1B3IA

Nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (minimized average structure)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
ASVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PLASTOCYANIN)
publication title NMR solution structure of plastocyanin from the photosynthetic prokaryote, Prochlorothrix hollandica.
pubmed doi rcsb
source organism Prochlorothrix hollandica
molecule tags Electron transport
total genus 12
structure length 97
sequence length 97
ec nomenclature ec 1.10.99.1: Transferred entry: 7.1.1.6.
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1b3iA00
1XMEB 1SF3A 4F2FA 1OF0A 1PZAA 2XU9A 2GI0A 3IN0A 4E9VA 4NERA 2IAAC 1MDAA 3NJGA 1BYPA 5B1KA 3V9CA 2XXFA 1EZLA 2IWFA 3UAEA 3QJTB 1SDDA 5B1JC 3CZUB 1IUZA 1F56A 2PPDA 3ASOB 1NWOA 3ABLB 2OV0A 2BWIA 3FU9A 3N55A 3OMNB 1E5YA 1A4CA 5PCYA 3S3BB 3T6ZA 1PAZA 4KO6A 4G7QB 5F7BA 2E86A 4DP8X 1PZCA 2PPEA 1I53A 3ZIYA 1NIEA 4A2EA 2UXGA 3IBOA 1ZDSA 3S3CB 1JERA 1L9OA 2FQFA 1X9RA 1A4AA 2WO2B 3WG7B 1NIFA 1JZGA 1SHXA 2PLTA 3MBWB 4Q8BA 4UF7C 4YSTA 5E9NA 2ZOOA 1SNRA 5B1BB 3G5WA 3PCYA 1AIZA 2UX7A 4QKTA 2XV2A 2DYSB 3WKPA 4YL4A 5D4JA 4L0PB 4G7RB 4HZ1A 2BP8A 1IKOP 3PLYA 2HX7A 3UABA 2R7EB 2IH9A 3QJVB 2H3XC 1GS7A 1GY2A 1NPNA 4G71B 4BWUA 4G7SB 3FSWA 1ADWA 4BK5C 6PAZA 3DKHA 1KBWA 4YSDA 3CDZA 1T5KA 2IDTA 3NJLA 1CUOA 1NTDA 2JKWA 1TEGA 2IDFA 2Q9OA 1AS8A 4BWWA 1XB8A 1B3IA 3EH5B 2DYRB 3N2JA 1TU2A 3FQ1A 3NJMA 3SBQA 4A68A 1ET5A 4DP7X 2NRDA 4A2FA 2BW5A 4P5SA 3AG2B 2ZXWB 4YVNA 3WIAA 3FQ2A 3FS9A 3IEAA 1PF3A 3L45A 2ZONA 1OCRB 3S8FB 4CSPA 1UATA 4A2DA 2YQBA 4AI7A 5FC9A 3DIVA 2BP0A 3NJKA 1YLBB 1CYWA 2W88A 4P5RA 2FQGA 1AANA 3ABGA 3GDCA 2CJ3A 2IDUA 1KGYE 1JVLA 1L9QA 4KNUA 5B1AB 2UXTA 2I85A 1BQKA 2EIMB 1AS7A 2CALA 5AFAA 2EIJB 9PCYA 3OMIB 3QQXA 1BQ5A 3T6VA 4FA7B 4KOBA 1ZPUA 2Q5BA 3EF4A 3GYRA 4E9SA 8PAZA 1FFTB 1PY0A 3FU8A 2OCCB 3NJNA 4YSAA 2YXWA 2RACA 1J5DA 3FU7A 1TKWA 1IBZA 3S3DB 4E9WA 1V54B 2QPEB 1AOZA 2BZ7A 2P80D 2PP9A 3WNJA 1ASOA 1E65A 4F2EA 1RKRA 3IN2A 1HFUA 4WKXA 1J9TA 1PNDA 2YARA 2IDQA 1ASQA 2JXMA 4G72B 3WI9A 1X9UA 4BWTA 1TEFA 2YAMA 4TXVB 3AZUA 1XB3A 4N4YB 2BO0A 1CURA 1L9SA 2FJSA 2XLLA 3NP3A 1OOWA 4Q89A 2AFNA 1ET8A 4HAKA 4F7KA 5I6OA 2XV0A 4PCYA 3NSCA 2FQDA 4YSRA 1NPJA 1WA1X 2A3TA 4YSOA 4GP4B 1QLEB 2X88A 2GHZA 3TBCA 4HCFA 1A4BA 1L9TA 1NIBA 2GSMB 4DP4X 4DP9X 1KDIA 2J5WA 3NJFA 1JXFA 5D4IA 4E9XA 1GS8A 1AZBA 1MZZA 4PAZA 3FSZA 4E9RA 2TSAA 1QHQA 2VSMB 4E9QA 1CYXA 1R1CA 1V10A 2VW7A 1SFHA 2HRGA 1A8ZA 2YAHA 4AKPA 4ZK8A 2XX1A 3FT0A 5AZUA 2HRHA 2J56A 2BP8B 2XYBA 4HALA 3NP4A 1RCYA 1W8EA 5IY5B 2Y69B 3FSVA 3JTBA 1FWXA 3NSYA 2FT6A 5TK2A 4BXVA 4JKNA 2VM4A 2P80A 3PXLA 1GYCA 3BQVA 3BVDB 2QDVA 3CVCA 3GXUB 3V9EA 4DP2X 1WS7A 2YAEA 2LLNA 1WA2X 4HHGA 1OCCB 3CVDA 1XB6A 1BXVA 2QPDB 5I6PA 3CVBA 3QJRB 1KBVA 3SQRA 4KOCA 1DYZA 1W6LA 2H5UA 2YAPA 3H56A 1SFDA 1V55B 1PCSA 2GC4C 1OE3A 4DP5X 3TA4D 1KDJA 3EH4B 2AZAA 5B3SB 5I5IA 1RZQA 2AZUA 1A65A 2Y1AA 3D12B 1BQRA 4GXFA 5B7FA 5I6MA 3NJJA 1KYAA 1URIA 2GB2A 2UXVA 3HEIB 