5HYFA

Glycosylated knob-knob fc fragment (p6122)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
209
structure length
209
Chain Sequence
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Structural differences between glycosylated, disulfide-linked heterodimeric Knob-into-Hole Fc fragment and its homodimeric Knob-Knob and Hole-Hole side products.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hyfA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hyfA01
4UIKL 5EBWB 4NPYB 4I18C 1TZGL 2HVJA 4ELME 3FB5A 3IDIB 3T0ED 4IRSA 3QWRA 3PWPE 3KYMA 3FFCA 4NKDA 1MEXH 4GRMB 5FM4A 5LGHL 4DGVL 1IC7L 4Z8FL 4YBQC 5I17A 3BEWB 3MFFA 3DYOA 1CE1H 4FG6D 5KAQF 2Q7YB 1FL3A 1QFWH 1UCBH 3EOTL 5IBUG 5TGBB 3ULUC 4PBXA 2ZCHH 5CD3B 2A73B 2DIJA 2E7LA 2EDTA 3IXTA 1MCEA 5IR1B 2YA2A 5E8NB 1X5YA 3WIHA 5GZOD 3FOLA 3HR5A 1ODAA 4M93C 4XC3L 2Y5TA 4MB3A 5HVFB 1GJIA 2GJ6A 4M43L 3QIBB 1HYSC 4R4BA 5DD1H 2D4FA 1G1YA 3PV7A 5JA9A 1EMTH 1WC7A 4GLRI 5C9KA 5KSBF 1KYOJ 2V2TA 3TCLB 4JHWH 1S7RA 2R69L 3LQMA 4KTDL 4TULL 3SDXA 1NL0L 1E4XI 2Q1EA 5GS2D 1NAMA 4K7FA 3KPRD 2HFEA 3RWHA 4OF7A 3L6FA 3OKOA 5E4EB 5I1KL 1BVLB 3NCCB 1NGYB 5D7JA 3GJFH 4JFEE 4P2OB 5EOQL 3AM8A 2XTLA 1HNFA 5DEFB 2GK2A 1LEKA 2CQVA 3GRWL 4PV8B 1GVIA 2AW2A 5FECA 3NBNA 2BDNH 1X5JA 4M7JH 2OR9H 4RX4A 2B0SL 4WUUA 2YPLD 1NCWL 4OD1H 3S97C 1CFVH 3RUGE 5FK9A 5JXEA 1K6QL 2MQ0A 4HLZG 2Q3AA 4YAQB 4X4XB 3KNBB 4JGJA 5H2BA 3QA3A 1JCKA 1LEIA 5FFLA 1TCMA 5T1DH 3P9LB 5FUOH 5LWYL 1ZHBB 4LCUA 3RIFF 4XPBL 4FOMA 4LRIC 7FABH 4CJ1A 4F7TB 2R0KL 4PJ9B 4NQSB 1MCCA 2XG4A 3K4ZA 2F19H 2J4WH 2EYSA 2VJXA 1CWVA 1CFQA 1ZGLM 4ZO8A 1OWWA 1OARL 2CKBB 3BZEB 2FH6A 2PO6B 5HI5C 4FA8A 5IW1B 5IMMB 4EI5D 5FM5O 4NZRL 4EXKA 4QRQA 4P9HL 3MRGB 4YR6A 4KMTL 4TSAL 4G9FE 1DBML 5ISZD 4GRWE 2D2OA 3P4LA 4IOFC 2MJWA 5GHWH 3QQ9D 1CE6A 2BNQA 3BP4B 3L3HA 1UENA 1QHOA 4KJWC 5HSFA 3G5ZA 1U8PB 5TF1L 4JEGB 5GGRA 3O0RL 2CGRL 4LPCA 5FKAA 4MZ3A 1U8LB 4OJFL 1MHHA 1JNNH 3KHOA 1T1WB 2HYMA 5D7IA 4FRWA 4N90E 5I1GL 3RNKB 5HHQA 1YY8B 2R29H 3O3DA 4NJAH 4WI7A 2QBWA 1YEJH 4HFUL 1OPGL 4H5SB 3MV9A 5B22A 4Y4FA 5HVHC 2W9DH 4XPFH 3Q6FA 1UADC 2X4SB 1F4YL 2F53D 1A14L 4W81A 1FRGH 3EGSA 4PTUB 1IAIH 1A7RH 4FFYL 2NX5E 1RU9L 2EECA 4LIQL 4X7TB 4APQC 4YE4L 3A6OA 4Z7WA 1YEIL 1F3JB 5IJVB 2LV4A 1PZ5B 1DUYA 1SBSH 2X4OA 3QUMH 1RUMH 3ARFA 4PJ5D 1KF9B 4TNWK 5IROA 1NCNA 5EU5A 4WGVB 2R9HD 4EOWL 3QUXA 4L3CB 1IE5A 4PGEA 1XF2B 1P53A 3NVQA 4MS8D 3VFWA 2EDKA 2A6KB 4IS6B 4HG4J 3FTGB 4LASL 1CGTA 2IMNA 4JQXA 4OLYH 2ZG1A 1UWEH 4QYOB 2HMIC 1A9EB 3QRGH 2OM5A 5C7XL 1UB6B 2AI0H 3V5KB 3QEUB 2VZOA 4LKCB 1ADQL 4HMEA 1DQQA 3EW3B 4ZFZB 4FTVB 5GZNC 3O3AB 4LIQE 5EA0L 1A4JB 3PQYB 1AC0A 4I48B 4YHNA 2Z93A 3BSZH 2DWDB 3NZHL 5CFHA 5IWLA 4KI1A 1OOAA 4OIIH 4AEIL 3HI1A 5F89B 2IQAA 4X9BA 3S5LB 4HIHB 4MA1B 1AGCA 1H8OA 3NFPB 4BZ2L 2NY0B 5H35B 2R4SL 4X4MA 1JNHA 5GGVL 4KDVA 4K3GA 2EE3A 1A1NA 5A16B 4ZPTA 3EAKA 1OP3K 1NC2A 2OL3H 5IF0B 3QIBD 5IEHA 4WFGE 2PETA 3IGAB 5BV7B 3C60C 2BY3A 2F8XC 5BQ7A 3MRDA 4P5MA 3KG5A 4UQ3B 4XCYB 5DFVC 4JO2L 2B4CC 1UM6H 3MO1B 3B2UD 2XI9A 3NMEA 5MEPA 1SQ2N 5CJOL 1EFXA 4CGTA 5EZLB 4PJGE 3JWOL 3WNOA 4CMMB 1U41A 3CXDH 3O6MH 4P2OD 4GBXA 4XVSH 1FG2B 3LZFL 2ZUYA 3U0TA 3UTTE 4G42A 4WHDA 3UYRL 4JFHE 2BVYA 4GJTB 4YHIB 2RGSA 4PGCA 1C5BH 3SDYH 1C12A 4KZEH 3QNZA 2WANA 4YZFE 4D0CA 3V7AG 3QAZB 1EV2E 3SGJA 3BPCB 4XNQB 3JVGA 3VD4A 4Y5YB 5E8OB 3EYQD 3VFUB 1NCBH 1AGBA 1MUJA 1P1ZA 3HE6A 1U2CA 4IOIA 3QPQC 1GZPA 2IH1A 2CPCA 1AGEB 4F80A 4MNGA 2YRPA 3F5WB 1S5HA 5I19H 2F5BL 4HKBB 4PJ9D 1K4DA 1U3YA 4EDXB 3MLSH 1JRHI 1YMMA 1FZKA 3CH1A 3TT3L 5L9DH 5EZOH 5HGHB 4NRZB 3JTSA 4KMLB 4XAWH 5GRXG 3S3PA 2GITB 1XF5B 1FNGA 1NBZB 4WDIB 5J6GA 1XGYH 2VDQL 1JGUH 2PO6D 1IGFH 3U46B 2BVPA 5B21A 3BXNB 3O45B 3VXUE 3WO3B 4OBSA 3MJGX 2IF7A 1P4BL 4LCIH 4CKVX 4WU5A 3PHQA 1LP9A 4I2XB 1DFBH 5EUKA 3V6OA 3FB8A 3TJHC 3UZVB 1BEYL 1MCLA 3JXAA 1B0GB 1Q9WA 1U36A 3IFPB 4JPVL 5CCKL 2VXTH 2BVTA 1T1XA 1N0XH 3FJTA 1AD0B 2VN7A 3O3EB 4JRXE 4WFFE 5B38A 3T09A 1E4WH 4OD2A 4Z78A 4N1CA 4D9LH 1A6VH 3UTSE 2P5EE 4PJIF 3B43A 4AMKL 3B5HA 5IGXH 1ND0B 1GSMA 5E1AB 1FDLH 2V7NA 4JPWL 1YMHA 2APFA 3P4OB 5EDXA 3OGCB 4ZDHB 5TPWH 3W0WB 4GUPB 2DM4A 4X5XA 3ULUH 5D7LE 1CXHA 3VXTB 4UAOB 3TYFB 5F97E 3HRZA 2Q8BH 4XNYH 4JQIH 4EDWL 4XP9H 3MV7E 1MIML 3M45A 5F8RC 1S9WB 1QO3A 4Y16B 4Z7VA 3W2DH 2IAMA 3LEYL 4OAWA 4FFVC 5TE7L 5EUOE 1KACB 2ED7A 2VWEE 5A2IH 4GRLB 1IGML 1RULL 4TSBL 1GGIH 4FTVD 2IPUG 3PQYD 2GUOA 1A7BA 4XMLH 2PW1A 2B1HH 1CCZA 5IMLB 5ANMB 1D6EB 4RAUB 3OAUH 4M7KL 5EC2B 4ZS6D 4F58H 3HAEB 5IIEA 1FL6A 1K2DA 3PWLA 2MPAH 4BFGA 3QXDB 2ARJB 5D1ZC 4YX2H 5F7MC 1LMKA 5CJQH 2NY0D 1MLBA 1UYWL 1S7QA 1PEWA 4N0CC 4XBPB 3QBTB 2DMCA 2VLLB 4NHCL 2IG2L 2QHRL 4JFDA 1UM4H 4HGKC 3DO7A 4OFPA 1QPXA 2XWBB 5J7CC 2DAVA 2RB8A 4UNVA 2V5RA 1PKQA 4R3SA 4YFEA 2DQGH 4KRLB 2ICEA 2FLBT 5FYKH 3CPLB 4PRHA 2VISA 4LCCB 4HXBH 1ZWIB 5GGQL 1AR1D 2VDOH 4ZUSA 1XEDA 2DQFA 4WWID 1YPZF 3WNPA 2X4QB 4P4RB 1GAFL 1CD1B 3VG0H 1A6TB 1FVCB 2D03L 4JM4H 1MFDL 3GSNB 3ARUA 1YEFH 4YHKH 1HSAB 4E42B 1KCUH 4R0LB 3VE0B 2P5WA 3FKUS 1M7DB 3VGGA 2G2RB 2NNAB 