Q2WA 2XIDA 2IBBA 3H4HA 4J6RL 4FFZL 5JHDE 5E23A 3ZDZE 4MQTB 5C1MB 1INQB 3EBAA 2XTJD 3HNSL 3QZOA 3MRBA 3MLSH 1AZCA 4JGUA 1T7VA 4JDZB 2GAZB 4AYGA 3GMQB 4OFYD 4K2UL 3WEXA 5C7XH 4HGMA 2D3VA 1F56A 2MCPH 4E9LA 3JWNC 2PYFA 3MV7B 3UBFA 4E41B 3LV3A 1LE5A 4XPBH 2OL3H 1L5GB 1RZIB 3KAAA 4L4VA 4RAVA 1IL1A 4FTVD 4TYUA 4LLWB 4Z23A 1I82A 3DX8A 4XP6H 5DK2A 2J1YA 2GJJA 4P5TC 1ECZA 3Q2LA 5FYLE 2XNAA 1KCUL 4L4JA 4F8TA 5HYJE 3LZRA 1T5XB 3ERXA 2VXQA 3O3BA 4KK5C 3DPBA 1RIUL 2ZSWB 3MV7E 4YFEA 3ZO9A 4TTDC 3KJ4B 1BQ5A 2IO5A 5JPMA 3FUFA 2Y36L 4LSTL 2X09A 3MLZH 1CN4A 1PFOA 3C6LB 1PLGH 3GLEA 2J56A 4N1CA 3WJJA 1CLOL 3QUYD 5TQ2H 1KN2L 4NO3B 3QJQB 3X1EA 2JXMA 3WLBA 3O11A 3W1ZA 4JB9L 4AQAB 3GHEH 1TZGH 4M03A 2H2SD 2YUZA 4HIEB 2XY2A 3OWRA 5KYNA 1XGUB 4CN1A 1SY6H 1R47A 2FEDD 3FOMB 4LRIC 2WTRA 4NXKA 4WHDA 3KYKL 1P6AB 5ACZB 3OR7A 3DV6B 3PDGA 3AACA 2OMWA 4QY8A 4F8LA 2VSKB 1UWFA 4YSQA 1YC7A 5TD4A 2EIDA 4TSAL 4PRBB 1UC6A 1TYJA 1HHKB 4NZUH 2JKXA 1MW1A 4RVBA 4F57L 4LCCA 2JCCF 4I7ZC 3LQZB 4B96A 1WISA 2WXNA 3MOBL 3NPSB 4DTGL 4KKBD 2F5AH 3QQ4B 1ACYH 4ZFGL 3L81A 1A6VL 1UA3A 3FU9A 1JXKA 1YZZA 5T8IA 3O6KL 4HEPG 3TA3A 4NQEB 2K45A 4JANB 4PGBB 4M6AA 3SGDH 5I1KH 1RSYA 4HCRH 1FWXA 4K23L 1DN2A 4OAWB 1NCHA 1MHEB 3SJVB 1CGSH 1RL1A 3OAUL 3FCSA 1ZMYA 4RLDA 5E6ID 3GBMH 1QSFB 3Q6FB 3QDGA 5D7KD 1MVUA 2Y3AA 4LLYA 1FV1B 4NAMA 2EIKB 1ZSDB 3B5TA 2AQPA 4FXKA 1HSAA 5IEKB 2GUOB 2ZOOA 1Q9WB 5KS9B 2C1OA 2CDGA 1LO4L 4DGUA 5E0QA 4U6TA 3VXTB 2EAEA 2WBXA 2UYLB 2XZAL 3VNZA 1ED3B 1KTLA 3BKCH 5ILTH 3M17B 5FYLL 4XPTL 4XCEB 4K5NA 2OJ1A 4BYHA 4ONHB 4XO5A 4Q2ZA 2NYZA 3L45A 3CHSA 3ZE2E 1O6SA 4JE4B 3V0VA 4N2EA 4NAJA 4F7CB 5C0IB 1QUNB 4FZ8L 1A9EA 