3UGEA 2IH8A 4A66A 4N8UA 3KW7A 4K9JA 3NT0A 2FT8A 1PLAA 1EHKB 1ZIAA 3HB3B 2UXFA 4EF3A 3T6WA 1OCOB 4CSZA 3FYIB 2FNWA 4X4KA 5EHFA 1SJMA 3OQRA 4YSCA 1PNCA 1BXAA 4DPBX 4ENZA 5I28A 4DPAX 2BP0B 4GP5B 3ZX1A 1CC3A 1IBYA 1ZV2A 1HAWA 2H47C 3PAUA 2HLEB 2CUAA 2GBAA 3PAZA 2EIKB 5I6KA 2YAOA 4HCIA 2GC7C 3SBRA 2MRYA 4W1TA 1AZUA 3T71A 1BXUA 1ILUA 2EILB 2VMJA 1JZFA 3WKQA 5I5JA 3ZDWA 4BDVA 3ZBMA 2IDSA 1OE2A 3X1GA 4JHVA 3NYKA 4W9ZA 3AW5A 5LDUA 1E67A 2AVFA 3WNIA 1AQ8A 2BW4A 2PCFA 1WS8A 2QDWA 4AKOA 3X1EA 2X87A 2JFCA 3PPSA 3NJHA 3T9WA 2N0MA 4AX3A 1A3ZA 3UADA 7PCYA 1KCBA 3C75A 2VM3A 1AZCA 1NIDA 2YAQA 1J5CA 1MG3C 1NINA 3EHBB 2HZHA 3FPXA 1MG2C 2TSBA 2CAKA 2PCYA 1JVOA 4NAJA 2FT7A 1SDDB 2ZWNA 4E9YA 3H4FA 2HX8A 4FAAB 2XVBA 3NJIA 1E5ZA 5A7EA 2BZCA 2BWDA 1N68A 3OM3B 2BHFA 3PAVA 4M4RB 4MFHA 6PCYA 4DP1X 3KW8A 1L9PA 3UAAA 3AY2A 4KNSA 4A67A 1KV7A 1ETJA 3ABKB 1KCWA 1ILSA 1AR1B 3ABMB 4KO5A 3NSFA 1DZ0A 3AG1B 1ET7A 5AKRA 1PMYA 1OE1A 3JT2A 3FYEB 1ZDQA 2OJ1A 4HIPA 3TU6A 2YAFA 1JZIA 4UANA 1JOIA 3DTUB 4A2HA 1M57B 1QNIA 2EINB 3TASA 1GSKA 1GS6X 1PZBA 3EH3B 4AKQA 2R7EA 4JHUA 1NWPA 4YSPA 3IE9A 1L9RA 2I7OA 3QJUB 4GP8B 2VW6A 1VLXA 1AZNA 4UAHA 3QJSB 1IC0A 2GIMA 1ASPA 1N70A 3RYMA 3X1NA 1AAJA 3OMAB 3QJQB 1SHWA 3CDZB 1J9QA 5I6LA 5B7MA 4M3HA 1J9RA 4GYBA 2DWSA 5I26A 1OCZB 5B1JA 1BAWA 2PPAA 4NB7A 3TBBA 2QT6A 2XX0A 1HAUA 2B3IA 3AG3B 1PLCA 2FQEA 2J57A 2PPFA 2PP8A 1M9WA 3UACA 2WO3B 2FTAA 5D4HA 4G70B 5ANHA 2XUWA 2DV6A 1GR7A 1W6WA 2IWEA 4QLWA 1M56B 3H4HA 1AS6A 3T6XA 1NIAA 1WA0X 2XWZA 3OD3A 2CBPA 2PPCA 4YVUA 1WAEA 4DP0X 2FWLB 4DPCX 4WTQA 2B08A 3X1FA 4E9TA 1NDTA 3ERXA 5I5MA 3U25A 3QPKA 3FPYA 3MX0B 1SF5A 1FA4A 7PAZA 1AZRA 3NSDA 4YSEA 1BEXA 2PP7A 3ASNB 1JZJA 4HCGA 4YSQA 1MZYA 1E30A 1GY1A 2VW4A 1JXDA 2IWKA 5F7AA 2HXAA 4KO9A 1JZEA 3FSAA 5I6NA 1AACA 2I7SA 1ID2A 5B7EA 2CCWA 4KNTA 3CG8A 1JXGA 2DY2A 2XV3A 4A2GA 1BYOA 3S8GB 4HHWA 1AG0A 2XXGA 3X1BA 4BXSV 1RZPA 1JZHA 4YSSA 4AZUA 1NICA 2AANA 2DWTA 3X2QB 2UX6A 4RH4A 1AG6A 2MTAA 2WSDA 4KO7A 2W8CA 2YXVA 3AG4B 3SBPA 3FU7B 2HX9A 4BDVB 1NZRA 5PAZA 4DP6X 4YSUA 1GW0A 2J55A 1OV8A 1PLBA 3FQYA 1ZIBA 2VN3A 4GY4A 5TK4A 1J9SA 2VSKB
chains in the Genus database with same CATH superfamily
1C8PA 5F7MC 5KSBF 5JHAA 1OF0A 2DQHL 4PRNB 5BZXA 4WEBH 1BEYH 3ARFB 4UQ9A 3TCXA 4OI8A 5DZOA 4NERA 2G60L 1BAFL 2DM2A 2VISB 4BRVA 3BUBA 4LEXL 3A6BL 3LH8A 3BIAX 4B96A 5I23A 4UM9A 1G9NC 3NCXA 3DSFL 1FP5A 1UWEH 4AVIA 3RL2B 4B60A 3LKRB 1I75A 1E9OA 3FO2B 2WBJA 3QCUH 2B20A 3S3BB 3DX7A 5DZLA 3QFGA 1LDSA 1BWMA 2Z35A 3IWUA 4P3CL 4JR9H 3UTQB 1NKGA 2MKLC 2YC1B 1N5AB 1JERA 2X89A 2WO2B 1UFUA 3HAEB 1PZ5A 2XJKA 1PGRB 2PLTA 4OZIF 4Y4HD 3HBGA 2JMRA 5DMJB 2Z0UA 3G9AB 4HIXH 3ARBC 5B1BB 4OGAC 2OXGA 4P2OA 1XAKA 3PGCB 4Q9QL 2YSSA 1TFHA 4IBLT 4MMXC 5I6XB 4LVOB 2BP8A 1WPCA 4MJIE 4O2EA 5JZ7D 1DCEA 2EEBA 3LIUA 3FCTA 1YJDH 4C56A 2A9NL 5IHBA 4L29B 4OGQC 1IU1A 4YSDA 4MRBA 1T04B 3QIUA 4PH8A 1CL7L 2XXCB 3SOBL 3HNSH 3EUUA 5ITBH 1CUOA 1UJ3B 4AEEA 3CVIL 1KJMB 4PW3A 4PFEA 2HCZX 3WAJA 1Z7JA 1G6VK 3EH5B 2CIKA 