1JRHH 4JO3H 1Q1JH 4ZXBB 1FLTX 4BFIB 2KZWA 2WUCH 1MNUL 1G7LB 2QLVB 2AVGA 4PRPE 3TBVB 1B2WH 4HGMA 1EXUA 1NUFA 2YD9A 2ADJB 3HZVB 3SE3C 5DO2D 4OLUH 4LHQB 4LLMB 3BYYA 1OAQH 2HFFB 4NCC2 3RVUC 3VFOB 3S35X 2Z4QB 1KB5L 1YEEL 3OPZL 3QCTL 5EORH 3L3KA 5E9DA 2XNAA 1MSPA 1DQLH 1X4YA 4XPTH 5D2LA 5KVFH 4S1RH 1I75A 2G5BB 1FYHB 3F7PC 5EC1B 3K8KA 2QADC 4P5KA 4EN3B 3TLRA 1IGIL 5HGAA 1RVFH 3G9VA 1JNLL 4YXLL 4V2BA 1HH6B 1MFAL 1JN6A 3QZWA 3C08L 3BVNB 1PSKH 5KVEL 2DQIH 4BQ8A 1T2QL 1I1FB 5DUBA 1NPUA 5INCA 1E4KA 1F3RB 2HVKB 3DGGA 5C2BH 2D7PA 2A6DB 1H3UA 1NFDB 5TH2A 1F2XK 3H3PH 2E8YA 2VYRE 1X5HA 2JE8A 3G6JE 2AEPH 3IAPA 1NFIA 5GPRA 2R1YB 4FQ1H 1I85C 2VXSH 2Y4SA 3D39E 1P7QA 4BQ9A 3CZJA 2V9RA 4LCWE 5E5MA 3IB4A 3GSXB 5IOPA 4EQ2A 3G6DH 3TH4T 4N9OB 4FG6C 3TZVA 4Z7UB 1P69B 4NSKA 1FVEB 5HI3D 3RBGA 2L7JA 4XT1C 5JORB 5IJKA 2AV1A 1OHQA 4LRNL 2W07A 4S2SA 3U9PL 4OF5A 3W0WD 5GZOC 4X0KA 3CC5A 4X6EB 4U1HB 4JFFA 3FB7B 4JFXB 4M6MH 1GGCH 5CD5D 4HUKB 1CFNB 3MXVH 1BQHA 3MTRA 5JIKA 4QRPE 2PYFA 1CDUA 2M2DA 5KW9H 3VA6A 2R2BA 1VGKB 4Y16D 3KXFA 4HIIB 2YS4A 1JI1A 4I18A 3RPKA 4GG8A 1CU4L 2FHBA 5HHOA 3FT4A 2BHZA 4GRLD 3CXHJ 3I75B 4LSVH 1RHFA 3AY4C 3VRIB 4BSVB 2QQLH 5ICZA 3RVXD 3RRQA 1CLYL 3IFLL 3GO1H 43CAB 3ILPB 1WICA 4UU9B 1RZJC 3C6SA 2XA3A 3QH3B 3QO1A 3WHXA 3D25B 2P8MA 5CJ8A 1S9YB 3HC0A 4A2LA 3KPNA 1G9MH 3V5DB 5I1CL 4NRXB 2HKFH 4XGZA 1QBMH 2A1WL 1IGYA 3MJ9H 1CN4A 2AEIT 1V8HA 1DQDH 2AABL 1IAOA 1KCLA 2CO7B 5J89A 1OLZA 4UILL 5HY9B 2XOTA 3FFDB 4GMSL 3B3IB 3BPNC 3M1BB 3KAAA 4OGYH 3WFEH 4ONFH 2YZ1A 4DTGL 3IJSB 5I1EH 4KRPB 2MMXA 3KWWA 1D5MB 2NXZB 3LKRA 3WV0A 3ZTNH 1IT9H 2VLJA 4MD0B 3FO2A 5GGVY 4LKXB 1P5VA 1CGVA 3VFRA 5DA0B 4M48L 5T5FH 2BJML 5I30L 4YC2B 3ES6A 4L8CB 1A3QA 3K1DA 4P46B 3F12B 4MLIA 4JY5L 5E4IA 4EI5C 2LAGB 4F33A 4BQ6A 2R4RL 5A3ID 4G8FB 2C3HA 1WK0A 1YC8A 4QOKB 4YHZL 3H7LA 3D69B 4D8PB 5JQ6L 2R39A 3QQ9C 1H9VA 1XZ0B 3D2UA 2ZCLH 5D8JH 5F72S 5TQ2L 4HPYL 1KYOK 1OTTD 4M6NH 4BKLA 1S7WB 4W6YB 4WENB 4OZIE 1QACA 1ZVYA 5IW6A 2GTZB 4JJ5B 4RSVA 1NCDL 4K55A 4ZXBD 4G8IB 4LAQL 3TN0B 2I9TA 3ARZA 3I50L 4M61A 3PJSB 4LRIA 1HXYA 4OZFA 3OZ9L 3BIKB 1T21B 3RA7L 3BFOA 5C0CB 5TDPB 3D3VB 4JRYE 1JPFB 2BP3A 2XZAL 1DBJH 1HYRC 2V7HB 5SWSA 4O2EA 5I8OH 3BZ4B 4PUBL 1OF2A 3DECA 4C4KT 2XACC 5H37G 2VLKB 3L5XL 2DS4A 1BBJB 3SOBH 2J88L 2YSSB 5E2TH 1WTLA 1KGCE 2RJMA 3HNTH 4CL7A 4EN3D 4ERSL 2ARJQ 5L7XH 4QCIA 1L4IA 2BVQA 2O5ZH 3O4OC 3LV3A 3OKMA 1IM3B 1BD2B 1G6RL 3ZZ1A 5HHPA 2CJUH 4PJHE 4ZD3L 3H8NA 5BW7C 1OCWH 3VI4E 4U31A 3NGBC 3LEVL 4MXVF 1CK0H 4F7CA 2R9HC 3VXPA 4ZOEA 2P8PB 1R3IL 1DEEB 4MS8C 1U8NA 2Q3ZA 2YPKA 1FFOA 3UX9B 1JPGA 1YN6B 5LCVH 1GXEA 3PGFL 3CFIC 1MLCB 1I7UB 4GW4A 2B8OT 2XQBH 3QDAA 1ZA6A 3VXSE 4X6BA 1T20A 1A7OH 5DEGB 2Q7NA 1GHFL 3V5HA 1CGYA 1UC6A 1NC4A 1NBVL 4HC1L 2D3VA 2WIMA 4APQA 4Z18A 3LKPB 4OZ4A 3OF6A 1XIWB 3O11A 3SPVB 3CSBA 2JELL 3KDMA 1VENA 3ET9F 3KPLB 3V2AR 1OD7A 5DK3A 3CFCH 2X70B 1FFNB 4H26B 3QIBC 3OKLB 2BNUB 1DUZB 4YWGL 1KIQB 2JB5H 4NKIL 3L3OA 3IS1X 3SHSA 5C0RL 4HD9A 4F8TA 3QCUL 4HX1A 3HNVH 4H1LH 5DVOA 2VO5A 3VFNA 3QEQA 3VD5A 3WLWD 1HXMB 3B2UC 2H9GA 2PW2B 5CILH 2AJXL 1QSFB 4CVZA 4GG6B 2AQ3A 5E4EC 5D5MA 5LGKA 1GZQB 4P2OC 1WBXA 1R3HB 3EYSH 5C0GB 1TLKA 4TNWF 5HYSG 2DLIA 3LN5B 2BNRA 3U36A 4O4YH 4HKJB 4O2CA 4HG4K 3MRMA 1SVZA 3LD8B 1CFSA 4AL8L 4Y1AA 1U8MA 3G08B 4Z7QF 3C60A 5JUEL 1T1ZB 4PJFA 3CVIL 3EYQC 2JCCA 3RL2B 4O51B 1JHLL 1Y0LA 4G6KH 1WWWX 1MAJA 3R1GL 5E7FA 4QHLA 3KPSE 4KRPD 1LE5A 1CXFA 2NXZD 5DYOB 4PJ9C 3F65A 1KLGA 1PG7L 5DJAA 2RFXB 5BMFL 5C07B 2R0ZL 4UT6H 5JHDA 4N8CL 4PJAB 1NLBL 3R8BB 1RZKC 5HJ3A 4P46D 3WNKA 2KZ1B 3I6LD 3W82A 1L7TH 5J0BA 3GMQA 4OZGB 1AY1L 1U8IA 3MGTA 3G04B 2ZUWA 1RZFH 1UWGL 4QOKD 1FIGL 4PRIB 2R1XA 1KIRA 2B2XL 4TPRL 3RNQA 3F7YA 4JO1H 2MOVA 2Y36H 1NEZB 4NIKB 1FC1A 2X89D 1TVDA 5EIIA 3TN0D 1UZ6F 3STZA 1HEZA 5JO5B 3VGEA 3W9DA 1JF1A 1VFBA 4J6RH 4MNQE 1CBVH 3P30H 2XN9A 2DWEB 1JWUA 4OD3H 5C0CD 3D3VD 1IGTA 4NM4L 1OAXH 3I6KA 1NGWA 1DBAH 4X80L 3T3MF 5KSBA 4XNMA 1JGVH 5ESAA 1S7VB 2X9YA 4RGOL 1N3NA 1HINH 3H7BA 3BISA 3IDGA 3MUJA 4KKBD 3CUPA 3NACH 3ZKXB 1ZLVK 3EYVB 2LTQB 2VLKD 1I8KA 1EZVY 4KC3B 4R7DA 4C56E 2H2PD 5EU6E 1U6AL 2X44D 3VXNA 4KVCH 4UQ2A 4J3TA 1OAUH 2Y6SD 1T6WA 1KJ3H 1BD2D 2XKNB 5TQ0L 2ADFL 5D7KD 4PTTB 5INDA 5E6ZA 5A2LH 1QHPA 4HK0B 3LRSB 4MAUL 5I8EB 4ZNEA 3RDTB 1ZS8B 4XZUA 4M1GH 1JZ6A 1QEWB 3R06A 2MNUA 4U6XA 3WYRA 5HYSA 1NEUA 1FYTB 4EVNA 1KPVB 3ZDZF 1MFCL 5M94B 1QSEE 2FSEB 2N4IA 2W92A 4AIZA 3CNKA 4HWBL 2KQNA 3PP4L 1EUUA 4RBPK 3OG4B 4ZS6C 3GM8A 4HFWB 2FWOB 3O4LE 1FL5B 1Z5LB 1QLRA 4RAHA 3JV4B 4NO0B 3OQ3B 1C5DB 1DLFH 4MA1C 4JANA 5D9SA 1B0RA 2NY0C 4P3DA 5IBTH 4E41B 1MJ8L 1WGOA 2I5YL 4PJCE 4KAQH 3WIHL 1FNAA 3HI6H 1XCTB 2IALA 3P40A 1HQRB 1LE9A 3SGDH 5BV7C 4OZHE 2WSKA 1U95B 2VAJA 4HHAA 5IVNA 2H8PA 4OCWL 2VXQL 2RAMA 1KCKA 3ROOA 1IGCH 2NW2A 2AJVL 3CGTA 5GGSA 1TIUA 1QBAA 1CL7I 2FIRT 1MPAH 4NKMA 4Q6IA 3REWB 1LNUB 5DJ2B 4NBYB 4OGAD 5LAXB 1QSFD 1AR1C 5E5UB 2WWKO 1GGBL 1P5UA 1HI6B 2V5TA 4YDIH 1HILB 4XP1H 1N5AA 3BT2H 3P0VH 3B8YA 2VQUA 2XWJB 4GAGH 5DLML 3NCYP 1WQVT 5D1ZA 4TN9A 4QO1A 3GHEH 2GJ6E 4QHUA 