2F53B 2G9HB 2BOCA 8FABA 1S5IL 2V7HB 1Q94A 4D8PA 3S88L 4Y7MA 3W0WE 3IAQA 1ORSB 2P8LA 3JWNG 1RHFA 3RRQA 3QUZC 5DJ0B 2DQDL 1DQLH 1EAPB 5B1JC 2WLYA 2JCWA 5IB3A 4OH2A 5DRZB 1KTKE 1G5AA 1BFTA 3TVMA 3S4SG 3DO4A 1RMFH 1J9CT 1X5IA 3RQ3A 1U93B 2HFEB 3U46B 4O2CA 3GD1C 4HDIA 5CLWA 2F53E 1T7XA 3VFNA 3X14A 4KRPD 2YUXA 5DO8A 1NC4B 3ALXA 4XVTL 3MO1A 2WYHA 2VMEA 5HYJD 3VRLE 4I0PB 1AMYA 1CICA 4WF7A 2YMXH 3GBEA 1IAMA 2I60L 2B1AH 3C8DA 3DSFH 3UCRA 3ZDYB 4HUKB 3QCTH 4MMXC 1JOIA 3MV7D 1TOXA 1JZHA 3HA0A 2E3VA 3GRWL 4E41D 1JNLL 4OIIL 5DD0H 1RFDH 2AZUA 3FFDB 3P9WB 4F8QA 3HG0A 2Z91A 4F15C 1KTRL 1SJHB 3KYNB 3IGAA 4WO4B 3W2DH 1DSYA 1QHOA 25C8L 3JV5A 5I1CL 2VISA 1LO0H 3WXVL 3ZUNC 1M7IB 1WEJL 4AM0B 5J4MA 3DETC 5EUKA 4TMPA 4BKLA 3MNWB 3GQFA 3FO9B 4BFJA 3MMEA 3E9TA 1TTFA 5EUOA 3ILQD 2DJ4A 5EDSA 5HDQL 3FJTA 4LHQB 5ICXB 3FO1A 3W81A 2MHAB 1YEEH 3KCPA 2CLRB 4LSSH 3NJKA 1HVXA 3VFWB 3IAGC 5EOTA 2DWEB 3GXIA 1RULH 1OT1A 4CADB 4F7KA 5F9JA 5F7UA 4WI5A 3ATEA 3ZQWA 1XH1A 3KWXA 3PWUA 4TKWA 1T66C 5BV7B 3OMIB 1ZCRA 1EO7A 4XVOA 3T3PB 3KZ8A 1I1CA 4AIZB 3SY0B 1SLXA 2A83B 4MXQC 3HN3A 1S4IA 1WBZB 2O5NA 4ZTEA 4IRSC 3TNNB 1VDGA 2J5LC 3CVBA 3MODL 4CW1A 4KZCA 2QDVA 2ICCA 2Z31C 5DHDA 4JUSA 4FNRA 2IDFA 1E6JH 3ULUF 3SPJA 1XSOA 4MKMA 5H35B 4MMZA 4I48B 1N6VA 1S5HA 3F6JA 4HK3N 2D8KA 2FBJH 1AXSB 1A4JA 3T3PE 1O5DT 5FB8A 1YMMA 1WICA 5EIIG 1UXLA 2Y23A 1WVZA 1ZS2A 5HHVL 3QS2A 3VXQB 3S36H 3PF2A 4TNVF 1NBZA 1KXQA 1JK9A 4LOEA 3QHFL 1NAMH 2XVLA 4N2MA 3C9NB 1OT2A 3N85L 3SJVD 1U8KA 4U1NA 1UQSA 2OZ4L 1CYXA 1OAYH 4AKPA 2F54E 5EU5A 1QSFD 2WSPA 1PBYA 5ITBH 3SDYH 4OLXL 4HXBL 4ZO7A 5HTSA 5FO8A 5L2KA 2GTWB 2QSQA 2IAMB 3WHXB 2ITFA 5D93B 