3F7KA 4BRJA 1TU2A 4XP6H 3NFSH 1VADA 1UFGA 5IESH 1S9KC 4FNQA 1CLZL 3IAQA 5ID1B 4B9JA 4I0CC 4ODXA 2XETA 4X42A 3S96A 4L1SA 2KT6A 2Q3XA 5DJZA 5E2TL 2OMYB 4ZYKB 3UAFA 2CO7B 2G2RB 3PDOB 4MAYA 3WTXA 4I18A 4WI3A 4DVBA 4QRRB 1CBJA 4Z3TA 2CDEA 4P2CG 3ZN6A 1NCDH 5AL8A 2OSLA 2H41A 1KMGA 2Z31D 1T0PB 1NCWL 2X3AA 1RZGB 5E9DD 4Q9RH 3HC0B 4HIHB 4FGMA 3SKOB 4EXKA 3HG1E 3IJHA 4HUWB 5SX5K 5AVWB 3RNKA 4Y4HA 2ED6A 3MRGB 1I1AA 1BZ9B 2E59A 5DI8A 1U8QA 5FHBL 3PWPE 3OZKA 1OSPH 5A16A 1RIHL 3MLUH 3U0WH 5DEGB 1CR9L 2EIMB 2CHXA 2EDBA 1G7QA 3T0ED 1IBGH 3BHBA 4RDQF 1M2VA 4DIXA 2NX5B 4I0PD 1OTTC 1T5WB 1XX9C 2VXSH 1M7IB 2YKKA 2APTA 1FJ1A 3KPNA 3LNHA 4LP8A 4CNIB 1J8HB 1EXUA 1QPKA 4LSSH 4Q14A 3U36A 1A7PL 5LWYL 1J5DA 2HT4D 1DVFB 2LLLA 3MMEB 4ZZFA 5IHWA 3L95A 1QBMH 2A74A 3D3VD 3JYCA 4HZAA 4B9PA 4KITB 4F2EA 3AM8C 3KGRA 1TJHH 2H0JA 3X13A 2G5BA 4I85A 2YQ2A 4N5UA 5E1AB 5I8CA 1WWCA 2XIIA 1I3RB 1IGTB 1MQKL 1U8PA 3KLHC 2P44B 5F3BB 2F53E 4FQXC 1JTTA 4CJ1A 2Y22A 5EH1A 5H4YA 4LL4A 3LKOB 1MXGA 2UZPA 3QQ9D 3OKEB 1C5DA 2CO4A 2OR8A 3AAZB 4DK3A 5IG7A 1A7OH 3Q6FA 2OR9L 1DQVA 2VDOH 1KCUL 2Z31A 4GG8B 4X4YA 1EDYA 2Z8VC 3HNTL 5EO9A 5GGRB 3QHZL 3O6MH 5E9DA 4XN2A 2DLEA 4Q89A 2GSGA 3RUGB 4U1LA 4QYOA 5F7LB 2V2TA 4MXVF 3O6FB 3NJVA 3MLWL 1OGTA 2W0FB 3OJDB 2IIJA 4N9GB 2R0WH 3R4RA 1N2RA 2BVQB 2PNDA 3WFZA 5EEXA 3G5YA 4B9CA 5DUPL 4QPEA 2WXNA 4Z7NF 1BECA 1CICC 3I9IA 3IVKA 1ADQL 4OR1A 4BSWA 1AHWB 2P1YA 5MERB 5IBUG 5ID0B 2UY6B 5F7WC 4F80A 1BG1A 4PAZA 4G7VL 3T0EA 4JM0A 4NLAA 4K7PX 1PQZB 1CG9B 2OP4H 4I0PA 4FLHA 3EYFB 4QXTB 1JPFB 1K5NA 2AQTA 1EZSA 5ECGA 3ZW3A 1KYOJ 4KZCA 4LCWD 2EEDA 3FT0A 3L2MA 1KJ2H 2HRHA 4LF3A 1KC5H 1KJ2A 3KMDA 2A1WL 1BIHA 3OKDB 3NCJH 4JJHA 4LLQB 4ZS6D 2X4PA 3B5GA 2XQYK 3C5SB 3P4NB 5K1VA 4Y2DD 5BS0A 4XPAL 2L0DA 3SKJL 3NZHL 5FEBA 3V9EA 2HSIA 3ZHFA 4YO0A 4O02H 1A6UH 3D18B 2OX5B 3HN3A 4L3CB 3VMOA 3MRDB 3H2WA 3NGBC 4O2FA 2IMNA 4PM1A 3TJHC 1AIFA 3MVSA 3ARFD 3ZYIA 2I60H 3RWGB 4YQXL 5EOCH 5HJGA 2YUXA 4HD5A 1CD1B 4L4VB 4PD4K 4LOEA 2GK0B 4KOCA 1CDHA 3SGKC 1JGLL 1PCSA 2EXYC 1YC7A 2MPAH 5EIIA 3CFCH 4PJAA 4PRHE 1ZHBA 4IIQB 5INDA 2E7HA 2WVVB 4MQSB 2GSIA 5AAMA 3STLA 3KAAA 1QWUA 3RFZA 2HJLA 1QKZH 4IMLB 5EF0A 3OPUA 4HWNA 5DVNA 3V0VA 1I7UA 1CGXA 5DDHB 3VXTB 5SV4A 5H4ZA 1LL1A 5IOPB 3HCVA 3BDXA 1EVTC 2CHWA 1H3GA 4U7KA 2Z92B 3H9SE 4XAWL 1HQ4A 4A55A 4MD4A 3QFJE 5TFSH 2FUQA 1OO2A 1UVQB 1Z5LB 1HCFX 2EDDA 3IKKA 3HZYB 1H8NA 3VFWA 1J8RA 4F7EA 1RZKH 3DWTA 4M8QA 2PO6C 5HVFB 4E42B 3EF7A 4QCIB 3SDDB 2XTSA 1TCMA 1A2YA 1Z9OA 3G08A 4FFTA 2OW6A 2D9QB 1SN2A 3W56A 1CXKA 1H6TA 3SQOL 2FHFA 4EUPH 5B39B 1RIVL 1T5XA 4WTXA 4EUPA 4XNDA 1OE2A 3MODH 3FUIA 4Y2DA 6FABL 3RA7L 2WW8A 4YFLF 5KVGL 1AQ8A 4W4OC 1NMAL 4APQB 4NENB 1JV5A 2GTZB 4CADB 2WNXA 2C9VA 5CBAA 2JFCA 4GMSL 3PPSA 4EZJA 3N40F 2A9BA 1TQTA 4KFMA 3G6JE 3SB3A 3IK2A 3SY6A 4B7LA 2NY5H 2X4SB 4NZFA 4Y19B 3QO1A 1MG3C 3KD4A 4HIIB 1SBSH 4KXZI 3BSZH 3RWDA 5K59F 3BSZA 4HXBH 5EBMA 1TNMA 2OBGA 3NBNA 1WD9A 2FO8A 4LSQL 2QTVA 2CO2A 3PL6B 1WT5A 1JD9A 4XAKD 4AENB 3X11B 3ZDYF 5JHDA 