4ZZFA

Crystal structure of truncated flgd (tetragonal form) from the human pathogen helicobacter pylori
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
146
structure length
146
Chain Sequence
NSVSMIGKIAETDVSGANFDGNNKLSFSLFFDEKIDASKGVPAIQILNENNELVKTIPLKDYNGQKGYINFEWDGTNEKGEKVPKGNYKIKAEYNLDSHSKQYLQTRIGRGEVESVIFDKGKPMLRMGEMVLPIDSAIEFYQPDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar basal body rod modification protein
publication title Crystal structure of truncated FlgD from the human pathogen Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori 26695
molecule tags Motor protein
total genus 32
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4zzfA02
3C12A 4ZZFA 5K5YA 4ZZKA 3OSVA
chains in the Genus database with same CATH superfamily
3HS8A 1UJ3B 4ECNA 3QUXB 3RNQA 2XKUA 4X9YA 2DS4A 4Y5XB 2NSXA 3NCXA 2XNAB 3UEQA 3THMH 3CN3A 1D5RA 4XH2A 3VNZA 5EZIL 3X3GL 2A6JB 4PGBA 1NDGA 3TC9A 1VEOA 1PCSA 3GZPA 1J05A 4W9CC 3II3A 3WNMA 1LO2L 2VXVL 4F2MA 1U8LA 3O11B 1L0QA 3PHAA 4APQC 15C8H 3BLPX 4XBPA 1X9UA 1RZKH 3DETD 1IC7H 3MPCA 3N9GH 3GIVA 4ZTOH 2CH8A 3NH7L 5B4MD 2ZUVA 2I9TB 3BGMB 2OL3A 4NDMA 1FSKB 4JGMA 2Y2YA 2EEXA 3DMMC 5DUBB 3RILA 2W9DH 5FLUA 5EF0A 2ZKYA 1MCPL 2GPZA 3ZT6A 5JPNB 3ABLB 3JZYA 2V17H 3EJTA 1HI6A 2XKNB 5I16A 1RL1A 1F4YL 1YYML 3KW8A 3UTTA 1E8ZA 3BKCL 2HN7B 1GGBH 1R3HA 3OZ9H 4G72B 2GITB 1U58B 3FF7A 5I1IH 3NA4A 3MYZA 4X2UA 2WBJB 2FBJH 2G2RA 3V95A 1SM3L 1NCHA 3IMUA 3C5XA 4JK0D 4KZCA 1I9RL 3H9SA 2W07B 4AQAA 1CCZA 5C0IA 1V7NL 1OAZL 3KBFA 1O9WA 4OCYH 1ACCA 1F11B 3UJTL 3UPCA 3NSFA 1NBVH 5A2AA 3LAFA 4I18C 4QMEA 5HDOA 4KJPD 3HW7A 1YY8A 5IFHH 4PWGA 4H20H 4GRWF 1IKNC 3EOYG 4J23A 2BOBA 3ROLB 1JZDC 4PLOB 3UAJC 3QPKA 3X14B 3PHSA 3KLSA 4KKLD 4RMUA 4UMGA 1KXTA 4XWGH 3MRBA 1MJ7L 1KWKA 5H37H 4Z7VA 4W9DC 2Y72A 4YUEH 2Z91B 1I53A 2BMKA 3IJHA 2Z92A 1AFVL 3M7OA 5C0ND 3VXQA 4POUB 3S2CA 1SBSH 1URZA 4KX9A 2PYEB 2WZ5A 4CU8A 3LRHA 2D7OA 5K9KA 3TH2T 5ABDE 5AUMB 4XNZB 1N64L 2NY7L 4QF1A 2OLDA 1E8YA 3TURA 1E30A 1XV8A 4BKSC 1F6AB 3I74A 5E6IC 1UZ6E 2PR9A 3WKMH 5I5MA 3DOHA 4PP2A 3GRWL 1XGZA 1OEZW 3H0TB 4N9GA 3VMNA 3T8MA 2MRYA 2R69L 4XP9H 3U2SA 4DETA 1QSEA 4LRNL 5CJOL 3ES6B 5HYEA 2FO8A 2IC2A 1KIPA 1FE8H 3UBXB 5HP5A 3SDCB 1QSFE 1KDIA 1YAZA 2PCYA 5I6KA 3REVA 3AXLB 3VXUB 2GIYA 5EIIG 4S1DC 1R0AH 1J9CT 1BPLB 3M86A 2NNAB 1DEEB 4IK6A 2P28B 4KROC 2IDCA 1MJ8H 4M5ZH 3V0HA 3CSFA 3VW3H 3HC0A 4LB8A 4J3OG 3ZTDC 4J8RB 3ZDYE 4XHJC 1BQKA 4GXFA 4G6FB 2CO3A 1NDMA 4IIQB 4EVNB 4J3VA 2B5IB 3D4CA 1R3LB 2EO7A 2JLLA 3DHUA 3O2WL 1AZNA 4QNPF 1BXAA 3C2AL 4Y4KD 3V0WL 1CBVL 1DO5A 1CB4A 3LJ3A 3RNQB 2SODB 1CJYA 1FRGL 2HKFH 4IRJB 3L3OB 4L0YA 4N1EA 2VXTL 4MWFB 1DJSA 4FHBD 3D09A 2E5EA 3TO4D 3QIBA 4ORGA 4XMTA 2EVIA 2EE0A 4HBCH 5E5RB 3ZDZF 3GWJA 5DMKB 2EXTA 1D5ZA 4NX0A 3TN0D 3VH8G 3SY0A 1K3ZA 2VLJD 4HJ0C 4X83A 3ARYA 2H8PB 3VFPA 4G3YL 3FO0H 3HI5H 3Q2WA 3V6FA 1KJ3H 3VXOA 1RUPL 1T7ZA 3FUKA 4N87A 3GXMA 1J8SA 2X70A 3WS6A 4TVPH 3FBQA 4F8QA 1VLXA 5F72S 4XVJL 5ICXA 1QHOA 1QFUH 3GRWA 4HISA 2FUQA 4JFDB 1CBJA 4W6XB 2PWFA 4ONOA 4QGYA 2R69A 1J9RA 1R3HB 2QQQA 4JPWL 4NQDB 5EN3A 5BUGA 2XVGA 4JG9A 3DUSB 5E4IA 5IG7B 3CFBB 4X8JB 1P4IH 3IU3A 1F6FB 3N06B 1DVQA 4NKMB 4RFNB 4HZAA 1IM9A 2KT6A 4N0UE 4BSVB 3ZT7A 1XGUB 3X12A 1C1EH 2VB5A 1HS6A 4WI6A 3QJQB 2BWDA 1VFMA 3VTAA 1GGCH 1MZZA 1E2ZA 3FCGA 3QNZA 3VD1A 2GJJA 1EEYA 3RZCC 5JA9A 4AJ0A 3TJEL 4GIAA 5I18H 5D9SB 3BKYL 4TVPE 3MUY1 1WEJH 2A6DA 5EWIH 1MEXL 4I77L 1FFNB 1GSMA 4G6KH 1I9EA 2C1PB 5DD1L 1HXYB 5CLWA 1UWXH 4DPAX 1KYOK 5IW6B 1PQZA 3KXFE 2CLVA 3ZO0A 4HALA 2WB7A 5AVYB 2Q5BA 2XWJB 1AH1A 3MLSL 4A67A 2BMKB 4FQCH 3VFNA 4ZYKB 2WNXA 4KMTH 1BBJB 1U93A 2F5BL 2IOMA 4GT7A 4KY1L 2ZKWA 2AQTA 1BAWA 3CFEB 4TNWK 3V4VL 1TR7A 5D7IF 1Z9LA 1UT9A 4OLVH 4S2SB 5CCKH 1MW0A 3QPQD 1KWGA 2YD3A 2NYYC 2QDVA 1WZMA 2JKWA 3B9EA 1XMEB 3V4UH 5TGBB 1BYNA 4X6BA 1PIGA 3FTGA 3CFJA 4J4PA 4TQ8A 4RMSA 4CNIA 2EXWD 2YPLD 4PJ8D 5K39A 3L9EA 2AW2A 3Q8EA 4JS7A 4MYWB 4EZLA 1MCRA 1SHWA 5EOQH 3LKQB 4ZW8A 4GAYB 4UAHA 1U3HD 2YQBA 4A6YL 1P5VA 5I1JL 4LPTA 4ZFGH 5IHWA 5GZOA 5BMFH 5ES4B 3OJ2C 3V4PL 1CLZH 3PWVA 3HN3A 4FI6A 2XJKA 2C26A 5E1AA 3S3PA 3O6MH 3TWCL 2WCSA 4BK8A 3REVB 1U8QA 1JZ5A 2VQ1A 3RHWK 5C7XH 1LK3L 1AD0B 1WUZA 3QJUB 2YIHA 1M53A 5HDBB 3AQXA 1GW0A 1V5JA 5F1NA 3D39B 4G5ZL 4P9HH 4S1RH 4DP2X 4FA8A 1D9KC 3DX1A 2X4QA 3IDIA 3PQYE 4BUHA 1ZV5A 2YK1H 4Q74A 5C0CE 3O9WD 4YBQD 1HHJB 2Y7QA 3ALPA 4IHOB 4OGYL 1FPTH 2F53B 3GXPA 3FKUS 4GP5B 3TYGL 4I3SH 4MNGB 4IU3B 5CKGA 5GRXG 2XA8H 5DD3H 1KCUH 2V37A 2YGNA 3MRQB 3D30A 4NQEE 2YQ3A 2JJVA 1JGDA 3VI3A 3QIBB 3ZIYA 3QZOA 3VXTB 5IJVA 4M43H 4OY9A 4E9TA 2CKNA 4Q6KA 1A02N 1AY1L 2CGYA 3MJ8A 1IC5H 2Q2EB 3U2JA 5K1JA 1TUPA 4JMNA 1FZKB 3UTQB 3E8UH 4BBWA 2AZAA 1V3KA 3MO1B 5AD0A 1LP9A 3TM6A 2C34A 5E2JA 3ZL1A 1CLYH 4AW7A 3V4VA 4EN3A 3PE9A 3RDJA 2DMGA 2JB5H 4LVHB 5DI8B 3I3EA 2X70B 4RGND 1AIFA 1GY2A 1UXSB 1U8CB 2ENQA 3B6SA 3KPQA 2Z0BA 3M46A 4JPIA 4PV8A 5CKAA 1HJBC 1IMHC 2NPLX 1PU0A 3WMSA 2B4CC 5BQDA 5B1JC 1AGDA 1FO0L 3OB8A 3Q5TA 4JHVA 3ET9F 1R5WA 5DZAA 3CWGA 4OZHA 5IGXL 1SOKA 2AQRA 1EHNA 4EO5A 4A6YA 1CL7I 3ZDXF 