4ZZFA

Crystal structure of truncated flgd (tetragonal form) from the human pathogen helicobacter pylori
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
146
structure length
146
Chain Sequence
NSVSMIGKIAETDVSGANFDGNNKLSFSLFFDEKIDASKGVPAIQILNENNELVKTIPLKDYNGQKGYINFEWDGTNEKGEKVPKGNYKIKAEYNLDSHSKQYLQTRIGRGEVESVIFDKGKPMLRMGEMVLPIDSAIEFYQPDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of truncated FlgD from the human pathogen Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori 26695
molecule tags Motor protein
molecule keywords Flagellar basal body rod modification protein
total genus 32
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4zzfA02
4ZZFA 4ZZKA 3C12A 5K5YA 3OSVA
chains in the Genus database with same CATH superfamily
1U21A 4PREA 2APFA 4N9OB 1M42A 3ETSA 2WBJB 1A25A 4K5LA 5F0MB 3KXFD 4OM1L 1MCWM 3T4AB 1BD2B 5T3ZE 4JKMA 3C6LA 3UEZA 5BS0B 3KPRA 3EYOB 4K9JA 1NFDA 4XCNA 3ZO9A 1KC5H 3CC1A 3OKNB 1H8NA 1TJIL 3UZEC 1SQMA 1H6EA 2QGEA 3B9VA 4ZS6C 3FKUS 4GMSH 1CUOA 3PQYA 5C8JA 2X40A 1A7BA 4E41B 2OMVA 4BFIB 1NPJA 2YAOA 4P99A 5MHSE 3IMWA 5T1LD 1X4ZA 3U0PB 1ZTMA 1ZVHA 2ZUSA 3R7RA 4JAMB 4FS0A 3EZ8A 1SOSA 4CVXA 2XX1A 2W95A 4LLUB 2KZWA 3BH8A 1R3KA 1H19A 4DIXA 2MQ0A 4GS7C 1WCBB 4KU1A 1FFRA 3DO4A 4DEUA 2EH7L 5BZXA 4QJ4B 4WNJA 2E7BA 4HIJB 1RURH 3KXFB 3WENA 2OZ4L 3VXUE 4JEGB 5JNYA 2ICEB 1BQSA 2IBBA 3CFUA 2R2EA 5DJ0B 3BYTA 2B1AH 4Z18A 4NN7B 1RHHA 2MNUA 4MCZB 1YUKB 5EBLB 2LU4A 3VGEA 4GXUM 1NOAA 1EZLA 5EOQL 1RD6A 4YOKA 2Y07H 3MLSL 1T1ZB 5ENWA 3KPNA 3OM3B 2R4SH 2FJUB 2DKMA 1PSKH 2WXFA 1AR2A 1FVEA 3PPEA 4F3FA 5FOBB 2H26B 1FZOB 4NO5A 2NX5E 1QSED 3LRHA 3TBYB 2J88L 2B14A 4U1GB 5G4NA 3UH8A 9PCYA 4U6VH 5HYSA 1JCVA 4XODA 1GAFH 3RTQD 1HDMB 3IDMA 2Z7WA 5ICYB 2ENQA 4UBDD 1QD0A 5HDRA 5I18H 2B20A 1I9RL 3WTTA 2XKNB 4CSPA 1QOKA 2CR6A 4PB0H 4Q4IA 4I0CC 1OE3A 1JRHL 5HYSG 1MAKA 3S3PA 2OL3A 4UDTB 5C0DB 2R1XA 4UQ2A 5EOCL 5IFAL 1HXKA 4JX0A 3VFOB 4D2NA 1DEEB 1M05B 1ERNA 3QAZB 1QVOB 3FU0A 1WG3A 5DJZB 2GTQA 1ZWIA 2G2RA 1YEJH 2FL5B 3VO0A 3VRIA 4Z3JA 2HLAA 4OQTL 1QW9A 3UYPA 1KCUH 4GQRA 2CDGB 4M5ZH 2WHVA 4R3SA 2BVPB 1TQCC 2XXMB 1RSFA 4I4WA 3IDYB 4MA8L 3QIWB 2Y7OA 4AJYV 1XB8A 1CK0L 2IBGA 3PL6C 1H3WM 3EO0B 3ZYZA 4MVBC 4U1KB 5FYJE 4OFDA 4Y4HD 2QMKA 2PETA 3DRTB 1WPCA 1FL3B 4RDQG 1HXMA 3GMQA 5HGDA 1J0ZA 3MOAL 4HC1L 3QQNA 4LU5L 4WY7L 2WAQA 2L7QA 3WKMH 4LCIL 2EDFA 2EYRB 1AZRA 3KGTA 4HS6B 3V0GA 3ZE2F 4JZNB 5C70A 4Q9CA 1KCSH 2I25N 5ID1B 4GEIA 2PPAA 4XPAH 1J1PL 3NZUA 5DWPA 5TF0A 2VLKD 2X4OA 3UTZA 4AGPA 4X42A 2UWEA 3NIFF 4GPVA 3MRFB 3AG3B 4G7YH 4Y5XB 3QZMA 1IO4C 1ZVNA 1ZS8A 4BQ6A 2F53E 4YSAA 1AMYA 1AHWA 1E6JH 2UWEB 2VZ1A 3VDCA 4IOFC 3LKQA 5JHLA 1KBVA 5DR5H 2Q8BL 2X4RA 1BQKA 3FT4A 2D03H 5K9KB 1L9TA 5B8CC 1JVKA 1UWXK 4OZHF 3CVIL 4M43H 5I1EL 1BVKA 3VXMB 2H32B 3QRGH 2V2TB 1KTCA 3TO4D 3M17A 3HE7D 1T7ZA 4EN3C 4ZAKA 5IB2A 3IETA 4N2KA 2ED7A 3GK8L 3PL6A 4F33A 4ZOCA 4A7UA 3OAYH 3X1BA 4PUBL 5KVDE 3Q6FA 3EYUL 3LMJH 4Z1PA 2QV4A 1LE9A 2RH0A 1OGAA 1LLAA 1R5IA 4IBTA 1NCWL 3EFDH 2N0MA 3HG5A 5EO9B 5JPMA 3VMOA 2A9NH 2QKIC 1LE9B 3VRLE 5FYJU 1SRDA 1A6AB 2ZOTA 2FWLB 1WS7A 5FUCE 1LEIB 2VLRB 2J3SA 3AACA 3S37H 2X7LA 3ISWA 1A6AA 3QQDB 4RAVB 3SDYH 4DP0X 4KKPA 5L4FA 4PV1C 2E4FA 5KTEL 1EUUA 5M94B 2Y36L 1PLGH 3QUYD 4RA3A 2NSXA 2F7QA 5INDA 4AEIH 2J43A 1GGIL 4Y9FA 2G60H 2NNAA 5GGTH 3GJEA 3CXDH 4OUUB 2XHNA 1LGVA 2WUBL 1VF5C 3ZU8A 3B9AA 4P05A 1KXTA 5I8EB 3Q43A 4KXDA 1C5CL 2DI9A 2NY5H 5FYJH 3QCTH 4JQVA 3BIKB 3QSKB 3S34H 2H2SD 5C7XL 2NNAB 4UYPA 4XPBL 1EO7A 2R0KH 3O4OB 2LW3A 2G3NA 1RLBA 5D1ZD 1IQWL 3E2HB 5BZWA 2CLRB 3B5GA 2AANA 3WFZA 3ASOB 1KJ3H 3BPLC 4KUCD 5GPRA 3LB6D 5D7SL 5F6IC 1AP2B 2AEQL 4CSZA 1TIUA 2AXWA 4XN7A 3OLDA 1BOGA 3CSTA 4PN6A 3V5DA 1A5FH 4KITB 1N5AA 4ZXBB 3VM5A 3D4GA 4LSQH 4N5EC 1F2XK 4WJG3 4XZUA 3OMNB 4YGVA 5GGUB 2M2DA 4PCSA 1CTOA 4XCEA 1S7RB 2ZYSA 3ARDD 5IMMB 4XO8A 3FH5A 2BFGA 3HG0A 4B9IA 1I3GL 4E0RA 3IJ8A 3MCKB 2QQLH 3SYAA 3TPKA 4YDLB 3L3IB 5IVZA 4Z78A 3MGTB 4LSQL 5T5NG 1A22B 4XNZB 3QR2A 1ZPUA 1T6VN 4RSYA 3B5TA 3NIGE 4EUPG 1NAKL 1PLGL 3T8MA 5IVZB 2W9DL 4TUKH 1U42A 3H7LA 4UIKH 1A4AA 4S0TD 1DVQA 4QOKB 5IHHA 3Q2WA 4FQCL 4XPGL 1XH0A 4P9MH 1JPEA 1FO0B 3E3QE 1BWWA 2OQJA 3EBIA 1ZIBA 5EU7C 3FULA 4PP2A 1L9PA 5I6LA 1YEFL 2IAND 4W81A 3DMMC 4MAYA 4M4PA 2R15A 3CSBA 1IVLA 4B9ZA 3N5AA 3SJVD 4DEPC 5INCB 1HXYB 4LE8A 1GVIA 1NFDB 5E2UH 2XWTA 2FGWL 3FAWA 4N8PA 4AGQA 2O93L 5E08H 4CKVX 4NJAH 3IYLW 4YIQB 1OAKH 4NN7C 2DI8A 3MCYA 2HAZA 3CFEA 4IK6A 1C12B 1AGDB 1UOKA 3U7YH 1ZT1A 2OSXA 4QHPA 3DWTA 3HUJE 5EBMB 3E6FB 2X28A 3H7BB 4DPRA 1DVFB 3FH7A 5ETUB 3FUHA 3V4VL 3Q5OA 4NZTH 5L2KA 3GMOB 1CDIA 2N7SA 1EWHA 2EDJA 4G1EB 5FM4A 3U9UA 4NIKB 3BEVA 4NQCB 1OM3L 5ETUA 4KVCL 3ROOA 3G08B 3F6LA 5AB9A 1J9QA 1HE7A 5I2IB 3HR5B 1FVDA 2W07B 4OJDH 7TAAA 1RHHB 3QJUB 4N0FA 1AGFB 4F7TB 1CGYA 3I50H 4PRID 4JFPB 1QKZL 3VFGH 4W9LC 1WS8A 3UPRA 2J21A 4P2QB 5CO1A 3QDJD 4DN3H 1FVCA 5E4EB 3L48A 3IN2A 1XD0A 4OF5A 3SYOA 3BUIA 2F58L 2VLLB 3D3VB 3MNVB 2JJTA 2BOBA 2C9RA 3CLWA 1JN6A 1WEJL 3EXJA 2WTRA 3ISYA 4KK9D 1JPGB 2A74C 3GDBA 3GGWB 3N55A 5C2BL 3Q6GH 2RQEA 1KXQA 