4ZZFA

Crystal structure of truncated flgd (tetragonal form) from the human pathogen helicobacter pylori
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
146
structure length
146
Chain Sequence
b'NSVSMIGKIAETDVSGANFDGNNKLSFSLFFDEKIDASKGVPAIQILNENNELVKTIPLKDYNGQKGYINFEWDGTNEKGEKVPKGNYKIKAEYNLDSHSKQYLQTRIGRGEVESVIFDKGKPMLRMGEMVLPIDSAIEFYQPDQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar basal body rod modification protein
molecule tags Motor protein
source organism Helicobacter pylori 26695
publication title Crystal structure of truncated FlgD from the human pathogen Helicobacter pylori.
pubmed doi rcsb
total genus 32
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4zzfA02
4ZZFA 3OSVA 4ZZKA 3C12A 5K5YA
chains in the Genus database with same CATH superfamily
2H8PB 4GT7A 5I6PA 4GQPH 3TFKC 1OCWH 5IW3A 5T33L 4OF5A 2WIIA 4ZFGH 2AJ3B 1QATA 5ESAB 4LARH 3O8XA 4WVRA 1HTYA 3NCFB 1JDCA 1CLCA 2B16A 3G5XA 3KPOA 4NQDE 4P59L 4TSBL 4HG4J 1OT4A 2HLFC 5MENB 1AQKH 1QFHA 2ZAHA 1MAML 4HIHA 1KJ2B 4TUOA 2W8CA 4PQXA 4X6EA 5F7AA 1FZOA 2Q3XA 4KZ0A 2WCPA 3QUYA 3HG4A 1MCSA 1MY5A 1DBBL 3E3QC 4NUGL 1WA0X 1WA2X 4X99B 3RIFK 4HGKC 1D5IL 1RZJC 4R9HA 1H6TA 3N6YA 4KKZA 1BZQK 3TO4C 2W1NA 5DGQA 4WNJA 2FD6H 4A68A 2ZSWA 4PREA 2ED7A 5AUMA 3QCVH 3WIFA 3V4PB 1IT9L 4AV4A 2CCVA 3REWB 3PQYB 4B9ZA 1XFPA 4HUWA 4EIUA 5I1AB 3CFCL 4HX1A 1ES0A 2BNRA 3Q2NA 4J3VA 1MCPL 1RP8A 2P9RA 4S1DC 3EDFA 5KAQF 5A43C 4X6DA 5T1DH 2CSPA 4EDWL 5IKCA 1V3MA 2X9WA 3PAUA 4RFOH 4KHTH 4WSJA 4OZGA 5E56A 3GJFB 4QR7A 4R7LA 3MDJA 4UQCA 1Z9LA 5H2BA 3UYOD 3FCUB 3T4YA 4BWTA 5D6CB 2OMXA 2QL1A 3TH2T 4HFUL 4HCRH 1MVUB 1TITA 3C8DA 2E9WA 4IBTA 4MSWB 3CFQA 1VGKA 4C4KT 1P1VA 3T0EA 3DHJA 3FL7A 4EN3C 1DLHA 5IHLB 4RGNC 2UYLB 2OMNA 3VI3E 2VDRH 3MRQB 3MSPA 3GSQB 1LO2H 2GTQA 3DV4B 3CVBA 5E23A 2YAFA 5A6LA 5HYQB 1KGCE 5LKNA 4OLZH 2EXTA 1PJWA 3PWJA 1G1OA 1A9EA 3DOSA 1XF1A 1DBKH 1X7SA 2WXOA 3GZPA 4NPJA 4Z7VF 2NY0B 3QJUB 4MB4A 2HRLA 3VXTA 3ZSTA 3X1BA 4D0BA 3SE3A 2F58H 3LNIA 4NWTH 2D03L 3ZZLA 4FNPA 3GLAA 1JNNL 4LLVA 4PG2A 3MJ7A 5GIRA 1ETZB 2Q0ZX 3MJ9H 4KNTA 3IU3B 1OP3K 3QO1B 2AJXL 3UERA 5IG7A 5DFAA 3DRQA 4YK4C 3VFPB 3P4MA 3GM8A 4AIZA 3OKKB 1T04B 2ATKA 2I24N 4JZJA 5DHYA 4G71B 3FHAA 5KSAD 1QO3B 2NYYD 3I3BA 5B1JA 2E27L 4NENB 2X4SA 1LWRA 5FS5A 5AKSA 2OXGA 4YZWA 1KN2H 1Z6JT 4TVUA 3MKGA 5J4MA 1S78D 1JD9A 3MLWL 1P4BH 1C5BH 3T8VA 5DK2B 1SJXA 2DPKA 2IANB 4ODWA 4LQ1A 4NC1C 1JGDA 4N0CD 4Q14A 1UOLA 3GSUB 1YEHH 2HFFB 2ZP0T 1UUNA 5I1KH 1QSFE 4MCYB 4FA7B 3TNMA 4NX0A 1KN4L 1TJGH 3UX9B 4Z7QB 4CRPA 2OLDA 5AKRA 2FNWA 5LGKA 2XTJE 2AJUL 5DVOA 3WYRA 3D09A 3PL6A 4WUUB 1FZMB 3VXUA 4B9CA 3A22A 4O02A 2M2DA 5F0LB 1NLDL 1M4KA 1R3IH 2DQTL 3NABL 3SGKC 2DICA 2PWGA 5CJQH 4BQ9A 1X5LA 2P48B 5IFAH 3U0WL 4CN4A 1LILA 4CJ1A 1I1YB 5AB2A 3X14B 2UZYA 1BVKA 3OD3A 3UIZA 4S1SL 1RJZA 2Z93A 2F7PA 4DZBA 1KBWA 2EEFA 2JXMB 4HKBA 4K9EL 5CHNA 3BDBA 1AQ8A 4TV3A 4DGVH 5DD1H 1A4KB 1AIZA 2WQXA 4K73A 1UFGA 1G84A 1EZLA 1E5BA 1OAZH 1P5VA 4R7NA 1BVZA 1AGBB 2TSBA 3S4SG 2DJSA 4YSEA 4CMHB 1INDH 2QELA 3DYOA 4JAMA 4NBZB 5I5JA 1ET5A 3GSXB 2BS8A 1ULVA 4AMKL 2V7NB 2FLRT 2X6VA 4XBGA 2VIRA 1E40A 3G5ZA 3NJVA 4ZOEA 3KWTA 3ZL2A 4MKTA 4M6MH 3ARRA 2YWYA 5TE6L 3MGOB 3OBAA 4WI2A 4XN7A 4R90H 3GHBH 2IPTL 5HDRA 1E5UI 2GC7C 25C8L 2DQDH 5DHDA 4J4PC 1LD9A 3RVWD 8FABA 1ECZA 4F15B 4LEXL 4YK4B 1UJ3A 4LCWD 1JDAA 5HGBB 4KBPA 1QTSA 4HS6B 4P2RD 4XP6H 4P5MB 4XN5A 4RAUA 4L8SA 1NCTA 2Q76A 5EO1A 1NAKL 4ZD3H 1NFDF 1C12A 1JSYA 3W57A 4GJTB 4ZMPA 7PCYA 4NQEE 2XKNA 1A6TA 4OGZA 3KPMB 1L0YA 1KC5L 2AABL 4GEIA 3Q06A 2KZKA 2JTYA 3MAWA 3GT6A 5EEWA 3CSTA 1MFVA 4NO0D 2R23B 1ACYL 1G4MA 3QXAB 4M02A 4OVUA 4O58L 5D4HA 5EN2A 1QA9B 2D9QB 5KVGH 3CTTA 2W0KA 3KPNB 1P6WA 4DUWA 3US0A 4RNRB 4ABWA 4NRXA 5H4ZA 4WI3A 4O2FA 4U1IB 1JPFA 3FUDA 1BFOA 4NFDA 5CEXA 4ZX5A 2X4RB 1DZ0A 5DZVA 4QF1A 5DR5L 3VGEA 3DHUA 1KUMA 3C60D 4N0RA 4ANUA 4ESKA 2WWKO 1OK8A 1KC5H 4NQED 4DEUA 1YY8A 1OWRM 5C0JA 1ETA1 2XBDA 3BP4A 3R8BB 1IGYB 2FL5B 2R2EA 4J1UA 3N9GH 2JI1A 3K0YA 1XCTA 4M3JA 5E9AA 5FXCH 4MNGB 3TCXA 3REVA 1FL6B 2W0LA 4L8CA 1AGFA 1P4LB 2P80D 2X4PB 2BFGA 2EYSA 2J1XA 3VRLE 3IAGC 3KPSB 4OFYD 3X13A 1YAIA 5D1XE 2EINB 3OZ9H 4JQVA 2OM5A 4ZOBA 2FHFA 3MGOA 1O6SB 5HHXH 3CK0H 2X2YA 4M29A 2WZPA 2OYMA 2W80C 3NVQA 4I1PA 5I18L 1BM7A 5D71L 1M2VB 3WEBA 3C5JB 3JWNE 1EH9A 5B3JF 4I1RA 1JGUH 4GQRA 1QYGL 1DQDH 1E9OB 2LTQC 3F7VA 1P5UB 4BJLA 5D70L 4CA4A 2B2XL 1U8PB 2QQLL 4PU2A 4ADGA 3VFGH 2ITCA 3WN5A 3L5XL 4V11A 3IU4H 2BWDA 3CDFA 3CC5B 3KPMA 4MYWB 1VFAA 5ALCL 1CYXA 2CXGA 5KBKA 2H6PA 3BP7B 2FX8L 4PJAE 4JQIH 4EO5A 1NUGA 1AR1C 1JAEA 2FSEA 4XNMB 3KJ4C 5D2NB 5DZJA 1PX3A 3QFJD 3V8CA 3TWCH 1RZ8A 2NX5E 4F7PB 4L8SC 2X89D 1GYCA 5IVXF 1GC1C 4F37F 5I76B 4Q2ZA 3TF4A 3MYJB 4PTTA 1NBQA 1AH1A 5EBGA 4WEUD 2G3MA 3UTTD 5JPMC 4UCFA 2F6AA 5ESVA 5T3ZD 4YSTA 1H6EA 1JV5B 1YY8B 5IR1A 4GQ9H 3HHSA 2GFBA 3IRZA 1T4WA 1EUUA 2O61A 5I73C 4Z7UE 5E0FA 1CDCA 1E28A 3H0TA 1GIGL 4WTZA 4XH2A 4HV8B 4MVBD 1ITBB 3TBSB 2GEEA 4TNGA 1JTTA 2BJML 4NQDD 2XQBH 1CICA 3NJJA 2VXUH 1WA1X 1VEOA 2QLYA 3LEXB 3T0AA 2ZUUA 2QGEA 2QV2A 3O4OB 2JELH 1JXKA 