2W9EL 3R0NA 4QRRD 3ZL4L 3S2CA 3P4MB 2Z93A 4XT1C 4IM8A 2A9MH 1J10A 3HZKA 4WRLA 1AJ7H 1G7IB 4MNQB 6PCYA 1D5BA 4OZGE 3U0TB 3ZUNC 4O5LL 1L9PA 4I77H 4PWGA 2IFFL 1O7DC 3O2VH 3UTQA 4N0FB 2YC1A 3HZ3A 1N5AA 3H9HA 3W2DL 3A22A 1A5FH 3DSNB 1DBML 1WE5A 2F7OA 3ECQA 1BX2A 3MV7D 1RK1B 3MTRA 2VLJB 5DJDB 3VXMD 2Q6WA 1U93B 4UANA 5DZVA 2DLHA 1Q4NX 1P2CA 3GKWH 3MSPA 4YXLH 3TO2A 3LNIA 3F84A 3S37X 3WFCL 1ONQB 1Q8MA 3Q2VA 4RFOH 5K93A 1QZNA 1SEBA 2NX5D 4HOXA 5SX4I 2XKNB 3BGMA 1SGKA 2OTUB 3ATEA 2QGDA 5AOZA 1H6EA 1H8SA 5I1JL 3EO0B 2X53A 3ZE2F 3ZGIA 3G5VA 1YPZA 2WGXA 2WLJA 3QJQB 2K9FB 5CLWA 2WB1A 3EYQC 1GKOA 5IBTH 5I0DA 1J8HD 3BH8A 2IH3B 3QNZB 2E3VA 4MA7H 4FQIL 4N0YL 5EULV 5E6YA 1DVFD 3RBSA 4BZ1H 2X6VA 4BZ1A 1QR4A 3CDYA 3KDPB 1Q1PA 4P9HL 2QT6A 2DKMA 4ZUUA 3MRCB 3OF6D 2E8ZA 2MCPL 1JGUH 3B1TA 1HNFA 5C9KA 3G6AB 3AREA 5HJDA 1DE4B 3QR1A 2ARWA 1F4YL 4ZQKB 2G2RA 2EKSB 2P5WB 5HYJB 4N2FA 4F57H 2BDNL 1M56B 3DHUA 4XE0A 4QRRA 2FR4A 1T0MA 1HIML 2WWOA 4PB9H 4ZJ9A 4I3RL 1PX3A 3ESOA 3BUYA 1TITA 5E6UB 3RY5A 4PJCA 3KWXA 3CVHH 2FLRT 3VXSB 4D94A 3CVHA 1ZT1A 2OSXA 4DK5A 5I18L 4R5XA 4FADA 3GHBH 5HGBA 3CCHA 2NCMA 2SODB 1FO0H 4K7FA 1XF2B 3MV7A 1FO0A 4YDKL 5CS7A 5C71A 4NWUL 3PPEA 5JW3H 1NJ9A 3MRGA 4N2KA 2VW4A 4QTFA 1RZJH 5JYLA 4J5VA 1KULA 3MI6A 3VXMA 1G0YR 4LXFA 4KO9A 5HY9B 3HRZB 2B0SL 4NKOA 4ZPVB 5DEGA 1HXMA 5DUBB 3HAEG 1GTFA 4IDJL 4FYQA 3WIHH 2W91A 4FZ8L 4OGYL 3FFCE 2HRPH 2YMXH 4WO4C 1H19A 3RVVC 3II2A 1XF5A 3GRBA 4UOQA 4IS6B 1INEH 3ELAT 1Q72L 2C9RA 1PDKA 3FK3A 4R5VA 3V5DB 1HWGB 3JWDL 5J6HA 3WJLC 3KPMA 3RWIA 1DVFA 3LN9A 5TE4L 3B2MA 4PJHB 3S34H 1CGWA 4YGVA 2QHLA 3GXNA 5E8DL 2GUOB 5FM5M 1B4LA 4FFWC 4U1NB 3GI9L 2IAMB 4WEMB 4CC4A 3FUJA 5HSFA 2YPKA 4HFWA 5E1AA 4IU2A 1NGWA 2JNZA 4YJZL 5F6IC 5C3LD 1UASA 5FHAL 2FBJL 2CLRA 15C8H 1KENH 1WEJH 1WIUA 3VACA 3CD4A 1FNSL 3OKEA 4HJGB 2QELA 4UOJA 3WFEH 1I85C 1P7HL 4GG8A 1BGXH 2ZCLL 3T4AB 1PD6A 5FF6B 4ZFFA 4XWGL 4FD0A 5IHHA 2AXFA 2BRRL 5C6TL 4JHAL 3KPRB 3T2NH 3CZUB 3FO0L 3G5XB 4TVPL 2KL6A 1GC1L 1J05A 4YK4C 4OCWH 1DQDL 2W0FA 1CGVA 4L8DB 5AVTB 1E5YA 4N3UA 5TPWL 1EHLL 1COBA 1F11A 2JELH 3CHRA 4DP8X 1CS6A 4ZUWB 3ISRA 4MA3B 4D3CH 1WC7B 3T09A 4IMKC 4JFHD 4X5XA 2H4EA 5F7NC 2XZCL 2BLFA 3BKML 3D85B 1OAYL 5FIEA 3QZPA 5DJ2A 4QGTA 5DJXB 3GSVB 4EI0A 3VX1A 1VGEL 2XZAH 1SNRA 5D7LB 1T7VA 3U83A 1QFWH 1QFOA 3GBMH 4XVOA 3VWJB 5I1HH 3NEOA 2VDQB 1AKPA 3CE1A 2DYSB 3RWFA 4JW3A 4F7TA 5EU7C 4G7RB 4S11A 2JK5A 2YOCA 5J3HD 2DQFA 4RGMC 3CNKA 3PQYB 3QEHA 3UABA 1JPSL 4PB0L 1T22B 5L9DH 1GS7A 3EJUA 5D72L 1M1XB 4U3SA 4QHMB 5E7BA 2FO1A 3PHAA 1GY2A 3T3PB 4QRPB 3W1ZA 1MPAH 2X6CA 5E56A 5DK0B 3FSWA 4BK5C 1AZZC 4GW5A 4RMBA 1S3RA 1KY6A 4APQD 4PVNA 1EAPB 2PXYC 1E27A 1J86A 2OX5A 4I48A 1UB5B 3V0EA 3UAJD 3GMNA 4XNBA 1F5WA 1B3IA 4UZSA 4E0RB 4OFQA 3ZRFC 2H2SC 4B53A 1CD1A 2CD0A 2ISDA 5LXGL 4MGXA 4PYGA 4GUPB 4ZXBA 2FLBT 1NFAA 1QW9A 2YGOA 5D1XD 4KJWC 1P4LA 1FGNL 3KPPB 5AYUH 1TTFA 1JD7A 5H8DA 3WHXB 4AM0B 3GBDA 1F0LA 2Z4QA 4HUVB 4MDIB 3PL6D 1ROWA 1A4JA 1RUPH 3K4ZA 3WO3B 3ZIMA 3ZRCC 1AGFB 