2ADGB 1NFDF 4DZBA 3QEHB 4DN4H 3MYJA 3RP1A 5ELIA 3CVHB 4XB7A 4B53A 1TJIL 3QAZC 3GIVA 1AFVH 3DUUA 4N0YH 2MCPL 4LLVA 2X9WA 3MRJA 2O61A 4L8BB 1B88A 4Y5YC 3WXWL 1FNLA 3UJIL 4BM7A 5SX5K 2C3VB 3DRQB 5C1MB 1UQSB 1FHGA 4UDTB 5C0BB 4C83A 2ICWJ 5HYQB 3A6BL 5L8JB 1A7QL 5DO2C 3TBWA 1MRCL 3C9NA 1C08A 1PZUB 4Z7UF 3MLUH 2JB6A 2HRPH 2JKXA 4WWKB 5E08H 1CVSC 4W70A 4KMQA 5I18L 4CJ0A 2EDJA 3X11A 3GHBH 2B1AL 4TVPL 4XCEA 5C07D 4NHUB 5HHMB 4X4YA 1T22B 3H42H 2AEQH 3P9MA 4WUUE 2HT2D 4NZJA 3JSSA 1JNJA 3SBWC 1WEJH 4XVUD 5MENA 2WAHA 3UTPE 5ALBL 1BFVH 4FN0A 2E6JA 3IFOA 4PRID 5EU3B 3VD3A 4U1LA 5BVPH 4U1IA 1KJ2H 4P99A 8CGTA 3ULSA 1ZVSB 1KG0A 4LSSH 4HLJA 3FO0L 12E8H 4OT1H 3V4PL 2VUYA 3WFBL 5K9JH 1J1PL 1I7ZB 4KI5E 3UBXG 4ODWB 5T33H 3ABZA 4JZNB 4TVPE 3K2UL 3SE3A 5CZKA 3NCYS 4KJQD 1XF3B 3WEXA 2ZUQB 5CEYB 2IANB 1GOHA 4L4VB 3BRDA 1DN2A 4P2RE 3INUL 5BZDB 4KPHL 2YK1H 1F4XL 1EEQA 5FAAA 1UXSA 3WXVH 4HKZA 4X6CB 3HNSH 5CWSB 3VFVB 1RZ7H 1KTDA 4JFOB 5HI3C 4XC1H 1DN0B 5DVLA 1FLRH 5JZ7C 4G6JL 1ZSDB 4GKZA 4CW1B 2BNQE 4OCXH 4MNHA 2H6PA 4P57B 4ODVL 5DRZB 3Q1SL 3SEPA 3OXRB 3TC9A 2W0FB 3QSKB 4UAOC 2UWEB 5CD5C 3IKCB 3GMNB 3C5SA 2KBGA 3RDTD 2KH2B 1IAIM 2Q87A 3GMOA 4Y16C 5D7IE 1H8SA 3KYNA 2COQA 5J06A 1FYTD 3TO4A 1JZ7A 4DKEH 4DOHE 1FPTL 1ZOXA 3MUGB 2VLRB 3MV9E 3ZTJG 1JPTH 4NOFA 2JJSA 3D1MC 1X4ZA 4ZAKB 3QULB 4GRLC 2FGZA 4JY4A 4N0UB 1YYLL 3VFSB 5JXAH 2UUDH 3T8XB 3U0PA 3RVXC 1CZ8L 4BSWA 4FQ2L 1A47A 3HZYB 2NY6B 4H88L 4MA7H 1W72B 2F8OA 4H8WL 4Z7WE 4D0DA 1J05A 1URLA 4XXCC 2ORBH 4O00A 3NCJL 1J8HB 3DXAE 3WL9B 1ZT1A 4I3SL 3L3DB 3QI9B 1ZHLA 2ATKA 4TRPL 5EU7E 2QQKL 4X7FC 1PFCA 3JUYA 4NO0D 1KTRL 2ZSWB 1RUAH 4OFIA 4E41D 2V2XA 1TZIA 3E2HB 5JPNB 5AZEH 5F7HA 4DFHA 4K8RL 2IADA 3SE9H 1UZ8B 4U6YA 4CN1A 4ODXB 3MRCA 5L88L 3H9SB 5KVDL 4GKSB 4KQ3H 5BJTB 1WTGT 1V7MH 5HGBB 3GSQA 1BJ1J 1MEXL 4YPGA 1CDHA 3AY4A 2C7UB 4HDIA 2R23B 1ORSA 2BHUA 3PWNB 4EJ1C 1KPUA 4LCCC 4NUGH 3WUWG 3MACH 3AFLA 3DPBA 1XGTA 2HJKA 4PJIA 1MWAB 2R1WA 4U6HB 3U9UB 2GJZB 4X4ME 3BH9A 5A3IC 3RZCB 2YPLA 2M26A 4OUUB 1RZKH 3EYOA 3IJYA 4HS8H 1EVTC 3FO1A 5JPMA 1BGXH 1MHPH 2UVFA 4R0LC 1OTTC 2MHAB 4JDZB 2Z91B 3IDJA 4LLWA 1A1MA 4ZXBC 2B20A 1U93A 4YHOH 5GS0D 3CXHK 4JHWL 4D9RE 3AAZA 3MRFB 1FZOA 3VXQA 1CICB 5E8EA 2DQTH 2JJTC 2ATPB 1HHIA 5C0BD 1EHLH 2ZPKH 3OAZH 4NRYA 3T4AB 4X9HA 1N8ZA 4UV7L 4FXKA 4WWKD 2R8SH 4UNTA 2AEWA 1E6JH 3S8WA 3KLHD 4BH7B 3PE9A 4U4BA 4ENEC 5J6HB 3OKEA 3WHE0 1YNKH 2BDNL 4M8VA 5FO8A 4EI5A 5HHMD 1X5XA 2JJVA 2X1QA 5HPOA 5DHVA 4UTAH 4EN3C 4ZFFB 1UACH 5ISZA 4OKDA 1SM3H 1S9VB 1JHKH 5DMKA 1J1XH 2W65B 4DWHA 1XR8A 2X42A 5F6HJ 1AXTL 4X5WB 1UM5L 4G43A 5FUOL 1IGJB 4HS6A 3HKFA 3UC0L 7FABL 1U8OA 3RBSA 3NAAL 3FFCB 4GG6F 4NKDB 2E6QA 1YMME 4YHPB 2J4WL 1P84J 3LDBB 1NGZB 5E99L 2IAND 5B39A 2M8XA 1OP5K 4K3JH 5GS1B 4PB9H 1RUQH 1JHTA 3EO0B 3QNXB 2F53A 4M6AA 3DV6B 1MCSA 2VITA 4JLRB 1QVOA 5JOEA 1RHHA 3FOLB 4A6YA 5F21B 1QOKA 3EFFA 3JTTA 1FNHA 4WV1B 1YPZA 2I9LA 4YK4B 3WSQH 1WCBB 1HH9A 5EO1A 3TEUA 4PLNC 5BW7A 2L7UA 4DKFL 4PJ5A 3KYKL 3EDEA 2CSPA 3GIZH 5K9QG 2V2TB 3WIFA 2BX5A 4RDQF 3V0WH 2C1OA 5IMOA 3E8UH 3PWPB 1AJ7H 3ARQA 3T04D 1HHJA 3RWHB 4L3EE 2R29L 5EBWA 4HSQA 4NJAL 3OKOB 1YEJL 4NPYA 2VLRD 1DP0A 1RIVH 3WLWC 4K9EH 4PJAF 5CKAA 2W9DL 4ZAKD 1F2QA 3EDFA 5HDLA 4HUXB 5ERWB 3QFDA 2EC8A 3BEWA 4V1DB 1FFQA 2NZ9D 4NNYB 5DMIH 2AJ3B 2VH5H 4OZGF 2Q7YA 3ZSTA 3DTXB 4U2ZA 5TGBA 5LGJB 4HCRH 1NH6A 5CD3A 2E9IA 3D6GA 3IJHB 2NY6D 2A73A 4XPHH 1IAKB 4PP1D 5IR1A 3C5JB 1J8HD 5E8NA 3QI9D 1SBSL 1RUML 1FQ9C 4NDMB 4XPAL 2P24B 1NGPL 3QIBA 4Z7VE 3H3KA 2O5YL 3MLWH 3VFPA 1YECH 4CADB 1PG7X 3MODL 1UWEL 1I9RH 2GYSA 1NUGA 4G5ZH 3FHAA 2EC9T 1D5BA 1FNSH 4KDTC 3NFSL 3H9SD 2AI0L 3O81A 3FMGH 2X41A 4KGLA 3TCLA 4WTZG 2EYSB 2CR6A 1TTUA 3B9EA 3ARRA 1CFQB 2XYCA 3CX5J 4KRPC 5D2NE 3S4SG 5IV2B 2NXZC 4MJ5B 1AE6H 2CLVB 4JAMB 1BVLA 2I60L 5IQ7L 1NGYA 4CN4A 3QCVL 4P2OA 3D18B 1M6OB 5DJZB 3NTCH 3S3JA 4WHTB 4YC2C 1WFUA 5DEFA 4P4KA 4PV8A 5C8JA 4P46C 2DQUH 3BGMB 4ZYKB 1RJZB 3PV6B 5IBUB 3RZCD 1VHPA 1G7IB 4IOSD 4FFZL 5A43C 4DK6A 4GQPH 2W60B 5FXCH 3MNZA 4JFDE 4YAQA 5JDJA 4NQEA 1ZKAA 3DSFH 4LEOB 2PNDA 3DX6B 4X4XA 3KNBA 3VDAA 3TN0C 2DQJL 3P9LA 1IVLA 4FABH 1KTKE 3MLYH 1ZHBA 5D71H 4OF8A 1IEAB 3TBSB 3KYAA 3RWEB 1CICD 4F7TA 1MQ8A 4JDVB 1CDCA 4PJ9A 4NQSA 2VKWA 3LB6D 2NY7L 2UZIH 3T2PA 3K81A 5LGHH 3CDYA 4Z8FH 3EYUL 1MREH 4JDTL 3ZE1E 4XVSL 5KVGH 3EOTH 2CKBA 4KKBC 2C3XA 4LPWA 3BZEA 3UTZB 5IW1A 5IMMA 2VAAB 4ZQKB 3MMEB 4LSPH 3SDYL 3CFEB 5F44A 3MRGA 5B4MD 1JFQH 1OM3H 4HULB 3CCHB 4XC3H 4JFQB 4Y4KB 4Q2ZB 2Y6SC 3BP4A 4M43H 1A6AB 4JFPB 3RPIB 4YGVB 3ZT6A 2DL2A 3UTQB 4LFHD 3O9WB 1U8PA 1A22B 5DJ8B 5HYEA 4ZUUB 4URTB 5HYIA 3DBXB 4Q6YA 2MSPA 3ZDXE 4ZO6A 3NN8B 1U8LA 4KTDH 4TULH 5E9DE 5DQJB 1NL0H 3FFCD 1T1WA 3MLSL 1U8JB 1KJVB 4MHHG 5D2LE 3GSUB 1QYGL 5L9DL 3RNKA 4XAWL 2FEEI 4U0RB 5I1KH 4H5SA 1YEKL 1XGYL 1JGUL 2NPLX 3RY5A 2YD1A 2X4SA 4Z0BH 4OFKA 3GRWH 1U8QB 4LCIL 4PTUA 4WTZA 3FT3A 3GSOB 5BZWB 5C71A 1JNHB 4X7TA 1JP5A 3BE1H 5GGRY 1CLCA 3CSPA 3K7UA 1FAIL 3TGXA 1F3JA 5IJVA 1PZ5A 4U7KA 1XIWC 4DUVA 1ZANL 4DZ8B 4AQ1B 3BWUC 5KG9B 4ALAL 1IBGH 4L3CA 3MRNA 