4S1RH 2KMWA 3O4LE 3QIWA 5FUZL 2CLZA 1BA9A 3DPDA 5TQ2L 5GJSL 4Y5VC 1CLZL 1K2DB 3SYQA 3C12A 3SDDD 5JO5B 4ZXBD 5T5FA 1MY7A 4YE4L 4UQ9A 4F1SA 4N5EC 1XZ0B 4HOXA 4JN1H 4JQVC 3MCYA 4Y2NA 1MFAH 2DWYA 3KLKA 1WK0A 2VLKE 2CAKA 3BSZA 1JZ6A 4L0ZA 4BDVA 4WFGD 4JY5H 4XXWA 5C08B 3EJZD 3SN6N 1MH5A 3QQ4A 2K6YA 4P2QA 3T6ZA 5DK2A 3OJDB 1IARB 2WK2A 5FO8A 5I19L 2IMMA 4U4IA 2C9XA 4ZMVA 1NIDA 5C0FA 3LKQA 5HHNB 1EDHA 1AZVA 3TNMB 4RRPG 5DK0A 4OCMC 3TNNB 2R2CA 2F54D 3L5WA 5BUPA 3PJSA 3QI9D 4MS8D 3P69A 5ICYA 4M7ZB 2WLJA 1JBJA 2WBJA 1JGVH 4WWOA 2B4CH 2X1PA 3ARGC 1MJJA 2UY6B 2VO5A 4JFPB 2R4SH 2NY1B 3HZ3A 5LWYH 4OKVA 5D1ZI 1JHTA 1IC0A 1TCRB 3CD4A 4JRYB 1Z2KA 1RJLA 1CZ8L 1IKOP 3LKPA 4GRLC 3DHPA 2VZSA 2ZWYA 4EBQL 4BKLB 1T66C 5BPPA 3T6VA 5B4MD 1SN5A 4BXVA 1RJYA 2QT6A 3PAVA 2CK0L 2DH2A 4TN9A 5JPMA 4C8XA 1MFEH 2YQ2A 4Y1TA 3A4FA 1UACH 2BDNH 1IBZA 2YD9A 4I0PD 3X1GA 2HKHH 3LS5L 5E5MB 2X9ZA 1MCOL 2V6HA 2CO7B 4L3AA 5KSVB 5A7EA 4TUKH 3K6DA 1CMOA 4PP1D 3C5XA 3PP3K 3FO9B 4MTMA 5DT1H 1EZVY 4JL2A 2CGZA 5HJBA 2BHFA 3P73B 4MJ5A 4UIKL 1PX4A 2ZYRA 3K5RA 3MBEB 3FQXA 3PPEA 1YN7B 1BHGA 3WMQA 4A2HA 1RUKH 3L95A 1UUSA 1GZQA 3BUPA 5HYJA 2HLFD 4HBCL 3S5ZA 3U1SL 1A5FL 1OALA 4F2MB 2P3YA 4MJIB 4DVBB 1SQMA 5AALA 1K5NA 3CVDA 3U9PH 4WHCA 4U6YB 3BGMA 2XKUA 1MI5B 2X1WL 3T0XA 4TNWF 3PWLA 3D30A 1N6QH 4XZ4A 4IIQB 3S5LB 3WE6A 4P5MA 3JWOC 4ACTA 5KOVC 3KVQA 3OLIA 2BINA 1TQVA 4G6KH 1NBYA 3BPOB 2QSVA 1ZXKA 2WYHA 1FYTA 3FTZA 1AP2A 4QTIL 2W0PA 3FTWA 3HPJA 3I50L 3KGTA 4ERSL 4R96A 3V2AR 4IGBB 4OKDA 2MCPH 2X2JA 3C5ZB 4L4JA 2RGSA 4BINA 5JDJA 5AW2B 2R1YA 2OW6A 2VM4A 5DMIH 1F90L 1J1PL 1VEMA 5GGRY 2ZICA 3L45A 7FABL 3GRWH 2ESVB 2FQGA 4MDJB 2PYEE 3RTQB 2ORBH 3WMPA 1HIMH 2MNUA 2OXHA 3ARBC 3QCUH 1S9VA 3DGDA 5EU3A 2QSTA 3F6LA 3VE0A 1GVIA 1TZAA 1E7VA 2DQEH 3VXQA 2WW8A 4YXKH 3H4FA 4YFEA 1OP4A 2F58L 3NJKA 1S9WA 5LGJA 1UWXK 4DN3H 5HXMA 3TZVB 2WCGA 5AB9A 3ARGA 3E1F1 4LSRL 1NPUA 5ILTL 3UYPA 3R0NA 1EEYB 3FT2A 4XBPA 3GXPA 4F1ZA 5A2JH 3E8UL 1E6JL 1S6NA 2CALA 3N0PB 1VLXA 3TA3D 1FG9C 5DVKA 3WJMB 2ZOUA 2UV3A 3EH5B 2Y5TA 1Z66A 3ZIMA 1NDGB 4QT5A 5ADPL 1WIOA 3IDGA 5GSRA 4AV0A 4M4RB 5L88H 1GHFH 5IB5A 3CHXA 4TQEL 4DSYA 3NZHL 5IWLA 4ZSOE 4KFMA 4OB5H 5DF0A 5FUZH 4A7GF 1AGDB 2YUWA 2VQTA 1EJFA 4H8WC 1CC3A 1H0DB 1HXYB 5ECJE 2R83A 3UZEA 1AS8A 2VZOA 2X6BA 4HUWB 3VWKB 5I1AA 2NUPB 4QRFA 1JGEB 1Z3RA 2IXQB 4FA6A 3RVXC 3RJDA 3RGBA 1IFHL 4KJQD 2EJ1A 4DW2L 5ERWA 2BOBA 3VH8G 3U6RB 4PJBB 3HE7C 2Y7QB 2VDPL 5AQ0A 2WKOA 4XPBH 4N0UA 2D3LA 2W60A 7PAZA 3H9SE 5KEZA 5CR8A 5CJ8A 1SDAB 5LGHL 2OTWA 1KYOK 1MCIA 2LGNA 3RDJA 2OMXB 3DARA 2YD5A 3MBEC 4PRNA 1XF3A 3MX0B 4YBQC 5INDA 1TZGH 1JZ5A 2HZHA 2DOCA 3HZKB 5CMAA 3HN5A 2WXHA 5KYWA 4JB9H 1VFUA 1FNEB 5CIPB 4PRIE 1LP9F 1DYZA 3RU8H 4JDZA 5I24A 2DY2A 5SX4I 2FEDC 4YPJA 2EAEA 4F33B 4UILL 2YA0A 3CAFA 1WF5A 4TQ8A 1I7ZB 3VJ6B 1USZA 1MW1A 1G0DA 4UU9B 4YPGA 1UQSB 3D25B 3JZ7A 3J07A 4QHNA 1KEGL 1KIPA 2XNAB 3LIUA 3SDDA 2A77L 3QO0B 1PL3A 2VNCA 2XXGA 2DTSA 3S8FB 1FI8C 4CSPA 3T2OA 1OT2A 3VFPA 1D5BB 3VD3A 3NCCB 1NMCB 4P5TD 4CU7A 3ULVH 2R56L 1F00I 4QHKI 4KVNH 4HGWB 2ZPKL 1S7WA 3JV0A 3QS3A 5F8QC 3KW7A 5LBSL 1FVCB 3MQIA 1UEYA 3ILQD 4QHLA 1KV7A 3SD5A 3NCYP 3DO7A 5JHAA 1WQVT 5EO0B 1RERA 2VABB 3O3EA 5DEJA 4PB9L 4APQA 1QSVA 1G7HA 2F2HA 2Z91B 3H2PA 4X80L 2WN2A 3P30L 4IDJH 3VRIA 2XETA 3IVKA 2R69H 4KKPA 3RY4A 4JRFA 1RURH 4HCFA 1GJIA 4A04A 3E80A 1CXHA 3ULVD 2Z34A 3L5WB 1MWAB 3M07A 2NY6D 3P9MB 3M17A 3UTQB 1MRDH 4ZZFA 2AK4A 3O4OC 1E4KA 4K71B 3BW9A 4ZOCA 4N2CA 1MPAH 4UT7L 2JKTM 3L81A 3UXFA 2H26B 5D5MB 4TQPA 5CILH 5FB8B 4DERA 1CFQA 2L7JA 4XBEH 6FABH 2JXMA 1J8HE 2J1KA 1XB6A 3EJPA 4GAYA 1JNHA 5F7MC 3S37L 4L05A 4BQBA 4EIZC 5BW7C 3F05A 2ZCKL 3IJHA 2F7OA 3T09A 5EBLB 4HD5A 1DN2A 3OXSA 3O6ML 1IAIM 1RZ7L 4HCRL 3B5TA 5FWRA 5DURD 3AABA 3TBVA 2Q5BA 1CF8H 3ZN6A 1ACCA 1MVUA 2DTML 4AW4A 4P3DB 2R0WL 3D0VB 3E7JA 3C9NA 2P24A 5E51A 5MP6H 1PSKH 1RLBA 1JERA 2GHWB 4IBLT 5AVWB 1AS7A 1XH1A 2ZSVA 5I5RA 4Q4IA 5DZOA 5D5MF 4YGAB 1QR1B 4YO0B 5AVXB 4JM2F 3IDJB 1GC1L 1T21A 5F6HJ 3V6OE 2ATAA 2IALA 3S96B 2Z31B 4MS6A 3KLHD 1XF5A 3OAWA 5DUMH 4NEHB 3ETBF 2W07B 5IHUL 2DWEA 2V7HB 5BNXD 2BHUA 3REWA 4BZ1A 4PD4J 1MJUH 1YNTA 4D8OA 1NOFA 3ZZ1A 2KH2B 4Y7MA 1K72A 1FH5H 4KKAD 2F1EA 3HMXL 3LXAA 4FJYA 3INUL 4E5XB 3ZO0A 1ET8A 1QASA 3P4MB 3WKMH 3D48R 2ADIA 4UQ2A 5JHDE 2GPZA 2OMUA 4G6ML 5DO2C 2XCMC 5GISL 4HMEA 1YJDC 4AYMC 5JW4Q 1MXGA 5E1AB 1MZZA 4GUQA 3I9IA 5HTSA 1HSBA 1YEJL 3X3FL 4K15A 3OKMB 2APVA 2XJLA 2R0WH 4YDJB 2YKLL 1FL5A 4IJ3C 1M6OB 5I1KL 1MWOA 1M6UA 4JMXA 3UTZA 5CP3A 3FOLA 5TGBA 2DYSB 4KXDA 5IQ7H 5LUMA 3VVWA 2P5WD 3TIDA 3PF2A 1QFUH 1WFUA 3ULVE 2WGXA 1QLRA 3WUWB 2LVEA 3AS2A 3G6JB 5IJKC 2FAUA 4LIQE 1CBJA 3QDGD 1KPVB 3F7LA 5A2KH 4U3SA 2X4TA 1HXKA 4JG1H 1PG7W 5IBUG 3E0GA 1OWWA 4NO3A 1YYLH 5BW7A 2F19L 4W6YB 4HUUA 1AGEA 3SDAB 2CR3A 3WKPA 2YR3A 2EYTB 4OM1H 1HCYA 1LLAA 1HH6A 3FMGH 3V5DB 4ELME 3LN4A 2GSIB 3KM2A 3VSUA 4AE0A 4AKQA 1F8TL 5DVLA 5C0IB 4XI5D 4ZUSB 3F7VB 2J8UE 3OZLA 4KZEH 4Y16A 4NUJB 4PWFA 4I0PC 2E7BA 3NCBB 4HLEA 3H3PH 3SB3A 4AUJA 3FO1A 3NUKA 1VFAB 4ES8A 3B2MA 1R24A 1FAIH 2VN7A 4Z7QF 5FYJH 3WKNA 5GGRA 