2JB5L 3S8FB 4LMQI 4H44C 3VXTA 3STZA 1JI2A 1JZ5A 4F2MB 4S2SB 4MNQD 1C7TA 1F4HA 1TENA 1ZPLA 3ARBB 5G5DB 4FMKA 4AEIH 1M7XA 2FB4L 5FYKD 4NGHH 4X6CF 1KGWA 2BMKA 3AQZA 4KDTA 3ULUF 5ISZB 2HG0A 4N2NA 3VX0A 4QTIL 3DV6B 4F15B 1ERNA 1UVQA 1WWAX 5JOFA 4HCRL 3LEXA 3WIFA 1G9ML 2CR3A 5EZIL 4ZW5A 1YCSA 1QA9B 2B2XH 2PR4H 5CZRA 2VLJD 1L9QA 4G6KH 1S9XB 2VSCA 3B7TA 5IB2A 2ZSVB 2NW2A 2X9XA 5DQ9B 2ADIB 1ETB1 3T3MF 4M4PA 4TUJA 1LVEA 4Z8FH 1LDPH 4WEEA 3L5IA 1J1PL 1F1GA 3BJLA 3T2LA 2V7NB 4HXAH 2F0CA 4R7DB 1AGDA 4TOYL 3PG2A 4Z3EA 5I19L 5T1MA 1CFBA 8PAZA 4F1ZA 3JTTA 1DDHB 3QI9D 2OCCB 3N1PC 3UAJA 3CFBA 1NFKA 2GPZA 4NFBA 4W9CC 3K8KA 4JO3L 4LAQH 1NL0H 2FLMA 3B8YA 1I9IH 4L8CB 1NC2D 1EZVX 1ETZA 3AQDA 4LDOB 4PJ5E 5CJQH 1R5WA 1E4XI 3QORC 3M7OA 3WNJA 2B4CH 4KKZA 1KJVB 1PTZA 3ESMA 5D1XA 4MXQD 2Z6FA 3LAFA 2NW3A 3ARGA 1OARL 1KXVC 2W0PA 2NNCA 3V4PB 1MIEH 1ZLUH 3NCEB 4LSVH 4XB7A 2P5WD 3MCG1 2IALB 3VXUE 2YAMA 1IILE 3S36L 3AZUA 1Q9KB 1I4FB 2Y1YA 4Z7UE 5HHNA 2J1KA 2DDQL 4KI1A 4WHCA 4RBPH 3TBYB 5J6SA 3DXAD 3ZZSA 2EDJA 2WXHA 2HLAA 4R96A 5GGRY 5KJ7E 8FABA 1KEML 1XVSA 2QZ5A 4M6NH 1KIPB 2NZ1A 3EDJA 1EAJA 4KBPA 3VD1A 4NQQA 5LBSA 1ED3A 3UTSA 3WO4C 4H88L 1YMHB 1QTSA 3FAXA 4XBPA 2HVBA 3SE8L 2ED8A 3WN5B 2YWYA 4TSAL 5D71H 5FKAA 5TDPA 3U7WL 1QLEH 1EGJH 1FZKB 4N0CC 3MBWA 1EGJA 4NPYB 1AD9B 4POUB 4ALAH 2VDKB 4JRLA 4O4YH 2XZZA 1SFHA 5HI4D 1U8LB 1RI8A 3KG5A 4K3DL 3IFLH 5FGCE 1CFQB 3ZKMC 4U6YB 4QXUH 4GH7B 2OTUA 2ZXEB 4AKPA 1Z9NA 3X3GH 1EBAA 3EJYD 1CFMA 3QI9A 2JQZA 2BFVL 3JUYA 2Y5TB 2W60A 3BH4A 1MCWM 1TF4A 3HUJF 3MNDA 3WNMA 5L0QB 4GJTB 4F7CB 1QLFA 4PJEE 2LGNA 1PS3A 3CZJA 5BJTB 3ULVE 3FOLA 1PLGH 3LIZA 1LO3L 1OD7A 3R06B 4JZOB 2FT6A 5B39G 1XGPA 5IV2B 3QXDA 2F19L 1NC2A 2GJ6D 4F9PC 4FQXB 1DJGA 1FVCB 3L9RB 3AABA 3NVQA 4XPHL 5TTRA 3MRCA 2FD6H 4U05A 4M61A 3GXUB 4KHXH 1WS7A 5IREA 1U36A 3GZOA 1TT6A 2LFEA 3FT9A 4U1GB 1YQ2A 2APXA 4OAWA 1WA2X 2DBLH 4L4VE 1UH4A 2FH6A 3UXFA 4JDEA 2QADD 3FFDA 3QJRB 1QO3A 2IOIA 3SQRA 1JWUA 3EO1B 1MHHA 2QKIC 1ECZA 1W6LA 3L54A 3DXAA 2H32A 4J3OF 3IU4L 4G8GD 1EEQA 3OR7B 3FN0L 3TEUA 3QJFB 4Z7IA 1T1ZB 1TEYA 3A6CL 3KPRD 1Y1DA 4A7GA 1RZQA 3O2WH 2Z0BA 5D2LA 3QS2A 3JV6A 1MJJB 2CM5A 4P23D 3BEVB 3N1MC 3F04A 5C0BA 4GS7C 2V9QA 3U6XA 2NSQA 3N43B 1C9SA 1SJMA 1S5IL 1MFAH 2V9TA 2WPGA 2Y9RT 3P9WB 1TUPA 1HHGB 5BW7C 4NQDB 3QG6B 1OAXL 3GB7A 4GI9A 4L8SB 1J1XH 1NC4A 4I0KA 1L9NA 5FA4A 2E56A 2XBDA 3B9DA 4HJEA 1TCRA 4IS6A 3VWJD 4MWFB 1KOAA 2FBOJ 2ESVB 4TNVK 5DD5H 3BVNB 3R1GL 4HGWA 3PUCA 4LCVA 5D93C 1R0AL 2IPTH 2GJ6A 3C5ZC 5FYLH 5C0JA 2ICEA 4BHUI 2A5UA 3KWWB 3VXRA 3L3HA 4J3XA 2CA3A 1XF3A 4TLUA 5EOCJ 5B8CC 4Y19E 5EUKA 2DQDL 5LNGA 4I3SH 1QVOA 4HEME 3EO9H 3QZWA 5CR1A 2EABA 4DKFL 3D06A 1NINA 1HN1A 2C4XA 4HJJH 2XHNA 2YGQA 4G8GA 5EA0L 3FT4A 5DUMH 3EDFA 1HU8A 2Z91B 2TSBA 3ULSB 5CN3A 2HWZL 4QHNB 3RX5A 1D7BA 4Q0XH 2FYVA 2K3TA 1EJOH 3VRLF 3H3KA 3LQAL 4P23A 2YMTA 3N0AA 5E5LA 1EHXA 3FQWA 1J1OL 2PWFA 2WTRB 4DZ8B 2O5YL 3BAJA 3ZE0B 2QKSA 4PJGB 3D69A 3NABH 2UZXA 5BRQA 1SLWA 2GBVA 1P7QB 4WDIB 5JPMB 1P7KB 