3AG3B 3PJSA 3V0FA 2OYLA 3OKMB 2XIIA 1E27B 3VXSB 1GC1H 2LT9A 4E9QA 3B6SA 4OFQA 3FUEA 4QRSB 5DJ6B 1JXFA 1WYJA 3SYOA 4JDTL 3OKNB 4GSDL 4N0CC 3WSQH 4GG6E 4R7NA 1EHNA 5LGYA 4XBEH 1U58B 2A1WH 4OLVL 4PJ9A 3RWDB 4FQ2L 3RWFB 5ADPH 4X9BA 3FU7A 4PMEA 4G82A 3D0LA 2EUXA 1FVCA 1F4XH 1XXFC 5D2NB 2F53D 4NQQA 4PLKC 5H94B 3RWCA 4AYID 2EICA 3QEHA 4EI5A 2AJUL 5CKGA 2MOQA 1E4WH 4G9DA 2Q1EA 2RAMA 5DO2C 5SWSA 1TCRA 1YQVL 3CFQA 4LEOB 1KELL 3BIBX 1N59A 3ILDA 4FYTA 1UM6H 1Q9OA 4B5EA 4I1NB 1SMOA 5JW5B 3DJZA 5JNYA 3FO2A 5ADOL 4F37F 4C56E 2LE9A 1NEZA 1ZLUH 1KB5B 5D7IA 4EDXB 3MRPB 2DPKA 4UT7L 5HGAA 5AENA 1NC4D 1NIBA 4YE4H 4P46B 1SEQH 3T2NL 3IMBA 4MS6A 1N70A 5DLLA 4I0PD 3MJ8A 4QRPE 2Q7YA 5TDOA 5GGSB 2E6QA 3L5WA 2IH1B 2R0WL 3D48R 1OTTC 5BZWB 1LDSA 1NLDH 5GGRB 4V2BA 1JZ4A 4XH2A 3EJQA 3TO4B 1FGVL 2FJSA 2R2BA 1UEYA 2KYIA 2BVQB 2KMWA 4HS8L 4JEGB 4JFEE 1EFXB 1GW6A 4K3JL 4B6ZA 1DBJL 3BO8A 2JKJA 4WO4D 3QJXA 4OZ4A 3SQOH 2XPZA 1VPOH 3BPLC 3MBEB 5C0EA 3UAFA 3IGFA 3RY6A 5D5MA 3SCMD 4P5KA 3GBDA 3QB7C 5EOQL 1XWVA 2VDLL 4UBDD 5CSZB 1ZT4A 4HF5H 5GZND 1D2PA 3CSYB 3O4LB 1HKLH 3FTXA 3GHBL 1UB6B 1U41A 3IRPX 3LRSA 4YGVA 5TQ0H 1UJ3B 3QUMH 3QJHB 3GB7A 4OGXH 5EH1A 2QV2A 1ND0B 1NUGA 3FHQA 1T6VN 2AEQL 4XMWA 4TN9A 4XAWL 4ZO6A 5CEYB 3WTWA 1U42A 2GK0B 5K39A 2FUQA 3EXLA 3MLRL 3KLDA 2WINB 3UZQA 1F1DA 3IDMA 2UY7A 5HHOA 3KLHC 2VQ1B 3KPOA 3L1EA 4UAOC 3P73A 4OVVA 3PV6A 3CBKB 4KY1H 2DEYX 3SBQA 3V0WL 1ZS8A 5I6MA 2HFFB 3CHXA 4WU7B 3U6RB 3FZUC 3PWVA 3C5JB 2CR6A 3WNIA 1A0QH 4QOKA 1I9RL 1USQA 1FZJB 1R34A 3X1NA 1KYOJ 2I69A 3O0RH 4DUVA 3RGHA 4H8VA 5EO1A 4CU6A 2AJSH 2F54D 4TNFA 2QVIA 1E90A 1KIPB 4JKNA 4NS0A 1OP4A 1TYRA 2NY1B 5IQ9A 