3GRWL 2EQDA 2HJKA 1KIRB 2ORBL 3QQ3B 3Q2LA 3RVTC 2IPTH 3TZVC 4DGYL 5KSUB 3OGCB 2FVNA 2Q7NA 4H88H 3WNLA 4ETYA 3VQLA 4UQ3B 4P4RA 2IAAC 1IJNA 1PU0A 3KLSA 1U58A 1XCWA 3BKCH 4M1GL 4NNYB 2C1OA 1SZNA 4JLRB 4U33A 3MRPB 5T3ZL 3KJ6L 3G5YA 2JCCA 2AMGA 4QXUH 5BXFA 3O8XB 3VXPB 2DQJL 4JFFB 2NY5L 4KVPA 2X10A 3G5XB 2GFBB 4X0KA 5FR3A 5IR1B 2RIKA 2B3IA 4KRLB 5E8DL 4YSAA 2PP8A 2ZOLA 3TCTA 1R46A 3VXSE 2JKIS 1I9EA 2H0FA 4LVNB 5EOTA 5KJ4A 4B7LA 4K9EC 1BQSA 1OCCB 4J27A 4QHMA 3P3SA 5SX5H 2FIKA 3EOBA 3I75B 1UM6H 3BGFB 1CG9B 2VR5A 3V4UL 1N19A 2AK4D 2DQCH 4CW1A 3QHZL 3SDCD 3FQNB 3L3HA 4HK3N 1YQVH 3NSCA 4KHXL 2OMVB 3DC0A 2ZOTA 5B1BB 5DO2D 4FEIA 2QKIC 3C2AL 1OSYA 4PJHF 4ZUSA 3B2XA 4QXGL 4Y2DD 2FQEA 2MPVA 4LRIA 2J4WH 3MXWL 1S3RA 3U83A 4UIMB 4ALAL 1QPKA 4CC4A 4OLXL 1KB3A 3LH2H 4YSOA 5FKPB 4H5SB 2IPKB 2F7IA 4N2DA 1JUFA 2WSDA 5FKAA 4M7JL 2MOQA 1YEWA 2G5BA 1G6RH 4A7GA 4Y2DA 4KKQA 2Q76B 1FAIL 4PGEA 1ND0B 2QADC 2JIXA 4YHNA 5HGDA 4G7YL 4IRZL 3VG9C 1E7UA 1AZNA 3ZYZA 5IEHA 3ARTA 1SM3H 5FECA 4EZMA 3HZYB 4S2SA 2XVGA 4HIXL 3KNBB 5BZZA 3VI4A 1T0MA 2CDEA 2VL5B 2W0FA 3EOAA 5D4IA 5FW7A 1WCBA 1F2XK 1EHKB 2GJRA 1NSNL 8CGTA 5K59F 3TFKD 1DHKA 4DESA 4F2EA 4MJ6A 3VCLA 5AZEH 4AEHL 1PTZA 2BVQA 4OZFB 1IGYA 1QO3A 2X87A 2Y24A 3UMNA 4KO7A 4AWJC 2MJWA 3CSBA 4OGXL 3V9CA 2MQ0A 1AGCA 3O2DL 5E8EB 1IZJA 3DPBB 4OTXL 3ABZA 4FTVE 2JCCE 2JF1A 4ZFOB 4MASA 2CDFB 1KT2B 1EEZA 1XH3B 1GGBL 4QLWA 1O5PA 3ZY7A 3O41B 2CHDA 3T6QC 2ZXBA 1WFTA 3HC4L 4XVSL 4FZ8L 4O9HH 4NS0A 5E6ID 1TTGA 5JA9A 2Y2WA 5ITBL 2CO7A 3DRQB 1JWMB 2Y5EA 2BHYA 2PP7A 4MX7B 3V95A 2O5YH 3UZQB 1ORQA 2BP8A 3MR9B 4B53A 3E6HB 4F5CE 1BD2E 1N2RA 4R8WH 1B9KA 4O5LH 3UTPD 4CVXB 4OV5A 4WJ5B 4GS7B 3KGSA 3OB8A 4M6ML 4PJ5D 5BO0D 4MZ3A 3LRKA 1BQUA 1I53A 3K4ZA 4N5ED 5L2KD 1T5WB 1TJHL 2AQTA 3GHBL 3EXJA 3DROB 4QXGH 3CN3A 1UH4A 2X4OA 4PJ9D 1Z3GH 5KVEL 3BZFB 3VSVA 4W9LC 5CWSB 2G2NA 4O9HL 3U2SA 5IGXL 3WTTA 3MNMA 3TN0B 1J10A 1BSIA 5EU6D 4Z7OE 3ISRA 4PTTB 6PAZA 5ISZB 5L2KA 4FHBD 1F1GA 4LHJB 1YNLH 4FQIH 1DVFA 4QYOA 4F8TA 4DWHA 3LDBB 1K5WA 1SOSA 1H6UA 1ZT1A 3EJYD 4LRIC 4QLRA 3VRLF 1YMMA 4NM8H 3OKLB 4KQ4H 4DKAA 4OZIB 2WXQA 4CC4C 4WTQA 2V7NA 4UTAA 3RB5A 3I02A 5I73B 2EE9A 5TDOB 1E3FA 2XKSA 4HJJH 4AK2A 4U6VL 5D72H 3T4AA 4ZT1A 3LS4H 4F8PA 3B56A 4M3HA 4AYBA 5DMKB 4NHCL 4F9PC 4O58H 2GJJA 1KV3A 1MW2A 1QQDB 3JV5A 4K7PL 2B9AA 4Q74A 1DEDA 4ODTH 2Y06H 4P5SA 5E8EA 4UM8A 1CWVA 4TSBH 4AJYV 3F6IA 4L4TE 1PAZA 4NUMA 3QFDA 3KYKH 5EO1B 3QDGA 4AEIH 4MBOA 5IQMA 3CHQA 4X6BA 3TA3B 5DJDA 3ETSA 3FZUC 2VSDA 3Q1SH 3OC8A 3RVUD 1LQSR 2OR9L 1TJXA 2W91A 1ODUA 2A0LC 2NNXA 3ALPA 3DUSB 3KJ4B 5D2NC 1WAAE 1NBVH 4MVBC 1KJVB 1L9PA 2FH6A 4BK5C 4LMQE 5INCA 2IF7A 1MG3C 3VI4E 1HXMA 4N0YL 4JPIB 3BVNB 3FF8A 3BT0A 4NQVA 4IOIB 4R84A 4J6RH 4XXDB 4AYDC 2YPLB 1PZ2A 3HJEA 3H7LA 1KTLA 4FMVA 3LVEA 4NSKA 3RGVD 4CGUB 4UQAA 2C9UA 5F1IB 3NJHA 3U25A 3ZU8A 2GJ6E 2NX5D 3DGCR 1DUYB 2BCKA 1T7WA 1IC5L 1NGYB 4PY8I 2HKAA 4FXKA 4PRDB 1QW8A 1V3LA 2KBGA 2UVEA 4J3OC 2AJSH 2K1MA 1LEGA 1B6DA 2ICCA 2WO4A 4I9WD 1IVTA 2VLRD 3DKHA 2BOBB 1UKTA 2KPWA 1K85A 1J0KA 2HJKB 4WFHD 3EHBC 2R69A 4TQHA 1AJ7H 2Y2YA 2HJLA 3KYNA 4LRNL 3UH8A 1MEXL 5D96B 2N1KA 5KAQG 3IE9A 2Y2TA 2VDRL 4PI0A 5KJRH 1ACYH 1NINA 3QIBD 1NGWA 1CFNB 2NY4B 3M86A 4LCYB 5TFSH 3RTQD 2OFQA 1RUPH 1I9RL 1G1KA 4JFHD 4K7FB 3AQXA 3N40F 3T2NH 2CIIB 3QEUA 5D7KD 1MHEB 1URZA 3N50A 3BKCL 1N9PA 2X1OA 3VNZA 2X89A 4BIKA 4DEWA 3O6MH 3BOVA 1S7VB 1II4E 3TVMB 2SEBB 3RUGE 3BPCB 3IJYB 5C0AB 4B9GA 1P4BL 3MOBL 1LTXA 2MCMA 1B4TA 4OTXH 4ZS7L 3TYFB 4PJGF 5IFJA 5TE6H 3KBPA 3TU6A 1QUNA 2IH8A 2UXTA 4LSPH 3TBWB 4PJCB 4RZCB 4MB1A 1GY2A 2YQBA 1WITA 5IVZB 2F53B 4H8PA 4JB9L 5E5MA 3IJ8A 4KZEL 3BVVA 4MDRA 5F0JB 4MXVF 2PR4L 3O0RL 3DNKA 5HHOB 3BWSA 1T2QH 4XHQA 5IMKA 5IROC 5E99H 4BK5A 1F3DH 1F4AA 4O2EB 4FAAB 5L4IA 1ZJAA 4IK6A 4U1JB 3S3DB 3IDIA 4HW6A 1TMCB 4I3SL 5IV2A 1CICD 4KKBD 4XTRC 4I18A 1THAA 2ZIDA 4AG4H 4NQTA 3UBXA 4X9BA 5C0ND 4KQ0A 5C0EB 4DTGH 5AFAA 4P46C 2XWTA 3QZMA 1NGPH 2Z8SA 3I6LE 4ALAH 2Z7UA 2FK9A 3NZSA 1TXKA 2CO4A 3ULVL 3VXNB 2JIXB 3EJCA 5IZ7A 1DQJB 4ORGB 4TVPD 1MCKA 2XTSA 3GB7A 4PJ6A 2CPCA 2D7TL 3FSWA 5LBVA 5T1LD 3Q3GB 3FQ1A 3VXMD 1PZ5B 3PIQA 3ZYOA 4F3FB 2QSCL 3AJ7A 5KJRL 1E3ZA 3MI6A 2K0RA 1BLNB 4JMNA 5IMOB 2CIIA 4GRWB 3K2MC 3CLEH 2NTSP 4Y19B 4S11A 2YLHA 4IRJD 3TLRA 3DVNB 4ONOA 1H3WM 3CFKB 1BFTA 2FCBA 2FSDA 1X7TA 5D1ZC 1V7ML 1NCCL 5G5DA 4B96A 2E56A 3M88A 5DTFB 2OK0L 2N01B 4FMKA 2WXKA 3K80A 4JHVA 4TLKA 4Z95H 4U05A 3NACL 4YIQB 3WTSA 3P0YH 4YFLF 2IMNA 1UACL 1DE4A 1WAAF 2VKXA 2VSKB 3BJ91 4LAQL 5JMOC 1FZMA 3VXUB 3T1WA 2FWSA 3KCPA 3SBWC 3UADA 1KEMH 3V0VB 1M57B 2A2QT 1QTPA 2DWTA 1ZHBB 5CLXA 4LEOB 4KROB 3SSGA 3MJ8B 1YYCA 4WUUE 4WK2B 3ZUCA 3L4XA 4JFOB 4NP4H 3QNXA 4RQQA 5I30H 3M1CA 3HMXA 4QOKB 1RHFA 5G4NA 4WI7A 1IGMH 1ASPA 4D9RD 1JF1A 5DUPL 3E8VA 5CGYD 3INOA 3D5OF 4CMHC 1T21B 1MELA 3HR5A 2UX7A 2Q7AA 3QULA 3MV9A 2A4ZA 3PHQB 1ORSA 4LL4A 1HAWA 2R29A 2ZUQC 2OTWB 3ZW3A 1T1XA 2AANA 1S7QB 1EXUB 3QRFM 4AGPA 1HWWA 5D1ZB 1MXDA 2BERA 4HSQA 2PTTA 2YSTA 3NJNA 3C6LB 4G6KL 2VQ1A 4WV1A 4JFFE 3RAJL 2E59A 2WKGA 4NERA 2EIEA 2MPAL 1ZIBA 3LKOB 2CUAA 1PY0A 1X5JA 