1E4WL 4HWZB 1XF1A 2A6KA 2AKRB 4IS6A 4D9LL 4XPBH 5TE4L 3PWPD 4QYOA 4XVJH 1A9EA 4EZMA 3KVQA 1UB6A 3V5KA 3QEUA 4I9WE 4LKCA 3CSGA 4ZFZA 4FTVA 3O3AA 2Z35B 3PQYA 1XT5A 1OARH 2FECL 4U33A 4OGAC 1WITA 2DWDA 4V1DD 4TTGA 1M05B 1X7QB 4NZRH 1Q0XH 4P9HH 4Y0GA 5F89A 3VRLF 3ULUL 4KMTH 4TSAH 3O6KL 4HIHA 3ALWA 4JFFE 4WEBH 3NFPA 4MGXA 4XNYL 2YD4A 4JQIL 5H35A 3CZFB 1P1ZB 5A16A 3LD8C 1GZPB 5CGMA 3MX0A 3KXFE 5IF0A 3W2DL 4MNGB 2X4UB 3T2OA 8FABB 2Z31B 3ARGB 3N85L 1TXKA 1CD8A 4UQ3A 3BP6B 2YRLA 5HHOE 4XCYA 1EFQA 1LD9B 2YWYA 3QIUB 3WFCL 4BH8A 4KK6D 4X6CF 4HFUH 5GSRA 3MO1A 1N6UA 3AREB 4XMLL 3ULUE 1T0NB 5EZLA 3AXLB 2BC4B 4U1SA 4GAFB 4F58L 5BRZB 1F4YH 1LO2L 2EDBA 2MPAL 1FG2A 4FFYH 5CAYB 3H0TB 4YX2L 3KPTA 5ABDE 2HT2C 2UWEF 5CJQL 5EUKB 2E5EA 4YE4H 3WN5B 4YHIA 4XVUC 3NABH 1YEIH 1NJ9A 4GH7B 5EFIB 3QWQB 2N1KA 2VMFA 3WNMA 2NMSA 4XCFL 3CK0H 3BPCA 4XNQA 3SO3B 1MCHA 1J5OH 1UM4L 5F3BB 1RK0B 4Y5YA 5E8OA 3VFUA 1OAYH 1J12A 3ULVH 4QNPF 4Q0XL 2Z8WC 4XP6L 2VZ1A 5ESVB 1OGAB 3F5WA 2VLJE 2JLLA 1SYVB 5C7XH 4M3JA 5DQDH 4KJQC 3ZDYF 1NQBA 2WBWB 4HKBA 4EDXA 1IQDB 4TUOB 5HGHA 4NRZA 2GITA 1XF5A 1NBZA 4WDIA 4AEIH 3FHQA 3ZKXC 1WFOA 1BWWA 3BP5B 4WFHD 3U46A 4K2UL 2LTQC 3BXNA 3O45A 3SBWA 4YHKL 3IKKA 3G9AB 1Z6JT 4PRBB 2MTPA 1CGUA 3EDDA 4BZ2H 1KCUL 2OQJB 2R4SH 1BQUA 4I2XA 4LARL 5BOPA 4Y4KD 2WUCL 2QEJA 1LO5A 3QXVA 1B0GA 1B2WL 5HDBE 3IFPA 3RDTC 3MV01 4PJXB 4R90L 2CKNA 3O9WD 1AD0A 1T7ZA 3O3EA 5LQBH 4JO2H 4LLDB 1MHEB 5FO7B 1TVHB 5EORL 1A3LH 1J1OL 1NKOA 3MUHL 4XPTL 3UTOA 5KVFL 2HJFB 3JWOH 5DRNB 1ND0A 5E1AA 1K2DB 4F3FA 4ODBD 4CU6A 1RVFL 3QYCA 5EIVA 3LZFH 3P4OA 3RWDB 3EOYG 5IB2B 2X9XA 3OGCA 2W91A 4ZDHA 2QSQA 1UEYA 1PSKL 1X5KA 3W0WA 1C16B 1WT5A 4GUPA 5IW3A 2DQIL 5JNYB 3T0DA 3VXTA 3TYFA 3K4AA 1K85A 1CFBA 1I1AB 4M5YL 1A6UL 3AB0B 1YDPA 2VSDA 2V17L 1S9WA 1J7VR 5CEXB 4Y16A 2AEPL 4I0PB 4EKXA 1PKQB 4I77H 3EJJX 3Q5TA 4FQ1L 1KIPB 2C1PB 2ICEB 1WISA 3P77B 4LGPB 2VISB 1YA5A 4GQ9H 2F5BH 5ITBH 2KUTA 1F8TL 3T2NL 1LO4L 3TT3H 4TVSa 1P4IL 5JIPA 5IHLB 4GBXD 4FFWD 1F3DH 1II4E 3FZUC 1CGSL 2F15A 5DT1L 3WFHB 1RJCA 5IMLA 5ANMA 1D6EA 4RAUA 2XTJB 4CVXB 5EC2A 3JV6B 3DO3A 4XXCA 1X5GA 3HAEA 5IG7B 4O02L 3QXDA 4KTEH 2ARJA 1UJ3B 4LNVA 1WAAF 4M6ML 1GGCL 5CIPB 2CRYA 5D4QA 1BEYH 5I1HH 4G7YH 3E6HB 4XBPA 5CCKH 1N26A 2J7LA 4MDJB 4Z76B 2VLLA 4IIQB 2Z31D 5DJ0B 5GS0C 3ARGD 2RCSL 5H8DA 4EUPH 3QEQE 2XWBA 4YEEA 4KY1H 3QUKB 3HPJB 4M1CD 1U58B 1MCDA 3ZYOA 2M1KA 1K8DB 4BFEA 4RGNB 4AMKH 2QQLL 3ECBB 2GY5A 5D5ME 1TJGL 3CPLA 2Q76B 4WWKC 4ZUWB 3ARED 3GO1L 3KLHC 1ZWIA 5HGAB 1LO0H 4JPWH 4ZOCA 5BRZD 4QTHB 2BNRE 2X4QA 4P4RA 1XGRB 3V6FB 1CD1A 2W9LA 1A6TA 4K3HA 1FVCA 3MRPB 5DD5H 3GSNA 4Y1AE 5T3ZD 1HSAA 4E42A 3M8OH 1JPSL 4EDWH 4ELMF 4R0LA 4I0KA 4PJFE 5TH2B 3M07A 2YR3A 3VU2A 1M7DA 2A6JB 2ICWB 2G2RA 1MIMH 4OCMC 4RAVB 2NNAA 2ILLA 4XNUH 1QD0A 4ZXBA 4ONFL 5ETUA 4BFIA 5SV3A 5HHNB 3Q3GB 1G7LA 2H32H 4WW1B 5F7WC 5TE7H 3TBVA 5I1EL 2DLHA 2QSTA 2JJTA 2ADJA 3HZVA 3QXAB 1OGAD 4KHXL 5B3JE 4LLMA 4LVNB 1SY6H 2HFFA 3VFOA 4Y2DA 4TSBH 2ZUQC 1AI1L 4F15B 2E7CA 2IGFH 4M7KH 4OI8A 5EU4B 1CI5A 2G5BA 4ODUB 4TSCH 5EC1A 3U79A 2XA8L 2DMBA 4L9DA 5F9OL 4WJ5B 2OXGA 3PP3H 4JQVC 3IETB 4EN3A 4C57C 2E6PA 1WIOA 2EEBA 3TFKD 2ESVB 2H3NB 1R24B 1YJDC 2ZCLL 4RMUA 1V3JA 2DLEA 1S7XB 3BVNA 5C0ND 1UYWH 25C8H 3D85B 4S10A 3WDHA 1I1FA 3OKDB 3QDMB 3QNYB 4N0FB 2N7AA 2HVKA 2IG2H 4KKLD 2A6DA 3T3PF 1NFDA 1SMOA 2XN9E 4POZD 5C86A 1HNGA 3BGFB 4LCWB 1Z9OA 1Y18B 1JIBA 2R1YA 5KSBE 5I0ZA 2X5PA 4J2XA 5HPMB 1FO0H 4ZAKC 3VWJB 5GGQH 3HMXA 4L3AA 4XHQA 4KQ4L 3RUGF 3GSXA 2DJUA 3LS5L 5DTFB 3QO1B 1OP9A 2NZ9C 3HNTL 4DVBA 4Z7UA 1GAFH 1FVEA 3S3SA 2NY6C 4PLOB 1MFDH 1YQVL 5FYJD 3RJQB 3SQOL 4PP1C 2SEBA 1OCWL 3QI9C 1R5WB 2BXZA 4X6EA 4U1HA 4JFXA 4MJ6A 5DZOA 5KBNC 2OMBA 1QLEH 1I1AD 1CFNA 1MNUH 3E2HC 3OSKA 1P84K 4QRRB 2VIRB 1LK2B 4PG9B 1VGKA 3BAEH 3L5IA 4KK8D 3KGRA 4I0PD 3H9HB 6FABL 1H3XA 5TE6L 1ZHNB 4LMQI 2GAZA 3W5NA 2VDNL 4CVWA 3P11L 4OQTA 3QCTH 1KB5H 1RUPL 1YEEH 2LAAA 1A7OL 4GRWF 3I75A 3ES6B 1PGRB 4M1DL 1AC6A 1OVZA 3KJ4B 2FH8A 4BSVA 4KXZI 5F6HI 1W2KT 1ZT7B 43CAA 3ILPA 2XTJD 4GS7C 3QH3A 5IHBA 1G6VK 3D25A 3T1FA 1S9YA 4G6AD 4K94C 3D2UB 1I7RB 2BMKB 3V5DA 1QBBA 3C08H 1UXWB 4G7VH 4YBHA 4ZPVB 3LH2L 4NRXA 4U49A 3FQNB 2FJFB 1RQ5A 1LGVA 3GBML 5ACLA 1R5VB 5HY9A 3ZHKA 1ACZA 3FFDA 2ZP0T 4LDEB 1JJUA 1KNOB 3B3IA 3M1BA 2C26A 4KDTA 3DHMA 5E1HB 3GBNL 3Q0HA 5KOMC 5SWSB 5CUSH 3IJSA 3RJDA 3N1FC 5SWZB 1CICC 4KWUA 3KYOB 5CILL 2NR6D 4RGND 4Y8AA 3LB6C 4MD0A 4D94A 1MCBA 2BOBB 1JZ4A 2ITCB 4FXGB 3EYSL 1CIDA 3S36X 4L8CA 4ZS7L 2BVQB 4P46A 1BPVA 3F12A 2ZOLB 4LRNH 4FQJH 4G8FA 3U9PH 4JZOB 5FM5M 5B4MC 1J11A 1WZMA 2Y07L 3D69A 1XZ0A 1GH7A 4KZDH 1S7WA 2GTZA 4JJ5A 2X89A 4GW5A 3TN0A 1GRWA 3CX5K 4Y7MA 1A7NL 3PJSA 1RJLB 3BIKA 1T21A 1CU4H 5C0CA 4M9PA 3D3VA 5TDPA 1JPFA 5MHSD 3FQXB 4XBGB 1EEYB 3BMVA 4PS4L 3TESA 3LDBC 1A1OB 4UT6L 3BZ4A 1NC4B 3VGDA 1CLYH 3IFLH 5GS1C 5ACZB 2QR0A 1HHGB 2VLKA 5FV2A 5IB1B 2E7LC 3VD9A 1BBJA 4IMLA 2YSSA 3SCMB 5MENE 2KDGA 5DC9B 2CLZB 2X4PB 1G7JB 1A0QL 1O7VA 2EIZB 3L5WB 1RZFL 2VABB 5I1CH 2F8VA 3ARWA 5CBEB 2ESVD 4EEEA 3NIGF 4WV1C 1IM3A 1BD2A 4I4WB 