1EGJA

Domain 4 of the beta common chain in complex with an antibody
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
IQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOKINE RECEPTOR COMMON BETA CHAIN PRECURSOR
publication title Structure of the activation domain of the GM-CSF/IL-3/IL-5 receptor common beta-chain bound to an antagonist.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1egjA00
4OZIB 2UUDK 5F7DB 2HT2C 1FZOA 3OSKA 4NQXA 1K6QL 4Q9BA 4H0GA 5CEXB 3MRKA 2YA2A 2HJFB 4Y4HD 1XGTA 1LVEA 2CXKA 1TVHA 4OJFH 4DQOH 4EBQL 1PEZA 5GGSA 1DQJA 3U9PL 4RZCB 1DUYB 3UTSD 4LNRA 2VLRA 1I1AA 1J86A 1HEZB 1Q8MA 3B9EA 3CFCH 1XZ0A 1IQWH 4JFFD 5I8KL 2MNUA 1JF6A 4XP9L 4FQIH 4JQIH 4KJYA 4ELMB 3T3PE 1NMAH 4MNGA 4R90L 3MFGB 5IOPA 3G6AA 3GMRA 3QXVA 4JZOB 4ZAKC 2B2XL 4JDTL 5D2NB 3QH3A 2VXSL 2FEEI 4J3WA 1S7VA 3QZWB 2GW5A 3NGBC 3RQ3A 1OCWH 2GY5A 3HNSH 4XRCB 1P6FA 4AEIH 4YHIA 2LV4A 4G6ML 1VGKA 4G8GD 4JKMA 4KROD 4M03A 1NBZB 4F7MB 2OL3H 5HGDB 1W72L 3VXOA 5GISH 1PY9A 1ETZB 4XCEA 3MRRA 4OZFH 3VXME 3WSQH 1P2CB 4TUJB 1KB5L 3ZE2E 4ODXA 1JPSL 1C12B 3MRFA 2X1QA 5EWIH 1ZK9A 4TQEH 1H3GA 1NAKH 5T3XL 2I24N 3V4UH 4LCWD 2APBA 4C56A 4S1SL 2R69L 5KAQF 2PTVA 3JVGC 3CSYA 5EZJB 2FATL 4IMKA 2AQ1A 3MV01 3KPPA 3WNKA 4G3YH 3WIFA 1KJVA 1B2WH 2HT2D 4S1RH 3TT3H 5FDWA 1OAXL 2Q8AH 4BQCA 1BLNA 2PYED 4BKLA 5L2KD 4QRPE 2A6DB 4POUB 2UWEE 3CFDA 4J3UA 4MDJB 2VDKH 3D69A 5DVKA 3BUTA 3MACL 4GLRI 1A6VL 1JWMB 1QFOA 4PTUA 3IDGB 4R8WH 4Y2DA 4K94H 3RVXC 2VLJB 1MEXL 1OL0A 3SKMB 4PJIE 5DD0H 3TO4C 1QHOA 4YXHL 3SE9L 2OSLA 3O0RH 4ZAKD 4OM1L 5DURD 1RUPH 3O9WA 4YXLH 2ICWB 5D1XC 2AK4B 2Q7NA 2PO6B 1MPAH 2P43B 3DTXB 1O7VA 1HHHB 1YJDL 5LAXA 3CK0L 2W60A 4ODSH 3BZDA 4BUHA 3E8UH 4PGEA 2RBLA 1EFXD 1TTGA 1GGCH 4QXTB 5I8EB 2NY7H 3O3BA 4DTGH 4GQ9H 2F5BH 4HIHA 4KKAC 2ZSWB 1CVRA 3HUJE 1TJHL 1NBYB 3BYTA 1DUZB 4LASH 1HN1A 2YZ1A 1UGNA 1TTUA 3K2MC 4KHXH 3E6HB 5D7IB 2WIIA 3DRQB 3VFTA 4ODUA 1I8LA 1T1ZA 1ORQA 1U42A 2CRYA 2GJ6A 3JV6B 4JPWL 4AIXA 3VFGH 3P77B 2H9GB 4JREC 3FAWA 4OCLC 3ILPA 1D6EB 4YFEA 5I18H 4PJ5D 3IJHA 1DSFL 5F9OL 4WCYH 3F58L 5FYKL 4LIQL 4Z95H 5DLML 5J1SC 3DO7A 1JNNH 4KHTH 3AS3A 2BFVH 3LKQA 4YR6A 1K8IB 2BSED 2CIKA 2VAAA 5DJ6B 1FLRH 5C0BE 1BVKB 1RMFL 1RFDL 2IC2A 2GSGB 1XH3A 2OK0L 4U0RC 4ZQKB 5IVXE 5IFJB 3K81A 3WNLA 2GTZA 3MFFB 3OF6D 4DN3H 5E1AA 3FO0H 2FWOA 4M1GL 5K9KB 4HXBL 3OB0K 5HDBF 3QO0A 2IH1A 3WUZA 4LHJB 1ZHLB 3RVXD 4ONFL 1E4XI 2A6JB 2ZCLH 1Z5LA 3FT4A 3BIKB 1KGCE 3TO4D 2HT3C 5MEQA 4LEXH 5T1LB 4HJGA 1UA6L 4M61B 2F15A 5EOCJ 2AAVA 4P5KB 3ZYIA 4Q6IC 3WEXB 5D1XD 1BGXL 3RVTC 4A6YB 1LEKB 4UV7H 1ULVA 4YWGH 3UYRL 2IBBA 4FQLL 2X4PA 4KKLC 1T6VN 1WIOA 4JM2C 1PQZA 5HVFB 3VFVA 2HVKB 2H32H 3OMZA 4MVBC 2R1WA 5DRZA 1NSNH 1RZFH 5J3HC 5CBAA 2RCSH 3QCUL 4YHLL 5F6HI 1DZBA 3AUVA 3IFLH 5KSUA 3MRQA 4KKAD 3UAJC 5J57B 3IDNA 4ORGB 5DQ9B 4GKSA 3JTTB 2DIAA 1E4WL 3N9GH 1HK6A 3TN0A 3QIUA 4CN1A 2XG5A 5DSCA 3O4LD 4FQJL 4XAKE 1IAIL 3RUGE 2YD7A 1DVFB 2ZSVB 3VXSA 4KU1A 1A14L 1VERA 2DIJA 5JHDB 4FTVA 4N0YL 5EFIB 3SBWC 1LEIB 4KMTH 3LKRB 3MLUH 4HWBL 3BUYB 5D5MF 1QTYT 5C0IB 3SGEH 4YXKH 5TDOA 1F8TL 1A6WL 1N0XL 5DEFA 3T0XA 3EYSL 1LO4H 4KVNL 1EPFA 4HIXL 4XNMB 1C5CH 3K4ZA 4OLXH 2UWEB 2MCG1 1DQMH 5IFAL 4Z7WF 1FNSL 4L8DA 4RISH 1V7NH 3FB5B 1JWSB 3VG9C 3MUGB 1MCLA 3HC4L 2X05A 2AXFB 3ZE0E 4PJIB 3G6JF 3WS3B 3NOIA 4J3SA 5L2JB 5GGQL 1JNHA 4S2SB 4ZUSA 1WAAF 3DNKA 1UZ8A 3IETA 2HVJB 1JVKA 3DSFH 1U95A 5CGTA 1FAKT 2G60H 5E7BA 1CICC 1QBML 4Q9RL 1V5JA 2IH3A 2IBZY 3NFSH 5D4QA 2HT3D 3QUML 5AYUH 3WN5B 1X5AA 3PGDB 1CDYA 4JRYA 1SEBA 5E2WL 3RWIB 3OZ9H 3RVTD 4JKWA 2F5AL 3WL9B 3MC0A 4KKLD 4JM2D 1AQDA 3MNVB 3MNWA 3HUJB 4MVBD 4Z7VF 2VABA 3S5LB 3SN6N 4Q2ZB 5J3HD 4ZDHA 2X89D 5DWUL 3OKOB 3IU4H 3PWPE 4OCMC 4BQ9A 3UAJD 5HYEA 5IM7B 4JM4L 1MCOH 4Z0XB 2QLVB 1F00I 5L88H 4UU9A 4QRRB 2XACC 2Y7QA 2CO7B 3M45A 3QNYA 3QEGH 2E6JA 4HHAA 3JV4B 1FL3A 4BFIA 2G75A 3ARWA 4U3HA 1BVLB 5E94A 3GSNA 1YEKL 3EO1B 1QEWB 3QUXC 1FVCA 3LN5A 4X4XB 4N1HB 2HT4C 5E8DH 3RDTA 1JRHL 2WQRA 5C0BB 5HHQA 4IRJA 3IXAB 2OTUB 1KV3A 2MKWA 4P5TA 4AMKH 1HXMA 4ETQA 1P4IL 4PD4K 3P4OA 4X99B 2N7BA 2B1HL 1AKJD 2H45A 3MV8A 3X14A 1MJ8L 5B4MC 4AQOA 3B4NA 4KK9C 1FH5L 3RJQB 5CJOH 3O3AB 5T33L 4HC1A 5HYIA 4LHUD 2N4IA 4PJHA 1U8NA 1KENH 3KWWB 3MJGX 4YDIL 5C70A 3KG5A 3HC3H 3SGEI 1GZPA 4DKDC 1KUMA 1CICD 1OPGL 4LPTA 4M6AA 1J18A 4XAWL 3MV11 1BWMA 3CFKB 3ARTA 3A6CH 25C8L 1EHLH 3PWLB 4Y16C 3PWJB 5EBLA 4M1DH 3X12B 5IQ9B 2QR0B 5KG9B 5KW9L 1G7IB 2Y06L 4GT7A 1NDGA 1R24B 4D8PB 1X5LA 4JFDE 1X6NA 1MY5A 3PL6B 4NC1E 3FB8B 4E5XA 2DQGH 4WUUD 4NSKB 2ZUQC 1N6QL 4NBYB 4YFLF 4L4VA 3U46B 3UXFA 3EOAB 1NUNB 2JELL 2DQFA 4OFKA 3H6JA 5BV7L 3RUGB 3QRGH 1FGVL 2CDEA 3HI1B 5JW4R 4YDLB 1YEGH 4UT6L 4HK0B 5DQJB 3GHEH 4YDVA 3AU1B 2J8UB 4LLDB 4UDUB 4F3FA 5C6TH 2ZUWA 3O4OB 1KTDA 2VXVH 3S4SB 4QRTB 3GJFH 3EOTL 4O02L 5FOBA 1IC5L 5BO1L 5BJTA 3U0TA 3MODL 3QUXD 5J6HB 1UYWH 2JIXB 4LK4A 3V4VH 2HT4D 4WI3A 3MGTA 1L0YA 1CFVL 1HWGB 4X9HA 3QUKA 1DN0A 4XBGA 4XPHH 5KS9A 1C1EL 2XG4A 1DBMH 3SKNB 3T4AB 2GTWB 1UZ6F 3LRSB 3DWTA 4APQB 3WFCL 3B8YA 4HWUA 2DDQL 1WLHA 