5JXEC 1NUFA 2OM5A 1KXHA 2HLFC 3EDDA 1MF2L 1KIPA 4HFUH 3WL9A 1XGTA 2X6BA 1QUPA 4BFRA 3N9GL 2E6QA 2UZYB 2HTLC 2SODB 1FZKA 3UJJH 3FO9B 2WXJA 3I74A 4C57C 2GK0A 1O7DC 2P4AB 3CUPA 3PP3K 4XZ4A 4HPYL 3CE1A 4PGDA 3EYFB 3V0FA 1DDHA 1RJYA 5CAYB 5LXGL 3VFSB 1XGUA 2HLAB 4O00A 5LBVA 4C54A 3D4YA 5GGTA 2CDGA 5H94A 4R7DB 2XFGB 3T4YB 5DEJA 5KSVA 4XP9L 2DH3A 4OCSH 3QGVA 4PI0A 2PTTB 4HUKB 1MVUA 4IBLT 3G5YB 1MQKL 1J11A 4NPYA 2DJ4A 5L8KB 3T4YA 5KSVB 4P5KA 3WG7B 3FU5A 1V05A 1LHZA 1GZPA 3B7TA 1A7PH 1WFUA 1EZSA 1BFSA 1U3ZA 3IDGA 5DC9B 3FTZA 5HGAB 2BWDA 4JFDB 1FZMA 5DJDA 1WAAF 1DUYA 1I7UA 4BDVB 3MODL 2WMPA 1YECL 2Z31B 3GS7A 3NAAL 3X1FA 4AC2A 3IAPA 3Q1SH 2LV4A 4BSVB 4O51A 2HRPL 4JFDA 2AK1H 1CDCA 3NYKA 2MSPA 2V17H 4NRZB 5CLWA 2FIRT 3K4AA 4IOSA 2RFXA 4YWGH 4YS4A 3LN4B 2NNXA 5DHEA 3DXAD 4TPRL 2NXYD 2Q2EB 1WP6A 4P04A 2OZ4H 5J8OA 3QW9A 4I77L 4UF7C 4V1DE 4IU3B 1JI2A 2Y1YA 2J88H 3CLFH 4YHZL 1A14H 3ZRFC 4B7LA 2X1QA 1XO8A 4EI5D 2LR4A 2R1WB 4GKZA 3F04A 3K7UA 1Z5HA 4LEXH 3LD8B 3MV8A 4R6UA 5JHLH 3OGOE 1EAOA 2IDUA 5DT1H 3UBFA 2BHZA 2MWCA 2W9DH 4TUKL 4BK5C 4YX2H 1BQRA 1E5UI 1RZ8B 3O6LH 2ERJB 3RVWD 1U6AH 2GPZA 4Z3GA 2WQUA 1E4WL 4RDQF 1OGAE 3DVNA 4P2OD 5FYKH 1MHCB 3DBXA 1I3GH 5EBWB 5C0AB 4N1CA 3K71B 1YLBB 3K72A 5IKCA 5JIQA 3W39B 4YHYC 4HGWA 1DQLL 3S5LG 5HGGS 4L3AA 3T2PA 4MMZB 4DAGL 4H8PA 4QHKJ 5ES4B 3DV6B 5J12C 4MD5A 5LNEA 1F5WA 1HWGB 4JG1H 1S5HA 1I1FA 5G55A 4R0LB 4XVSH 1NMBH 4ANXA 3BDYH 4JO8A 4R5TA 3UL4A 1XX9C 1ASQA 3MFFB 1IBHA 3GSRA 2V37A 3JZ7A 3MYJB 1T0PB 4P46D 4FF9A 3VWKC 4JUSA 2VDPB 3GXFA 2CMRL 4JZJA 4OGQC 5F7MC 5IBTL 2J1KA 3QEHA 5CN3A 3T3PB 2R69L 3DVGB 3GSRB 2VJXA 2MCMA 1IAKB 3MYJA 4CSSA 3QDMA 3LNFA 4LK4A 5T5FH 3FFDB 4YK4C 5JPNA 4S10A 1J05A 1JK8B 1AGBA 2BCKA 3MMEA 1X7QB 2D3NA 4N8CL 4KY2A 1LQSR 3C08L 3CFBB 3FFDA 3MU3A 3FJTA 3PWNA 2OKMA 4N2AA 4JFEA 4QTFA 5CSZB 5E9DE 1W8NA 1S7XB 3WXWL 2DWDB 2DYRB 4B9PA 4DP5X 3T08A 3ZOAA 3EW3B 1M56B 3NK4A 4N2LA 4OM0H 5BXFA 2VH5H 2WKOA 4L0ZA 4HWBL 1JBJA 1WHPA 5KVDL 5IGXL 1AP2A 4GMTL 4KX8A 3PWVB 4LKCA 4U0QB 1DBKL 1MCNA 3ELAT 2LU7A 1U92A 2DDQH 1OOWA 3KR3L 1W8OA 3N1FC 4CN4A 5HDLA 4IW4C 3UAFA 3V9EA 3FUNA 4LQFL 3IE4A 2D3LA 4WU7A 5GISL 4P3CL 3RU8H 2H6PA 4FRWA 4PJFB 3KDMA 3HS9A 3ZY7A 3C60D 2ZP9A 4BZYA 4YEFA 1ETJA 4Y1AA 5KVGL 3WO4B 2FRGP 4O2FB 1GGBL 4QO1A 2ZUUA 1A7OH 3WGVB 2M8XA 3DX0A 2ENJA 2WKLA 3PJNA 4JN2A 4H1LG 4AYGA 2E8YA 4OB5H 4EO5A 5IVXA 4MX7A 3AWFA 2EINB 2LVEA 5DZ9A 4JGUA 2MOQA 2VM9A 3TXAA 4X5RA 5E1QA 2K6ZA 5C8JB 2EUXA 2YD9A 3LPGA 4MX7B 4L3CA 3OXSB 4BGDA 5MEOB 2O72A 4WSJA 1KXVA 3CVHH 1J8HA 3K5SA 1KNOB 3D69B 1UT9A 4L3CB 3KPRD 4EN2A 1E2ZA 2CA3A 3M46A 3FUIA 1B0GA 3OXSA 2JB6A 4R5VA 1K5WA 1QPKA 2EO9A 2OL3L 4JHWL 3DO7A 3NP4A 2JJWA 2WKGA 4QTIH 3PUUA 3RKDD 5PAZA 3CSYA 3KXFA 3MUY1 3WDHA 3QUMA 3P9MB 4U4IA 2EIEA 4MSWA 4F8LA 1NCBH 2RQ8A 2PW2B 3IJSA 3BGMB 4HUWA 3VX1A 5DVNA 1WEJH 3H2WA 3LPOA 2FEDD 2D7QA 2E86A 5F7LB 2XCMC 1ZT1B 1TCMA 2Y36H 1CFMA 5DC2A 5HP5A 1QBBA 2J2ZA 1E9OA 1OTSC 2XU9A 1AZBA 1T20B 3HHSB 4KKCD 4MD4B 1FORH 4WK0B 3GBML 5AEAA 3SDAB 4JY6B 5CJOH 2FB4H 2CD0A 4KO7A 43C9A 3BP7A 5SX4H 2WBJA 4HVBA 3PXHA 1ROWA 2UZXA 3U9UB 4TLTA 3SIKA 1QACA 4YPGB 2VUOA 4NO2B 1WLHA 4DP6X 1P7KA 3WKQA 2JWYA 1T4WA 2ZKWA 3P4OB 3ULUC 2DQIH 5EDSA 3TBYA 4PRPA 3HN8A 2KPNA 3GHPA 1YRKA 1YY8A 3KPRB 4ANUA 5HI5C 5KJ7E 2XY1A 1CT8A 5F97E 2ADGB 4FEMA 2H0PA 4LP4A 1GOGA 25C8H 5H4YA 4JDVA 2Q76A 3C12A 2OXHA 4ZMAT 4PVLA 5F1KC 2QQNH 1AQHA 2NXZB 2N7BA 5HI5D 3WY3A 1NIFA 3TTYA 2OXHB 1JGEA 3SOTA 1KJ2L 3O3EA 5JXEA 4LHUD 2BHFA 3F64A 3BT2H 2I32A 4ZO7A 3WUWA 2XPGB 2KBGA 1JGEB 4HQQH 1LEGB 5SWSB 3UZEA 3CZKA 2EVGA 1N64H 3L3OB 5IT2L 1AR1D 2VLJE 1KIRA 1X9UA 2JNZA 3T0EB 3GMQB 1I7TA 4HOXA 4TTGA 5D8JL 2Z1KA 2DF3A 1SEQL 4GI9A 4HIEB 4Q14A 5IQ7L 1PG7W 4OFQA 2FB4L 3NUKA 4XPGH 5SWSA 1E30A 1ORSA 1SOKA 2RBLA 3L3OA 5KVMC 3VVWA 4JJHA 4K94L 4YGAB 5E7FA 2CG9X 3GKWL 4XAWL 1QMUA 2MTAA 3SE3C 2VC2B 5D8JH 4R90H 4WTWA 3MUUA 3NFSH 4KDVA 4MYPA 3W3BA 1D5ZA 1Z5LB 1TU2B 1TITA 3CZFB 4P59L 5E8PA 1BLNB 4CW1B 5EEXA 3ETBJ 4NPKA 2BY0A 2AK4A 4LCYA 4UAOB 5CGYC 1O7SA 1GGCH 4X9YA 2ZZUT 1GKEA 5CD5C 3B2DC 5D7LA 1MXGA 3LKRA 3QNYB 3COOA 4FYTA 4HEPG 5I1DB 3CXHJ 1NC4B 4L0PB 3C5SA 1I9EA 1FQ9C 4PVMA 4BSVA 2WGNB 3VFOA 3EG9B 4D9QE 5FOJA 4WW1A 2R27A 3P30H 2ZXDA 4BCZA 4H88L 3P0VL 1T89A 4GXUN 3LN4A 3DX9A 4GY4A 4QHUA 1UADC 2VDML 2VDKL 4PRDB 5CIPB 2G5BA 1MHEA 3QDME 2MH4A 3Q9QA 1T22A 2WQSA 1EEZA 2RD0A 5I71B 4FLQA 3S6CA 2WW8A 3RNQB 3GSNL 4X4XB 5B7EA 1T22B 2DM7A 2UY7B 3PG2A 4JFEE 4XNZC 3WOVA 3KEHA 4HWEH 2VDOH 1ZANL 4NNYA 4OZFB 5DMGC 2CDEA 2P26A 4XMKH 1SN0A 3FONA 1NPUA 4PJGF 2R2HB 5L0QC 4OW6A 3VG0H 2MHAB 3BAEL 4OZHE 5HDBF 2APSA 3NJVA 1KB9J 3F58H 4PTTA 3ERXA 1RCYA 1G7QA 5DK2A 3O4LE 3ZMNA 5B7FA 2HJLA 2XWCA 4AMXA 3OKKA 1H6UA 2MHAA 1TVBB 1EGJA 1OY3B 3NZ8A 5D7JC 1T4KB 3HAEB 4XC1H 4IIQB 2WWOA 4ODTL 4PWEA 2PWFA 4WQOA 1AH1A 1VESA 4K3JL 2CO7A 2DQDH 3O9WA 2YOAA 3TF4A 1MW1A 2PCXA 1T5KA 4M1GH 4N9GB 4JHWH 2Y4SA 1P6FA 1S46A 5DLMH 3SYPA 4BA8A 1GYAA 3AT8A 3ILPA 3CVDA 3ZHDA 3GI8H 5DFWH 1J0KA 1WIPA 3PWPE 1CYWA 3VM7A 3A4DA 1CFVL 2ARJA 4HUXB 3DIVA 5GHWH 1I82A 3QIBA 2BSRA 5IQ9B 1JNHA 3TJHD 