5C70A 2WLLB 3E1F1 4G9FB 4HSQA 1BQRA 1R1CA 3V4PA 2AJUH 3Q05A 1G87A 2ZJSH 2GHZA 1KTBA 2PXYD 3RWJB 4JKKA 3UTSE 3HHSA 1JF6A 2XZAH 5HHMB 2QKIA 2XBTA 3NN8B 4U3CA 4OAWA 1NA8A 1WITA 4O2CB 3O8XD 3EJCA 2GJ6B 2VZ1A 4Y19D 4JRXA 2ZOKB 2P8MA 1WA0X 3QFDA 3T8XA 4NUGH 5D8JL 1MPAH 1EGJH 2HPOA 2X0VA 4M6ML 4ALAH 2CRMA 1P69B 1ZIAA 5BRZD 3PRZA 1MIML 2CJTA 1KTRL 4K23H 1O5PA 2FT8A 4WNQA 5J8OA 1QP1A 1IM3A 1KN2H 1FVCB 3CE1A 4FTVB 4YSRA 2C3GA 3FFDA 4AEEA 3WLBB 1QBMH 5DJXA 4KXZH 4WSGA 2HRHA 4QRUA 5E7BA 1F97A 3NRQA 2CGZA 2EECA 2O5XH 12E8L 1E9QB 5KAQG 3L17A 1XF1A 1UOWA 3LB6C 1OHZA 2Q6WB 4XO8A 4JFFB 1FGNH 1T04A 4MQSB 3GBMH 5TFSL 3UABA 3MXWL 1QFWM 5HJ3A 1DVYA 1F2QA 3B7RL 3DX8B 4GKSB 2OMYB 3HBQA 4H8UA 4X6BB 3M6DA 3GINA 3RFRA 4XOCA 3K4DA 3UTPE 5K39B 1PLBA 4OGQC 1KBVA 1F56A 4Y2OA 4F93B 1LE5A 4JQXA 2PP7A 2Q8AL 3ZW3A 1J8RA 1FL3B 4NC1E 1KEGH 2KZBA 1DJWA 3JYCA 3GJFA 5CZVH 1FO0A 2H45A 5B8CC 3L5HA 2AK4A 3HS0A 4X9FA 3WXVL 2AS5M 5KJ4A 1PS3A 3LKNA 5C0DB 3RGVC 5I26A 1MHHA 3TT1H 1JI2A 5GRYA 5E2UH 1D5IL 3QFJA 1CZ8H 3AC0A 4HIEB 3OHMB 4C58B 3QR0A 1KBGH 5I17B 5F1NB 2A74C 2Q76B 2R4RL 3IJSA 2MFNA 5GRVL 3QUZD 3LDBB 1M7UA 3NCBB 4IBYA 4UT9H 1X6LA 3RIAF 4AXWA 2NNFA 3JTBA 4PJDE 1AC6A 3JV6B 4HU2A 2Y7QB 3E6FB 4CSTA 1HNYA 1GXEA 3N85L 3ME0A 1A9BB 4B9YA 2BCKA 3CLEL 3RKDC 5D1QC 5I30L 2CO7B 5SWSE 2DMCA 5DK3A 4M29A 4JRYD 3APCA 2R59A 4OD2B 1H9VA 2B16A 3N1PC 1D2OA 3VI3B 2VL5B 3A0OA 4H13C 4L3AA 1QQDA 4ODWB 3GJFK 4PJHE 5MEOB 4WHCA 1OHQA 1RK0A 3QARA 3B7UX 1TQVA 2XWRA 2YGQA 3F58L 4NCDA 5GGUB 3FCSA 4BUQA 4MQ7B 3ZU8A 1BQHB 4LCWB 4F8OA 1UM4L 4DCQA 1IEAB 2KLTA 4YGVA 3ENEA 3KLAA 1N26A 2EIBA 5IOPA 5C08E 3WIAA 2VJ0A 2YEZA 3BEWB 4I2XA 2WAHA 3ZMEA 1IGCH 3OG4B 5E95B 3TS8A 3V7AG 4ZO9A 1KTJA 1I9IL 4JPIB 4LLYA 2AXHA 4PV1C 4TLTA 2WZPD 3HPJA 1MF2H 2AAAA 2ZUXA 1KCRL 3GXDA 1C5BL 2VTFA 3F7YB 1ZA3A 4K73A 3VFVB 4B97A 3RTQC 4UT6L 5I73B 1XD0A 2FECI 4NUJA 3FTXA 3VTTA 1QPKA 5FB8B 3SGKA 3U0PB 3CZUB 4G5AA 4XMLL 4ZW7A 1ZHNA 5T8IA 5DU7A 4Z5RB 2CGRL 3NFNA 2X2IA 4D0BA 3MV01 2Q87A 5C0AD 3TIEA 1M3JA 2Q1EA 3GS0A 3NVQA 3FB5B 1JPFA 3QEQD 3CBRA 4MXVF 3ZZLA 4OFYA 3A3YB 4OAWB 3O0RL 3IDXH 3IT8D 3CLWA 4XBGA 4I87A 3AG1B 5HGAB 4GPVA 4B9IA 4ZFOL 1NWOA 4EIGB 5FS5A 3UJJL 2BNRE 2OJZH 3AREC 2A73B 1PKQB 4M1DL 1CD9B 2DLHA 1XH1A 2I07B 3INUH 3C6LB 3TCXA 1BIHA 4PRHA 4F92B 1T0MB 2X87A 4Q89A 5AVQB 5C0BB 1OP3K 4MNQB 5KS9A 1G7PA 4PIBA 2ADJB 3ULAB 2QR0B 2I69A 2UY6A 4QRUB 5SWZE 1ZT7B 2BIMA 4GS7C 3ROOA 4PJ7B 5GGRY 4MXQC 1IAIH 1IAKB 3HZKA 4WU7B 5I0ZA 5C6TH 1B4LA 2YLKA 2DY2A 2Y0SA 3FFCE 4RMTA 4W81A 4X6DB 2Y5TA 3GNML 3SYPA 4HKJA 1OPGH 3FZUC 1VENA 2MEJB 1TQBC 4KUZH 1L7IL 4I48A 2ZSVA 1X4ZA 3RFZB 1I3RA 4WWOA 2LFGA 5GRVK 1FN4B 1PG7L 4N6RA 4YO0A 2MWCA 1UGKA 4MCZA 4N26A 5ABAA 4QRSB 1K8DA 3SN6N 4NNYA 5IP4A 2FNWA 2R23B 5EPMA 1I85C 3ZKXC 3IETB 4F15B 3QJVB 2DWEB 2J6WA 4F57L 4PTTA 1IAOA 2GABA 4XOBA 3PAUA 1MI5D 2QVIA 4KI5E 1MFVA 2R27A 5T5NG 1MFAL 3AG3B 2BZDA 4AXWB 5GS2H 3HC4L 4FQHA 4OZIB 4XXWC 2RMNA 2NZIA 4G43B 5BPPA 5K9JL 4PCSA 1NSNH 4OB5L 3VG0H 1JZJA 1TMQA 4ZFOA 4D9LL 3K4AA 4X7SL 3EDFA 4ENZA 1LYQA 1U21A 4C57C 4Z95L 4MJHA 1YNKH 1FNHA 4YHYC 2G4GA 3J7HA 5AW4B 2Y07L 3OAZK 1M71A 1FL6A 1YG9A 3BP5B 1NEPA 1BQLL 1OLZA 4JEGB 2CUAA 4HUMB 4AH2B 1TETH 3UO1H 4I85A 4NAMA 4PMFA 1QG3A 1T1XB 4NO5A 1U2CA 3KLAB 4LLMB 2DIJA 3SDDC 3LN4A 4G1EA 4H0HB 5KSUB 1A6ZA 3VYNA 1PD1A 4QOKA 2E9JA 1P5UA 4FL4B 4JG5A 3ZIMA 4CMMA 3DRTA 2X9WA 4P0DA 2AXFB 2VLME 3B83A 4BFIA 2IG2H 4N1CA 4YDZA 1ULVA 5E0QA 3WUWB 5D96C 1OTTC 1G1CA 4P5KA 4FQIH 4QXUL 4YHLL 4A38A 1HQ4B 4DEPB 1NBZA 2Z9TA 5IBTH 4XNDA 1DJZA 4N4YB 2BC4A 2QFPA 4YSUA 4XC1H 1YSOA 3QA3A 1E4XL 4G6MH 1AHWA 4Y5YB 4BD4A 2X0UA 4WUKH 2QVTA 4QHNA 2WP3O 3AY4C 3GSVB 4RMRA 3FUEA 4I5BA 4X7TA 1E4WL 1KN4L 4DQOL 4WW2A 1GS7A 1QD0A 3F6LA 1S8DA 5A16A 3BZEB 4MQXC 3UMNA 4LASH 3QW9A 5GS1A 1T7YA 4F7MA 1H19A 1OGAE 1UM6H 5BVPL 3G9VA 2ZWNA 3KYMA 3NZ8B 2ZXWB 5SWQB 4YXLH 3SCMB 4HFWA 4WHTA 1O7SA 1AVAA 4JDZA 4N8UA 5EU4A 3NTCH 4YEFA 2VCOA 3DUUB 5TDPB 3VFWA 2WNWA 3TJHD 5CZXC 4PRHB 1KTCA 4FFZH 4AKOA 3R4DA 1OB1A 3S37L 4KJWD 3FJTA 3ELQA 4WTWA 4ZUSA 2J5WA 1G7MB 2ATKA 4QTIH 2XWBB 3NQIA 2BWIA 4GAFB 3D0LB 3K8LA 3ZKMC 5C9JB 3UJIH 4IS6B 2EYTA 3P73A 3PP4H 1AO7E 3GMNA 4H8HA 2VABA 2ITEA 4OH2A 1MWAH 4TUKH 4AGNA 3QYCA 3APNA 1TZIB 3WL9A 3T0EE 1DANT 3L1FA 1CDCA 4A66A 1DN2A 4GXVL 4XAWL 5DMYA 3QUYA 5SX4I 1CLOH 2Y1ZA 4YXHH 1X4YA 2HTKD 1XR9A 2GB2A 4NPJA 3IXAA 3QJHA 4QXWA 5FYLE 3L3IA 3CVBA 3R19A 3D33A 5BV7C 3FO2B 4GXUN 4N90D 4PYGA 2WC7A 3WFCH 1T0OA 5EZOL 2WUCL 5T3ZL 1FYTD 1T2JA 5LN4A 1DJIA 3SKOB 3IFPA 4QTFA 4TKWA 5DVNA 1J8HA 5F7UA 3BCFA 3OLDA 5D1ZA 1MRCL 5B22A 2ISDA 5M95B 2G60H 4E5XG 1M1SA 4KJQD 4NUPA 1WJ3A 4WK2B 2YSSB 1UT1A 3H2QA 5CGYC 5C2UB 1J5OL 2LGNA 2HZHA 4KVCH 3UGXA 3MUUA 3ABGA 4QLWA 1SN5A 2W0LA 3EFFB 3EDEA 1D7DA 4ETYA 2DQIH 1R5IA 2W0PA 2ZUSA 1L9SA 2VDNL 3GLAA 4PS4H 3UC2A 1E42A 5L88L 2CJUL 2HH0L 3FNKA 4BA0A 1ONQA 4DPBX 1MELA 1Z9PA 1AP2B 5LXGL 3HJ0A 1RAMA 4EPSA 4BIKA 4O5LL 1TZGL 3UZQA 4AX3A 4M8QA 4M7KH 1JZFA 4FKHA 5I1CL 2NX5A 3KGUA 4NQQA 3GUTB 4BE5A 4OSUL 1L0XA 1JI1A 4RNRA 5MEPB 5CMAA 1EWHA 2Z35B 1GC1C 2ZCKL 4RGOL 1LEKA 