5B4MD 1H15B 4MD4B 4W6XB 4TPRL 3ZKQD 1KIPB 4KK9D 1YEDB 1CR9H 5TH2A 2VKXA 1IM3B 3F7VA 3MOAH 4NQED 3OKMA 4TN9A 3BPLB 3ARZA 4OGXH 3VXNA 2XIDA 2GQHA 5F6HJ 3MOBL 1JUFB 4XCYB 4X5WB 1LHZA 1R3HA 3UTQB 1R5WB 1JNLH 4Y16D 1ZSDB 1AHWC 4PJ9C 4JY6A 1FGNH 1NAMA 2PXYA 3MMEA 4J12A 3TVMC 3SDAA 4M4RA 4NYLA 1RJLA 2QSTA 2D0HA 4YNYA 3PWPB 2V17L 4HC1H 4GSDL 4EXPX 4UIKL 4TUOB 3F7YB 2RHEA 2YA1A 4TULH 5FXCH 5JA9A 1B0WA 5JW5A 1UWXK 4GS7B 4NQSB 1UG9A 1ZT7A 1MHPL 5KSAB 5E8EB 2EECA 4NM4L 1HXYA 4GAJH 5E8NB 4DK3A 4EOWL 1KOAA 4NRYB 5KVFH 4JCLA 4N0FB 4LPVA 3O6FA 1S7UB 3NPSB 4CW1A 3BH9B 1D6VL 1MCFA 5D7LD 4K94C 4NN7C 3MRCA 3QFJE 4HK3N 5IBUB 3IYLW 1MRDL 5I2IB 1FNAA 3LD8C 4NM8L 4GKOA 3BYYA 4X6FA 4FMKA 2NY2C 1YYLL 1EJOL 4JPVL 5DDHA 2FGZA 3VRJB 3ARBB 4PRHA 2YN5A 4AEFA 1D5BB 1U8KB 2A6KB 3HPJA 1I1AC 5EH1A 2G2RB 2F54E 4ENEC 2R0KL 3QG7L 4M7KH 5I1JL 1NFDA 1UKSA 4AENA 1I1RA 4U6YB 5KTEL 4XCCL 4X98B 4RBPK 2BY1A 3MRDB 1O0VA 4ZFGL 4HDIA 4W70A 4LPCA 2Y1VA 3CDYA 2X2YA 5CP3A 2EDDA 4JFDB 1AO7E 2E6PA 3P9LB 5DMKB 4PJ9D 1C5BH 3TVMD 3OPZH 2RFXA 5DJCB 5A3IC 1MFEL 5C3LD 4AL8L 2YWYA 1CDBA 4NN5B 3QDJE 3IDYC 4NUJA 4RFNC 3VXMA 1EBPA 5GZNC 4L8SB 3AAZB 1BEYH 3GDBA 5B21A 4URTB 1K5NA 2R4RL 4X7EC 3PP4H 4FQ2L 3F6LA 3EO9L 4NNYB 3V52H 1FBIH 3VXRD 4Z76B 4FFZH 3CFBB 3O2WL 3LKNA 1P6AB 1RHHA 4PJ8A 1YNTA 1J05B 1DLHA 5EU6E 1IL1B 1IGYB 2DD8H 5HGBA 4KUZH 1ZT1A 5FKPA 4I77H 1YMMD 5IJVB 1YEEL 4OD2B 4M6OL 4XH2B 4H88H 4HULB 2ZJSL 1MJUH 2HAZA 4IMKC 3U30C 4EI5A 2Y07L 3TO2A 1G6RL 1EAJA 2NY2D 2YD6A 4WHTB 1OAYL 4MNQA 1WICA 1MCIA 4AIOA 1A22B 3O3EA 5A2IH 4IEFB 4ZO9A 3I6LD 3LEYL 1SVCP 5L9DH 1YEHL 2E7BA 3VDCA 4Z7OF 5KZCD 2IPTH 2HKFH 1EAPA 1I1AD 5CJQL 1R0AH 4I3SH 1ZS8B 3LS4L 1UH4A 3P4NB 5JQ6L 4ENED 1FYHB 4Y2DC 1XAUA 1V3JA 2D7QA 1BBDH 1JGVH 4LGRB 5J1AA 1B4JL 1S7TA 3JWDH 2EO9A 3GBML 2ZUUA 1HHJA 3S34H 4RAVB 2VXUL 3QNZB 3O9WC 5IEKB 2WNGA 1LDPH 2V9QA 3RX5A 5D72L 4U1HA 2IG2L 3WFEL 1Q94B 4HIJB 2VLRB 3O8XC 3LY6A 4X83A 1YUHA 4WENB 5AAWA 3GSXA 4UTBH 5GZND 1UB6A 5L6YL 1JYVA 4A6YH 1XF2A 5HGHB 2M1KA 1J87A 4MMZC 1CL7L 1BQHB 4PGJA 1NGQH 4LQ1A 4AYFA 1I8LC 4DUVA 4CL7A 4ZYKB 4XNYL 3QFJB 1H3TA 1T7XA 3QEQA 1U8JB 5HPMA 1MCPH 5IVXA 4WFHD 5JNYB 3ARGA 3OKLA 5E5UB 1I3RA 3FCTA 1JI1A 2JB5H 2WBKA 4IM8A 1TFHA 2EYRB 5IMLA 1JK8B 1VFAA 3ULSB 1T5XB 1BBJB 5CWSB 4F7CA 5I6XB 4C54A 3VRLF 5DD5H 2PNDA 4XCEB 4J8RB 2F54B 3W2DL 1J0ZA 3S6CA 3QIWA 3QEUA 1BD2A 4FQXA 5F3BB 3EGSB 3MV7D 35C8H 3S35L 5C1MB 5LKNA 1IFHL 3MRFB 2EH8L 4LLAA 4NNPH 4Y2DD 4HUVB 2A83B 1AO7B 4NO0A 5LG1A 3TT1H 1NBVL 3KPPB 4D9QE 1NEZG 5JIHA 1KJVB 1X3DA 2P24A 1QFWH 5J13C 5TDPB 2FD6L 3LS5L 3O9WD 1JPTL 3BVNB 2C4FT 4LLYA 3QDJB 4JKPL 1OGTB 1U92B 1T1XA 1UCTA 5HDLA 4QOKD 1IM9A 5FCUH 5E08L 1KLUA 3WLBA 1MNUL 1D9KA 2JCCF 4MZ3A 3HCVA 1XGYL 4MA3B 3O8XD 4RQQB 2R1XB 3WHXA 1NEZA 5ESAB 1LO5A 1QBLL 2XI9A 1K2DA 4KAQH 4G5ZL 3S3JA 5B8CB 2IANE 3CVHA 3GK8L 1KF9B 4NKIL 1Z0NA 5T5NF 3GSRB 4NP4L 1KJMA 1EH9A 3RU8H 5EU6B 1KT2B 1UQSB 1R5VB 3TN0C 3QIUC 1EFQA 2VLME 4BH8B 4NZUH 2VH5L 3X11B 4CVUA 5I0ZA 3EYFB 1F11A 4EVNA 3SY0B 2GJ6D 2UYLA 4MA8L 3TA3A 4KPHL 3NCMA 5C0CD 1J1PL 1KJ2A 3EYVA 3RNKA 2W91A 3V6ZA 3F12A 4RFOL 4XVJH 5FB8A 1L0XA 3GB7A 4CUCA 4I3GA 2AJ3B 1A9EB 3FFDB 3HZKB 4R7DA 1MWAB 2OI9C 3RGVA 3RZCA 4MD0B 1CFTA 1WF5A 5K9OB 3VFTB 3V5KA 2IQAA 3S96A 5SWZA 2AKRB 3D3VB 4RWYH 5D7KE 1RVFL 4C4KT 4ZNEA 1MHHA 1JCKA 1MJJB 4M93B 2YC1A 4PREB 1NCWL 2EDXA 3G5YA 3LDBC 2HLAB 5I1GH 4U3CA 1OARL 4KJWC 2ATKA 3FOLB 3HPLB 1JWUA 3E2HB 4XB7A 1JJUA 2EEDA 3BSZL 4HXAH 1I4FA 1ACZA 3W0WE 5DK0A 4Y4FB 3C6SA 4CMHB 1VPOL 3DX7B 2HJKB 2NW3B 2XKNB 4NRXA 3W9EB 3ZHLA 4HKZA 5HDQH 1CLYL 4JZNA 4NQUA 3B9KB 1G9NL 2FBJH 5BZWB 1LE9A 4CU6A 4MXVE 1MCCA 1AGDA 4EDWL 3P0GB 4MGXA 5EDXA 2ARJB 5C8JB 1XT5A 4PRPE 2SEBB 3N85L 4JFEE 2ZUVA 3QWRA 1FG2A 4PJ7E 3NFPA 5K9JL 2M26A 4HJGB 3TN0D 3QIUD 3IU3B 4HUMB 4X8JA 2V7NA 5LBSL 2W1NA 4X5LA 3RY6C 3L95B 3TIEA 3SDCA 3VXSD 4OCSH 3BPOB 3H0TB 4MCYA 1YZZA 3WO3B 1NJ9A 3T65A 4Q97A 2X4PB 2CJUH 4FTVD 2DMKA 4IHOA 3VFVB 1A0QH 5AEAA 3FN0L 4XPTH 3V4PH 4LIQE 3UJIL 1QSFA 3BP5B 1FV1A 1TQBB 2OQJB 3CVHH 1VFMA 1ACYH 3Q6GH 5D8JL 4YC2B 2DQUH 5FECB 1U91A 4GKSB 4IRJC 2CRIA 4M6NL 5GGTA 1S8DB 1ZANH 4P5TC 4DZ8B 2X5PA 1MF2H 4L3AA 4Y1AE 4GG6F 1IGFL 2ADGA 1LO3H 2XWBB 2Y9RT 4R0LB 5C2UB 4GFTB 5EC2A 4KQ3L 5I1AB 3U2SA 3I2CH 4M1CC 3TCXA 4IJ3C 4DKEL 4OT1H 1SJEA 1MSPA 1ZA6B 4PB0L 4OBRA 3UTTA 3ZKNC 2Q1EA 2XTLA 1KJ2H 3EZ8A 1F4XH 1WIUA 3TNNA 2DLEA 1N2RA 3CPLB 5AZEL 4RSVA 5C0AE 2E7LC 4KJWD 1T1YB 2BZDA 1FRGH 1EZVX 1YEFH 4M4PA 2HG5B 4WNQB 5J12B 5EA0H 1Z0MA 4NT6A 1ZV5A 4OGYL 3SDDA 1JE6A 1U93B 2XZCH 4CVXB 3RIFF 12E8L 5MI0B 5J0BA 1RURH 4POYA 2D0GA 5DHVB 5C2BH 1MCHA 2OR8A 4LLMB 3INUL 1C16B 1NL0H 2A0LC 4JKKA 1QZ1A 1NPUA 1CD1A 2YEZA 4LSUL 5C0DA 4F9LA 1ZVSA 4I2XA 2IH3B 4ZOAA 3VFOB 2A9NL 3WDHA 2ZG1A 1CGSH 3FQXB 4NKDA 5DJ2A 4F57L 2V2XA 3KPSE 4BZ2H 1JHTB 3QO1A 4I4WB 4G6AC 4NQCE 4NKOA 1XGQB 4IRZH 1AQDB 3KYMA 3KPRE 1ZLUK 1P7HL 5IK3A 1BFVL 2BNRE 3VFPB 2BVEA 1OY3B 2PN5A 3PHQB 4RCAA 4XPFH 1HHGA 2DQHH 4R9HA 1EO8L 2ADIA 1IEAB 5HYQA 1AJ7L 4IRJD 1XR9A 4P4RB 5IB4A 4P5TD 1QLFA 3AM8A 5I1IH 5ITFB 