1IU1A 5GJSH 3PL6B 2JQMA 1AHKA 1OSYA 3DVGA 1E5BA 3OJ2C 4KTEL 35C8H 1PIFA 4HSQA 3ZL1A 4DKEL 3MZTA 2O5YH 2Y7QB 1LWJA 2ATPA 3GMMB 3QAQA 3CQFA 4Y5VB 4A55A 2WNXA 1MIML 2P7TB 2XN1A 5CS7A 1RUKL 3O6KL 3ZYJA 2IEPA 3PHQB 1E67A 1A7QL 2Y7QA 1TVDA 2HVKB 1V3LA 5J12B 2YD2A 1SJVA 1E4WH 4U1JB 4ETQB 1FNGA 1X5ZA 3NGBB 4NN5C 5ACZA 5EF3A 5T1KA 1MXDA 1TETH 1TCRB 1LP9F 3QFDB 4AV4A 1BZOA 4JFFB 1YNTB 1KYAA 5FYLL 2PWHA 3K1DA 3K4DA 2QADB 2X4PA 3GI9L 3HCVA 4MNGA 5FWQA 1UURA 4OZFG 4P2OB 5IJVA 3ZIYA 1KPUA 4J3OF 2FVNA 5JOFA 1YNTA 4UCFA 2VWEC 4UT9H 2VUKA 4MQXD 3TPUB 4TVPE 5AOMA 5F9OH 1KTKE 3RTLA 3QCTL 1QZNA 2V8LA 2Y6SC 3U6XS 4Z3HA 4M48H 1TZOA 3TEWA 1DLFL 2GITB 3LZNA 3O3AA 4FQ2H 4I48B 5BVPL 4KK6D 3ARQA 2PCPA 3LMJL 5T33H 3HG1D 2GJJA 3VCLB 5C08E 5A16B 5EWIL 3VW3L 3N85L 1S7VB 1VGEH 3GSWA 4ZO9A 1C5BH 3UJIL 4AQOA 3ETTA 4GG8B 4L2LA 2YPLD 1T83C 3QRGL 1OK0A 1E0OB 1IGTB 4PEEA 4KRLB 5CIPH 1KGJA 2ZXAA 4WEUD 2OZ4A 4B9KC 4QRQA 1AKPA 2Y5QA 1Z9OA 3AWEA 5F3HB 1FHGA 4K71B 3VI3E 4CNIB 2BNQD 3AG2B 4BELD 3T65B 1K8IA 3CSYB 1DQLH 1Y7VA 4QRQB 1EZUA 4NQCA 2EIZA 1DVYA 2AKRB 2XQBH 3FCUB 2W81C 3OXRA 1IC4L 1NCWH 3EFDL 3NCCB 1GGTA 4NENB 5AWNL 5D2LF 4HWNA 4YHMH 3AW5A 1MCOL 3IM1A 4HW6A 4S1SL 5HPOA 4ABVA 1TJHL 1OAUH 1O5DT 3TA3C 2X05A 3QIWC 1OXYA 4NDMB 4WEMB 2OMVB 4BFIA 4WUUA 2ZXEB 2EE3A 2OBGA 1FH5H 4O5LL 2EYTB 1D5XB 2BRRL 2UY6B 3HLKA 4U1SB 2XI9A 2LVCA 3T4AC 3QDGE 5CP7A 1MHHB 2HCZX 5AW9B 4X8CA 5L2JB 2XIDA 3UP6A 4KX7A 1FL5B 1MF2H 2VISA 4OJFH 4RSVA 5DWUH 2FBJL 3TBTB 4D8PB 1M1XA 1E65A 4OY9A 3DVFA 3ECQA 4K07A 1QP1A 1SJXA 3M7FB 4ODVH 4IHBA 5FK9A 1FL5A 3QHFH 1KWKA 2R0ZH 4PGCB 2G30A 3V4VA 2C1OA 1CFQB 3NACL 4NFDA 5D4JA 3LPFA 2Z8RA 1WZ1H 5HDWA 4DQOH 5GGVH 1F90L 1TKWB 2R1YB 1OAYL 1LO0L 3MODH 3RIAF 3MTXA 2NNCA 4O02A 2XRAH 3FUDA 3ES6B 1T1ZA 5DO2C 2CHXA 1T6BX 2W60B 4TF4A 5E00A 5GQBA 4WK2B 3GMLB 3RFZC 1JZIA 1GGUA 4B9YA 3BT2L 4J3OG 5HYSB 3TA3B 1TZGL 4TNFA 5EU7E 1L9OA 3ALXA 5B3JE 5IFJA 1AGFA 2XZCH 5BOZG 1MFUA 1MCIA 5F70A 2K8MA 3N6YA 4JB9H 2B1HL 3PV6A 4MRCA 2BP3A 3WO3B 2VT0A 2CAKA 5SV4A 1DJGA 1XBDA 1SVBA 1E4XI 3DX1A 3PHOB 5LGYA 4FEIA 1DYZA 1CFTA 2LAAA 1A1NA 4ZPTB 2V3DA 1KZYA 1S9XB 4PY7B 3ILDA 2H0EA 5AOZA 5D1XB 1I4FB 4R4BB 2PR9A 1EIBA 4NM8H 4Y2DC 2YFOA 1A1NB 2DQHL 3RWHB 2FYVA 2VW7A 1WC7A 4R3SB 1EAPA 2GIXA 3I6GB 3QNYA 1FPTL 1UACH 4IBZA 1XGTB 2F8XC 1HHGA 1JK9A 4WO4B 3B9KC 3ZMEA 3FSAA 3WLBB 1ONQB 4LSRL 4BUGA 5E9NA 3VD1A 4WHYG 1OAXL 2OJEB 1JZEA 1ZLUK 4D0BA 1IFGA 1JV5A 4N0CC 1PGRB 1W72B 5KYUA 2OULB 4NEHB 4O2CB 3SDXA 1GZHA 3VFVA 4Z3EA 3U48A 3MREA 3BVTA 5DJ2B 3WSQL 4X6DA 4XVSL 1Y0LA 2AI0L 4AEHH 4ELMA 5HHVL 1TJXA 1INDL 2D0FA 4PV9A 5TK2A 2VZVA 1YMME 1YEEL 2ZICA 2O1AA 2HX7A 1UHVA 3OTTA 5HVHB 3G5ZB 3PLYA 3VXPA 3DI2B 3UYRH 2ITEA 1FNHA 4G70B 4RZKA 3HJEA 3QULB 4MQTB 3DGGB 3D0LA 1DANU 3C8KA 1Y07A 5IW1B 3N50A 1YG9A 2O6DA 3O6ML 1BM3H 3H4FA 3HLAA 4ZFOA 1S7TA 2VXSH 3WD5L 2E27H 4J4PD 5LB1A 5JPNC 3KL3A 2O26U 2XX0A 3O2WH 4FQJH 5FA4B 3PF2A 2XWJA 1JGVH 1UXWB 4I0KA 2Y7MA 4Y19D 3DHPA 1G0YR 3QC5X 5J13C 2C9UA 4N2DA 4Z7AA 4I3SH 3RUGF 1CI3M 3N04A 1AY1H 3F6IA 4L8BB 2V7NA 3O45A 4R2GB 2VKWA 2X4SA 4UOW0 5K39B 3WN5C 4HXBH 4PJFF 5EZIH 3P3SA 4EN3B 3LEYH 4G6AC 3DUUA 2V7NB 2H47C 3MLPA 3BP5B 3QORB 4LF3B 2F8VA 3SBPA 3K2UL 2F54A 1N0XL 2FATL 2HH0L 4GEJA 4H5SA 3RVTD 2IH3B 3Q5TA 1GTNA 1BZ8A 4OGAD 1O7VA 4GKNA 1XGPB 4N1HB 1NDGA 4LF3A 3JTSB 2CIKB 4EKJA 3L1OL 4UILH 3UAJC 1XR9B 3BH9A 1A4CA 3MOBL 3F12A 3HS0B 3MNZB 5KJRH 5LN8A 3H3PH 3WXWH 2H6PB 3QARA 3TBVB 3GSUA 4X6BA 4Q56A 1DE4B 2BY2A 4M61A 4NKDB 4RIRA 5CSBA 5GS2H 4XMVA 4BKLA 5DHVA 2OTPA 5BO1H 5GZNC 1ID5I 3RVVD 3LIZH 1M6OB 4IU2A 2CWRA 4OVVA 3WFCL 1F18A 2PTVA 5DEZA 5E94B 4F7CA 2R69A 3BT0A 3ILQC 3PWUB 4QF1B 1CJYA 2H5UA 4M93C 3WKYA 1UXMA 2E9IA 4HKXB 4KVPA 4EN3D 4AQAB 4ELMF 4K8RH 4M3KB 4BUHA 1PX4A 2FDBP 3ZT5A 2G0LA 3ATEA 1LO4H 5E6SB 4K2UH 4AITA 4TV3A 1UWFA 5D6DA 3BO8A 1WGVA 2QTEA 2EABA 3HZKB 4LBEA 5HI3C 4HXAH 5G2NA 1U8JA 3NIGF 2IFFL 4HWUA 2H2PC 4GRLC 1KV3A 1DDTA 4AH2B 3BPOB 2FUTA 4N2FA 2VQ1B 4LCVA 3ARGC 2NW2B 4OSUL 3BP4A 5C0FB 4JRLA 2J20A 4MB5A 1ESOA 1HK6A 1X5HA 2XV6B 2X10A 1E50A 2GITA 4I48A 2F7IA 4XX5A 1UUNA 4E0RB 4MNHA 4KKLC 3DPDA 4IRSA 3GWJA 3ULUH 2G9KA 2JCCB 3B2MA 5BS0D 1HI6A 1NSNH 2EDEA 2JCWA 2MCPL 4NNPL 1KJVB 2F58H 4S11A 1U8KB 2W0LA 3PIQA 4JO3L 2WTPA 5F7WC 3RILA 4FLSA 4TNVF 5BRZD 3ZO0A 1MCEA 3BIAX 1WBXA 3CHOA 2NY2B 3B7SA 5AYTA 2V4LA 2CLZB 4MA1B 1NLDH 2AEWA 3WFEH 3UTPE 5IROC 5HPMB 1KLUB 5AW0B 4GBXD 4Y8AA 1F4AA 2EUVA 2BVOA 4ZX5A 2ZCKH 4PRPB 4O2FA 3L5WA 3TF7C 2DQJL 5IUSA 4FFZH 4NENA 5DYOB 2ZNWA 3DX7B 1BFVL 5IESL 2XXFA 1OT1A 4YIQA 4ZUWB 5LG1A 5C09D 4JN1L 1SQ2N 1R19A 3EJCA 4JGMA 1TO5A 2A3TA 2QSCL 3CFNA 3D85B 1CDBA 3ATDA 5EOCH 3KHOA 4M7KL 4KJPC 3TWCH 1E4XH 3BH4A 4U6YB 1CD0A 5DZPA 3IU4L 2BY1A 1T21A 3GS0A 4NJAL 4O2EB 4UTBL 3SQOL 3VD3A 2V2XA 4PRNA 1GAFL 3UMNA 1O9WA 3KYKH 5EOCJ 5JUEL 1TYRA 4FG0A 4JFZH 1XQ4A 1F3JA 3KPSD 4EVNA 5AYUL 4PJBF 4P59H 4CBZA 3HRZC 3BGMA 2GTWB 3VXSB 4JS7A 4PCTA 4W4OC 3L4XA 4QYOB 1A9BB 4WKXA 1CO1A 1CXLA 2DLEA 3AFLA 3LJ3A 3N42F 4EI5C 5AALA 4HIEA 1JGDB 1A7RL 1BQLL 3VXSA 3LOWA 4IKLA 1OAYH 3DK0A 4OZIF 2DL9A 4FN0A 1QLFB 