1EGJA

Domain 4 of the beta common chain in complex with an antibody
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
IQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CYTOKINE RECEPTOR COMMON BETA CHAIN PRECURSOR
publication title Structure of the activation domain of the GM-CSF/IL-3/IL-5 receptor common beta-chain bound to an antagonist.
pubmed rcsb
source organism Homo sapiens
total genus 12
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1egjA00
4AEEA 2HG5B 1S7WA 1C7SA 2D7OA 4G5ZH 5EOTB 5A2IH 4GRMB 4XHJC 2MCPL 3KJ6H 1A9BB 2AJXL 4A2MA 1MCOL 4HDIA 3OGCB 4JO1L 1U41A 1PQZA 4YDIL 3VXUD 4P2QB 5E8DH 2D0FA 1KIRA 3F7PC 1P9MC 2PO6A 4NC1C 5ICXB 2VQ1B 4Z0BH 3EJZC 2CIKA 3S34H 3Q6FA 4BH8B 4EN3B 3W82A 2WSKA 5DR5L 3I9GH 4FQJL 4GAGH 3HNSH 4Z95H 1HK6A 1UACH 3PQYE 4FQXC 1JZ2A 1JFQL 4PRPB 3WKML 5B38G 1UVQA 3AS0A 2KPNA 2X42A 2R1YA 2DKMA 2XRAL 4XPTL 5MEPA 1NBVH 3B2VH 4OD3H 3X11B 1T89C 3R1GH 5ERWA 1ZHNB 2Q6WB 1R3HB 3QAZC 4LU5L 4GRWB 1BVLA 2Z31B 1OGAB 5FECA 1KPUB 4FOMA 4NQCE 1IKFH 1FNAA 2NW2A 3S3JA 4Y16C 1EO8L 2L7UA 2XZAL 1TCRB 3B3IB 2HN7B 3K8MA 1E4KC 2DYPD 3G5YA 4XNZC 1XF1A 4WCYL 3RA7L 3JWOH 3WS6A 2GTWA 3VRIB 1G7MB 2B39A 3MV9E 3H7BB 3MRGB 4DJMA 1EHLL 3ELAT 1CF8H 1XMWA 1FZKA 1U8HB 4MMXC 5I8OL 1JNLL 4CVUA 2CJUH 4YJZL 5C86A 3SY0A 5HI5D 5BO1L 4L3AA 5L9DH 5I19L 2M2DA 3L3OA 4NZRL 1C5BH 4YQXL 3SDDA 2EO9A 43CAA 2FJFB 3VFVB 3P11L 1FG2A 1H5BC 4DEPB 4XPFH 1IAMA 3QWOA 5FM5O 3AMLA 3LSOB 3VXNA 2VXQL 2Y7QA 5FO8A 4IRSC 1IARB 5HGAB 2R56H 3MLXH 2VLRB 4KRPC 5DRXA 5DFWH 3UTSE 4KRLB 1KJ2H 4RFEA 3BRFA 4Q9CA 4PRBA 2P24B 3P9LA 2DKUA 1AKJD 5IB1A 1QFHA 3MRQB 5EBLA 2OR8A 4RQQB 4JKKA 4NO2B 4I0PB 4LKXB 4YHOL 2CGRH 1IT9L 5JR1L 4PPTA 1BFTA 2YOCA 5BS0D 4MA3A 3C2AH 1VADA 2FDBP 1D6EA 3VRLE 4JO3L 4HKXB 1Y0LA 1XR9B 5BV7B 2ERJB 2VDNH 1UZ8B 3CX2A 1J0JA 3PWNB 3RZWA 3DO7B 4TVPD 1MOEA 2YD7A 3EOAB 4GKZB 4XP5L 1JGDB 43C9A 4K7FA 1UM5H 3MNWB 4ELKA 3FCTB 1QKZL 2YN5A 1JGEA 3FQRA 3GHEH 4WHYH 1BZ7A 3LPGA 2IFFL 5A3IC 1EEYB 32C2A 2OTUA 1S9XB 4HBQA 4DUWA 4W4OC 5AAMA 2WUBL 2W0FB 1T1YA 2NY5H 3P0GB 5GGQH 5JPNB 1SYVB 4HBCH 4FN0A 4P5TC 3S98A 1BBJA 1HKLL 1LO2H 3E0GA 1EEUA 4FQQA 2CUIA 3WD5L 2FH6A 2BY3A 1LO0L 1KJ3L 3C08H 2YK1H 2OR9L 3EZJB 1V8HA 4OFDA 5C08E 2CKBA 3C5SB 3QHTC 4XRCA 4PGEB 1UWXH 4RCAA 1I75A 2YD9A 3B8SA 4MZ3A 3DXAB 3Q5TA 1XT5A 5DEZA 4OCRH 1NC2D 2VLLA 4LDOB 2JELH 3D3VB 5ECJE 5DZOA 4Z7VA 1T1XB 4LASH 4Y5YA 4EDWH 1FC2D 3IXAA 3LPWA 3QAZB 2DN7A 4KKBC 1OLZA 2VLJA 2F8XC 3TJEL 2NW3B 3ABZA 4PRNA 2DQCL 5TDOB 1A6TB 5EUOB 2O5XH 2AJSL 3TF7C 1YQVL 3W9DB 1MJUH 4YNYB 1BD2B 3RZCC 4XNZB 1GXEA 1HH6A 4XAKE 1FFRA 1SYSB 5C0IA 1J1PH 4Z7VF 5AYUL 1YN7A 1JNHA 3O45A 1JWSA 3LEXB 4XX1G 5I1AB 2VR9A 1K8DB 3AY4A 4EUPA 4F33B 4NSKA 4NT6A 4OGZA 4I9WD 5JMRA 3VWKD 3U6RA 5F7DA 2AW2A 3O6FD 5DSCB 3INUH 4PTUB 1CDBA 5GQBA 2V17L 4YXLL 3I2CH 3QPQD 5MEND 3FQUB 2OJEA 3EO0B 3MA7B 3STLA 3U82B 3DX6A 5EUKA 3ILPB 3CLFH 2BOBA 1EEQA 4P57B 3IKCB 5J11B 1Q8MA 4HKZB 3O2VH 3QWQB 5ILTL 5EC2B 1B90A 1H5BB 1BFSA 4X8XA 5E7FA 4LCYA 1XF4B 3FT4B 2I26N 5CJQH 1SHMA 3IS1X 4PJEE 2BMKA 4KRPB 5FF6B 3SJVB 4CBPA 5IT2L 2YD3A 1EBAA 1NMAH 2HVJB 3IGAA 3UJIH 5DZLA 4IBLT 4POYA 3O8XC 4YAQB 4F7CB 4G7YH 4HH9A 2BNRB 1PFCA 5CEZH 3GO1L 5ACZB 4PFEA 4R6UA 3QFJD 4QNPF 3W0WD 2IANB 1G9NL 3MV8D 2CQVA 3L95A 1NSNL 3OKYA 1P5UA 1BFOB 2ADJB 1OHQA 4UOJA 4OZGE 3B83A 4H1LA 3TA3B 5JW4R 3VH8A 1Q94B 4R96B 4NRXB 2FYYA 4KPHL 1OB1B 1DBML 4ODVH 3NIDF 4JHAL 2ZG3A 3P4MB 4ZQKA 3W5MA 3D39A 1QSED 5FYLL 1RK1A 4UTAH 4XNUH 4QHKI 3E3QE 1P4LB 2NX5D 1H8SA 1P7QA 4Z7UB 3V52L 1W72B 4M7LL 4WUKL 1CG9A 5L0QC 5GJSL 1J8HA 3TBVB 4NBXB 1MJ8L 3HE6A 1NCAH 3H9YA 4LVHC 4HPOH 2ATPA 4PB0L 4WI7A 5BZDB 5FYKU 9CGTA 4CJ0A 3AC0A 1JRHI 1CGVA 5DYOA 1F3JB 3Q2CA 5I2IA 5KSBB 3ZDZF 2OL3L 3JTTB 4JDTH 1PY4A 1JN6A 3PHQA 2NY3D 4HAFA 1R3KA 4LARL 4XCCH 4KKAD 3RL2A 2DIBA 1AC6A 2MHAA 5CEYA 2A74B 5KW9L 4M3KB 5I8CA 4X8JA 4DAGH 5A16A 3JWDH 1UA6H 3PWPE 4AL8L 5B3JF 4P4RB 1KXVC 3TN0A 4I18B 2D2OA 3LAFA 2Q8AL 3FONA 1MF2L 2DI8A 2GW5A 2XICA 1FORH 1PSKH 4KK5D 5GS2H 4S1QL 1P7KA 4JN2B 2OS7A 4LGSB 3DRTB 1NC4B 1Q0YL 2A1WL 4HWEL 1GC1H 1FLTX 4XNQA 3AROA 2F53A 2HKFH 4JZNA 3UPRA 3L3IB 4UQ3A 3MOAH 5IHZA 4U3XA 3QR2A 1KTDB 3GI9H 2BDNL 3QIWC 4FABH 2OZ4L 3P77B 4D94A 3GMRA 3O9WC 5K9JH 5J4MA 5IFHL 3L5WB 2YPLE 5CJOH 3MRKA 3QNYB 2Q3AA 4N1HB 5D2NE 4UBDD 5TDNA 5C0EA 5ALBL 4YPJA 3EKCA 1OWRM 2FHFA 3NIFF 4X4YA 4EUPH 2X4RA 1DCLA 3C5JB 3MV01 5D1ZD 1LO4L 3G9VA 1KTKE 1MQKL 2SEBA 5DHXB 3D69B 3GK8H 1BIIA 3KPPB 5I18H 4KXZI 3RWIB 5FA4B 4X7DC 4E41A 1CFVL 5D5MB 3NFNB 5B22A 5FM5M 4GBXC 2NLJB 3ARTA 3QEQD 4FFWD 1MLCA 1XGRB 3B9KC 4X6CB 5DJ0A 3DJ9A 4PP1D 1JHLL 2HJKA 3KXFB 1B6UA 1X5FA 1DBBL 2E9JA 3QEUA 4JDZA 4MAYA 2F54B 4U1IA 3WNNA 1J86A 1AD0B 4JLRB 1K2DB 4PRIE 2R1WA 4HUMB 4R0LB 5D1XA 5HI4D 5C0JA 4YHZL 1AC0A 4JFEA 3WHXA 3Q1SH 3WN5A 1U8PA 2VABA 2NY6C 4JKWA 3VXOB 1A7RL 3MLZL 1DBAL 4JFPB 3M1BB 1J5OL 1JHTB 1EFXD 3LQAL 2RR3A 4LP5A 1QOKA 4MAUL 4QXUH 4U1GC 1S7RA 3T09A 2AXGA 4HKJA 1F00I 5T3XD 2X4SA 1ZSDA 1F4WL 3O8XB 2G75A 4AQOA 4JJHA 5EU5A 3BZEA 5LBSL 2D4FA 5BOPA 5AZEL 4Y2DB 