4B0MB 4GXVH 4OF0A 1R3JA 3HLAB 2J5LB 3ARBD 3BGFC 3CZFB 3QPXL 4OGAD 3S5ZA 2QTEA 5BRZB 3FF7A 3KJ4B 4Y4KC 3QZMA 4GRWH 1DZ0A 2OTWA 3UJIH 4NZUL 4ZOBA 1J11A 2BSEA 5FA3A 2Q7AA 1ZA6B 2GEQA 3VWJA 4JEGB 3OXRB 3RWEB 2NY4B 5GISH 3H3PL 1K2DA 1QNIA 1TG8A 2EINB 1KGCE 4KUCD 1ZLSL 1GS6X 4NC0B 1A1MB 1VESA 3CDGB 4E41E 1ZK5A 4PV8B 2NY0C 4ADIA 3TBWA 2AJZB 3PIQB 4NCC1 4PGBB 4OCSL 1BWWA 35C8H 1HSAB 4LIQL 3CDZB 2AQRA 5I6LA 3KXFB 1RQ5A 4BZ2H 3GMOB 4FZEH 3NCCB 4BZ2A 4C83B 1R9FA 4N8CH 1TVDA 1G9NH 1KB5L 5I75C 2D3LA 3DURA 3PWNA 3L4ZA 1BQHB 2QVTA 3VI3B 3KNBB 4G5ZH 1KEGH 4OIIH 4HIEB 1EEYA 2F1BA 4B3EA 3UZVA 3BZ4B 1VA9A 1XWVA 4Z0XA 1QYGH 4GKSB 2DMCA 3K8LA 4LPYA 3RP1A 5K39A 2Y1ZA 5CJ8A 4EI6A 4HJ0C 5ERWB 4F33A 4YPGB 1RUAH 1XR8A 1CLOL 4S2SA 2VB5A 2RCSH 1YEHL 4FG0A 2Q7NA 3K1KC 3BH9A 3ARBA 3GIZL 1JGVH 4PGZA 3O6KL 1A1NB 4LP5A 1UM5L 2KZBA 3EYSL 1S7TB 3BT0A 1BVOA 3ZQ9A 3NK3A 4MMXA 1BEXA 3SJVE 3HE7B 4PLNC 4EZMA 4JPIB 3FQXA 4HCGA 1PG7L 1NCAH 1OLZA 3BP6B 2AJYH 2HP4A 3RU8L 3MNWB 1Q9LA 5F7AA 4N6RA 1OTTD 4BEIA 2ZSVA 4Z7QE 5D1QB 1E5AA 4LL1A 2CHDA 4MX7B 2CCWA 3BZDA 4PUBL 3ZR6A 1L7TL 1DQJA 3D4YA 3UBGA 4RCAA 4DHLA 3DUUA 2V7NA 4WV1B 3V52H 1F86A 4YWGH 5H2BA 1KIRA 3MLZL 5I74C 5GGTH 2BH0A 3SE6A 1N3NB 3MRRA 4GNKB 4KAQH 5FK9B 3KZ8A 1L0XA 3W82A 4XHJC 1PSKL 4DUXA 2W8CA 3MR9A 1PZDA 4HYTB 4Q9CA 3AG4B 3P1VA 4L37B 3JWNH 2AXWA 1GKEA 4P57A 2WYIA 5IFHH 5DMKA 1WFOA 5BQ7A 4L8CA 4GUQA 4NJ9H 4FQXD 2BVPB 2NT0A 1ZD6A 2QMKA 1Y6NR 1T1WA 2Y7QA 5CD5C 4H0LC 3I6KB 2WAQA 4UQ2B 3EJJX 2A73A 4R0LC 4JVWA 3QDAA 5K33A 5GZOC 2O5ZH 2LLGA 1FIGL 4RGOH 1BYPA 3Q43A 2ZE0A 1PBYA 4F7PB 5E2WL 1P9MC 3TBYA 5C07A 3S8WA 5CHNB 4HH9B 1B90A 1A9BA 4XCNA 1XGRB 2FECI 1MVUA 1F56A 2C9QA 1Q9OA 2VLME 3FU9A 1X7SA 2XN9B 3VQ1C 1HXYA 1PAZA 1PZCA 3QQ4B 2G9HA 5KSAC 2L7QA 2P5EB 5GIRA 4BFJA 2K6ZA 4P2QB 2J8UF 5IVZA 4WUUB 5AUMB 4IGBC 2UWEE 1T2QH 1Q1JH 1JZGA 1N12A 4J1UA 4YSTA 5D7LE 3RB7A 4DO6A 4NQDD 5C8JB 3KYOB 2A83A 5E00B 5JR1H 5E0QA 4JFFA 5DEFB 3BC9A 1Z3GH 3L7EB 4O58L 4W9GC 5HVGB 4QKTA 4ZFGL 5FCSH 1XCXA 4F93B 3PQYE 4LNVA 3HB3C 3KH4A 4X6DB 3QH3A 2QGCA 5D5MA 4Z1PA 4XN4A 1BJMA 1HHJA 4PV1C 4QRPE 3AM8A 2R7EB 4BFIB 1JBJA 5BJTA 1WFTA 3EKCA 4OUUA 5HDLA 2CGZA 3VDBA 1M6UA 3GRGA 1WZKA 4WW2F 4FQXA 2D31B 1FVCA 4XNUH 3TJHD 3GO1L 2JKIS 4Z6AT 3QIBB 2BNUB 2DMHA 3LZRA 1ZLUK 1O5PA 1JF1A 1E2VA 3RQ3A 1X5GA 2KPWA 1A14L 1NTDA 2JKWA 4M48L 3TLRA 5IBLC 5HGAA 3HC4L 3C87A 1DQIA 4LASH 3GGWB 4X6FA 4PR5A 4RBPK 4Y16B 2AJXH 2CO6B 2CLZB 1TZIA 1TYJA 4G9FB 5D96B 1KG0B 1NCIA 4ZUTB 3SKUD 4ETQA 2XZQL 3QUKA 5TGBA 4RMRA 3P2BA 4KY1H 3NA9H 5LBVA 3WIAA 1CICA 4ZFOL 2NLJB 4OSUL 5GRYA 2VH5H 2YWZA 2HKFL 4F2ME 2C3WA 1P5VB 1Y0LA 2VZ3A 1QEXA 1GL4B 1EBPA 1KNOA 3AB0C 5JIMA 1YEEL 4WI2A 5D2NE 5ISZE 4OQTL 1P7QD 4PIRF 1FL6A 2ZUVA 5JIKA 2Y72A 1YLBB 3EGSB 5G4NA 3RVUC 1FFOB 3SDXB 2PO6D 3QBTB 1HHGA 3I9GL 1FYHB 3NIDB 2IDUA 2WN2A 1TFPA 4PVBA 1F90L 2P8PB 4O9HH 4OJEH 3FUEA 3BCDA 4P5KA 1S7RB 3I75B 4MWFA 3O0RH 4M7ZC 1FVEB 2NY4D 2QJDA 3UTTB 4OD2A 2ILLA 3ETBF 4OF3A 2D03L 4M43H 4NXSA 1VB9A 1LK3L 5DMGD 