2AV1B 1YNLL 4JG5A 3RY6C 4AYDC 5HDQL 2QGBA 5BRZB 3FS9A 4MA3B 1XXFC 4IOIA 2PCFB 2VDNH 1M53A 4N8UA 2X44D 2HKHH 2C9SA 3QUZD 4C58B 5L9DL 1JPGA 2XN9B 4X5XB 4XTRC 3ZYOA 3MRDA 2R4RH 1BLNA 4CW1A 3GZOA 2VITA 1GGCL 4N85A 5FW6A 1FZOA 1TFHA 3A67L 4NO5B 5B39B 1G7MB 2VYRE 2MCAA 5DZAA 5SWQB 2BS9A 4F5CE 4FQHB 3ZR5A 1IGML 3C5SB 1I1AB 3QPKA 1Z9PA 1OCCB 3FQUB 3FO9A 4TNGA 1FGVH 4PJAE 5FDWA 3I3EA 4HGKC 2ZUQC 2GT9B 3SPGA 4IHOB 5F21B 1QBMH 4L8CA 2OMNA 3RZCB 1J10A 3ZE2E 5IG7A 4FLRA 4YSTA 1S9XA 3BSZA 1NIAA 1QFOA 4PV8B 5CEZL 4R4BA 1J1OH 1EERB 5C1MB 2ATKA 4ANVA 5I8OL 3GZPA 2VAAB 4TULH 2IPUK 2CH8A 1RUPH 3ZZ1A 5D1XC 4KRPC 1XSJA 2GSIB 3P69A 4W6XB 3WTXA 1IGFH 5I0DA 4KKNA 4Y4KC 2ZCKL 5T3ZD 1EO8H 4I4WB 5BQ7A 5DRWA 1QWHA 2CXGA 4H2AA 3T0EA 3D2UB 4POZD 3B4NA 3RX5A 1W72A 4NSKB 4TN9A 5E4OA 2HX9A 3MLSH 1JDAA 3FU8A 2VXQH 5HHXL 4AY0A 2YUVA 2NQCA 5HYIA 1WA0X 3D4ZA 2AJSH 3R1GH 3SDYL 1OP3H 2X1XR 4R9HA 5I15H 3MRGB 2DQTH 3JWNC 1NUDA 2X6UA 1Z5LA 1KTJA 1AG6A 1L5GA 4CL7A 3OR7B 5J6GB 3DO3A 1CE1L 1KB3A 1N7MH 2V33A 3ECBB 4QGTA 2D7MA 5BVPH 5H35A 1KXQE 3DPBB 3VI4E 2XN9D 2OFQA 3OLEA 4WLCA 2EH7H 4MA7L 3MRJA 1Y18B 4OLXL 5B4MD 3QUGA 2R69H 2AERT 1NUNB 1A3LL 1HZHH 5T1JA 1F13A 5D2LA 2X2UA 5T3XD 2YKLL 4EDXA 3LS4H 4BFKA 3FOMA 4K23H 4JHAH 5KSBB 3DX9B 4MRBA 4QHUB 4B3EA 4KZCA 1OAQH 3SKUD 3ULSA 4WK4B 5T5FA 2DY2A 4APQD 4KUCF 5AW7B 2NY6B 3X13B 2P8PB 2JK5B 2HFEB 3UZVB 4KWUA 5DEGB 4ZMLA 1KCRL 1V54B 4BKTC 1R3IL 5TPWH 4XPTL 4EDWH 1E3ZA 2ZF8A 4RMUA 1U3JA 1NGQL 5EF2A 4R0LC 1OP9A 1DQQA 3IDUA 3VWJA 3GS4A 5BS0E 1ODAA 4MJIE 4F7KA 1CYGA 1HEZB 1J0YA 2FJGA 4PP1C 2BFVL 1EDYA 4FFYL 5DQ9B 5HHPA 1J1PH 1VENA 5I66A 1NGYA 3EH3B 5GS3A 1R3JA 1UJ3B 4PJIA 1U8PA 5DD6B 5AAMA 1OQOA 4JFFA 4Z7VF 5DA4A 1W9XA 2HMIC 2X89D 3TJEH 1ZOXA 5A2IH 5JORA 3IRCA 1BFTA 1XR9A 3BH9B 5ITFB 1KLGA 5DQ9A 5I66B 2J25A 1UH2A 1YDPB 3RWIA 4Z76B 5CGYD 1UKSA 3GF8A 5E8DL 4FFTA 4ZOBA 2CDFA 3LXBA 3O9WB 5K9OB 3C6SB 1SDAB 4UQDA 5E5LA 4XR8C 1EJ8A 3PJSB 1FSKB 1PZ3A 5IEHA 5DGQA 1QBLH 3FRPB 3WKPA 5K9OA 3R4DA 2NCMA 3T0XA 2HT3C 5DMIL 4D9LL 2DD8H 2CMRH 3BP6B 2JMRA 4HIXL 2VDKB 2RMNA 1R3LB 2JIXD 5IQ9A 5LDUA 3CFCH 1NCUA 1S2EA 1FUNA 2BIPA 3K6NA 3VFUA 4ABWA 2JJSA 5DUJA 1OL0A 1UCTA 4PJAB 1FSKC 2K9FB 2H7WA 2FATH 1NM4A 3AU0A 5KVGE 2AJVH 3BP4B 4UOZA 3FQWA 3NIDB 2Y0SA 5FO2A 2PO6A 3DUHA 4YVNA 3GJFK 1K8DA 1KTDA 3KPOB 3MCG1 5C0RH 2WSPA 1PD1A 6FABL 3UG5A 1ZDQA 5I82A 2G75B 1LYQA 5E4EC 5B38A 1FFNB 1MW3A 4OCWL 5BUPA 3AJ7A 1BD2A 1ZHKA 4M03A 4ZFGH 2CUMA 4UV7L 2BERA 4FQ1H 1QFUL 1GH7A 2I5YH 3ZZSA 4KK5C 1WBXB 1QI5A 2F0CA 3K46A 3MRBB 3RI5F 3EBHA 1X5LA 2OSWA 3Q8CA 1YMMA 2HT4D 1QBML 1DBBH 2OYMA 4B6ZA 1YN7A 1QQDA 4ZSOE 2IANE 3UOAB 3KBFA 2Z92A 1Z3RA 1SBBA 4UV4H 4ESKA 2WCPA 5D2LE 2Y9RT 1RZKL 5JYLA 4PJ5E 1RU9L 3AM8A 1LO5A 2Z3FA 3MX0A 4RGNE 4S1DD 1R33A 1JFHA 1X4XA 1EFXA 1MCLA 3OJDB 3GXPA 1D5IH 4UZSA 4BK5A 3MLXH 3ZHKA 3AAZB 5IF0A 5AW8B 2ZUXA 4NM8L 2IXQB 4NYLB 2BHUA 4PRAA 5F1NB 3WIIH 4JGNA 3OJDA 2I07B 5C6TL 4DESA 4KAQL 1H8LA 3CK0H 1NBCA 3FQTB 1G5GA 4U1GC 4B9JA 4EJ1C 2WZ0A 1IGTA 5D1ZA 4QPEA 3IGAA 2I07A 4BQ8A 1P6WA 1KYUA 4N3UA 2FBRA 2P24A 4HCIA 3TC9A 2UZXB 1NWOA 1OAXH 3B5HA 2V2XB 1NLBL 2KERA 1GRWA 3TONA 3FNKA 2BSEA 1PTZA 3DSFH 4FX5A 5SX4I 1NGPL 1T0MB 3MRRB 5F7EH 3GXNA 3CQQA 3IFPA 4XCFH 1CT8B 4WHYH 3Q9PA 1QNZH 2VLJD 1G7IA 2GBUA 5B1AB 1Z0MA 3W0WD 4JM4H 1SN5A 4W4OA 5T1LB 4Z7QB 5B39G 3VA6A 2C4FT 3HR5A 3IJHA 4ADJA 1P9MA 1AYRA 4OU3A 3HN3A 4WUUB 3U7YL 3AT0A 3ATBA 5F9AC 3B34A 3SCMC 5ECJE 3TIDB 3TT3L 1FFTB 3MBEB 4MMXB 2XC8A 4PRPD 5EWIH 2P1YA 2J72A 4U6TA 4NQTA 4RESB 5E6IC 1P0SE 2H3XC 4HIHA 2OMUB 4OT1L 1EA9C 5E2WL 5IB4A 1YAIA 3ML8A 2IV8A 1BDYA 1Q0YL 2CM5A 4Y4FA 1IGJB 5F7EL 2ZOKB 3QQXA 5IB4B 1J8KA 3KLQA 4M3JA 1FRGH 4GXFA 1IBDA 4HFWB 3TA3D 2ZNXA 2FHFA 3E2HC 3P54A 4M6ML 3AUWB 1JV5B 3HFML 3MGOA 5TDOB 4FHKA 5EOTA 1TF4A 1SY6L 4PJAF 3EH4B 1YO4A 3FU6A 3KH3A 4O2CA 1UFGA 1T5WA 3TZVB 3QDJA 4DQAA 5BV7C 5CD3B 4BFFA 1P53A 1JXDA 3CFDB 4I1RA 4XI5D 1J8RA 2PPEA 1TJHH 3VFSA 2ZG3A 2A9MH 5FC9A 2GFBB 4ODVL 3VXPB 3BSZH 1OVZA 5FUOL 3MBEC 4MMXC 2AJ3B 3OMZA 1RUKH 5BQ7B 4GAGH 3N44F 1CFNA 3LN9A 1RZKH 4JM2F 2IGTA 4LCWA 1RUMH 5E6RB 1FYTE 4R96B 2Q87A 3UIZA 3WEXA 2EEFA 4YJZL 5I8KH 4MCYB 4Q9BA 3OKMA 5E2JA 3PHOA 1M2VB 4XP4L 4X6DF 2GIYA 3FT4B 2CKBH 3FO2A 4PU2A 3EGSA 4KH9A 1Q9OA 3CU7A 2VNCA 2BIIA 2YXWA 3QG7L 1PAMA 3KVPA 3L4VA 1QKZH 4L1HA 5FYKU 1GY1A 4QHLB 4KQ4H 3MBED 5FB8B 4OTXL 5DJYB 1LVEA 1XIWA 1IRAY 4OLUH 3HMWL 4OQ1A 1UWEH 1AC0A 2EXYD 2XZAH 1H3PH 2E59A 1QFWI 4YLQT 2EVHA 4IU3A 4NPJA 4PBDA 4WW2B 4X8GA 4NBXB 2MKLC 3GMNB 5D2LB 3WIAA 2A73A 1KV7A 1IEAA 2E7DA 2IH3A 2WBWB 3WUWG 3SBRA 2BOLA 3BQUD 1J12A 3LVEA 1NDGB 1MFCL 4Y1TA 2XA8L 1WD9A 4ELMB 3KYNA 4D9RD 4WWKD 3SBWC 3HTLX 4XMLH 4MZRA 5GS2D 2F5BH 4QOKE 3SY6A 4Q9RH 1TEGA 1DJXA 4P46C 4Y2DA 4G80B 4AXWA 4MNQD 2ZWNA 2WXKA 1Q9WA 3U0TA 5C0CE 2QQLL 3BXNA 1PZ5A 2YUXA 5ICXA 3VXNA 2X2IA 3DJRA 3HE6B 1WAEA 3DC0A 5E94A 1CFBA 5TK4A 2PP9A 1ZK9A 2A9AA 1AOZA 4NO3B 2JLPA 3SODB 4MD5B 1QI3A 3ZDYB 1MFNA 4NZUH 2AXGA 4AQEA 4FFVD 3QUML 3EGXB 3HBZA 4Z76A 1IAIH 3OMIB 5DS8A 2V6HA 3BCDA 5JHDB 1RUML 5DQDH 1G9MC 3NJFA 3EGXA 2IGLA 3H9SB 2GB2A 4XPBH 