3QPQD 3OAUL 3QXVA 1Y18A 4H7VA 4WFFE 3KLQA 3EYOA 2ZXQA 3HAEG 2W60B 4MQSB 1T3FA 2EDJA 3NH7L 2A38A 5D4QA 5IBLC 2WLLB 3QIBC 3BUYB 4OLVH 3TONA 4G80A 4CBPA 5FLUA 3UTSA 5T1DL 1SXZA 1JMXA 5AUMB 3PWLB 4X6CB 4N0FA 4J6IA 2OR8A 1RPUA 2B08A 2IQ9H 4KZDL 3BAXA 2Z92A 3LN9A 3MLTB 5I82A 2DQEL 4KDVA 4I77H 3QXTA 4K23H 3NJXA 1IGFH 3L5HA 3QYNA 4P57B 4LNRA 2NXZD 1AD0B 4PD4K 5D7LB 3CWGA 3RIKA 2WLMA 4AEFA 4AL8C 4ZS7H 2AHIA 1I7ZA 3VJ6A 2C9RA 4EZLA 5L4MA 5FYJE 5H2BB 1DUZA 4N26A 5EU5B 3L3KB 1LGVA 2DMBA 4P2QE 4JFOA 4M62L 4KXZI 3C08H 4RDQF 3QEQD 1ZTXL 5H94B 4RAUB 3WIHL 1SJHA 1JZ3A 3OF6A 4U4BA 1SEQH 2OXHB 1MNUH 5GZND 4A1RA 4HPYL 2VDNL 4YDLB 1WV7T 5J11B 3ZDZE 4FDWA 4IBWA 4WI8A 1UADC 2V17L 3RUGB 1ZANH 2IG2H 2D9CA 3BWZA 3S36L 1ZLVH 3JT2A 5CZXC 5FO9A 5CKGA 4LCIH 1YNTF 2YGNA 4AITA 2ZF8A 1NCAL 3WFHA 1J05A 1RD6A 1KCUH 4HKXA 4OF6A 3RL1A 2AZAA 5AZ2H 1M1SA 5JOPD 3DXAE 1BXXA 3S88L 1OSZA 2JKJA 3HZVB 4HDIA 4X7TB 2A9NH 3FSAA 3UJJL 4PY8J 2H26A 5D5MA 2VDLL 4G8GB 3WI9A 3DTXA 3O8XD 4IKNA 4E36A 2NTFA 3OAZK 1GTFA 4HWEL 1HESA 1QI3A 3G6AB 2Z31A 5TQ2H 3H3KA 4C47A 5F9OH 4EXKA 3AQDA 3QS2A 3P9MA 5FYKD 2D2CC 2BS9A 4FXLA 4K7FA 4W4OC 3X2QB 1BXAA 3W0WA 4MB3A 1MUJA 4PIRF 4X5XB 1ZTXH 4Z7VE 3WIHH 2RALA 5T1MB 3S37H 2P8MA 5IQ9A 4LOFA 1DBKL 1NWPA 2K8MA 2RB8A 4NBYB 4FQ1H 1N8ZA 3IJSB 3SDCB 2APTA 3NGBB 3MUHL 3P4OB 1YYML 1E67A 5F7BA 5A6IA 3WIIL 1KG0A 4OH2A 4R0LA 1USQA 4PGJA 3TURA 4P04A 4Q9RL 1C5DB 3UL4A 3P3RA 4BUHA 2C9VA 3U7YL 5CR1A 3QJFA 3WKYA 1CL7I 4GRWE 2MKLC 2V4LA 2BWIA 2ITDA 5CZVH 3N1MC 3BWUF 4JM2B 2FJHB 4LL1A 4LQFL 3HNSL 2UUDH 4OCYL 5F6HI 2FATL 1C1EH 3MMEA 3SQOL 1BZ9A 3T0EC 5L2JA 5CN1A 4JZNB 1DSFL 2Q9OA 1IC4L 2UZYB 3GEFA 4WJG3 2YA1A 1TKWB 3HMWL 4NHUB 2VDKH 5E2TH 4FQJH 1IAOB 5KVFH 4FLRA 2HYMA 5A3IC 2YZ1A 1L5GA 3OMAB 1Z5HA 4BSVA 3QQ9D 4GKZA 3QORA 3AACA 2GY5A 3OV6A 4FP8H 1MJ8L 2Q6WB 1MFAL 4JQXC 1XGUA 2JI3A 1QFPA 2IWKA 1RURL 3MUGB 3QB7C 4QXVA 1G87A 2J6EH 5CEZH 5MI0B 4WWNA 4LPXA 2GUOB 4Y4KB 4QRPB 1A1OA 3I84A 2WNKA 1AG0A 4HJTA 4P23B 3N06B 1C08A 2P7TB 4XNAA 4TULH 3TA4D 5ITFA 4HFUH 3VU2A 1PZ5A 5IBUB 1PJ9A 1Q0XL 3OPZH 1S7WB 1CE1L 1RPQA 2ZKMX 3WLBA 3SO3C 1OW0A 3WHXB 1K4CB 3ESOA 3AQZA 4P4KD 1FUNA 3B3IB 5KW9H 2E7LA 3DVFA 2CLRA 1RZKL 2KZBA 1YNKH 4XGZB 3TEZA 1CFSB 4JQIA 3T4YB 1MCNA 3ZK0A 4AGQA 1QMUA 1VRSA 4AGNA 5KSUA 3ABGA 5HVHC 2XVKA 3HB3B 4QTIH 5ECGA 4X0NA 3MLUH 2CLZB 3CZUB 5L0QB 1BF2A 4GBXD 1J11A 2HX7A 4MD4B 4NBXB 1UB5B 3UGUA 1DFXA 5J1AB 1Z32X 2AAVA 1OZUA 5IT2H 4FE9A 3FZUD 4QRPE 3T6WA 2QHRL 4APXA 3L9RB 4RDQG 4GB9A 4X7FC 3QG7H 1B4RA 4TL4A 3UFIA 4DGIH 1JHTB 4AX3A 5CM1A 5HGBA 3B9KA 3MV01 1NUNB 3W37A 4YHLH 4L8BA 2EDXA 1V54B 4JFTA 3CDZB 2QVMA 3U1QA 3DX9B 1DJGA 2I7OA 4OGYH 1NCJA 3RVVC 3SDYH 1EJ6A 1GJWA 4DIXA 3ARXA 4AIEA 4HEME 2FRGP 2AABH 1EDQA 4JPKH 4MA1B 4PSPA 6TAAA 5J1SC 4P2QD 3RX7A 5JIDA 4ZMNA 1FV1A 1AXTL 3WEXA 4UQBA 1ED3B 1A1NA 4FFTA 3WMSA 2NCEA 1UH2A 4PGCB 2FTAA 1NEPA 4OLUL 5E1QA 4UOW1 1D7CA 4IMLA 4H88L 3FU9A 3IFPB 1X3DA 1AZRA 3WL9A 4P23A 1DTUA 1AI1L 1X4XA 3QQ3A 4JVWA 1NEZA 1EAJA 3WHE0 3GUTB 3N91A 3SQRA 4E5XG 1N26A 4XPGH 5DMKA 2IADB 3VMNA 4ZXBA 2EACA 1IQWL 2IPUK 5I74C 4CVWA 3BGMB 2JCWA 3GO1L 3U36B 5IQOA 4L4VB 1Z0MA 4IKLA 4RGNE 1UJ3C 5C0BA 5D7JC 1T20A 3ELQA 2V33A 3W3BA 3I75A 2OX5A 2F7QA 4YHIA 3VW3L 4DP4X 1WYJA 4WWKC 3UTTE 4MD5B 4QYAA 4LCWE 1H9DA 4ELDA 1FFOA 3SPGA 2VL5A 2VN3A 5DD1L 4CADB 3MRFB 5AD0B 4AVJA 1BVOA 4QRSB 1A3QA 4H20L 1MCCA 3D85D 1VJSA 1HWHB 4KI5E 1U36A 5E6IB 4BQCA 2G2RB 4R4BA 2VM3A 5H37G 4OZIF 4FHJA 4XP5H 4AQZA 1E28B 4U6YA 1XL4A 3CQFA 3AREC 1XTMA 5EF0A 1QEWA 3BUQA 3Q13A 4UYPA 2YPLA 1H3GA 3FN9A 1U8NA 2TRYA 1HDMB 3KPQA 2I7SA 2Y07H 5EU3B 3FRPG 1A6UH 3OAYK 2TAAA 5J8OA 3U7YH 4QJ3B 3BEVB 3QFGA 3RKDC 2VLRB 5E5UB 1AO7B 5EBWA 1JYNA 1N64H 4IGBC 2WBKA 2X12A 4PJ9A 5KTEL 1BMWA 4M5YL 4ZUTA 5I26A 4XMWA 3EOAB 5IEKB 5JW3L 2VR9A 3KMDA 4G1MA 3DWTA 1I7UB 3KBEA 4EOWH 4OLWH 2OZ4H 4XBPB 2AEQH 4JW3A 4QAMB 1D6EA 3HFFA 4R8WL 3EYVB 2VLLA 1CO1A 3CZLA 3FB8B 1Z9SB 4CJ0A 2NLJA 3U7WH 2RA1A 1VHPA 1SVCP 5FIEA 4CMMB 4Y2OA 4Y1AB 1COBA 1NL0H 2IADA 4ZXBB 1PNDA 2WNGA 2BNRD 4F93B 2BC4B 2CHZA 1E9PA 3EBGA 4UV7H 2ISDA 1INQB 1SN0A 4M61B 1H3PL 2XLLA 1XBDA 1X5FA 3AREB 3WFEH 1UM4H 1NCCH 1T5XA 2HT2C 3UBFA 4ZNEA 5KSBE 5C08D 2QR0B 3B3BA 4GNKB 3FT2B 1ZXQA 4UOZA 3BD5A 4HXBH 4A39A 1UXLA 1M71B 3EJQA 5LCVA 3UZVB 5IREA 4ZXBC 3WO4B 3MRFA 1XAUA 3WOVA 4YXHH 1PDKB 1U8LA 2WAQA 2Y7QA 3A21A 3MV7A 2C9QA 5FO8B 1J1XL 1DP0A 1CGSH 4XZUB 5F89A 4AYID 2CHNA 5BUGA 5TF0A 4MZRA 3FB6A 4A7TA 1XR8B 1THCA 4WO0A 2FT6A 3FUNA 5EOQH 3MV9E 4TLUA 3WD5H 2AEQL 1D7DA 4HYTB 5KS9B 1T89C 3V9FA 4KUZL 5HSFA 4N8PA 5I74B 2E4FA 3NZ8B 4LK4A 1LK2B 1N2RB 1TTCA 5DI8B 3LNGA 4QAWA 4GKSA 5J9PA 4PCKA 4MA1C 5AYUL 5F96H 1VFBA 2NR6C 3APNA 2NXYC 3NN8B 2B8OT 2Q7YB 3EDEA 3T3MF 4RMVA 5IEKA 1MLCA 4XN2A 2C5DC 3I02B 4C4BA 4PJ8B 1RI8A 4HG4K 1Q38A 5EZIL 3ARGD 4AOFA 3U46B 3T2PA 3DX4A 1FBIL 5JLZB 4HF5H 4PVNA 1PKQE 4MQXC 3FT3B 3PWNA 2VR6A 3OKNB 3OMZA 3MROB 3QDJE 4NM8L 2FIKB 1OTUD 1FPTL 3PDDA 2GI0A 4UAHA 3B2PA 3II1A 4PJ9C 4KKCD 2K7PA 3ZTNL 5KS9F 3K0WA 4EI5A 4ANXA 4BFKA 5A6MA 1ZKAA 3U30B 5AWNL 2IVFC 4OFVA 3ESNA 3MACL 4G43A 4A63A 