5TF1L 2X3CA 4C4BA 4P2OB 5C0RL 1RZJC 3TZVD 1MHEB 1MCQA 2J88L 2VLKE 4FNPA 2AXJA 4G1EB 4MCNA 5IBLC 3SPGA 1BGXL 4XNUH 5EZLB 3MGOA 5JO5A 1FDLH 3WUZA 3MRHB 5SX5K 3E2HB 3K6OA 5ILTH 1V7ML 4ZXBA 2XY1A 3CU7A 3ARQA 4GUOA 1KY6A 1U92A 4JDEB 1NFDF 5GGSA 3P30H 4OF5A 1YUHB 2KYIA 3DXAD 2E27H 1P4LA 1NC4A 2NXZC 2VZSA 4O58L 5K1VA 5IHZA 4EZJA 5I74B 3E3QC 3W9DB 4ELKA 1DBAH 1OWRM 4Q2ZA 3GKZA 3Q9QA 2F5AH 4U6HB 3MXVH 3RDTD 5L2JB 5I1HH 4U1KA 2A6KB 4K3EL 3PWNA 3DHMA 3A23A 2OMVB 1OAQL 3VFSA 3HB3D 3DGDA 1HOCA 4OLYH 4RWHA 5IB4B 2KERA 3F12A 1HQRB 2DYPD 5DQJA 3IDMB 3SJVB 4Z3HA 3Q8BA 3ARBB 4HS3A 3TBWA 4K5MA 5LDSA 2WO4A 3L8QA 4LLWA 1A9EB 5FFOA 3GSNL 4V1DA 5IVXB 4LSVL 1BOGA 3DV4B 3QEHA 5DGQA 4BK5A 3QC6X 4KKPA 1TKWA 3IE9A 4GUQA 1V05A 3TEUA 4TPRH 2BVOA 4MJ5A 4W70A 5DDHA 1ODAA 5E2TH 3K5RA 3NABH 1QNIA 5BS0E 2B2XL 2F61A 2IAMA 3GMRB 4Z7QF 5E9DE 1GZPA 2D7TH 1WAPA 1YEIH 4AIZA 3P73B 5CILH 4X8GA 2WVVB 4X7DC 2JNZA 2P3YA 1CC3A 1ACYL 3QHFL 1X9LA 5MI0C 3LN5B 3O45A 1ID2A 5CEXA 2R0WH 4ODXB 4P57A 3LXAA 1QEWA 3OKKB 3QUYB 4P5MA 4O02H 2X1OA 5T1LD 1AMYA 2O30A 3Q8AA 4MCMA 4XCYA 4G70B 5AVUB 3P9LB 4WHYG 4MRCA 4XCNA 2VN6A 3THML 5ACMA 3SB3A 1G9EA 3X1NA 43CAB 4PGJA 2CBQA 4K8RD 1TMCB 2F7QA 4P2QA 4BZYA 1AJ7H 1S7TA 1LGVA 3PLYA 5B39G 1J8HB 3GI8H 15C8L 4NQCE 4R96A 4Y4FD 1RZKL 5AW2B 3N9GL 4ZTOL 3I6GA 3ZMNA 4XE0A 2F1EA 2JE8A 4WWID 3EG9B 1E4KC 4IOIB 5IEKA 1OP4A 3RWGA 3ZKND 1WCQA 3IFOA 2W9DL 1IGJB 3E9TA 4PGDA 3ZE1E 2VZ3A 3DX6A 4OKVB 1C5DA 2D9CA 2CHXA 2V17L 3CZFA 1UURA 3GSUB 3WNPA 1TVHA 4Y16C 2XZZA 3OZ9L 5F8RC 1GGBL 4HX1B 2CDFA 4TLUA 4NHCH 1NCBH 2P46B 2FBJL 5H94A 1DLFH 3SEPA 1JNNH 1RQ5A 2BS9A 4BJLA 4JKWA 2VZTA 5CJXA 3F85A 3KCPB 1UM5H 1JNLH 2GCYB 1B2WH 4HKZB 1NL0H 2H2SC 2FJSA 3DTUB 1RIVH 4OCYL 4TNVK 5LXVA 1QI3A 1NBVL 3IN2A 2V2XA 2OCJA 4LF3B 2LU7A 3HAEH 3WNJA 3DGGA 3PUCA 2J8UB 4M1CC 5IFHL 1FV1A 2JV6A 2YRLA 3MJ9H 4H20L 2N3JA 3MV11 4OCNC 5HYSA 5E94B 4Z7WE 3CZEA 3MLVH 3KPOB 3MVSA 3MRKB 4XWGL 5ALBH 5J12B 1F1DA 1UZ8B 3NUKA 4NC2B 4LPCA 4ODTH 5ESQA 3H3PH 4YUEL 4HG4J 2DL9A 5CLZA 2NZ9D 3VD9A 1YCSA 3TBYA 1RH8A 1SBSL 4PJIF 1T2XA 4UQ9A 4I1RA 2WSPA 4R7LA 3CDZB 3ESPA 4X0KB 1YNTB 3KLKA 3UTZB 5LGJB 1IBZA 4IMKC 2EEFA 1GR7A 4GW1A 5D7LE 1J0JA 1OGSA 2X6UA 3WKML 4E41A 1INQA 4KO6A 1UB5A 4JM2A 2ZUUA 4JFHD 4KKCD 4QLRA 3O3AA 3WS3A 1GOHA 3LKPB 4RWYH 5INCA 1E3FA 5HHPA 5MEQA 5DJ8B 4Z7OB 4GG6F 3TEWA 3U4AA 1FE8L 2R4SH 2A5UA 3L3DA 2VUKA 5GZOC 4DHLA 2BIHA 3HG1B 5DHYB 1LD9A 2NY4C 3WE1A 5E4OA 1R0AL 3V4LA 1N70A 4PLKC 1A0QL 3FH8A 5GRJH 3ARZA 2CBPA 1MJ8L 2CRZA 3N5AA 4M5ZL 2IAMB 3GIZH 3VW3L 2R1XA 4R7NA 1HAUA 3QO1B 2K70A 4APXB 4TLSA 4Y4HA 4CL7A 1JPEA 1G6RB 1U91B 2NY6C 3AW5A 3C60A 4MA1C 4AQEB 1ORQB 1Y18B 2HX8A 1YHPA 1A2YB 4PG2A 4M6AA 4Y1TA 3TO4B 3T8VA 1MLBB 1X7TA 1BVLA 1WFNA 4LLQB 3BZ4A 2HKFL 4DFIA 4NT6A 3RB7A 3KLHC 4Y2LA 3UADA 4R2GD 4DH2A 1R6VA 4U7SA 3A5VA 4P5TD 4D8PB 1JUFA 1BF8A 1Q9KA 4X98B 5EFIB 3FULA 5H37A 2Z8SA 4G8GA 4HSAC 2BS8A 4OT1H 1PSKH 1ET7A 3KH4A 3UXFA 1QR1B 4MMZB 1HILA 3PREA 1QSFA 4DGUA 3PJSB 4KO5A 3BAJA 3FO0L 2VWEE 3HI5L 5FF6B 1KJ3L 2Y24A 2PP9A 1JZ2A 1B0GA 2Z31D 3FQXA 2JI2A 1Z3GH 4EN3C 1B0WA 2IXQA 3PS6A 3T2NH 5ANME 3QFGA 3C12A 4TVPL 4M93C 4PGDB 3GMMA 1CLCA 3RL2A 1DYZA 3MMEB 3TXAA 2DOCA 4LBAA 4N2IA 1DVTA 1NUDA 1F90H 1OARH 2A1WH 2FYVA 1S5HB 3VNYA 1VB9A 5H8DA 3RU8H 3DVNA 4IKJA 4GSUA 1P4IL 4LFHG 4BXVA 3D2UB 2XYBA 4HOMA 1JZ3A 1RPKA 2BP0B 1ZE3C 2E56A 1U8HB 3CN0A 1YEKH 4HIHB 5JPMA 3FUMA 2X40A 3VFTB 1SY6H 1C1EL 5B38G 2EYSA 2DF3A 4Q6IB 5HHNA 4ENEC 2QKIC 1GGCL 1AR1B 2QSTA 4WVRA 2YXFA 4ZMWA 3A47A 1EFXD 2FZ3B 3NSJA 2V2XB 1TVDA 3MRJA 5I18L 4X5QA 3U48A 5A6LA 5JOFA 5DYOB 4XZUA 8CGTA 4UTBL 1WEJL 3OLEA 5EWIL 4KKBD 2QVKA 5HI3D 3LSOA 2FO4B 3TF4A 4G6KL 1DVFA 3LS5H 1JDDA 5F1KC 3W5NA 1M7DB 1FG2B 3QUMB 4PJ9D 1ZT4B 5F93C 1W16A 3QULA 2X4RB 5DRZA 5AOMA 2V0AA 4X9IA 5DVKA 1AQKH 3SDAB 1M6OA 1VGEL 4FQCL 3RVVD 4Z0XB 3M1BB 5HSFA 4KMTL 4PCTA 1CGXA 3ZE2F 2CKBH 1S7UA 5E6ZA 3HI6H 3VB9A 2F7IA 2W92A 4OLVL 5CCKL 2AQ1A 3AS3A 2PCXA 2Y6SD 3DHPA 3V4UL 1HZHH 4GW1B 4HCRH 5CIPB 4B3VA 2G9HA 2GI7A 2AJYH 1EXGA 3OJDB 3EOAB 2CIIA 4PY7B 1M42A 2AGJH 2XU9A 2XY2A 1CE6B 2F7RA 4JM2B 2EC8A 5EOQL 5F7DB 3BUTA 3UGEA 4JN1H 2KL6A 4JQXC 2VM9A 3F64A 4ZFGL 5MEQB 1JGEB 5BMFL 3CC5B 5JOEA 1VEMA 1CLZL 4G82A 2PN5A 3BQUC 1DQJB 5L2KE 3EYFB 3KXFA 1E5BA 3O6ML 5CP7B 1HOEA 3KGTA 4OI8A 2CDGB 4ORZC 5C7XL 1A6TA 3WTXA 2R1XB 4CSSA 1E67A 1YMHB 4FQXD 5F71A 5DO8A 1N6QL 4P9HL 6FABH 4HAFA 5T1DH 4KXDA 2VLJE 4AYEC 3FQNA 4JLRA 2YK1L 1DQTA 4QO1B 2E46A 2UY7A 4OM1H 3U79A 3HHRB 4X9GA 4AE0A 1FPTL 3BZ4B 5E00B 4I3SL 4UTBA 3GSWA 5FA4A 1NIEA 2XA8L 5DD3L 1KCUL 3BUPA 2WMPB 2EYRA 4LIQE 4KNSA 3FB8A 1CTMA 4PGCA 2P42B 2XQYG 1I1CA 4M43L 4NN7B 4P2RD 4LHUB 1JZ4A 2P7TA 3MNMA 1IC5L 3BPOC 5LBGA 3AB0C 1HILB 1GZHA 3E8UL 1TJGH 2DD8H 2EIEA 2HRLA 4QY8B 3QUMH 3ZRSA 1CLYL 1TZHB 1KB5B 3OX8B 3D08A 3E9UA 1KBPA 3FQXB 2JB5L 2BOCB 3RUGF 5KBKA 3BW9B 2N7BA 4L4JA 4X4XA 3MRRB 5DTFA 3C8KA 3VFRB 3ZDYB 4MCYA 4DGVH 3PQYA 2A9AA 5E6SB 4AM0B 3NCMA 1GGIL 3FSVA 4HLZH 2A4CA 2BJMH 2C8NA 3JWNC 1YEDB 3QDJB 4U3SB 1NWPA 4TQHA 1ZLVH 1ZSDA 2FJGB 1G7HA 4AW4A 4ONGH 4WI3A 5DT1H 1IGFH 1O9VA 