1F4WH 2VDPH 4IJ3C 1A7QH 1EZVX 4GRLB 5TTRA 3NFPA 3H9HB 4EN3A 4ZXBA 3BDBA 5DC4B 4Z7WA 1HL4A 3RL2A 3KS0J 4U1JA 3JWOC 4D7PA 3HIZA 3O2VL 2X70B 3OAWA 3QHZH 3N41F 4NWTL 3WAKA 3O6LL 3D1MC 4NQQA 5CN1A 3FF8A 1JTTA 2VDLL 1A6VL 3BAEH 1TVHA 2A4CA 4PQXA 4RGMC 4Q6IC 2OPCA 3PXLA 3BRFA 4HP5A 3HNTH 4YHIA 3TV8A 3HS0A 1CFVH 4L23A 2CO6B 4JO2L 1MFVA 5F1IA 1M9SA 5H4ZA 4PJXA 3L5WB 1CU4H 2OQJB 3QDGA 4G8FA 4IDLA 3APDA 4X8XA 3DBSA 3ZDYE 5TDNA 3QXVA 1S7WA 1DEDA 5L6YH 4CDHA 1ZD6A 4I77H 5C71A 1N5YL 4KFMA 2A5UA 2VC2L 3AB0C 1D9KC 2DLGA 3FTWA 3OKEB 3TOPA 3VFRA 3BRDA 1AHMA 4AWJC 1G1YA 2DWEB 2YEVB 6PCYA 3MA7A 4RX4A 5AL8A 1PZCA 5CZKA 4GG8A 3QR1A 3JV6B 1Z6JT 3B1UA 1KTRL 2BIMA 1UWGL 3KE0A 4AZ8A 3GXUB 3NJHA 5GGSY 4D9QD 1CXHA 5K9JH 3AADB 2B3IA 4QDGA 3JV0A 2R9HD 1ID2A 4FNRA 2H6OA 4PJXF 2NY4C 4Z7UF 2EO1A 3LKNB 4LGSB 2A74A 3DDFA 4JJOA 3U6RB 2HUEA 2WO4A 3NTCH 4HAGA 1ZSHA 2AVGA 4RMRA 3WIFB 1QFWM 3Q2LA 1QSEA 4P57A 4NQUA 1ZVSB 1KEMH 2Q8AH 3RWFB 1CDJA 3M6DA 1QLRA 3LZQA 5I8CB 4ZSOB 3FQTA 2YPLE 3G08A 1HWWA 1DBAH 2O61A 4QXTB 3SOBH 2G5RA 1Z7JA 1QLRB 1S78C 2FTAA 5E8NB 2BZ7A 4X0KA 1I8MA 1E9OB 1R34A 1ILSA 3K6OA 4NQED 1UYWL 3UJJL 4XXDA 4F92B 3T04D 3FTGA 4MDJA 5CP7B 2B2XL 4OKVB 5HHOD 3S2CA 3GRWH 3CHPA 5CILH 1JRHI 4HQQL 1AXTL 5LGKA 3OKNA 1U2YA 3S36L 2WJ7A 1JS4A 1KGWA 4X5WB 5FCSH 3IFOA 3GGWA 2OSYA 3NA4A 4KMQA 2WXOA 4P2RA 4P9HL 5EHFA 2BDNL 2K6YA 4PHZA 1B6UA 4G7YL 1I1AA 5KN5A 3SPVB 4BXVA 2R23A 3NN8A 4RFNB 2PN5A 5KYXB 4GYBA 3CWGA 4X4MA 1WISA 1OE1A 3HW7A 1SOQA 3LIZA 5ALBL 4PJ9C 5D1QD 3WY2A 5GRUH 1LO4L 1R3KB 2DICA 1B0RA 4XTRD 2Q76B 2B4CH 3O2DA 1V8HA 3IMTA 1R3HB 1EHAA 2F19L 3CUPB 3GMPA 4KRPB 4Q8BA 4XP1H 5FO9A 4F20A 5EA0L 4RX4D 1TJIH 1BFOA 3UG4A 2DQMA 1UM6H 1PJ9A 3GO1L 4MKTA 2HFFB 4PJ5B 3CFMA 3CZJA 3VFMA 3X12B 4XNUL 4F24A 5ITBL 4JFZL 2XQBL 3MRPB 1I1YB 3N1MC 1V7ML 3QI9C 2A1WH 1HCVA 2YMTA 4WFHD 1HHKA 1A9BA 3N41B 3HBQA 4URTB 2BVEA 2BJML 1DTUA 3HZVA 3CMOL 4F2FA 4OLYL 5E8OA 2XTLA 5T8IA 4QRRD 2Y1ZA 1AOHA 4MB1A 1CG9A 1NGWB 2WBJC 4AK2A 1DP0A 3B3IA 1BPLB 2AXFB 4TNVK 2ICWI 4DP2X 3F7KA 1W0VB 2QVFB 3H1ZA 3MRDB 4J3OC 1DBML 1NGWA 2OX5A 3K74B 1AHWB 1HJCA 2DKUA 3OB8A 5ALCL 2RFXB 5KOMC 3MRMA 4HKZB 1FG2B 4PJ9A 4CVZA 3QEQB 3MRJB 1Q0XH 5LAXA 2V5MA 3JQOB 5GS0L 5IJCC 3GBLA 4G9FA 4I89A 5DK0B 2NW3A 5C09E 4EI5A 4WI6A 5MHSD 4TQIA 5ERWA 1T7XA 4K3EH 3D2UD 4HAKA 4KXAA 5IG7B 3UXFA 3QYCA 3VXTA 3FOMB 4FNTA 1VGKA 4KY1L 4UQEA 5H37H 4J8RB 4J2XA 1BJ1H 1FYTA 2FEEL 2WK2A 3ALWA 4ORGB 3RZCD 3H9ZA 4D3CL 5TE4L 2X89A 3IXTA 3VMPA 3Q8BA 3SKMB 1XIWD 4MZIA 3FZUC 3OX8A 3II2A 4KV5F 4FLHA 5DEGA 2PCYA 4OD1H 5DUBB 1KG0B 4KHTH 5HGHA 1HEHC 4UOJA 1X9RA 2EYSB 1M7IA 5KVGH 1JWSA 2YGQA 2FO1A 3B3BA 5EBWA 1KBKA 2AVFA 4U3SA 1A6UL 1AE6H 1ED3A 1KCVL 2KHAA 1FI8C 4WV1A 4Y4KB 2DPKA 3P77B 4K9EL 4ZFOB 4N2NA 2I9TB 1JYWA 1CR9H 2OXGA 4PJEA 3OF6D 5H2BA 4HXAL 3UTQA 5HDBB 4E9VA 1IJ9A 3DX6A 3KWWB 4OI8A 2X4OB 3UTZB 2QV2A 3RVTC 3C9NA 4R0LA 5DD3H 1OKEA 4P46A 1VZGA 2RCSH 3H6JA 1YNKL 1KUMA 4ZPVA 1NH6A 1F45A 4C55A 5FGRA 4G6JH 3CPLB 3LH2H 5I8EA 1QTPA 1XVSA 1KJMA 1TVBA 4ZO6A 2R0KL 4PM1A 4XH2B 4DK5A 4U6HB 5DQJA 2BM3A 3WMQA 5ACMA 3ZMRA 3MOQA 4HZLB 5T5FL 2VXVL 4OD2A 4G7RB 4RBPK 1SMDA 4K8RC 3EOYG 2MPAL 5GISH 4KJQC 2G60L 3BDXA 3D48R 3I02B 4JFQA 5JOPD 3BP6A 5FYJD 1GW6A 2V2WB 4HJIA 4JM2A 1OP4A 3AXLB 4JO1L 4N0YL 2FX9L 3ZE2B 5SWZB 5BV7L 4L3ED 2P45B 1UUSA 3PHSA 5J6HB 5IWLA 1NKGA 1ITCA 1UVQA 4R4NC 3MV9E 5IGXH 3MLWL 3U36A 3ZIMA 4PG2A 4B9FA 2NQDA 1QSVA 1KXVC 2YAPA 4GI8A 5D7IE 3S3CB 4HYTB 1P1VA 3ARGB 3PDDA 3RWGB 3OKDA 4XNYL 1CICC 3MA9L 3LQMA 3MUGA 3QUHA 3BLPX 4LPCA 1UEYA 3LAFA 3MCKA 3QCVL 1D7CA 2EDRA 3M1BB 4NLAA 5H37A 5BQDA 1AY1L 1EPFA 3CAFA 4A6YL 5IEKA 2D7OA 4HKXA 3SE6A 1MJ7L 1DN0A 2D7PA 5EUOB 3V52H 3FCSA 5INDB 4PRHD 2ZP0T 4YHIB 2F15A 1HCFX 3BVDB 1PAZA 1SOXA 1WDAA 1YHPA 3K0YA 4Z95L 5AZEL 5ILTH 3DSNB 3PE9A 2NY4B 1F58L 3BEWA 4M43L 3NACH 2XT1B 2NMSA 4G43B 4FXTA 4Y1AD 1PF3A 1WUZA 1H8OA 3JWOL 4DOHE 3PWJB 4L3FA 4P2YA 4B53A 4PMFA 2PABA 1IBGL 2NY3B 4G42A 2VW4A 2FECI 1ORQB 1X9QA 2VL5A 5KVEH 1GZHC 5L4JA 1EFXB 5IEHB 3SQRA 5F6IB 2CLRA 4FXLA 3DYOA 4N0UB 5F7UA 4NAJA 2CIIA 2ID5A 3RWJB 1P4UA 1UJTA 2A6KB 3QJHB 1IFHH 2X9WA 3H2QA 1WIOA 2IPUG 4LLWA 3RVWC 3H3BC 2XVKA 4M7JL 4FKKA 3TWYA 1XIWC 4L1LA 2I24N 4K94H 4DN3L 1ZGLA 3QJHA 5BJTA 4OCYL 3BE1L 1AR1C 3MXVH 4NFCA 3JUZA 3D2TA 3V4PB 3SGDH 1RIHH 1VZHA 4KPHL 5GRJL 3BPNB 3P2DA 2A6JA 4IRZA 3BKCH 4MASA 1LEKA 1X6NA 4DSYA 1DUZB 1BIHA 2AQSA 4M6NH 2R2BA 1HH9A 1INEL 4OZFH 5DVOA 1H5BC 5I2IA 5B38B 1EJFA 4IGBD 3EYOA 2FD6H 4HIIB 1JF6A 1QHOA 2A6JB 4QAMB 4XCNB 2AXJA 5ALCH 3U4AA 2BVQA 1ETA1 1XCQB 1YC8A 3G6JA 2WQ8A 4E9YA 1RIVL 2R2BB 4YBLC 2RTTA 2IALB 4UUJB 2AC0A 3DRQA 1JNNL 3DTUB 2WXRA 3T0VA 4HJ0C 4NXKA 5D96C 2XG5B 2BSCA 3DROA 3VQ2C 5IVNA 1SJHA 2DLFL 2J57A 1VZIA 1CLCA 1DVZA 4FI8A 1BECA 1UM4L 2W91A 3VXUA 2WINA 5IMOB 4Z7NE 3K81A 4MDJB 1GC1C 1KY7A 4DGWC 1JNNH 2NR6A 3SDCC 2APXA 3S4SG 3FQXB 3KCPB 2VSCA 5LCVA 2FSEA 3LN5A 5E0FA 2Y23A 3VXUB 1AO7B 1PFCA 1XEDA 3MX0B 4HFUL 1TG8A 4UQIM 5F44A 5C0IB 4WHTB 2FNBA 4R83A 5AVZB 4JBSA 1XF2B 3FTYA 4JFHE 3PGFL 4AOFA 4EVNB 4YSSA 5C09A 4HWZA 4RFEB 1ZV2A 1M1XB 3OJMB 1NBZB 