4FG6D 3WTWA 4ELMA 1X9LA 1TQVA 1O9VA 2Q5BA 4UT7H 3EF4A 3DIDA 3UMNA 1G7PB 4LBAA 4AQAB 2ZAGA 2RACA 3UTZB 2H26B 3KXFD 3SGKA 5F9OL 1WSST 1H8OA 1F3JA 3ILQD 5T3XL 1MCPH 3F62A 4OLWL 5I16B 3VSTA 4U1IA 5CILH 5LCVL 2EYRB 3V4UH 3V4VL 4UWQB 3FXIC 2KI6A 4OY9A 2Z91A 3H8NA 3FCUB 3BRFA 1IEAB 2XTJB 2YARA 4QHNA 3VFRB 1QUPA 3F7RA 1ASQA 3MLYL 3VI4B 4ENEC 5KBDA 3S35H 3TWYA 1VPOL 4FQJH 4PBWD 4G7YL 2DQGL 4DZ8A 1PX4A 2GIXA 5F44A 2K3HA 3ZY7A 1T0OA 2HYMA 2AFNA 2VAAA 1EMTH 4ZODA 4WHYG 2HB0A 3HLAA 3CZFA 1IC1A 2PO6A 3FB8A 4GP4B 2X10A 1ACXA 4OJFL 2QGEA 1K8IB 1JF6A 3HE7D 5I8EB 4WK4B 1X5IA 3LYRA 3D5OF 4EE2A 4N8VB 1NIBA 4PTUB 1JTPA 4DP9X 2J5WA 4AMKL 3FT3B 1YQVL 4AMXA 2JB6A 3LHPH 1MZZA 5D1QD 1C5CH 3RPIB 1S78D 1IC5L 1OGAD 3LEYL 4W4OA 4JY5L 4WTZA 1XH3B 1YNKL 5EU6D 5T33L 5AB0A 2X4OB 2HFEB 1CO1A 3TH4T 3CDGA 2YAHA 4R4BB 3ZE1F 1NBZA 2CIIA 3BAWA 3QULB 1W80A 2GJZB 4N9OB 3F7LA 1NCCH 3ECBA 3ZTNL 5I1IL 3T0DA 4YAQB 2AERT 3EJPA 3QORB 3GMOA 4C83A 5IY5B 3B6SA 3LS5H 1CGYA 4RIRA 4OFVA 4TSCL 3TONA 3VI3A 1YSOA 2DJ4A 1MCQA 2FZ3B 2VM4A 2Z7WA 2ZXQA 1YUHA 3K7UA 4QUOA 3WNOA 1H6UA 3H7BB 2C26A 4W6WB 5D7SL 1UJTA 2R2CA 3BZEB 2CWRA 1N7ML 5J4MA 1NAML 1CT8B 2X7LB 3D6GA 5C09B 2I25N 2XQYG 1IVTA 5CBEB 2YD8A 3DVIA 3NSXA 1GGCH 3GPSA 4MVBD 3LNEA 3U46B 3QK0A 2BC4B 2VUOA 5HHQB 1QTYT 1UM4L 1KBGH 2NXZC 4G2AA 2W5PA 2WLKA 5T5FH 1KDJA 2QQLH 3VH8B 3L3JA 5IQ9A 3TA3C 5ANMB 4A6YB 5I6MA 1HSBB 3RZCC 1V05A 5HYEA 4FI6A 3QFDB 5FGSA 5KG9A 1S7TA 4FL4C 1CPUA 3KCPA 2XN9D 3NT0A 2IJ0C 4Q6KA 1H3UA 1EDQA 3ZTEA 4MMYA 4B41A 2ZCKL 5DJAB 1F2QA 2WZPA 1N5YL 1UZ6E 1N0LA 3T6WA 4EN2A 3MNWA 4NKMB 3CUPB 1YYML 5C0IB 5CD3B 2TRHA 3HNVH 1KFAL 2FEJA 4P2QD 4Y1AE 1QPXA 4PP1C 4YE4L 1T0NA 2ARJB 3HC2A 1OGAA 4MX7A 4P07A 3RVVD 4N25A 5KVDE 4WUUD 5EU6A 1YO4A 4YIQA 4ZUVA 1DQTA 5GGQL 3T2PA 3TBSB 3NIFE 2ZWKA 3D25A 4QRUB 4E9LA 3IPBA 5DFTA 2ESVE 3S98A 1TZOA 1NUNB 2WQUA 1MN4A 4HCIA 3V5HA 2IQ9L 1O0VA 2E75C 1AXIB 1JRHH 4N0UB 4YDJB 3IDXL 3TYGH 4Y9CA 4FFWD 4U1KB 2OK0L 1S9YB 1SM3H 2YLHA 3ZDWA 3MJ8B 4QO1A 1EEZA 4JK0D 1UACH 2J1XA 5HDQL 3BP4B 3BT2L 3AW5A 3T4YA 2FECL 3LXUX 3ARSA 4FQ1H 3AITA 2NTFB 1MUJB 5HHOE 1CDYA 2O5NA 3DHJA 2CLVB 1GGIL 4XB3A 4UQ2A 5IIEB 4RGNE 5LGJB 3IMVA 4HS8H 4F27A 1U95B 3KYMB 1BQHG 2OJEA 2HVJB 2FGWL 4Y16D 4LGSB 2BY0A 1MSPA 4G9FD 2Y36L 1AOHA 1WBXB 5J57B 4JNXA 5JNYB 4ZTEA 4GS7B 4FABH 1A9EA 2IGFL 1Z9MA 1ZS2A 3V6ZA 2HX8A 3DECA 1KWGA 3W9DB 2XVBA 3FL7A 2VDLH 3D9AL 3ALPA 4M56A 2XN9A 3RX9A 5IB3A 1K3ZA 3VFMA 3THML 2B39A 1ZGLM 2AEQL 1NCOA 3CHPA 4R90L 5ETUB 3AC0A 2KLTA 5BRZE 5CZVH 4X9HA 3EYOA 4WO4A 4GAJH 1ETJA 2GHWB 3BVVA 4HLJA 3GSXB 4ANWA 1KTLB 4NO5A 2GT9B 4N22A 2OZ4H 5KVFH 5KSUA 2OZ4A 1YYLH 5C8JA 2JVUA 1SLUA 2BIMA 3WJLA 1OKEA 4HIPA 3L7EA 3AXIA 2LU5A 4AJWA 2VRAA 3T77A 3AACA 2B5IB 2O61A 3IDJB 2HKAA 1CFVL 2BHUA 4WI9A 2XRAH 1NFDB 3UTTD 1HHIA 1GSKA 1PZBA 3GIVB 4UV7H 1OGPA 3V7AE 4AKQA 2R7EA 4OJYA 4J3TA 1XHHA 4YSPA 5D1ZI 1D3CA 3RDTC 4N24A 5E1QA 4NAQA 5KYYA 1VLXA 4ZO8A 3QDJB 1NEUA 2JH2A 4JO2H 5SWZE 5IVNA 2F8IA 3DO4A 1QBBA 4AQOA 2BNUA 1PEWA 2HA1A 3DK0A 