4FFYL 5JOPE 5KWYC 4L3EA 2I7OA 5B1CA 4FG4A 4UZSA 1XD1A 4Y19B 3SGKC 4Z3EA 4NQEA 2AJUL 2YRBA 3WN6A 1K72A 2ZJSL 4NZDA 1KCLA 3KL0A 1WYJA 5DC9B 2XZAL 4L1DA 5E6YA 3ZE0B 4NNXB 4OZFB 1SXAA 1WZLA 5I82A 3QWNA 4NUGL 1TPXB 1MPAL 1EGJL 1FZMA 5IK3A 4ALAL 4WRLA 2IDFA 1CGYA 3MNWA 4AYMC 3WTYA 4K23L 1I8LC 4B5EA 4YDVA 3VRJA 4O2FB 4G9DB 4HKXA 3T1FB 2Q20A 1DVFB 3VXPA 5DXWA 1KN2L 5G5DB 3QULB 4WFFE 1HDMB 4YMPA 3EGDB 1QBML 1ZHKB 4E9WA 1XH2A 5CGMA 1JYVA 3BT0A 5KVDE 2V5TA 4TTDC 4Y9CA 3T1WA 4N25A 1EXUB 2O5XL 3O4LB 2A77H 5A2KH 3IGUA 2ITCA 5GJSH 4F7EA 1UA7A 2EICA 3NEOA 4NPYA 4N0UB 1AGFB 1FGNL 4MJ6A 2WO2B 4MAYC 5AAMA 3GBML 2VSKB 3QIWB 3UTSA 1MVUB 5C9KA 1UATA 4XMKH 4A7QA 5B3JE 4Z8FH 4HPOH 1OP9A 5GGQH 1O6TA 2JIXB 2OULB 4KUCF 3PWUA 3U9UB 3PXJA 4NN6B 1U6AH 5D7IE 2JKJA 3OXSB 1E65A 4JANA 5IFJA 1OAKH 3GXFA 3GDCA 1NJ9B 3G04A 1FLTX 2Q86A 4ZUUA 1KEGL 2YQGA 2QADD 2R8SH 4EEEA 3UACA 1XSJA 3QI9D 5CZVL 2QFRA 3K71B 4Q4EA 3VSQA 4JREC 4JRWA 4EI5C 2Q9OA 2W5PA 3KGSA 2XN0A 5ABZA 4YZWA 3TF7C 4FFYA 4DZBB 4Y2DD 3TT1L 3KJ6H 5HVGB 3HIZA 4TL5A 1KYDA 4TNWF 4AVIA 5E2UL 4L8CA 3ARFD 2HT4D 4R83A 1Y6KR 2IWFA 2LLLA 4JJOA 4KXAA 2BVQA 4PTUB 3TVMD 3AZUA 1KBGL 1HL8A 1J1XH 4F33A 1W8EA 4HGMA 4AT6B 4NB7A 4RGMB 2AK1H 2ICEB 1HX0A 5D1ZI 4IYKA 5IMKA 5DRXB 3VXRD 1E4XI 3QIUA 5F6HJ 4QRTB 6CGTA 2H1XA 3COOA 1TF4A 1B88A 1EGJA 5FYJE 3D05A 4RGNE 3OC8A 3GSQA 3IE4A 2GSIB 1CICA 4GAGH 2VO5A 4AV5A 2ICWJ 4Q14A 1JF5A 2C9XA 1XZWA 2W94A 3FB8B 5JNYA 2IQAA 2F18A 3C8HA 4QI3A 4GB9A 3WFDH 5JIIA 2XFXA 2C3XA 3VYPA 1IGMH 2XI9A 2NTSP 3BLBA 4QYOA 1QWNA 3AWFA 4HLJA 1Z0NA 2XHNA 4IOSD 5C09D 1KNOB 5FOBB 3JZ7A 3LKRA 3BP4A 2CA4A 5FUOH 4CVWA 1EBAA 1E6OH 1K9TA 5IVZA 3UGUA 4K94H 2AXWA 1DDTA 2HTLC 4M03A 4AK1A 3QNXB 2OQJA 2VDQB 1TQCC 3G08A 2E86A 4OI7A 2EC9U 1CGSH 3MRCB 3SIKA 1D7FA 4HVBA 4RZCB 1P5UC 5K9OA 4OV5A 2C4FU 3PQYB 3WO3B 1HKLH 4RDBA 4ZPVA 2F19H 2R0ZH 1MF2L 4B6ZA 2ITDA 4O4YH 3RVXC 4PJDA 1IKOP 3P0VH 5JW4M 3CUPA 4JFOB 1NFAA 1MDAA 5BRZE 1WCBB 3ARGD 4Y7OC 4P4KA 1J48A 3HA0A 5SWSA 4OFPA 1K4DA 2YXVA 1QLEB 3W11C 1RUMH 1AHWC 4MA8H 2E7CA 2ARJA 1M05B 4PJHA 2W65B 1JZ6A 2OR7A 1G7JA 5CJ5A 5KBDA 4G80B 3BVUA 4KK6D 5KN5A 2DKSA 1HT6A 5L4MA 3IDXL 4N8VG 3ZDXE 4WW2C 3ILPB 5LO7A 1A4JB 1BQUA 1YMMB 1AOHA 1KOAA 3ABKB 5GS1C 3C08H 3VE0B 1CLVA 2OJZL 4NKDA 2NUPB 3TCLB 1J1OH 5L9DH 4YDVB 3KPTA 1ZS8B 1FC2D 3WEBA 2FNBA 1KELH 1HCVA 4MGXA 3S36X 3ZTJG 5A3IC 3TA3C 1NKRA 2F54B 3PL6A 4LT7A 5EH1A 1N5YH 5HYJB 2JKIS 3VVVA 4KRPD 3ZZQA 2WW8A 1TVBB 5JYMA 1IAIL 2GSGB 2ZCLL 3LIZH 2PWHA 1TJHH 5C6TL 3L1EA 5I8EA 4QHMB 1QRNB 3LKOB 2NR6A 25C8H 1OPGL 3VFMB 5D7SH 1YQ2A 4AQ8A 4KUZL 4YHIA 5DUPH 3U1PA 4S0HA 3QAZB 5IB3B 1FFQA 2DMHA 3D85A 5DFVC 1P84J 3BMWA 2XX1A 4WWKB 5DFTA 4JANB 1Q1JH 3RWEA 1ECYA 1USQA 1WZAA 1ZVYA 2BNRA 4PRPD 2Q86B 2VQ4A 4KQ4H 4J5VA 1BV8A 4KJYB 4JVPA 4ONHA 2WBKA 3CSTA 4OZHF 1UCTA 1EEZB 4TNEA 4JFPB 5BXFB 5FO7B 5DVPA 5HVFB 2Q7AA 1KF9B 2XTJC 3AABA 3GM8A 4QHUB 4WCYH 1OGPA 1H5BB 4JRYE 5SWZA 5D1ZC 3OKMA 3AM8C 2OTUA 3PYCA 1G0XA 1RI8A 4YLQT 1J10A 3Q0HA 4X6FB 1H6FA 4NO0A 5EO0B 1J0ZA 5DD6A 2Z93A 4GP8B 5DZOA 3FFCA 3OKNA 2HG5B 4NQSB 1L9NA 4KVNH 4D9QE 2FQDA 4LCCA 4HHAA 2IWGA 3GSXA 1NSNL 1QLEH 3VG0L 2AABL 2R7EA 4MJID 4NQXA 1WG3A 4E2OA 1KXVA 1AG0A 4CRPA 5DJZB 4X99A 1DDHA 2K4AA 1VCBC 1I31A 1TETL 5C0JA 3KPMB 4BFBD 3UO1L 3BP4B 2NXYC 4K4KA 4LEOB 3DA0A 1BMGA 2V9QA 2ZOUA 3ALXA 9PCYA 2UX7A 4YDJA 3BAXA 5DR5H 3S5LA 2BSEA 2Q3AA 2Z65C 1RXLA 2OQJB 4WV1B 5C0AE 2WQRA 1N8ZA 3VWKB 3QEQE 2E4FA 2DM2A 4ZX5A 3WTUA 1ORSB 3P0YL 3JTTB 3L3JB 4IDLA 1BD2B 1EDQA 1JGUH 3ZTCC 1XMWA 1UKTA 2XIBA 3CFDA 2BM3A 4AZ8B 2IG2L 2ZYIA 3VTMA 1M9WA 1P7QA 2WN3A 3ECUA 3INOA 4K7FB 4ZXBC 5I71B 1MCNA 2GUOA 3DX9A 3R18A 1XF5A 4FQIL 3T0DA 3RWFA 3V0AC 5IBTL 1F1AA 2DPKA 2P9RA 3TL5A 2FEDD 5KG9A 4JZOB 4XC1L 2ZYHA 1UD4A 1A5FH 5IMOA 3VXSD 1S3RA 4G6ML 3DKHA 3PAYA 4YIQA 5IR1A 4WUKL 2HKHH 3BWUC 1MNNA 4KVPA 3RLSA 4PJHB 1MCFA 2APXA 1I7RA 1G7JB 3QK0A 2BNQE 2XOTA 1W0WA 2WB1A 3GMOB 2Y9RT 2EZ0D 3WGVB 5JW5A 5E99L 3H55A 1UM6L 2GTWB 4GJTB 5D2NE 1E43A 5C08B 5AALA 4YXLL 2BSRB 4UAOC 3QDGD 2WLKA 5J1AA 3PGDB 3NTCL 2XLLA 3C6SB 3L4XA 4BK5C 2CA3A 3CNKA 3OKLB 4NO2B 4FFZL 5GSVA 3QQDB 5FW7A 2LE9A 1OSPH 3DTXA 5SV3A 4KKZA 3H8NA 1L6PA 2VDPB 4QTIL 1E7UA 4MBOA 1JXFA 2MPAH 3C9NA 3B2VH 2FAUA 3UJIL 1URLA 3PP4L 3T2PA 3ZX1A 4U1LA 2QL1A 4DNLA 1C7SA 1MWAL 4TUKL 2OR9H 1KENH 5F7NC 3VXMB 4C83B 4PJCB 1Z5LA 2Q3ZA 4G1MA 5DJCB 4UILH 1JNHB 4N2BA 4P23A 1P53A 5FO9A 1MI5E 3QH3A 1CLOL 5CHNA 4YXHL 4PV9A 1JXJA 1AQDB 2FJUB 3SGJA 1OGAA 5HDWA 3NCYP 4J3UA 4L9LA 3VI4B 3WJMB 1T22B 3LRSB 3EJZD 5I66B 1N2RA 1M6UA 2FX9H 1PKOA 3JVGA 3B9AA 5DEJA 2YN5A 3U4BH 1KDJA 2A99A 3WFCL 4DSYA 3PJNA 4U0QB 5I6MA 4WO4A 1W80A 2DLIA 3Q5OA 3SQOH 3H54A 4QKTA 2G60L 1DL7H 4LAQH 4QT5A 3NQKA 3VXNA 5FGRA 2ERJC 2CCLA 3G5YB 4KZ0A 1JK9A 4S10A 1AO7A 3OAWA 2Z93B 4JL2A 2DQIL 4WJ5B 2VR6A 4H0IA 3T0EA 5JXAH 4PS4L 4H8WH 2DQDH 5HPMB 4HHAB 2KUTA 4PJ5E 4AMXA 3FCTB 3P9WB 2F7PA 3BPCB 5KYNA 5EU5B 5F9JA 2G3ZA 5FGCE 1MAKA 2P5WD 1TCMA 3LPPA 5JHDD 1A7PH 3W38A 1BJ1J 4MJ2A 3BRGC 1SBBA 3P54A 1SXNA 2DKUA 3GLEA 1BFTA 2B9AA 4M7KL 3TPUA 3MLTB 1LDSA 4FFZA 1T89A 2GJPA 5E1QA 