3S35X 3GLAA 5CHNA 4K3HA 1CL7H 3BQVA 2HN7A 1HNGA 5EPMB 5I0VA 3BKMH 4UT6A 4PB9L 2DQFA 4X4ME 2R0WL 5EBMA 1F8TH 1ZLEA 3BFQG 2Y3AA 1HSAA 2X88A 2DAVA 4HCRH 3QQ9D 4NNXB 3OKLB 1FE8H 2B39A 1FL6B 1ES0A 5BCAA 1QASA 3ESNA 4BH8A 2BHYA 2X9XA 5HJBA 4M29A 4ZK8A 1W72L 4I0PB 2ROXA 1MDTA 1UJ3C 5K69A 1KEGH 4I85A 1EAJA 5FV2A 3LHPL 3TN0D 1IBGH 4Q9QL 1S5IH 3EOTH 1QUNB 4U33A 4LCWB 4M5YL 1KDIA 4UV4L 1H3XA 5EUOF 4BDVA 1IE5A 1ACYH 3DHUA 3FQUA 1QATA 2E7HA 2E7LC 4TVPL 1NC4A 4BHUI 4NHCH 2WIIB 1UGNA 1JDCA 2ZYRA 3OC5A 5T1MA 2EEBA 2JVUA 4QNPF 1PYWB 3VRIB 3E6HA 1OF2B 5KBKA 1NJ9A 1OSZB 4YE0A 1L7IL 5EC2A 5T1MB 4HJEA 4WKZA 4YNYA 2YOCA 1SXSA 4HS3B 2IBZY 2ZKHL 1IBBA 3GXTA 3MFGB 3S34L 4DWHA 3RVXC 5IUCA 1MHEB 2AHIA 3SKNB 3HI5H 1IC1A 1NCJA 5I5RA 1CLYL 4HKJA 3H3PL 2GI7A 4N3TA 1SXAA 3D2UA 4WTZG 4F37F 5D1QB 2A73B 1UD3A 5DRXB 2C34A 4AEIL 4PH8A 4TTDC 3MLZH 4TRPL 1E5YA 1G7LB 2NLJA 4AUJA 2P5EB 3MO1B 1AVAA 4AKPA 3PP4H 1KN2L 3MYZA 2I9LB 4YO0B 3OF6A 1ZHBB 3L81A 2NY0B 1N9PA 2NZ1A 1F1DA 3A5VA 3WTUA 2COQA 2UXVA 1UH4A 4Y19E 3QZWA 5FYKD 3OR7A 3OLIA 2FH8A 1SM3L 5CSGA 2WTOA 1N5YH 3W39A 4GSQA 3SE4A 1WIUA 1BIIB 3LZRA 2CM6A 4M5SA 4PWHA 4ZW5A 4UM8B 5CGBA 4FTVB 3OC8A 3WJLC 5K9KA 2QVMA 2VDQB 4EEEA 2UVEA 1IZJA 3A3YB 3OKMB 5KYWB 1BZDA 4OZHA 4MJ6A 1MWOA 5G4MA 3CN0A 3BWZA 3HLAB 5DMYA 5AKVA 2IH9A 5CR1A 2UXGA 5DFAA 3WLWC 1E2WA 3T6ZA 2ZONA 4V2CB 4HLEA 5JHDA 4E5XA 3QIBB 2MCPH 2DJSA 5D7LE 5E9AA 1LD9A 5EO9A 4V1DB 3NIFE 2ZUQB 3L4YA 4PJDE 3KW8A 4OCXL 1KYDA 3EO1A 3HG1A 5C07B 4TYUA 3VXQA 4NBZB 4RQQB 4RWYH 3BZEB 1P7BA 4LNRB 5BZZA 5GZOA 3AGWA 1CXIA 4KVNH 4YHNB 3C5JA 5BRQA 2DM4A 4QRTA 4U1LB 1B4JH 4H40A 4LNRA 2G9HA 2GC4C 1U92B 5DRNB 3EJSA 2ENSA 2X3AA 4M8QA 3CX2A 1K5NA 3S35H 5BRPA 3LB6C 4G5ZH 2VDRH 4K7FB 4UT7L 1X5MA 4Z7OF 4MLIA 4K7PH 4NKIL 3LRMA 3HS8A 1IM3A 5FX3A 2IQ9H 1NANH 5SX5H 1BMZA 3I9GL 5BMFL 1JZJA 3F12B 3FRPG 5E5UB 1OW0C 4H0IA 1HYSC 5E8EA 2FLBT 1RJLB 1MCFA 2ODIA 4QXVA 4LPUA 3G5XA 2J8OA 4OQTH 4HK0B 4UQ3B 4JL1A 4PJCE 5AAWA 1CURA 3JT0A 4PRHA 2OJZH 4HHAA 5MENB 2ZWYA 2J5LB 3MJ8B 1UM4H 3WUZA 1U8OB 5JPMC 4YVUA 3QWRA 2XQYA 2H8PA 2XWBB 1KCKA 1BAFL 2OSLB 3TNNA 2J4WH 3M45A 1MG2C 4I2XA 3FQNA 4N2MA 4FKEA 2DYPB 3KLAB 4W9HC 4YZFE 4MNGE 1AQKH 2DW5A 1P69B 2OR9H 2Q8BH 3WNOA 2AQ1A 3MBXH 3QIBD 1X7QA 1O9VA 4ZX4A 1UD8A 4MQSB 3FQNB 4YPJA 1ACZA 1RJCA 4JPIB 4AIZA 3ULVL 2H0JA 4F9PA 3VTTA 3VWKB 2C7UA 5JW5A 3TVMA 1I8LA 5EN2A 4AM0B 2ZWZA 2VXUH 3LZFH 5F0PB 3M1OA 3OXRB 1U36A 4N5UA 2BP8B 5KW9H 1GA2A 2XTJB 4NO0D 4OV5B 1J5CA 4IBWA 2WUCL 5C08A 3MRIA 3V9FA 4J5VA 4U7MA 3RDTB 3S4SA 5IK3A 3CN2A 3B6SB 4WI5A 5CXPA 2BSDA 4I3RL 4MA1C 3SGEH 5F1IB 4Q6IB 3ARFA 4ES8A 2NY0C 4AGOA 1LK3H 2XJKA 2Z64C 1JZDC 2OJ1A 1NIBA 5TDNB 4CMHC 2UY6A 1B0WA 4R8WL 4WENB 3M1CA 1ETZB 4DP1X 2I27N 4HV8A 1P1ZA 2VUYA 4L4TD 2EIDA 3NCJL 4KNSA 3DRQB 4E41E 5IREA 3SPVA 4PTUA 4D8PA 3TASA 3QEGL 3VI4A 4FG4A 2ZUYA 1FH5L 4O5LH 2QHRL 1MG3C 2VSDA 3KJ6L 3H7BA 3MJWA 1MJJA 4YHPB 4S0HA 5HHOA 3BPOC 4O9HL 5JIDA 3W1ZA 1MRDL 2A6DA 1M71B 1F3DH 1NKOA 1OK8A 4JJ5B 3O4LA 1NBVL 1AO7A 4GBXC 5L8LB 4CU6A 4S1SH 2AF2A 1C08B 3SDAD 4RGNB 3RFZB 1LK2B 1LO3H 3BUBA 3QFJB 4JJ5A 1SY6A 3FZUD 3T1FB 6FABH 2NX5D 4L4VD 3MRCB 2VN4A 4GB9A 1U91A 5ADPH 4S1RH 4YBQC 1PL3A 4NN5B 1XB6A 3E3QC 3VTAA 4N6RA 2R4SL 1BZ7A 1JHTB 1GYUA 2DLIA 3QQ4A 5D7HA 3VYOA 4YC2C 4CSTA 1QYGH 5JZ7D 3D18A 4HGMA 3V6ZB 1FVCB 1J9RA 1RZGB 3QWQB 4Y2OA 1B0IA 5AZEH 2VMDA 1AI1L 1MPAL 1RVFL 1UZ6E 5JDSA 4OBSA 2W38A 4LT7A 1ES0B 2DQGL 2VLLA 1DVFD 2L04A 1WJ3A 3D6GA 4JPSA 4N90D 2YBGA 5AZ2L 2R39A 1QYGL 2EEAA 2ODHA 4PB0L 3F05A 1TU2A 4KQ3H 4LSVL 4OKVA 3F7VA 3SPIA 3CZFA 5E8PB 1G1KA 3RRQA 4EOWL 4DW2H 4X6CB 2QLYA 4HIHB 2VLJB 5HGBA 1DJYA 5FO8A 1U8LB 2JELL 4G11A 5E1AB 1KIPB 5LNDA 1S6NA 4OIFA 3HNVL 2UZYA 4PJ8D 4TLSA 1HDMA 3AREC 2PW1A 3CIQA 3OQRA 4JO5A 2W0PA 1TZ8A 2EDXA 1G6RB 2F68X 4LPYA 1N6UA 3FPYA 5KSBE 1Y6NR 3P11H 4IOSD 1ZKAA 3X1NA 3II1A 1VGKB 4D0DB 3BUYA 4Y4HB 1B0RB 1K72A 3ZYIA 1J18A 2GJZB 3KLDA 4IRJA 4AC4A 2VERN 1ZT4B 2AFNA 2BFVH 3MV9D 4FFYH 1ZTXH 2YJQA 4YNYB 5F1OB 3MREB 4N20A 5DJ2A 4NQEE 1Y0LB 3IMUA 3MLXL 3SN6N 3U4BL 1ZT4A 4R4FL 5L0QB 4WU5A 2P44B 1WV7T 1G7JA 4G6KH 2C7FA 4KI1A 4QTIL 3X11A 5E2TL 3NPZB 3P3RA 2BK8A 3HZVB 4JE0A 3G5ZA 5EEUA 3EH5B 2XQ0A 3FU7A 5E8DH 1BQHG 3GNML 4HUUA 3V7AG 5E8OB 1HILB 4O58L 3A6BH 1HXMB 4A68A 2DTML 4WWKA 3FO0H 5ILTL 2EJ1A 5CJQL 3MBWA 4LAQH 1RMFH 4Y5YB 1FZJA 2YRZA 1PDKA 5CJ5A 4Y2NA 3HKFA 2WANA 3MQIA 1S7TB 2WM0A 4Z7IA 2WXMA 4ZPVB 2IAAC 2WIMA 2HT4C 2OCJA 2CK0H 5DRZA 3T6XA 4QHMA 2OX5B 7FABH 1HL8A 1LTXA 5F3FA 1OGSA 1A6UH 1AE6L 2QBWA 3D34A 5C0BE 4AG4L 3WFCH 1UB6A 5IIEA 2E74C 4KKAD 3JV4A 1OM9A 1XIWB 2P49B 3LH9A 3EOAA 5E9DB 5FYJL 4HZLA 4R4FH 2R7EB 4KO9A 3ULVH 3HPLB 4Z5RA 2F5AH 3VH8B 2R1WA 2ZPKL 1S7QA 2HZHA 2NY7L 2L0DA 2HUHA 3BESR 2K7PA 3JV4B 2ZQKA 4HHGA 2X4RB 3RLSA 3ABMB 1G84A 4EUPH 3PNWA 3P0YL 4FNLH 2JKSA 4AENB 3IF1A 1JNHB 4ZTEA 1VB9A 3QQ9C 5GZOD 5ICZB 1LP9B 4UQ9A 4K94C 3ZE1E 1HKLL 5AVUB 3TFKD 3A6CL 1ZJAA 2VDQL 3REVB 4AENA 1ECZA 3EBGA 4LOUD 1J0HA 3D12B 2F1AA 2AEPL 3IXTB 5E1GA 1BYOA 1XGPA 3MNDA 4JPQA 1L7TL 3E7JA 4YXKH 5L88H 1MHCA 4G8AC 5JXAH 3S3SA 1AD9B 1K4DB 1WFMA 3ARGA 