3D39A 5EBMB 5EZIH 5F9JB 1IGJB 3MV8D 2VERN 5DUPH 2BNUA 4M1CD 1M7XA 2P45B 2XRAH 1MCSA 2Z8RA 1N64H 3ZKND 4YHZH 3W0WB 5JMRA 4F58H 3REWB 5HI4C 4OZGF 1NQBA 1ZGLP 3VGEA 5DVNA 3DUUB 2DBLH 1QKZH 4U6VH 1FL6B 5GGTH 3HE7A 3S97C 4AIZA 2FHBA 3BP4A 4JG1H 3T3ME 4P3WA 1BZ9B 2ZCKH 1AD9A 2PXYC 2R0WH 2DLTA 4FNLL 3S35X 3WKMH 4PRPB 4JFEB 3MCKA 4PJ7B 3DGGB 2F8VA 2EH7L 3PDOB 4L4VD 4UTAH 5KJRL 1WFOA 1HNGA 4X4MA 5LGHH 2AV1B 2EDJA 2A0LD 4YBLB 4D2NA 4XMKL 3IKCB 5SWSA 2D03L 5DYOB 3FO9B 3MREA 1I85A 3ZHDA 3MLYH 4JPKH 5E5RB 4UOJA 3RP1A 4Y5YA 2CKBH 4J1UA 2OZ4L 3O6FC 2ZNXA 1NLDL 4OZ4B 4K7PY 4G6AD 3WV0A 1TJIL 5I71B 4C57C 1N0LA 4JM2F 2P8PA 2ORBH 2VQ1A 1B9ZA 3D9AH 4GUPA 4GKNA 1C08A 3BKCH 4NJAH 4A2MA 4L8CA 1EGJA 3G9AB 3JWDC 5DQDL 5E2TH 1KEMH 2AK1H 2H1PL 4K71B 4YDVB 1IKNC 1HKLH 4F3FB 32C2B 3L5XH 2R1YA 1WCBA 1E27B 4UIMB 4LVHB 4N8VG 5DUBB 3GEWB 2B1AL 1F4WH 5GSRA 4Z7UE 1YYML 1QPXA 3MRGA 4V2BA 1T21B 3T08A 5C07A 1N7MH 1S9YB 5C0AB 4NCC2 2E27L 4W81A 1A7OH 3MLWH 4S0TD 3L5WA 3O41A 4PFEA 4NBXB 2GUOA 3QI9B 4JRXD 1OSPH 2AI0L 3QHFH 1T3FA 2OR7A 4NWTH 2KQNA 4X7TB 5HI4D 5HTSA 1B0GA 1JTOA 1YNLH 2UY6A 5CBEB 2F74B 4XPBL 5GGUA 4R3SA 4WTZA 1LK3L 4U33A 3WD5L 3HMWL 1X5YA 3EDJA 1SJHA 1E6JL 1GIGH 2PXYD 1TCRA 1GGYA 2NR6C 1V7ML 1A47A 5B3JF 1D5MA 4W4OA 5H2BB 3K1DA 4Y7MA 1JFQH 4L4TA 5FKAA 5JDSA 5J6GB 1T0NB 4PJDF 5IEHB 3QXAA 5GRJL 1Q9LB 5BS0E 4UV4L 3LHPL 1IVLA 1JGUL 3IRZA 1GOGA 3VXNB 1RUQL 4ERSH 4JFPB 4UT7L 2Z4QA 2BRQA 5TPWH 3CCHA 2ID5A 3KPRB 3KDMB 1JPST 1HHIB 1B3JA 4K3JL 5B39A 4CJ0A 3O6FD 3LEXB 4PLOB 3VI3F 1RJLB 2BY0A 1CGXA 4M5ZL 1S5IH 2BCKB 7FABL 1BOGB 2Z92A 4QHNB 4U1LA 1YEJL 2EEBA 4HMCA 4NPYA 3VFSA 5I15L 4HWEH 1IQDB 1GHFL 1Q0YL 5JDJA 4OTXH 1V3LA 1ZLWK 2CIIA 2NY5H 1DQDL 5JXAH 4WHCA 2Z91B 4JZJA 2WLZA 2R9HC 2CLRA 2A1WL 4I0PA 1UM6L 4CW1B 3L3JA 4CVWA 1I3GH 1RK0A 5DD6B 2UY7A 3RIFK 3BIBX 4PGBB 2GFBA 3LMJL 2I07B 4FQHB 5I73C 2IQ9H 1KPVB 5FO8A 3QSKB 3V8CA 3K0WA 3WN5C 4KTDH 4N8CL 5K9QG 1CCZA 5KVEL 4LF3A 1EGJH 1LO2H 1EIBA 5CSZB 3KYOA 4AH2B 1NKRA 4P3DB 3LQZB 2DKMA 5DDHB 1CXHA 5FYJU 3HZYA 1N26A 3PGFH 2O61A 3NCYP 3CLFL 3DMMA 5CILL 5DJZA 2NR6D 5C0RL 4TVPD 1G7HA 3JXAA 4JHWH 2PF6A 3V6FB 2CLZB 1E4KC 1YC8A 5C08E 1Z9SA 5GGVY 3VXMD 1O7SA 2V5RA 1RQ5A 1KCKA 4PTTA 1K4DA 1U8HA 4F8QA 3CDFA 4LPUA 5HY9A 3QA3B 4GMTL 2ESVE 5KSVA 4NHCH 3T8XA 3CFCL 1QYGH 5F44A 4ZFOB 4DEPC 1NDMA 4Z78A 3RI5F 4FQIL 1T4KA 4JQIL 4XXDA 3RHWF 3F5WB 2X7LB 4PLKC 3VGBA 1WBXA 4PY7A 3D85B 3LN4A 4Q9CA 3AXLB 4FZ8H 5KAQG 4PJBB 4NUJB 3K46A 4QRPD 4G6JH 5F9DC 5DHYB 2DQTH 5IHBA 3EJJX 2VDLH 5F1KC 4UDTB 5GS1B 3FB7A 5DD1H 1LGVA 3HNSL 4OFPA 2Q3ZA 5D96B 4Z7UB 1CZ8L 5ICZA 2X6MA 3DLQR 3FT2A 1TMCB 1IRAY 3P4MA 2R9HD 1G7LB 3OKDA 3CX5J 4MNQD 4IDLA 1YNTB 2WLYA 2WBJA 2VIRB 4HFUH 3X13B 4WIQA 1OVZA 5F71A 1N4XL 3QIWC 2CK2A 2OL3L 4FQXC 4Y88A 1A6TB 3GMQA 4WW2B 5GISL 4KQ4H 3UO1H 1S9KC 1AXTH 1MWAH 3BFOA 4P4KA 4P2QE 3WSQL 2QQLH 5INCA 2KPNA 2IMMA 4PJXF 5EO0B 4ZSOE 4PJAF 3FO1B 1FORH 2VL5A 3TO2B 1BZ7B 5EWIL 2IANA 2X09A 5IESH 1W72A 1NAKL 2VISA 4YK4C 4R26H 3V4UL 4KDVA 5EOQH 4PJFB 2XZQH 4HX1B 4JY4A 4RWHA 4RMVA 2FGWH 3ARDB 1KB5A 3DUSB 5BS0B 4EUPG 1B2WL 1D9KC 1FZMA 3HKFA 4D0BA 1AD0B 4O9HH 4G42A 1KBGH 1XF5B 1FNEB 2Q8AL 4H8WC 2EO1A 2NX5A 2VDKL 4XBPB 1KEGH 3NA4A 2AW2A 3WCYA 2NXYB 5I75C 4OF6A 2Q7YB 4EUPA 4R8WL 4X0KA 4K94L 4RGOL 5GS2H 3X17A 5T1MA 2EDQA 2RJMA 4PLKD 3TNMA 3CFJB 4RIRB 3O0RL 4R7NA 3L6FA 1BAFH 3TA3C 2X70A 4R4FH 2CSPA 4QTIL 1RUPL 4YXLL 1UACL 3ULVL 2BMKA 1ES0A 4JHBA 1GL4B 4O00A 1S7RA 3E8UL 4UI2A 1PZ5B 4KMQA 1GGCL 1B0RB 3UX9B 4G8FB 4K8RH 3ARUA 1TZGL 3RGVC 3RZCC 4DTGL 2V7HA 4QGYA 1K6QH 1Y18A 4GQ9L 2FSEB 5I76A 5CZVH 3KPNA 4F15B 3FAXA 3QJHA 3QIWD 3KS0J 4PYHA 1BD2D 1CLCA 4FQXD 4HS8H 4LASL 2ENYA 6CGTA 3D0LA 5T3ZL 5D7JB 4KHXL 1IC7L 3ARGB 5I8KH 3OKLB 4N5EC 5AD0A 1XF1A 1A64A 4I8DA 1PYWB 5FDYA 4NO0D 3VFGL 4U1JA 3DX6B 4R90H 1UJ3B 5I18L 2B2XH 1XGUB 4JDTH 5J11C 4U6XA 4AT6A 4K23H 4ODWA 3BEVA 4QRSA 1HH9A 5D9SA 2I9TA 1CFBA 1U8LB 1IM9D 3VRIA 1JNNL 3MCG1 4KHTL 2C1PA 5F1IB 1D9KD 2J12B 3I75B 4B5EA 3B9AA 2IBZX 4WGVB 5EO1A 5JTWA 1NGPL 1DLFH 5F93C 2DL2A 4LCYA 4G9FA 5FA3A 4C83B 1SVZA 3MRHA 1W72H 3BPCB 3CGTA 3K4DA 5DHVH 4LSVL 2O5ZH 4ZXBB 4I0KA 4H20L 4LLYB 3SDCC 5HD8C 2ZCLL 1A4KB 3VD3A 3BX7C 1KB5H 4LMQE 4LEXL 3FOMA 3TA3D 5TQ0L 5JOPE 2W07A 2FHCA 2DQCH 1L7IH 3QULA 3CSPA 3ZKSD 3MXVH 4FQ1H 3ESUF 4UV7L 1KTLB 4UNUA 5T3XH 4YWGL 5D7SL 4WDIB 4S1SH 3IF1A 2R69H 1NLBL 3H7LA 2NPLX 5SWQB 2BX5A 5D2LF 1MCBA 4EUPH 3RGVD 4GAGH 5A43C 3G5VA 3RZCD 3C9NB 3UBXG 2Q3AA 3IFLL 4JANA 4G7VL 2ITCB 2JJSA 3QNXB 4Z5RA 1OAXH 1A5FH 1P9MA 5CIPB 3DBXA 2P8LA 4P2QB 2Q76B 3ARQA 3KJ4B 5SWZD 3TF7C 1P5VA 2KL6A 4Z7WA 5K9QI 3CDGB 4PYGA 4UUJA 3EYVB 4NQVB 3T4YA 1DJSA 1FIEA 3DROB 3UBXA 3F12B 3V6ZB 1RJZB 4N5ED 2LAGB 4NC1C 2DQDH 3G6JA 4XNXL 3MLUL 4YPGB 1WAAA 4I3RL 4YXHH 3SE9H 1A1NB 2JJTC 4OM1H 4LKXB 1ZHKB 4TNWF 4XNZC 3FN9A 1NFIB 3RI5K 4D9RD 1LO4L 3RHWK 3A6OA 3V5KB 1N3NB 4JFHD 4LSTH 3CK0H 4OLXL 5E99L 4XNQB 4ZTPH 1CE6A 1DQML 4HWBA 5CS7A 4ELKA 3OXRB 1KXTB 3KPSA 1CBVL 5ENWB 4NQCA 3PXJA 1V7NL 4JFXA 5JO5B 5FUCE 3SCMB 4ACPA 1A1OA 5EIIA 1ZLVK 3V95A 