3ZOAA 3Q1EA 4RSVA 5CJXC 3VH8A 3N40P 4BFEA 4WI7A 1SLWA 4ZDHA 1IGYB 1S7XB 4HUXB 3CG8A 1XAUA 2D7NA 4MX7A 5E5UB 1MHCB 3N04A 4Z3TA 3BRDA 3D25A 3DXAB 1MWAA 4RCAA 4XNUL 1N8ZB 3IJ7A 1WWWX 2ADIB 1FDLL 3EHBB 2GBAA 1NKGA 2HFFB 2VDPH 3ECBB 5ILTL 3OZLA 1F3RB 2GC4C 3QCVH 3P30L 3FOMB 2UVFA 5ICZB 2V9RA 2Z3FA 2E27L 2GK0B 1OZUA 3EH3B 5EMYA 3P69A 1DBAL 5D1XD 2CUMA 3GLDA 4PMEA 3MXVL 2J21A 2XG5B 1G84A 5I1HL 4WTZA 1TFHA 1JK8A 2VLLA 2NMSA 1OSZB 2HRGA 2FCBA 5D93C 1JXGA 4DOHB 3GMPB 3G6AB 3ZTEA 4OLYL 4NM8H 3VFGH 5ICYA 4WFHD 3V0DA 2RFXB 4I88A 2N59A 4TLKA 3ILQC 1NZRA 1RZKC 1CFTA 2BFVH 5EUOB 3SY6A 1RURH 5HD8C 4WTQA 5JMRA 2VLKA 3GZOA 4L4VB 1XGQA 1Z2KA 2IAND 3UAJD 4DP5X 4MSWA 4PJGF 4JZJA 4BEIA 1DQVA 3NGBC 2IOOA 3BP6B 4O9HH 4LQFH 4TPRL 4ANVA 3EYSH 5EB9A 1CT8A 3BUYB 3E0GA 2Y69B 3QXDB 5E2TL 4L1HA 3NABL 1MQKH 1MJJB 2X6CA 2D7TL 1OM3H 5L7XH 4N90E 1YEIL 1XFPA 3BPLB 3HE7A 3OKOB 1LO3H 5CILL 3NBNA 3L5JA 1FYTE 4IBLT 4CN1A 3T5WA 4F37F 3V2AR 2R9HD 3HZVB 1W2KT 1X5GA 2XETA 4Y4HC 5EO1B 4EAEA 3GMLA 5LWYH 1AHKA 2R0WL 3RYMA 3TBCA 2XG4A 1GKOA 1V3MA 3QRBA 2YBRB 3RX8A 1XCTB 3D3VB 4U1IA 1DVXA 3BVDB 2VMJA 1MXDA 4PG2C 3TFBA 1ZK9A 3N44F 3QH3B 1JZIA 5CHNB 4O02L 2H2PC 4ES8A 3H3KA 3TU6A 1XIWD 3N41B 4PCKA 5KOVC 1TEFA 4NQTA 2ENPA 1RLWA 4Y4FB 3L7EA 3FW6A 5B7EA 3QO0B 2G9KA 3PDDA 5D4QA 5GIRB 4K5OA 2XIIA 1AJ7L 1DFBH 2PTUA 5GZNA 4M7LH 1MUJA 4GAJH 1SHMA 3KYNB 5EIIB 1NQBA 3GI8L 4PRIB 4ZT1A 2GVYA 3FN9A 3RQ3A 4XN4A 2J5LC 4JG1H 5BS0A 1Z7JA 5D7JA 4TQIA 5IM7A 5E8OB 3IJEA 5E08H 1UJ3C 1BXXA 3KM2A 1Z9NA 2W80C 4M6NH 2GC7C 4MNHA 1N7MH 3P3TA 4R7DA 5EU6E 3SO5A 4WW2F 1BF5A 4OLWL 3U7WH 4FCAA 5F21B 2X38A 1G9MH 4XRCB 1DUZB 4NENA 2DWXA 1A1MA 1J5IA 4PWEA 4G42B 3MV9B 1U41A 2OZ4H 3OB0K 2IALA 3ZHLA 3RY4A 4V11A 2JQMA 3MOBH 5C07B 4UM9D 3FT2B 1NCBL 3H2WA 4FXGA 4JQIH 1D5MA 1PEWA 4UOW0 4HIPA 1MLCA 1DLFL 4NNPH 1JNNL 1OQXA 4TRPH 1SLUA 3WG7B 1E5CA 1KTDA 5KEZA 5JPMC 2WTRA 5LBVA 1JNLL 3LNEA 1B2WL 1YN7B 5DURD 1NL0L 3VH8B 2ZOWA 2H26B 2F08A 4D3CH 4U1HB 4ZDHB 1RIVL 3OMAB 1AGCB 4NQCA 2I25N 3OKDB 2QGDA 3W39B 5DK0B 2WINA 2ZICA 2VC2H 3MJ9L 3HZMA 2YKKA 1U8JA 3OD3A 1JYWA 2HFGH 3MLVL 2V4LA 2YGPA 5D2LB 5EBMA 2E76C 5ALBL 5E4AA 3ARDA 3AT0A 3CX5K 4ODTL 5DEFB 2YUWA 4HKBA 3H3PL 2KDYA 3T3MB 1HCYA 3I6LE 2HXAA 3K0YA 3S8GB 3DIFA 1C8PA 2IPKB 1ZS2A 4QXTA 2WWMC 3SBQA 3MBED 4DT2A 1JRHH 3D7PA 5ISZE 1JK8B 1SDAB 4U1NB 3UC0H 1NFDE 2AV7A 1XR8B 4K8RH 3TGXA 3JV4A 3O6LH 4Y9BA 3HUJF 2ZP9A 2DICA 1PAMA 4KK9D 1U8NA 1I8MB 2P80A 2ZNWA 1GHFH 4HUWB 2RR3A 3CJJA 4F9PA 1DLHA 2C9RA 1OY3B 3B9KD 2ATPB 1ASQA 4A2GA 4Q97A 2WXRA 3CCHB 2IDUA 4RWYL 2Z8VC 5FKPA 4AQ1B 4Z7WA 4KMLB 1ITCA 32C2A 4OF6A 3FT3B 2R4SL 5HGHB 4J7RA 4AYSA 4UF7C 3BWAB 4N2GA 4WQOA 4WW1B 1HSAA 5F7AA 5AKSA 5C97A 2LLGA 5GRJL 5I0WA 3KYAA 5JQ6H 3ZY7A 4GW5A 3GHEL 3GIZL 4LAJH 4QJ4B 1QW8A 4X0NA 1CYXA 3HE7B 5I8OH 3OKEA 4DN4H 3C09C 5D1QE 1OXYA 3TFKD 5C0EA 1RVFH 5E2WH 3MGAA 2FB4H 5TE7H 4CVZB 1A3LH 2IH1B 5EOCH 4ZFQA 1ZTXH 3EJJX 4JHAH 5D7LA 3RIKA 4AEHH 1TU2A 2GBTA 3HAEA 5B1KA 1J9QA 4LOEA 4DWHA 3L48A 2VXSH 3MJ9A 3VU2A 4X5WA 2QPSA 2X3AA 5JYLA 2XX0A 4PJXB 1IFRA 4R5TA 4BSWB 3MUHL 5HVHB 4YBHA 1LO4H 2IADA 4LPUA 5IVOA 1FZJB 5TPWH 5TD4A 1PLAA 1XF4A 2BOLA 4AEIH 2NY1B 4OT1L 4E42B 1PSKL 3Q3GB 3L4VA 2OZNA 4KDVA 4WI2A 4YK4C 4HYTB 2YA0A 4WKZA 4ZMQA 1OOWA 5AB9A 3C2SA 1JIBA 3SDXF 2EH8H 3BWUF 4WU5A 2VAAB 3ZRCC 1G7QB 2NY2C 5DZVA 5D7JB 3FPXA 4QRRD 3U7YH 5E9DB 1OCZB 3HKZA 1KJMB 1TG8A 1Z3GL 1KTLA 4KXZI 3C5ZB 1V3JA 5DRNA 2QTVA 3MOQA 3MKKA 4TXVB 2R2BB 3W5MA 1CURA 4DP8X 4FXKA 3QDMB 1T5XA 4HJTA 2Z4TA 3VWJC 5MEND 1ZHLB 2R2EA 1Q72H 1F90L 2DI7A 4H8QA 5F88A 1C8QA 1OARL 2A1WL 3JTSB 4N85A 3PAVA 1GTFA 3RU8L 4WUUB 4RFEB 3KGRA 3BN3B 2QSCH 3I75B 3IRPX 2D31A 2F15A 3HBGA 2J6EH 2ESVD 1GIGH 3ATBA 4W9ZA 3C5JA 1YEKL 1OLLA 5DO2D 1SY6L 4LCUB 4GBXB 5I1AB 3Q06A 1WT5A 1DJGA 2F8OA 5ENWB 5G4NA 1KCWA 1UB6A 1FFOA 3LEVH 5L0QB 1KMGA 5KVEH 2H9GB 1OTUC 1SDDB 2FT7A 2VLRD 2H0EA 1OOAA 3BLKA 1KGUA 1U8JB 4ZAKC 1XTLA 5AWNH 4EIZC 4P9HC 1ZGLB 4H25A 4UM8B 5I28A 5ANMA 4D9RD 3LS5L 5C0FA 1FHNA 2IBBA 3X11B 1DQQB 1ES0A 3FB7B 4P3DB 4N8PA 4JFHE 1MFDH 1AQKL 3ARUA 4QHPA 3FRPA 3BJ91 1W6WA 4X5LA 5D5MB 1A6AB 3Q8FA 4QXTB 2CKBL 3NJLA 3PY9A 4IBSA 3HI6L 2COQA 4ONFH 1C12A 1MFCH 2C9AA 5J13C 5EORH 2V33A 4PRBB 2AANA 5CLXA 1VAHA 2EIZA 1Q9WB 2EE9A 4HCRL 2AJZB 3G5XA 5I0DA 2AJYL 2IH8A 4F2FA 4YDKH 2XN2A 2AGJL 4UIMB 2CXGA 2HT3C 2PO6B 2XQ0A 5A6MA 5JIPA 5I8CA 2VDOH 2WXPA 4LNRA 3VFOA 5I1LA 3F7LA 2NLJB 3DNKA 1VFBB 4JN1L 1QABA 2CRYA 3KPNA 3GBDA 4LSPH 1OV8A 2FUTA 4XWOD 1INDH 4OKDA 4C56E 3PABA 1KIQA 3KDPB 1L4IA 6PAZA 4UQEA 3L4TA 1IQDB 3MC0A 1JG9A 4LVOB 3L95B 5HDQH 1RY7B 4OJCA 1QPXA 5CO1A 1JS4A 3BVTA 5F7BA 5HJGA 5E0FA 5J56B 1SY6A 3ERXA 6FABL 5T1DL 1KC5H 1RZ8A 2BVUA 4TQPA 4HZLB 3W0WD 1C08A 2YRZA 3VSTA 3LD8B 1P6AB 4OM1L 4I0PB 3QIUC 5DA0B 3CVHH 5I6XC 1KB3A 4AMKH 5KOMC 4ALAC 3RB5A 1DE4B 1CICC 2YAPA 5HHQA 4DPRA 2OV0A 3HNSH 4MA3A 4M1GH 2YN3A 1U8PA 4K2UH 4ZSOE 4Y4KA 1BJ8A 4G6AD 4CC4C 5D71H 4Z76A 4H8VA 4PJFB 3OBAA 4Y89A 4MVBC 2CAKA 3FCBA 2PF6A 4KFZC 1N59B 3WBDA 1E9OA 1IEBB 3OMNB 3T65B 3UH8A 1G4RA 2CKBA 2LU4A 2DD8L 4FA6A 1PZAA 5D6DA 3EOBB 5BCAA 