5KSAD 4F2ME 1A47A 2A4EA 4Q7DA 5DUPL 5AAMC 3K71A 2GCYA 3U7WH 3S7GA 2VZOA 3DXAE 1WZMA 2E9GA 3L7FA 3FU3A 2FUQA 4JRXE 4PJDF 4X7TA 1AD9A 1K4DA 5E7BA 4AQ1A 2XN9E 3GSUB 4G7VH 4YFLF 4MHHG 5AKSA 3T0EC 3UZQB 2JI3A 3VUAA 4WWOA 4K5PA 3T6QC 3KLHC 2V5TA 3UTQB 2PXYC 4NO3A 1CD9B 4YSOA 2GVYA 4F7CB 1UJ3A 4HJ0D 4FXGC 1A1OB 5B1JC 3GUTA 1SVCP 2BSSA 1IM3B 3QEHB 4L3EE 1OP3K 4F57L 4BWTA 1EHKB 3QJQB 3HVDA 2D03L 3ZVVA 1IM9B 3B8SA 3VRLF 3NRPA 3OAYK 4FYSA 5I73C 4KI5D 4APXB 4MXVE 2VDLB 1MLBA 3OB0K 4L29B 2JJUA 1U3HD 3O3UN 3QP3A 1AXTH 4OD2B 4OZGF 2VQ1A 5I5IA 1Q1JH 3U4BH 1MIMH 4Q97A 4JFXB 5IVOA 1CZ8L 1BXUA 3VFPA 2Q3AA 3F85A 4WFHE 5LCVL 3M8OL 3LEVL 4LPVA 2Z6FA 3WE6A 1RZKC 1KJ2A 5EF1A 3VFPB 4YMPA 3MLUH 1GIGL 1SHXA 5JHAA 1SDDA 5D7IB 2VXTL 1NAMB 3OD3A 1LE5A 4KXBA 3BSGA 3WN5A 4IKKA 5F3HA 2ZX6A 5DD5H 4YK4B 1HZHL 2NY1D 1CL7L 1XMWA 3WDJA 4B50A 3LRSA 4N26A 4YZFF 4QOKD 5F9WB 4ZDHB 5I30L 1SLWA 1U33A 2XJLA 4Y1AB 3SDAC 3VGHA 1MJUL 1NMAH 3VD7A 4G8FB 5CU9A 2OTUB 2ADYA 1AQMA 3FMGL 2CJUL 1H6TA 3OAUL 1BZQK 1FBIL 2YPVL 4ZI8A 2BSTB 3NCFB 2E4TA 3ORJA 2JKTM 1IAMA 4NDMA 3ARDB 3HNSH 1EJOL 4XMTA 2QQNL 3PFUA 4U1IA 2PWDA 2W0FA 1IZKA 1DQKA 3ECWA 5MEQB 1MHPL 2C9VA 3B83A 2Z65C 4X8JA 3T0EE 1IGYB 4LSPL 2LTQC 4ZBJA 1EXGA 3SOBL 1J8HB 3TPUA 2P9RA 1RH8A 1KNOA 3ARFB 3DHJA 4MJ4A 5FHBL 4PBXA 3WTWA 4XPHL 3D08A 1AGCA 1RZJC 4X83A 4F9LA 3I3DA 3CX5K 4RGNC 1IGYA 2AGJL 2YHGA 3L3HA 3L95B 1ORQA 5F9JA 3PCYA 3OV6A 3C8DA 5C2UB 1VA9A 3ZT7A 3U2SB 2FR4B 4JANA 4QHNB 4UTAA 2VM3A 1PS3A 5D6DC 5G5DA 1LO3L 3FT2B 4G8GB 3VD4A 2OR9L 1HWHB 1LL1A 1RP9A 3L7EB 4WEBL 5CINL 4LMQI 5LLIC 4LRNL 1F4YH 4UBDC 2DQFB 4ADIA 4JG0L 2O5XL 5D1XE 1XCXA 3FUFA 4KOBA 3FT2A 4FQCH 1X5FA 5FIEA 1Y6MR 2QVKA 4H88H 1PLBA 4HPYH 4B95C 5BJTB 1X5AA 4ENED 43C9B 2AXHA 3CVCA 1VSCA 2J6EH 4GW5B 4NNPH 3AS1A 4M1DH 5F7FA 2C3VB 2FLMA 5DJ8A 2QZ5A 1TJGL 1TZHB 2RIKA 4OLZH 3ARFD 3ZKND 4EI0A 1FBIH 2HP4A 5D2NB 1JPSH 1IC5L 2E76C 4P2RE 3SCMA 4X5XA 1N18A 1S9YB 2BNQB 2E3VA 3P2BA 2HPOA 4JDVB 4NO0B 5FKAA 1LNUB 4Q6KA 4FI7A 4NQCD 5E1HB 5DZLA 5DVPA 3NA9H 4JQXC 2F7PA 2G2PA 5KYXA 1S9YA 3WCYA 2DN7A 3HNTL 4R2GC 2DRUA 4YBLB 2NZIA 4RMTA 3PQYB 1L3NA 3SDXF 2HKAA 1MHHA 1ZY9A 3HKZA 2XIIA 2H45A 4FQ1L 4PR5A 5FDYA 2WVUA 4FI6A 3EJZC 1UEMA 3D39E 3I6GA 3SGJC 2HFTA 4GXVH 3WEBA 1MDAA 4G9FD 3U7WL 1QSEE 1I1YA 2NOYA 1XB3A 4MDRA 2YC1B 3ZK0A 1KACB 2LT9A 3RPKA 4RFNC 4P3CH 5EPMA 3RU8L 4FA8A 5BOJA 5JNYB 1OAZL 4A7TA 4ZZKA 4LOVA 4W9FC 3TEUA 5MENE 2QKSA 3SE4C 2EKSA 1JPFB 1MELA 1VJSA 1HHHA 5KTEH 1CLVA 3BFOA 5FGSA 4V2BA 5FM5O 5KG9A 2FX9H 1TPXB 4HK3J 4ZMYA 1DVUA 4KDWA 1A4KB 3GIVB 1WYJA 2HH0H 3C5ZD 1BYPA 2ITFA 5ENWB 2QPUA 5LGJB 3OVUB 4NZFA 5F88B 4AQZA 4WU5B 4QNPE 3SB3A 1BZ9B 3BW9B 1H3PL 4G7VL 2GUOA 2IG2L 4Y5XA 2F6AA 5E2UL 3D50A 3QIUC 1BW8A 5J6GA 2ZCLH 3L3KA 4HUUB 5I74B 1WFOA 3QBTB 1S7UB 1XTMA 4G6JL 4IBQA 4XE5B 4GW1B 3OZKA 4WJ5B 4MJ5B 1L9SA 4KRPD 3ZGHA 3OJVC 3WEXB 4JMXA 4DNLA 2Y6TE 2C9QA 2AV7B 1MUJA 2DKSA 3F83A 2ZOWA 3M17B 5DVMA 5IV2A 1FO0H 2BWIA 5LBSH 4XVJH 4GI6A 1HHGB 4HS3A 2O5ZL 2R29A 2CCLA 3QI9D 3VAEA 1NGXA 2JB5H 5EZJA 1ZE3H 4H8VA 1IAIM 2Y7LA 3U30B 4XPTH 1NFDE 4EDWL 1X5GA 2M1KA 2N4IA 4ADGA 4OF0A 5AB0A 3NCYP 2CBQA 3EO0A 3IF1B 5KYUB 3EZJB 3Q2VA 1MZZA 4WFGD 7PAZA 1ZXQA 5TE4H 3WTVA 2D7TL 2R29L 1F3DJ 5C0EB 4JQIA 1OAQL 5EO0B 3WSQH 1FGNH 1E3FA 2VWEE 2EXWC 3FYIB 3FRUB 3EYVA 3V6OC 4MHHI 1K5NB 2EDBA 3MNZA 5LO7A 2XN0A 4DZBB 4RRPM 2NXYC 3RTQC 5FCUL 2VQTA 1DE4A 4M61B 2ADIB 1MFMA 2BIHA 3NCWA 2F53D 2WXNA 3JYCA 3L7FB 4ONGL 5GGRB 3V0WL 2CBMA 5IQOA 4G80A 2F2HA 3DBXB 2XKUA 3BD5A 4I8DA 4LVEA 4APQC 4DUXA 4Y88A 1MIEL 3KYMA 1G43A 2NTFB 5PCYA 4MMZA 3P73A 5KJRL 1UC6A 2ZOLB 3KBHE 3F7RA 2N1TE 4ZZFA 1G6VK 1QRND 5CZVH 5D7KD 3V2AR 2FO8A 4P4RB 4JR9L 1DHKA 1TUPA 2DTSA 4I9WD 2YAHA 3LS5L 4JCLA 3DETC 4DKTA 1T7VA 2AXGB 4JL2A 2PUQT 3GSVA 1NMCC 5KUMA 3US9A 7CGTA 3CMOH 4OD3L 2ATPB 3GMMA 2NYZA 1NCAL 1UA6H 4OJEH 3F01A 4YXLL 3QUKA 4XZUB 3FU9A 5EU3B 3GXIA 1ZT7A 1X7SA 1IILE 1I85A 4TVUA 2ZE0A 3CH8A 5DFVC 1JL8A 5E2VL 1KJ2B 5LHDA 3X17A 1JCKA 4JDEA 1OLZA 5FW8A 3QVAA 1RUQL 2GJPA 4LDEB 2PWEA 4WDIB 4FNPA 4WTZA 5DRNA 5KEZA 4AIXA 4YBQD 3KWTA 5IK3B 2OYPA 4ENZA 1R17A 4PFEA 4QOKA 1KGUA 3QEUB 3QZBA 1MI5D 1URIA 1W6WA 1UTDA 4YLCA 2D7NA 3KLLA 4G42B 3VI3F 2D4DA 3UC0H 4CVUA 4PMEA 3I9PA 4FL4B 2PCPB 4AQAA 1CB4A 1PNDA 3H9SD 3OHXC 4FFWC 4PTUB 2NDGA 3V4PL 4DJMA 4JDTL 5IJKA 2C26A 4WW2C 1VFBA 2H9GB 3LY6A 4I3GA 3BWSA 2KT6A 4RAHA 3WJJC 1RFDH 1BP3B 3F7YB 5DSCB 5DMJB 3CFIC 4LLWB 3UACA 1KIQA 2K7QA 1Q1PA 2IH1A 3MA7B 4XO9A 1QRNB 9CGTA 5F1NA 1F97A 3BZDA 4H7VA 4ZW7A 3EJUA 8CGTA 3AUVA 2OA9A 3KLAA 3FQ2A 4FYRA 3VFGL 2AJZB 3QQ3B 3V4PA 2DMGA 3KBEA 3SEPA 4CNIA 2PO6D 5F9JB 3ULAB 3T65A 1CIDA 1NCHA 2QR0A 4NB7A 4Y5YC 2HKFL 1A2YB 1BQHA 4PRIB 4NRXA 1FPTH 3UTTB 5HHMB 4KVCH 1S7RA 3H53A 4QJ3B 1AJ7H 2IADB 4Z78B 4PRIA 1DBMH 4BFJA 1QSEB 4OD3H 3CDGA 3LV3A 4BFOA 5JLZB 5ANMB 3D4CA 2CCWA 3S98A 2VSKB 1WTLA 2E75C 1E4JA 2VQUA 1QLFA 4M5TA 1UWGH 2NZ9D 2ZXCA 4Y5VC 2VRQA 15C8H 3MLVL 4PVBA 2AJUL 2DLTA 3HS0C 4JY6A 1C5BL 1QEXA 1ZJBA 1KYOJ 5D72H 3QUXD 1EJOH 2B1HH 3STLA 5BPPA 2XPZA 4HF5L 4M7LH 4TVPD 5E5RB 3GSOA 5EUKB 4TUJB 4Q58C 2ZXWB 