4ZZFA

Crystal structure of truncated flgd (tetragonal form) from the human pathogen helicobacter pylori
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
146
structure length
146
Chain Sequence
NSVSMIGKIAETDVSGANFDGNNKLSFSLFFDEKIDASKGVPAIQILNENNELVKTIPLKDYNGQKGYINFEWDGTNEKGEKVPKGNYKIKAEYNLDSHSKQYLQTRIGRGEVESVIFDKGKPMLRMGEMVLPIDSAIEFYQPDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Motor protein
molecule keywords Flagellar basal body rod modification protein
publication title Crystal structure of truncated FlgD from the human pathogen Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori 26695
total genus 32
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4zzfA02
5K5YA 4ZZKA 3C12A 3OSVA 4ZZFA
chains in the Genus database with same CATH superfamily
3CZJA 5H2BA 1V05A 3LAFA 3DSFL 2GTQA 3OLDA 1TETL 5L9DL 1EMTH 2GJ6A 3I74A 4FKHA 4LL4A 5TDPA 5DMIL 2KPNA 4ZS7H 2V2TA 1PZUB 4D0BA 1SVZA 4ZMQA 1M7XA 4UT6H 4WF7A 1P6AB 4XP5L 4LARH 2V37A 3KXFB 2WXRA 5LAXB 3QDHA 1AXSA 3CZKA 4LKCB 1BXXA 4TM9A 3ILQC 3LMJL 5ERWA 2EDDA 4JO4L 1F42A 1HVXA 5KBNC 3HG2A 1B6DA 2VLME 3P9WB 4B7IA 4GAYA 1UASA 5I75C 3GJFK 5JPMA 3GBEA 2HUEA 2KYIA 4MB3A 3EAKA 3QZMA 1ZLVK 1RK0B 4FNPA 3TO2A 4JPVL 1EDQA 1LL1A 1TJHL 4AM0B 2XWCA 2ZYRA 4H88L 3DO3A 4PV9B 1MRCH 4BQCA 3QS3A 2UWEF 1NC4B 1Y18B 1KTJA 3P4OA 5EV7A 5C0CD 4L4TA 4U1MA 4NJ9H 1J8RA 4R26H 2BXYA 1OLLA 1KG0B 2VLKB 2A99A 1Q0XL 3GZPA 5FWQA 5CGYD 5DUBB 4UCFA 1IM3A 3JQOB 1G9MC 4IGBC 4OQTH 4M6OH 4ODHH 4XMZA 2C4FT 4J1UA 1A6VH 1T0MB 4IBYA 1DDHA 2WBKA 3T77A 4YMPA 2VM9A 8FABA 1XFPA 3I50H 5ESVA 4Q9RH 2FE0A 1DQKA 2VDOH 1BVKA 3GXMA 3PLYA 4G7VH 4PUBH 5ETUA 4A1RA 5F88B 1UCBH 3VXRE 1U8OB 3ZDYB 3RWCA 1M4KA 1HHGB 1DBAL 4R5TA 2VR8A 2VKWA 3NBNA 3FRPA 5IFJB 2A5UA 3JT2A 1VESA 2D9CA 3CN4A 5KVFE 1G4RA 4KHTL 1S7QB 4LEOB 3A67H 2DQHH 3CMOH 3HUJA 3BAWA 1FP5A 1I1YB 1AJ7H 2LT9A 2XZZA 1FAIL 1R5VA 5LXVA 3QI9B 3U30C 4ADJA 1WC7B 3C5ZA 4Y9FA 5FAAA 2GJ6D 3CVHB 1AQMA 1MG3C 3L6FB 4HP5A 4EOWL 3BAKA 1VB9A 1SXBA 4X99A 2CCWA 1N8ZA 4MJ4A 2CK0L 1QWHA 2VISA 5F1OB 3VRIB 1TLMA 4CBZA 1BBDL 2Y2WA 4E9TA 1P7BA 4ZOEA 1CO1A 2QR0A 5LBSL 4JHVA 4R2GB 1RCYA 3O0RH 3BGFC 1IV8A 3BFQG 3C8KB 5TF1L 1XF4A 1GYCA 3VGDA 3ZE0E 2EXSA 2FQFA 5CSZB 4JZNB 4Y2DC 3QNFA 4ELMA 1FFNA 1E67A 5DXWA 4FFZA 2XG5B 1BQ5A 5ECGA 4UIMB 4QJ3B 1ZEAL 4TNFA 4F1SA 5BRZB 1HNFA 4WFGE 5DS8B 3RX5A 3IRPX 4IMLB 5EEZA 4D8PB 4IBTA 4L4TD 4LCYA 4NUQA 5MERA 1JNHB 1BWWA 2FO4A 1QUNA 3DVGB 2X28A 3A3YB 1ZK9A 3QG6A 1EXHA 1FA4A 3ZDZB 4QLRA 4UTBL 1IM3D 1MCHA 4C56A 1A7NL 4NNXB 1S5IH 1V3JA 4ONFH 4LLMA 2R0LH 3D39E 2W92A 1MHEA 2JJSA 4N87A 1N64H 1PQZB 1Z66A 1ORQA 3MYJA 5JO5A 3T2NL 3FC8A 1QEWA 2AF2A 3F64A 5K5YA 2EACA 2XXGA 3BKCH 4JJ5B 5IW3A 4CC0A 4C55A 2CGZA 3B9DA 3EGSB 4Z7QB 2BH0A 1A6UH 1A7QH 4QRSA 1CDGA 4RZCB 2Q1EA 3GS0A 1AGEA 3QIUA 3BHBB 5IVXB 4M4RA 4APXA 2OCJA 5T3ZD 3IDNB 4N4YB 4GQ9L 4NO5A 2EXYD 3D09A 4ACPA 2TSBA 3C5ZD 3C60B 4TLKA 2PUQT 2K9FB 4PRBA 1OEZW 4TQHA 1IAIM 1DQQB 2QQLL 4CVXB 1A5FH 1R3KB 5DI8B 3EYOB 1JYNA 3ZW3A 4RDQF 3QQ3A 1JGEA 3N85L 1UVQB 2ZCKH 4M3KB 3S4SG 5GRUH 3V9FA 3MLWH 4LF3A 3B2PA 2CR6A 3GMLB 1J8SA 2W0KA 3MX0B 1EANA 1KJ2H 2FWLB 3QPXH 3RURA 1AS6A 3VD3A 3S97C 2ZWYA 3BWAB 4YFEA 1THCA 4LCCB 1AG0A 4BELD 1ZK5A 3BEVA 4NM4L 15C8L 3VXTA 5EN2B 4WI2A 3QORB 2DQ6A 3BH8B 1CLZL 3WNJA 4CNIB 4LQFL 4JX0A 1C1EL 3AU0A 3NFNB 4AIZB 1SGKA 2OMTA 3A0OA 3CFJB 2WLIB 2K0RA 3EYQC 3LD8B 4H2AA 4C56D 4PWEA 1MQ8A 1F11A 2QLYA 1HXMA 4L2LA 1MFUA 5JQ6L 5C2UB 3IVKA 1Z7JA 2Z8RA 1W16A 3FB7A 4V11A 5C0GA 3UDWC 2NR6A 2VUOA 3VWKD 5C2BH 1YNLH 1G1CA 2DM7A 4FP8H 1FL5A 2R29L 1GGCL 4U4BA 4K94H 4L1TA 2DH3A 4R84A 1VA9A 3JWNE 2WQAA 6FABL 1BQLH 4BD4A 3C08L 2QQKH 5FUOL 2JXMB 3FQRB 4XMLL 4ZOCA 5ALBL 4ZTEA 4ZX5A 3QIUD 3JVGA 3T0EE 4EKJA 2WN3A 4JY5H 4TNWF 4Z76B 4Z23A 1QFWI 4Q6IC 4QRPE 2CJTA 5FX3A 2NY5L 2O61A 4U6VH 1MXGA 2ZPKH 5G5DB 4HLZH 3SKMA 1WAAE 3QDGB 2MJWA 3WFZA 1OSPH 3FDWA 1YJDC 4YLQT 1AS7A 4NENA 4X6BA 1MI5A 3FSOA 4NN7C 3FUFA 3Q2LA 1U2CA 3MRIA 1KGCE 1P53A 2OL3H 2R59A 3N1GC 3BVTA 2E8ZA 2VERA 5CCKL 2AMGA 4M1DH 4PRIE 4XGZB 4H8UA 1K85A 1T6VN 3BH4A 3P9LB 3QIBA 2UVFA 2A83B 3B5HA 4HS8L 4NQEE 2PCXA 5D4HA 5B7EA 3X12A 2X38A 2GK0B 3NESA 5IFAH 2Z31C 2I32A 2JQZA 3EH5B 2WV3A 5CGTA 3FCSA 4PLJC 2FSEA 3AWFA 5EUKB 1CE1H 1HYSD 4BH7B 3DV6A 5L8LB 1O9ZA 4Y5XA 2YN3A 1NAML 4L4JA 2CNYA 3VVWA 3BWUC 3EFFA 5D7JC 4UM9A 4MD0A 3BC9A 4IKIA 4BM7A 4Y2DA 3CCHB 2F6AA 4XP9H 4JL2A 4L4VB 3GLEA 1QA9A 1Z9NA 3GD1C 2R8SL 3NA4A 5DO8A 4NUGL 3SKNB 4JFDE 1ZHNA 1U8QB 2VDLB 4FEIA 3RJQB 1W0WA 3N42B 1DFBH 1T1ZA 2Y5QA 1SYVA 5EC2B 1WAAF 4EQ3A 4HZ1A 1S7WA 1ACYH 4OF0A 1NA8A 3V4UH 4FX5A 4PGZA 5DJ6A 2DH2A 4HUVA 1MPAL 1NCNA 2CJUL 4FABH 2D31A 4HOMA 5C3TA 3SCMC 3DX9B 3OWRA 3MCKA 4YS4A 2GY5A 1NSNH 5JXAL 2ZP8A 1F3JA 3AW5A 4PWGA 3F58H 3HA0A 3BSGA 3N1QC 2F08A 1TSHA 4AKQA 2XI9A 3LEYL 4OV5A 3HAEG 3BKYH 3HI6H 3ZK0A 2ZX8A 1OAUL 3EO1B 2C3VA 1JE6A 4DP4X 1YDPA 3FCUB 3SY0B 1C08A 4LVOC 3KYOA 2VDRH 5F1KC 2QPDB 3TONA 1MI5D 3RWHA 3QNZB 2PPDA 3S6CA 2EDNA 3NIGE 4LCUA 2ITDB 4LT7A 4P06A 4WFED 4DEPC 1F4WH 1KXVA 2VH5H 4PWKA 4HS6A 1T0PB 5DJDA 4M02A 1OHQA 1DN0A 