3JWNG 1K5NA 3S37X 2JKRM 1XB8A 3KWWB 4FMFA 3F6IA 4HJEA 3MRLA 4PI0A 3SO3B 3TN0A 2GIXA 4HCRA 2VLJA 1PZ5A 4DGVL 3F65A 3G5VB 1CN4A 4JFED 2Y2WA 5LJYH 4L3CB 1IAII 2BJML 2FIKB 1T1YA 4OGXH 3PG2A 2XTLA 1U36A 2WVSA 2OMXB 2OS7A 1S7RB 3QORB 3O2VH 5AL0A 1IGFL 5IJDC 1EDYA 1R75A 3BVNA 1HL5A 4P4KC 4RZKA 5AAWC 1ED3B 4JO4L 4GMSH 1TTRA 2Y7NA 3C5JB 5E1IA 3HC3H 1ACXA 3Q9PA 3IDNB 4QDGA 4GKZB 4ZRGA 1RUQH 4JRLA 1G0YR 1PX3A 4F7KA 1YQVH 2DMKA 3EUUA 3HI1A 4R7VA 5HHXH 2O61A 2FH8A 5K93A 2QDWA 3L4WA 5IB2B 4IRZH 2DWDB 1KYOJ 2M2DA 4FQQA 5CJQH 3V6BR 4MB4A 1RZFH 4GFXA 3H6JA 4P49A 1A7RH 3TYFA 2DM7A 1Y1DA 1Z9SA 1SQ2N 3FRPB 2Z4QB 1T21B 1SVCP 3CZGA 3PL6C 5C92A 4IRSD 4XPTH 2P5EB 2A77L 2AXGA 5GJSL 1C16B 3BHBA 1YPZE 4JAMA 1AG6A 1NGQH 4V33A 2L4OA 3BO8A 2FYYA 3STZB 4KAQH 3N1QC 1RZ7H 4XMKL 1UENA 4Z8FL 1QLFB 3QQ9C 4HPOL 3ZE2E 2NRDA 1WS7A 5GGQL 2HLFD 1F3JB 4JO3L 4TF4A 1VZHA 3MRIB 1BZ9A 3CVIH 4P06A 1U6AL 2X4NA 1AGEA 3E8VA 4KQ0A 3IYLW 3VFOB 5BZDB 3DPBB 3CHRA 1OAKL 3PWPB 2R8SL 3H56A 2EINB 2ZNXA 3UYPB 3ZKQD 3I50H 5IMLA 5FM5O 3DVIA 4YDLC 2K9UA 3EGXA 4YFLI 4A7VA 2WLIA 2YPLA 3PHOA 3TP4A 4PJ8A 5J6GA 2ILLA 1X6NA 4XBMA 2VW6A 4LOUC 3MZTA 3L54A 1I1FB 5BVJB 5KBPA 1WUNT 3JWDH 4OGAD 3KJ6L 3U36B 1CFSA 3VD3A 2ADGB 3SKMB 1WK0A 4GRWB 1HZKA 1U3HA 1RULH 2IH3A 4WIQA 5JIQA 4WTXA 1HWWA 5H35B 4AL8H 1J1XL 2X2YA 4LZKA 3WY3A 4YC2C 4NRYB 2AK1L 3BSZH 4MD5B 2A6IB 4LHJB 5C1MB 5KUKA 1MREH 1RHHA 1B4TA 4N1HB 1FJ1B 1W9XA 4DPCX 5HHOE 2DQHH 1OTSD 3QZWA 4PG9B 2CDEA 4EI6A 2B9BA 4IBUA 4LCCC 3QUXD 4WKXA 1AYOA 3K6DA 5F9DC 4P48A 2N0KA 3RJQB 1BAGA 4GAGL 2NOYA 5D7IA 3PWLB 3T6VA 3SKJH 5F0JB 3MNZA 4DF9A 1KXVC 4MA3B 3CQPA 1TIUA 1IGML 5JHAA 2CBOA 3PNWB 5FGBA 5IQ7H 4XO9A 1ZLVK 1IFHH 3T9WA 3HLAB 4BQ8A 1H3TA 1UTDA 3S36H 3V5HA 5L2KB 2XN9B 5AW3B 1RK1A 1CXEA 5FUOL 1WBZA 4BH7B 3WKQA 1E6OL 3S96B 4U31A 4K94L 5GSRB 1X5XA 2NUTA 2EDWA 3RVWD 3K6FA 4JKPH 3E3QE 4WSJA 1CGSL 1HHHB 5KYYA 4KI1A 1QUNA 1LWHA 2F1AA 3J8F7 1DN0A 4F3FA 5F7WC 1HKLL 3CFMA 1TFPA 2F19L 2GBVA 2R0ZL 5IROD 4O4YL 1DQLH 1II4E 3P0VL 2K7PA 5IF0A 5DHVH 2C9QA 1S9XB 1F4HA 4GI6A 2F74A 2DQFB 2WYZA 3RUGE 1A1OB 4PI2A 4HJJH 2DQGL 3P11H 2WBJD 1JERA 5I1DA 5LAXB 3QCUH 3QPXH 4R4NC 5ERWB 3RWIB 1RUML 2EKSA 1VGKB 1ZWIA 2FATH 4MA8L 5C6WH 5KBLA 4YSTA 3H7BB 3LYRA 4F9LA 3V10A 1NMCB 3US0A 2WIIB 3NZHH 3UAAA 5HYQA 2ALWA 2JKTM 2OJEB 3QHZH 3ZR6A 1SJEB 3B7TA 4UDUA 4WNJA 5ADOL 3C08L 1A7OH 3RA7H 2ZSWB 5FECB 3ZDZB 2B1OA 2PXYA 3WLWC 1J1OL 4H88H 1KT2A 3LTVA 5L9DL 3P0GB 3W81A 3VCLA 2N7SA 3O8XA 4UT7H 1KELL 1CMOA 4YZFF 1D5XB 4BDVB 1CG9A 4YR6B 5F9WB 5BRZA 1A7NL 1I7TA 1F4AA 1HL9A 1VFUA 1XH3A 1GKEA 4TM9A 1UA6H 4MD0A 2PYED 4QRQB 4HUUB 3SGEI 3LIZL 1TJHL 1VKXA 4HA1A 2CUHA 3HE6B 4MMYA 4JAMB 3PGCB 1PPIA 3BZFB 1SOXA 3BO8B 25C8L 4GOSA 4U05A 5TE6L 3GEWB 3TBTA 3PFUA 2VUOA 3SE3A 5D7SL 4P23C 4ACTA 5DUPL 2WO3B 3K2UH 2JXMA 1I1AB 5CEYA 4Z78B 3OQ3B 3IKCB 5DJ6A 5CF3A 3EF7A 3K6NA 2G75A 1Q1JL 3SGJC 4K5LA 1SJHB 4L9LC 2C7UB 2OPCA 4YNYB 3ATFA 4KQ4L 5A2FA 2C9PA 1WICA 3R1GH 5KSAB 2WLIB 3JVGC 2G0LA 2YBGA 3KYOA 2VN3A 5CM1A 1YY9C 4XODA 3SDCD 5BOZG 4GLRH 3UAEA 3VXUD 4A68A 4Q7DA 3MRDA 4WCYL 4WO4C 3HZYB 2K1MA 1SYSA 1OGTB 1T20B 4HSCX 1DFXA 2OP4H 4BCZA 2ZUQC 3TIDB 4M61A 2A9NH 4M7ZB 2EVJA 4JDVA 2Q7YB 5G4OA 4G6FD 1I8IA 4M4PA 1FIEA 5E8EB 3QZWB 3F5WB 4KVNL 2XVBA 5HJDA 3T0EC 2CDEB 3QWOB 4LEEA 4BWWA 4EI6B 1QLEL 3O81A 3QBTB 4OFIA 1BZ8A 4IRJD 4G7RB 5I9QB 2M1KA 4ZPTA 2CBMA 2EDLA 2WQWA 1MY7A 1PYWB 4KNUA 3MNZB 4LLUB 3NJXA 4AKQA 3RP1A 3MYJA 4BQ9A 5I6PA 1FCGA 3MV8B 4E5XB 2D9QB 3NCYS 2IGFH 1NGPH 4YSDA 4JRYA 4P46C 3O6FB 5DR5L 4GKOA 1MH5B 5KSVB 4RA0C 5KSBE 2WYHA 5MP6H 1SMAA 3I6KA 3MLYL 5HHVH 3TBVA 3TNMB 5KZCB 1P4UA 1R17A 3LPOA 1JGUL 5EEZA 2XN1A 2XVLA 1PX4A 5ESAA 2BP5M 5DF0A 2R2CA 1UEMA 1KBBA 2NY0B 4JJHA 1A1NB 4KPHH 5DWPA 4IGBB 5DK2B 4BQ6A 3OHXA 4YPGB 4JN2B 1TITA 4NQDD 1TTUA 3H4FA 4KOCA 4WEUD 4MDJA 5DS8A 5HGDB 1A5FL 3ULVF 1KPVA 5E5MB 1J12A 1U8IA 3SPVA 5I1DB 2L7EA 1CPUA 4GRLB 2HKHL 3D52A 2BXYA 2X6AA 5EEWA 1RD6A 4U1SB 1IKNA 5I2IA 1YLBB 3IRCA 4KK5D 1GSKA 4KX8A 1NUGA 3U1SH 1QVOB 1G1YA 4U0RB 3AY2A 1QRKA 2XWDA 4UDUB 1AYRA 1MCLA 2BHUA 3E6HA 3OV6A 4O00A 5C0AA 5IWLA 3QEQA 5DMIH 4ABVA 1KT2B 5LG6A 2NZ1A 1CFBA 3S5ZA 4JZJC 3D69A 4XE5B 4AGOA 5MERB 3KHQA 1M2OA 1MCOH 4Y5YC 3VYOA 1OSPL 4Z7UB 2W81C 3DX7B 1I7UB 3UDWA 1CTNA 3BIKA 4PRPE 2OW6A 3NFPA 2C3VA 2MPAL 1RPUA 3PHQB 2JF1A 3KPRB 3B2VL 4ZK8A 5C71A 3ULVD 1S5IH 3T09A 3IFNH 4XAKD 4NKOB 4JUTA 1B6DA 4OLXH 3RIAK 5F0MB 2OR9L 1KENL 4YE4H 4MMYB 1N3NA 4ANKA 4UILL 4ELMB 5C0CA 1I3VA 4M5TA 1H3GA 2BNQA 3D87B 1TTFA 3NCJH 1A3QA 3C87A 2JXMB 2ICWA 4X6EA 5I1KH 3PGFL 3OAYH 4H26A 5D2NA 1EMTH 3NOIA 4FI8A 2X89D 3N43B 3EJUA 2FX9L 5IIEB 4JY6A 1FNAA 4OUUB 3U4BL 4I4WA 2VDRB 4LCVA 4XB3A 3GTTA 5KYUA 1RLBA 3GRBA 4MJIE 3V0FA 1VDGA 2X7LB 4ODSH 5GZNC 3SQOL 4Y0GA 3G6DH 4FLOA 2VRAA 1DL7L 1YDPA 4LAQL 3QYMA 2A9MH 3LZNA 3V79C 3CBJB 2Q10A 1JHKH 4LP4A 2I27N 3BIBX 4FFWD 2WWKT 3D39D 1AZVA 3FQTB 5D4JA 3IDJA 5EDSA 2KBGA 2K6ZA 2P5WB 5JXAL 5I76B 2MOVA 4H8WL 3MX0A 2DQDL 1KG0B 4XXDA 1MI5A 2G2NA 3ZBMA 1LEIB 1EZUA 5CD3B 3DSNB 1KGCE 4APQB 3LQZB 3UYOD 1E28A 4FXGC 5DJAB 4B50A 3QIBD 3N42B 1FVDB 