4PV9A 1TJHH 4TUKH 1R3KB 5DXWA 2BNRA 4Z7VA 4ZG1A 4E42B 1MVUB 4Z9KB 3MBEC 4L3EA 4ZUUB 3DSFL 2HWZL 5EU5A 1INDL 3DARA 2G60L 2MOVA 5HD8D 3SDCD 4NRXB 1I8KA 3CVIL 4MD5B 4NNXA 1G84A 1WJ3A 3NN8B 1XF4B 5AYUL 3S3SA 3RL1B 4JPWH 2IAMB 5ACZB 2KZWA 3MGOA 3OZ9L 4MB5A 1QSFD 3MXWH 5F9OH 4AK1A 4WO4A 3CZJA 5DMJB 4HS3B 1JF1A 2XPGB 4LIQH 2LABA 1VFOA 3L7FA 5DLMH 1MI5A 1UEYA 1AR2A 3SOBL 3QUMA 4HH9A 1WBZA 4TYUA 1UENA 2V7NB 3AM8C 2AJXL 5A2JH 4RAUB 1MCOL 3WUWG 5L88L 3QUYB 3T1FB 4D0DA 2ARJQ 2NW2A 5D1ZA 3QEGL 4OUOA 5GGSY 2BSRB 4ZPVA 2NY4B 3QAZC 3UZQA 4PLJC 4HUWA 5E0QA 1DQQB 2DOCA 2D31A 1GC1H 1CTOA 1KCLA 3WUWA 3HE7C 1FSKB 5IG7B 3C8KA 1UA6H 1NMBH 1MCJA 2P5EE 2VUOA 4DAGH 1UWEH 4YDKH 2KH2B 1BGXH 2HN7B 1D5ZA 1T80A 1H0DA 4LDEB 5F88B 4DOHB 4L8BB 4GXVH 4AMKL 1M6OB 4R4BA 4MJ6A 3UTTB 5EBWA 3TBVB 3QCUH 4IIQB 4H5SB 4N0UE 5CJOL 4CDHA 2NY5C 3GUTB 4XMLH 3MBED 4FQJH 1IAIH 3RKDD 1FYTA 4XCFH 2XKUA 3HC3L 3OKKA 4F7PB 1P7QA 4D0CA 1T20A 5HGAB 4QT5B 3MRIA 3TBTB 5GJTH 3I3BA 2QEJA 1M7DA 3VD7A 4HG4K 3A6CL 4HWBH 4RFEA 1MCKA 2YK1L 4X6CE 4DWHA 4P59H 5FGCE 5DEGB 3N1FC 1CN4A 2F19H 5DI8A 3IVKB 5HDOA 3MRLB 2P48B 1S9WA 3C6LB 1AC6A 3EYSH 4DVBA 1QSZA 1ZVSB 4ONHA 5ID1B 2DKSA 2DQGL 4P2OB 3V5HB 1QR1B 3D39D 3EYQC 4QO1A 3QRGL 4RMQA 4O2FB 1YEGL 4ALAL 1E4JA 3GHEL 3HC4H 3O6KL 4OZHF 3NBNA 2FIRT 5C6TL 1MHEB 2YPLE 1IEHA 4GJTB 2EIBA 5A16A 5F70A 4PLJD 1RUKH 43CAA 4BSVB 3EDDA 1FO0L 1A7RH 3UC0H 5MEOA 1ODAA 4M62H 4V1DA 3FTGA 4M7LH 4Q9RH 1UYWL 3CSBA 4NOBA 15C8L 3HE7D 3Q6FA 2VAJA 3QYCA 5EU3B 4LVNC 2FJFB 2XWTB 5E00B 5AUMA 3RWCB 5DK2A 3BXNA 3NACL 2F5AH 4QRQB 4PRIE 1BF8A 5B8CC 3FB6A 1ZLSH 2VZVA 1Q1JH 1DBML 1NC4B 1FHGA 4W4OC 2XXMB 8FABB 3LKPB 1U8MA 4DGYL 1RD6A 2LTQB 3OJ2C 5MERA 1H5BA 1S9VB 4FZEH 5DWUH 2WW8A 3WHE1 4HUUA 1CR9L 6FABH 5E6IA 5SWSD 2EEAA 2P7TA 3MLTA 4ZO7A 3CD4A 4X6DE 5HHPA 3MV9A 4PRBB 4NZJA 2OJZL 4HMEA 4OGXL 1AD9B 4FHBD 4P2RE 3CU1A 3RWDA 5F7HA 1ZGLA 3BRGC 3L9RB 3AREA 4XP1H 4MDIB 1KN4L 1JNLL 5C0FB 3KVQA 1PGRB 3CC5B 2IF7A 1R3JA 5LJYH 1JRHH 2XY2A 4AM0A 5IMMB 3K3QA 4OFIA 3MYZA 4UILH 3UBXI 4PGDB 3F62A 3MREB 4JZJC 1PEWA 1AIFB 1Z9OA 1P4IH 3BO8B 1DEEB 1QO3A 2R39A 2D2OA 3KHOA 5FM4A 3EYQD 3DO3A 4I0PC 2DS4A 1IAII 4F2MB 1LE5B 3ETBF 1FH5H 43C9B 1R5IA 2ZWLT 4GAJL 5C07D 2P8PB 5CD5C 3E2HC 3PWNB 3L3GA 5C09E 1CLOH 4GKNB 5KVFL 5F97E 4NUGL 3SGDI 2P5EB 4I13B 4N0CC 4Y4FC 4D94A 1MHCB 4OZIF 5E2VH 2HFFA 3N1QC 3BZFA 5GSVA 5C08A 1LQSR 4XAWH 2R4SL 3KPOA 4IOSD 1UXSB 25C8H 2R1YB 1WCBB 3GI9L 2L4OA 2ESVA 3VFUA 4OUUA 4N9OB 5IV2A 2Y06H 3IJYA 1VADB 3EDEA 1NFKA 3VGFA 2VB5A 1MFAH 4OSUH 4N0UB 4UQ3A 3O2DA 4G8EA 2LVCA 1N6QH 1I1FA 3RWHA 2AV7B 2JELH 2XY1A 1FZKA 1MUJB 1I1YA 1FGVH 2DWDB 3AROA 4LAJH 3JV5A 4IMLB 1IGTA 4UT6H 3FFCA 1UH3A 4Y5XB 4P9HH 1UXWB 4K8RC 3LSOA 4M7KL 5TDNB 5FCSH 3SQOH 5DJXB 5IROA 4KWUA 1FVDB 3JTSA 2EYTA 4NJ9H 4ZUWA 4X6CB 5FO7B 3B6SB 1SJHB 4QLRA 3DYPA 3ZL4H 1QLRB 4MWFB 4NCDA 5BO1H 4YC2C 3FT3A 3BGFB 3TBWA 4M5YL 3H7BA 1L4IA 4M02A 4O51A 3GIZL 5HYJE 3IFOB 5CP7B 5FGSA 5E9DB 3P73A 1JYWA 2ED8A 1ZE3C 1IKFH 4PD4J 1CFVH 5H35B 3X3FL 2OCFD 4WV1B 2H6PB 1GGTA 3SE4A 5A2KH 3B2UC 4YAQA 1RZ8A 2YPLB 1BEYL 1RPQA 4ZSOA 4AZ8A 1AE6H 2J7LA 3D18B 3VWJB 3WFCH 5IB3A 3EKCA 5DS8B 3D87B 2WBJC 3NIFE 4I0PD 3BGMA 3PP4L 1NGZA 3A67L 3V52L 1J5OL 4WY7L 4WFGE 2Z31A 1BJ8A 3PIQA 4HFWA 2FJHB 4FFZL 3RWGB 1L7TH 1PKQE 5I1DA 5CD5D 4TRPH 2I25N 1F97A 4U1LB 4KI1A 3EOBA 3V0WH 1CDJA 1U9KA 4P4KC 4YFDB 1NCDL 4I18B 1K4CA 4N0CD 4Y4FD 2DD8L 4KUZL 1JNJA 4I77L 2XN9A 4CVZB 3MOBH 1CFSB 5FYJE 3IAGC 4IOIB 1GGIH 5MI0C 1JRHI 3KPQB 3D25A 3DV4B 1F2QA 5H8DA 3WLWC 1MLBB 5GS2D 3QEHA 1MJUL 2BOCB 2NLJB 1LNUB 4WHDA 4NWUL 4OLZH 5F1NA 4X5XB 3U4EA 4E0RB 1B90A 2YPKA 4PJGE 4UIKH 2VSDA 3PGCA 4KRLB 5I66A 3R4DA 3NIDF 1BWWA 4PGCA 4JO1L 4WFFD 3SPVA 5DJ8B 4X6DB 3HE6B 3K8LA 4MYWB 4NBZB 5L9DL 4GG8A 4U7MA 5HXMA 4KTYA 3WHE0 3MROA 2IPTL 3KYOB 4TOYL 4OLVL 1HIMH 4I3SL 2FR4A 2IPKB 4K8RD 3RWJA 1G6RA 3U0WL 3STZB 3QDGA 4OIBA 3QIBB 4EOWH 1AGCA 5IB5B 4OIIL 1PZUB 3X3GH 2W0PA 5CINH 4QCIA 3FHAA 4HF5H 1D6VH 5CHNB 2C4XA 3L3IA 3O2DH 3JWNC 5KSBE 4YHOH 5LQBH 5DRNB 1TVBA 3FQWB 5IMKA 4NO3A 5DK3A 2WK2A 4CMMB 4H26B 2CDGA 5D7IF 4PUBH 4WI4A 1TETL 2YKLL 1EJOH 1NDMB 4UTBL 3B2UD 5JHLL 5HHOE 2X4NB 1S5HB 1JPGB 4ETYA 3Q5TA 3BAEH 4A6YL 1WBXB 2WBJD 2BK8A 5IVOA 2WINA 4PY7B 4D9QD 1YJDC 3G04A 4B53A 3VFMB 2MKLC 3LIZH 1RIUH 5B22A 4F80A 1A6UH 3BDBA 4J23A 2R0KH 1NGQL 1F6AB 5I1JH 2HJLA 4P4KD 4U4BA 3RGHA 4N0RA 5KTEH 2BC4A 4XCCH 1PFCA 3LKSA 1TJGH 1OGAA 5CIPH 4ZFGH 3HS0B 4BZYA 1MCPL 1WT5A 2P46B 4HV8A 1KB9K 1ONQA 2IAND 5ICZB 4U6TA 5KN5A 3ULUE 1QFUL 3WLWD 3DOSA 2JB5L 4FG6C 1H9VA 3L5JA 5J9PA 4PS4L 1JMZA 3GJFK 4MQ7B 3T0DA 3GM0A 4YBLC 4GAYA 3VA2C 1A21A 3QQ3A 5T5NG 4S1DC 4Y4HA 2VNCA 2AQ3A 2HYMA 5JLZA 5T3XD 3DXAE 2C3GA 1NC2D 1KLGB 1OWRM 3ROLA 3TPUA 2NX5D 1OTUC 2XICA 35C8L 4FQ2H 4Z8FH 4HCRH 5JPMB 4JFFA 4XI5C 5I71C 3ECBB 5H94B 4XP6H 2ZNWA 3O2WH 4NNPL 1I7RA 4JG0H 3QISA 5F1OB 4K9EH 1MCEA 4TSBH 5HYJB 3AFLA 3KAAA 4EDXA 5IB2B 3PXHA 1FZMB 1QFWL 4UOW0 2ERJC 1HE7A 2WWKO 2APTA 5FCUL 2IMNA 3H3KA 3MRNA 3ZKXC 3ZE2F 2VTFA 3ORJA 4HPOL 1I8MA 1FZJA 1YN6B 3GMMA 