2Q2LA 1CDHA 4Y1AE 3DI3B 3BRGC 2Z8VC 2FH6A 3FTGB 3QUZB 4BHUA 1S7SB 1QNZL 1FNSL 4NGHH 4W68A 1ZTXE 3OBAA 5CJXA 4ZUWA 5F7DB 1KZQA 2XWTB 2EICA 3NRQA 4RISL 4ZS7L 3CX5J 3O3DB 5IVXF 1H8SA 5DJCA 3SJVA 2FO4A 5JQIB 3LNGA 2AEPH 3E0GA 1OHZA 3QUZC 1KENL 3CLEH 3CFEB 4N5ED 3ZKNC 5IMKA 1A6VH 5D7JB 4GRMB 3PABA 3M07A 3LIUA 4PPTA 1MCWW 2GYSA 4BH8B 3P0YH 2BC4B 4XGZB 4Z7OB 2IF7A 2YA1A 5DVLA 2VDNB 4ZFFB 3RGVD 4W9GC 4P4KC 3QUXB 3TTSA 3MROA 1FLTX 1J87A 4HCRA 4QXUL 1U91B 4B9CA 5IFJB 1C7SA 1KBGH 1G1OA 3ARUA 3SE9L 4ZT1A 1X3DA 1E7UA 2WCGA 1O9ZA 2C9AA 3QNXB 2W07A 3JWOH 2OK0H 1RZGA 4Y2OB 2QKIB 4NQVB 4IEFB 3AS0A 5F2FA 1U58B 4HCFA 4IOIB 1R5VA 5KVFH 4P2QA 2YZ8A 5B1CA 1TSRA 4MCYA 3K8MA 5GGSB 3SKOB 5KSBF 1I4FA 5LGJA 5FPIA 5K93A 3QZLA 3LH8A 2WYIA 1KDJA 1JFQH 1N4XH 4Y1SA 3O0LA 3UBXA 4N68A 4PJBA 1ZGLP 4R7VA 5C0GA 4TKWA 3L2NA 1JK9B 2E7CA 2R7EA 4LCWE 1G6RL 2EQDA 2XDHA 2AK4B 3U46B 3IFNH 3WE1A 4PJHF 4CVZB 4OLVH 5I1DA 2GT9A 4L8CB 1Z32X 1M3IA 3RNKB 4JFDE 2G2NA 4ENEC 3S96B 4GKZB 2GK0B 1I3VA 4LRIC 1AZNA 1KGCE 1H5BA 2GSMB 2TRYA 4N0YH 4BRVA 1Z9SA 1BVNT 1TQWA 1Y1UA 1J5OH 1WA1X 5CEZD 5I76A 3QYMA 1MNUH 4J4PC 5CEZE 4AW7A 1RKRA 5T33L 4F8NA 1AGEB 1Q94A 3MRNA 1GS7A 3KVDD 4MZ2A 3TO4C 1HAWA 1ET5A 3JTTA 2XTJC 3PWLA 3KS0H 4BE5A 3NP3A 4XOCA 4G8GE 4NCC2 4AQ1B 1RAMA 1MCQA 3U0TB 2UWEF 1GCFA 1J9SA 3V0WH 3K72B 4UM9D 4AG4H 4PJGB 4H4NA 4EOWH 4N2IA 4PJFE 2IQ9L 4IIZA 1V7NL 4WWKB 5AAWC 4M4RA 1IFRA 1O6TA 4OZHB 4M7ZC 2B3RA 2IGFL 1ED3B 5EC1A 4AMWA 4JFUA 1T3FA 2YD4A 3Q8EA 4CN6A 2OXGB 5H2BB 1A1OA 4FXKC 3GUTB 1AI1H 1MPAH 4MMYB 1L5GB 4J39A 3MFFA 1JWMB 1NMCB 4HT1L 2EKJA 1AZUA 4PIBA 5D7IF 2FK9A 2VZSA 3QHZL 1N0LA 2CDFB 1BM3L 4H8WH 5CBAB 2OK0L 1FDLH 2C8NA 1CE6B 2MFNA 1YMHB 1E3XA 2GY5A 4Q9QH 5B7MA 1GS8A 4NZRH 5IQMA 5GS0D 4HPOL 5I75C 2DBJA 1KJMB 4G8EA 2JJSC 1YEGL 1JD9A 3TS8A 4ZO8A 4N9GA 2MOGA 5TPWL 2XG4A 2ZAIA 5AFAA 1LP9E 1WT5C 1D9KA 1PKQA 2A0LC 5HJ3B 3UG3A 4LQ1A 3QZPA 3WGUB 3BZEA 4JQXA 4IRZL 4F93B 1KB9K 3WE6B 2JKJA 2BS71 1F4HA 4FP8H 4GAYA 4DP7X 3LYRA 3TEZA 3EYSH 4PJCF 4XAKE 4UTAL 4L9LB 2GW5A 1NEZA 1RZ8A 5E03A 4JDTH 1RY7B 4H1LA 5AB1A 2B9AA 4DEWA 8FABA 3R7QA 4AGLA 1A64A 1RP8A 2F54D 2WZ6A 3WMPA 4GRWF 1CLOL 2P7TA 1RPUA 5I1KL 1NEZG 1NANI 4KI5C 5F96L 3MGAA 4JREC 2P5WE 3RBGA 1TLMA 1G87A 3QRBA 1MCRA 5TQ2H 4NQDD 1CE1H 1N7ML 4WV1C 3LQAH 3ZPDA 4CA4A 2V0AA 2NCEA 4RFOL 4N86A 2C1PB 2AJUH 2Z9TA 3UO1H 5IW6B 2FJFA 2FSDA 4JRFA 1GHFL 4FCAA 4XN5A 1IEHA 1AYOA 3BZ5A 1C16B 2EDHA 2XWBA 2GBVA 4BFBD 5K1JA 5J56B 3BKML 1E9QB 1RZJH 5ECGA 5JOFB 4EI6A 4KDTC 3EHBB 4E9QA 4XOAA 5I1AA 1WZKA 4MXWH 4B0MM 4L29A 3I6KB 4IBVA 4KNUA 1UQSA 3F5WB 3RIFF 1NM9A 1RUAL 4HBCH 5CMAA 5I1AB 4GO8A 4ZMZA 1JK8A 4ZW3A 5I30H 4QJ5B 1F6FB 2Y25A 1NBYB 5EN2B 3RZCC 2LLLA 4AM0A 2PWGA 4LASH 2B15A 5DSCA 2X6VA 3WIFA 5E56A 4HJUA 4LOUC 2BNUB 2MIZA 2PW2A 3IJSB 2ALAA 2DLHA 3APNA 1U8NA 1NBYA 1X5IA 3MRIB 2DIBA 4RGOL 2VLKE 3RDTA 2O6FA 4XHJC 4BM7A 4LKCB 2YPVA 4HUMB 2OJZL 1FFPA 1KGYE 1ZLSL 4Z3IA 3W11D 2ALWA 4RZCA 3GLZA 2CO1A 5E6IB 3C6LB 3DYMA 3QDGD 1M1SA 1T7YA 2OTUA 4JFSA 4POYA 2F61A 2CGZA 4AJVA 4FKHA 4KMLB 2YD3A 3R06B 3ZLQC 3D07A 3DX7A 3O2DL 4CJ0A 1LNUA 1PLAA 3FAXA 2XWDA 3O6FD 1KYOK 2CO3A 2K9UA 3LPWA 3PY9A 4U1IB 3QZNA 5D9SB 4A39A 5MI0C 1MAMH 1DL7L 4UUJA 3G6DL 2NXZD 1CD1B 1V55B 3A22A 3JTBA 3KYOB 3MLTA 4U4BA 5HHQA 5KS9B 2R2CA 3GXDA 3BH8B 3KPLA 3W0WA 2VMCA 4ACPA 4F5CA 3EH1A 5HHOB 5EU5B 5D9SA 1SZNA 5AOIA 5I1IH 3I9IA 3WV0A 2O5XH 5A6IA 1R1CA 3O4LB 3R18A 3FHQA 3KPSB 4FFYA 3U4EB 1SJEA 1RZ7H 4LNVA 3S5LB 4JANB 4ODXB 5EF0A 3BAWA 1L0QA 3GZKA 4L8SC 1GGBH 5CCGE 4H26A 3NEOA 3KPSA 4ZUVA 1LMIA 3APCA 5EEYA 4WTQA 4LSUL 4N24A 5DJ0A 5JHDE 3L7EA 4IKIA 2CHWA 5CUSL 4MMZC 3SCMD 2A7BA 4YHYB 5DD0L 5KBNC 1MSPA 3IDIB 5D72L 4P23A 5FHBH 5C08D 2YRLA 1JPFA 1P4IL 2KZKA 1VPOL 2Z7ZA 1GSKA 4WFFD 3PABB 1CQYA 4MA3A 3UADA 1MREL 3G5VB 1VFUA 4JN1H 1LDPL 1OARH 4XMPH 3BUTA 1QW8A 4XC3H 5LBSA 2Q3XA 4MAYC 5CWSB 4A37A 1USQA 3IFPB 4YPGA 4GP8B 2AJ3A 4HIQA 3B3IB 3LQZB 2AXFA 4TM9A 4AT6A 5SWQA 3VSQA 2QLVB 3VXSD 4MLSA 4XXWA 3IJHB 3MRLA 5EU6D 4BZ2H 3NT0A 5EBGA 1HHJB 4GUOA 5C0DA 1MNUL 3NOIA 5ABAA 1NLDL 5DD3L 4FD0A 4LIQE 4CJ1A 2RJMA 5BZDB 3SKOA 4LOEA 4TMPA 3RHWK 2UZPA 5GJTL 5FF6B 3FO0L 1UD2A 4ZUSB 3ZDXB 1KYFA 5CBEB 4WUUD 2VR9A 3VXTB 2EDKA 4DKFL 3L9BA 2YSSA 5I19H 2ZG2A 3NCMA 4Y4FB 2R8SL 4JDZA 2GSGA 2P5PA 4G6KL 4PD4J 4J2QA 1WC7B 1T2QL 2YC1A 1G7JB 1XSOA 2B0SL 5ANHA 5JIHA 2IOOA 4WI8A 4I0PD 3ZT6A 1C7TA 1KBPA 1L0PA 2ENYA 2XZZA 3SKNA 5CKAA 3S96A 2JKIS 5B4MC 2E0PA 5CD3A 4DKDC 8PAZA 2OP4H 4UOW1 3PU7A 5D7SH 5KG9B 4Y5YA 4LHJB 3FONB 3QFGA 3J07A 2ISDA 1G7LA 2KQNA 1VFAA 2A99A 3HE6C 3L5HA 5HJGA 4RA0C 1C5DB 1U2CA 3QG6A 1E4HA 1MWAA 2BZCA 4FGMA 2MOVA 1CXFA 1PZ5B 1BZ9A 3L9YA 2ZUWA 4OB5L 4NUGL 3MRKA 1VFAB 1AS6A 5AKRA 4P46B 1BX2B 2NTSP 2IG2H 2JELH 1REIA 4R96A 2GIMA 3O8XD 3V6OA 3GBNL 1HESA 1EHNA 3IMBA 2FLRT 4OFKA 2OMBA 3ARTA 2H32A 2V2TA 5IHUH 2EXWD 3T6WA 3QWNA 1V27A 4JRYA 3UTSE 3ZL2A 4AQEB 1MCPL 5ICZA 2AI0H 1S8DA 2W65A 2VDQH 3LS5H 1F6AB 5DS8B 1IC7L 2DI7A 3IDNA 5FS5A 2JQAA 1UXWA 2V3FA 1KB5H 2QVIA 1W6LA 3GUFA 3ULVD 1YMHA 1ZANH 4XXCA 3LZLA 4FQIL 4JY5H 4LSRH 3EDJA 2ARJQ 3D39B 4W9DC