3C09C 5CEZD 3ZDYF 5ICYB 4H1LH 2E7HA 4RFNC 1CTOA 1MI5A 4QWWD 2KKQA 5E99L 1CDYA 3FKUS 1SJVA 4MLSA 5J9PA 4N9GA 3PL6D 2MJWA 2VMFA 1CFQA 4EI5C 1OAQH 5KOVC 3ZE1F 4ZYKA 1U3HD 3QIUA 3MX0A 3N1MC 2GCYB 5IB4B 1UENA 4G42B 2H3NB 3HCVB 4QYOB 4ACPA 3EYOB 3VXSA 5J3HC 3WHE0 2QQKH 4XVSL 1FNHA 4O4YL 4R7NB 2YRZA 4LHQB 4PJHE 1S3KH 4OQTL 3KPRA 5FGBA 4A6YA 3U2SA 2A0LD 4K94H 3IDIB 4AEIL 1R0AH 4E0RB 4LAQH 3UXFA 1W0WA 3MRCA 1CLYL 1IGML 4C4KT 3EGSA 3KLAB 3ZTJG 1YEKH 3NOIA 1KC5L 2YUVA 3REVA 3MRLB 2EDTA 2CRIA 2V7HA 1RK0A 5GGVL 3V0AC 2GEEA 2NYYD 4KJPC 4X4ME 1YC7A 4XAWL 3TZVC 4HK3N 3VXRA 2JTDA 2GYSA 1B0RA 2AK4D 2VRAA 3FMGL 5GS2D 2FRGP 2YKLH 1NGPH 1CU4H 5D70H 3PHOB 1DL7H 3LZFL 4U33A 1SM3L 3FO9A 2P42B 1S7QB 2HKHH 1U8OA 4HIXH 1ZTXL 4YHYC 1GCFA 3QIWB 4W68A 1PKQE 1O7SA 5I1CL 4YHIA 4BQ8A 3T4AB 4Q2ZA 2Z92A 5KSVB 3JV5A 1IC4L 4QRRD 4JQIH 5E6ID 1CXEA 3HKFA 1JGLL 1ES0A 3BKJL 1A3RL 1ONQB 3RPIA 1D7FA 2Y07L 2ZP0T 3SGJC 3LEYL 1S7TA 4LLDA 1YPZB 2I60H 5C0CA 1Z3GL 4ODXB 1A21A 1U2HA 2FX8L 2ZUVA 3LEVH 1FH5L 2CUMA 3QUYC 4KKCD 3BP4A 3SOBL 4Q97A 4ZXBD 1RIHH 4HIEB 4JQVC 3FB8B 5ABDE 3VGFA 5IW1A 2DRUA 5EBWB 3QDMD 1MFEL 4L9DA 2VDPL 2YA1A 4MDJA 4RZCB 1PEZA 5IHBA 3O4OB 3S88L 1HWHB 1QLRA 4LCIH 2IF7A 4MCYB 4AQ1B 3TGXA 3W39B 1NKOA 4NYLB 1R5WA 3W9EB 2A9MH 2RBLA 4LPVA 1QZ1A 5F9WC 2O5YH 2AXFB 2W9DL 5C0ND 1I8IA 5FM8A 4EZMA 1MNUH 2QQQA 1EAPB 5J57B 1MWAL 5DJCB 2EDYA 4MLIA 2GTZA 1MFCH 1HINH 2H2PD 4HWNA 4GRLA 1SBSH 5EZJA 3P0VL 2JCCA 4LCWD 4QOKE 5TQ2H 4M5ZL 3LKNA 4I3GA 1DQML 3WO4B 3RIAF 1SJHA 4XMKL 5CJBA 5DMIL 4N0YH 4EI5B 4ODTL 1LNUA 1MPAH 3NPSB 4KAQL 1AGFB 4HH8A 4XCFL 3TCLB 1K4DB 1EIBA 2BSTA 1RIUH 4N8VB 1S7UA 5F7UA 2QKIB 1PJ9A 1H3WM 4YXHH 5ICZB 1G7PA 5B3NA 4JPKL 3KPLB 1I3VA 4G8GB 1OM3H 2JCCF 4HGMA 4PRDB 4Y5XC 1C16A 2AK1H 3UX9B 4XGZA 1DBJH 4JHWL 4TNWF 4W81A 4XCNB 3ULUL 3O4LA 1FO0L 4OZFA 3O3EA 3RTQC 1C12A 1VGEH 4IOFD 2NXZC 5LGJA 3SE3A 4WI9A 4MA7L 3KPSB 2CDGA 4BFEA 4KZEH 3QXUA 4NNYB 5C7XH 4U1MB 5HHNA 4HFWA 3FQWB 2Z91B 4GW1B 1EUUA 1KTLB 4L3EB 5CD5C 4P9ML 5IROA 2VLMD 3BHBB 3GSOA 3KYAA 4O00A 5HYQA 1YNTB 2GJ6A 3VDCA 1IC7L 1HZHL 2EDJA 4APQB 2XN9B 3P0YL 5DJ8B 4UIKH 1YNLL 5JDSA 1G9MC 3K7UA 4ZS7H 3E8UH 4I4WB 3IKKA 4N8VG 5DUML 4PREA 4N5UA 4ORGB 2YD6A 1J9CT 2QR0A 2CXKA 5D7LE 3NFPB 3MRRB 4URTB 4Z78B 5LVEA 1Q72L 5EA0L 4LFHG 4U4BA 4JFDB 1MH5B 5JXED 3V4VH 1KSRA 5GZNC 4NM4L 5L88L 5DDHA 4FQHA 4HWBL 2PW1B 4ZOCA 3EAKA 4YHYB 4OZIE 3QG6B 1M71B 1OSZB 5KS9B 5T5NG 3RVVC 2BXZA 5CP3A 4WUUE 4U6XB 5I0ZA 2FSEA 5CFHA 4Z7NE 3BKML 3OTTA 5JNYA 5D7IA 4HS8H 4WHDA 5FYJL 4UILH 1MY7A 4KQ3L 2GHWB 1EGJH 3MLYL 2R1XB 1AQKH 2HJFB 5F1NB 5HHVL 3EFDH 1TJGH 2B1HL 4WWKC 1MEXH 4ZTOH 3WFCL 2P49B 2VAAA 4JFFA 2PR4L 4JKMA 5F70A 5F44A 5IR1A 4XBGB 2PTUA 5TE7L 3PQYB 5INCB 4OGYH 1I1AD 2P5EE 4G6AC 4YHKL 5DHVA 2Q86A 4FXGB 5GGSY 4BZ1L 1OAUL 5IBUG 5ENWA 2NTFA 4JCLA 4RGOL 4HLZH 5D7IF 3HE7C 1A1NA 1FIGL 3RVXC 4DKAA 4G6JH 2NNAA 2R0WH 4ZMAT 1S7VB 3TT3H 3GB7A 1YEGH 4Y16A 2UY7A 1CD9B 4TRPH 3BEVB 4MQTB 1N3NB 4NQCB 3RWJB 4LVOC 4HUKB 3FRUA 4OLWH 4B7IA 1TJHL 4IS6B 4ETYA 2R4RL 4QLRA 2XY2A 1AGCB 3VMPA 2QTEA 4NWTH 2YZ1A 2V9QA 4P9HC 2AV1B 3DSNA 2R69H 4K7PH 4MS8D 2YN3A 4XP4H 3MV9B 5TF1H 1RJZA 1A0QH 4K9EH 3V6FB 3IAQA 4JZOB 2PYED 3LKPB 3BW9A 5LJYH 1DVFC 2DTMH 4NM8H 3B4NA 3OQ3B 3GSWB 3O0RH 3MODH 4JJ5B 2YC1B 3B43A 5T1MB 5ISZE 5FO9A 2EYTA 5FK9A 1D5ZB 3RX5A 3RKDD 3HI6H 3R06B 5IQ7H 1ACYL 4UT9H 3O11B 2GJZB 5C0AA 2OJZL 3QIBD 3SKUD 2GIYA 5I1LB 3ULVE 1IBGH 3CMOH 4G8IB 2ZOKA 4KJQC 4U1NA 5F88B 3UTSB 5I30H 4X6EB 1EJOL 3CVHA 3RQ3A 3F65A 4YDJB 4J8RA 4LLUB 1HSBA 4I5BA 2G60L 3RTQB 1P2CA 2D9CA 2IADA 5KBNC 4ZOEA 5GRUL 3TNNA 5KSAB 5HPOA 3MRDB 1HHKA 1VERA 5DMGD 3TT1H 3C60B 3IDNA 4NJ9H 2GFBB 1T2QH 4F7MB 1NLDH 4ZUSA 4PGDA 4X7TB 1U95B 3ARBC 2C7UB 4LQFL 5I8EB 1BX2B 5A2KH 3BN9D 2VL5A 4ZUUB 1QFUL 1QFPA 3K0WA 4OD1L 4ZFFB 5IV2B 4JKPH 4BSWB 1NANH 3PWJB 4C83A 1WFNA 5I1JL 1XGPB 1F3RB 1NKRA 1H0DA 4M61A 3BUYA 3E3QC 3EO1A 4IIQB 4W70A 5F8RC 5D6CB 5JHDE 1MHHB 1V3KA 2X4NB 5D1QC 3A6OA 1J88A 3S35X 2QADD 1AE6H 3V6OE 1IGJA 3MLSL 4W4OA 1KB5L 2C1OB 4P2OD 1G7QA 1EJ6A 1I8KB 2EKSA 1F4AA 5FYLE 3GSNA 4JFYB 4IRJB 4Y7MA 2EDOA 1F4XH 1A1MB 4OCYH 2FD6H 2I9LB 1U58B 1A6WL 2FJGA 3GMPB 2D4DA 5CP3H 4UINH 2ENYA 2Y6SD 5J12B 4P2QD 4PJ5E 1X5AA 3BEWB 3BXNB 2DJUA 5C6TH 4XWGH 4FG6C 5C0BB 3RU8L 4NWUH 4KVCH 4L9LC 1D5XA 4JEGB 4KTYA 4EN3D 1I3RA 4LGRB 5CHNB 3VXMD 3EHBC 1T5XA 1K6QH 3VG9C 4L5FH 1A7NH 3PNWA 1OAZH 4PRPD 3FOLB 5CP7A 3TV3L 1NGXA 5IKCB 1RUAL 1A6UL 5DQDL 1MCDA 1S7SB 4X98A 4QHUB 3HMXA 4N0UA 5ESVB 1I9RH 2ZUXA 2EDFA 3HE7B 1OGAD 4HX1B 3BPLC 5ANME 4HULB 1A3LH 4PGCB 4FXLA 3I02B 3MLPA 4JRXA 4OLEA 3GIZL 4WW1A 2L7JA 1RQ5A 2CKBL 5E9DE 1YEIH 3BX7C 4NZDA 1DJSA 1VA9A 5D2NC 3RZCA 4FQLH 4NHUB 3JSSA 3SQOH 1J1XH 1LGVA 4ZNEE 4LHUG 4PRHA 1XCQA 1ED3A 1AP2B 5HY9A 4RA0C 4IHOB 2X70B 4NQDE 3TJHC 3FOMB 3BFOA 3BYYA 2MQ3A 5HD8C 3OKEB 1R3IL 3EYQD 1TLKA 2W65A 5F7MC 5KVEL 5D7SH 1IAOA 4QTHB 5D71H 3SKJH 4N68A 1YEFH 3S37X 2OK0H 3I85A 2VDOH 3OB0H 4U05A 1FL6B 2FEDC 5I1HL 4RRPA 3MUY1 2VLRD 3UTZB 2C4XA 5KVFL 3T0BA 2QHLA 4RAVA 5E00A 2AEQL 2EXYD 4OCWH 2BVTA 3CVHH 2BVPA 