4RMTA 3RNQA 5GGRA 4WGWB 5EUKB 4GKZB 4P5MA 2D7NA 4CAGA 3QUZB 4KAQL 4CRPA 2Z35B 4MJ5B 2DQJH 2JJSC 5GHWH 5EC1B 3QDME 3UROR 4QHLB 1P9MC 3U4BL 1DBKH 3W0WD 1YEIH 2IADA 3RU8L 4W6YB 4KZEL 4MNHA 2OS7A 4NZUL 2XTJE 2X41A 5JQ6H 1FJ1B 1ZWIB 3DI2B 5HPOA 1MRCL 4CBPA 3BZ4A 5INDB 4PJEE 2A74A 4YUEL 5ESVA 4N68A 5D6CB 2WUCL 1AGFA 3GBMH 5CEYA 3CJJA 3VD9A 3KLAB 5IIEB 1WZ1H 4TTGA 2V7HB 4HAFA 4UAOB 3UPCA 4LCWA 1NGWB 4XVJL 2F8OA 4PJGB 3SEPA 4PJIF 4ZUTA 5HJ3A 4IS6B 4FG6D 4KV5F 2BRRH 1OSZA 4U1MB 3WFEH 4BFBD 1YY8B 5F6IB 4U2ZA 1OAQH 2EYSA 3BKJL 2DQEL 5CJ8A 3MJ7A 3PABB 4M43H 5CSGA 4JJ5A 4S1DD 5L0QB 2PYEA 5L2KA 5L6YH 4LEOB 5TGBB 5LCVH 4RWYL 4G9FD 3ROOA 1OTUD 1J0IA 2W9EH 3GHBL 1M71A 4U6XB 1CXLA 1EMTH 2IALA 2FCBA 1GGUA 5I1GL 1MQKH 5KSBB 4UINL 3HUJF 5D1QB 1CT8A 2GAZA 3ULVE 2FL5A 2NNAA 4HXAL 4Y1AD 4Y5VB 1G7MA 2VLKE 3VFNA 2A73B 2C7UB 3FQNA 3LEVL 2V6HA 3E6FB 2HTKD 5HHOB 3C08L 4U1SA 1IJ9A 5GIRA 2QKIA 3G6DH 3HI6H 2GCYA 2FBJL 3FJTA 2Y5TA 3HAEB 3Q48A 3U36A 5IWLA 1S78C 1QD0A 3MRHB 3QXTA 5C0AD 1GAFH 1AXSA 1RK1A 5T3ZE 2WP3O 1EEZA 4XP4H 3OR6A 4GG6A 4X9FA 2YD1A 3CX2A 3H8NA 3S7GA 3S35H 4WW1B 5D1ZC 5EZLA 1IFHH 1N5AA 1FL5A 2EH8H 5FO9A 5I8CB 4OCSL 3BQUB 5IVXF 1NGXA 3TIDA 2MQCA 2WQ8A 1JBJA 2CJUL 4AEHH 3SKJL 2QSCH 2X4QA 5SV4A 4QY8B 2C3WA 4K2UH 2GSIA 1A0QL 1AGBB 2EKSA 4XHJC 3BP6A 5D5MB 3V4PL 1INEL 3K74B 2MMXA 3VJ6A 3O11A 1G7JA 1T22A 3DUHA 3G5VB 5BQ7A 2FD6H 2BNQA 1JPTH 1ACYL 2I9LB 3Q6GL 5F7KC 5IJKA 4JKPH 3VGAB 5E08H 4HUXB 3DXAB 1ZANL 1EXUB 1MNUH 1MF2L 3IFNL 4K3HA 1XGYH 4BK5A 1QLEH 3KPSD 4GRLB 4NQCD 4L9DA 4HWNA 4L9LB 4G5ZH 4K3DH 5IR1B 4NKIH 1WC7A 3I2CL 1EERB 1Y6NR 2A6IB 5JOFA 4NP4H 1KCVL 1XR8A 4X6EA 5A2LH 2BNRD 5F9AC 3GJEB 4JR9L 4NFBA 1F4XL 5MENA 2EDOA 1TZIA 1SM3H 3JSSA 2VH5H 3NTCH 3J8F7 4P23A 4WWKB 3HN3A 4DGVL 3OJMB 3TO4A 2X9YA 5D6DA 1FRGL 3WXWL 3N50A 4CGTA 1YEFL 3C8HA 4MA8H 3RUGF 1FE8H 2QQNL 5EA0L 2ADJB 2C3VB 4X9GA 1B6UA 1HQ4B 5EIIB 3VCLB 2PYFB 4EQ3A 3OKNA 4GW1B 2W0KA 4Z7VB 3QDMB 5HHNB 4UT9L 2J5LB 4K7PX 1HHKB 4L3EB 1S78D 3ZZ1A 3RWFA 3H9HB 5FOJA 1Q9OA 5CEZE 2DM4A 3H2WA 1EHNA 2XTJB 1IBGL 1ZA3B 2Q6WB 3UPRB 1CL7I 5HGGS 1NUGA 4QTHB 5EUOE 1W8NA 4M8QA 1RVFH 4NRZB 1W0VB 1CGSL 1XCQB 1YA5A 4PJEB 5DRXB 3BZEB 1KPUA 5D1ZD 5D93B 1BFSA 3IGAA 4IRSB 1KCUL 3P9MB 5T1KA 2F53E 1OARH 3ZE0F 2ZPKH 3R1GL 4XHJD 4P9HC 3H9SB 4HH9B 3I6GA 1RJYB 1P53A 2AEPH 4OZGA 3PG2A 4FQCH 3NZHH 4B7LA 1YNKH 2DQHL 2FZ3B 1PX4A 5ETUB 3UTZB 4XBEL 4JN2B 5JXEA 1A6AB 1R3IH 4R2GB 4D0DB 1VHPA 1G9NH 4LLQA 5I1IL 2W9DH 5EZIL 4P2RA 2WAHA 4PP2B 4L1HA 2NXYC 3VXUE 5I19L 4R97B 4EDWH 4YIQB 3RL2A 3U9UA 2OMBA 2Z0BA 1D3CA 4LLWA 5FA4A 5DUPL 4JRWA 2EDWA 1VKXA 2EIZA 2XRAL 3KLHC 1A7BA 4C55A 2GITB 1BREA 5LBSH 3T0WA 4J2XA 2NY0B 2BVTA 1P7QD 4N9GA 5I1CL 4MB3A 3OKEA 2L0DA 1XIWB 1U8QA 4K55A 3UJIH 3OXSB 1N59B 3BT2L 3GKZA 2ZCKL 2R0WL 1WGOA 1HNFA 2NZ9C 5IP4A 3C5ZA 3WKML 1E28A 4DCQA 1Q72H 4M6NH 3R06A 4XWOC 4WJ5B 2X89A 3B5HA 2VLLB 3OKKB 1SYSB 5DTFB 5LGHL 5C0JB 4H25A 1F58L 4HZLA 5D7JC 1F4HA 2X1PA 3MRIB 3HFMH 4KQ3H 2VDNL 3UMTA 5I1HL 1M7DB 5FUZH 1BX2A 2M8XA 4DKEH 4RFEB 3MLYL 3U7YH 2XOTA 5IHZA 4JPKL 4PB0H 2BVOB 1HILB 1KPRA 2CKBL 4NO2A 2WBWB 3I02B 1BIHA 2D4DA 2PW1B 1BJMA 1WTLA 4YO0B 4PR5A 1CD0A 1N8ZB 4ONHB 1AC0A 2ORBL 3QQ9C 3D9AL 4LVEA 3OJDB 2ITDA 5IW1B 3CUPA 4EJ1C 3BKCL 5BS0D 4K3EH 3DECA 3ZDZE 5TE6H 2OZ4A 5E2TL 1KEML 2BSTA 4U1KA 5J06A 12E8H 3PQYA 4WU5B 2W0FB 4MAYB 2X9WA 1T66C 3L5XL 1YMHA 1AKJA 4JPIA 4OFYA 4JFOA 4J4PA 1U58A 4O2CA 5FM5O 2AJVH 3ALWA 1MLCA 4V1DB 1N7ML 3H9ZA 3KLHD 2YBRB 3MLWL 4KJPC 3S3PA 3OHXA 4GRWE 1FFNB 3NH7L 1OSPL 3QHFL 3ZT6A 4Z7OE 1S9XB 1OF2B 2X4SB 1A4JB 1BIIA 1YNLL 4OF3A 3IFPA 2DWEA 1J0JA 4LBEA 3RBSA 2J3SA 5GJSL 3EYUL 1FFOB 1A8JH 4RMRA 1AGEA 3S36X 4NFDA 4KFZC 1I7UB 4EN3B 1ZTXH 5HYSG 1GIGL 4LRNH 5ICXA 4NZTL 2NZ9D 4X7SL 3MJ8A 5DRWA 1PKQA 3PHOA 1EO8H 1VEOA 1T2QL 5DT1L 4XWOD 5BVJB 1JFQL 3KJ4C 5F7UA 1SMOA 1S7XB 5EUOB 1T7YA 2CD0A 1SYVA 5HHPB 2D0FA 3U48A 2IJ0C 4PG2C 3LV3B 2F9BT 5D7JD 1U3JA 4XC3H 3NA9L 2Z31C 2F53B 2NY6C 4QHUB 3ZKMC 3MX0A 2R56H 5TPWL 2OM5A 5L8JB 1JGDB 1G7QB 4PY8I 1R3JB 4GOSA 1KJ3L 5SV3A 1HDMB 2B0SH 1IAKB 3MRMB 1OB1B 2O5XH 2H26A 3CMOH 5C08D 3L7EB 4LSQL 2GK0B 2NTFA 1I8IB 2ESVD 4OTXL 4U49A 5DMIL 5F3HB 5JXAL 4K9EC 3VXUB 1FVEB 5CJBA 2VDRL 1X5FA 4OIAA 5ESQA 2HKHL 1TZHB 1HI6A 1T66D 3L3GB 5C86A 5E8PA 4BQ8A 1I3GL 5JORA 5CZKA 2B20A 5EULV 1Q9KA 1R3LB 3B5TA 4XMKH 4LPYA 3V7AE 4Y19E 1G7PB 2D03H 3FFCD 1T89A 4KJPD 5IB1B 3GFUA 4U3XA 4F33A 4LCUA 4KTDL 1TLKA 1G0XA 3C5JA 2FX7H 5HHME 1U3HC 2OZ4H 4EI6A 4GQPH 1LO2L 3KXFE 1KNOA 4HKBA 5CGYC 3HLAA 4QF1A 2YUWA 5EPMA 5TF1H 4UQ3B 4Y16A 4G8EB 1RZKH 1KG0B 3BPNB 4ELME 2VN4A 1I1FB 3RWHB 4QXUL 2B5IC 3UTPD 2VC2H 4HK3J 4GW5B 3RWEA 3D2UA 1H3VA 1Z2KA 4BUGA 4JHWL 4KGJA 2PTTA 2ZUYA 2C1OB 1NGYA 3NIGE 3UTSE 1IAOA 2JCCE 5BRZA 3UJJH 1MCDA 5ICYB 3G5XA 2B1AH 3FRPG 3MYJB 4BH7B 1QYGL 1P1ZB 2Z31D 4G43A 4UMGA 2NY6D 3ZKMD 2E27H 3KNBB 1CFQA 2FECL 3TCLA 4QNPE 3H7BB 3TJHC 1I7ZA 3IKKA 4OAWB 1UVQA 4JFQA 1J12A 3FRPA 4FRWA 2CK0L 4P46B 4MSWA 2Z9TA 1WT5C 3OWEA 3FQRB 5IB3B 3HMXL 1LK3H 2VDLL 4PJXA 3WD5H 1A7QH 4PJAA 4HKXA 4HS6A 5DD1L 5FYJH 