2R0LH 5ESQB 5E08L 4BK4A 2NT1A 4QJ4B 1YN7A 5L4FA 1BFVH 1I1CA 4NPYB 1ZEAL 3FAXA 5IMOA 3GMLA 3S4SA 2DIAA 3ZDXB 1A7RH 3MFGB 1PCSA 3IKCB 4M8QA 1OV8A 5DVPA 4K5MA 1CXFA 1P7KA 2A74B 5I8OH 3DVIA 3IK2A 3WY2A 3A6CH 1X9UA 2AI0L 1RZ8B 4J8RB 4RIRB 4APQB 1UXWA 4S1QH 1IE5A 4BM7A 1TEFA 4RRPM 2C7FA 1YO4A 3K2UH 4WWKD 1ZIAA 2NMSA 2ZUXA 3T8XB 4H2AA 1IQDA 3BMWA 3DSNA 3FQTB 1IGCL 4XWGL 1HYSD 4FZ8H 5E00B 5HVGB 3OKYA 3G5VB 3H6AA 4DNLA 4M9PA 5DJXA 2W88A 3DV4A 3GI9H 1KTDB 3HTLX 1RZQA 3O3DB 3B5HA 1XGYH 1XD0A 4LE8A 4N68A 4PRIA 5I8OL 4BA8A 5BS0A 5C0BD 3NAAL 1D9KA 2DQFB 2DQIL 1IM9A 1MCFA 3KYOA 3QR2A 5F7EL 2MH4A 1NGXB 1NZRA 3QDMB 5FGSA 3CIQA 3E8UH 2XA3A 1G7JB 3QZBA 1M7IA 2WINA 1LMIA 4UI2A 5D5ME 4TQIA 5EOCL 1KPUB 2W9EL 5E94B 2YXVA 4DGVL 4IBUA 3KNBA 3VI4B 4K3JH 5GS1A 2EEBA 4CL7A 4F8LA 3AFLA 5JHBA 3KLLA 2UWEF 4RDBA 2E5EA 3OR7A 2OQJA 4BYHA 1OGSA 2KPNA 4OFKA 4QY8A 5KYXB 2AKRA 2KERA 5IMKB 1TENA 1A0QH 2XX1A 2IV8A 4OV5B 1RMFL 5E8DH 4P5KB 1GGTA 3VXUE 4YO0A 2GEQA 5CN3A 1UTDA 5EC2A 3WFDL 3MLVH 5ALBH 1HQ4B 2NXZB 5EU4A 3VGAB 1A1MA 3SCMA 1HXYA 4YEEA 3P9LA 3QEGL 2AJVH 1MRFH 4FQ2L 4AH2A 5BUAA 1QR4A 4LSQL 1ZK9A 3TNNA 1TYRA 4MAYC 4FMFA 3N1GC 5DJ0A 3AAZB 3FOMA 5AW0B 4AEIL 1BAWA 3DSFL 4F15C 3BPCA 3NA9L 3OX8B 1FO0A 1FJ1B 5BOPA 5HI5C 1AHWA 3MLYL 3V7AG 2VGLM 4YSCA 3IF1A 2JQAA 3K1KC 1DVXA 1L7TH 5J6GA 1KBBA 2WKLA 3L5JA 4I48B 2CU9A 4WWPA 5C0RH 1A3RL 3VXUD 5E1AA 1R9FA 4OKVB 4LESA 4BFIB 2ICEC 2QTVA 5KVGL 2E74C 2KKQA 1FYTD 5C08E 2Q3AA 4KRPD 1WO2A 5JIQA 1XF5B 4MQTB 3LHPH 2XA8H 1XIWA 4GKNA 4PJ7F 3LPWA 5BRPA 2YEZA 3M8OL 3ARBA 2OSLA 3PV6B 4QOKD 3O2DA 5J5EA 4JEGB 2FYYA 2M26A 4PJBE 3S3JA 3ML9A 4UNVA 1WZKA 4TVPE 3GSXA 1P5UC 1O6VA 4HIHB 4FTVD 2DBLL 4HS8L 5DEGA 1DBJH 1TJHH 2FR4B 2BOLA 3AS3A 4HLJA 3U6RA 4QD2E 4JFED 4G8GD 2BNQA 2NYKA 1HL4A 3NIFE 3UBXB 2AF2A 4FG6C 4GSDL 1QFWM 1J8KA 2AXJA 1IGTB 4PRPE 1L9NA 4BGLA 3DVGA 4FQPA 2RFXA 3BGAA 3S48A 2AV1A 3D08A 3H9HB 1J87A 5A2AA 4E9LA 4TNVF 2YC1B 5J11C 4FFYL 3CFKA 4XXDA 4UM8B 3MCLH 4OBRA 1RUMH 5DMGD 1AD9B 1PF3A 3T3PF 3VSQA 4C83B 5I6OA 4XODA 4UTAL 2GBVA 3APFA 4A37A 4Z7VB 1KTRL 4F57L 5D1XA 1KGXA 2OP4H 2B14A 2NUTB 1PQZB 1Q1PA 3HPJB 4XMPH 4DKDC 1FZKA 4U7MA 3QFJA 3KCPB 2QPUA 4X5XA 4OJFL 1OPOA 5F97E 4ZFZA 1WTLA 4LPCA 2EC9T 4GW4A 4JGJA 5JIHA 1M71A 4FHKA 1H3VA 1WS8A 5IT2L 3QRGH 4JRLA 4AQEA 5ILTH 4D0DB 4G7SB 3HE7A 4U3XA 3L17A 2BNUA 5I15H 1KEML 4IK7A 1G9MH 1C8QA 3NCJL 4ODBD 4PLNC 3UTSB 2J43A 4JZOA 4MQ7A 3EYFA 3RPKA 4RZKA 5IVXE 2AVFA 1OOAA 3ZDWA 3ZDXE 4I2XE 3VX0A 2NNAB 1D7BA 2BRRL 4XAKE 1CDBA 3RWDA 3QARA 4QHLB 3FN0L 2EILB 3GMNA 3OGOE 4P3DA 3ARYA 4ABUA 5CEZD 1F42A 3PFQA 2YFNA 2XN9B 2VLJD 4LNRB 4P46D 1R5IB 5PCYA 4DGWC 3CZNA 3U7WL 3MA7A 4KKRA 3DURB 3B5GA 1BPVA 3A6BH 3WJMA 4LO9A 1KWGA 1J88A 1R34A 1G7MA 2AXHA 2JWYA 2HT4C 4FLQA 4J28A 2YBRA 1XIWC 3V4PL 1GYAA 1SF5A 3HC3L 3H1ZA 5IMMB 2GSGB 4ICXA 4PJXE 3MXWH 4WW2F 1IGTA 3AB0B 4DGUA 2P45B 4HK0B 5I6NA 4E9TA 2VJ0A 4HP5A 4LGPB 1P5UA 4FOMA 3PWUA 4NM4L 4O2CA 4Z7UA 5HDBB 1NH6A 5D4JA 3BP6A 2H2SD 3PCYA 2C3GA 3V52L 4YL4A 4L1TA 3RL2A 2IV9A 4GSRA 1TTAA 4KROC 1QOKA 2OMWB 4JCMA 3TBYB 2YJQA 3VFVB 4PRBA 3GLZA 3AXHA 4KH9A 1QFWI 4ZQKB 3WIHA 4C56B 3L2NA 1I8KA 3X1FA 4U3HA 1SLWA 4AEHH 2P26A 5DMGC 3U4BH 4CSTA 3FQWB 4NZTL 3H42H 3DXAA 3OKOB 4LB8A 3D50A 4YXLH 1CE6B 5TE7H 3IMBA 5LNGA 4P2CG 1FO0L 2VRAA 1DN0B 4BSWB 1OZTG 1PD1A 2BK8A 4QXUL 2C9SA 4FQHA 4R6UA 3AITA 5DD6B 4FULA 3ME0A 3G6AA 4YGVA 3TCLB 3TWYA 4PJAF 1VERA 1EA9C 1UG9A 4I3GA 5I1GH 3KPLB 1G6VK 2YUXA 1HI6A 3MLSL 1DBAL 3RNKB 3B1UA 1ZA6A 3QQDA 3V5HA 2XQBL 4PGDA 5FYJU 2B1HH 3BQUC 4FQXD 1FFPA 4NP4L 1OAUH 3TTSA 4AT6B 4LDOB 2KHAA 1WDAA 4DCQB 5M7QA 5DUPH 4XO5A 1J8HA 2W95A 5HGDB 1EEZB 1XH3A 4HT1L 4QHNB 5K1NA 1JTOA 1NA8A 2X4UA 3QUXB 4FF9A 4N8CH 5ENWA 1AQDA 5B1AB 1TO4A 1UOKA 3ARDC 3D8MA 5ACZA 3GGWA 4DETA 4YHOL 4E9VA 4NN5C 4MQXD 5DEZA 4P4KA 4HALA 2XDHA 3EOYG 3S5LG 3T0WA 4IKJA 1M7DB 3D3VA 1UVQA 3B7TA 1VGEH 3WXWH 1I1RA 4MWFA 15C8H 1VADB 1KCKA 1E9QB 2BVQB 3RG1C 2MRYA 4HUXA 3SDAD 1R6VA 1WGOA 1ZHBA 1BLNA 2JKRM 1GOGA 2HB0A 4LAJH 3C5ZC 3H42L 4YXLL 4K9JA 4NO3B 2HVBA 4EE2A 1DQKA 1WBYB 1WT5A 2EH7H 1DDHB 1XR9B 2EVHA 2VDOB 1OANA 3F64A 5DCCA 4PM1A 4DKEL 4XMZA 1J0JA 3LKRA 2DJMA 3EOTL 3D2UD 4UTAH 3K72B 2Y22A 4PLJD 2C8NA 2Z0UA 43CAB 4MA3B 3JWOH 4FRWA 1MIML 5ALBL 5D93C 3U9UB 1FNAA 3L4ZA 2ITDB 4NCC1 5GGRB 2FIRT 2R2HB 5IB4A 4E9WA 3I9AA 5ADOH 4K8RH 5EZJB 4B6ZA 2VZ3A 4JFFA 4EBQH 3Q01A 3VFUB 3NPSC 3VD4A 4GG6E 2EXYD 2YAPA 4JN2A 3CSPA 2O6EA 2CE6A 1HHKA 2YPKA 5BRZD 4HJGB 4TNEA 1H6FA 1DQQA 3HHMA 1F4XH 5E24E 3HPLA 4FQCL 4JFFD 4BV1A 4FTVA 1KCVL 4QWWD 3NCJH 2X88A 3WU1A 1S7TB 1UWXH 2CZNA 4K3JL 3EUDA 2WJ5A 1UATA 3JWOL 5J6SA 1MOEA 2FQDA 1EXUA 1XF4A 3SKJH 3O9WB 4R5VA 3AG3B 2ED6A 3JUYA 4LBAA 5LG6A 3FB5A 5AW4B 4FG2A 2J6EA 3N85H 1V3JA 4QRBA 4NJ9L 5A40E 5DRNA 1IAOA 5IHBA 1OE3A 2Y9RT 2Y4SA 4FP8L 1QRND 1U91B 2VXVH 4LSPL 2MMXA 3CU1A 1FQ9C 1G94A 1T83A 1BBDH 3OPUA 4RAVB 2NY3B 1QQDA 3MJ6A 4LSDA 3W56A 3OZKA 4JO3H 4Z7OF 3L1EA 3BUYA 4G8EA 1RZIA 1JIBA 5CEZE 4BUQA 2JK5B 4NM4H 3CU7A 4RFEA 1LE9B 1YNLL 1PEZA 3FQNA 5EN3A 4ETQA 2PCPA 4WU5A 4N87A 4PCSA 3IDYC 5F21B 2JMRA 1F2QA 2VISB 3UIYA 