1GY2A 1VEPA 3HN3A 3W1ZA 1HZHL 1Q94B 4KRMB 2WJ5A 4LDOB 4PJCB 3UTOA 3VXSA 1QLEB 3IJEB 3W38A 3KW7A 2Q6WA 4WTXA 4GAGL 4ZAKA 4FQLL 3EJJX 4W6WB 3UTPE 1SLUA 3D0VB 2BC4B 1E4XL 1THAA 5ID1A 4UOQA 1RFDL 3KCPB 4LFHG 4UM9D 2FLMA 3FQ4A 3E6HB 4Y2DD 3EF4A 2QDWA 3DOSA 5T3XH 3BEWB 1LEKB 3T8MA 4DKEL 4PRNA 4TVSa 1JK8A 4K8RH 3R0MA 1BZ8A 4IU2B 5D2LB 4YR6B 4W70A 1NL0L 3THML 3HI5L 5FDYA 5LXGH 5F8QC 4OFKA 1HK6A 2Z8VC 2CO1A 3HAEB 4KHXH 3PWPE 4CL7A 1OAJA 2WSDA 1RUAL 1T22B 2KLRA 4IRJA 4PB9H 1AMXA 1YUHB 4JM4L 4WFFE 3FL7A 3GHEL 3K71A 4OF5A 4QJ4B 12E8L 3RKPA 2YSSB 4FG0A 5EF0A 4XO9A 3UDWA 5B8CA 1VFAB 3MBXL 3FFCB 3P77A 1FGNH 4H0HB 4OGAC 4QTIL 1P7KB 3N6YA 3FU5A 1UT2A 2MNJB 1NGQL 3U1PA 3UJIH 5BOPA 5HDOA 2E7CA 1BA9A 2CDGA 3G6JE 5DEGA 5F6IC 1VKXB 2X09A 4UYQA 5HYSG 1KB5H 4TSAL 1DJYA 3K5RA 4F15C 1I7TB 2IC2A 4IRZL 2ID5A 2IANB 5A2BA 3TBSB 5E99L 1KYAA 1G9ML 4Q6IA 1T4WA 1AZVA 1MLBB 4MDIB 3Q5OA 4GW4B 1MCPL 1FYTA 3QAZC 4DEWA 4GY4A 5FUCE 2CO4A 5CZXC 1L9MA 1AS8A 2JCCB 1MWAA 3ZHLA 4AK1A 3QQXA 3EXJA 3NGBC 2P45B 3AMLA 4JPIB 3WELA 2VABB 4N2KA 4BYHA 3HMWH 5I8CA 2H1LM 2R1WB 3ZXAC 2E86A 3IFOA 4L0PB 1X7TA 1NCCL 4MJID 1MIEH 3VXSD 4ABUA 4OAWA 4JRXE 1DLFL 3GWJA 3HS0B 3EJYC 1U8IB 2DEXX 2UVEA 3BH9B 3P0GB 4X4XA 2E6QA 2Z31A 2J88L 1CT8B 4QGTA 5IHWA 1I7RA 1SDYA 1YPZB 1D5IL 3UAJC 3QXDA 3L3JB 3ZQXA 4JO2H 1TZIB 4ZNCD 5KS9B 4D0CA 4X7EC 2OJZL 3TTYA 2H3NB 5I5RA 3G6JF 4FFYL 4KVCH 4XAKE 3ZZ1A 2WTPA 1KJVB 1F00I 2IV9A 2HT2D 2NXYB 3QQDA 3BP4B 5B1AB 3HG1B 2J25A 4LSDA 1FV1B 2YMXH 3ARFB 2YA2A 5IBLC 1J9RA 4DUWA 5HYSB 1GL4B 2CXKA 3L81A 1EQWA 4MMZC 1SBSL 1I3GH 3WFEH 5C7XL 1ETZB 2X3CA 1LE5A 4MXQD 4Y4HC 3NTCL 4IRJD 5MENE 3EYQD 2ERJB 4XAWL 3QFJB 5GGRB 3S4SA 3WN6A 1CLOL 4HIJA 1HNYA 4ATWA 1CTNA 2WLJA 4F8NA 5HPOA 4P9HH 1QWNA 3U6XS 5ICXA 2YQGA 2P46B 1MHHA 2WB7A 2NDGA 3EO0B 3VMNA 4DPAX 5KVEL 1A7RH 1P1ZB 2ISDA 4K2UL 5EG6C 5AVTB 4LNRB 4G80B 1TQWA 3HHSA 3NABH 3V6ZB 4XN8A 4ONHB 4YDIL 1BLNA 2V7HB 2Q7YB 3VGFA 2HVJA 3RZCB 5DHMC 5JHLH 3DHPA 4AEFA 1B3JA 5E2UH 3B2XA 4EE2A 1UADC 2VLRD 4B97A 2FLBT 4ODXA 1NMBL 2UZIH 3O3DA 4WSJA 4HUNB 4LLDB 4HIXH 4CBPA 5EIVA 4P3CL 1FYTD 4R83A 3GMPB 3NN8A 2FJHB 3DDGA 1OP3H 5BV7C 1ZLUH 1J05B 5D2NC 3U9WA 5I0VA 3B37A 2QEJA 1JL8A 3ZN6A 3LB6C 4D9LL 2EEAA 4BV1A 1CL7L 1HXKA 2XCMC 1IZJA 1U36A 3HN8A 1I8KB 1JV2A 4GBXA 5DUMH 5AYUH 3QRFM 1SMDA 2V4LA 4FTVE 1PCXA 1S7SA 2XTJE 3IFPB 3VFSA 4B9ZA 5HHQA 3NSFA 1IGFH 1QLRB 2YC1A 4EDXB 2BCKA 5F7BA 3PL6C 2B1HH 2NY3B 1JWSA 2Z31D 2XG4A 3QJXA 4H8WH 4BZ1L 5A16B 2X7LA 1FSKC 2NMSA 5KBLA 1XGPA 3ZKQD 2RFXA 3ATEA 4DQAA 2GIXA 5GGVL 3R7RA 3VCLB 4XXDA 4JN2B 2YO3A 5GGUB 5D96C 1RD6A 1T21B 3BPLB 4XC3H 4DGIH 4ODTL 4G6FD 3VFRA 5D7JD 1NBCA 2DLFL 1HL9A 3IFNH 2QKSA 3V7MA 4DP7X 3VWJB 4W9IC 3PYCA 1WH0A 2C9VA 1BOYA 4KUZH 4Y4KB 3RAJH 4E9VA 2FATL 3S5YA 3F7KA 1S7VB 5FFLA 2JIXB 3QO0B 4PJIE 5LBVA 5C0AB 2CD0A 5DSCB 5F9JA 3CX5K 4K3DH 3TPKA 1GC1H 3CDZA 1OGAE 2DQUL 3WLWC 3L5WB 4OZ4B 1PEWA 4LLQA 3MRLA 3ILPA 3VGGA 1DQML 5BVPH 5JHAA 5E08L 2CMRH 1LLAA 2KC0A 3K6FA 3SCMD 5EU5A 1U8HA 3LS5L 1B90A 3OJ2C 3TJEL 2Q76A 5I1LB 1KFAL 3DUUB 2W38A 5FECB 4JO1H 3ZTEA 5CP3H 3PGFL 4NKIL 2CPCA 4MSWB 1A1OB 4F7CB 3EYVA 1R9FA 2D03L 2PW2A 3PV6B 1VSCA 1CS6A 2IH1B 4PM1A 5FYKD 1X6LA 3KPNA 4OJAA 4JGUA 4DP2X 4NUPA 2HKFH 1CBVL 3BE1H 2XN9E 4HKJA 3RWIB 1DBJH 4LBAA 1PX8A 2HFEB 5FS5A 4GBXD 4RCAA 1U8NB 1FE8H 1RL1A 2AJYL 1KYDA 2DM2A 2I9LA 3HRZC 4PJBE 4XCFL 2F15A 3A47A 4PJIF 4APQB 3MOBL 2HRGA 4AGLA 2WXIA 4M7LT 3QULA 2NY7L 3SO5A 3E80A 4FJ6A 4NN6B 4KZCA 1U8KB 4G8GB 1MJ7L 3PY9A 1UZGA 5F9AC 3TT3H 4ESKA 2VC2B 5SX4I 4FAAB 4JNXA 3TV3L 3P3SA 4YN3A 4TUJA 1E9QB 4F3FB 2L7JA 3ARWA 3RG1C 5H8DA 2ZWZA 4PW3A 4W68A 2ADJB 5FHBL 2ZSWB 2Y69B 3TNNA 4JPKH 5KN5A 4BCZA 2KLSA 4Y9EA 3WJMA 2NT1A 3O3BA 4XCEB 3B7YA 2YQBA 3FTYA 1HZKA 3QEHB 1BAFL 1UWXK 4FQHA 1F58L 4OLZH 5E8NB 3GZOA 4MA3B 1WF5A 3CFKB 3QDJE 1U0QA 1PW3A 4X6DA 1IGCL 2G2RB 1YSOA 4NT6B 4ZSOB 4GH7B 1R3LA 3F01A 4ABWA 1NIBA 1XIWC 1XDTT 1F4XH 1H8SA 1FO0A 1CDHA 7TAAA 1JDDA 2YEZA 2H32B 4MMYA 3SBWA 5H37H 5IHBA 2OTWB 3SQBB 4PJBF 5FGBC 3OG4B 3V6OE 5FF6A 2IAMC 4LP8A 4HT1L 1L0XA 2BSEA 2ZXDA 4XNUL 1T7ZA 1XZ0B 2H1XA 5FHAH 1AZCA 3MLSL 1K6QL 1T2QH 4YHML 2G5BA 2BWDA 2A6IA 4AV5A 2OR9L 2VZTA 4HIHB 2ENYA 1EFXD 2WLNA 4G6JL 1D7DA 1DANU 1IFRA 1U58A 3QFDA 3QUZA 2FR4A 3AWEA 2O5XL 5DHXB 5D5ME 4D0DA 4B96A 1Q72H 1FFPA 1NLBH 5CZXD 4QXGL 3SDYL 3O6FB 5JMOC 2B1AL 5DQ9A 5IGXH 2A3TA 3T4YB 4A2GA 3SYAA 2NX5D 4PHZA 2K8QA 3BT2H 2XFGB 5I6KA 5BUGA 5CUSL 3IT8D 1U9KA 5DEFA 8PAZA 1J1XH 3SDXE 3IKKA 4QKXB 1MAML 3EJYD 5CIPA 5DQJB 5FYKL 4O2CA 2DWEB 1P9MC 3KPQB 2ODHA 1K3IA 3SDDB 1UXWB 5L4IA 2DLTA 2XJKA 3AADB 1IBDA 1TO5A 1UJ3A 2BZDA 1IE5A 5DMKA 4U0RB 4CRPA 2Z92B 1BZ7B 4NGHH 4O9HL 4JKWA 4RX4A 5D7EA 3QNXA 3QG7L 4LSRL 3KM2A 5F96H 1A6WL 1HESA 2Q87A 3SO3B 4NCC2 5IBLD 1KJ3L 4P5TC 4U4IA 3LN5A 1KSRA 2EDWA 1H3UA 2YS4A 5JHDB 4JBSA 2YPLB 4Y4HD 4KUCF 3BXNB 1A1NA 5D5MF 3MR9A 1P4IH 1G9HA 4JG0L 3LKRA 4LPVA 3VXPB 4ZRGA 1C12A 3WDHA 5BVJB 2XN1A 5T1DL 4GLRH 3WUZA 4JGMA 2BSED 2WOYA 3VFMA 3BP5B 2X6CA 3E1F1 1F86A 3QHFL 4ZFGH 2F5AL 3MRBA 4JG1L 2O93L 2EDXA 3CFDB 2R69L 4HV8B 3FK3A 5F72S 1F3DJ 1XXDC 