2BSSB 1V7MH 4HFWB 3GSQA 1IEBB 1AH1A 4G8GE 4Y8DC 3WO4C 4XGZA 1A2YB 3M17B 1NCNA 4GRWB 2BVQB 3LHPH 3ARFB 1JHKH 3G5ZB 2DJ4A 5HI5D 3FQTA 4KQ4L 4ZFFA 3UO1L 1AXTL 1LK2A 2YXMA 3MA7A 1MWAL 3SDXE 3QDGD 3M1BA 5E5MB 2CDFA 2QTEA 2QQKH 5TE7H 4OI8A 3BE1H 4HKJB 1U3HD 3ES6B 5E24E 5FF6A 5FK9B 4LSSL 1FORL 3C6LC 2D9CA 2OL3A 4JLRA 5CGYD 4M5ZH 5IT2H 7FABH 4XPAL 5L8KB 2AJZA 3A6BH 3GSOA 2OMNA 4XZUB 5EOQL 1AHWA 2R0ZL 5I15H 5I1LA 3OAZH 5C9JB 1I7TB 2QHRH 1Q0YH 3LKOA 2EKJA 5DJYB 1DQDH 2FRGP 1U8OA 3BWAB 2Y36H 2AK4E 1FAIL 4O9HL 3GMPA 4CKVX 1KBGL 3BKYL 5FM8A 2ZOLB 3RA7L 2OX5A 1QHPA 2D7PA 4QYOB 3TESA 2YZ8A 1P84K 2A1WH 2FX8H 2DYPB 1KEGL 3HG1A 3VXRA 4RMWA 3MZGB 3FMGL 1M05A 4JCMA 1X4XA 3C2AH 3LMJH 3UZEA 3TJHD 4OD1L 3Q3GA 2YSSA 5KVEH 1QA9A 3VG0H 2A38A 5C0EB 4NO3B 2UVEA 1BAFL 4Y0GA 4KKBC 1G9EA 3SO3B 2VITB 4OKVB 3QCVH 3GIVB 4HJ0C 4B7IA 3FRUA 2GT9A 3UYPA 3CLFH 4G7YH 1T5WB 1HOCB 5CILH 5F89B 4K8RL 3QQ4A 3ULUH 3FO2B 4ZD3H 3L3OA 3U1SL 4PB9L 1ZVHA 4Y19B 5ERWA 5CKAA 1FC2D 2B39A 5CZVL 1QRNA 3DYMA 3QXDA 3DURA 4R96A 3NMEA 4LHQB 4RMUA 3KR3L 2VLKA 4HGWA 5JOPD 2XNAB 4HS8L 3MRJA 4GMTH 5HHMB 2NXZC 1X4ZA 3KXFB 3LH2L 3B2VL 4CADB 5DA4A 3QJFA 5LXGL 5I16A 2VR4A 3B5GA 1C5DA 3N1GC 1F3JB 4FP8L 3D5OF 2FIKB 4RA3A 3I6KA 5EO9B 2Y4SA 1CG9A 2HFEB 3C6LD 5KVDH 4C59B 4F7TB 1FFPB 3QQ3B 4HWZB 4YHNA 4K23L 2B4CH 2H2SC 4JN1H 4KI5E 5E2UH 3UTSB 2JCCB 3O2VH 2EXYC 3LN9A 4PY8J 1UM4L 5DJ0A 4P57B 3U6RA 3PWVB 1QPPA 5IWLC 1TNMA 5CD3A 1Q38A 3CFEA 1CZ8H 3GSVB 3D48R 4M3JA 1JI2A 3CH1B 5C0GA 1DLFL 1TPXB 4BSJA 3TBSA 1J1XH 3MLSH 5D2LA 1N4XH 4X4YB 5LVEA 4KDTA 3W9DB 2FEDC 3REVA 3P2TA 1G9NC 4PRDB 3MR9B 1HSAB 2O5ZL 4BZ1H 5MEPA 2FJGB 4YDJA 4MCZB 4LAQL 4RBPH 4LCCA 4G8IA 3VH8B 3P11L 2XWJB 1OLLA 4KKBD 2DQCL 3DVNA 3G08A 1L7IL 1DEDA 1U8IA 2VKWA 3L3DB 3MXVL 4FQ1L 4HJ0D 4ZUVB 5JHDE 5C6PB 1VFBB 4J7RA 4G8GB 4KROB 2OXGA 5IJKC 1T1WB 2PTUA 4HPYH 4PRAA 2JK5B 3OGCA 2OTWB 5IKCB 5DC0A 4GRMA 2FO4B 1RZGB 4GAGL 3MTRA 4Y5XC 3D0VB 2BVPA 4G80B 1X44A 1EUUA 1A5FL 3SDXB 5BZDA 3HR5A 3O4LE 2PCPB 4ZFZA 1NCUA 3AS2A 1W0YT 3MV7A 3SKUD 4CN4A 3C09C 2QADC 2H32A 2NXZD 3E3QE 5E8OA 3VFRB 2R0LL 3MO1B 4LCWB 2X1WL 4RGOH 4OI7A 2CLVA 1PAMA 2DQDL 4FXGB 4P23C 5FIEA 1NCCH 5D6DC 3K8MA 4HIIA 4JO4L 4QTIH 2Z93A 3WNMA 4L4JA 4WV1C 1UACH 2H2SD 2PW2B 4DGIL 3ULVH 2J4WL 2Q86A 2PYEB 5EN2A 3SGJC 3BHBB 4QOKA 1CXIA 4LSTL 4LSRL 4ZTPL 1YPZA 1CK0H 2EXYD 3O8XA 4CNIB 4I5BB 4JFYA 1Q9WA 4JDVB 1TZGH 4F37F 4OV5B 1M7IA 4Z6AT 1MAJA 3ARSA 2MWCA 3W39B 1XCTB 2NY1B 4K7FA 4MJIA 4TUKL 4FQQA 2ATPB 1ORSA 3IAQA 1A1MA 2P5ED 4ZAKB 5DURB 2FEDD 1ITCA 3V0AC 1DE4A 4BSWA 3C60A 4LKCB 1X6LA 1F3DH 1GZQA 3BD4A 2H8PB 3DVGA 5T3ZH 1T04A 1NMCC 2N1KA 5ANME 1IC7H 2ZZUT 2ZOKA 4Q7DA 4QRRE 3ALXA 3IDIA 3NGBB 1TIUA 2QKIB 3TZVA 2GCYB 1EFXB 5IF0B 5C0CA 5KVGH 3ZDXE 1CQYA 4WFEE 3TFKC 1UKQA 2P5WA 3MXWL 4JAMA 2BNQD 2ICEA 1IZJA 5JXEC 5BOZG 1OOAA 5DZOA 2V2WB 2Q8BL 3WE6B 1XF3A 5FM5M 3RKPA 3VE0A 1EEZB 3OR6B 3HE6C 1IC4L 1DQLH 5HHVH 3TGXA 3LPWA 3B3IA 1Y0LB 4U1GB 3MRPA 4L29B 1S7QB 2BOBA 1YDPA 4L3CB 3DV6A 4LLUB 2E8ZA 1NGPH 3C87A 3BGAA 3V5DA 3CU7A 4MXVF 1JZ4A 4X7FC 5GPRA 2QADD 4RX4A 4E41A 4PJ5B 1BJ1J 4DKAA 5MEND 4PPTA 4LSVH 4KDWA 4KRPC 4H20H 4JHAH 3WS6C 1MIEH 4PJ7F 4P23D 3GGWB 1GC1L 4HSQA 1WBYA 4YZFF 2G5BB 3HZMB 1NMBL 3O45A 3OR7B 5TQ0H 4O58L 4MHHG 4DAGL 1UWEL 4YDKL 2PR4L 3IDJA 4LP4A 2VE6B 5I74C 5D7SH 3WFZA 1JV5B 5GRUL 4GXVL 3C5ZC 1OP3K 1INQA 2Q87A 1NLBH 3FHQA 1LP9E 2AXGA 4NQDE 4F7EB 1RZIA 2CQVA 1T0MB 4G7VH 1N6VA 2KQMA 4XMLL 3T0AA 4PJDE 3TO4B 1G9ML 5CEZH 4J3XA 1W2KT 3IJSA 2NQCA 4XCFL 4XT1C 5D1XB 1CTNA 4JGMA 4QHKJ 4MX7B 4PRID 1DN2A 2FYYA 1JGEA 5T1KD 3KPMA 4GBXA 2J8UE 4OZHA 5GJTL 3CZFB 4XNXH 5IBTH 5B38G 4UNTA 3HRZA 4HQQL 4I3RH 4XCNB 2BDNH 3LPGA 4P59L 4HIEB 2F19L 1NCBH 3TFKD 3DETC 4BK4A 1J8HE 1O5DT 5JXED 4WUUE 1T0PB 1QSEA 5EIVA 5KVMC 4YEFA 5E99H 2P8MA 3O4LB 1HSBB 3HE6D 4M8QB 3SKOA 4HLZH 2BERA 1CBVH 1QOKA 3DX9B 4P2RD 4J4PC 4YE4H 3OGOE 3QWOA 3OX8A 1KXVC 5DJDB 3PWUB 5FV1L 3QXUA 3GMNB 4I48B 4JREB 1MH5B 5ISZA 1A9BB 3FONA 1HQRA 1RUKL 5IGXH 2HWZH 3GSWA 3W5MA 1K3IA 1INDH 1A7RL 4KRPD 3UC0L 1CU4H 4M62L 3CVIH 1QVOA 4M7LL 2WZPD 1VACA 1YN7A 3RY5A 1U6AH 1F4AA 3BJ91 1C8PA 1FN4B 5IVZB 2AJSL 3GJFA 2ED9A 4KXZH 1PJ9A 4U0RB 2OJEA 4G6FD 2G9HB 1FO0A 1QP1A 2X4UB 1ZLSL 1FLTX 3C5ZD 4OF8A 1Q1JL 4ISVB 4JVWA 5C09D 3TYFB 3RTQC 4RGMC 1KTRL 3SOBH 1VFUA 3F65A 1FNGB 2AJXH 4FZEL 2C3HA 3IXTB 3T0EA 3L3KB 5ANMB 6FABL 1JN6A 3R0MA 1GRWA 3RY6A 4Y4KC 4Q6IB 5FAAA 3V7AG 4NQTA 3DIFA 3KYAA 5JW3L 3UP1A 4UAOC 4JM2B 3HNVH 4RRPG 4F9PA 4H1LB 3SJVA 4XP1L 3BEWA 4ZO8A 2R2EB 1DBBH 4Q9QH 4HMDA 2AJUH 5EU4B 3PNWB 4ZFOL 2GJJA 4OZIA 1HYSC 5F7DA 2NY3C 3DETD 5CEXA 1VEMA 4BFGA 2HJFA 4LLVB 2X44D 4UILL 3PQYD 4BELD 5ECJE 1DUYA 1UCBL 3T3MF 5JPNB 1KIQB 1HEZA 4OFYD 4J4PD 1AP2B 3QZWG 5BOPA 2KDGA 4ELMA 3VGDA 5IHUL 1XGRB 1T89C 2R8SH 4Y5VC 1CLOL 4JZOA 4F37K 5CSBA 2R29H 3KYKH 5D2NA 5DD3L 5E2VL 2E7LA 3KLDA 1OQOA 3QZWA 1ND0B 2YK1H 2ZCHL 3KYNB 1LP9B 4DFHA 4XX1G 4XRCA 2HLFC 3ZYOA 4CJ1A 2B7DT 1T03L 5C7XH 4NQDB 3VG9B 5JOEA 4OCRH 1MFAL 1HH6B 4OSUL 3MBXH 3RTQD 4EKXA 1NBZA 2AERT 4PJDB 2VZUA 4LHUB 4F7MA 