2QQNL 5F21B 1GHFH 3IF1A 3GRWL 1P1ZB 5I15H 4X80L 2JK5B 1KEMH 2AJ3A 5DJ6B 1N5AA 5LXGH 5FCUL 5EU4A 1GIGH 3WS3A 1FN4A 4DCQA 4XCYB 1AXTH 2HP4A 4J4PA 4X5XB 1WWAX 1SY6H 4CMHB 2WQ8A 3MGOB 4GAJH 4F58L 1YJDL 2NTSP 4X6BA 1Y18B 3HZKA 2OI9C 1T04A 4XP1L 3A6BL 4D3CH 4OZGB 4HUUA 1QFWM 3SKOB 5CZKA 4PJFE 4NUJB 1AY1L 1UXSA 3Q6GL 3UJTL 1ZA6B 1F90H 4AIZA 4BQBA 2DWDA 1EMTH 3CPLA 2WBJC 3GSVB 2MFNA 1NJ9A 1T03L 1GH7A 2VDKH 5D1QB 3IAPA 4J2XA 5F96L 4PJCB 5EIVA 1AIFB 1R5IA 4RGNC 3WIIL 3MXWH 4JR9L 4X4XA 1GGBL 4JY4A 3DV6A 4ELMB 5ID0B 3VFWB 5DVKA 4D9LH 4XHJD 4ZG1A 4RA3A 2OXHA 2F9BT 3VFGH 4ZNCD 5MERA 3ALPA 5BQ7A 3NZHH 3BPOC 3D6GA 4DOHE 3VWJC 4FQIH 4PJBE 3EJZD 3LY6A 1AI1H 1PKOA 1QTYT 3PWPB 2ILLA 3H2WA 3QDHA 3U79A 1DEDA 4UB0H 5ETUB 3WJLC 1Z9LA 2N7BA 3FB6A 1U92A 4OFPA 4RFOL 4FFYL 3SDCC 5JOEA 3WIHL 4FQXD 3BZFB 5FGCE 1IKNC 2WWKT 4OJFH 4RISL 3WL9A 1U42A 2DQEH 1OTTC 5GZOD 3V5KA 3OR7A 2G9HB 4JG0H 3KYKH 2AP2A 4L8DA 1OD7A 5B39A 4BH7B 5MHSE 3T0EA 3VI4E 5KVGH 3G5VA 4Y4KB 1D5MA 1W8NA 2VZSA 3NN8A 3PJSB 4HF5L 1MREH 1JRHL 5C6PB 1GZPB 4NQEA 1I8MA 2B20A 4QXTA 3BT2L 2OSLA 4P4KB 2BNQE 5FHAH 1KLUA 4JZJB 1BD2D 3MO1B 4LLMB 1PG7W 2FL5B 2YPLB 4Z7QF 3G08A 5DTFA 3S96A 3X17A 3FL7A 3VRJA 1JUFA 4KMTL 3ALWA 3VFNA 4U7KA 2X4TB 4LNVA 5GS0C 1CK0H 3BH8B 3NH7L 5I76B 3EDJA 4GBXA 4QRPE 5D9SB 4O51A 1AQDB 1ROWA 5FYKL 4NCC2 4AMKL 4KDTC 2QBWA 5IBLC 4FS0A 1DQQB 5FA3B 3VD9A 3DX8A 1BLNA 4XPHL 5EWIL 5EU6E 3U0PB 1RUPL 4NO0B 5IEHA 1DQTA 5T33L 4IRSD 5I66B 5KN5A 1FNFA 4KRPD 5DWUL 3ZE0F 4JFHD 4X99A 4PJIE 3GSXB 4LRNL 1WBXB 3BUTA 4OFYD 1YYLH 4DTGL 4QF1A 1OAYH 3GJFK 4ZAKC 3HA0A 1AO7B 4JB9H 2VN4A 3SBWC 4HJGB 3T1FA 5D2LE 4OF3A 3DX9B 2BY1A 2IGFH 3BQUC 3BZ4A 2XTJC 1FVDB 3V8OA 3TA3D 1GGCL 1UM4H 1U8NB 2VH5L 3TYFB 3MUGA 3S36X 5DUBB 4G6ML 2O5ZL 2OQJA 2YD5A 1HH9B 3N1QC 1LP9A 4P23B 4KHXH 3V4PL 1RY7B 4LKCA 2IPKA 4UNUA 7FABH 1ODAA 1QYGH 1HE7A 3BWUC 3HFMH 5F3HA 4LLVB 4U6YB 3F7RA 3EW3B 3GMLA 1UCBL 1G6RB 4LEXH 5GGTA 1BJMA 1Q0XL 3UYPA 1XGTB 3IJYB 4PJ8C 3ZSSA 1JHKL 1MCJA 4PG2A 5A3ID 1WLHA 2VL4A 5IVXA 1KN2H 1Z9SA 2GQHA 1I1YA 3EO9L 1MCIA 3ARXA 3OKKB 5JMOC 4Y4FB 1J05A 1MAML 1LP9F 3KPTA 2VXTL 4WWID 1I7ZB 3OKLA 5C0DA 4TULL 4M1GL 3G6DL 2FWOA 2Z93A 1XGYH 2Q76A 4OI8A 4KVNH 1F6AA 4P5TD 4Q9QH 1M7DA 3DSFH 4OIIH 3PGFL 1NBZB 3IVKB 5DRZA 1ULVA 3QXTA 2RAMA 5IVXF 3ULUE 3LD8C 3BPOB 3VWJB 5HYEA 1K8IB 2R29H 3T0XA 5LG1A 1LD9B 4KUZL 2ORBH 1JTTA 1FFQA 2CRMA 1HYSD 3VGDA 3UBXB 4N9OB 3SDAB 4R26H 5DRWB 1NC4D 4X9HA 4BFIA 5SX5H 3TZVA 4A6YL 1G7LA 4P3CH 1ZEAL 4UT7L 1X4YA 1CD1A 3GUTA 5SV3A 3FO0H 1PVHA 3T4YA 5DZNA 5IG7B 1NGZA 1OW0C 1T3FA 4LEOB 2I9TB 3MBEA 3DURA 4XCEB 3IFPB 5GRVL 4HUNB 5HGBA 4KKBD 4R8WL 4P46B 1ZOXA 2E8ZA 1INQA 3VJ6A 3HRZA 4NC2B 3IFNL 1AFVH 3HUJA 1ZVHA 2V5TA 4YPGA 3NAAH 4CUCA 1YYML 2YS4A 3D5OF 4Q6IB 3GJFB 3R4DA 5KAQG 3ARGA 5HYJA 5AWNH 5FKAB 3AAZB 3TPUB 4K71C 5DEFB 3WJJC 3TESA 5L2KA 4IDJH 1VB9A 3FB7B 5IIEA 4WO4B 1N6VA 4G43A 4PS4H 2AJYL 5BRZE 3QXDB 2CO6B 2YD8A 4UT6L 4UIMA 1CGTA 3KYOB 4P2RE 3HUJF 4G8EA 1OVZA 4MA8L 4JQVA 3KXFD 1BAFL 1PLGL 4NQXA 4EXPX 3KVQA 1E4XI 2HWZH 4N1EA 5BW7A 5JW5A 2F54D 1YY8B 2DMCA 1QLFB 3U7YL 1CBVH 3OAUL 2DI9A 3CUPB 3BP6B 4JDVB 3BD4A 5DEGB 1QACA 1NBYB 35C8H 5HHXH 4Y4HB 1HILB 5K93A 1G1YA 3ALXA 1OP5K 4QRSA 2XNAB 1VKXB 1N2RA 2AV7A 1T20B 4WHTB 1OPGL 5SWSA 3LQMA 3UZEA 1T1WB 2FX9L 1H15A 1YUHA 3PGCA 2DWEA 1DUYA 3O8XD 1ZWIB 4ODUB 4F37F 3BPNB 3D25B 2DLFH 3EIFA 5IF0A 1D5IL 5JO5A 2X7LA 5DGRA 3MRBB 1C1EH 2P5WB 5D8JL 1EEZA 4J3XA 3LV3B 4NKOB 3OAZH 5FOJA 4AIXA 4G9FA 1ZK9A 3V4UH 1JYWA 3OZ9H 2HLAB 3RUGA 4M6NH 3NCJL 2HTKC 2IMNA 2QSCH 1FVCB 5ADPL 1HI6B 2B0SH 4YWGH 3QDJA 1BOGB 1V5JA 5GGTH 4JY5H 1ZKAA 2E9WA 2Z8SA 4OCSH 4PP2B 3LDBB 4GS7B 5KJRL 2ZCHL 2FB4L 1CICC 4HIIA 3OAYK 5IVZA 4IJ3C 4TNVK 4RWYL 2DQTL 3GSRB 5HJ3B 1JPTH 4UTBL 4XVTH 3ARFC 2O93L 4Y5XA 3CH8A 3D48R 4P49A 1R3JA 2AKRA 4LPXA 3RUGF 2V7NB 5B8CB 3KHOA 2ICES 2P8LA 1KLGB 2R2HA 4K3DL 4LBEA 4BZYA 4Z7OF 1MCPH 3WXVH 3ZKMD 1DFBH 4V2CB 4K23H 1ZLSL 3C6SB 4Y1AA 1F2QA 4R7DB 5I71B 4LSVH 2HFEA 4XBPB 4MHHG 5GGUB 1BZQK 1GAFH 3G9AB 3LKOA 1AXSB 1RHFA 2XOTA 4MB4A 1DQLH 1S5IH 2X4UB 1U8IA 4U6TA 4XNXH 3QUXA 1QRNA 1LQSR 2I24N 4HZLB 1I85A 1QEWA 3LMJL 2M1KA 3QULA 3UJJL 4CVXA 3CXDL 4NZUH 5F97E 1CL7H 2WANA 5E08L 3TYGH 2UZIL 3CJJA 3AREC 4AY0A 1JP5A 2UZYB 2CDEA 3Q5OA 4O02L 4R3SA 1G9NC 1FDLL 5I17B 1HHIA 2IALB 4WU5A 3K4DA 1IEHA 2P45B 1FJ1B 1F5WA 1NQBA 2AJUH 3E6FA 4U1SB 1I1CA 2V6HA 1ETZB 1TPXC 3VRLF 3V6OC 3NABL 2MKLC 3H0TB 3WDJA 5D7LB 3SPVA 5F93C 1KN4L 3CDGB 4FFVC 5JW4N 1PAMA 3QO1A 1FYTD 3FB5A 1IEBA 3WFHB 2BJML 1T5WB 2DQGL 1MCBA 2W0KA 3QIWD 2EIZA 4D8PB 1HN1A 3RPKA 5ESQB 4DGVH 3O9WD 2X1OA 4BQ9A 2VR5A 3HHRB 1FL3B 1NDGA 3GSQA 1JK8B 4TPRL 4EVNA 2EDXA 4FQ1L 1GOGA 3EOYG 4NO5A 4WI6A 4OZIB 2ZCKL 4FQCL 5I75C 5JOFA 4WUUB 3T3PF 1X5KA 2X89D 2X4OA 4WWKA 5CCKL 3JBG7 1DBKL 4LSRL 2B1AH 2J8UA 3SE4A 2GY5A 1YNKL 2YA2A 2PYFB 5CSZA 3BYTA 2YUXA 3FFCA 4R90H 5TQ0H 5C07A 1NUGA 1QR1B 1RMFL 3B9KD 1MRDH 1WT5C 4AYFA 1JGUH 4LAJH 3JV6A 1ZE3C 3NCEB 4ZUWA 2DQJH 1N59B 3O2DL 3GM0A 1EHNA 2CDFB 4FNLH 1RIVH 2LU3A 2W9EH 1X5XA 4M5YL 3MLRH 1E28A 2YPVL 3FN0H 