2Y36L 1IZKA 1IEHA 1F4WH 4YK4C 2YPVL 5A2KH 1Q0YH 4UILH 1N64L 3L3OB 3D85D 5EZJB 5FHBL 3QDMD 4PJGF 4S1SH 4J6RL 1CBVL 2P8PA 3TIEB 1DEEA 2WIIB 3BD5A 1EBPA 2EDQA 1NANH 1YN6A 1OAXL 2JTDA 4LCWD 4ORGB 3WS3B 1DBAL 2F58L 3SDCB 3RZWA 1MLCA 1I7UA 3VWJD 2D7MA 3E3QC 3RI5F 1H15B 4G8GB 1W0WB 3L95B 2E7HA 5J9PB 2R4RH 5EPMB 4GAJL 1CD0A 4KVCL 3LKPA 1OAUL 4YHZH 3WKNA 4ZSOE 5HGDB 1XIWA 5TQ2H 4HPYH 3SPVA 2JCCB 3KPLA 5FGCE 2X70A 5AWNL 2RR3A 1FFNA 4RWYL 5DD6A 4H26A 3I50H 2W1NA 1MH5A 2BNUA 1DUZA 5C09B 1KIQA 3FB6B 1OGTB 2ZZUT 4QRRD 3FQUB 5MP6L 3T0EE 4KVNL 1LE5B 3OZ9H 2FATL 5E00B 3LEXB 5DK2B 3RA7H 1CTNA 3TWCH 4KK6C 4XAKD 2ICES 2NLJB 3AMLA 3MREB 1HXMA 1S5IH 1QNZH 5JHDB 1KELL 4PUBH 5FGBC 5HHVL 5J57B 2Z92B 1ZLUK 1QSFA 4GG6A 2QHLA 1XGPB 3L5XH 1VACB 2YHGA 1I8MB 3W39B 5KOVC 2WP3O 1GZQA 4ACPA 2ZG3A 1R3HA 5C0GA 5BS0B 4ISVB 4ERSH 2FBOJ 3OKKA 2WZPD 3SKMB 4R97B 1RZJL 4NGHH 3D2UD 1EJOL 3LN5A 5F1IB 5K59F 1S8DA 3EO1B 4C54A 1G6RH 2NZIA 3BUTA 3R0MA 4HKJA 3NPZB 4KAQL 4U2YA 4PJXF 2IEPA 4ZD3H 2GY7B 1JL8A 2B7DT 3BP7B 4MJ4A 5EIIB 5IESL 1T5XB 1F6AB 1VFBB 3DX8B 3O3BB 1XGUB 3OJ2C 1R3IH 5DQ9B 3DETD 1CLOH 3CIQA 3RL2A 1HWHB 4O51A 4PJ8B 1WWCA 2P44B 3KPRE 5GSVB 3JWNC 4OM1H 4KV5F 1MPAL 5SWSD 1KUMA 2NYYD 4WFED 5SWZD 2P46B 5DYOA 4PRNB 4XI5D 5E70A 4PJIE 3TM6A 2FJHB 2RFXA 3GI9L 1GHFH 1MFEL 4YDIL 1BAFL 5C07A 4J3XA 5DXWA 4KHTH 5JW4Q 2X4TB 3U0WH 4J3UA 4GAGL 1NBVH 4PJAA 1MIEL 4HC1H 2YPLE 3GHEL 1Q38A 4F9PC 3VXRE 1GIGL 4OZGA 4DN4L 5INDB 5EUOF 1BQLL 4LVOB 2JELH 3ALPA 1AFVL 2E9WA 2EDRA 4N0YL 4PRIA 4YLQT 4Y4KC 5L8KB 4U6XB 3U2SB 5HYSB 3V4VL 4CU7A 4YWGH 4UBDD 3RWGB 4NKIH 1W8NA 5C0RH 1CT8B 5JO5A 3ZYZA 3O9WC 4AIZB 3QCUH 2IQ9H 4D9QD 3TH2T 2HRPL 2DWEA 2X10A 5F7UA 3KPPB 1JYXA 4MXWH 3GHBL 3LCYA 3QQ4B 2AJXH 2EXWD 4U0RC 1S7VA 1NC4D 3NFNB 3H42L 5KVMC 1FE8H 3EYVA 4OFYD 1QLRB 1EHAA 2XG5A 3T65B 5ISZE 1H3VA 2AV7B 2PXYB 5JLZB 4PREA 5IBLD 3SCMD 5TF0A 4KK9D 3WDJA 5BVPL 4I8DA 1ZLWK 2XXMB 4AL8H 3ZKND 5I8CB 2XKNA 4KU1A 3N1GC 1G9NC 4HH8A 5K9JL 4GAYB 4OT1L 3LRSA 5I8EA 3RDTA 1ZS8A 1N59A 5EOCJ 1JHLH 1Y6KR 4U3CA 3I3EA 3KJ6H 2XKSA 2I25N 5IVZA 3C8HA 3MCLH 2VNCA 1FYTA 3R1GH 1KPVA 4OF6A 1R3KB 4Q6IB 1MRDL 2FSEA 1FZJB 1OD9A 3WIIH 2YK1L 1PG7H 3OB0K 3SDCD 1N6QH 1B4JH 2F53E 5KSUB 3WXVL 2JK5B 3HNSL 4NNPL 4FFWC 2R0ZH 4N8CH 3O2DA 4G8GD 3ZKQD 5F71A 4OCXL 4HFWA 2FWOA 3ZO0A 1YPZE 1FL5A 2E8ZA 2XRAH 3IRPX 2EKSB 3MYJB 5C70A 1XCQB 1Z5LA 2DL9A 3JV4A 1UWGH 3OWEA 4NO0A 4PJ5E 2BSTB 1C5DA 4TPRH 5AEAA 5HGGS 3VW3H 3MRJB 3JVGC 2FO1A 4E41A 2O61B 2FZ3B 1SJHB 1XCTA 3MLZL 1HQRA 2VR9A 5E2JA 4C83B 5C09D 2Z31C 3ARGC 1JF6A 1U95A 3QHTC 1JPTL 4P5TB 4M1CC 5ADPL 4RZCB 1ZXQA 3QIUC 2DLTA 3X11B 5EZIH 5JXAL 5DF0A 4X80H 3PUCA 1CDIA 5JHDD 4RGOH 3REWA 1PX3A 3AREC 1LNUA 1W0VB 5DJ2A 5A40E 4QRUB 4JVPA 5LAXA 4KUCD 5C08B 1CGXA 3FOMB 1HI6A 1HILA 3RHWK 2OS7A 3SGKA 1WBYB 4LAJH 5BS0D 4R2GB 4UB0L 1WVZA 2XWJA 1MCQA 1E6OL 4P2CG 4EI6B 2GTWB 3G5YB 1PD6A 3WN5C 5F7KC 2ADGA 1RY7B 1KEML 3QEHA 5TQ0H 3RWCB 1GGUA 3OAYK 3QJFB 5GGSY 5AZEL 1P6AB 3CVHA 4HK3J 3IVKB 1WZKA 2FHFA 3PABB 3SJVB 2WBKA 1FIEA 5EIQA 3SO3C 4TTDD 2Q20A 4L8BA 1ETZB 2D9CA 4NC0B 2C3VA 3DRQA 4PB0L 4PJ8D 1UQSA 2GFBB 2CH8A 2VC2H 3VH8G 4UDTA 5C0BA 4JKLA 5HYQA 1DTUA 3UBXI 4HWBH 5IMKB 1UXSB 3PNWB 4WWKA 2BHYA 4NUGL 3PP4H 2IFFL 1FNEB 4RISL 4R96B 2BVOB 1JTPA 1EUTA 4NHUA 4FZEL 1INEH 1T22A 1D9KB 4CDHA 3E6FB 2CKBL 3X12B 2X1OA 1RZKL 3N0PB 3TFKC 3UZQA 1QFPA 3VA2C 4HS8L 1M7IB 1IILE 1JMZA 5C0NC 5EO9B 3WIHH 5EU3A 2P43B 4OSUL 4YHOL 3MLVH 4KKLC 3TO4B 1ZVSA 4POZC 1I7ZA 4OCWH 5SX4I 2VXQH 4ODWA 1EHLL 2N56A 1A4KB 2ZPKL 4P2RB 3D5OF 1DJSA 2AJVH 1CF8L 5HHXH 2CDGB 4X6FB 4WIQA 3IYLW 1A6WL 1XF3A 3UZEA 2MFNA 1OT2A 5CEYA 1A2YB 2IANA 4BSWB 4L4VA 3EDKA 3U4EB 3IDNA 1NAMH 1YNKL 3B9AA 2DYPB 1O0VA 5K93A 3T77B 2OJZL 4J3SA 5T1LB 5CWSA 3VFVA 5C6TL 4UTAL 3GKWL 2ATKB 4JFOA 1TQCB 4JQVA 3MV8A 4LHJB 4AT6B 1DN0A 1WFTA 5DLMH 3BYTA 1JHKL 2PXYD 1PY4A 1QRNA 1ZSDA 1W8OA 4CW1A 4MX7B 1ULVA 5T3XD 4P23B 4YH6A 4P57A 1DDHA 2DI9A 2UZYB 5DRZA 1TJIH 3OXRA 3CFJB 2W0FA 1MCNA 2VDKH 2UWEA 1ZMYA 2MCPH 1IC4L 2ADIA 3GJFK 2DM2A 4U6YB 5GRVL 3AC0A 1I1AC 3IKCA 3GMNA 1T80A 5TDOA 3AB0C 5C0IB 2PKDA 2I26N 1ZVHA 1WBZB 4O5LL 1QKZL 4KK8C 4I0PC 3IF1B 3ZE0F 3NOIA 2VSCA 1A7QH 3MUGA 4G6FB 2VLRA 1YUHB 1KPUB 4U1KA 3K2MC 1RUQL 4ZAKA 1UFUA 3QULA 2L4OA 3UBXB 5I18H 2EE9A 4N0UA 3VFSA 2B1AH 4TVPH 5ICYB 4NO2B 3T8XA 4D3CL 2QV2A 1F6LL 2R1WB 4XNXH 1A3RL 1T04A 3O6FB 3BESR 1JGEB 3HZYA 5AAMA 2IWGA 2XTJC 4NWUH 1W72A 4MJIB 4Q7DA 2AERT 4G6AC 3HCVB 1JZ8A 1OT1A 1J8HA 3WL9A 5ALBH 1C8PA 3L3DA 3QI9A 1WUNT 1UJ3C 3U7YH 1V3LA 3GIZL 5DSCB 3R0NA 5I1IH 2ZSWA 5GIRB 4NQXB 2O93L 2GHWB 1EVUA 3PXJA 3E8UL 3FO0H 3WFBH 4AEHH 3LY6A 4X8XA 1UZ8A 4IIQC 4ODXA 3K2UH 4UUJB 1Z9SA 5FDYA 1N8ZB 3HTLX 5BJTA 5IB5B 4FXKB 5BV7L 2IPTH 5BXFB 5E2VH 3W9EB 2ZKHH 5HGBA 4P5TD 1FGNH 3UPAA 5JW4R 3PQYE 4MAYC 1RSFA 2NR6C 4RGNC 4DN3H 5DMIL 2C7UA 2OSLB 4KPHH 2R23A 4OFVA 4AY0A 1F4XH 4HT1H 2FNBA 3PWNA 4HCRL 4U05A 3MPCA 2ZOKB 4XPHL 5C08D 3RY6C 2ZNXA 4KJYB 4M3KB 2EO9A 4QXTB 1MWAA 3GDBA 4ZODA 4G6JH 5E2WL 3SGEH 4U6HA 3U9UA 1NMBL 2GJZA 2ZUTA 4IRJB 4R2GD 4Q9CA 4O58H 4ODVH 3GUTB 