3UDWA 4D9LL 5HGDA 1ZHBB 5F9WB 2Y23A 2H3NB 4TSCL 4OQTH 1ETZA 1G6VK 1CICB 2W65B 5MHSD 2DWEB 4ALAH 1WITA 4P9HL 4LRIA 3O6KH 1P2CA 3DSNA 4TUJA 1LD9B 4X80L 1AGEB 3SQOL 3RJDA 1C12A 4Y4KD 4NJ9L 4TTDC 3ZL4L 1FO0H 1QQDB 1DL7L 1J8HB 3DPBA 4KXZI 5I9QC 5K59F 3THML 5EZJA 3VGAC 2AS5M 4WUUB 4M6ML 15C8H 1HCVA 1IILE 3W82A 4PJCE 2WUBH 1HYSD 2NY3D 1J1OL 1M4KA 3NACH 2ZG2A 1NCAL 1IKFL 5E6ZA 4L9LC 2A6DA 1UM5H 3IB4A 4G9DB 4MDJA 2B4CC 4DGYH 1AE6L 1JWMA 2QV2A 1UKTA 3IDGA 4QRUB 2VLJA 1FFQA 3QUXB 3SKMA 4NHUB 1L7TL 4WWKC 3OKYA 3QFDB 4TRPL 4JRXA 2V2TB 3GI8L 1FDLH 3V0WL 2GHWB 4FXKB 4B50A 2OJZH 4HG4J 2ICWA 2AK4A 2PO6A 1UB5B 1YMME 1K3ZA 3DTXA 3RPIB 4PBVC 4OB5H 1W0WB 4MHHI 2X4RB 1HHHA 1B6DA 1KXQE 3V6BR 5HHOD 1GGIL 3PJSB 1KN4H 4QXTA 5I8EA 2HLFD 5DJAA 2AEWA 3PV6B 5JORB 3K4AA 1Q9KB 1VGEH 4HJJL 4KZDH 4OLZL 4NDMB 1BQLH 2XTJC 1KCSH 2ZSWA 3JUYA 3D2UD 3HZVB 5C3TA 1ADQL 4NQEB 4C58B 1DUZA 1EEYA 2AP2A 3I6LE 2L7JA 2VLRE 5BRZD 1LWRA 2R2BB 3E6HA 5D7IA 3DRQA 2CRZA 1HIML 1JTPA 4NC2B 2R2HB 3EYOB 3JV6A 4M48H 3IDMB 3P77A 1D6EA 1PG7W 4MNGE 3BP7B 4TTDD 3VXTB 3X3GL 4NUGH 5CINL 2LQRA 3ISWA 3SO5A 4HF5L 1MCNA 3O2DL 4OGZA 2YRZA 1X7QB 1IGMH 2ZUQB 4YHOL 2R4SH 4JY5H 5LQBL 1TQCB 3GI9H 1K8IA 5DJ6A 4LOUC 4U2YA 4UQ2B 1BFTA 1BVKA 2GSGA 1IKNA 4ZQKA 4PUBL 5J56B 3MFFA 1XGPB 3I3DA 5K9KA 3ULVC 3KHQA 3BAEL 3MJ9H 1ZHLA 2NY0C 3LIZL 4LDOB 1RIUL 2A6JA 1D5XB 4WWKD 1A6UL 2ZP0T 3KPLB 1FPTH 5D7LB 5T1LA 4JO3L 1S7WA 4M61A 3V7MA 4PJXB 4PJAB 4P5KA 3WEXA 3SGKA 1WK0A 4A6YA 1YQVH 4YGVB 1LEKA 1TJGL 1IT9L 5DEZA 4OLYL 5BXFB 5F7EH 3HC0A 3MNZB 4NFCA 4C56E 2HVKA 4M5YH 3AMLA 3GIZH 5D71L 4Z0BH 3VWKB 2XTJD 1ZHNB 3T2NH 3X3FH 4ORGA 3NZ8B 5EBGA 5DQ9A 3JTTA 3STLB 3IS1X 4U1NB 4PBWD 1A6PA 2AEIT 2ZSVA 5JHDA 3HG1D 3A67H 5FF6B 4Z8FL 4HCRL 4WY7H 1JZ2A 4KDTC 1J5OH 2OL3B 5EFIA 1LEIA 4O4YH 4XP6L 3LKRA 4DVRL 4JG0L 3BUYA 4LPWA 4PJ9B 1DDHB 5CMAA 4OZFB 3TVMB 4K9EL 4TSBL 1SHMA 1NCDH 4PJCB 1J0YA 4LCCC 1P4LB 1S3KL 4E9LA 1G0DA 4LSDA 4LVOB 3RVUC 3VXPB 2GJZB 2C9AA 4XNMA 4QRPA 2UWEA 2XQBL 3I9GH 4LOUD 1H3PH 5J89A 5I17B 3FB5A 1C7TA 1JWSA 1RY7B 4NWUH 5LGJB 1FC1A 1OM3H 2AXFA 4PJIA 3WS3A 3QG6B 5L2JA 2DQJL 5GHWL 4S2SA 4JO1H 2APXA 3ULVD 1ROWA 1QRND 2HVJA 1DBKL 1YEIL 2E9IA 4MQSB 2VLKD 2NY0D 5GRXG 4ORZC 4TOYH 1YMMB 4OLVH 2P4AB 3DX8B 3U0WH 4KRNA 3S5LG 3WN5A 5EOTB 1KN2H 3N06B 4QHMB 3D3VE 4K7PH 3PDGA 4OIIH 4EN3C 3RWIA 3LD8B 3GMLB 2CUIA 2Y72A 3GRWH 2NY2B 3H42L 4CU7A 1WZ1L 1FZOB 3MNVA 4NQXB 3HUJA 3MRKB 5T3ZD 4O2EA 5AWNL 1XGTB 1TVHB 3S5LA 4Q2ZA 4R96B 2BRRL 1ZGLM 3LRGA 3I85A 1DQJB 5GGSB 2XQYG 4LNRB 4XNUL 5KZCB 3EBAA 1I1AB 5A3ID 1OAQL 5IM7A 3BRFA 3OG4B 4WU7A 4Z0XA 3DHMA 4M43L 1E4KA 4QRRA 1XZ0B 1TETH 2YKLH 3BD5A 5JHLH 4LL9A 5IBLC 3JV4A 2J6EL 4KJYB 5LCVL 5F7YC 4MNGB 2W9EL 5IOPB 1BVLA 3G6AB 3GMRB 3EO1A 3CLEL 1QEWA 3C60C 3QH3B 1EMTL 4X4XA 1MQKL 2QJDA 1S7VB 3TZVC 2V9TA 3TYGL 1MCQA 5C0BA 3RVUD 5DJ0B 3IXAA 2FO1A 3IDYB 1VB9A 4RFNB 4OLWL 1GGBH 4YHIB 4MZ2A 4X99A 1VGKB 1QFUH 3G6DL 3HI6L 1DBAL 4MB4A 4PS4H 1GJIA 2ICWI 1JZ5A 2ED7A 3VXOB 1WFNA 3O3AA 1AY1H 3OB8A 1GAFL 5MEPB 1CVSC 2XFXA 3MRRB 3KWWA 1GOFA 4XP4L 3ELAT 5EB9A 3VXSE 4ODXB 3DVNB 5I30H 1I9RL 3CFKA 4FTVE 3QP3A 3PWLA 4C56B 4AEHL 2QSCL 3CSYB 3X12A 2J8OA 4K2UL 2QR0A 3OGCB 4EN3D 5KG9A 1KCRH 2VYRE 3U30B 1G7IA 1R24A 3WIFB 4RNRA 4D8PA 1GOHA 3PL6A 5CCKH 3FB8A 3S4SG 4NSKA 1AR1C 5FDWB 1UJTA 5F7WC 3U46A 1BLNB 3EOAA 4BKLB 4X6BA 5BZDB 3CFDB 3RUGA 4HPOH 3HI1A 3D69B 5SX4H 2KUTA 5E8OB 4I0CC 1QLEL 2EE2A 2WM0A 4HK0A 2YMXH 5DQJA 3AU1A 2VWEC 4PTUB 4LLDA 4UDUA 2VR9A 4Y2DB 3AB0C 4K3DL 2P44B 3S4SA 5IBLD 4QRTA 2FX9H 3U4BH 1CFNA 4MJID 2EC8A 2OSLB 3BDYL 4KZEH 4BFEA 5ID0A 5J6HA 1SM3L 3C60D 3O9WB 5GRWA 2JIXA 4P46C 3NTCL 1MRCH 4FA8A 4GBXC 5LAXB 2W60B 1KIRA 1CGYA 1KB9J 4YUEH 3TZVD 4WUKH 4PGEB 4NCC1 1DR9A 1DFBL 1FE8L 1ZEAH 1WFTA 4JRYE 3VXUD 2WUCH 3BOVA 5M7QA 1PKOA 3O3BB 4HZAA 3T4AA 3NAAL 2GTWA 3LCYA 3LRSA 2P5WD 4HIHB 1XMWA 4APQA 4KTEH 1YC7A 2JJWA 4GW4A 1H15A 1CGWA 2DMCA 4MD4A 1KIPA 1LO0L 3ARFC 3MA9L 4H1LH 5L7XH 1YEDA 3BKJH 2DQEH 1LEGA 5AYQA 3P30H 1IM3A 2WIIB 3K2UH 4ODUB 1T1ZB 3S36H 4XMPH 1ORQB 4PBXA 2GJ6B 3LZFL 1CI5A 4MS8C 5C0CB 4RX4D 3ILPB 4CDGC 1JUFA 4E41D 3GHBH 4X5WA 4XCYA 1FIGH 3IJHB 4KMLB 3PDDA 4JAMB 3UTQA 1R5WA 3TWCH 4UINH 1ZSDA 3ZTNH 2ZPKL 4OD3L 3DO7B 2YD3A 2MQ3A 3K1KC 3LKQB 4M7JH 4YR6B 3PWPA 5TF0A 2VAAB 2CIKB 5CUSH 2AEPL 2ZKHL 4FQCL 3NZHL 1YNKL 4TUOA 1AR1D 1XH3B 3LEVH 3QR2A 5EOCH 3F7YA 4YJZL 1R3IL 5ALCH 3C08H 5B3NA 2GKIA 2GTZB 2HFGH 5E1AB 4NQSA 2FWOB 2GYSA 3WFBL 2W9DL 3BI9X 5KSAA 3MV8E 3QO0B 2IH1B 3FN3A 4Z7QE 4NN6B 5E8NA 3ZE1E 4LGSB 2J1KA 4NRYA 5IBUG 3T0EC 4N0FA 1Z5LB 3FT4B 1S7UA 4RDQG 1C7SA 2J2ZA 3BH9A 5MEQB 3TV3H 3DGCR 4PJHE 1RUML 4FFVC 4MA1C 4WEUD 5J13B 3MRBA 4P46D 1QFWI 4WTXA 3CNKA 4GBXD 3SKJH 1PQZB 4F9PC 5I2IA 1INEH 1VENA 1EO5A 2R1WB 5DRZB 1WV7T 5CBAB 4P99A 2C26A 4P3CL 3ZDYF 4X7CC 5KSUB 3VRJA 2MFNA 3MRQB 1MFNA 3ARBA 3IDNB 1Q72L 4PRNA 1QSED 4L4VE 3TN0B 3QIUB 5DSCB 5FHAL 1D5BA 1U8KA 3IFNH 2A6KA 3ARFD 2D7TL 3VXSB 2G2RA 5IUSA 1CYGA 1JGEB 4OFDA 4YGAB 1X5KA 4FTVB 3HFML 1A7PH 1F42A 4U6YA 5FUZL 4GO6B 8CGTA 2E9BA 1KCVH 3P0VL 3U7YL 