2OI9C 3DRTA 4Y9GA 4DKDC 4NCC1 2DL9A 3IRZA 4S1RL 2ZKWA 4HPOL 2WGNB 2WZPA 3JV6B 4OZGE 2DWSA 4UQEA 1Q9KB 5L2JB 3WJJA 4G3YH 1CFVH 3B9KC 4R0LB 1YYMH 2XKSA 3EBHA 32C2A 1BBJB 4LLVA 5LJYH 5IB3A 4X6EB 2LLNA 2XA8L 1SN5A 1QX1A 3EHBC 1HSBA 1RSYA 1ERNA 5HHVH 3E3QC 5HYJA 1XXFC 5E5UB 2HVBA 2BW5A 3QWOA 2CM6A 1FL6A 4TUKL 4NO3A 1JTTA 4Q9QL 3UBXI 2XVLA 3HRZA 1NFDA 3I6SA 4WHDA 3BSZL 2BIQA 3D0LA 3RNKA 3C5XA 3B2MA 1WUNT 1YNKL 3NEOA 4OCNC 1QBBA 5SX5H 3MNWB 4P49A 1MCQA 5EUOE 2DM3A 3D4GA 4ZPVB 1R3JA 4N28A 4NIKB 1HILA 5DRNB 4RX4D 1Z6JT 2J8UB 2ZKYA 1SDAB 1MNNA 5F2FA 4PTUB 4BRJA 1WFUA 3VFPA 4N1EA 1OE2A 1LVEA 4XNYH 3DXAA 4OZGF 1T04A 1YEKH 2AQQA 4D9RE 3N43F 3BDXA 1U92A 3JV4B 3S96B 1CK0L 4N20A 5MP6H 5I0YA 3F84A 4BQ8A 2AABH 4IRSB 3GGWA 3FQWB 4HWZA 4AL8C 1I3UA 2R7EB 1IQWL 3U25A 3HZVA 1BREA 1XIWA 4IIQA 4JFQB 3ZQ9A 2WNGA 4BINA 1BHGA 4NOBA 1A9EB 1B4JH 3KWWB 3CH1A 5CINL 4XCYA 1GS6X 2HJFA 2H26B 4LRIA 3US0A 1ZHLA 3EOAA 1BQHA 43C9A 4BKTC 2W0FB 3WXWL 3O2VH 3GPEA 4AQ1C 2W0PA 4LCVA 2VE6B 4WNSA 1V3MA 5E8EA 2BMKA 2XA3A 4K4KA 4HQQL 1JERA 5EUOF 2X9ZA 3A23A 4WUUD 1E9PA 1V7ML 5AVZB 3IS1X 2VJ0A 1BVNP 3E6FB 3MLZH 3O4LB 4DGVH 5C0RL 5I0XA 3OKMB 4ZD3L 4JPQA 4J28A 5CJ8A 3V52H 5CEZE 3QBTB 3K6SA 2YKLH 2ENPA 1CR9H 2I7SA 3MA7A 2C7UB 2EIEA 2DMGA 3EOBB 4KMTL 4UT7L 4G7RB 2A9BA 2GT9B 4YVNA 1KCVH 1UEYA 4JM2B 5IY5B 4LAQH 3TFBA 4P2CG 2GKIA 4PSPA 3V5HA 3IWUA 2BY0A 1CXIA 2GBAA 4AQAB 1ADWA 4IK6A 4BFOA 3ZZSA 1SYSA 5B3NA 1MHCB 1XSOA 5ANMB 5DS2A 5B3SB 2WQWA 3PNWA 2H9GB 1NJ9A 3UBXB 3SIKA 3MRGA 3QRLA 1JGUH 2EVJA 4NZRH 4EJ1C 4RNRA 4QHNB 3Q1EA 2F19H 4KO6A 3L2LA 4QMEA 1JNLL 5DFAA 4HVBA 3O9WA 5IHZB 5DD5L 1W8NA 1L9PA 2ITEA 3WO4B 1J5DA 1DBKL 3KR3H 3IM1A 2M2DA 3G9AB 4NZFA 1QTSA 4P5TA 3RWEB 1N10A 1WBXB 5F3HB 4FFWC 5AVWB 4WJ5B 5CD3A 2H41A 4XE5B 1XIWD 4G5ZH 3OKNA 1X9UA 3OQRA 4MJ6A 5C0CB 3LZFL 4PRHE 3EG9A 2FT6A 3A22A 5J6SA 3SD5A 2NYZA 5HJGA 2IAMD 1EPFA 4KAQH 1H15A 2C9AA 4PB0H 5I1JL 1ZTXE 4OJFH 1L4IA 3SHSA 1OKEA 3LPWA 1M3JA 3MBEC 1CC3A 2VR9A 3S5ZA 1P4BH 3B1TA 3KJ6L 1G0XA 3BPCB 3EGXA 4OLXL 1NBYB 4YSEA 1LO4H 4UT9H 1J7VR 2WVVB 1FH5L 3DROA 4UV4L 4ZMZA 4UAHA 1PKQE 2F58H 4KI5C 1LD9B 2FWOA 4L9LB 3Q6GH 3B9KA 3FB5A 1SLXA 4QYOB 3LEXB 4D2NA 4UQDA 1MJJB 2GUOB 4XPBH 4ZT1A 4AGQA 3PWJB 4JB9L 2X0VA 3VSQA 3KPRE 1XF5B 3BWSA 5CWSA 2IGTA 4I1RA 1DBML 2CO3A 5B1CA 3MRPB 2DZEA 5ES4B 4JDTH 5INDB 2VDLH 4D9QD 4DKFH 4FFVC 5D1QE 3TO4D 5IM7B 4UQBA 1R17A 1SXCA 1N0LB 4MS8C 2GJ6B 4LDCA 1ADQA 4FCAA 5J6HA 2VXTL 4PJFB 4YHKH 1CFQA 2WQ8A 2AQ3A 3MV8B 3OAYK 5MEPB 3EGDA 3O2DA 4HLJA 4OCYL 1WSST 2CXGA 1WFMA 3K72B 5C08E 5J9PA 4X80H 2R9HD 5ERWB 3DK2A 5LUMA 1DE4B 2HA1A 2IDUA 3NRFA 2FH8A 1CLYH 2JB5L 1V3LA 4N8VA 5FDWB 1AGBA 1LO0L 5LDSA 3VGAB 1A9VA 2WQSA 4Q4IA 5C09E 1XEUA 2AJZA 4P5TD 1F8TH 3L4UA 4GSRA 1RJYB 3DHUA 3LIUA 5AB0A 3SPHA 3ZDWA 2P8MA 3CHOA 2O5NA 4NQDE 1T03H 4NBXB 4N22A 4K9EH 4L8DA 2CO6B 3OVUB 3LH8A 3UCQA 4YXHL 3TJHC 1UKTA 4OTXL 3ZO9A 4AK2A 1QFWH 3GI9L 1DTUA 5DJCB 4ANUA 3SDCC 4WTQA 3QUKA 5BXFA 4YZWA 4FNLH 3VGBA 1SDDB 3VD0A 1BX2A 2H5UA 3C5JA 4K23H 5EZOL 4DVBA 2GYSA 2CUMA 2PTVA 4L9DA 4YAQA 3X14B 1FZJA 4AX3A 3NFPA 1ZANL 4LLUB 3KWUA 5GRJH 1ZA3B 1QAWA 4RLDA 3S34H 1OL0A 3VRJB 4AYFB 1WBYA 1PVHA 3B9KD 4ODWB 2B4CL 4FQXA 1WV7T 1JGLH 1NGWA 5GS2H 3EHBD 3WAKA 4R97C 1NZRA 2YKKA 4GIAA 4MJ2A 1PU0A 2XETA 3BUDA 3HUJB 3DX7B 3Q48A 5HVGB 4IHOA 3QXAA 3FT4A 3BN3B 1CFTA 5JW4M 1NAMB 5HHXH 4IBLT 4BZ2H 1EAOA 3IEAA 4YSSA 4QF1B 4FMVA 4YBLC 5I76A 4YUEL 2A9ML 1JGVH 1G7QB 1AO7A 1RPQA 4EI5B 3HI1B 1OWRM 2AQ1A 3ZKXC 3TURA 1DLHA 2W95A 4U7MA 3RTQC 8CGTA 4PGDA 1BF2A 4Z95H 1AI1H 3KBEA 4HSCX 4BE6A 2VR4A 3WL9A 5JR1L 4OZIB 1XO8A 2APXA 2B3RA 2QR0B 3RA7L 5GZOC 2XPZA 1QZNA 3UO8B 3J07A 1WWWX 3CTTA 3DPDA 2WQVA 1RUPL 3RWDA 5JIKA 3NIFB 3MNZA 4LSVL 2CPUA 2GW5A 1PZCA 2DKUA 2J5LB 1ZE3H 2QSVA 4GEIA 4LPYA 3WNOA 3VQ1C 5FB8A 2V8MA 3FT2B 3BVUA 2QKIA 4HJ1A 4LCYB 4QTHA 5I19H 2CIKB 1MREH 4AW4A 3V6BR 1KUMA 2VDML 4I9XA 5F89B 4XB3A 3M45A 4Y0GA 5EOQL 4AUJA 1YNTB 1HOEA 4L3EB 1FVEA 4XN9A 5EEUA 1YMHA 5FFOA 4K7PX 5BS0A 3W5MA 5B7FA 3EKCA 3CLEH 1X7SA 3DX6B 3B2VH 1J18A 4WDIB 3VWKB 3EJZC 4LBEB 4YNYA 1AC6A 4KRPB 4K5OA 3KAAA 1YEEL 1E5YA 3WSQH 1JF6A 4TLTA 4PY8J 5IF0B 1H8NA 1DQTA 1TQUA 4FQXD 5FKPB 3TZVC 3F7PC 3BAYA 4B5EA 2HRPL 4AG4L 3MI6A 3P3RA 4ZUSA 2DIJA 1RZ7L 4G71B 1E5UI 4F57H 1ZPLA 1QNZL 1UYWH 3LN4B 4NO5B 2A6JB 1T66C 2LVCA 2NUTA 3ZR6A 3H85A 3GIZH 5CGMA 2EECA 1CLCA 4PJ9C 1CQYA 4OF3A 2WKOF 3O8XC 4GUOA 4C59B 3C6SA 3L9RB 4LU5H 4ZX4A 1SQMA 5TD4A 4ENEC 3DECA 1AO7D 1LP9E 4GQZA 3BPNB 2J12B 2PWEA 3QQ3B 2H6UA 5FYJD 3ML9A 4N0YL 2ICCA 4AENA 3BZDA 4N9GB 5E1HB 4XNZC 2Y7NA 2CDEA 2WBJA 3CBRA 1GZPA 5CN1A 5L4FA 3QZNA 3RIAK 1W72H 1GTNA 1I31A 4N0CC 2AXHA 3ZYIA 1UZ8A 1JMZA 2IWFA 3V4PA 2KLTA 4K5PA 2FHBA 2ADFH 3AB0C 5E5MB 3ECBA 1TCRB 5I75B 2CDFA 3ESMA 1IL1B 4AEEA 4L4TE 3VQ2C 2DOCA 2VIRB 3MCLL 4FFWD 2IPUG 4NZJA 3HNSH 3RL2B 1L9OA 2OP4L 4NC0B 3U9PH 4C54A 1KLFA 1RPUA 4JKNA 3LZQA 1R3IL 4JMNA 1B0WA 4ZX6A 1AIFA 3BX7C 3IRCA 4H25A 1JXJA 4JDZA 1BW8A 2G3ZA 1EEQA 3BUYA 1TIUA 1Q90A 3Q8CA 5BS0D 1JPSL 1OT4A 4FQQA 2G9HA 1U8CB 3MODL 4NDMB 5C0GB 1G7LA 3OR7A 3P4MB 2ROYA 3HZYB 2IFGA 2ICEA 