1JZ2A 5JOPD 2ID5A 1CTOA 1YECL 2MHAA 4JDZA 2Z91A 3CFKB 4HZAA 3ARSA 4G5ZL 3SJVD 3EJZD 5J3HD 1NSNL 4MXVE 3FMGL 1QTYT 4OLEA 1FPTH 1CICA 4IMKC 2ATPA 2WV3A 4N1EA 3T4AA 1F00I 4LVNC 1YYLH 1F97A 4F15C 4BH7A 1CZ8H 1ZEAH 3S35L 5E24E 4H88H 2DQUL 2VERN 5JW5B 4BFBD 4H8WH 4Y8DC 3NCJH 3MQIA 1D9KD 1H3TA 4TRPH 5FYLD 1T2XA 5E8DL 1HSBB 3L3JA 3WUWB 1JGDB 1S9VA 2W65A 3S88L 3GJFB 2DB8A 1D5IL 3V6BR 5AUMB 3QPXL 1IAII 2C1OB 3GMRB 3RAJH 3ZYIA 4X5WA 4WI5A 5DD0L 4FZ8H 3MA9L 4Y5VA 1WAAA 4FABL 4LLQB 5D71L 1IGJA 5L88H 3TO4D 1RUKL 5J1SC 5KVDH 4HF5H 2XZQL 5K9QI 3BGFC 3IFNH 4KUZH 4P2RD 4OCNC 4KUCF 3P2TA 2UZIL 2NY5C 4YHPA 1YNTB 4XNZB 5C0FB 3QFDB 1MCKA 1MREL 5AD0B 1NGZA 5KVGL 1MJJB 3SO5A 5HYJB 4M9OA 4HQQH 5GS1A 3VWJC 4QLRA 3EO0A 3QNXA 4OB5L 4XVTH 2DYPD 5GGTH 3DV6A 4LSPL 5T1LD 2WWKT 4JLRA 1QR1A 1JFQL 4AIOA 2FIKB 3K3QA 1OM3L 3RKPA 2CMRL 4I2XE 4HWEL 3D87B 4WV1A 4P23D 3K4DA 1WCBA 3HLAB 2A2QT 3VFPB 4LHUG 1F90H 2BZDA 4JE4B 4I3GA 1D5BB 4LEXL 4L3EB 4RQQB 1UKQA 4Z7QE 3MUZ1 3U82B 2BSED 4ELMA 1HKLH 3PWPA 4NQCB 5EB9A 4OQ1A 4HIEB 4G6FD 4L1DA 2CD0A 3QWOA 4UV7H 3VGFA 4Z0BL 4HUXA 5ERWA 4P4KB 4V1DA 4NNYA 1J18A 3KJ4C 4M00A 2AJ3A 4H20H 5C8JB 2VL4A 4IDLA 3CDFA 3DTXA 5LGJA 2XQYK 3O6FD 4RFEA 3W0WE 2VZVA 2BXYA 3BE1L 3IJHA 1IAKA 2YXMA 4MJID 1QLFB 4Q9RL 3DVNB 1YN7B 3C5JA 3MNZB 4NQEB 4PBWD 4R4FL 5D72H 4NDMA 1IBGL 1AXTH 4M8QB 2P24A 3G6AB 2HAZA 1UM5H 2Z8SA 1I8LC 3DETC 3UC0H 4CADA 5E5RB 5CEZD 4XVJL 3NAAH 2EDWA 3D0VB 4OKVB 1UZ6E 3GFUA 2AXGB 5FCSH 3GSVB 3TIDB 4L4TB 2FLRT 1Y6MR 2NYYC 3QUMB 3QDHA 5J11B 5FGBA 5E99H 1TCRB 5IV2A 2Z8RA 4MJ5A 5I0DA 4XI5C 5ANME 2CLVA 2DIAA 4JAMA 1MELA 4OM0L 1RK1A 1ZV5A 4NJ9H 4N1HB 1Q0XL 1JI2A 3D18A 3VXMB 1M6OA 5DJZA 1JE6A 4WHTA 4K8RD 1J0YA 1ZTXH 4S1QH 4WEBL 4DK3A 4KGJA 3RUGA 3BGMA 5L6YL 4ZYKA 5I1DA 4IRJD 1RJZA 3PV6A 1P4LB 5J1AB 1G7IA 5MERB 5SWQB 4DKFH 3KYKH 5JA8B 1FORH 3GSNL 2W60A 4P2QB 4ZUTB 5IFAL 4LEOA 3DX6A 1BX2B 4UBDC 1F42A 1X44A 5DJ6B 3I6GB 4U3XA 3W11D 1I9JL 1T3FB 3TBSA 1IEAA 4HMDA 5T1MB 1E28B 3RWEA 3MZTA 2FJGB 4JDVA 3ZDZE 4BELD 1FH5L 1PYWB 4YFLF 2OL3B 2EXWC 4JVUA 4MHHI 1NDGB 5I1LB 1NCCH 3IU3B 1NCTA 3O41B 4PJCF 3FT3B 3QO0B 5FUCE 1OAZL 3S4SB 3IDUA 1J0KA 3UTZA 2YA0A 5DZNA 2VAAA 5DJYB 4ZQKA 4BK4A 4F9PA 3MRKB 3MMEA 5IBLC 3NABL 4OZHF 3SCMC 2NTFA 3LSOB 3CFEA 1KENH 4XHJD 4LCYB 1BIHA 4JFZH 4KK9C 3KR3L 5JHLH 3CK0L 3CCHA 1RIHL 4JFQA 4Y4KA 4Q2ZA 2FECI 4XPAH 1J5OL 3MRNB 3ZKNC 1A6AA 4JFPA 3RPIA 4YGVA 1NGPH 2Q8AH 1OAYL 3ULVL 1UCTA 2O5YH 1I1YB 1TENA 3UTQA 1G9EA 3MODH 3OKNA 4GO6B 3WMSA 1CYGA 3O9WA 5DJ8A 4ZUUA 3NFSH 5DRWB 5IHUL 2IBGA 1GC1C 3DBXA 4IM8A 5DQDL 3NN8A 4MQSB 1MFNA 5DQJA 5F96L 5FA3B 1U8JA 1KJVA 3GSUA 2B39A 3SDCC 1X5ZA 2I60H 5IQ7H 3N1MC 4UTBH 5HYJD 3QCVH 2CIIA 5JMRA 1X5FA 1TTFA 3QEGH 3HMXL 4OIAA 1U8QA 2IC2A 3ULVE 3ZHLA 2OZ4A 3GSOA 5BZWA 1HQ4B 1WLHA 3GI8H 5DVMA 3QHFH 4LGSB 1J87A 4FFZH 5DMJB 3EBAA 1RJYB 1NFDE 4AEEA 1TVBB 3VI3F 3QRFM 4DZ8A 2LQRA 3GSRB 5E94A 5KG9A 1G7PB 5F1OB 4L3ED 5D96B 3S98A 4BH8B 3HUJE 2DQJH 3GJEB 4HWZA 5LQBL 2AKRA 4ZFOB 1SJVA 4PGZA 3TCXA 1A3LL 5GSRB 4NQCD 4JVWA 5GGTA 3MNVB 3BUYB 4U1SB 5I75B 2NY7H 2FL5B 3VFGH 3ILQD 4YGAB 3EYUH 3FQRB 4JDTH 4Z7UE 2Z35A 3BN9D 4OQTL 1AGFB 3BKYL 4LPVA 4P4KD 1C7SA 1EA9C 2V5SA 2GIYA 4HIJB 1M05A 1X7QA 5EO0B 2A77L 2CLRB 4O9HL 1LDSA 1NJ9B 3WJLC 4KI5F 5BVJB 1KEGL 2EH8L 1G1CA 3P73B 4GKNB 4HH9B 4R97C 35C8H 3IRZA 3CMOL 1OSZA 3S36H 4KTYA 1ADQA 4NQED 3CZFA 5CJXC 3WS6C 3CDGA 3RVWD 5DHYB 1RI8A 2CRIA 2CK0L 1AGDB 4I77L 2X4UA 8FABA 2Z31A 4X8JA 4TTDC 4E5XB 3ARGA 2MKWA 2EYRB 1MJ7H 3BP6A 4GQ9L 4OIBA 4PJ8C 5ITBL 2F54B 3I3DA 1LD9A 1HZHH 2FDBP 3QIUA 4PJGA 3UO1H 1QYGH 4Z5RB 2ZG2A 3DARA 4L4TD 4YDJB 1UB5A 3D48R 1YEKH 3AREA 5B3JF 5I76B 1T0NA 3AXLA 3GMMB 2BC4A 5D6DC 4NWTL 5KS9B 5BRZA 5IVOA 4CUCA 3VXMD 1UVQB 1FVDB 4KTEL 1AXSB 4X99B 3H0TA 5K9KB 1TETH 3WN5A 3ZKSD 3WO4B 5I1HL 1FAIH 1QP1A 1MRFH 4G7YL 5GS3A 1LO5B 5EFIA 4LVOC 1ZANH 3H9YA 4QF1B 3HN3A 5CBAB 2OYPA 2WUBL 1K8IA 4ALAH 4P2QD 5F3BA 1RK0A 3TF7C 3HZMA 4KY1L 2CIKA 3D0LB 1I3UA 2BVEA 5TE4H 1DQTA 4MA8L 1U3HB 5ESVA 1OGAA 1SYVA 3WFDL 2AQ2A 3RHWF 4F3FB 4MCZA 1IQDA 1LO0L 1NCAL 4NZDA 3P3YA 4TUOA 2O5XH 3CFBB 1JWSB 3I6LE 4HJJH 2IPKB 3BP5A 1M71A 4JCLA 5DD5L 4FS0A 3DURB 4QOKE 3O6KH 4JGMA 2PXYC 4HBCL 4PRBA 3M8OL 2D31B 1IZJA 2OQJA 2DQHL 4NM8H 5CINH 1QA9B 1YDPB 3LPFA 3DRTB 1IM9B 4XNUL 1YEHH 1ZLSH 1T4KB 4HZLB 4J1UA 2YA1A 3U4BH 1BZ9B 3SE8L 4RRPG 3UTSA 3N85H 4RCAA 4H0GA 4RFOH 4LDLB 4HEPG 4PJXA 2WNGA 1WV7T 5C0CE 3D3VE 4PYGA 2HT4D 2UY7A 1NDMB 3VCLA 3X13B 4LLDA 1MHEA 5FO7A 3WFCH 1SY6L 3STLB 5ID1B 1TVHA 3IDMB 4Q6IC 4KH2A 1N4XH 2IGFL 2HJFA 3HC4L 5F3HB 2VLKE 1RZIB 5DRNA 3LQZB 1GPOH 1IAMA 4TSCL 3I9GL 1LO2H 1K3ZA 1PVHA 2PCPB 5K9OB 3RWDA 1UT9A 3GEWB 5IB2A 4JKKA 1BD2E 1TDQA 3CLEL 15C8L 3TO2B 5D7KE 25C8L 1RIUL 1C16A 4DKDC 3O8XC 5JNYA 1TZHB 4XCFH 4XWOD 1FG9C 1I1AA 3O3UN 4X7EC 1O7SA 4JPIB 5FEBA 5I15L 5EUOA 5CEXA 4Q0XH 4XP6H 4I0PA 2CDFB 3QFJB 1KIPA 2C1PA 3LKSB 3P77A 4WHYG 4K3EL 1FO0L 4P5TC 4YHML 5DS8B 4OZFH 3C6LB 2X1XR 3TBTB 1KIUA 1SYSA 1CXKA 4MDIB 2X40A 3WFHA 4NOBA 1F58H 4M7LH 4M5ZL 4CVXA 4K2UH 3JV6A 2YC1B 5IG7A 3X3GL 2AAVA 4R2GC 