3MRDA 1SY6L 4MS8D 4OM0H 4HD9A 1CLZH 4JR9H 5ISZD 4UB0L 2F8XC 5TDOB 2V5SA 5D2NC 5DEFB 4KC3B 4JFDA 3TPKA 1MRFH 3GZKA 3P9LA 5DMKA 4DGVH 5I1EH 1PBYA 1RI8A 3WXWH 5DJCA 1IMHC 2JJTA 1SQ2N 4K3EL 2QQNH 1LMKA 2YD4A 4KVCL 4L8DB 5DR5H 1CWVA 5TE6L 2CKBA 4AG4H 1A3RH 5KS9E 4L8SA 3AAZA 3QHTC 1X9QA 2BHUA 1J11A 4UZGA 3Q0HA 3UPAA 1JNHB 4UT9H 4ZUSB 4NNYA 1UZ8B 4Z76A 3UDWC 2C3XA 3IETB 3WFDH 3CFBA 4KY1H 1U95B 3LDBB 2AJVL 5GGRY 1IBGH 3T0ED 2VZOA 2MPAH 1J05A 1YN7B 4N90D 1IL1A 4LRIC 3MBEA 1IGYA 4YBQC 4FFVD 2JF1A 1KCUH 4JRYB 5IJVA 1SEBB 4EIZC 2ICWJ 2VUYA 4XH2A 1PD6A 1VEPA 1R6VA 2V9RA 3MNWB 3R1GH 3SJVD 2IFFL 3H3PL 2VABB 4ZDHB 1ZTXL 4LRNL 4J6RL 5DFVC 4WHTA 4ZODA 4XBEH 3R8QA 2DLIA 4GLRH 4UU9B 2Y7QB 3I3EA 4OF5A 3QNYB 5JUEL 5HHMD 4HHAB 1KYOK 1ZS8A 1FL3B 1PLGL 2G75B 3P4NA 4BFIB 5I19H 3DIFB 4KRMB 4WHYG 2LAAA 3EIFA 4XC3L 1WUNT 5E94B 3GSNB 1SMAA 3QRFM 3S9DB 3LQMA 5ABDE 1FVCB 3BEWB 2R56L 3LN5B 2E5EA 3SQBA 2Z8SA 4RAVA 3WNOA 2B0SL 3QNZA 3RDTB 2IPUG 2PO6C 5IEKA 5HHQB 5I1CH 2O5XL 3C8DA 3CMOL 4IRJB 5M95B 2RQ8A 3HI5L 1RULH 4P5TB 1Q94A 3OAYK 4HIJA 1HXMB 4X6DF 4ETQB 3TP4A 3P4OB 2EXWC 1BQHG 3BT2H 3MV8B 4YBHA 3X14B 3O6MH 2YPVL 5ITBL 4IJ3B 4OGAC 2NY1C 1A6ZA 4PRHE 3TBYA 3WDJA 5HGHA 4PJHB 1F5WA 2MSPA 3UEZA 1U8NB 2B8OT 4XP5L 5ADOL 1BQHA 1GZPB 1EV2E 1F58H 1CQKA 4DUWA 2VDNH 5I1HH 4ZYKA 1NFDE 3QFJA 4YBQD 4B0MM 5EBLB 1U8JA 2FX7L 4R6UA 1JP5A 2E9JA 2LE9A 5JNYA 1NDGB 1UH2A 5IHLB 5TF1L 2EYRA 3GO1L 1JK8A 3ULSA 1T5XA 4E5XB 3ABZA 1BBJA 1RZKL 5CWSA 4L4VB 3GBNH 2DQFB 2PKDA 4TVPE 1MFBH 2AQ2A 2ZUSA 5DFVD 5F21B 2CDEB 2VC2L 4U1GC 4J8RA 2F54A 1PG7X 4PJBE 2EDLA 4LSPL 5F3BA 3EGSA 5E7FA 1KTDB 1E4XH 3UJJL 3SE3A 1NEUA 3NCJL 2IEPA 5FOBB 3GNMH 2VLJD 3WIHL 2YUXA 5BJTB 4HUVA 2A83A 3U0TB 2K7QA 3MLZL 2LU7A 1AO7A 1CDUA 3EW3B 5C0NC 4GXUN 4KI5C 2X1XR 3NH7H 3MGTB 2DBJA 5TDPA 4N8VA 1MIML 3BVNA 2AK4D 3QDJA 2PO6D 3SGKC 1OGTA 1U92A 5IFHL 5JQHC 3QUKB 1DN0B 2RR3A 4XBGB 1XEDA 5KS9B 3A0OA 5F7LB 5GJSH 3EYUH 1CDGA 3ALPA 2HMIC 3ESVF 2EXWD 4MA3A 4RQQA 2R1XA 1A7QL 4XTRC 5FYJL 4NZTH 2KZ1B 4X7SH 5ESAA 2P47B 5B8CA 1P69B 3GSRA 1T2QH 4OGAD 2NY1D 3MUZ1 4MNQE 5TH2B 2OYPA 4PJFE 2KKQA 4KV5E 5DT1H 5EU6A 3F7VB 1KT2A 2DLFH 1UQSA 1KELL 1R5VA 4JRXB 3OKMB 4BH8A 3HMXA 3X11A 1OHQA 1DVFC 3RPKA 1JHKL 4WHYH 4BA8A 1ZXQA 3EYFA 4JKLA 4ODBD 3MCLH 1OT1A 3EUUA 3NA9H 1L9MA 3SY0A 4X8XA 1R3HB 1S7SA 1EHXA 2QQKL 1MJ7H 2Y25A 3NIFF 5TE7L 4JY6B 3BE1L 1NAMB 2PXYB 3MMEB 5DJAB 3F8UB 3SDAB 1KJ3H 4NYLB 4YNYB 3T0VA 5IT2L 2AJ3A 1A9EA 2DLGA 3FFDA 3A6BL 3HZKA 4LSQH 4EXKA 1EEYB 1MWAA 3NCEB 5JW5B 4MD0A 2QHRL 3E3QC 1ZT7B 5DMIH 5K9OA 2Y36L 1RU9H 2HA1A 2VDRH 2AKRA 2HKHH 1HXYB 3D3VA 5FHBH 5FUOH 4DK6A 1MJJA 4YQXL 3O6FB 2FX8L 4PREA 2VSCA 3VGGA 2HLAA 5TFSH 4PJGF 3C2AL 2HRPH 3FOLA 3HPLA 5C0ND 3MJ6A 1WWWX 5T1LD 4KI5D 1P7KA 3MRCB 3VG0L 4Y4FA 5CGMA 3CXDL 3DX7A 1HKFA 3QEQE 2HJKA 2XKNA 2NW3A 3W9EA 2AEQH 4DN4L 4X6FB 4Z7NE 3TH2T 2DRUA 3QCVL 3VU2A 3B9KA 5BZWA 2HMID 1IGIL 3HRPA 4G7YL 4PRHB 4QXUH 4XTRD 1SEQL 3VXQA 2ARJA 2BVUA 5C8JA 3ULUL 2SEBA 3HPJB 5KSBF 2EDYA 4ZD3L 3BISA 1YY9C 1S7WB 3QDAA 3IU3A 1NFDB 1BD2E 4AENB 2EE3A 3L95A 2JLLA 1DVFD 3PP3H 3H0TA 3AMKA 3CH8A 5JHDD 4HDIB 5DVLA 1FCGA 3HC0B 3MZTA 1U8PA 3EFFA 5BMFL 1RV6X 4HGMA 1H8NA 3BP5A 2RFXB 2OQJA 5KVDL 3OAUH 7CGTA 5FECA 2CK0H 5HVHB 2B4CL 1F2XK 2MCPH 3RX7A 4JN1L 3VXMB 1S8DA 4DZ8A 3V0VA 4I1NB 3HMXH 5E2UL 1J8KA 1E6OH 2XWBA 1K5NB 3O2VL 4R0LA 2EZ0C 5EORH 1OLZA 4ONGL 4FOMA 4WI8A 5I1AA 4KKNA 5DFWH 3ULUF 2VOTA 3LKNB 1RHHB 4PJ8B 4WWID 1ZA6A 4M9PA 5FYKU 5CMAB 1DLHB 1J1XL 3MLSL 2EDHA 5HGBB 3CPLA 1ZT1B 4TNVF 5FKPB 1T1YA 3KPTA 4BZ1L 4QRPB 2HG5A 4WNQA 4DZBA 3BWUC 1U93A 3L3HA 4CVXA 4JEGB 4EI5B 4LSSH 3FKUS 4ODTH 4XPAH 5DHVA 4MNQB 3PL6C 5C71A 2JJUA 5I0DA 4LLMA 2R0ZH 1PSKL 4HPYL 3O3EB 1C16A 5F9WC 2D4FA 1OAKH 4YDLC 1EAPB 2A9ML 1FAIH 5I73B 1OW0A 1YY9D 4ZS7H 1I3VA 4QRRD 3BKYH 3VFOA 1JPFA 1QBAA 4HT1H 3RA7H 5SWZE 3O4OC 3FQXA 1NC2A 1MREH 1OAZL 4ZNEE 5J1AB 1S7TB 3QBTB 3I50H 4U1IA 1JHTA 1Q0XH 4I4WA 1JMXA 4WFED 1XGQA 3FMGH 1HHJB 5BVPH 4OD1H 1RZJL 4O2EB 3VFPA 1NCCL 4U1HB 4OF7A 3ARXA 3WFHA 3PHQA 4M00A 4WU7B 5C0BD 1IEAA 4D9RE 4X9BA 3Q5OA 1YUHB 4P4RA 5CZXC 3GSXB 4JFHE 5ITFA 1UB6B 5EBMA 4PJEF 4APQC 5F9JA 1IGJA 2EZ0D 1CK0L 3BMVA 3F6IA 1XF2B 2K9UA 1RUAH 3GKWL 3BD3A 1MFCL 4DEPB 2RIKA 3U1SH 4PB9H 3RZWA 1KGCD 1JIBA 3W0WA 5D70H 2FECI 4PP1C 3REWA 3KR3H 5EG6C 3BPLC 2GIYA 4LFHG 3QEQB 4M7LT 3DUUA 3LH2H 3B2VH 5HPMB 1CD8A 1FL6A 5IVXB 5LXGH 2COQA 1IGCH 1I3RB 3FCTB 3T2QA 4D3CL 3VI4E 3LPFA 4FP8H 1BZ9A 5IMLB 1U3YA 3IAPA 1VFAB 3RBGA 2YD8A 4F7CB 5KVGL 1QSFE 4NQDD 1VA9A 3V8OA 3N1PC 4PRPA 4JFEA 4PJ7A 2XFXB 3DGGA 3PL6D 2UZIH 3ULVF 2MTPA 3PDOA 3QIWB 3QEUB 1BD2B 4FQXB 2AV1A 4GS7C 2VXQL 4XAKD 1DQLL 5HHVL 1UM4H 5KSAC 4HBQA 3IKCA 1P84J 1UWGL 2OP4L 5DYOA 3FO9A 4DOHE 3ZSTA 1WQVT 1AI1H 3CFIC 5A1AA 4NO0B 3UTTE 3NPSC 2W9LA 4OZ4A 4RNRB 3S37L 1OTSC 2P24B 3P40A 4YK4B 4AEEA 1J8HD 5HBBA 1ZT4A 1F90H 2JIXD 4JHAL 1T1XB 1MIEL 4LAQH 1IM9B 1TQCC 4X6BB 2A77H 4Y1AA 1KLUB 5GRVL 3WLBB 1T7ZA 1D9KB 3P11H 3HCVB 3WHXB 3LVEA 3ME0A 5CZXD 1NEZB 1LO5B 1K2DB 32C2A 3CVHB 1A3QA 1E27A 3PF2A 4UIMA 3ARBC 1KJMB