4IGBB 5F7YC 3ARXA 1LP9F 3UH8A 3BO8A 2G75B 3KYMA 4IOFC 4G9DA 4FMFA 3BKJL 4KK8C 4AXWA 4AMKL 5GIRA 2GIYA 3FO2B 3RPKA 5DURB 4H1LG 4KI5D 5A6MA 5T3ZE 1AIZA 5SWSB 2UYLB 3MLXL 4WI0A 3HNVL 3GKWL 3HFMH 3OMIB 4U3SA 3HKZA 2FO8A 4BSJA 4YHPA 3MLVH 5FO8A 1A65A 3K6DA 2RMNA 5DRXA 4RAVB 1D9KA 3UAEA 1QRNA 4FFVD 1TKWB 5I74C 2V9UA 4PGEB 5DK0A 1EZVX 2OR8A 4M56A 2V2XB 3U30B 2JK5B 1KEML 3N0AA 4UTCA 4LRNH 2WMPB 2AKRB 3CZSA 2TAAA 4MS8D 4OFYA 4P46C 5CXPA 1PLGL 4FKEA 3W0WA 3UPRA 1YECH 1PSKL 1WFJA 4HKBA 2R29A 4ZO8A 3X12B 1IVTA 2WBJD 1S78D 3FTWA 4U6XA 3TC9A 2H0PA 3HEIB 3FCSB 4F33B 1BZOA 5D7KD 3RTQA 2EC9T 3P73A 4EQ2A 4A6YH 4ELME 5I0ZA 5B21A 2PWDA 1XV8A 2JMRA 4E41E 1H6TA 1O9VA 3DV6B 5TFSL 4ODUB 5MEOB 1HS6A 1X6NA 2Y36H 3H1ZA 4PP2B 3ABMB 3BGFB 4Z7IA 3BISA 1HINH 1M7DA 1BQSA 3BD3A 4Y2DB 4ODVH 5ISZA 3I6LE 2NZ9C 1OB1A 1K2DA 3MV01 5E9DA 2XY1A 3AUWB 4Q74A 4H1LB 3KPLA 3U0WL 1UA6L 5DYOA 3UO1L 1JJUA 1OD7A 3ECQA 4HCGA 4C56E 1EJOL 1N4XH 1QVOB 2HT4C 4XMPH 3S37X 3V5DB 3DNKA 5ALCH 3TJHD 3PQYA 3BUBA 3HHRB 3SDCD 1IE4A 5GRZA 3S3BB 1V54B 2XTSA 1E0OB 4HUVB 1OO2A 2GJRA 3HE7C 4N3UA 3GNMH 4N2LA 4XOAA 4HH9A 4XXCC 3S8FB 2ZOWA 4BJLA 2D31B 2VMDA 3GMNB 2NW3B 2P5EA 1BPLB 4AITA 1F0LA 3EBAA 3MCKB 4O5LH 3RRQA 1G7HB 4LK4A 4IQHA 3FBQA 4M8QA 4OD1H 3LKNA 4PJHA 4M9PA 3D08A 3SE8H 5GRYA 2WGXA 1RULL 3ME0A 2B2XL 5BZWA 4ELMF 4H8PA 4OIFA 4DGWC 3NCWA 5EU4B 5KYXA 2QHRL 1MCJA 4NRXB 3HPJB 3U1SL 2ED7A 5IB2A 3WOVA 1NFIB 1D9KD 4XMKL 3KYOB 1QRND 1VCBC 4OFDA 4P99A 3WKQA 4MD5B 4YBQC 5EFIA 2CR0A 2WXMA 4PJ9A 5KSVA 1LWRA 2I24N 4U1IA 4UDUA 1HSAB 4GXVL 3UFIA 2AJXL 1E5ZA 2MPVA 5DT1H 2P8LA 1CFNA 5DJDB 3U36B 2JWYA 2Q8BH 2FWSA 1NOAA 1DN0B 4NNPH 4KX9A 5K1JA 4F7KA 1KEGH 4MQXD 3OAZH 5E6IA 4WU5B 4MJIB 3G08A 3RTQD 4QIRA 3BVNA 4WQOA 4A7GA 2FWUA 4RQQA 4OLWL 2APFA 2ZZUT 4IU3B 3S88H 1RAMA 1QFWM 3VXUA 2CKBH 4KKAC 3D9AH 4R4FH 4IEFA 4AZ8A 5M94B 2W88A 1QW8A 3GHPA 3UYRH 3UJJL 1CFBA 4Z7AA 5A2KH 3VTMA 4ZFOA 5ISZD 4FG4A 1A8JH 5E9DD 3TIEA 1T4KA 4PRNB 3TBVA 1GPOL 1UEMA 2MQGA 3A6OA 4G9FB 2ZF8A 4UILH 3WLBA 4DO4A 3DI3B 4P2QB 5EOCH 5C97A 3W82A 4BWUA 2DEYX 4NWUL 4QY8A 5FM5M 2GUYA 1H8OA 2J21A 3WTXA 1E8XA 2BNRA 2BVOA 1E5BA 3MRJB 3NJXA 4EDWL 2PCYA 4J3WA 4D7PA 4GSXA 2NUPB 4JFHD 5GJTH 1NKGA 1VCAA 5IJKA 2E7HA 3V9EA 5FUZH 4LGRB 4CKQA 3EJZD 3LQZA 4N2BA 2YD0A 3QCUH 1HQ4B 4F9LC 3DGDA 4QRUA 3L4ZA 3RB7A 4PRPA 5HHOA 1U30A 3TZVD 2MQ0A 4E36A 2QPEB 3PDOB 4L1BA 4MAUH 2AK4D 4NCDA 2N7AA 5SX4H 3D6GA 3ZKMD 2XNAA 3UZVA 1EDYA 1ZSDA 3GDBA 5IHUH 2VLRB 4XPFH 3FAWA 3SZ6A 4NO0D 4HJUA 1MI5E 3QH3B 3BZEB 3VI4E 1Y07A 3F5WA 5DWUH 4PJ8C 3E0GA 4PJ9D 3AQDA 1HZLA 3SPIA 3DGGB 3T9WA 3KL0A 4FNUA 1U93A 1UGNA 3CFTA 1EEYB 2WOBA 3KPMA 5HP5A 1U3HC 4HWBH 2I69A 3NJGA 4NN7B 1BEXA 1BV8A 1NDMB 4I18C 4ENED 2QSQA 4HUUB 3F3HA 5E2TL 4MX7B 5E6ID 5JW3L 1RIHH 3US1A 4P46A 4XRCB 1JZJA 3GB7A 2VLKE 3EIFA 1HWWA 3VXUD 4WGWB 4MB5A 5J11C 4QOKA 1T2XA 2Z31B 3GBNH 5T5FH 3APMA 4TTDC 2I60L 3NJHA 4N0CD 4K3EH 4XNQB 1AVAA 4L18A 1ZTXH 3IXAA 3V4VA 5L7XH 2IDCA 4WCYL 5ADPL 3GMQB 5CLZA 3U6RA 2BW4A 2IPTH 4G6FB 4KV5E 5BNXD 5D7JB 1EZLA 1GAFH 3FO0L 1QBLH 2P24B 3ZDYE 5JW4Q 1U41A 4IDJL 4F7PA 3A5VA 3QK0A 4MLIA 1LE5B 1V8HA 3MOAL 1HH9A 2BNRD 3L4YA 3OB0K 3VI4F 4EZJA 5FW6A 4IBWA 2DTMH 3MJGX 4HUWA 4XX1G 4AYID 1U8PB 3I75B 2AERT 4DKTA 2YPKA 2COVD 3G6AA 3L3GB 1XH3A 4Z18A 5T33H 3H56A 3HR6A 3SE9H 1NCWL 3G6DL 4HW6A 3I6GB 1UG9A 3HE7A 1YN6B 4OR1A 3L3HA 5C86A 3SCMB 4KK8D 4PRPD 3PDGA 3FNKA 4PG2A 1M6OB 1E9OA 1LXMA 3MV7B 5GXBB 1TSRA 3ZOAA 3D25B 1CXKA 2DQIL 5A3IC 2VWEC 5IJVB 3STZB 1IAIL 3P1VA 3QZWG 1BGXL 2Y06H 1HAWA 4KV5F 2FIKA 1Z3RA 4LXFA 4PJAB 3ESPA 4LVOB 4QXVA 5GGTL 3ZDYF 4EXPX 4G83A 3VUAA 1FNGA 3GBLA 2I25N 4CVUA 4YQXH 3VXSE 2UZXA 4TVPH 4XVSL 1UM5H 4PBXA 4P46D 2OMXA 1RZ8A 5HHQB 4DEPB 3U7AA 1MFBL 1RIVL 3OJVC 4H44C 5AVQB 1JYXA 1D5ZB 1GJIA 4GKSB 2BVPA 4QOKD 3UC2A 4LASL 2EVGA 3MACL 1EERB 1C5CL 1XGPB 2MMXA 3DVIA 4OCRL 2RFXB 4JZJA 3BPOC 4LGPB 3ULUC 4XXDB 4JQVC 2VDKL 4XX5A 4L5FL 1UA7A 5FLVA 4G8FB 1BM7A 4BWTA 3KH4A 5AW4B 4O02A 3UZQB 2DWDB 2P1YA 3WIAA 3X1BA 2NZ9D 4OZHB 3MROB 3PHAA 2BOBB 2F7PA 3NRPA 3DX8A 4R90H 5EF1A 1HL5A 2HT4D 2YGPA 5KEZA 4X50A 5F7EL 1G84A 4J8RA 4MA8L 5IB4A 3MYZA 4XPTH 3QZWB 2AEWA 1RK7A 3BYYA 4H2CA 2DD8L 5DDHA 5EIIG 2IWKA 3VMPA 3HE7D 1OB0A 4R7DA 1BZDA 2PO6B 3B6SB 3BAXA 3RL1B 1JHLL 3H2WA 3WIHA 3ATAA 3DJRA 1CIDA 1QBMH 3LNDA 1NAKL 4XBEL 1WUZA 4H4NA 5JDSB 3TEWA 1R0AL 2V3EA 5F7WC 5F6IB 3QFGA 4AGMA 2DV6A 3VXNA 5KTEH 2Y22A 1FYTE 1KXTA 3JUZA 4JO3L 4E2OA 4F15B 4HHAB 4JFUA 4WHYG 3KPNB 3KCWA 2PNDA 2IPUK 4TRPH 4ZUUA 4OGXL 1I3RA 4G2AA 3FSAA 3ZTJG 1EFXB 1IC0A 4PW9A 3KGTA 3TPUA 4BSWA 3QAZB 2MPAH 4YBQD 3UG3A 4NBZB 2OAAA 2LW3A 2ZKHH 1N6UA 1HHJB 4MAYC 3RFZC 1PCSA 3HB3D 3NGBB 4KDTC 4MHHG 1LILA 5IVXF 4B9PA 5BO1H 3FPXA 2IPKA 4Q9BA 5LGHL 1YEFH 1RZPA 2NX5B 2V2WB 2YEVB 5AVXB 4Z3JA 4PGJA 1DSFL 1SEQL 3D30A 4EUPH 1G6RA 1RUMH 3FMGH 4OB5L 1R24B 2YD8A 3L3IA 5EIIB 4KKAD 2XVGA 5CZVH 3UXFA 4NKDA 2ZOLA 5TQ0H 1IBGL 4AUYA 1MNUH 4ZW5A 1JZDC 1KN4L 2XVBA 1QFUL 1BVZA 1TZGL 4FA8A 3FRUA 5KW9H 4GKNB 2NNFA 2EO9A 2WXKA 2BSRA 4X5WA 3F00A 4RBPK 3II2A 3QEQB 5F9WC 1ZXQA 2WKLA 2E9JA 3GSUB 4PJ7B 4TN9A 