3PGDA 1UJ3A 4LARH 1Q9OB 2V2WB 3UPCA 1OWRM 2F5AL 1QLEL 5CIPA 1PG7W 1REIA 4JO4L 4WEMB 5ETUB 5MI0B 2FEDC 4NZUH 1QR4A 1K5NB 3OB8A 4LOUD 3E6HA 3BAEL 3I02B 2WLYA 1DLHB 4R90H 4MDJA 4Z76A 3EJZC 4IIQA 4RIRB 5J3HC 5DJ0A 2VQ1B 3L3GB 1E0OB 3IDXL 4Y2DB 1N6VA 3HPJA 3QUKA 1J1OH 4QXWA 2F54D 1U58A 4GXVH 2VKXA 5KSAB 4BZ1L 4MAYA 1Z2KA 5FUZH 1K8DA 3BHBB 1QSFE 4GG6E 3ECBA 2PTUA 2Q76A 4ZUWA 1EO5A 1MCJA 1S7UA 3RY6A 4JN2B 2APTA 4Z9KB 4I5BB 4PJEB 3IU4H 3EHBC 4QTHA 1UWXK 5EWIL 1XGRA 3V6FA 4G7VL 2H2SD 2PYEB 1D9KC 1MF2L 4DFIA 3DOSA 3MRPA 3C09B 1W0YT 4CAGA 4M5YH 4N9GB 4PP2B 1AQKL 1A6UH 4MJ2A 2A6JA 2ICWA 4RAVA 1F5WA 4RFNB 2WW8A 2V17H 3PIQA 4J12A 4WTWA 5HHNA 3Q3GA 5CUSL 5JW3H 4WW1A 3TO4C 4M62H 3U7WH 4ZNCD 5M95B 4IMKA 1U3HD 4U3HA 2JJSC 3QXAA 2DKUA 1C1EH 1F8TH 4QRTB 3T2NH 1LO4H 5C0AB 4RNRB 3V6ZB 1P4IH 5BO1H 5C07E 1R0AL 3LKQB 4DVBB 3GZKA 3DSNA 5DT1H 1CGSH 3HS0B 4QEGA 2DD8L 5JZ7D 1I3GL 3MOAH 5EU4A 1M4KA 4RGMB 3ME0A 4QT5B 4ODUA 2J3SA 4OZGE 4FQJL 2SEBB 4WJ5A 1TQCC 3IETA 4O02H 1OQXA 4PRIE 2ESVA 2H3NA 1Q94B 1R24A 4MJ6B 1SBBA 2FX7L 5FYKD 4KZDL 1L6XA 4P23C 1S7XA 1IM9D 3D85A 3OKDA 4BJLA 3QDMA 3QNYA 4N0FA 5F88B 3JWDC 2J8HA 2I24N 2RCSH 2GAZB 3D39A 1J0HA 1JGLL 4M4PA 2P48B 4ZO9A 3DMMB 4HW6A 1BVKB 4LCWA 1VEOA 2H26A 1P7KA 1Y18A 1MCWW 3KPQB 1S9XB 2B4CH 1TJGH 5HPMA 4QTIL 5ENWB 1Q8MA 3VWJA 3VGBA 5DTFA 4NQVB 5FV1L 1IKFL 3T1FB 4NO3B 3V8OA 3O6FC 2NY2B 4L8DB 3HG1B 1NFKA 1F4WL 4GOSA 1Q0YL 2ZJSL 3MBXL 1JPSH 1R5WA 3L9RB 2J8UB 2W9EL 4MQXD 4M03A 2ED9A 1MCPL 1TITA 4S1SL 1N2RA 5JMOC 4YIQB 3LMJL 1T5WB 3ZE1F 5JDSB 1NBYB 2P4AB 1FYTE 4NQUA 3TT1L 4QRRA 2VIRA 1LK2A 4PG9A 3PDOB 4PR5B 3H9HA 3QFJD 4KHXH 1ZHNA 1SEBB 4J3OC 4RMTA 2WM0A 3SDAB 1AI1H 3C6LD 1MVUB 3MBEB 1CLZL 4YBLB 5FOJA 3MJ7B 1BOYA 2OI9B 5L0QB 3BJLA 1ZT7A 3MJ6A 2XA8H 5F9OH 1F45A 3NIDE 4K8RC 2NY1B 1NLDL 2VDML 2OTWB 1I7RA 4QY8B 2BMKA 4WI2A 2XV6B 4E41E 1QFUH 4IRJC 1UXWA 4ZPVA 4DGIL 3VGAB 5IB3B 3FQNA 1DVFB 2R2CA 2FJFA 1TJHL 3OHXB 3PWJB 4WUKH 4GW5B 5EG6C 3ARBB 3HE7B 4EIZC 1I8LA 1QUNA 4NC2B 4JREB 1R5VA 4U6TA 1KNOA 4PJDB 5DJXB 1MQKL 3TWCL 5DA4A 3W11C 3W5MA 2C4FT 2EEAA 5EH1A 4WI4A 1S5IL 4Y2DD 3VRJA 1QNZL 3B9KB 5SWZA 5KSAD 5IEKB 4ENED 3KYOA 4MWFB 3JUZA 1G0YR 2QR0B 4Q58C 2XZCL 4KQ4H 3KPMB 3LS5H 1A5FL 4IMLB 4LGRB 2BOBA 2ITCA 43C9B 4FXGA 1LVEA 3BKMH 4UOW1 1RURL 1S7TB 1P7HL 4H1LB 4NGHL 5A2JH 1YQVH 1QZ1A 3SQOH 5CLWA 1S3KH 2ZOLA 5EBMB 2PYED 1A02N 4JZOA 4XHJC 1SEQH 1LO3L 4GSDL 1RMFL 4NQDB 4YHLH 2A38A 4OF3A 4FQCL 3LKOB 1CLOL 1FBIH 4MB4A 4P2YA 3R4DA 2PTTB 3FQTB 2YD8A 4OM1L 5C0BE 3VJ6B 2FD6L 2X09A 6FABH 1KCRH 5TE6H 1MCWM 1RJLA 4PRDB 2VDNH 3P11H 1RUPH 4AH2B 5GRYA 3FQXA 4PJ7B 5DZLA 4QXUL 4NQTA 4XBGA 1EEYA 4XNZC 4DW2L 4WO4A 3BH8B 5C0AD 4M1DH 1A1OA 4KHTL 5HHME 5IK3B 3VDCA 3U0WL 1XGQB 2I27N 3QDJE 5DURB 4Y19B 5ACZA 1K3IA 4F7MB 4KK5D 4OFYA 1HHGA 5IB1A 1CL7L 3F7RA 4XWGH 3SCMA 2CLZA 2X4PA 1G7JA 1BWMA 2EIZA 3L5WA 2VABA 4UINH 5CBEA 3LH2H 3VRLE 5C0JB 2ZNWA 5DD6B 1YJDL 4I4WA 1MH5B 3GBMH 5HVGB 5EZJA 1DQJB 4HWUA 1YEGL 2IQ9L 2YN3A 2Z0BA 3TIEA 4JPKH 2WIIA 1ES0A 3GBNH 4ONGL 2AK1L 4J3WA 2IANE 3DMMD 4MXWL 4ORGA 5CP3A 1JTOA 3WS3A 5KS9F 2DF3A 3SDCA 3N06B 3ILQC 1L9MA 3SGDI 5J56B 4PV9B 4X6CE 4PIRF 1VFUA 3BO8B 1FE8L 2GI7A 3BN9C 4QXGL 2YUZA 4ELKB 1H15A 3OKKB 4G8GA 1W0WA 4ZS7H 4JN1H 4P4KC 3L95A 1J86A 5C0EB 4ZSOB 5J9PA 1T7XA 1S8DB 2K3TA 5EPMA 2NY2D 1NGQH 5FGCB 3HG1D 3ARDB 5B8CB 4IDJL 2Y07H 3C8DA 2UWEE 1W72L 4OBRA 5HGDA 5IKCB 3X14B 4E0RB 2VDRH 3VXOB 3V0VB 3RVWC 3TVMB 3T0EB 2E27L 3KJ6L 5TFSH 3MJ8B 3MCLL 1KPRA 2CUHA 5C09A 1A7NH 3FB6A 4HPOL 3REVB 2OK0L 1A6ZB 1OGTA 4XMPH 1AO7B 2VLRE 3FQUA 2UYLB 5E00A 3LEXA 5DK2A 4QNPE 3WIIL 1WFNA 1N6QL 1B4JL 3MRQA 3ZMRA 1N7MH 4PS4H 2NLJA 3MREA 4ZTPL 1F02I 3ZDYE 5J11C 3MBED 4FNLL 2Z92A 4OGXH 1XGPA 2A74B 3RU8L 1VACA 3S6CA 1I8MA 3W39A 3OJDB 4WNQB 3RTQB 2XRAL 3WJLA 1J8HE 3AS2A 5BS0A 1A0QH 2NY1D 4ISVA 1NAKL 3SKMA 1T0MB 5HDOA 3MGOB 4S1DD 1VFAB 1CVRA 4HIXL 3VW3L 1MWAL 5F1IA 3EO1A 5CJXA 4K94L 3WS6A 5DJDB 2YPVH 1DVFD 1N64H 4QGYA 3BP7A 5FHBH 3ARBD 1T5XA 1U3ZA 4JY6B 3HE7D 4B0MM 5ADOH 5FYLH 1J8KA 1F6AA 3DX8A 3O3BA 3H9SE 1XGUA 2CDEB 5ITFB 5DQ9A 4AENB 2VLMD 3B2VL 2XIDA 1QBLH 4IJ3B 1CIUA 5DRXA 2HJLB 4HUVB 3B8SA 4PJ8A 4U1JB 3DUSB 1X4XA 5EZIL 5GSVA 3WDIA 1VEPA 2F58H 4P9ML 3B9KD 4JHAL 5DMGD 3QB7C 3JBG7 5FDWB 1LWRA 4PRNA 5D6DA 4CBPA 2FJHA 3DVGB 4PREB 1AR2A 4DVRL 3VXRB 3F6LA 1K4CB 2X4TA 3P4MB 1AKJB 4P3WA 4GAJH 1BREA 3RFZC 3MGAA 3ZLQC 4H0HB 3L3IB 1CS6A 4JG0L 1OB1A 3VWKB 1N5YH 3NIFF 4NQDD 1N59B 3MLPA 2UUDK 3HA0A 5AWNH 3C8KB 5IVZB 3U2SA 4RWYH 4CMHB 5D6CB 3RWGA 1CT8A 5MP6H 4KVNH 2F74B 2VC2L 4WTXA 2FATH 2HT4C 5E95B 3QIWB 3WE6A 1PY9A 3CFDB 1ZK9A 4AYFA 1A7PL 1WWAX 2AXFB 3HMWL 4MB5A 1KELH 5HHVH 3KPPA 4Z95L 3QQ4A 4HUUA 5GS2H 4UOW0 1QQDB 2VUOA 3KHQA 1INEL 5DURD 3NFNA 4QHNB 4Y19D 3RKDD 3QG7L 3T65A 2UY6A 1LDPH 2AV7A 2D0GA 2PXYA 5JLZA 1RZJH 1EJOH 1XIWD 1J9CT 2A83B 1G7HB 1UEMA 2YN5A 5EN2B 1CXEA 1JK8B 1UH2A 4ODTL 3SKUD 5IESH 1WAAE 3MLVL 4XWOC 1G7MB 5I8CA 5DI8B 4GAYA 1HE7A 1Q72L 1ZGLP 2C4FU 4G8EB 1ORQB 3FFCE 3ISWA 4J4PD 5I66A 5HHXL 2DOCA 5D96C 1TTGA 3PWVB 5A2FA 5KJRL 3AMKA 4LLAA 5FCUL 