4ERSL 4ENED 5CSBA 5EB9A 2J8UF 2ID5A 4GW4A 2EEAA 3HNTH 1KIPA 2ZSVB 2GAZA 5T3ZD 5D93B 4LK4A 4L5FL 4I3SL 4OFVA 3C9NB 4LIQL 1A7OH 2V5SA 5DD0L 1CVSC 4OUUA 3QI9C 1HKFA 5BJTA 1NMCC 3ARRA 3UYRL 5D7JC 3RP1A 2EC9T 3OXRB 2X9YA 4XXDB 5EIIA 3HG1D 4NHCH 1EBPA 5J13C 5FKPB 4LPCA 3A6CH 1SVZA 5HI3D 5I8KH 4YHLH 3VCLB 4MXWL 4OGXL 5IFJA 2BVOB 4P59L 5ITFA 5IMLB 5TE4H 3DNKA 2DQFB 4EI5D 1T7YA 3ARDA 4M62L 3PP4L 1BJ1J 2EICA 4LSQH 4Z7VE 3JTSB 1BQLH 1J0ZA 2ITDB 5DQJA 3AS3A 1L6XA 4AENB 4KROB 2VLJE 4YHMH 3BSZL 4ZD3L 4ZS6C 4G8GD 5J3HD 1Q9WB 1GGUA 1YMMA 2EZ0C 2DQUL 4L29A 4LFHD 1HOCA 5F1IA 1QSFB 4EKXA 2DQHL 5A2LH 3U4BL 3KPSD 3KLHC 5FO7A 1KCRH 3TO2A 3PG2A 5KZCD 3BO8A 5GGRY 1QG3A 1D5BB 2J8OA 4WENB 1G0XA 2C3GA 3X13A 4OM1L 4PJEF 4JE4B 3LQAC 5EPMA 4DKFL 2HG5A 1MHEB 1S9WA 5EOTA 2XN9D 1G9MH 1PEWA 4S2SA 3ROOB 4Q0XL 5CGMA 1NCBL 3RFZC 1CN4A 4TVPL 1HIMH 3AREB 3BESR 1OF2A 3D18A 4QNPE 1IGYA 5ICXA 2VQ1A 4OLXH 2ZUQC 1RU9L 3MRMB 1KT2B 4WEBL 3O81A 2QQLL 1RVFH 5E2WH 1U8LA 2J88L 4KKNA 4KJPD 2NXYB 3LN9A 5FUCE 4WFED 1ZT4B 5JORB 3C8DA 3G04A 3NIDE 1KCSH 1MCLA 1V7NH 5J0BA 2VQTA 2ZUUA 3L1OH 4QT5A 4DW2L 4LNRB 2R4SL 2Z31A 3HNVL 3JUZA 3LPFA 3CZJA 5E24E 4AM0A 1KPUA 3FT3B 4L9LA 3BD3A 1KENH 5KG9B 5J8OA 1SMOA 3AXLB 4R97B 4HUXB 1RZKC 3B3IA 2HN7A 4HQQL 5I75B 5HDLA 4WY7L 3D39E 3VRIA 3QPXL 3ZDZE 1G7MA 3OGOE 3GSNL 5EOQL 3QUYD 2FEEI 3PQYD 1NGQL 3DVGB 3DMMC 3QUZB 2UWEB 4MX7B 4N8CL 3BE1H 1J8HE 5ACLA 1Q9LB 3P30H 1FGNH 2FX7H 5B3JE 4FA8A 5CD3A 3FQXA 3PWVB 1A7QH 5F89A 1I1FA 2VDQH 2FJFA 1G0YR 2WLYA 3MRIA 1OCWL 1RUQH 4JREC 5ANMB 3RWHA 4GKNA 4NQCD 1AGBA 3DX7A 1VESA 3QT2A 4P9HH 4JFZL 5D7KE 5E9DB 1YEJH 4KDVA 2F8OA 3H7LA 4OCXL 1DQJB 1VEOA 5C2BL 3PDOB 4KC3B 3KYNB 3ZDXF 3HMXL 3MV9D 2XKSA 4MJ5A 4NPYB 1A9EB 4NCC1 4PJ9A 4UU9B 2NY4C 1FZOA 4Y5VC 5CMAA 3SGKA 1J0KA 4NQDB 1W0YT 5IBTL 4QKXB 2NMSA 2M26A 1F02I 3OPZL 5T1DL 1EFQA 1JWMB 3L3GB 4MNQB 3DYPA 3NFSH 1A14L 4GG6A 3NIFE 2LVCA 2F53E 3RNQA 5CWSB 1XH3A 4YIQB 1ZMYA 3VD4A 4LSUH 1XR9A 4YX2H 3SEPA 3T3MF 1UZ8A 1CDUA 1X6LA 4JG1H 2LE9A 4W4NA 1S5HB 3PWNA 4JPWL 3QH3A 2BRRL 4JM4L 3UTSD 1CGUA 1IAII 5BVPH 1U3JA 1TETH 1BJ1H 3L5XL 3MA9H 5D72L 4Y19E 1BVZA 3FCTA 3KPMB 5E2VH 3HC3H 4IMLA 4GG6F 4E42B 4PBVC 3LN4A 3VXUB 1JPFB 3RTQD 1TQCC 1L4IA 3QUML 2VKWA 2WP3T 4WTWA 5DK0A 4PR5B 4NRYB 4NNXA 1WZ1H 2NXZD 1S9XA 2H1PH 5KSAD 2R0LH 3TWCH 4YHPB 2YEZA 1NCWL 4PV9A 5JPNA 1SYVA 3QEGL 4ONHA 5CD5D 3P4OB 3H8NA 4E41E 2W1NA 5DD3H 5GRYA 3TFKC 4DFIA 4LSSH 3F7YB 1SBBA 1Q1JH 3MBXL 2B5IC 4ZFOL 2F74A 1AGDB 3OJVC 1ZS8B 3RDTB 3FO2B 1VHPA 1BFVL 2VZVA 3CLEL 3CCHB 3CFBB 4PJFB 5JHLH 2WBJA 1K4CA 3DGGB 3EJYD 3ZDYE 3IETA 2D7TL 2HFGH 5E6YA 2E6JA 1JPGA 2AEIT 3UEZA 1CFTB 2BC4A 4IRJD 4X9GA 1XF2B 3QXAB 3OKNB 5DK3A 4Y89A 3HZMA 3CSYB 1TVHB 3O6KH 5IQ9A 3QZWA 3I6LE 4PJHA 4XP6H 2B4CL 3L9RB 3ZE1E 1OQOA 2NY2C 2OTPA 5GZND 5EIQA 5EG6C 3D3VA 3JWOC 2ADGB 3MOBL 4Z8FL 5GHWH 1REIA 1P6FA 2C1PB 4LHUD 5JUEH 1FBIL 4UAOC 2IG2H 2NW3A 3RVVD 1F8TL 1MI5E 3BAEH 3KR3H 4M48L 1A6TA 5EUOA 2HH0H 3ULUC 2AJVL 1TFHA 4O9HL 3BPCB 4NP4L 2WWMC 4PJBB 1I9IH 4PJHF 4UDTB 3J7HA 1PG7H 5C08D 4WWKD 5DC0A 3MJ9L 2YMXL 1I7RB 1CZ8L 2Z35B 4ODSL 3IU4L 4PUBH 1IKNA 2ATKA 3LEXA 5KANI 1A7PH 1ZAGA 1K8DA 3VXSE 3MRPB 4G6AD 4LCCB 3DMMB 3CDFA 3QCUH 2BY0A 3OF6D 2GJJA 5EUOF 4KMLB 4MCZB 5HVWA 3HE7D 1AKJB 3RVXD 2BVQB 1BM3L 3ILPA 1PZUB 3KPRE 3QDAA 3IKCA 4HKZA 1PZ5B 4MMZC 4OTXH 4S1SL 3X12B 4TTDD 1QQDB 2NCMA 2XWJB 5BS0B 1XF4A 4AG4L 3TBSB 4LSDA 3I84A 5IB3B 4XAKD 3MREA 3SJVA 1QA9B 3G6AA 4HWZA 5E94B 2CIIA 3SE8L 3X3FL 1P4IH 4FXKA 1TZHB 2AQ1A 5B4MD 2BNRA 2C3HA 4Y5VB 1UT9A 1FRGH 2X09A 3TPKA 1DVFD 2IANA 4KDTA 4NRZB 5DI8A 5FUZL 4GMTH 5JOPE 4QRPB 3GMMA 3VXTB 4L8CB 3VXRE 4CKVX 5IOPA 5HHQB 1BFOA 1RJLB 1J1OL 4H26A 3QQ4B 1VACA 3S5LA 2EC9U 4H5SA 3RWEA 1MAJA 1A6VH 3GMQA 1A6ZB 4ZFZA 4HMCA 5EU6B 4XPBL 1OB1A 1MRFL 3K2MC 3QDGA 4AEFA 2ZNXA 4RDQF 3MRJB 4DGIH 4KJQD 1V05A 4NN7B 1I3GH 1MRCL 1TZGL 4G3YL 4Z7UA 5ALCL 3H3PL 5T3XL 2BSRB 3V6ZA 1EZVY 4OM0L 3SBWA 3ECBB 2PO6C 5DD1L 5L7XH 5E5MA 2PUQT 3KPOB 5BZDA 5F7HA 1TENA 4KFZC 3BQUA 1U3ZA 5C0CE 3BP5B 1GGYA 3N85L 1F3JA 5KSBA 3ARBD 3JTTA 1HCFX 4QOKA 2XG5A 4MWFB 15C8H 5DT1L 4GO6B 4DK3A 4Z7UF 4LSPL 3WNMA 2EDQA 1NC2B 2PKDA 2BFVH 4L4VA 5T1KB 3U1SL 4D0CB 4J23A 1Z9MA 3GZKA 2ZJSH 1IC5L 5ADOL 1QNZH 2EC8A 1RUKL 4I18A 5D1QD 4HPYL 5JIIA 1UXWA 5KSBF 4LLYB 3SKNA 4Q9RH 3UYOD 1G7HA 1T2XA 3R8BB 4K2UH 4M7JH 4JN2A 4S1RL 4WHCA 5EBGA 1E4JA 1B0GA 2FLRT 4P5MB 3D0LB 2VXUH 4PBWD 5GSRB 3LS5H 1PDKA 3E2HC 3IJSA 3QHZL 2XKUA 1I4FA 3GI8H 2F5AL 3QA3A 5JW4M 1E6OL 3MLUH 4FG6D 3O3BB 5GSVA 3PWPD 5MENB 3BGMA 1FLRL 4L4TA 4GSDL 1CGSL 3TBTB 1WC7B 2FJHB 5EZOL 1WVZA 2VDLH 2Q8BH 4NN5C 4OLUL 3RWCB 4XPAH 1FFOB 1VEMA 1T0MA 3B5HA 3D69A 5CUSH 5TFSL 1OW0A 1QFWH 3EOTL 4TYUA 5FA4A 1OP3H 2AGJL 4YK4B 1OY3B 5T5FH 2NLJA 5KOMC 5IVOA 1MCFA 1WBZB 2XXMB 3O4LE 3L7EB 4ZDHB 1CE1L 1KJ2B 3HS0B 1OARH 5IFAH 4P4KD 1X3DA 4FZ8H 4XNYH 5FGRA 1T1ZA 5IWLA 4IRZH 3QFJB 2DQIL 5JPMB 3W0WB 2YPLD 2IPTH 3IU3B 3TYGL 8FABA 2FZ3B 4R0LA 2RCSH 1AXIB 5EO9B 5IMOB 1S9YB 2GJ6E 2MCPH 4JFPA 2AJXH 3VDAA 1MCOH 1IRAY 4JO1H 4U1HA 3EYVB 4JGJA 2HTLC 4YDIH 