5DJ8A 1G1YA 3ABGA 1UURA 2R2HA 4X6DB 5FOJA 3R18A 5I5IA 5IV2A 1BQKA 4MXWH 4HPHA 3NAAH 1T1YB 3Q6FB 4MMZB 4ETYA 2RTTA 2DQMA 2HPOA 3MRQB 4Y4HB 1FO0B 1EJFA 4A68A 1DVFC 3JWOC 2YZ8A 4WUKL 2V8LA 1N5AA 3BVXA 2DWYA 4DUVA 1EMTL 4ZS7L 3P3UA 5E94A 4UT6L 4WW2F 5DD6A 3LHPH 4C4BA 3FQXA 1KELL 1ZIAA 3C2SA 3OKKB 4LARL 1TCMA 3QVAA 2OMYB 3O11A 4ZZKA 5AB9A 5F3BA 3FCBA 3IU3A 1O7DC 3ARVA 5DVNA 3HG0A 4V33A 4PVMA 5ICUA 2WKGA 4LO9A 4HYTB 5TE4H 1MWOA 3AXHA 1U58B 6PAZA 1DO5A 1UD4A 3KYNA 1JUFA 3ROLA 3L95A 3KPOA 4YK4C 4D0DB 4YSAA 4PJ8D 5HXMA 4HMCA 1MRCL 5D2NB 2ITFA 4I7ZC 4UWQB 5C0FB 2H0JA 3UTTA 2R2EA 2WLKA 1DL7H 2OA9A 4NJ9L 4OIIH 3U2SA 4R26L 3STBA 5IMOB 1GYAA 3FQYA 4K7PH 1EXUB 2E8YA 3RIKA 2CCVA 3FUJA 2AV1A 4NOFA 3ZL1A 3PL6B 3KH3A 1FZKB 3HW7A 4M6OL 3BP7B 4GT0A 4OQTL 4ODHL 4TTDD 4UQ3B 3E38A 2VZ3A 2J56A 1A6VL 1FSKB 3NIDB 4K0OA 1RJZB 5AOZA 1LK3H 3I50L 4JDVA 2GITA 1N18A 1QFHA 4DN3H 4Q9RL 3L7FB 2VDOL 4JLRB 2X9WA 4G7VL 4GS7C 4PUBL 5D96B 1M56B 1Y6MR 1UCBL 2D7MA 4PLKC 1T1WB 3QNXB 1KV3A 3G5VB 1P7HL 5BW7A 4HUXB 1IFHH 4DGUA 1F97A 1JD7A 2V3DA 3MRHA 3UPCA 3A67L 4PREB 2DQHL 2QFPA 3CMOL 4WWNA 5T3ZH 3VFOB 1AJ7L 5C0JA 1IKNC 2VTFA 4E9YA 3B2UC 3PABA 4GO8A 1C12B 5IMKA 2HUHA 5C0BB 2FBOJ 3U2IA 1FLTX 3H53A 2OCCB 4L2YA 2BHZA 2JTDA 5AEAA 4U1HA 1BD2B 3EUDA 3SQOH 5BJTA 1F56A 4IK7A 2J43A 3BLBA 5EC1A 4PRDB 3MRFA 3Q8EA 4BKSC 2XV6B 5TDNA 3ZR5A 2Z4TA 2EUWA 1XX9C 5CP7A 2DQFB 1VRSA 2YBGA 3WE6A 3ZL2A 4DCQA 3OM3B 4Z5RA 4F2MB 4XP4H 2QVKA 4KKRA 3T2QA 4ELKB 3O0RL 5I6OA 1RSFA 4OLVH 1D2OA 3BFWA 4CN6A 5AW6B 5A3ID 4I89A 1N59B 4WUUB 1U8MA 4R5VA 5KVGE 2SEBA 4FFZH 4LLVB 1V5JA 2FD6H 2A6DA 3OKDA 5K9OB 1X5LA 3G5YA 4HHWA 2Z0UA 4MCNA 3UTTD 1HSBB 4DP5X 3AWGA 3C6LA 4TULH 2VMJA 5D2LE 2EADA 2GAZA 1MCOH 2L04A 3OJMB 1FL6B 1RHHB 3FT0A 5F7UA 4OV6F 4RZKA 5GGRY 3RFZA 4MAYA 4KDTA 5IB1A 2D7PA 2P3YA 2YJLA 1RVFH 3S36X 3ULSB 3W39B 1S5IL 2PYEA 3MHZA 1UH3A 2R0LL 4GMTH 2L7EA 4S10A 1N64L 3ULUD 3MRDA 3R06B 1R3JB 3FFCE 3VXQA 5E8OA 3MSPA 4O00A 4CADA 1P2CB 2IXQA 3D3VD 1JFHA 5DJ0A 4P23C 3CSTA 5JW5A 1L3NA 3BKCL 3LZLA 4J2QA 3SDAC 2B5IC 1T7VA 1JK9B 3QUGA 4M3HA 4Y19D 3VFPB 1TZHA 2VCOA 1A6UL 1A7QL 4IMKC 2FYYB 4RGOH 1VZGA 3MKGA 4XB8A 4YGVB 5TH2A 5FA4B 1SVCP 3WIFB 1UFGA 4LHQB 5AKRA 2IANE 4X8JB 2FDBP 3GS4A 5IFHH 3GQFA 4HEME 3JBG7 3QISA 4X4YA 1AR1D 2CLZA 5ELIA 4U1SA 5DK3A 3FQTB 3OPZH 3DOHA 3PGDB 3ULVE 2EIZB 5D2LF 1A5FL 1I7ZB 3VNYA 3TBWA 3CH1B 3ET9F 3MBWB 3OX8B 1KFGA 3MJ9A 4Z7VA 4P5SA 1ZHLB 3EOAB 1BQHB 2BNQB 4XOCA 1XR9A 2IAMB 4QDGA 1SHSA 2ZCKL 3MUGB 5E0QA 5GRUL 5E95B 1FRGH 3K3QA 1KJ2L 2K70A 3IE9A 3QPXL 1HU8A 3QEGH 2PYFA 3TV8A 5A6IA 2E75C 1C5DA 1YPZE 3CSYA 1A4KA 1GOGA 1KCRH 2VL5B 2CGRH 2DYPA 5I6XB 5HGBA 2WIIA 3A6BH 4FZ8H 1QWUA 2HJLA 5AB2A 3U7WH 5IHLB 1QSED 5F3FA 3PJSB 1JZ6A 5D4IA 3S37H 5BRPA 5C0DA 3HC2A 3QW9A 4OJEH 1RZGB 2YPVA 3LIZA 4FRWA 3OSKA 4KTEH 1IEAA 4MAYD 4ZYKB 4CJ0A 1XGUB 4JREC 4NI3A 1J5OH 1H3VA 3H9SA 1E28A 4Z1PA 5F7AA 1JTOA 2PYED 3QFJE 1G9EA 1TJIH 1ZY9A 2Z34A 4XI5D 5C2BL 3PWUB 1YNLL 3ULVF 2JCCF 1TPXC 2VRAA 3T1FB 2CBPA 4FP8L 2HZHA 4OLEA 5I73B 2JJTA 4K94L 1GHFH 3VXMA 3WS3A 4G82A 1A3QA 1HQRA 3CHXA 2Y5EA 4RWYH 1ZLWH 3BD4A 1BQLL 4RFNC 4MWFA 3GZQA 4U2ZA 2MQCA 2QQKL 2VDMB 5GISH 1FI8C 4Q0XH 4ZMPA 1ES0A 3CFEA 4P04A 2BSTB 5B38G 4JY5L 2V0AA 2XRAH 2K4WA 4MNGB 1S8DA 5I1IH 2ATKB 1YPZF 4P5TB 4U6VL 2ZPKL 5EO1B 1XB6A 4DGYH 3SGKA 4GXUM 3LV3A 4OSUH 4PP1C 1OSPL 5ICZA 3CLFH 2AS5M 1X5YA 1ASQA 4MJ6B 3BAEH 2OL3L 2VDPB 4M1DL 1NGZA 2VZSA 1H15B 2KZBA 4JFOA 3IYLW 1INQA 1TEFA 5IFAL 5I15H 5KYUB 3P2BA 4URTB 3L13A 1IKFH 5C07B 2OI9B 1CE1L 1VAHA 4K73A 5IK3B 2BS9A 1JXKA 2W5PA 3BIBX 4C8XA 1HDMA 1EBAA 3EYUH 5DHEA 1JAEA 1PLBA 5TGBB 1R47A 2YAOA 3CVCA 1JYVA 2OJ1A 4BHUA 5HYJE 3FB5B 4FHJA 1ZJAA 4XP9L 5SWZA 1DVYA 4HK0A 2WZ0A 5KJ4A 1AYOA 1QTPA 3B7RL 3NT0A 4IS6B 1NFDE 2VSCA 3V0GA 3CSFA 5B38B 4QAWA 1AANA 1XCQA 2Z93A 5AVYB 2VQ1A 3H9SD 1FNLA 4HZAA 1DFBL 4FGMA 5C0AE 4OFIA 2DLHA 4X9FA 2QBWA 1ACYL 4ZX3A 3V4UL 1FJ1A 2NLJB 1HJBC 3PE9A 2GTZB 4OD2A 3RKDC 2LABA 1TZAA 5E1QA 1TTGA 3CUPA 2ZYIA 1CFQB 3ZRCC 4FABL 3AMKA 2EUZA 2EIBA 5GZNA 5C3LD 4H8HA 3EYSH 3C5SA 1PG7X 2EH8H 1NSNL 2AAVA 3G5WA 3DXAE 3KEDA 3F58L 4X0KB 4KRLB 4PLKD 2MRYA 2XXMB 4PR5B 3QDMA 3LPPA 4P23A 1BVOA 1DVXA 4FFTA 3SDAA 5E6YA 4Z0XB 1JRHI 3JZ7A 3VE0A 6TAAA 5E56A 5DMGC 4TXVB 3BKYL 2XBDA 3HI6L 4K5MA 4IMKA 1OZUA 1NGYA 4G7YH 2E6JA 2ZNXA 4IOSA 3GIVA 1S9WA 5LCVH 3UX9B 3CMGA 3QEUA 1ETA1 1YAZA 2D7TH 2VDRL 4HETA 1ZT4B 2ZSVB 2DQEH 4HKXB 3B2UD 1FCCA 3IWVA 3WKMH 4MCZB 2QHLA 1NFDF 1QABA 4JDEA 2PCFB 1F4WL 2VH5L 4P5MB 3JWNC 4AQZA 3PG2A 3OB8A 4OCXH 1L9NA 3IJYA 1QHOA 1MDAA 4W9LC 3GTNA 1BX2B 2BO0A 1A2YA 4NN5B 4AQ1B 1OCZB 3AAZB 5KG9A 1BECA 3T0EC 4QHMA 3CVBA 3LPOA 3GBMH 3PWNB 5LN4A 1IBZA 1KENH 4PJEB 4JFPA 5HTSA 1BPVA 3CV5A 3DSNA 4O58H 5T3XL 2FNBA 1RJLA 3NPSB 4FLQA 4L8BA 3UTSA 2R2BB 4GG8B 2IH3B 4K8RL 3DC0A 4HISA 1JF1B 4Y16C 2IMMA 3TA3C 2DTSA 5F1SA 1ML0A 3CAFA 5LXGL 2X4SA 4NO2A 4D9QE 3F7VA 4TL4A 4KHXL 4IHOB 3QXAB 3FT4B 5K9QG 2GC4C 3MLTB 9CGTA 2OTUA 5JPNA 3RLSA 1O5PA 1PZSA 4PB9L 2XV3A 4F7EA 3QJSB 4JZOA 2XWBA 3QZPA 1T7WA 5GZND 4LL1A 1FGNL 4UNUA 3M1BB 3OHXC 4PAZA 2N7SA 1OGSA 4WY7H 