3BQUB 1R3KA 1T7YA 1FZJA 4Z6AT 4PJEF 1NAML 3ZSSA 1KJ2B 5I75C 5KSUA 3KS0J 3GI9H 1MFEH 2JK5A 3QG6B 1BAFH 5IFHH 3ZT7A 1YYML 4K7PL 1MIEH 5KN5B 3BW9B 3WKML 4PGBB 1L0QA 3V95A 4WW2B 1GIGH 2EKSA 4PJCA 1XCQA 3O8XA 1FAKT 3OAZK 4KDWA 1L0YA 1BQLH 4BQBA 3ARDD 2BSTA 2VDKL 5DHVH 3I85A 5FB8B 1EEUA 4OZHA 2FZ3A 1IC5H 3V4VH 2HT3D 3TVMD 4LOUC 1SJHA 3MOBL 3SDXE 3FAXA 1EEZB 2WINB 4R8WL 3EKCA 2EDLA 4XCCL 4AK1A 5AZ2L 1AO7D 2D7TL 4N8VB 2H45A 4P5TA 1YNLH 2NW3B 2OBGA 3AVEA 3V4UL 1MOEA 4RZCA 3E3QE 2OJEB 1MI5B 1VESA 32C2B 4POUB 4V1DE 4W4OC 4NNXB 1KN2L 3QDGB 3N9GH 4XNXL 4TQEH 1BQSA 4L4JA 1W0VA 4QRUA 5F9DC 5GRVK 1RZGB 5C08A 4NWUL 4ORZC 3FOMA 5JR1L 1J0JA 4CN6A 1JVKA 2J5LB 3RTQD 1WBYA 4WI6A 2H2SC 4MCYB 1ED3B 4EI6A 4A6YH 3U7YL 2GTWA 3P4NB 3G5YA 5I1IL 5M7QA 4L5FL 4LSQL 4FQLH 2BSRB 3WO4C 5IVXB 2QSCH 3RWCA 3QJFA 4AEHL 1KLUB 3IVKA 3PABA 3SJVA 4W6XB 1ETZA 3V0AC 4JCMA 5F6IB 2IPTL 1L7IH 5E2VL 3SKOB 2ZKHL 3T3PE 1FGNL 2DBLH 2GFBA 3D9AL 1U3HC 1MRDH 3IDNB 4DN3L 4HT1L 5IMKA 3PNWA 3T0XA 4NNPH 2AJZB 2HFGL 4HJGB 3F58L 1FNEA 3MV8B 1IEBB 3X17A 5IQ9B 4R96A 2BVOA 1QRNB 5CMAB 3VXRD 4ETQB 2HKHH 3I2CL 1AKJD 4NYLA 2J8UF 1D9KA 3GK8H 1DDHB 1EBAA 4O58L 3FRUB 1WT5C 3E6FA 3X12A 3AROA 4F7EB 1M7IA 2ADIB 3VFMB 5TDOB 2F9BT 2UZXB 3VWKD 5AYQA 5EO9A 3LQAC 1NCUA 3MLZH 3F7QA 3B6SB 3NH7H 2D9QB 3STBA 5E6YA 4NN6B 4XMKH 3S9DB 1I7TA 1A6PA 5F1SA 2BOCA 4OLVL 1ROWA 4Z7NF 2D4DA 3VMNA 4U1KB 1A4KA 4Q9QL 4P2RA 5ADPH 3QIWD 4LBEB 2CDGA 3DV4B 4X6FA 3ARPA 5F7LB 4ZO7A 2YD7A 4U1MB 4Z7OF 4X7CC 1A2YA 1ZEAL 1T04B 5EOTB 3NA4A 4TYUA 3TV3H 3U4EA 5I71B 3AGVA 4WFHE 3VH8B 2DYPA 3T77A 1EGJA 1P2CB 5T1LA 1B90A 4I3RL 2Y9RT 1KCSH 2QQNL 2WWMD 4AT6A 4UB0H 2WP3T 3BDBA 1FCCA 3HFML 1E6OH 2J6EA 1QPPA 3MXWH 3TNMB 4MX7A 4P23A 4G80B 1KEMH 3V9FA 4PJDF 2YBRB 2OZ4L 3GGWB 3RAJL 4LK4A 4MQXC 4FZ8L 3CFJA 2R0WL 4M7LT 2AK4B 4HF5L 5C0IA 1G9NL 5A1AA 1MVFA 3CU7A 3IFNL 1WBZA 3BWAA 4KUZL 4PB0H 1CDYA 3NZ8B 1BBDL 4FQHB 3IF1A 5FYJU 3U7AA 3AS1A 3BQUD 3HRPA 3X3FL 1YZZA 3FZUD 1YUHA 2V5MA 4HQQL 1FGVH 3C6LC 2IFFH 3MRBB 4XVTL 3UBXA 1NMAL 4GS7B 5JOFA 5GGTL 4RISH 5ACMA 2VL5B 5ICYA 4NO2A 3FONB 2FRGP 3DXAA 4FZEH 3MUY1 4YO0B 2AXJA 3O6FA 1DCLA 1JGEA 1VERA 2CKBH 2WBJB 4MJIA 1J0ZA 4JM2B 3HCVA 2NY3B 4RMVA 4B7LA 3PL6C 1F90L 5F70A 3OV6A 3EO9L 5FHAH 5DSCA 4P48A 4OSUH 5GIRA 4L8SB 5MI0C 4XP5L 4NQXA 5BOZG 2VDLH 1HKLL 1Z9MA 4XCNB 2A9NH 2DIBA 4PJ7F 1BP3B 1TPXB 2PR4L 4UUJA 1CF8H 4XH2B 5IB5A 1A6WH 5BXFA 3W9EA 4Y2DC 5DUMH 1BZ7B 1HK6A 3BZFB 5KSAC 4GLRH 1GGYA 4RMWA 1MI5D 1I1CA 4XTRD 5C92A 4H20L 2OSLA 1FFRA 3K80A 5B38G 3O2VL 3QDGD 4MMXC 2OJZH 3HB3D 1E4XH 4YQXH 2ZOKA 5C6TH 3GKWH 1DL7L 2NTSP 4KJYA 3L3JB 4QXTA 2FEEL 2WMPA 4Q74A 2R56L 3ROLB 3KLAB 1R3JB 2DI7A 4HBQA 4X6DB 4IRJA 3ALXA 4HKXB 5D72L 4G6MH 2DJSA 3C09C 3FL7A 3HI5L 4Y5VB 3GUTA 1F4HA 4MNGE 4YDVA 1IC4H 5L2KB 3NIGE 3SE4C 4O2FA 5T3ZL 3CFKA 3P0YH 1I4FB 5KANI 3FN9A 4RFNC 4O5LH 1QKZH 1VEMA 2Y7QB 3CLFH 4OI7A 4LSUH 4LQ1A 1FP5A 1G9MC 1V05A 1V3MA 4LLUB 4L4VD 2EDXA 5I9QB 1QSVA 4D0BB 5E2UH 5BRZE 4NJ9L 4ZMAT 4PJBB 4D3CH 3RVTD 1QR1B 5GRJL 1PQZB 1ZA3B 1LP9E 3MV8D 1A3RH 4Y88A 1ZTXL 3L5HA 4S1QL 4KK5C 3EYFB 1QRND 2CRZA 3V6OE 5JW5A 3HHRB 4RGMC 5T3ZE 1T03L 4Y5XB 4OFDA 1HSBA 1EAJA 3WUWA 1JGDA 1FORL 5H94A 4LU5L 2LU3A 3GJFA 3MCKB 1G7QB 4JKPH 1F6FB 5AUMA 5AYUH 4ELMB 4P0DA 3GMRA 3BKCL 4YEFA 2R2EB 5MEQB 1GCFA 4GW1B 1NKRA 4LLQA 5GJTL 1OGAE 4NC1C 5I73B 3QWOB 5F7FA 5BV7H 3QUZB 1JPST 4NUJB 1U3JA 2NY4B 3DMMC 1GGTA 1AIFB 4S0SD 5JW4M 1YNTA 1KFAL 5C0FA 1E27B 2DICA 5FO9B 5AD0A 1NCCL 2XKUA 2ZCKL 1MJJA 3T08A 1ZT4B 5HYJA 2A6IB 2XY2A 4RFEB 1CR9H 1MHCB 3WJJC 2YMXL 3ZE2F 2LU7A 2AGJH 2VXVL 2YKLL 4KKCD 3RL1B 1U42A 3BGAA 5E2WH 4CNIB 1KENL 2FIKA 1NMBH 2YEZB 4PY8I 3MLTB 4JFZL 4UOJA 5HDQL 2NY2C 2XY1A 5DVKA 2XICA 5JHLL 4BSJA 4U6VL 5DGRA 4JRWA 1MFBL 5FYJL 2Q8AL 2FX9L 3HLAA 5K59E 2RQ8A 5LXGH 3MA7B 4ONHB 3THML 1Q9KB 1BHGA 3P0GB 5ALCH 4YJZL 4PJXE 1CD9B 3V7AE 4FQPA 1NSNH 4L3EA 4RQQA 2AK4D 4XRCB 4JFEB 4NQCA 4JG1H 3J8F7 3OGOE 2HRLA 4HIEA 4KV5E 1RK1B 4UTBL 3SDAC 2EDFA 2VRAA 2JIXB 3MBEC 5JW4N 3S35H 3QEGL 4YBLC 1FC2D 5FYJE 3RUGB 2OI9C 3VFTB 2VDPL 5I1DB 2I07A 5L0QC 2GCYB 2IMMA 2P45B 1KC5H 3GI8L 4K71B 2W0LA 3HC3H 4F7PB 3QHFL 2WBJD 2NY1C 5E8DH 1QLFA 4JM2D 4GXUM 4S1DC 1INQB 3DWTA 3DVNA 2NY3D 1YN7A 2CXKA 1T1YB 3S88H 1NGXB 2MWCA 4NCDA 1D5IH 3VGAC 3QPXH 1DVFC 4M8QA 3FN3A 3ARBC 5DD0H 1AHWB 3G6AA 3MZGB 4K7PY 3MA9H 1PKQE 1C5CL 2PUQT 3HE7C 3RWFB 4JREC 3QZWG 5FGRA 1RUKH 2A9MH 4HXAH 4PRHE 5D2NA 2XQYG 4LHUB 1T83C 4F57H 3GB7B 2XZQH 2ERJB 3D0VA 4OKVA 4CU8A 2AXGA 3RVVD 4NN5B 3VFGL 3GSVA 3TIDA 4L4TA 5CLTA 2K7PA 5CSBA 3B9KC 3QUMA 5DMGC 1BIIB 1TCRA 1JV5B 4G9FB 5DMYA 4JB9L 1JZ3A 1WZ1H 4ZTOL 1INDH 4GRWB 1Z3GH 2XTJE 5I16A 2DKSA 5KTEH 4OB5H 4K23H 1E4JA 2EYTB 2NTFB 3MROB 3VXMA 1MAML 2P5WE 2CMRH 3RI5K 2EDDA 4HWEH 35C8L 3A0OA 5D1QA 3S36L 2N7BA 4JHZA 3FRPG 1P4LA 5J1AA 3OKNB 5SWQA 5MERA 4GXUN 4OCSH 1BF2A 4LEXH 4P2QA 5L2KD 4ZUTA 4FP8L 4Y89A 1OP3H 2DJ4A 1BX2A 1MJ7L 3V52H 1HZHL 4K8RH 5DJ6A 3S7GA 3OR6B 3UO1L 1U92B 2Y25A 3I6GA 3LQAH 1T3FA 4RGNE 5T1MA 3TJEH 1E28A 2FBJH 4N5ED 1BQHG 1H5BB 2FJGA 2NX5B 3MCG1 2CIIB 1PYWA