5CZRA 1M7IA 1RJYA 4U2YA 2DWTA 4PPTA 3KZ8A 5EZJA 1XZ0A 3DMMB 4FFVD 1WGOA 4X5RA 5B39B 3WE6B 1JV2A 4ZZFA 4MTMA 5HYSG 3CV5A 3LZLA 3VXSE 4E0RA 5INDB 3ZXAC 4BKTC 1XSOA 2O6DA 4AMWA 3IMTA 3SYOA 4GSRA 5T1KA 1AQHA 2NY3C 1FL5B 3AGVA 3QCVL 3ARDC 2XYCA 4OVUA 2GT9B 1WGVA 2Y06H 3VAEA 5EBLA 5TDNA 1JZ7A 4PJ5A 3IPBA 4XGZA 3QDGE 1LMKA 4QCIA 1DVUA 3ULUD 1WFOA 3QRFM 4G9FD 1T6VN 1X5LA 3EUDA 3IBOA 2KQNA 4I18B 3IWVA 3TH4T 1H6UA 4PJBB 3MOAH 5EHFA 2UVEA 4N0FA 1PFOA 3WMPA 4CC0A 3VFGL 5AW5B 4OZ4A 3LEXA 5A7EA 1K5WA 1MXGA 3KPSB 2P24A 2PW2A 1OF2B 4ZS6D 4EDXB 1ZLEA 2GJ6D 3VA2C 3DBXA 3BE1H 2BFVL 5HXMA 1JHTA 1RURL 1G94A 2JJWA 2AK4E 2MHAA 4F9PC 2OI9C 5D6CB 3L5WB 1YNLH 3BKJH 4RISH 1BM7A 3WDJA 2XFGB 3M7FB 3HLKA 2HVKB 2K8MA 2OMZA 4E36A 4X8XA 4KK8C 3P40A 2FSEA 2Y3NA 3ZTNH 1QFWH 3BH9A 5DJYB 3UG3A 1BPVA 3VD5A 4O9HL 4LQFL 4FTVD 5KVMC 2CPCA 3EYSL 1PW3A 1N12A 2OMTA 4AIXA 5BJTA 4M62H 1KYFA 3WEOA 3BIKB 4JM4H 4NHUA 2B4CL 1JWSB 5E6IB 1OM3L 5L7XL 1BMWA 4UQ2B 2PWDA 1VA9A 2AFNA 4PRNB 1LO3L 1A14H 1Q0YH 2ZXGA 2IGLA 4MZIA 3OF6D 1D6EA 2E7DA 2QLVB 3PUUA 2IIJA 3O3DB 4J1UA 4OI9A 4PR5A 1LK2A 4JFFD 4ZQKA 5FW6A 1A66A 3GSOB 2QLYA 2A4EA 5LWYL 2XICA 4E68A 4GG8B 4CDGC 1T03H 4HS6A 3I9IA 4J4PD 1P84K 2XPGA 2X42A 1P6FA 3B3IA 4XI5C 5CN1A 5H37G 2WJ5A 4M48L 1SZNA 4LOFA 4QRAA 3P9MA 3MCKB 4KROB 2GJZA 5IQ9A 7FABH 3KLQA 3JT0A 2WYTA 5CD5C 3UPRB 2YFNA 2BSDA 4LRIC 1DFBL 2YZ8A 4M7LL 2X6BA 4XMVA 4HBQA 4GAJL 1D9KA 1F3DH 4IM8A 1R24A 4GMTH 5JHDE 2ZE0A 3CN1A 3JWNE 1ETZA 3KS0H 4EQ2A 3QNYB 4JG1L 5E8PB 2QPFA 1HYSD 2GHWB 2JH2A 4UQAA 5AW6B 5E08L 3CFKA 1TO5A 2P52A 1W0VA 2WXFA 4HIJA 3BI9X 2PETA 4M6NL 2HVJB 1N7ML 4U1JA 1FYTA 5DSCA 4IEFA 3VX1A 7CGTA 1G9ML 4KZEH 3RVUD 1IIKA 1TTCA 4HIXH 8FABB 4OFQA 1HWGB 4FXKC 3DETC 2OZ4L 3BUIA 4TMPA 1QTPA 5A2IH 5B4MC 1JPSL 2XQBH 4XXDB 3RGHA 1CVSC 5DVLA 2CK0H 3D2TA 1X7QB 3MRMA 2PTVA 3MOBL 3X3FH 1AHMA 2VOTA 1YEJH 2MKLC 4JQIL 4PBXA 2YEQA 2HX7A 2PTTA 4NNPL 1E5ZA 3Q6FA 4QHKJ 4TRPL 4EJ1C 5DEGA 2HT2D 1BZQK 1QUPA 5KANI 2GIMA 5D1XE 5FYKU 4A2FA 1GS8A 4LARH 4D3CL 1H0DA 3O6KH 4LCWD 1U8MB 2UZIH 1WT5C 4RMWA 3GJEA 4FA7B 3BPNC 3VGGA 1I7ZB 2VC2L 1FNGA 4R3SB 1NGYB 1S9YB 1WTLA 3BDYH 3MUGB 2MQCA 4NBXB 1TEGA 1KZYA 5BRQA 3RBGA 5EU6A 4WFHE 1L7TH 4DVRH 1YN6B 1T0NA 3LNDA 4BRVA 1VACA 2UZPA 4L8DA 4M6OH 4YFLF 5FYKD 1UA3A 2N01B 4Y1AB 3ECWA 5EZPA 3RWDB 2EDJA 1H15A 3KBHE 3TZVA 4R90H 2B59A 3LRKA 2JELH 5AZUA 5CGBA 3EYVA 2BP8A 4KJPC 4NLHA 5ADPH 2WTPA 3N50A 1U4FA 4PJ7F 4JVUA 3IDGA 1JRHL 5H4ZA 3HS9A 3RZCB 2V3FA 3UC0L 3GXNA 4K8RL 4KKLC 5B38B 2D4FA 5I75C 5EBGA 5AZ2H 1I3UA 4U6YA 5IW1B 1GHFL 1N0LB 5C0NC 1S7VA 1SEBB 4PLJD 4JRXD 1EHKB 4Q56A 2MHAB 4NS0A 1DSYA 2QHRH 4E9SA 3W9EB 1RP8A 2W38A 1LDPH 1ZVSB 4JGNA 3SGDH 3IXTA 2DYPA 2FSEB 3BH9B 3C6LD 5CZKA 2OZ4A 1O9ZA 4PVLA 3DURB 3J07A 5C0BD 1OQOA 4MNQD 3K1KC 1CF8H 4HC1H 5EU7E 1URIA 2H32B 4KMQA 1L6ZA 1Q38A 1A7QL 4JQIA 5T3XD 1XGTA 2ARJQ 5DHXB 4PJGE 4BFOA 1E5AA 4L8BB 1NBYA 1KIRB 4OM0H 5I8OL 3LV3A 4UNVA 4PR5B 4HXAH 3ESNA 5TE7L 1NFDA 2FB4L 4ETQB 2H0FA 1ASPA 1A3LL 2YOCA 5BOPA 4OZIF 5EOCL 4JFVA 4M02A 5C0GA 4L4TE 2CMRL 9CGTA 4JHAL 8PAZA 4AEHL 4GI9A 2V2WA 3SD2A 3DOIA 3QXWA 2VXSL 1R3IH 5CWSA 5TH2A 3D18B 3RGVA 4D2NA 2VZVA 3P9MB 3TBSB 1AI1H 2X9XA 2EEBA 5EUKB 3SQBB 2X4TA 1LO4L 5E6RB 2P8LA 1F42A 5TPWL 2AQ2A 3RL1A 3WO4B 4AEIL 3MDJA 2ICCA 4Y4KC 3FT4B 3FQWA 1GMIA 4LL9A 4Q8BA 5T1LA 1QOKA 2EH8L 3LXCA 2WXIA 4JB9H 2KHAA 3QFJD 2V7NB 5AL8A 1NCDL 3U7YL 3TO4C 3FTVA 4DO4A 1H9DA 1QBAA 1UVQA 2VJ8A 3O3EA 1IBGL 3EZ8A 5F96H 4YSEA 3KWVA 3P4MA 2VITB 4J28A 3TN0C 1L3WA 5JW4Q 2CO6A 2D0FA 2MTPA 3X17A 4MS8D 1NGXB 4RIRB 3FFOA 5CBEA 1HXMA 1Q72L 3BUBA 1MAMH 2QSCL 5IKCA 2B0SH 3DRQA 4UQ3B 4ZNEE 2FE0A 1N6UA 2J6EL 1GIGL 3IMVA 1BVKB 2IH9A 3IGAB 3KAAA 1MCJA 5DEGB 3WJLA 1W72B 1E8XA 4TOYH 2H6PB 2GAZA 1WP6A 3K8MA 3UIZA 1XGPB 1PLGL 2WZ6A 2X4SB 1W15A 3KYKL 3QJZA 4ODVH 3LEVL 2FX7H 2GY7B 5IV2A 1NCIA 1KJVA 2VDMH 1JJUA 3B8YA 5AWNL 3MREA 5F97E 4G6JH 4KHTH 1PTZA 3V0EA 4AEFA 1J0YA 3FO1A 2B39A 2EP6A 3P4OB 5CJ8A 3CFTA 1MFDL 4KOBA 5AKRA 4R84A 2X1XR 2I9LA 3P4NA 2JJSA 4XNYH 4ILDA 3ML8A 2FBRA 2BPBA 4ONFL 2W95A 4BZ2L 1MFCL 1NCJA 5EORL 2I85A 4XVOA 3ORJA 1EVUA 2VDLB 1CD1A 1H8NA 2B3IA 2IWEA 3B2XA 4NRXA 4NQUA 4U6VH 4YDKL 1ZHBA 2HJKB 2K6YA 5ITBL 3QQXA 1PLCA 5CN3A 2HJLA 2VDOL 2DL2A 3AROA 4PREB 1EAPA 3B9DA 2PCPA 3SCMD 4DJMA 3S88H 3HUJE 3QPQC 4RAUA 2MCG1 4LSPL 5MHSE 1JPGB 4R5XA 5J9PB 1Z3RA 4BE6A 5JIDA 3DV6A 5I5JA 4UUJB 3NIFE 4PRHD 4WFGD 5FKAA 1HEZA 2EXWC 4F8TA 2B1AH 4PJ8C 4NLAA 1ROWA 1U95A 5HDQL 4NZFA 3ULSA 2QPEB 5IREA 2NW2B 1NOAA 1BA9A 2EXYD 4X6CB 1CQYA 2J6EA 1S9VB 2JQZA 2WWOA 1U3HC 3CQFA 1IBHA 3ASWA 4JKNA 2N1TE 1BHGA 2OK0H 3FUJA 3LV3B 3FB6A 2BNUA 2DIEA 4FYSA 5ISZB 1AKJA 1JXDA 4ZQTA 1ZV2A 1I3GH 2AI0H 1BX2B 4P4RA 1E3ZA 4NAJA 2CJ3A 1EIBA 4Q58C 4U3HA 2QZQA 3V5DB 5B7MA 4H0LC 1E40A 4JDTH 4EUPA 3PIQB 5B8CB 3CVHL 3K0WA 1BQSA 1BMZA 1SMOA 5CWSB 3DVGB 5B1AB 4AMKL 1W72H 4M7JH 2WQSA 3ARSA 3RGVB 3ZZSA 2JB6A 5DRWB 3PDOA 3UBGA 2LVCA 4QTHB 2YD9A 5C8JA 1JGVH 5C86A 1Q9OA 3HNSL 4M1GL 5IFAH 1CIUA 1E27A 3O9WC 4K2UL 5MENE 4YBQC 3K6SB 1MCDA 3PV6B 5D71L 1SXSA 5LG1A 4C56A 2A74B 3AFLA 1P2CB 5T5FA 3GI9H 4CADA 