1P69B 1HEZB 1WZ1H 4PGBB 5IB3B 3O4LD 4G6AC 5DVMA 4ZDHB 4P57A 3C5ZA 3ZE1B 5JUEL 5HDQH 3DECA 4Y7OC 1FORH 3NP3A 5D7IE 2ADIB 2LU7A 1J9RA 4KTDL 4W9EC 3PE9A 1I31A 5T3XL 1DVFD 4KHTL 2ZXAA 3CDGA 1CT8A 4NB7A 5HGHB 3VFTA 2DWXA 3LMJL 2XI9A 2WJ7A 4H26A 5FHBH 1VKXA 1J5HA 3PGFL 5I1DB 1T0OA 4UV4L 4Y16D 3GIVB 2K7QA 2VDMB 2L0DA 2YRPA 4GRWH 1AZBA 4P06A 4NSKB 3N85L 2ZX9A 2H0PA 2Z8RA 3VXQB 3QUHA 1A7BA 1VCAA 2G9HA 4ZYKA 3ES6B 3FRUB 4PJHB 1LEKA 2GSMB 2I9TA 4DVRL 3VW3H 4LCCA 3QZPA 3VCLB 2LABA 1GGBH 4OJEH 3L4TA 5DJZB 3RWGA 1HNYA 4N2MA 3QUYD 1JWMA 1XF4B 4MZ2A 3AM8C 2WZPD 4MD0B 4P5RA 3VA6A 3TO2A 3RL1B 1IC4H 3B7UX 5AB1A 2WQ8A 5KANG 2D0GA 2H2PC 5IOPB 3V4VB 3ZTJH 2CDFA 2FX8H 5MI0C 3HS8A 4LNVA 3O9WC 4HUVA 4JDEA 3DK0A 3JYBA 3X12B 1QZNA 1EPFA 4XXCA 1MKFA 1EO8L 5DQ9B 4WF7A 3L4UA 5FGBC 4LOUC 2R59A 1A9BB 2DYPA 4U1NB 2CXKA 1L9TA 5C0IA 4L8SB 1Y7VA 3KW8A 3D39D 3LZQA 1Q9WA 2JKSA 1S7SB 4XP6L 4KKLD 3IFPA 4L29B 5DS8B 2UXVA 4HPYH 4GXUN 4LOVA 4PJ9B 3UJTL 1VA9A 4DN4H 3GNMH 3VYPA 2HUEA 1BJMA 1OPGH 3ARED 4BK8A 4H4NA 1T66D 3LKNA 3FCTB 3PNWB 5D93B 2ZP8A 3RWHA 3VI3F 1BCIA 1LYQA 4J3OH 4ZO8A 2YK1H 2NY3C 3SDCA 5F0PB 1CK0L 1TDQA 2FE0A 2R9HD 4XMLL 3A4AA 5T5NG 1CJYA 4JRXD 1URLA 2ZOWA 1XGTB 3BZ4B 4HJJL 1BWMA 5E08H 5ID0A 1WRFA 4NYLB 2D73A 5KSAA 1YECL 1T03L 1N59B 4L2YA 1DVSA 3NGBC 4OAWA 1AZUA 2Y69B 3MLUL 4JANB 1BFSA 1IBBA 3VXME 3PIQB 4BQ6A 4HWUA 3F5WA 2ZYIA 2OI9C 2EICA 1XX9C 1P1ZB 1WLHA 4NAJA 1WBZB 2J5WA 4K5PA 4LLDB 1ZWIB 5T1KA 1GL4B 1VACA 1JK9A 1MFBH 4ZUWB 3S2AA 3IAPA 5A2FA 3NQKA 3TO2B 1CBVH 1N5YL 1E5ZA 3BEWA 5D70H 1LO2L 1IGCH 5JQ6L 3W2DL 4NN5B 3VXTB 3BSHA 3WO4C 3HNSH 4OCYH 2YD7A 4GSXA 2IFGA 4GYBA 2QFRA 4HWBH 4KTYA 2MPAH 2WSPA 2E9BA 3BPLC 5BZWB 1FNFA 4KX7A 1KCBA 4ONHA 2VDMH 5BRZE 1H15B 3HRZA 4HA1A 1UENA 4RMQA 1QNZL 2J3SA 4NKIH 4NJAL 4PMEA 2JH2A 5JYLA 4NQVB 4JKKA 5FFGA 2EIDA 4LEXH 1YMHA 3BVUA 1ZA3A 4QWWC 4R5XA 5J3HD 4J3WA 1NOAA 1N3NA 5KVDL 1LDSA 4L8BB 1Q94A 2G60L 3S35L 3IVKB 1U8JB 2D31B 4JDVA 4G6FB 4YHNB 1DFBL 5IEHB 4YIQA 3V0EA 5DJDB 3DUUB 1KTBA 2B59A 1Y07A 3CN2A 2H0EA 1ACXA 1O7VA 1G9NH 4PJDF 4PMFA 4UDTB 5AWNH 1ZVYA 4NKQB 1SOXA 1J8SA 3QEUB 4KRPB 4XP1H 1Z0NA 1YEEH 2R2HA 2DWSA 2WYZA 2XV6B 5D1QE 1IL1A 2O61B 5CBAA 1JZJA 1AGCB 4KO5A 1BVKB 4BZ1H 1Q0EA 1NMBL 3F6JA 3BQUB 4YDNA 3MNVB 5CJQL 4Z7UF 3W9EB 4A2GA 2UY7B 4F9PA 3N5AA 1KT2A 1Z9OA 3IN0A 4QPEA 2JTDA 2EDHA 4RIRA 5LO7A 3QUZA 4QRUA 2MKWA 3PV6A 1CFVL 3BRFA 4MA7L 3PUCA 4ODVL 4NQSA 3PHOA 4OBSA 1PPIA 5E2VH 3C6LA 1AGBA 1TFHA 3ROLA 1CGTA 2AQ1A 4YFDB 3OAZH 5CEZL 2H32A 4LCUB 1A7QL 3SY0A 5L0QC 1KJMB 5K33A 2ITEA 1PZCA 4G43B 3KPTA 5ESQA 2VIRB 3HIZA 3TBBA 3PGDB 4Q58C 4X9HA 4AEEA 5EULV 4U1JA 1ZOXA 1BOGB 5JHLA 2IPUG 3FB7B 3SDAC 4CVZA 1P4IL 2H3XC 4Z1PA 5F7NC 3J8F7 4DP2X 2VXTH 3A4EA 2IALB 4IYKA 1EERB 2CHWA 3S96A 4KJYA 4PB0H 2LVCA 2VW7A 3FF7A 2VMJA 4I3SH 5CAYB 5L6YL 2WXGA 3HMXH 1HNGA 1YEKL 4AM0Q 3PHAA 5C0NC 3AT9A 1B4JL 2KZWA 1ZLVK 2P46B 1EVUA 1LE9A 3D18A 5EEYA 2G3NA 2Y36L 2FATH 3SQOH 1AHKA 3H8NA 1LEIB 2HFEA 3DJRA 3QNFA 1WGVA 5E70A 5EV7A 4ANWA 4RMSA 1W2KT 4Y4KC 3WTVA 2CMRL 2ARJQ 1ZV5A 2VUKA 1GGIH 1I85C 2OMZA 3F12B 5IFJB 2J2ZB 2D7OA 1A6AA 1BX2B 1T0PB 4PJCF 4FYTA 4Q9CA 5DD0L 3HS0A 1QZ1A 3PRZA 3QZLA 2RJMA 2OV0A 3DETD 1FORL 4UOQA 4W68A 4AUUA 2A4EA 3NFSH 3MRCA 1SY6A 4BKSC 3VACA 3HNTL 3OSVA 4OZFH 2JJVA 4DP5X 1OGAB 4Q8BA 1RLWA 5CMAB 1QBLH 1U33A 5FUOH 4AXWB 5I0VA 2XN9D 4LZKA 4I77L 1T0NA 1HHIA 5C9JB 1MQKL 1J8RA 2OMTB 3DJZA 1L9RA 3MJ9A 1JP5A 1O9WA 4LCCB 3UP1A 2I85A 2CR0A 3O2DH 1OEZW 2XQYK 1YRKA 1PS3A 2Y07L 2ZT9C 1BBDL 4MDIA 1MDAA 5C86A 3IMVA 1MFBL 3IJEA 4X4ZA 4EUPG 1RSYA 1P4UA 2Q20A 4L4VE 4RGNB 3BCFA 5FO7A 1BG9A 1ZK5A 3QNXB 4RQQB 3RB7A 3ZHNA 2QMJA 1I8AA 3SKMA 4YN3A 1BJ8A 4UNTA 5TE4L 4GW1B 3K8LA 3DX6A 3BLKA 2WXMA 3ZE2E 4ZMYA 1WUNT 2Y5QA 4M7LT 2Z4QB 4ES9A 5KS9A 4FD0A 4LCIL 1SY6H 1QHOA 2WHVA 3QRBA 3PQYA 4HGWA 1L9OA 1JFQL 3IDMB 4PB0L 4N2AA 3OHXA 4GIPD 4I88A 4G8IA 2NW3B 4JKWA 5BV7L 5DVNA 2PKDA 2QFPA 1JZFA 4KKAC 1A4CA 5IQ9B 2KC0A 4NUGH 2FH8A 3MA9L 5EFIA 1G0YR 1WZMA 3OC5A 1MLCB 3ULUH 1E90A 1NCBH 5SWZE 3TJEL 2XU9A 5SWSB 4G6MH 5GISH 3EBAA 1XCQA 3P3YA 4JFHE 5ADOL 2K70A 4JR9H 1ZE3C 4FZEH 2B1AL 4NO5B 4BCYA 3Q0HA 5KYUA 2VLJA 4P46A 5K39A 3ESMA 3DMMA 1QG3A 3EJRA 3IFNH 3LZRA 1MHPL 3BT2H 4ZODA 4X6CA 5GGQL 3T0EB 4FQXB 2GUOA 4Y4KA 4ZW7A 1KLFB 2CBTA 4N85A 1J9QA 4WZ9A 3ZE0F 1UWEH 4IRJC 3SEPA 1A3ZA 3UABA 3NPZB 1DQIA 1W15A 4PJ7B 2NUTA 3U0TA 1KYFA 4OGYL 4XRCB 3CZGA 3T65B 3UCRA 3V5HB 3IJ7A 4ANKA 2PWHA 2QZQA 4M00A 2ICEB 2VSMB 1L5GB 4BSVB 1ZWIA 3N2JA 5T1KB 3EO0B 4POZD 5E4EB 1ASQA 3IFLL 4IOFC 4TRPL 2Y7NA 5AYTA 3C87A 3CFTA 2E7MA 4JE4B 4CKQA 1RSFA 5SWQB 3ZHDA 5D1ZA 2HKHL 2FJGB 3LS5H 2W9EH 3SYCA 5C09B 2B2XH 2OTUB 1HJBC 4TUKL 4U0RC 5BS0D 1S5HA 4UV7L 4GW5B 2X0WA 4WO4D 4BXSV 3VWJB 2C3WA 2VXSL 4L5FE 3ZE1E 3W38A 1EXHA 3P0GB 4G2AA 2R27A 5LGHH 3GBNL 3FSOA 4MA8H 5GS0H 2RCSL 1ZLWH 1UA7A 3TEUA 3MV9D 1AQKL 2X0VA 4OCSL 3VQMA 1BBJA 1TQCB 3JWNH 2AERT 2V2XA 4L1HA 2VC2B 3HC0B 1HHHB 3QR0A 4M93B 1ANUA 1NIFA 1WISA 2Z92B 5ACMA 4KMQA 3ARFD 4G7VH 1CI5A 5L7XH 4OCRH 4WNQA 1KIUA 4WI6A 2WOYA 2ADFH 2DL9A 3MBWA 1B0RB 5IP4A 1DANT 3EDKA 2YGVA 1D5MA 4TRPH 