3LXAA 2F54B 3LZNA 3TJPA 3UJIL 2KZWA 2MHAA 3QDMD 4P23D 4XH2B 3D34A 4YE4H 3SDAD 1IBFA 2WXPA 4XZUB 3TEUA 1KB5L 3SPJA 3MNVB 1UUSA 5I26A 3TTSA 4IOSD 4LVHB 3VD5A 1BIIB 2F74A 4QCIA 5EU3B 1RP9A 3MQIA 4ZXBC 2BZCA 3BUIA 1FIGH 4F8OA 1TQCC 3A4EA 1B4LA 4YSOA 3L2NA 5IEKA 4JY4B 1MWAH 5A2JH 4PJGE 1YJDH 5FK9A 2Y24A 1RMFH 1C8QA 3QUMA 1FVEB 1XF2A 5IBUG 1OTTC 3DI2B 3HMWL 3RVTC 3T3PE 3G5ZB 1D5BA 4YDNA 5KSBB 2RCSH 3NSCA 3TEXA 1R5IB 3T71A 5AVSB 4G1MA 4FXGA 3S5LG 1I9IH 2VO8A 3MBEB 1WGVA 4UAOC 1WP6A 2JKRM 4A7UA 2EVHA 2BP8A 4JO2L 3OC5A 5AKTA 4DJMA 5A2CA 4Z7UA 4XBGA 4KVCL 4N2NA 2A74B 3D7PA 4UANA 1J8KA 3OSVA 5MEQA 4A63A 2YMXL 2HLAB 3WFEL 1I3GL 3VG9C 3C75A 4L29B 5JQIB 5EA0H 2GSIB 4Z7NE 5J13C 2FT7A 4TUOA 2FK9A 2YPLE 4M5ZH 4P9HL 4GRLB 3IBEA 4PJGF 4BSVA 4LMQE 5AW0B 2PTTB 4GSDH 4TPRH 1GA2A 4KJYA 4ONOA 1A7RL 2CDEB 5TK2A 1SMOA 5IBUB 1JTPA 2WLLA 5FO7A 2ALWA 3NABL 3FCTA 1N0XH 2HKHH 1SXSA 1OP5K 5AZ2H 3X17A 4WFGD 2YWYA 5FW7A 3AM8C 5JHLL 3IGAA 5E2UL 4K3JH 3S5LB 1TVHA 2UZIL 4M48H 2E47A 5GS1C 1JZ2A 2R1XA 4HIXL 1N6VA 5GHWL 4JHBA 3S7GA 5I1GH 3K5SA 4WO0A 1Z5LB 2AFNA 1KLUA 2X2UA 1KLFB 3DETC 5EDSA 2QVFB 1MAJA 1OAZH 3N44F 2YD5A 4J3OD 1UENA 2EKSA 5DUML 5AYUL 3D39D 2AXFB 3D51A 5EZJB 2NNRA 3BW9B 1QLFA 4Z7NF 3P2DA 1I1FB 4PJ6A 1CD1B 1IGFL 3SDCB 3KMDA 2B1HL 1CBJA 5IVOA 3PXHA 4H8WL 1K72A 3LXBA 1IIKA 3NK4A 3ARGC 3WDJA 1UWXH 2Q0ZX 1GOFA 5GIRB 2ZXQA 2VLJB 3T0EA 1CI3M 4XC3L 1VGEH 4DGIL 5I66A 2LU3A 5K9KA 3B2DC 2BRRH 3IFNL 1ZT1B 2E7MA 5FUCC 1SMAA 2F53A 4GW1B 2PCPA 4QO1B 1PTZA 4GQQA 3RAJL 4KUZL 1AMYA 4XVUD 2YXMA 2A77H 2NNAA 1MCNA 3ISRA 3ZO0A 4CGTA 5J6GA 4J39A 4YHPB 4Y16A 4HHGA 4R97B 3TA3A 5IJCC 5FO8B 2NY2D 1XWVA 4AMWA 4PRIA 4K3DL 2ZOKA 3INUH 2XPGB 1AO7E 1GC1L 4QRQA 1JG9A 1NCHA 4ZTPH 2F7OA 1MFNA 4W93A 2HG5A 4XPAH 5EU6A 2PP9A 3ZBMA 1SNRA 5KANI 3AZUA 3HRPA 4EMZA 3T4AB 5BVPL 5TJWK 2CMRL 4PQXA 4YBLB 4NQQA 4U6XB 2ZT9C 2H2SC 4XR8C 2BP5M 3PWLB 4FHKA 1Q9WA 3ZKXB 1YEDA 2XY2A 3OHXA 4LHUD 4JO1L 5G55A 5K93A 1DJGA 4OZFG 3OAWA 1F1GA 1S6NA 1XCTB 2VDNH 3BGMB 1XMWA 4LKXB 3CZNA 2CZNA 1PZ5B 2IOIA 2D0GA 5DMGD 3FUMA 1W8OA 2X6UA 3M17A 3K46A 1K2DB 1WZKA 4JFDA 2OSWA 3FTUA 2HKFL 2AQSA 5JA8B 4WI7A 3BE1L 4N6RB 3DO7B 1Z9SB 1DBJL 3GXFA 5AG9A 1DEDA 1FE8L 4N26A 5BS0E 4YHNA 3O81A 4G70B 1AQDA 5KVGH 3L9YA 4GI6A 3BN9C 3J7HA 4HD9A 3MV9B 5CCGE 3RIAF 5I6PA 5HDRA 5DJAB 5DC0A 1Y6KR 1BJ1H 2H8PB 4NQUA 4KOCA 4Y5YA 1S5HB 1KIRB 2Q2LA 3TT3L 1AZBA 1MFEH 3T0ED 4LSTH 2JB6A 4QRPD 3LKNB 1U2YA 3MRCA 1ODAA 1WS8A 3QUXA 4K9JA 4JPKL 3ZUNC 1CN4A 2F53D 3ME0B 1QQDA 3AREA 4XMXA 3TZVB 2QVMA 1WA1X 4OZFB 2DQJH 4OLZL 2QJDA 5E00B 2AK4B 1S7XB 4Y16D 3TA3D 1L6XA 4N5ED 1KGCD 3GRWA 5IB2B 1BIHA 2XTJC 2WXGA 4M5SA 4NO0B 4PRID 4ZPTB 2W8CA 3L3DB 4N2GA 4JUTA 4I0KA 3MRRB 4NQED 4M5TA 2CQVA 4PJ9B 1F4XL 4LIQH 3BQUC 4U1IB 1NUGA 2OK0H 1FO0H 2VDKB 3EH4B 3O8XB 4X9YA 3T0XA 1IBBA 4LCWA 4BIKA 1L9TA 1KLGB 4CU6A 5FFGA 4H26A 4MCYB 3TOPA 3H7BA 1RZKH 5FHAL 3VXUB 5DJZA 3G7TA 1BZEA 4RFEA 5I8EB 3ESOA 1T2QL 5JW4R 3ROOB 1GW0A 5D9SA 3AM8A 3TVMB 4JFDD 1JZ7A 3AB0B 3GSVB 3TBVB 5EOCJ 4ZXBD 5GS1A 1DUYA 2NYYC 1X9QA 1Q72L 1NLBL 2XWTB 3D69B 1ZD6A 3K4AA 4WENB 5BV7H 1LO5A 2YJQA 1KBWA 5I1DA 2B0SH 2VL4A 4YFLI 3REWA 1HI6B 5IGXL 1QSFB 2WTOA 4F20A 3EDJA 3OMAB 2BNRB 1CVSC 1RZJC 2WIMA 1OTTD 3BT2L 1M05B 5EHFA 1X7QB 5FYJU 3FUKA 5D1ZC 3U2SB 2YZ1A 1J1XL 3ECWA 5ICYB 2XSKA 3AY4A 5DHYB 5CIPH 3G6JA 4E9LA 4BUGA 3MO1A 3QUXD 3QR2A 1N26A 1SLVA 3MGTA 3IDIB 4PJFE 5HI5C 5IP4A 4QEGA 3L5JA 2EEDA 1YAIA 3ARED 2C9RA 1NUNB 5A2AA 3FT3A 2WINA 4NGHL 3W9DB 3X1GA 4N68A 2WUBH 2Z8SA 4HPYH 5F96L 3R1GH 1DFXA 4KX7A 2YXWA 1QO3A 2VN7A 3TBYB 3RVWC 1I8MB 2FEEL 5F6HI 3Q44A 3W0WE 2YGNA 3DIDA 1XR8B 2X4OB 2XX1A 4IOIA 4M7ZC 3U0PB 1P4IL 1G4MA 2Z65C 3DK0A 3KPMB 4JRXA 5I74B 1I3VA 3PGCA 2VKXA 1PNCA 3ZSSA 5D7LB 3K2MC 4NUJB 3UTPD 3KEHA 4ZFGL 1FDLH 5KWYC 2NCEA 3L1OL 5DLLA 4L3AA 4P9ML 4POZD 5J57B 2GSGA 4RAUB 2DQCL 3GSRA 1YN7B 3AS2A 1RU9H 5DC9B 4AH2A 4HU2A 4JFFB 2ILLA 4U7SA 4LL9A 1OCWH 5BPPA 1PAMA 2KERA 5E9DE 5AFAA 4PJFF 4G3YL 1OW0C 1CFVL 2OR7A 4BKLA 2ZAGA 5HY9A 1YYML 3RUGA 2CIIA 4C4KO 5J12B 4N8CH 2HFGH 1LE9A 4MDJA 1PZ2A 3PQYE 3KNBB 3DETD 3NH7H 4WFFD 4ZMAT 3IJHB 5HHVL 3IXTB 1V55B 1T20A 2Z6FA 1HH9B 1U6AH 4PI2A 3V6OC 1EHLH 2X4PA 4QNPF 1OF2B 4YSRA 3T1WA 2P5EE 4MQSB 4N90D 1M3IA 2WNWA 1UCTA 3GMRB 4PJHE 1Q0YH 3SYOA 3IDXH 2R0WH 1WFOA 1MCKA 2LTQC 3L3HB 5T1KD 1PLAA 3F65A 2ZG3A 4WTZA 3GC3A 2OV0A 1G87A 1M2VB 1YHPA 4KTGA 3GKZA 2EEFA 3BQVA 5C6PB 1XF3A 4QWWC 2H45A 3OKEB 1AKJD 1A0QH 4WU7A 4A38A 4XCNB 4HS3A 4MJHA 3TIDA 3I6KA 3U4AA 1A1MB 1F6AA 4FLOA 4I3SH 3WKNA 5D55A 4XNYL 2M8XA 1KWKA 1YEKL 2C9QA 3RWGA 1TG8A 1HE8A 1E8WA 4YPGA 4AQEB 3NIFE 4FTVA 5MP6L 3CPLA 3IJ8A 2AABL 4JRXD 5IW1A 2HJKA 4N0UB 3MGAA 4V1DB 5HGAB 4F8PA 1A9BA 2VDOB 2YXVA 4HJGB 5KSUB 2XWEA 4I8DA 2G0KA 4BA8A 2Z9TA 3IDJB 1B4JL 3IU4H 3VDBA 4AKPA 1U3NA 4GSUA 3FSWA 4NC1E 1OSZA 3CFUA 2H2SD 1ZT7B 5GQBA 3O2VL 5EZLB 4RMSA 4XAKD 4D3CH 4PJXB 4PJHF 2O30A 1TDQA 3WN5C 3TH3T 2C1PB 1QATA 5EBWA 1Q9OA 4NIYE 4PJDB 3K4ZA 1OP9A 2WB1A 4KXAA 1D7CA 3MLZL 4DGVL 3CVIH 1S7RA 4DO6A 1KIQB 4ETQA 3V52L 2BSCA 2YKLL 2W9EH 4GI9A 4FQJH 3DMMB 5DVKA 1CR9L 4X6CB 