2PPCA 4MASA 4PVMA 3SKOA 4DNLA 1FVEB 2YOAA 1F41A 4KFZC 1R33A 5DR5L 2K6ZA 4H8UA 2W9DH 3HZKA 3D3VE 3QO0A 3ZIMA 4MA3A 3MGTA 4QJ5B 4OUUA 5I1GH 1CFTA 4OLWH 4S1QH 5GISH 4DN3L 1G0DA 5CFHA 2ORBL 2LABA 5EOCL 1GPOL 4ELMB 5DWPA 2QADD 1HT6A 3L9RA 4LF3B 5FUCE 3VI4F 1RLWA 3ZYJA 2VO8A 5LNGA 3IJEB 2F1BA 5CZXC 5FHBH 3O2VL 4LPWA 1N7ML 5D7LB 4OZGB 4LLAA 3UJIL 4Q9RH 1OSPL 4HBQA 1JV5A 3H42H 4Y5XA 1AZUA 4YZFF 3TPKA 4LASL 1Q4NX 5FFGA 2QV4A 1V8HA 3PP3K 4XVUD 2Y25A 3NAAL 4I88A 4LSUL 4L18A 1PAMA 2ZUUA 4DPAX 4PJBA 2W0PA 1L7IH 2YARA 3GRBA 1AR1C 4S1SL 2TRHA 3VWKB 1CI5A 2R56L 2ILLA 4EUPB 3FQ4A 4U1MB 4EN2A 1PD6A 1FRGL 4KKZA 1GAFL 1T3FA 4OZGE 2J88L 4NCC1 5GJTL 5I76B 4FKEA 1U2HA 4XOCA 2F15A 4XZUB 3O2DH 4IHOB 4G6ML 4X4YB 2B0SH 3IFOA 1TVBA 4PREA 5DS8B 5HYIA 1E0OB 2AXFB 5DUPL 3V8OA 4TNWF 3ZTNH 5I74B 3O3DA 3K72B 4FYSA 4X8JB 2VMFA 1MJUL 2QKIA 1YJDH 2VQ4A 5A3ID 5E99L 2HG5A 4XHJD 1E8YA 1OSEA 1J12A 1UGKA 1VZIA 4OB5L 2QVKA 4FI8A 3F85A 2BSDA 4TQIA 5JQIB 5LGHL 4QTHA 3K7UA 3LS4H 3LXAA 2CDFA 2GYSA 3HC3L 3G04A 4QHUA 3JT0A 2VCOA 3AW5A 4GBXB 3SYQA 2H26B 5PAZA 4HWBL 1W72A 4GAFB 5T5NG 4U1IA 3QS3A 3D30A 2EDNA 2VTFA 2ATAA 3Q6GH 3SPHA 2WWOA 5A6LA 1EFXD 3FMGH 4YPJA 1J0ZA 4F1SA 2QQLH 2NTFA 2R4RH 1XGTA 3MBED 1CUOA 4M61A 3WNJA 5F6HJ 4UINH 4UM9B 3L3GA 3MA9H 1S9WA 5CZRA 43C9A 3O4LD 1KT2B 2YLKA 4N8CL 5I5IA 3VSQA 1ONQA 2PKDA 4NM4L 4JFPA 1LK2A 3QFJB 4X6CB 1Q8MA 4GT7A 4XBPB 4WLCA 5DZ9A 2CO2A 1FNFA 1HH6A 2IBZX 4Y5VC 1X4YA 1P7QA 3L3KB 3VD0A 4Y4HB 4LLDA 3MRIA 4NQCB 3L4TA 2I9TB 2Q3AA 2CHXA 2E76C 2A6IB 3KPNB 3VE0A 3HZMA 4IJ3B 4LP5A 4YDKL 3PJLA 4ZXBA 3VMNA 2YD3A 5F3HB 4Z7NB 4H0IA 2G60L 3A6OA 4OD2B 1BX2B 1OO2A 2OJZH 1U92B 3TS8A 4PCTA