1KCSH 4R5VA 1B9ZA 4N5UA 4QD2E 2ESVE 4P5TA 5LBSH 4JFYB 5F7EL 3S97C 4BZ2A 1UWYA 4FD0A 4XHQA 4XOAA 1BFVH 2RTTA 1UVQB 5D1QB 2XV6B 3FU7A 5HBBA 3S4SA 3SDXE 5KJRH 4WFED 1A25A 1DR9A 2VIRB 3A6CH 4OGXL 3MJ6A 5GRUH 5I6OA 2DH2A 5T3ZE 5E70A 3T6QC 1KPUB 4Z7QB 4ZO6A 3UZEA 1FH5H 3L7FA 1F1GA 2IV9A 3O2VL 1LEGB 4HGWA 3L3GB 4Z7WF 1M56B 3EXLA 2FWOA 4RGNC 3HCVB 2X05A 1BZ7A 2XUWA 2V2TB 2Q2LA 4GMSL 1M9SA 2DBLH 2V7HB 5J6SA 2HFTA 3HC3L 2JK5B 4UU9B 3NK4A 4ZSOA 2CLRA 2LHAA 4N2DA 3F2LA 4V1DE 5AYQA 3Q01A 3LMJL 1RUQL 4F9LC 2OTWB 4MRBA 4P2OD 1RJZB 3VSVA 2J1YA 3T6ZA 1OAJA 5HHXL 4ODUA 5BV7L 2JQAA 1N5AA 3CH1A 3EFDH 4TUJA 3L9BA 4NSKB 3RTQB 4M8VA 1K2DB 3MCG1 1PZ3A 2WZAA 4HQQH 3P77A 5CJQL 2PXYC 3MFFB 4YBLC 1HHIB 4JO2H 3D48R 1RZFL 2MJWA 1EFXA 3O8XC 3F8UB 1A7RL 3OR6B 4L37A 2CO1A 3QJFA 4WEMB 1G6VK 4QRPB 4XPTL 1WBYB 4IW4C 4ISVB 5GRZA 1HU8A 1SJXA 4XMPH 1MIEH 2X4UA 3V9CA 2EDMA 2ZOOA 4PJ9A 3BFWA 2ZXQA 5B3SB 2UYLA 1QYGH 3IGLA 1NGQL 2L7UA 4L3FA 3VD2A 2JKSA 3VRIA 3AREB 4Z7NB 4Z23A 4KAQL 4XX1E 5JLZA 1RZ7L 5EOTB 3L9RB 1NC2A 4N8VB 4GUPB 1BFOA 2V5MA 3SJVD 4DP1X 4LKCA 3ARBD 4Q9BA 4K94C 4P2QE 4XPHH 3CVIL 5F6HI 3QXAA 4FXTA 3ARVA 4KGLA 2WNGA 1G7LB 1KCVH 3W0WE 2SEBA 4GS7B 5FK9A 4DP0X 5DMGD 3I50L 4TQEH 3SBRA 1NM4A 3DV6B 2PW1A 5GGRA 2ICWI 3BAIA 1IT9H 1WAEA 4HH9A 5DJDA 1L5GB 3B2PA 5FKAB 4FEIA 1RZGB 1U95B 3JWDL 2YMOA 3SE8H 2P8PB 4N6QA 3O2DH 1VEPA 4OBSA 3DYOA 1RULL 1TQBB 2MCPH 5FDWB 2WTOA 3VQ2C 4AL8L 4XC3H 1UZGA 2K7QA 3DVFA 3IJ9A 5CBAA 3L6FB 3FB6B 2QGBA 1SYVB 1AKJB 1G9HA 1H8LA 5JW4R 3MV7B 1HH9A 3BSZL 2EC9T 4NN6C 1Z6JT 3LZQA 3VD4A 1YPZA 1DQDH 4KV5F 2XV3A 4U1GB 1MREL 1KFAH 3CBKB 4GO6B 1T5WA 2DQHL 2C4FT 2O1AA 2VDKL 2EADA 2CM5A 3QUYD 3WN5A 1BXUA 3GMQA 2ZG2A 4PJIB 4FQXA 5LGYA 5I0XA 1HC1A 3HMXA 4NOFA 1D7CA 3R06B 3ZKXB 4JY4B 3U82B 1J1PH 3OSKA 1JGIA 3NSYA 3RWCB 1U42A 4JFEE 3QUZC 1FNEB 3IFLH 3BH8A 4UOZA 3N40F 4GP4B 4HCIA 4PCYA 3FPYA 5DJ0A 1E27B 3VSUA 1CL7H 5IQ7L 2EABA 4FJYA 3S5LG 1VERA 3K8KA 3S36L 5AW9B 4ZUTB 1RUAH 1J8HD 1ZSHA 3MNVA 5HY9A 2ICEC 3EYOA 3EFOB 1PF3A 2ZXBA 2J8UF 3MA7A 2MCAA 1NGWB 3LIUA 4JKPL 4LLVA 4GG6B 4X4YB 2BIIA 2P49B 2DN7A 3NIDE 3K7UA 1SVZA 3FU7B 1IE4A 4GRMA 1WAAF 1S7QB 4BFFA 3O3BB 1PEZA 4YHYB 4MDIA 4IBVA 1DQLL 3MBWA 5HHOA 2VN5A 3OKYA 1U8KB 4CVXA 2YUZA 3KWXA 3OHXC 3L7FB 1I9JH 5L8KB 3FL7A 4OQTH 4LSQH 1ZJBA 2Y3AA 4JG0H 3BEVB 2VR5A 4HJJL 3MROB 4F7PB 4E41E 3P11L 3AAZA 3KHOA 1FVEB 1NMBH 3EO1A 2WLYA 4AY0A 3QCUL 3QPXL 1AZUA 4MLSA 2FATL 1Q9LB 3SDDB 3STLA 2HMID 4YFEA 2OMUB 2OSLA 4HJGA 2ID5A 4ZSOB 5EBWB 2F8XC 1R5VB 1IC4H 4JUSA 4HWUA 1BLNA 2AKRA 3NZHL 5CN2A 3FH5A 1Z5HA 3IDUA 3W2DL 4AC2A 4YOKA 3QHZL 5IB5A 1NAMA 2FT6A 5D96B 4K9JA 2EDFA 2F1BA 3HR5B 4P07A 4WI0B 1P7KB 3RA7L 4IJTA 4H88L 1T3FA 4QHLB 5CJBA 5IWLC 3PWJA 1TSRA 3DOSB 3TEZA 3QE5A 4UT7L 4BRJA 3QP3A 5I5IA 1LWRA 4RAVB 1BIIA 1HKFA 5J0BA 2IAAC 4J27A 2BO0A 2G5BA 4NFCA 1I75A 2IDTA 2BSTB 5DQDH 1KJ2B 2QQNH 2VT0A 5F9AC 4CBPA 3DO7A 3RUGA 3UDWC 4MB5A 2XBZA 3SD5A 1UA6L 1L3NA 3OZKA 1BLIA 2X4UB 3CDCA 2OX5B 1RU9H 3NRPA 4O51A 2B20A 2DLFH 4H1LA 1E4JA 3KPPB 4KGJA 4B5ZA 1OT2A 3MA9L 3V6OE 3ASOB 3H9HA 2HJFB 5D7KE 1FCCA 4I3GA 1BFOB 1CD0A 3K2UL 4G8GE 5EF2A 1JWUB 4DKAA 4HH8A 2KC0A 2QSQA 2CIKB 3QXAB 3VJ6B 4G8FB 5J5EA 4TSBH 2Q8BH 5D2NC 5TF0A 1MCWW 5CEZD 2Y1AA 1DUYA 3MGTA 1IV8A 1BG9A 4Y5VA 3V6ZA 3QJSB 5GGRB 35C8H 3R1GL 1H3XA 3MUJA 1HNGA 3VA6A 4BM7A 4AYID 5DHVA 3GQFA 3HG1D 4KXCA 2A0LD 2D03H 3T4AA 1KEMH 5E24E 2F6AA 3I02A 5FO8A 1KPRA 3IGFA 2X9ZA 2IAMD 4HIIB 4LSUH 3QI9A 4DK3A 2MSPA 2A9NL 1GZQA 1PDKA 1R3JA 5DYFA 1QHQA 2VYRE 2OBGA 3D4ZA 3Q5YA 1CF1A 1CDGA 3DIDA 3ILEA 1D6VH 4JE4B 1QFOA 4Y2DA 3BP7A 4XH2B 3SE9H 4BFKA 3ARFA 4PGBB 1NDGB 3F6JA 3TVMA 2FK9A 1GGUA 1J05B 1CUOA 4YE0A 2HX9A 4F2MB 1U8LB 2DZEA 1TCRA 3WXWL 1EZLA 4X80H 3VXRA 2J8HA 5AW0B 4XBPB 1Y6MR 2XWXA 3GIVB 2I60H 2IOIA 3H42H 3EADA 4NDMB 2OL3B 4I8DA 1E4KA 2ZONA 2YZ1A 1AAJA 2ZF9A 4GSDH 4DAGH 4Z7AA 4FTDA 2VH5H 4PSRA 3KWTA 4I7ZC 1PIFA 2IGFL 1NGPL 2ZOLA 1YEGH 4X7CC 4RDQG 5MP6L 4XN1A 4Y16A 1HI6B 1UH3A 1X5AA 1WFIA 5I16B 5HHVL 1KB9K 3OMIB 3CN4A 3UTTB 1KLUA 2YEVB 3APMA 1EAJA 4IOSA 5C09A 4POZD 1NMAH 1ZAGA 2EUWA 3TLRA 2ZT9C 3GXIA 1IVLA 4KPHL 1QZ1A 4WTZG 4XNMA 43C9A 3CXHK 2G2RB 3M07A 2R2HA 2E3VA 1Y0LA 3H9SB 4AQAB 5C0IB 5M94B 2X2HA 2FBOJ 3D2UD 1EERB 4ZW6A 1UJTA 2APVA 4FNSA 2L3BA 2D8KA 1YY8B 1VZIA 1LE9A 1L9OA 2AKRB 2P4AB 3ARGA 2I32A 1AR1D 2BOBB 3U1SL 3V0IA 2AQPA 1NAMB 1KXTB 5KYXA 1XBDA 3MRBB 4Z7VB 2NXZB 5KSBA 1IILE 2HAZA 4NYLA 5DMIL 1UWEH 1T3FB 3VXQB 3IJHB 2Z92B 5B3JF 2VW7A 5DC4B 4GO8A 4G59C 1ZLWK 1X9QA 2WY3B 1KFGA 3N91A 4NXSA 3TPKA 2OMBA 2H0JA 5FUCE 4H8WC 1C5CH 1T6BX 1MCOL 2H0PA 4FABH 3SDAD 4IMKA 2YMXH 5K9KB 3NJKA 2NY5H 1ND0A 4QF1B 3CHOA 3RUGB 3EJQA 2R0LH 2QVMA 5D55A 4DP6X 1S5IL 5CCGE 3IFNL 1S78D 4ANUA 3NCFB 4U6XA 3TNNA 1W91A 4IMLA 4PP2B 5BQ7A 4OLXL 3CDGA 3WHE0 4XTRD 4YZFE 4YE4L 4H1LB 2AJ3A 3CK0H 3EOTH 3TJHC 3VXUE 2DI9A 4H0GA 4N9GB 4DZ8A 4F7TA 2VXUL 1ILSA 4KJWC 3U2SB 4RFOH 1HE8A 1JFQH 1ZLDA 1QSEB 3TOPA 1AMXA 3NCJL 3EDJA 1PNCA 5I1KL 1KIPB 4JM2D 2OL3H 1OKEA 2QQLH 1EMTL 4EZKA 2ZQKA 3PP3K 4S1QH 4FKKA 3CIAA 4ABQA 3MGTB 1K3IA 3OG6B 3QCTL 1NIDA 4OFDA 3R7RA