2EH7L 3KHQA 1QVOB 4JRXE 3ZRSA 4HX1B 4Y9CA 1LO4H 5ANMB 1R3LA 4MMZC 2EDEA 3HKFA 5CNHA 2UY6A 4QRRB 2A6JA 5FK9B 4XRCA 3T65A 2A4CA 2EDWA 3MLZL 1A3RH 2VMCA 5G55A 1PKQA 3IDUA 4XB7A 5F3HB 3X11A 5GHWL 1BZ7A 4N6RA 3NFNA 5DFWH 2J6WA 4I7ZC 4P8QA 5KVGE 4PGZA 4AJWA 3WJLC 4OF0A 5LBSH 3T0VA 2VDML 2XPYA 3KXFD 4N28A 3QRLA 2F54E 3UAJC 5GJSH 5I2IB 3HBPA 4CU6A 3MNZA 1NC2B 4LGSB 5MENA 4Q9RH 3RBGA 3U82B 1K3IA 1JVOA 2A77H 1I7TA 4F7TA 1WBXB 3HI5L 2NCMA 5J13B 2WO2B 3VWJA 1YVLA 5A16B 1LO3H 5E6IA 4G3YH 3EGXB 1HN1A 1ETJA 3JTSB 3LDBC 8FABB 3L08A 4RGOL 4WI9A 2EYRB 5KYNA 1PLAA 4OLXH 3DO7B 4A6YA 2Z1KA 3H55A 4MHHI 1IKNA 4TOYH 1KFGA 2RCSH 1BAFL 2P8LB 3MRIB 5DSCA 1PVHA 4DPRA 2IWGA 3O81A 5D1QA 3AWFA 3WIFB 1T1XB 5FW8A 2HT3C 3HE6C 4WFFD 4BCZA 1RIVL 1DVFB 4B60A 3ZXAC 1A25A 1FP5A 4OUUB 2VISA 4TTDC 5FEBA 2BZDA 3FO1B 5L6YH 5IBTH 3ZIYA 1PY4A 3FU6A 1AP2B 3KDMB 4B5EA 1SLVA 4GS7C 3LRSB 2CH8A 3N42F 2IDQA 6PCYA 3FUHA 3S97C 1F41A 3BPLB 2VERA 2Y1AA 4OZGB 1RZFL 3EYSL 1HSAA 2DI9A 2CRIA 3TS8A 3JWNG 3GSQA 2VDPH 4QJ5B 3MRHA 5HYQA 3MNDA 4RBPK 3UTTB 5A7BA 1BW8A 1BV8A 4PJ8C 5H37A 1OO2A 3B9VA 1CF8L 1L7IL 4P23D 5CLZA 5JYMA 2PXYC 4LDEB 2P28B 3DX2A 2K3HA 1DJIA 2J7LA 3BT2L 1GS7A 4NQCB 3ARBB 3LEYH 3UBXI 2BP5M 4ONFL 1I1AC 4G72B 5C0CB 5LCVH 4JM4L 5F7WC 1T0NB 5C9JA 2KYIA 5HYIA 2BIIA 4GRLB 1SXAA 1SEQL 1FFTB 4KKNA 2FR4A 1U8KB 3FYEB 1XCTB 4ZAKA 3MNZB 4GO6B 3UZVA 2YRLA 4Y5XB 3L1OH 1EEYA 1FE8L 1JV2A 2KLTA 4YJZL 5IFHH 2FDBP 3Q2VA 2XTJB 2GQHA 1WBXA 2QMKA 3FUMA 3CCHA 1CVRA 1YLBB 4FXGC 4Z3IA 1U8MA 3VFUA 4N2BA 1K9TA 2AV1B 1VAHA 3QIUA 2V2TA 3MACH 5DHVA 5CLTA 1FLRL 4HS8H 4YEFA 2V9TA 2ADYA 2YEVB 3K6NA 4M4RA 1UB6A 4DFIA 4HISA 5DFVC 2GTZB 4CC0A 4FYQA 3H9SA 4HKBB 2I07B 4OD1L 3M6DA 3B37A 3QC5X 4E41E 4I4WA 1HINL 1BIIB 1EVTC 1OAZL 1W0VB 2R51A 3LVTA 1OQXA 2L7EA 3BESR 4OFQA 2WD0A 2APXA 2FGZA 4PN6A 2ADJB 3STLA 1N0LA 4OUUA 5FYLD 4P3CL 5E6IC 1T7YA 5IB1A 1W9XA 3M8OH 1X5XA 4HIPA 4URTB 4F91B 4Z3HA 2JJSA 3VYOA 2G5BB 3QXDB 3EZJB 4M03A 1DDHA 3RBSA 3O4LA 2WZ6A 5I1JL 3DBXA 5KUKA 1L7TL 3QZOA 5D96C 5L8JB 3Q05A 1MW3A 3B2VL 1FL3B 2C7UA 2OP4L 4UINL 1IIKA 4M6OH 3HE6A 4KX8A 3RAJH 5LJYH 3EJZC 4GMTH 1UJ3B 1ILUA 2IJ0C 2W38A 4LPVA 1I8IA 1P6AB 3F7YA 3MX0A 1WSST 4NLHA 3OL2A 5INDB 1YYMH 3RWCA 1NFDA 3BP5B 4FLHA 4OM0H 5GRZA 2D4DA 1GAFH 2XQYG 1Q72H 1TG8A 2H1LM 2NY7H 1WFOA 3FB5B 2HPOA 1UM5H 3ZTDC 4ACPA 3D12B 3SHSA 5F7DB 5AENA 4P9HH 1U8KA 2ICWJ 3GJEB 4C54A 1BZDA 4LHUG 4PJ8A 4LIQH 5MHSD 5G4MA 1REIA 3DURA 4L5FL 1N6VA 3GJFA 5K93A 5EPMA 5I1EL 1QX1A 4ZUVA 4K23L 4PJGB 4HBCH 3AMLA 1QEWB 4R7DA 4QO1B 3QDAA 2DWDA 1I3GL 5AVSB 1RUQH 5C7XL 2IC2A 3GJFK 1OM3L 2RH0A 2O6PA 3D0LA 3MJ9L 3OXRA 5HHOA 2E6JA 3BKYH 4FNQA 4XMKH 4ZAKC 1DJWA 1SJVA 3FO2B 4YHYC 1E2ZA 5B21A 5K9OB 3I2CH 1KMGA 1BD2B 3IXAA 4TTGA 2M1KA 1D5IH 1HL8A 2CHXA 3BISA 2IAMD 2VQ4A 4FXGA 3TM6A 5B8CC 3PU7A 3BAEH 3LSOA 3A67H 4PRBB 1UZ8B 2A99A 4OI7A 3H54A 3HC0A 3FBKA 3O2VH 3P1VA 3QYCA 4G83A 5JORB 5C92A 1ZANL 1GW0A 3N1QC 2X2UA 5FUCE 3S36H 4IGBD 5DZAA 1EX0A 5KBMA 4PBVC 4QYOB 2NY2B 2Z35A 5JUEH 1MHPH 3PGCB 5GGQH 3QA3A 3QDME 5CJXC 4YX2H 3BH9B 1YQVL 4KHXH 4GXUM 1B2WL 1JGUL 1KN4H 2ESVD 3MRPA 3G5YB 5TK2A 3I9GL 4JO2L 4OZIE 4WENB 4UZUA 3T4AB 2WBJB 1CT8B 1P7QB 1DQTA 3PHSA 1T22A 3MCKB 1BP3B 2A73B 4P23C 1IBGL 4JRYA 4G82A 1GGYA 2JQMA 3TBTA 6CGTA 5LXGL 1W80A 1RXLA 4Z9KB 4DVRH 4UT7H 4XNMA 1CURA 5KVFE 4R4FH 3SCMB 4YHKH 3NFNB 2ZWNA 4PCTA 3VGFA 5HHMD 3V6OA 4HWZA 4ZNCD 3ZMEA 3MUY1 1YECH 1T03H 2FL5A 2OJ1A 3SDXE 2QDVA 2KQMA 4PJ7E 2YXFA 3S35X 1NLBL 2MFNA 4LSUL 3ETBJ 5E1GA 2I32A 2PR4H 3LHPL 1Z5LB 1QTYT 5LQBH 3FU7B 1YEIH 1U8LB 5IFHL 3QEQA 3VTAA 2OMYB 3A23A 4JG1L 3HHSB 4UOJA 1OCZB 5D6DC 2PXYD 1JN6A 4ZO7A 4OLUH 1QR1A 3GXFA 3EFDL 2DLGA 5CSBA 1U9KA 5B3SB 3RFZC 1E2WA 3F65A 2D0HA 1YMMD 2DKMA 1TCMA 1UA6L 1X9QA 3CDZA 3DX9A 3H6JA 3BEWB 4JCLA 5FKAB 3VFWA 4DKFH 4UT9L 1HX0A 1NKOA 1QRNA 5KYYA 3EO1A 3BWUC 3AAZA 3RZCA 1D5XA 4PJ5E 1IAMA 1UWGL 1IILE 4R96B 4O02B 4G6FD 3HCVB 2V9QA 3QUZD 4C59B 4FABH 1J1OL 1SDYA 3BP7A 1AQMA 3L3GA 3GLEA 4L4TD 2H2PD 5B8CA 3CH1B 1JV5A 3QIUD 2JSFA 5I5MA 1TJIL 3FQUA 5BZXA 3FTSA 3LQAL 4OZFA 3VAEA 1S7XA 4UQDA 1VDGA 1J1XH 2VR8A 3FB6B 2DMKA 5JLZA 1A65A 4D0CA 2HXAA 4G80B 2F5AL 2BRRH 3H9YA 2FBJL 2CLVB 5I1HH 1IJ9A 2A9MH 3L9EA 1A3LH 3IETA 3I6KB 2X4QA 1NCWL 2UUDK 3PXLA 4NQCA 5AOKA 3BFQG 4J39A 1ROCA 5AAMA 2X38A 2YO3A 2Z9TA 4LLYB 4MHHG 1EEUA 4Z95L 5I6XC 4S1SH 3GBLA 1GPOL 2BLFA 1AFVH 5FM4A 5DHXB 3RJQB 1MFCH 3HC3H 2ARJB 3KXFA 3CFDA 1IAKA 4ZX3A 2EXSA 5MERB 1CDUA 2NQ3A 3ZL4H 1SEBB 3SE9L 3Q8EA 4U7SA 2DMCA 4IEFA 4MRBA 4V1DD 3M1BA 3VFTB 2V37A 1M05A 2BSTB 4XPFL 4P59H 5GRXG 1D9KB 4LVNC 3GWJA 2FO8A 4M1CC 1LMKA 2BSBA 4JZJC 5LB1A 3LIZL 3DX6B 4X5PA 1R3KA 4JS7A 5JHLH 2WVUA 1LVEA 5FCUL 2X4RA 1G7QA 1MVFA 1NGQL 3UYRH 1I1FB 4N2EA 2IBZX 2WANA 1FH5L 4XHJD 1LP9B 2DW5A 4OCWH 3EOTH 3ZYJA 3BMVA 1OE1A 3RWDB 1FZKB 4W6XB 4KJWC 5F9WB 2CM5A 4QXTB 2IH1A 1J05B 4JO3L 4GRWF 4Y89A 4FX5A 3QUXC 2QADB 1IRAY 3VG9B 5AW8B 1R5IA 3BE1H 4JHBA 2EDBA 2VZTA 1OL0A 1ZSHA 1SJEA 2LU3A 4L9LC 4YLBA 3QVAA 2E7HA 1VFMA 1BOGA 1IAIH 2V5TA 5MEPB 3FB7A 5KZCD 5K69A 1RJLB 3LKPB 5KYUB 2IGLA 5KBPA 5K9QG 2J21A 1R5VB 