4ZMTA 3UYPA 4J8RB 3W5NA 1GGUA 3BN9D 1TVBB 2Q20A 2DF3A 5A40E 1KCVL 3QWRD 4U1LA 3TBTA 3NIFF 4LAQL 4Y8DC 1MEXH 3FOLA 4FNSA 1T1XB 3FB6A 4JS7A 1KB9J 2HTKC 5DVPA 1OM3H 4OGYH 4UZGA 4X98B 2D2CC 5D1ZA 1P5VB 4XBMA 4R7DB 3QNYA 2E46A 5A6LA 4PRPE 3WS6C 4P4RB 4I9WE 5HHOE 1ETB1 3TEZA 5IEHB 1PG7H 5FWRA 2ITCB 3SEPA 2VXQH 1JGUL 5AAMA 2BSSB 4NZRL 3T8VA 5IJBC 4U1JB 2MNUA 2VXSH 3WU1A 2F19L 3VXNB 2R23A 5L2KB 3QJFB 5E6RB 4JM0A 3FUDA 4JFYA 3SQRA 3KWTA 3KR3L 5BQ7B 4FTVD 2B39A 2AK1H 2DQGH 2XTJD 4FQ1H 4NQCA 4PJBA 2I7OA 2IG2H 3Q5TA 2F7RA 2NY1B 3ETBJ 4PJ8B 5H94B 2GIMA 4AQ8C 3LCYA 3BQUD 4G5ZL 4NZTH 1MFCH 1ND0A 1DVQA 1P7QB 5DJ2A 4AJYV 1U3HB 1X9LA 4QOKE 3QZLA 3F7RA 1R3HB 3D4ZA 4I18B 4Y4FA 2RQ8A 5D6CB 2VDPH 5I71C 5K59F 5AUMA 4KAQL 2W60A 1HH6B 2NRDA 3IFLH 3F12A 4XB7A 4PB0L 4O2EB 2MKWA 2PW1B 4AE1A 4OJFL 3W37A 4UU9B 4BE5A 1IQDB 3L3IB 4Q2ZA 4UQ9A 1JZHA 1H6FA 2FX9H 4RGNE 3D18B 1P4BL 5KUKA 4MNQA 1LO4L 4FI7A 4UT9L 2AHIA 1TYEB 3ELQA 4XN1A 1M1XA 2DMBA 4KNTA 5JA9A 2BSRB 5CMAB 3ZZLA 2F58L 5EIQA 4KKCD 3VX1A 4MMXC 3Q6GL 4MQ7B 3VXOB 3ASNB 2NYYD 5E7FA 3GXPA 3KBHE 5DJXA 4UI2A 2OMZA 4NKOB 3CHPA 5IV2B 1QKZH 1QHPA 3W2DH 3HC3H 4ZNEA 2APVA 2C34A 4MVBD 3SGJA 1G7IA 4JDTL 3V6OA 2VDLL 4J2XA 1KJ2B 5GGVY 2ZWKA 4DKFL 5I9QC 5D1ZD 1DJSA 3B7TA 1AACA 4HLZG 5AL0A 4D8OA 3M86A 4FL4C 4GKZA 2M26A 3LKPA 4OF8A 4KZ0A 1WZMA 4EXKA 1ADQH 4YHKL 3GTVA 3UJTH 3FQXB 2WVTA 3H42H 3N3EA 3O2DH 4KH9A 3MGOA 5HI5D 1ESOA 3V7AE 1AGCB 3ARRA 3QJOA 3EFOB 4X80L 4HDIA 2EYRA 4O4YH 2X4UA 2AMUA 3PP3K 2J73A 1V10A 4R4NC 4O51B 1CLYL 4BDVB 2GFBA 3MZTA 5HYIA 5DD0H 2H1PH 2J8HA 2QV2A 5F1NA 4NQCD 1IT9H 1JUFB 1F8TL 5EO0B 4WK0B 2DJSA 3RVWD 3R8QA 4PW4A 1YVLA 1H9DA 2K78A 1T03L 3EJTA 2R2EB 1UC6A 5ABAA 4PY7A 3W81A 5KVEE 4K9EL 1ILSA 2FGZA 4JKLA 4AL8H 4WTWA 1HAUA 2D7NA 4FNQA 4XWGH 3ZKNC 1GR7A 4Q89A 4P2RB 1QFWL 5ITFA 1NUDA 3PWVA 2YD7A 4DF9A 5CJOH 25C8H 5DMIH 4W9CC 2VN4A 3L7EB 2Z4QA 3KYAA 4U1NB 4FNLL 5TQ2H 5ILTH 3UBHA 4K23L 2Y3NA 2ADGA 3K0YA 4MNQD 2HXAA 3K2KA 4Y1AE 1MUJB 1NDTA 3X1EA 3RBSA 4H5SB 2XFXA 1A21A 5GRJL 3WN5A 3APCA 2WWKT 3S34L 3D3VB 3GSNA 3SKOB 2OL3B 2R83A 3I02B 3EJPA 5FA3A 3OGCB 4DEUA 4Y19B 4I48B 4EVNA 2ZX6A 4ACTA 5L8JB 1E40A 1JGLL 1UKSA 4EN3C 1QSVA 4JFEA 1NGXB 1AZNA 4AIEA 1T0NA 5HGDA 1OAXH 2HRHA 2VLLA 1QG3A 4W81A 1GKOA 2CK2A 1XB3A 5AOMA 4OUUA 2LGNA 1TLKA 4NLAA 1FNEA 3WMQA 3RGVB 5HHXL 4NM8H 4BZ2L 1KNOA 5BJTB 1JMXA 1M71B 1NOLA 1PNDA 3N41B 1JGVL 4EI6B 2KQNA 3DA0A 3Q8BA 3K91A 4OZGA 2C9XA 2X4NB 5FYJH 1IC4H 4Z95L 1AI1L 4YDKH 5HVFB 4GRMA 4QWWD 1SXNA 4AEIH 3B3BA 3Q1SH 2ZX7A 1VFMA 3K74B 4ZFZA 4B0MM 2HN7B 5SWQA 5IB5A 5IQ9B 1UQSA 2AGJH 2X0UA 1HC1A 1E4HA 2FL5A 1FNFA 3O2WH 4NLHA 1T5XA 1WAPA 3RY6A 4KY2A 4OFQA 1NCBH 5D1QC 1EIBA 1FG2B 1ILUA 2XKNA 2A0LC 4RMQA 3BDYH 5I19L 1G0DA 3HZMA 3NJIA 4G8IA 1MREL 4KPHL 1I8IB 2DJ4A 3PUUA 1QSEB 4N0FA 3CDYA 4AQ8A 1VJSA 4GMSH 1JRHH 4RRPA 3VAEA 1S9VA 3T0AA 3T6ZA 2XQYA 4MAYB 4HX1A 2WAHA 5IB1B 3FSZA 4RMWA 4X7TA 1BOGA 2X89A 3BJLA 4G42B 3KM1A 4AYGA 3CLEL 4JKPH 1BBDH 2E9WA 2XWRA 3B2VL 1P5UC 4GO9A 5EZIH 3VFUB 4NKMA 1SY6A 5ID0A 3WSQL 5F0MB 3TBCA 3BRFA 4HIIA 2ESVE 4GAAA 3FW6A 5E8PB 5CZRA 1VDGA 5CHNA 3PS6A 1VPOH 5E4EC 5D1XA 1L9QA 3ATFA 4NQXB 4PS4H 4F7TB 4MMXA 5JORA 3FUIA 1SFHA 1K4DB 3FFDB 4F57L 1CG9A 1UYWL 3WUWA 1ZWIB 5MI0C 1GMEA 2EIJB 4M61A 1QI4A 4UV7H 3V0VB 3GIZL 4HXAH 1L3WA 3D52A 4JQXA 1HHHA 2HVKB 4HC1A 5I17A 3GFUA 1H8LA 2NSMA 4U1SB 2HTKD 1DVFB 3FTSA 4LU5L 3D2UA 3TO4B 4X42A 1A14H 3QCTH 2WYHA 4S1DC 5T1MB 3QO1B 4F8TA 1MRFH 1T5KA 2GI7A 3U46A 4R7XA 4I4WB 3TCXA 4ONGH 1W72L 4PCKA 4ZW8A 1I9EA 3VTAA 2VRKA 5ADOH 2APWA 3H4FA 2OMUA 2D0FA 3V4PH 4UOJA 2OKMA 5GSRB 1ZVYA 2ADFL 3UEQA 3UZEC 5TE6L 2EYSA 4OCWH 1DVUA 3QIWA 2YRLA 3ZVVA 4YK4B 1U8LA 4GG6E 3HNSL 4H40A 2P5WB 5FLUA 3U9PL 2DAVA 4L8SC 4ZK8A 3IDGB 2EO7A 1CD0A 3N06B 3NDZE 4LLYB 2ZG2A 1CGSH 2FCBA 3V8OA 1SJEA 2QQLH 3GSQA 3ISWA 3KLHC 5IR1B 3LRLA 1IC7H 1FAKT 1NCDH 2DMCA 1AY1H 1MW1A 1PD1A 2LU7A 3IDMA 5C0ND 3B7UX 2OZ4A 2YLKA 4S1SH 1NEZA 4PGCA 1JZEA 4I85A 2EO1A 1G7PB 1ZHKA 3LPGA 4D9RD 4UTAA 1S9XB 4ZODA 2BHFA 4GS7B 4ZOBA 3IDYC 3MV7E 2XWDA 1I1AA 2PABA 3MREA 5J1AA 3MRKB 5KVDH 3WY1A 5AAPA 2B7DT 2BOCA 3HFML 4YWGH 2A38A 2J6WA 3HCVB 2F1AA 2ZE0A 2P47B 1ORSB 3QJVB 4IJTA 4YDJA 5GSVA 1IGTA 4Z7OB 5BMFL 3MLVL 2HT3C 3QA3B 3FO1B 1QPKA 1DQIA 4MGXA 1N2RA 2NTFB 4IDLA 5I1AA 5F8RC 3D2UD 2FJFB 4HFWB 5I1KH 4GG6F 4LRNL 4LSSH 3SJVE 2UX6A 1YECL 1TYRA 1PY0A 1X5MA 3NK3A 1E2WA 1U8JB 1FORH 5C9KA 2OSLA 1PDKA 2BZ7A 2XIIA 3WYRA 2H6PA 4YHIA 4A6YL 3IKCA 5C6TH 1U42A 1FWXA 1KC5H 1KY6A 2UWEB 4R4ND 5CEZD 5ALBH 4OIBA 1JHTA 2Y36L 1ZPUA 5HSFA 2YFOA 4IM8A 1BG1A 5DK2B 2IADA 2W07B 1FVDB 3FXIC 3KPRA 3QIWD 2OJEB 1HINL 4OBSA 3TN0A 2R0ZH 4ODVL 3KPTA 1FL3B 3PJNA 1GSKA 5JZ7C 3NP4A 2JJVA 1HNGA 2FZ3B 3ZMRA 1N4XL 4XMPL 1AYRA 2VQ1B 4F2FA 1SJMA 5ALCL 2PYEE 1LGVA 2VM3A 1FLRH 2VZOA 43CAB 4GJTB 4A2DA 2YBRA 1MVFA 1FN4B 2G60H 2YGQA 1KTLA 2WNKA 4AZUA 5BUAA 3GNML 3R4DA 4RIRB 2JE8A 1AP2A 2A2QT 2ICWA 3X11A 4O5LL 2C26A 1YEJH 4YOKA 1EAPA 4OD1L 1D6EA 1CICA 2ZOUA 3C8DA 1IGJA 5C09A 1E27A 1NIAA 4WK4B 3SE8L 2AJ3B 3AROA 2OQJA 1LMKA 1GGTA 4G8EA 3SDAB 3VFWA 5IIEB 5F1IA 2B5IB 4Y5VA 