2GSGA 1S7XB 3CK0L 4H25B 2XY1A 3IDYB 1QSEB 3MGTB 2F19L 1I9EA 5HD8D 3S9DB 1MCKA 2NX5B 4MJ4A 4Y2DA 5DR5H 1DEEA 4P2RB 4FQJH 5ICYA 4B7LA 1QBML 4L8SB 4MDIA 5EC1A 1CXHA 1JFQH 3WKMH 2FNBA 4NO0D 5GJTL 2JIXA 2FEDD 1HHHB 4Z0XA 4BUGA 4PRID 5F3BB 1JF1B 2XRAH 4XPTH 1A1OB 4DN3L 4JHBA 1HQ4B 4LU5H 1CT8B 2MQ0A 5AUMB 1AJ7L 2GCYA 1S7WB 5IB4A 4G42A 4KJWC 2H3NA 3DIFA 2YPKB 4WGWB 3EYOA 4HDIB 3GNML 1A6AA 3FQNB 3H42L 3RL1B 2PXYC 3S4SA 1EO8H 2XZAH 5D7IE 3GBNL 1ZGLB 2FGZA 2PO6B 3F12A 4WCYH 3RA7H 2CIKB 5I1GL 4JFFE 5DLML 3MLTA 1EHLH 4P23D 4LIQE 1UVQB 5I8OH 1JNLH 3ARPA 1NCCL 1E4XL 4LMQI 5AG9A 4MD5B 5AD0A 1F11A 3TH3T 4CADB 2HT2C 5MEPB 3I6KA 1M1SA 1CICA 5BO1H 1PD6A 5ERWB 5GISL 5I19H 2VZOA 2W9LA 4NZRH 4WHYG 1UKSA 1BVLB 4YQXH 3P11H 3MRLA 1GRWA 5FECB 4GW5B 1FPTL 2NW2B 2VXQH 3BRGC 1FHGA 1NCUA 1WTGT 4EBQL 3IDJA 4XPGL 1MIEL 1LDPL 1NAML 1XIWC 2GTWB 4HV8A 1MJ7L 3WNLA 1D3CA 3VA6A 5D1ZB 2CH8A 3BN3B 3QCVL 3M8OL 4Z77A 1LHZA 3IB4A 1FZKB 1XF5A 1DLHA 3UTTA 1FNLA 3MYJA 4MNHA 3VWJD 4YHOH 3K74B 1R24B 4HGWB 1IT9H 2A2QT 3N9GL 3QEQB 5JR1H 4XHQA 3SY0B 4YHML 5FDWA 4JO3H 3SDDB 1UC6A 1FL5B 3SDCD 4HW6A 3TBWA 1FG2B 3SQBA 1NFDA 1YJDC 5C0AE 3VXNB 2Y7QB 4GKSA 1OTTD 5FO8B 1YPZA 2EYRA 4ODXA 4XP5H 5DRXB 4RFEB 3ISWA 2BOCA 3SHSA 1QKZH 3QHFL 4PRBB 4NKMA 3P9LB 4YR6A 2HRLA 3ZYJA 2IFFH 3FB8A 1SEBA 5H94A 5EBWA 4NCDA 5EBLB 2F5BL 2VUYA 1HEZA 2WUBH 4U1KB 1F58L 3EUUA 1NFDF 5DVLA 4X0KB 1RFDL 1A02N 4MCYA 4LQ1A 2X1XR 2D31A 4YDKL 3W39A 1VADB 4NYLA 3W9EA 3PL6B 1HKLH 4ZUTA 4HCRA 4WO4D 1NH6A 2CKNA 5E2WL 3WD5H 1Y0LB 2DD8L 1LO0H 3TBYA 5GS0D 4RMVA 1KJ3H 1XF3A 5HXMA 4LLQA 3CU7A 3MFGB 1QHOA 2YBRA 1LEGA 4JM2C 2OR9H 3BGFC 43C9B 3HC0B 4YFLI 4K7FB 4NZTL 4ELKB 2JJUA 5IBLD 4WFHE 2X6MA 3FQRB 3OAYH 1BZ7B 3HE6C 4F57L 32C2B 4OV5B 4MJIA 2OTUB 3GM8A 3QP3A 1TTUA 3OL2A 3JZ7A 1T1YB 4M9PA 2MSPA 4MA1C 3OWEA 1TTFA 1T4KA 3T77B 2QKIA 4ZAKD 3TJEH 5ICZA 3W81A 2DQCH 1WWBX 5DUPL 4K94C 3FFDA 4FQQB 3IJHB 2AJSH 1YQVH 2OZ4A 4POZD 4K7PX 1IAKB 3U30B 3TN0C 2BNUB 4ZO9A 5CBEA 3CSPA 5CKAA 2CKBB 5AYUH 2ITCB 4YFLF 4N90E 4XRCB 4FFZL 4NNYA 4U1MA 4QOKD 2XPGA 3F58L 3FQWA 5E5RB 2Z91A 1M05A 3UZVB 4N0UE 4CN1A 4L3EA 2VLLB 2AK4B 3BHBA 2V17H 4YXLH 2J2ZA 1HDMB 4APQA 5DJ8A 1GPOL 4Y5YB 1A22B 5T1LD 3QJFA 4PJ8D 4NGHL 1CS6A 4JRXE 1CXFA 2VLKA 4GLRH 4KQ4L 4LGPB 3V5DA 5ILTH 4I4WA 2JJSA 2FBJL 5FHBL 1T7XA 1WUNT 3QRGL 1RJCA 4QRRB 2C9AA 3IS0X 4NQSA 4YFDB 5F7FA 4PRHE 3H9ZA 3UAJC 3EYUL 1WIPA 3NFPA 5C2UB 5IT2H 1KYOK 3BWAA 1JNHB 3O45B 4OBSA 1JWSB 4JFDA 1MH5A 4ODBD 2AXJA 3K3QA 3GO1H 4EUPB 4HUVB 4NSKB 4HIJB 1G9NH 1QD0A 3U6RB 1NSNH 4AT6A 2R0KL 4PGBA 1M71A 4X6DA 5KS9A 3UTPE 2OJEB 3STLB 4A2LA 2GT9B 3QDMB 3DX6B 1DUZA 4GQ9L 5EUKB 2X05A 2FGWL 1UB6B 2BOBB 1GOHA 6FABL 4OF7A 2P4AB 4KPHH 2ZOLA 1DBMH 5J1AB 4JHAH 5F7YC 5D1XC 4YBHA 4X83A 4HWUA 4LCYB 5FYLH 3K1DA 3WN5C 1H3PL 1U2CA 3H9HA 4AEHL 5IJVB 2H6PA 1BQHA 1P7HL 5D7LD 1XCTA 2VXSL 3V52H 4M7LH 4UQ2A 3AS2A 4WUKH 5C9KA 5GJSH 1ZV5A 3HI1A 4X6DF 5KS9F 1JYNA 2JB5L 1B4JL 1MJ8H 4FXGA 1TJIL 1A6PA 4PB0H 4HH9B 5E2UL 2B2XL 5LWYL 3PUCA 1G84A 4D2NA 1X7QB 3MROB 3L95B 4XP9L 1M6OA 2OL3H 5E56A 4WUUD 4EUPG 4LARH 1N3NA 5F7KC 4OQTA 4R2GC 3RWJA 3WV0A 5CBAA 4H1LB 4KK9C 5KW9H 3VH8B 3ZTNL 5HYSA 2H45A 4TSBL 2FYYB 1F45A 1ZLVK 1AGCA 4JO4L 5E8OA 5EZLB 5MEQA 3QIUC 4ZQKB 5F6HJ 4AL8H 2AV1A 1BP3B 3D39B 5BXFB 5EZIL 3ZKSD 2Z0BA 1TCMA 2O61B 2NY0C 3ZT6A 2P5ED 2Q8AH 4BK5A 1P7QB 3V6FA 1MF2H 1CG9B 2IAMC 1J8HB 4YBQC 2YSSB 2P44B 3VDBA 4RSVA 4S1QH 3HE6B 4NFDA 5FUOL 3GDBA 2I25N 1ITBB 1Q0YH 1JPST 2A1WH 4HWEH 3OJ2C 3RIFF 1WWCA 1RZJL 5T1MA 4JGMA 5DYOB 5FGBC 4XI5C 5I2IB 5I73B 3S8WA 1JN6B 3PHQB 1R3KB 2BDNH 3RL2B 2GJZA 5FFLA 2MHAB 1S8DA 5CEYB 2OZ4H 5E70A 5I1LA 4NJAL 5I8CB 4R4FL 5IFHH 2HVKB 3VI4F 4NN6B 5HHPB 2FO1A 4H1LG 5IB5A 5ALBH 2ZUTA 1OL0A 3RVUD 4QCIB 3VH8G 5DJAA 3WUZA 1LWRA 3FONB 3FQTA 2FEEL 3SCMA 1LO4H 5FV2A 2HTKD 1MQKH 3C60A 3I50L 2GFBA 2WUCL 3V5HA 2EIDA 5ID1B 1CFVH 1U95A 5ISZD 1BX2A 4CDGC 3T0EE 1IQDB 4XNQB 4ZUUA 3NPZB 2F53B 1CICD 5EN2B 3SO3C 3UPRB 4GQPH 1JHLH 5J6GA 3DTXA 4UQ3B 3HLAB 2XT1B 1DBBH 5B21A 3NA9L 1MSPA 4NQEE 3CU1A 1XGPA 3ARFD 4KTDL 3ULVD 2NPLX 3T1WA 3HB3C 1EH9A 2X2YA 3LKQA 3GMRB 1KNOB 4YHZH 1MHHA 3MRKB 5GRVK 3LHPL 5TDNB 3JVGA 1UJ3C 3GHBL 1A7RH 3MLZH 5C0EB 1DBAH 4WTZA 1J5OH 3LQAH 1C08A 4MAUH 1L7IL 1X44A 5EU7C 5I74B 3DV4A 2E9IA 3RRQA 3WFZA 1F4WH 3ZE0E 3BMWA 5BV7L 2SEBB 2I9LA 5H37H 4NZJA 5LBSH 5JQ6L 2V2WA 4KH2A 4PJGA 3GMPA 4H0GA 5AZEH 1MWAA 2XIDA 5F9OL 5DC9B 1GGIL 1I1AB 1MLCB 3ARED 1RSFA 5DJ0B 3BEWA 5E99H 2NR6C 3EYFA 2QV2A 5C0BA 1BOYA 2HJKB 4PY7A 5EH1A 4JDZB 4YDLB 3GFUA 4MAYB 5JXAL 3ORJA 3OKDA 4U1IB 4TSAL 3MR9A 5IMKA 5JTWA 1N7ML 5JHDD 2NXYD 4OF5A 2W0PA 1HXMB 5C0JB 3FOLA 4JFEB 4G6KL 3WHXB 5HGDA 3WN5B 1J11A 1IAIL 1NEZB 4PJGF 5IKCA 5HVGB 3NCYS 1GOFA 4FFVD 4QHUA 4RMSA 4XXCA 5HDBF 5J89A 3TP4A 2IH3A 1C5CL 1LO5B 5ESVA 3O6LL 1ZLUK 2AXGB 4HKJB 4XVSH 2X4SB 1ZSDB 3ARWA 4O4YH 4EI6A 5EU5B 3OG4B 4HX1A 1TTGA 4GRLC 4PGCA 4PJ5D 4OQTH 1D9KC 2PYEB 1N64L 4U1JA 1MI5B 4S1DC 4BA8A 3LRHA 4AEIH 2ICCA 4N9GB 1LP9E 1NBQA 2C4FT 1CFQB 2RFXA 2EXWC 2E7LC 5FYJU 3QG7L 1IGCL 1P5VA 1CLYH 1IGMH 3QUZD 4ZYKB 