2ED9A 1IO4C 4F57H 4XC1H 1VGEL 3MRNB 1NWOA 3DTUB 1MHCA 1W0WB 5I66A 1M7UA 4MNGE 3HZKA 3P0VH 4EI5C 3BSZL 3GMMA 4L3ED 4F9LA 1S7SA 4JFDD 3K8KA 4XPBL 3O0LA 5KSVA 1OSEA 2O72A 3C8KB 3AU0A 4UWQB 2OMWA 4G5AA 1R3JB 3K7UA 1CLVA 5CFAA 5ID1B 5JHLL 1J5OL 1NGXA 2WZ0A 5JIMA 4L1SA 5FLVA 1M2OA 4OCXL 1GGCL 5D8JL 1VIWA 5G5DB 5AVYB 4EN2A 1MHHA 1HQ4A 2PLTA 4W9FC 3ECBB 1P7BA 4EN3B 4LKCB 1KELL 1P84K 1U8OB 3M1BB 4WY7H 1O7SA 2GCYB 3FU3A 3EO9H 2XG4A 3QJFB 2GC4C 3H4HA 2WIMA 4NYLA 3T1FA 1PZ3A 4IIQA 3S5LA 3OHMB 1A22B 5J12C 5DD6A 1RU9L 2QQNL 4YGVB 1AHWB 4J4PA 1UM6L 5KSBB 4I2XA 1PLGL 3MC0A 2Z31D 5IVNA 3HUJF 3LRHA 3LJ3A 1RMFH 2YARA 2DS4A 2G5UA 1KCLA 3VD5A 4R2GD 3SPJA 2NDFA 3CFEA 2P5EA 1KCUL 5GPRA 1OF2B 4LKXB 5E0QA 3LSOB 4MLIA 3S88H 1RK7A 1PZDA 1G7HB 1NIBA 1RZFH 1KBKA 3MJGX 1S7QA 4L3FA 3VRIB 1UT2A 3VFGL 1MFDH 4KDWA 4X6CF 3FQRB 5JIIA 3CXDH 3NABH 2W65B 4YQXL 3OQ3B 4OGAC 4FLSA 4FCHA 3COOA 5DGRA 4YR6A 2D7NA 1M7DA 4UZSA 1T0MB 2CDEB 5JW4R 2Q86A 1P9MA 2ZP9A 1SNRA 1RZJH 5DEFA 5I0YA 43C9B 5FX3A 1A6AB 3KWXA 5E8OB 3QUML 3FH8A 1KELH 5KW9L 4GSQA 4KVCL 3ESPA 5JIKA 1VZGA 4ONGH 1ERNA 3OKEA 5DD3H 1ZS8A 4NPKA 3T0ED 4HKJB 5H37H 3O6KH 4AT6A 2B4CL 3BWAB 3O11B 5JW5B 1DJSA 2GJ6A 1FFNB 3GI9L 4L9LB 5ERWB 5I0ZA 5DC9B 2NOYA 2BSSB 1P53A 4N0FB 1U8CA 4G1EA 2BS71 2FECI 4ZFOA 4OT1L 3F7PC 2D31A 3KYKL 3EG9B 2OL3L 3R19A 3B9AA 5C0FB 3K6IA 3ZO9A 2EVIA 4QI3A 3MZTA 5DJCB 5E2UH 5DZNA 4PWIA 4F9LC 1AGDA 3V0HA 1TZGL 3TV3H 2A1WH 2WMPB 5EOCH 3FMGL 1ZLDA 2AJ3A 4MAYA 2OSWA 1MRCL 2APSA 3LQZA 3WGVB 5BCAA 1Q1JL 5EU5A 1CQKA 5I1CH 2AV7B 2RAMA 3KE0A 4JFYA 4GO9A 4D0DA 4WJ5A 3HMWH 1ZHKB 3FS9A 3SJVD 2N0KA 5HI4C 5KVFL 3VRJA 4YC2B 5DMJB 4HIQA 5HJDA 3S6CA 4WW1B 3WEMA 2ICEA 3VH8B 4YBQD 1QNZH 4IIQC 5EA0H 4P99A 1GGUA 3HBZA 2W07A 4NJAH 3K72A 3ERXA 5AOMA 2J1WA 3AT8A 1ZDQA 4HZAA 5KVEH 1MIEH 1HQRA 2WQUA 4AGOA 5AAWA 1KBPA 4MXQD 4HWNA 1DJXA 1KLFA 1FN4B 3PABA 3QEGH 4MRCA 4XCNB 4KH2A 1HCVA 3JV6B 4LCWB 4E68A 4JN2B 1OIOA 2R8SL 3OJVC 1UGKA 4Q0XH 3W0WE 3RVXD 1GGIL 2BVEA 3ILEA 1N18A 3ARBD 4P07A 3V10A 4TSCH 4KOCA 1TCRA 3CDCA 1OLLA 3HNVL 2IBZY 5HDQL 5J6HA 1TQSA 1CUOA 1AANA 4WUKH 4X4XA 5ELIA 5B7MA 3I9PA 3HC4H 3RURA 2Y6SC 1CIUA 2WWMC 4M5TA 3J7HA 4LPYA 1U8HA 2A3TA 1VZIA 1MIEL 4XN8A 3AY4A 4QRRD 4YHZH 4P5TC 2E9JA 1NOLA 4HHWA 2GJPA 3TO4D 1NBYB 1ZRUA 4HSCX 3EHBB 5CIPA 3RL2B 1DJZA 1NMCC 4IHOA 1A3LL 3ILQC 4X6DB 3GLDA 1TPXB 2NNRA 4U2ZA 1GCFA 1QSEE 3NRQA 5DQDL 3LQAC 3ATAA 4DQOH 4AQ1A 4B7IA 3E3QE 1BX2A 4PJXF 4DK6A 3GDBA 2WO3B 4RMWA 3QQDB 1OQOA 1LWJA 3GZKA 3LH9A 4BFIA 2XZQL 4IEFB 4LFHG 4FNLL 5EMYA 5FFOA 4NWUL 5D6CA 1MRCH 2F8XC 2V2TB 2JJWA 3CFJA 4E42A 1NFKA 3MXVH 5IJBC 5AB0A 2EEXA 1A7QH 2COQA 4ISVB 4WJKB 2F9BT 3IU4L 2FO4B 2EADA 3NCEB 5I16B 3X11B 1SOKA 5M94B 2GHZA 1E8ZA 2R1XA 4K2UL 1TZOA 1I8MB 3VFNB 3GGWB 1H9VA 3U9WA 1XL6A 3MJ7B 5GIRB 1ETZA 2ZKWA 4M8VA 1F4YL 2IDSA 1KIUB 4FKEA 1I7UA 1N0LB 4XXWC 5GS3A 2HLEB 1BPLB 2BO0A 3D06A 1IBFA 4LVEA 3VD9A 3CN1A 4M3KB 5C07E 1FHGA 2C4FU 4P3WA 4RCAA 3TOPA 1RIHH 1VSCA 2X4PA 4AG4L 3EFOB 1NAMH 1L9MA 2EUWA 1EEQA 2VMDA 3C08L 3GEWB 1JXFA 3WNNA 3FQWA 4NRZA 1NCBL 3BLPX 4MNQE 5DFTA 2C3XA 1PG7H 4H0IA 4TULL 5GGVL 4YQXH 5DYOB 2KUTA 2O5XL 2WBJC 1I8IB 2PW1B 3K4DA 1I9IL 5B4MC 5JXEC 1E3XA 4ZTPL 4EI0A 1MWAA 1U0QA 4IBVA 3MOAL 1RIVH 4BH7A 1KTKE 4HUXB 3K6OA 3L7EB 2QR0A 3PWPB 3V6BR 4KJPC 4B0MB 1FFPB 5FFLA 3KHOA 3KR3L 1I4FA 1AAJA 1FCCA 1EFXB 2FEEL 2IIJA 4FG0A 4QRQB 4LDLB 3GMOB 5EZLB 2HFGH 1QHQA 3D2UB 4UV4H 4PY7A 4A6YL 5KN5A 4XNZC 1QWUA 5E2TL 4Y4FA 1U93A 3JWDL 3F58H 2HFFA 1E4XL 1OARH 2EKSB 1X5AA 3V6ZA 1R3IL 1HHKB 2DQTH 2YPKB 1MHHB 1G7IA 2BXZA 4F27A 2Z93B 5HGGS 1KPRB 2D3NA 4P4KB 4P5TA 3K6SA 2VE6A 3NSDA 3O3AA 3KBHE 5DMIL 4DEPB 1QPPA 1MSPA 5AYUH 1YPZB 3FPXA 1PSKL 4E42B 3K2UL 1QKZL 4NQXB 3TBVB 4C4KO 4Q52A 5DO8A 1Q90A 1XB3A 4XWOC 5JQ6H 4FQXA 5SWZD 4JM4H 4NFBA 5FPIA 2JJUA 5MEQB 5IQNA 1IM9D 2OULB 4YDZA 1KJ3L 5GGUB 3WAJA 3WSQL 1T6BX 2AK4E 2Z3FA 2XWBA 3MRDA 3OM3B 3SOBH 1IGML 1WUZA 3FCTA 3OLEA 3MLWH 3PNWA 1PEWA 1E4XH 1JG9A 5ISZD 4HV8A 1UZ8A 1N6UA 3GSUA 1MCPH 4CU8A 1QFOA 2FX9H 1T4KA 2WCSA 1CCZA 4WO4A 4FI8A 1I82A 1JZHA 1Z5YD 2CA3A 2XWTB 2XTJC 4X98B 5JR1H 4ZUUA 4GAGL 4PJIA 1TO5A 2H32H 3PJLA 5F1NA 5HPMB 2CRZA 2QPEB 5ESVB 5I0XA 4TVPH 4OFDA 2OTUA 4G59C 1JL8A 3NFPB 1KGWA 2FHCA 3HE6D 5FYKU 5EUOF 2L4OA 1CYGA 3W5MA 2QQQA 2KI6A 4XMXA 4N90D 3X14A 1ML0A 3UTTA 3U6XS 3AQYA 3HI1A 4PJDE 3O2WL 2CK0H 3LXUX 2FX9L 1MFMA 4PV8A 1P2CB 1KPVA 1R5WB 3FTYA 3O8XC 1JFHA 5B39B 1HEJC 2FB4L 2WVSA 2J88H 2JK5A 1QWNA 5IQ7L 1MQ8A 3RWIA 2HRHA 2EIBA 5IIEB 1RK0B 4UQEA 4B95C 4N2IA 4YSQA 2CGRL 4YNYB 3WKQA 3EH4B 2VITB 5DK0B 3KL0A 2GITA 1HH6B 1U92B 3QUYC 4AC2A 2YQGA 3ME0B 4JFZH 2GG1A 1NC4D 4WAFA 3V4VL 2F0CA 1Z5LA 3D4CA 3C6SB 1ID2A 1TYEB 3E6HA 4XNYH 4Y16B 2J73A 3M17B 3TH4T 3UTQA 3ZKNC 4R90L 2HT2D 4LBEA 4X8GA 4ZX6A 2OMBA 5IWLC 1IV8A 5D7JB 2CKNA 1TFPA 2QV4A 1TTFA 4QUOA 3MRGB 4F7CA 1HJCA 2YSSB 1B3JA 3SZ6A 3K3QA 4ZO6A 5T3XD 1M7IB 1BD2D 3ARWA 3UZEC 2UX6A 4X9IA 1I7RB 3QUZB 4QRUB 2XIBA 1LEKB 3R1GH 2EDMA 3UP6A 4IBYA 4LLVB 3DGGA 4PBDA 5DUML 3VXOB 5T1JA 3EUUA 5TH2A 3ZTNH 3C09B 3LPGA 4M7ZC 2VR3A 3MRKB 1CLZH 2HX9A 1XGRB 2J1ZA 1NC2A