4HUMB 3BUQA 2KKQA 1BF5A 1DSYA 5GS0C 2PPEA 5J3HC 2ADIA 3MRMB 3KHQA 3DRQA 5J1SC 3VFNB 3ZHKA 2CALA 2D3NA 3JTSB 3T6QC 2FTAA 3CFBB 4Z7VE 4M3JA 2D7QA 2X05A 1G94A 5JOFA 3IJ7A 4AGOA 2VDQH 1HKFA 3I9PA 4OD3H 2Q8BL 1I8AA 4NNPL 1KEGL 1USQA 1IGYB 3AS3A 3HE6A 3NJJA 4MB4A 1QR4A 4DZBA 4XOEA 3APDA 4FQIH 3S88L 1NM9A 2C4FU 4QT5B 3VXRB 4Y7OC 1CGTA 1VGKB 2CKBL 3D9AL 3OZKA 3OJDA 1W0VA 4QHMB 4R4FL 4B6ZA 1FBIH 4OBRA 4JFPB 4FDWA 3UYRL 3KPRD 3TN0D 4RDQG 3D4CA 3S8WA 4DFHA 1XGRB 1QW9A 3WY3A 1K8IB 1CGWA 5JIIA 4CVZA 2VXUH 5FGCB 3RGHA 4C57C 2A0LD 1AGFA 4AWJC 4UILL 3QEQE 3H9SE 5DJYA 1GCYA 2NY6D 3UP1A 3KLDA 5EOCL 5CBAA 1WFTA 3OR6A 1SM3H 4KROD 1KCWA 3VFVA 4L8SA 2P4AB 3GJFA 4PJ5B 3DIFB 4R7VA 3BZ5A 2NQCA 3OKLB 1LJMA 7FABH 4GIOA 1SEBA 5FYLD 3I9IA 1S7UA 4JREB 4KNQA 1AXTH 3IS0X 5CR1A 5C08D 1SJHB 1IM9A 3VXME 3QWQB 5GJTL 4U3XA 3CN0A 3O3AB 5AW5B 2XWBB 5FUZL 1DUZA 3Q2CA 4WSKA 2YAFA 3S3DB 3V0WH 1H0DB 5E2VH 3HLAA 4B5ZA 3QCUL 5FM8A 2J8OA 1TPXB 3H2PA 4ZMVA 4BXSV 4CW1B 1CICD 5C09D 5H37G 3ZE0B 3AABA 2RJMA 5E1GA 2MHAB 2Y7QB 3KBFA 1LO2H 4RFNB 1BAWA 2VOTA 3AXLA 4MRBA 2FUQA 5B39B 3AGVA 3LSOA 3C09C 1VFBB 2WKOA 1BM3H 4MAUL 2DIBA 2X4RA 4NQDD 3OXRB 3ZT5A 2Y4SA 7PCYA 3QUYA 4KKBC 5IHUL 1O6SA 2XOTA 3OZLA 4XPFL 4WO4B 2X4QB 3HI5H 4QRRB 4MZ3A 3LZRA 4HWEH 2NQ3A 4WWID 5DWUL 1XQ4A 4NNYA 2GCYA 5IW6A 3AG4B 2Y1ZA 3TASA 4G1EB 1RZIA 4HWBL 5EB9A 3T6XA 2BVQB 3D39B 3RDTA 3WFHA 3K8LA 1E4KC 4S1DD 1RIHL 2VW6A 2MTPA 5EEVA 2OX5A 3LQMA 3BCFA 1AHWA 4HKZA 2MCAA 4L37B 1VACB 4YLCA 3D87B 4GLRI 1RUKH 4OIAA 5LG1A 4GQPH 5FCUH 5T5FL 2CA4A 3GBNL 4R7NA 5I16B 5L0QB 4XNMA 2YA0A 2X53A 4JHAH 5EZPA 4K3EL 1UWFA 3KPPA 5DLML 5SWZE 5CBEA 1KB5A 4B95C 1ZS8B 1ZTXL 5L7XL 3NCCB 1QYGH 2R1YA 2VMEA 4H0IA 3V4VH 2TRYA 5FM4A 3MJWA 3F6IA 4UQ2A 5HJDA 4AJVA 4OKVA 1K8DA 1GAFL 1QBLL 2OXGA 5ESAB 2D73A 3Q3GA 1VIWA 3M7OA 2YN5A 2XICA 1UTDA 3MNDA 2G3MA 4S0HA 2LV4A 3ZRFC 3CXHJ 3I3BA 2FAUA 3V5KA 5CFHA 1LP9A 2P9RA 5AOLA 1IM9D 3A24A 4QXTB 4NPYB 1JZFA 4J4PA 3KLHD 2DTML 2H47C 4NHUA 4P3DB 1HYSC 3POHA 4F7MB 1WD9A 3SE9L 5T33L 5JTWA 4NSKB 1C16A 2EDOA 3X13A 2BP0B 3MMEB 5C0BE 3L1FA 3WIIH 1CDYA 4KJYB 1GGYA 3AS1A 3RNQA 3STLA 1PG7W 5CS7A 3QDME 1E5CA 3O45B 4BK8A 3U0TA 5HHME 2WLLB 1IBHA 4N2AA 1WRFA 4LHUB 2EDRA 3S9DB 3L3OC 5E5LA 4ANWA 2Q8AH 1PX3A 3G5XA 3KLAB 4UNTA 3IJSB 3IGAB 2OMBA 2K1MA 4ATTA 3QUYD 1KT2A 2X2YA 3GDCA 4F2ME 3AJ7A 2AQ2A 1EO5A 1X4ZA 5CLTA 2ED9A 2NR6C 1E6JH 2RR3A 2YAMA 1HCFX 1KPRB 4YIQB 1UB6B 1ZHBA 2Y06L 1WFNA 2HT3D 4H7VA 4KK9D 1K4CA 2EDJA 4X9HA 3ML8A 3DBXB 3P9MA 2ZOTA 4JHWH 2WYZA 2BY2A 4P2OA 1AG6A 2JVUA 4ANVA 2EDHA 1KIUB 2JI3A 4YQXL 4PWHA 5L6YH 4GINA 4TVPL 1UM5L 3DGCR 3C2AH 2O6DA 4PS3A 4AOFA 3PHQA 4YVUA 3JVGC 5EBMB 1FZOA 3ARZA 4H8QA 3VRLE 3CDGB 2W9DH 3M8OH 2VB5A 3FONB 1O9WA 4HZLA 4OVVA 2I9TB 3UTSE 3GMMA 2QZ5A 2OMWA 3FOMA 3N1FC 4PMFA 3PV7A 4WJKB 5HJ3A 1PLCA 4QRPB 3G04A 2P43B 4UM8B 3N40P 4KQ4H 5K9KB 5DRWB 1KIPB 4O02H 1BMGA 3L4VA 2KZ1B 2YD1A 5C8JB 4H8VA 3QIBC 5IMMA 4PG9A 1EVUA 5C0EA 5JZ7D 5J6GB 4NXKA 1U91B 3P69A 4R90L 4GEJA 1JWMB 4GAJH 1L0YA 5HHPA 5LGYA 3U6XA 4M62H 1CWVA 4ZUVB 4NQEB 3DVNB 2BNUB 4WI6A 4Y5XC 5D72H 1NUFA 1AHMA 1J86A 3SYPA 2VO5A 3NOIA 3FQNA 2Z3FA 4E41A 3WIHH 3TYFB 1XH1A 3OHXB 1BFSA 1QBML 2BNQE 4PU2A 5F7LB 3QC6X 3VSTA 1A4JB 4L8CB 1W6WA 3VRLF 3U4EA 1LEGB 5AYTA 1L7TH 1YMMA 1E50A 3ATDA 5I24A 3WTUA 5KTEL 1OANA 3AQZA 2R4SH 5GS0D 4OCMC 2QMJA 1M1SA 3H54A 3IF1B 5J3HD 4M03A 4JFDB 4TRPL 1U95B 4ZUWA 3GSOA 1HL8A 1TEYA 1BFOA 4ZXBB 4QJ5B 3APFA 2GBUA 3GUFA 4WNQA 4P2OD 1SXAA 2P52A 2MPAL 1TQCB 2RBLA 4PTTA 4QXUH 4MLSA 2ZKHL 3FCGA 1BJ1J 1MFDH 3OXSA 3TF7C 1Z9LA 2OSXA 3KZ8A 4I0PC 5BO1L 3BP6B 3F7QA 1BG9A 1YEFL 2EXWC 5AWNH 2IBBA 2NNXA 3L9BA 1XGTA 1KJMA 2GC7C 4UDTA 3ARUA 2IBZX 1E4KA 1T83A 4BH8A 1RUML 3FMGL 1G6RH 1WS7A 3QJHA 2WQXA 1G7MB 3FTGB 1MOEA 2BLFA 1B0GA 5CZVL 4Z7UE 1M53A 5CGBA 5TQ0L 1MNUL 3O3EB 1MLCA 2BCMA 4R2GC 4U1GC 5C9JB 5KW9L 5EO9B 3CC5A 1KY7A 4HUCA 1KXVC 1UD2A 2VR7A 4X5XA 5IWLC 2GEQA 1GYVA 4HFUH 5BOJA 1N67A 5T1LA 1YA5A 3ZTNH 3RE0A 3NIGB 5LGJB 2F7IA 1M7IA 1DN2A 5D8JH 4MXWL 2WLMA 3NAAL 4DW2H 2ZTBA 3VG9B 4ZDHB 4MNGE 3S48A 3S35X 4FQ2H 4ZAKC 2OTPA 4J3OF 3CBJB 1ZLUK 2XWJA 3QRGH 4Z78B 5J13B 3IMRA 2E74C 5AYQA 4WHTA 1Z5HA 2Q3ZA 1MDTA 1MVUA 1TNNA 4E41D 1X44A 3F8UB 4MAZA 4Q9CA 4P0DA 2CG9X 3MRNB 3LHPL 1H3PL 2WCSA 1CQKA 3H7BB 2HT2C 4R4BB 4E42A 4OM0H 3I6LD 5JNYB 4KU1A 1YMMD 2APSA 2WTRA 4U33A 2X9XA 2XHNA 3HG4A 4MXQC 3L3OA 3TFKC 5D6DC 4IRJC 2OBGA 3NJMA 3PRZA 4Z7UF 5C07E 2GPZA 1LO3H 5I8OH 2CLRA 3DV4B 4KKBD 1I7UB 3HJ0A 5TE4L 1AD0A 3IGKA 5B8CC 3MLYH 3EOTH 2DLGA 3PWPB 2DMHA 3ZT7A 1S2EA 1TFHA 2E59A 2J1KA 5ENWB 3UTQB 1HEZA 1ZKAA 2EE9A 2Z35A 3BESR 1ZVSB 1DL7L 1T3FB 2V17H 3NQKA 4OIIL 3U4BH 5CD5C 4QRFA 1KZQA 3SE4A 5L88H 1J8HE 4K7PL 1DEEA 4DKAA 3CZFA 3D0AA 2ENJA 1AZRA 4HLEA 4KK5C 4ORGB 3NYKA 5D70H 1OV8A 4TSCH 3NSYA 3KXFA 4JHUA 5LAXA 2O5ZH 1I1CA 2ADYA 1EA9C 4LKCA 3ARGB 4LSUL 5T1KB 3BMWA 5DVLA 3RWJB 1LK3L 2F53E 2F8IA 2XBTA 4DN3L 1O7VA 3H9YA 3ZHDA 2UXTA 3ULUH 2J5WA 1B4TA 3DURB 4F91B 3AVEA 4LCCC 3D33A 1LNUB 3VI4A 5T1LD 1AKJB 4WEBH 1RK0A 4BQBA 1AE6L 2HWZH 5DU7A 4AM0A 1IFHL 1BYOA 4PV9A 3AITA 3QYMA 1NC4A 1Y18A