3CIQA 4IHOA 2X70A 1N5YL 2A9NL 1KC5H 2P8PB 4L3CB 3REWB 4DVBB 3EJJX 2K7PA 4LDEB 3VGAC 3QIBB 2V9RA 2KQMA 1EPFA 3VXSB 5IVXE 3OKEA 3BKCL 3GI8L 3NA4A 3DHJA 5GGVH 4YFEA 4ZTPL 5DFVC 3TO4C 3IFOB 3M17A 3MNZA 4XAWH 4GH7B 3UPCA 3FMGH 2OXGA 4OUOA 1T83C 3VD7A 2UYLB 1CXIA 1DSFL 3LZFH 5E03A 1SM3H 1FL6A 5E9DD 3UTZA 3U2SB 3ME0A 4WFGE 1ZTXH 3ETBF 3WLBB 1N6UA 3QI9D 3MRCB 3CXHJ 5I1CH 3FRPA 4TNWK 5D7JD 1DLFL 4PRAB 1IC4H 5DD5L 4NQDD 4HWBA 5DJ6A 1Q38A 4ETQA 1JGLH 3BKJH 5B38B 5H2BB 2N4IA 1A3RH 3PWLA 3TVMA 3QFDA 2IQ9L 4XCYA 2Y07H 3LEYH 3SDXA 1Z3GH 1RK0B 3ZYOA 2FX8H 5L6YL 2HAZA 1FH5H 4M1CC 3RWDA 5TH2B 3SOBH 3CC5B 2GITA 4U6HA 3PIQB 4QRUB 3SKOA 4M7ZC 5HGHA 1E27A 4ZS6D 1MFEH 5JIKA 1U8OB 2VDPH 2WW8A 5CGYC 3HUJE 3S88H 1A64A 3SDXF 5EORL 2Z92B 5HYJE 1J18A 4LP4A 2ZSWB 3KLHD 1INEL 1ES0B 4PJCA 4ONFL 1WZMA 2XQBL 5L2KE 1QRKA 2W9DH 3VXMB 3ZMRA 1A3QA 4LLDB 1MWAH 5DMKA 5C0CB 3L3HB 1UWEL 2LABA 4ELMA 2QL1A 1HHGA 3X14A 3RDTD 1NGWB 4FMFA 3P0VH 4C58B 1W72L 5IW1B 4M5ZH 4PJCF 4LCWE 1DQMH 4MDJB 2BXYA 4XMKH 5HI5C 4O2EA 5DMIH 4ODTH 4MQXC 3KNBA 1QLRB 4M6AA 4KAQH 4XCFH 4GAYA 5I16A 5SWSE 1UZ6F 1PX3A 3BZFA 1R5WB 5E4EC 1BPVA 4JPKH 1LVEA 2EE3A 2DB8A 1Q9KA 4GJTB 4OAWA 3NVQA 4RIRB 1I8IB 4JKLA 4BH7A 4JHWH 5EO0A 3OJMB 1ZA3B 3ULUH 4Y4KA 1FO0H 3LN5A 2FBOJ 4YZFF 3VFOB 3PJSA 5JZ7C 4G9FE 4MA7H 5GRXG 3RUGE 2JCCB 4C54A 4FQPA 1BEYL 4JZJA 4I2XE 3MO1A 2VYRE 4Z7OE 4K3EL 1SJHB 4OLYL 4P9MH 3PHSA 3QDJE 5DJ2B 1IM9D 1CFBA 4I48B 3QQ3A 2Z9TA 1IC7H 1HZHH 3P0YH 3HAEA 2BSTB 3DMMD 2WIIA 1S7UB 1YNLH 3U9PL 3T65B 1KF9B 2X4TA 1QSVA 1G7PB 2A83A 3WUWA 4HLZG 5MHSD 3I3DA 4TOYL 5D9SA 4M1DL 1JF5A 3TH2T 2XFXB 5DUMH 1C16B 3BMVA 4G80B 4XGZB 2IBGA 5SWQA 3MPCA 4CU7A 2H9GA 1N8ZB 3O4LB 2EIBA 4Y1AE 2W0LA 1WCQA 3O3EB 1OTSC 1C12B 2BNQD 1GL4B 1Q72H 5EA0H 4HC1L 3NACL 1KB5A 1FZMA 1Z0MA 4MNGE 4XNMB 3RY4A 1QRNE 1E6JL 4CNIA 1QP1A 4NM4H 1KXTB 5L88H 3Q3GA 3MV7A 2EYSA 3GSXA 2PW2B 4HWBH 2Q7NA 3GSOB 1OTUD 12E8L 4KUCF 3C6LA 5SX4H 3MV11 5I1IL 2GJ6B 1IGIL 5FEBA 2ED9A 1AO7A 1OLLA 4YLQT 1LEIB 3G6JB 3BKMH 4YH6A 5FYJH 4ZFGL 4KQ3H 5IESL 5MP6L 4HJGA 4QRPD 4D9QE 3VFMB 3MLYH 1B0WA 3OB0K 4BM7A 3IDXL 5HHVH 3DOSA 2B1HH 3WFCH 1KB9J 1UGNA 2PR4H 3RI5F 3WBDA 1RZGA 1FVDA 4PD4K 5TE7H 3OBAA 1U8NA 4JFXA 3T3PE 1FP5A 2ESVA 5EU6D 5DJZB 3U0WL 5F6IC 3OHXB 4BFBD 2J1KA 1BGXL 4YHKH 3GMOA 3EDKA 4BZ1H 1OAUH 1CFNA 4RGOH 1BVKB 3C5ZC 4M7ZB 3VE0A 1YECL 2R15A 4L1HA 3SGDI 2CMRL 3D2UA 4M7LT 4OZFG 1FIGH 3N06B 1N4XL 3C8KB 5DDHB 1H3XA 4P48A 1WBYB 3EBAA 2PXYA 4X9FA 4QRTB 3V9FA 1YN6A 1OT2A 2FSEB 1TJHH 5D7IB 3OKKA 4Y4FA 2R4RH 4BSVA 3B9EA 2J8UE 4J3VA 3DETC 3MCG1 5IR1B 3FFCE 4JFFB 4FP8L 4FQXB 1CYGA 4NUGL 5C07E 4M3JA 1UG9A 2WZPD 4JPVL 3UBXI 4Z5RB 2R0ZL 3H3KA 4F2MA 3DBXA 5T1KD 4BZ2L 5HYIA 2VUOA 3BKYL 1LE5A 3VWKC 2NTFB 3FT2A 5EO1B 1A1NB 4XVJL 3QPQC 4JRYA 1IVLA 1FIEA 1TVBA 3EDEA 4AH2B 4WJ5B 1LD9A 4U3CA 3GB7B 3CDCA 3T2OA 2Y9RT 3UBXA 4Y16B 1QFWI 4J3SA 4EJ1C 3SDAA 1ACYH 5DJDB 5DRWA 3CSGA 2OJZH 1WITA 5IGXL 5HPMB 2J7LA 1XIWA 4AIOA 2NY2D 1R3LA 2KZ1B 1EJOH 4XCEA 1U8KB 1FNEA 4PTTA 3U83A 3GRWA 5E2TL 1I9JL 1HQRB 1MY5A 4P46A 1IFHL 3SDYL 1RJZB 2G60H 3PGDB 5MI0C 3CH1A 5GRUH 3ULUD 4HUWA 4OLZL 4KJYB 1WZLA 2WWMD 3CD4A 4IOIA 4LQFH 3HAEH 2ARWA 1QFUH 5FKAA 3NCBB 3TPUA 4OD1H 4RMTA 2EYTB 5FK9B 3MRHB 3QWRA 3RBGA 5C09A 4IRSB 1URLA 5I1JH 3VFRA 3AUVA 1LK3L 1YMME 5C0AB 3SKMA 5F7EL 2WLZA 4KI5F 4GFTB 4U1NB 3AS1A 4DZ8B 3CVHB 1MLBA 1ZHKA 1MFDL 1YY8A 3MLSH 1KB5H 1QLFA 2FATL 4J8RB 4OZ4A 4ALAL 3V0WL 1HSBB 1JYVA 1P2CB 1TIUA 3FAXA 4J4PC 4MHHI 1JV5A 2IADB 2AQ3A 3KYMA 4TUOB 3TNNB 1NBYA 5D96C 4Y4HA 1HHKB 2XWBA 1HILA 3KWWB 5I1DA 1TMCB 3HI5L 5ITBL 1A6WH 2XNAA 4ZUSB 4PGDB 4WHTA 1VKXA 1T20A 2B4CC 5C0RL 3H6JA 4DQOL 5CIPA 3ZHDA 5CJ8A 2VWEC 5EDXA 3MLWL 4NKQB 1FCCA 4E5XB 4OI9A 1ZT1B 3RU8H 4QHKJ 1ZWIA 3C2SA 5BRZD 4ODUA 4JM2A 3P73A 3P9MB 1H0DB 4P2RD 4E9LA 2UUDK 3EO1B 2P5WA 3LV3A 3BD5A 4HSQA 2EDNA 3TV3H 2ARJB 1RUAH 1A6UH 5DQDH 1G7IB 2ZPKL 4N0RA 1KYOJ 3K46A 1G7QB 2VXVL 5GGSA 3WIHA 1FVCA 4HCRL 5D6DA 2JKXA 3UDWC 1FNGA 2G5BA 4GXVL 4JM2F 4P5TB 3NIGF 5T3ZL 1WTLA 2FJGB 3KJ4C 1F6LL 5HJ3A 1S78D 3VMNA 3GIZH 2BCKB 4TUKL 4YE4L 5CEXA 4J1UB 2PO6D 5EOCL 2CKBH 2A6JA 2YRPA 5B8CA 1D5XB 1CD8A 1KLGA 3DVNB 3O3AB 1I3RB 4UBDC 1T5XB 4RX4A 3HTLX 3PNWB 4YUEL 4HK0A 1AHWA 2DS4A 1OT1A 4HIHB 2X1PA 2KL6A 4X98B 1KG0A 1KCKA 1R3IH 1UM6L 1S9VB 4MD4B 3ZDXE 3T0EC 1X5YA 3WFEL 5HDOA 5KVEH 3QEHA 3QCTL 2WWKO 2E5EA 1GVIA 3EDDA 2LU7A 1VSCA 1NFIA 1A47A 3GEWB 3QRFM 1QFOA 5I17A 3P4NA 5I1HH 4Y19A 4JRXB 1FJ1A 3EFFA 4WW1B 3KLDA 5KVFH 1OAKL 1FFNB 2AEQH 1CGWA 1KJMB 2D9QB 3RZCB 2QQNH 3GRWH 1LO3L 4X80H 1XCQB 2HFFA 3OG6B 1ED3B 3CDGA 3T3ME 4PY8I 3UTQB 5FCUH 3WFHA 1T5WA 2LQRA 3FZUC 3QXWA 4MB5A 1KACB 4CU8A 4P3DB 3BDYL 4IDLA 4NKDA 4NQUA 4PJXA 5ESQA 4XMPL 2W65B 3W11C 3DUSA 5DK2A 4GG6E 4F58H 1YJDH 1IAOB 4X7CC 3SDDD 3X3GL 1LDSA 1N0XL 5SX5K 2M8XA 4FQ2L 4XP1H 3A6BH 4QWWC 2X44D 4R4BA 2R9HC 1NGYA 2FHCA 2A6IB 3VFSA 2DDQL 1AY1H 1M7IA 3BJLA 1W2KT 3Q6GH 3UJTH 2DOCA 2PYFA 1U3HC 4OZHA 4PJXF 2EDDA 1FYHB 3IF1B 4KUCD 1T03H 2AI0L 3IDGA 5DJXB 5D4QA 2AJ3B 2CLZA 1H3UA 3M07A 4H88L 1N5AB 5F96H 1CLCA 2CDFA 4LLWA 1FN4B 3DGCR 1B9ZA 3WIIH 3ZT7A 4JFQA 4DCQB 3VFTB 4OLVL 4JR9H 5M94B 3UCRA 1GGBH 5CIPH 5D96B 2PNDA 4PLOB 3GMNA 4X6BB 1IM3B 4OZHF 3HZKB 4YDVA 1T04B 4POUB 2ZSVA 5AAWA 2HTLD 4U7SA 4IM8A 3C9NA 1EA9C 1UXSB 5HHOA 1O7VA 3MRFA 3D85A 3OXRA 1RPQA 4XXDA 4AIZB 2DWDB 5L0QB 3ZO0A 2IAMA 5FKPA 1RZIA 4PG2C 4RRPG 1NJ9B 4M93C 2W60B 4RFOH 4FFYH 2V2XA 3WIHH 4HT1L 3VCLA 5BOZG 1MHCB 3BOVA 2E7BA 4LVHB 3SN6N 3UC0L 1XAUA 1DANT 4RGNE 4RISH 5E8PB 3AVEA 2ZCLL 4PJAB 4Q58C 3DXAE 1R5IB 4K8RL 1BBDL 2RJMA 1OSPL 4HXBL 3D3VE 4X4XB 4JY4B 5ACMA 3DV6B 2ITDA 3D2UD 1JZ6A 2O26U 2Q7YA 4KJWD 4HF5H 3MFFB 1JRHH 4C59B 2C3VB 5ESAB 4K3HA 3BT2H 5EUOE 5MERB 4U1LA 3OAZK 5BQ7B 1OAXL 4HFUL 3O3DA 1QSFA 5DD6A 1G7JA 1EO5A 4KMQA 1TNNA 3PE9A 2DL9A 5E6IC 2A6KA 4XB8A 3VFPA 1O5DT 4KMTH 2Q20A 1XR8B 2LAGB 3IFLL 1XGUB 3WL9B 5FOBA 3V5KB 3NH7H 4F3FA 1MAKA 2HT2D 3E6HA 3H9SA 3MBEC 4L8DB 1P4BL 1VFBA 5FYKH 4KKCC 4AMKH 5L8LB 3ROOA 1YEEL 1MCHA 2YXMA 1MJJB 1FAKT 4ODWA 4ZXBC 2VLJD 3G5VB 4W6WB 1FYTB 3NN8B 1CGYA 4U6VL 1P6AB 4XPHH 4Z7WA 5EWIH 4H20L 3TIDA 1BZ9A 4NQEB 1I8MB 1RUPH 3O9WB 5E8NB 3L7FA 5F9JA 3WE6A 1IL1B 5T33H 3BIKA 3MRMA 4OGAC 5CSGA 1KLUB 3ULSA 4XC3L 5DWUH 1K9TA 1UJ3A 2GSIA 3ARGC 4LRNH 5DTFB 3IAGC 3S96B 3SJVE 3KPQA 4DTGH 1ZT4A 4FTVA 1JUFB 2F15A 2XZQL 4EDXB 2Y5TB 4XBEL 1KCLA 2BNRE 3QBTB 5C0NC 4Z7WF 4JVPA 1RZFL 1ZLVH 1OGTA 3DRQA 4LNRA 5EU3A 4F15C 5I1EL 3ET9F 2IANE 4RAHA 4GBXB 4H8WL 4O51B 2RHEA 3B9KB 1YMHA 2H2PC 1KBGL 1HNGA 1ZHBB 5F71A 3RNKB 5BW7C 3QXVA 4KXZH 1GGCH 5KG9A 1BLNB 2DJ4A 2VH5H 3ILQC 2VQUA 4HUXA 4G6MH 2O5ZH 3GKWL 5HHME 5B39G 3V4PH 3BP7A 4M03A 3LRSB 3QDGE 4QGTA 3T08A 5KN5B 2F58L 2NY6B 2XA8L 1JZ5A 5E4IA 1UCBH 3DVGA 1T22B 4Z7UE 2N1KA 4YGAB 1K5NA 1Q0XH 3UZQA 2UWEA 4G9DA 4MX7A 4U1GB 1JHKH 4C56A 3GIVB 3I6GA 2J6EA 4HJJL 1W8OA 3EO9H 5SWZA 1ORQA 5C9JA 5AZ2L 3HZVA 1MAMH 2AEPL 2VXTH 3HG1B 3C09B 3U4EA 2XTJE 1D9KA 3MXVL 4WU7A 2FIKA 4PV8B 4TULH 4M1GH 3G6DH 4RFNB 5KSBE 1JGVL 4DVRL 3VGBA 5J7CC 2PTVA 2HMIC 2ZNWA 3BZ4B 4LDLB 2GK0B 4RGMC 4FHBD 1N0LA 3PGFH 2UWEF 3MUGB 2OQJB 4PJDB 2E7LA 1MHPL 3CFIC 4L4VE 3D39D 4GOSA 4V1DA 1PG7X 3O2WL 4F37K 3PDOA 3NGBC 4LKCB 2IPKB 2A77L 1F3DJ 5F3HB 1P7QD 4NPYA 5DQ9A 2QJDA 4UV7L 4KUZH 1J8HD 4DWHA 5L8JB 2IFGA 3HE6D 3BIAX 1AGEA 4F9PC 4BELD 2G2RA 3TO4A 1I1YB 4A6YH 1JWMA 4UT7H 1ZEAH 4MNQA 5LGKA 4WI3A 1BIHA 2NY7L 1T83A 2H2SC 2ENSA 1I3UA 5C0DB 4BQ6A 2FWOB 2Z93B 5KZCB 2Q76B 4YIQA 1F6AB 2IJ0C 3RKPA 1JI1A 4R8WH 3VD3A 4BKLA 3QUXC 5D7KD 5TGBA 5JW4Q 3V7AE 1I85C 5DRZB 3IFNH 4RMRA 4MJ6A 4GG8B 1TXKA 5IB2A 1YYMH 4L4TE 1RUML 5IW6B 3TN0D 3VXUA 1JPFA 4U0RC 1KEGL 5EFIA 1N6QL 3JUYA 3RX7A 5C0FA 5IBUB 4HG4J 3OB8A 3LS4L 2AJYH 4BFIB 3TZVB 1G7LB 4UT6H 3P4OA 1I8LA 3PP3H 4YEFA 2EH7L 2F53D 4ZOAA 3F7YA 4MA8H 3U7WL 1BAFH 3MBEB 3DURB 1JNNL 1PLGH 5HGBB 3RGVC 2CK2A 2Y4SA 3MUJA 3OX8A 3U7YH 1PYWB 3OAUH 4XWOC 4HAGA 3D0VB 1VFMA 3PABA 4M9OA 1ZLUH 3KHQA 3VJ6B 3HRZB 3O2DA 4Y19D 3HUJB 2XKNA 1IGFL 4S11A 3ZKXC 3QSKB 1NDMA 5GIRA 2K7QA 4MVBD 1OPGH 1KCUL 1KGCE 5JQHC 2FX9H 5HYJB 1CFTA 3WEXA 3CFKB 1XF2A 2DYPA 3AM8C 1NAKL 3CSYA 2VIRA 5FAAA 3L9RA 4ZUVB 5L2KB 3SE4C 2UV3A 4G43B 4E41D 1D5IH 3QUYB 2ADGA 2EEDA 4EOWL 1HYRC 5D8JH 3U36A 2C1PA 2VZTA 4MS8C 4J6RL 5L8KB 1MFBL 2XXCB 3WXWL 2ZKHL 1FAIL 4MAYD 5JW5B 1JCKA 5IM7A 4M8QB 2VDRL 3ZHKA 3NCJH 3BPCA 5ADPH 2J5LC 25C8L 3CFCL 1FGVL 2N7AA 5D1XD 5J6HA 3MACL 3K1KC 5DHYB 4JFED 4KY1L 3F7VA 2JB6B 1I7RA 1WAAA 1RZ8B 1KJVA 5KJRH 2ZCHH 2FB4H 4QRSB 3Q0HA 4MXQD 1N2RB 1DZBA 4RWYH 5DS8A 3RKDC 2DQTH 5SWSB 2EE6A 1MCCA 4UTBH 5F9WB 3CX5J 3MRPA 2DL2A 3I6LD 5KSUB 1FSKC 2DWEB 4OB5L 4MCZA 4K3DH 1AKJA 4QO1A 5IF0B 3ZSTA 1NMBL 2BVQA 2RQ8A 2X7LB 3LH2L 1ZLSH 2JE8A 1FE8L 2EO1A 1MI5D 1WAAF 4JY6B 3LB6D 4PD4J 5E8EB 2D7PA 3D9AL 1PZ5A 5A40E 3RUGB 1QQDA 5TF0A 4KK9D 5LCVL 3WIFB 1BREA 3ARDC 1KLFA 4YC2C 1IQWL 3O6ML 3R8QA 5IB3A 3LMJH 4NQTA 3QIUD 2MPAL 3UJJH 3CXDH 2PETA 3MRNA 4UUJA 2BP3A 3QDJB 3BN9C 3TNMA 5E08H 4YXKL 4LPTA 2UZIH 2LAAA 5E94A 2C3WA 4O02H 2NY0D 3VXSD 5IVZB 2H32A 1FDLH 4OZFH 3ROLA 1A4KB 2DBLL 3AB0C 4YBQD 4Y5XB 4XC1L 2AKRB 2OP4L 4NRZA 3MJ7A 2EDEA 4HS3B 2R2HB 3VXTA 4LBEB 1WGOA 4RMUA 4L8CA 1SJEB 3NABH 2NXZB 3KPRD 5BVJA 5GS1C 2QADC 4XI5D 4Y1AB 1KN4H 1A6ZA 2Y36L 3DUHA 2HFEB 4WV1C 2X9WA 2BJMH 3LKOB 2DQGH 1MCNA 4LL9A 2ICEA 3UTTE 1DANU 1WIUA 4Y0GA 1QEWB 4TPRH 4CVXB 4FQ1H 4WDIA 2Y6SC 2ZCKH 1C5DA 4FQCH 3WHE1 2P7TA 4Q7DA 1VEPA 2DBJA 4QHLA 1NFDE 1ORSA 3VA2C 4BJLA 4EN3C 1HHIB 3KPOA 4WU5B 5IHUL 5JOPD 5CCKH 1ND0A 3OV6A 1DBKH 5A43C 2RGSA 1YPZE 3E6FB 4LSRH 4DN4L 1FC1A 1KOAA 3VXRD 1YNKH 2D03L 2UVEA 2IH1A 1RMFH 2DLEA 3L3KA 1DE4A 3SPVB 2EIEA 1NC2A 1YC8A 3ARUA 3C5ZA 3ES6B 3O2DH 3QO1B 3FB5B 1IEBB 1D6VL 2J4WL 5LQBL 4OD2A 1I7TB 2AAVA 4M5YH 2Z31C 2YPVH 4ERSH 1KELL 4LHUB 2IQAB 1NDGB 4MQ7B 3GSQB 4W6YB 4EVNB 2W38A 4NO5B 1C7TA 4LSTL 1MCEA 1EV2E 1Z0NA 1RZJC 3ZL4L 3A67L 4I3SH 4LIQH 5C0CD 2V5YA 5DD0H 4OKVB 5C08B 4WWKB 5GSRA 5DHVH 4CVZA 2XWTA 4UV4L 1HXYB 2J8UB 3UYRH 2DMBA 3MUHL 4ZPTB 2PTTB 3DUUA 3FFCB 3FJTA 1BJ8A 5C07B 2NR6D 4MXWH 1G6RL 4OGXH 3WYRA 3VWKA 4P59H 1QPXA 4MJIE 3O6FA 4ZUWB 3EYQC 3WNOA 5MENA 5DMYA 4M62H 3PP4H 1E28B 1L9MA 4KWUA 4DEPC 4GW4B 2K1MA 4I8DA 4YHNA 3OKOA 4LVOB 3BSZH 3RWCA 4D0DB 4ZD3H 2VISA 1JPSL 5JDJA 1BQUA 5AG8A 3PWUA 2DQUH 2EXYC 4P0DA 4CVWA 3ZYZA 2VSDA 4FZEL 2DQHH 4F7TB 1U8MB 1HNFA 5LAXB 4PJ9C 1WBZA 3L7EA 4ZDHA 3NCFB 3GSUB 5KTEL 3SGKC 5C8JA 4R4ND 1KJ2A 4ODHL 4WFFE 4GRLD 3U4BH 3WFBL 3WMSA 2IBZX 4I0PC 4QRQA 3QFJA 3QUMA 1CDJA 1DVFB 3D1MC 3U0TA 3BDBA 4HHAB 3W0WA 5IFJB 5ITFB 3BH9A 3IU3A 3MV8A 4OFKA 4OM1H 1H8OA 2FZ3A 4L3EE 4DKFH 5K59E 5EO9A 3ARDB 4HJ0C 4YC2B 3B9AA 4KHTL 4BSJA 4Q0XH 1NCBH 2H32H 1YY9D 1U8QB 4TVPH 5BV7C 1WCBA 3EYVA 2GUOB 5DQJB 1S7XA 5BMFL 4WW2A 4ZFOA 1QSEA 2VLKE 4PJEB 5H8DA 1HOCB 1RU9H 2CRZA 2NX5A 2XTLA 3QJHB 4WEBH 2MTPA 5KVDL 2QQLH 4QHNA 5F1IB 5DFVD 2J88H 3O4LD 4KZDL 1YEHL 1UH4A 1NCDL 2R2BA 4NQVA 1JZ3A 5FO7B 3LKRA 3UO1L 3TO2B 3BO8B 3HPJB 4JFDE 5F3BA 1JF1A 3OJDB 2HT3D 1A1OA 4WW2F 4TQEL 1MVFA 4L8BB 4DW2H 1HQ4A 1MFAL 3ARBB 3MJGX 5AUMA 1CT8A 5EPMB 2GJ6D 2EEBA 2R4SH 3HNVH 1S9WB 4M43L 2YPKA 4X6DE 2CLVB 4S2SB 3TH4T 5GS0L 5KS9E 3FQNA 3RL1A 4DKEL 1NLBL 4HQQH 4PLKC 1ZGLA 4QXWA 5SV4A 1OF2B 8CGTA 1LE9B 3D18B 5TDPA 1YQ2A 1QVOB 5K9KA 1IGYB 4M6OL 4ZPVB 4WY7H 3ARZA 3QPXH 3GSNH 3RX8A 4R9HA 1U8LB 4UDUA 5EOQH 3S35L 4M1CD 1NGQH 2R8SL 2XYCA 3MJ9A 3OR6A 3ZZ1A 2QHRL 4N8CH 4I0KA 1T7VA 2Y06L 2X40A 4QXGL 4FMKA 3G04B 2DICA 3S3PA 5GZOC 4O2CB 3UDWA 4LPWA 4MD5A 4CADA 4QT5B 1DDHA 5CGYD 1Z5LA 4F7PB 3V0VA 4NNPL 1OCWH 1VENA 3LKSB 4GW5A 4QGYA 4AM0B 4CMMA 1FVEA 4L9LB 4G8FA 3VGEA 3GGWB 4JFZH 1NEUA 4QY8B 3SO5A 2CLRA 5J1SC 4NOBA 4OCXH 5C2BH 4EQ3A 1CE6A 1IILE 3VG9B 4JFFD 1VGKA 3CZFA 3E1F1 3HMXH 4X7SL 1A4JA 3RWFA 5HBBA 2EH8L 4PG9A 5D1ZA 4M6ML 1JTPA 1HWGB 4DGYL 2FH8A 5IBTH 1J12A 3KDMA 3L6FB 2V9TA 1MVUB 1CQKA 3OPZH 1R24A 4HGWA 5T1DH 2FR4B 3OXSB 3QEQA 1A14H 4KRNA 3L3DB 5CD3B 3FQXB 3BPLB 4MQXD 5K9OA 1MIML 2HRPL 4Y16D 1I1FB 5F89B 5J11C 3MRIB 1FL5A 3RWHB 4GKNB 5BZWA 3RWGB 5MEOA 1AGBB 4JPWH 3DX7B 5D2NB 2BRRH 4JM4H 1K85A 3L5XH 3NCCB 5D72H 1EFXA 1FV1A 3B9DA 3OSKA 4MJ5B 5JW3L 3QUMH 1QHPA 5JZ7D 1DN0A 4PJ9B 1FZOB 1SEQL 2P43B 5CMAB 5GGRA 4GMSL 5F7WC 4U1KA 1NCWH 2NQCA 4X0KA 3QEGH 3S37L 1KPVB 2D0GA 2UUDH 4GG6B 4KDWA 5FIEA 4RMWA 2YR3A 3CDYA 5FV1L 3DHMA 3TA3C 3DVFA 3MBXH 1B2WL 3PL6A 3RNQB 1OP3K 3VG0L 1XH3B 2YUWA 4PRIB 1T6VN 4D9RE 5C0AD 4X5WA 1BFVH 3CLEH 3STZB 5CJ5A 3C87A 2VR4A 1U3HA 3QH3B 2DQDL 4IEFB 1UYWL 1T6WA 3NMEA 3MCKA 4J12A 3HC0A 2D7TH 4K55A 5F7LB 2H26A 3N1PC 5CILL 3MMEA 5GRJL 4IMLB 3LN4B 1CDIA 1OTSD 5DK0B 2EE2A 4OV5A 4NNXB 1CR9L 1XFPA 1ZHLA 2IC2A 2B4CH 4PB9L 4I3RL 2YEZB 1L7TL 4PV9B 2APTA 1VPOL 2VE6A 3MOBH 4Z8FH 4ONHB 4PJGE 2OI9B 3T77A 5JIPA 1FBIH 5HDBE 1F8TH 5C71A 4M48H 2F74B 5C0BE 3WLWC 2ZZUT 4MXVF 2AJVH 3WSQL 1LK2A 3IJHA 1UWGL 4O9HH 2P48B 1T21B 2LFGA 3FTGA 4NP4H 4OSUL 4P99A 4XH2A 2WBJB 1IAKA 4OT1L 1K4CB 1KCVL 4I18C 3MJ9H 2BNUA 4WFHD 2YMXH 3IETB 1CZ8H 1JJUA 4ODSH 3IU4H 2ITCA 1HYSC 1JPGB 4GUPA 3L3JA 1DR9A 1P84J 2BC4B 4RGNB 5GRZA 3HPLB 3QQ9C 3HZMB 5I0DA 5IQ9B 3QZWB 2DM3A 4PJHB 2AK4A 3C5ZD 4LVNC 3QO0A 1W0VB 2FO4B 2NZ9C 5GRWA 5GGVY 1V3MA 3K2UL 1BM3H 1HDMA 4B5EA 3T0AA 1YEDA 5CZXC 2JLLA 1FFPB 4X7FC 4X6FA 1U3YA 4S1SH 1IEAB 1X5HA 2BHYA 2R2CA 2X4QA 4AG4H 4QRRA 1QBLL 5E6IA 1BF2A 3F5WB 3LVEA 3MLVL 1HSAA 3MJ8A 4PJ7A 4MD0A 3DETD 3HMWL 3CMGA 5E1HB 4N90D 3SDCB 3SE8H 3X3FH 1OD9A 4QEGA 2ATKB 1IGTB 3O41A 1F4HA 4HUVA 3F7QA 4HIJA 5FUZH 4UZGA 1NCNA 4ZXBA 2A73A 3ULVL 4LPUA 1J1OH 1M4KA 1H3VA 1HHJB 4PJ7F 2GT9A 3QDMA 2CPCA 1RZ7L 3B6SB 3QZWG 2EECA 4JRXD 3CFJB 5IWLC 4QTIL 1UB6A 1PKQB 4XPBH 1MRFH 1KXQE 5J1AA 4JAMA 4R0LC 1IC1A 3IXTB 3RZCD 5IEKA 5A2FA 1QO3B 1KPRA 5IJVA 4PRHD 1JBJA 5DJYA 2JF1A 3GBML 1MRCH 1TZGH 3MREB 4G3YH 4I77L 3H3PH 5ALCH 5T3XH 3G6AB 4HWZB 2CIIB 2Z8WC 4OM0H 4FXKB 1CIDA 1T0NA 1UEMA 5DD1H 1ZGLP 1ADQL 1WEJL 3QNZA 4CN6A 5FYJE 4Y2DC 1VFUA 3DROA 3SDXE 5DI8B 1V7ML 1X7QA 3N85H 3MROA 1CLOL 3I75A 3GMMB 3UTPD 2PN5A 2AABL 1JZ7A 3SE9L 4LCWA 5IOPB 4O2FA 3AFLA 5DT1H 1BQSA 4H26B 4MSWA 3S5LB 1VACB 4H5SB 4LSPH 3RBSA 2DLIA 1U8JB 3RWEB 3B5GA 1GZQA 3GMQB 4ZFZB 4ZSOA 3T2NL 1RI8A 3DYMA 5HHMB 5C92A 5EZLA 1XZ0A 3U1SH 3QDGB 3T8XA 3VXPA 3T2PA 2ADFL 5BXFA 4OF6A 1IC5H 5KANG 4LHJB 5ADOH 4D0BB 1RUKH 4ZAKB 2O61A 4HPYH 1UB5A 3T0DA 5TE6L 3V6ZB 2YSSA 4N1CA 4PJCE 3BVNB 4LOUC 2E27L 4S1RH 3KG5A 4J4PD 5E5MB 1F13A 3ZKMC 3BQUB 3QHZH 2XTJB 4ELME 1TDQA 3JV4A 4EEEA 1UZ6E 2F5AH 3UPAA 4I2XA 4QOKB 3S36L 1NAMA 2GK2A 4RDQG 1ZVSB 5I1KL 3BDXA 1E6OH 5M7QA 5H35B 3L5JA 2HVKA 4L4VB 4XTRC 5JLZB 2J6EL 4XZUA 3NCMA 4YZFE 5HHPA 3S5LG 3U4AA 1FLRH 1L0YA 2OM5A 4GSDH 4B50A 4DZBA 5T1LB 1CGSH 4QCIA 4PIRF 4F9PA 4PJ8B 1JMXA 5EZOH 2X4PA 1UXWB 3SKNB 4OLUH 5HVHC 1G7HB 4LCUB 3VFUA 1Z6JT 2YWYA 2R2EA 5TPWL 5TFSH 4RAUB 3EOTH 2AGJH 4N0CC 5ID1A 1B0GB 1IQDA 3IJSB 1NUFA 2ICWB 4DK6A 4LVNB 4WNQB 1E0OB 5EN2A 4MNGA 1I4FB 1CE1H 1K3ZA 3QNXB 3HLAA 5JXEA 1YDPA 3QA3B 1ZANL 2ARJQ 5HDQL 2DQIH 4NFBA 2DIAA 4I0CC 3LD8B 2DKSA 1KNOA 5GSVB 2PCPB 2R39A 3TIEB 1OQXA 2OLDA 2HA1A 2CR6A 3BGMB 4L4TB 1INDL 1U93A 4HGKC 1SMAA 3HR5A 5C0GA 2K9UA 3CK0H 5CS7A 2P1YA 1QLEL 1RURL 3CFEB 2F19H 1T0MB 3C8HA 2Z8VC 4ZO8A 1BECA 2JJWA 3T0ED 3N50A 4G7VL 5DRNA 3RGVA 2BSSA 1FNSL 4NKIL 1I1AA 1QBMH 4JN1L 3KPNA