4P2RD 2J2ZA 2HPOA 1I7ZB 1I85A 3CWGA 1MH5A 4XPBH 4AV0A 1KYFA 4NQCE 4KJWD 1EHAA 2XPGA 4YUEH 1R3LA 1N64L 2ENPA 1TMCB 1Z0NA 3WS6C 1BYNA 5A2KH 1USZA 3DO3A 1Q0XL 2KYIA 2DMKA 1IARB 2AK4B 2ATKB 2VDNB 4GO6B 5ICZB 3TT3H 4PCKA 4JUSA 3SGDH 1YHPA 1F02I 1T4KA 2DWEB 1RUMH 4HWBA 4OCLC 4ABWA 4YHNB 3P3UA 4TSBL 5IEKB 4IMKA 5IQMA 1JPTH 4XXCC 3X14B 1P5VA 2OMVA 3T65B 2CBPA 3NDZE 4Y4KB 2E7LC 5E99H 3U30C 4DPCX 5DRWA 2I32A 3TO4C 1TTBA 3DROB 4GQ9L 1NDTA 1L7IH 3QXAB 3FQUA 3E6HA 1MREH 3S6CA 3SDXA 2WK2A 4KMQA 4L0YA 3I6GA 1E4KC 2V0AA 3NSDA 1HZLA 3G6DL 4L3AA 1AC0A 3FRUA 4CKVX 4TPRH 3TZVB 3LZLA 3WUWA 3L7FA 4LNRB 3U82B 3E8UL 2JJSC 1IJ9A 4D7PA 5HP5A 2GFBA 5I6NA 4L3EE 2P8MB 2N01B 5D7IA 5B7EA 2P26A 3KM2A 4BK5A 1FVEA 4BYHA 5KW9L 2ITEA 1SEQH 4B6ZA 2PXYA 1EZVY 5MENA 2F8XC 1DQLL 2F54B 3TFBA 4WQOA 4H20H 3WE6B 3X2QB 2AXGB 5HI3C 4P2RA 3L3IB 1HHKB 1GW6A 2CR6A 4FQCL 2DPKA 3QORD 1MHCA 4JPSA 4LFHD 2AEOA 2YXVA 3C6LB 2HX9A 5JPNB 2NPLX 3Q3GB 2J12B 4N87A 4YL9A 5F7KC 4HUUB 1KELL 2AJSL 1YEFL 2HUEA 3IM1A 3MNZB 2EYRA 2X2YA 4N86A 2WC7A 4MA8H 3L6FB 4MCYA 1U8NA 3HFFA 1XMWA 1SF3A 1IEAA 1TJMA 2GI0A 4NO2A 5IJVB 5D6CB 2ZJSH 3U6RB 4FNLH 5DGRA 4WKZA 4KQ4H 5LQBL 3P73A 5CGMA 3RVXC 2IWFA 4JB9L 1CE1H 2YRPA 4KXDA 1O7VA 3IFNH 4UILL 1ZMYA 3B9AA 4H8HA 2OL3B 1MJ8L 4KKNA 1CZ8H 5KYXB 1SJEB 2DWDA 3GI8H 5EEVA 3ASOB 1Q0EA 1YY9D 3VJ6A 2OCJA 1S2EA 3N55A 4HLEA 3RVTD 3KDMA 3HZMA 3U0PB 1D6EB 3V5KA 2P5EE 4UIKH 3KPLB 4PS4H 4JDZB 3QXVA 4N0CD 2PPEA 4F3FA 1MRDL 4XNYH 5E2VL 2A6DA 3H0TB 4OZFH 2J43A 1NIEA 3OHMB 3CSGA 1ZDSA 3P9LB 4N2IA 4ZTPL 3LY6A 3RURA 4QJ3B 1MWAL 1P4UA 1CLCA 5DT1L 1DL7H 3WXVH 4ANXA 4C56E 1SXBA 4NEHB 1YN6B 2GJPA 3C12A 4M5ZL 3B7UX 3PHOA 4BBWA 3MA7B 1LE5A 1VAHA 3QORA 2IMMA 3DLQR 4PIBA 3RWJB 1KXVA 5CUSH 3O3DA 2DF3A 4R0LB 4AK1A 2BCKB 2X0UA 3G6JF 3JTSA 4LCUB 3X3FH 1W0VA 2HVKB 4FQPA 1CT8A 3LRLA 2IDFA 2QQKH 3QJHA 5DTFA 3IDMA 3NRFA 2BVOB 2VXVL 4PU2A 3EDDA 4U7MA 1OAZH 1OTSC 3U46A 3N1QC 4XP1H 4AQEA 2ERJC 1KIQB 4FN0A 4FXKB 3FT2B 4GKZB 4HKZB 3TBVB 4IKLA 3SPGA 5F93C 4JR9L 1P84K 3T1WA 3OWRA 4O51B 1FPTL 1JP5A 3VH8A 3EGXA 1DJIA 2LHAA 4OZGF 3MNVA 3FS9A 2NYKA 1KJ3L 2WIIA 3MNMA 4BQCA 1R3HB 3EJRA 3DVGB 5KSBB 3QYMA 5DJAA 5GS2D 4EO5A 4QHPA 3DHMA 4QRAA 3RRQA 2DWYA 4WNSA 3OG4B 1XH0A 2OMBA 1J9CT 1NLDH 2X1QA 1IBFA 2WSPA 2X9YA 4G6FB 5DQJB 3TT1H 2F9BT 3DOHA 2FQGA 3MRNA 4Q4IA 4G1EB 1YJDL 5DD6B 3JVGC 4QF1B 3QJXA 2CSPA 2C4FT 4U31A 1E9QA 2GTWB 3DDFA 5AW8B 4F9PA 2FRGP 4UUJB 4YDJA 4PJIB 4LSRH 5L8LB 4NN5B 4IOSD 1E9PB 3UZQB 1E0OB 3V8CA 5JQ6H 5E6SB 1TZAA 5EC1B 3WFDH 1QHOA 3HFMH 3FRPB 1AR1C 1DCLA 3W9EB 4IRJC 5AEAA 3FOMA 3L4XA 1PY0A 3FU8A 1IC4H 2J4WH 4OZIB 4L5FH 4LFHG 4NSKB 2QKIA 4HQQL 2WVUA 1CGTA 1UT2A 3QDGB 4JJ5A 4OM1L 4XC1H 1U95A 1YEJL 3MLVH 3VGAB 2FCBA 2LT9A 2Y7NA 4MD0B 3V55A 5ILTL 2DIJA 5IMKB 4GRMB 5JYMA 2XTJE 4JQXC 1E8XA 3VI4E 5E6IC 3DYOA 4Z5RA 2B15A 5LUMA 3DRQA 3TTYA 1J9TA 4R97B 1PNDA 1IEHA 2G3MA 4QRTA 3CV5A 4RX4A 4LSTH 1N6QH 5DK2B 3GTVA 4Y4KD 5BW7A 4NUJB 1OSPL 4J7RA 3P2TA 4X8GA 3U0WL 3V0DA 4P05A 1IBGL 4LPTA 2OLDA 1KTLA 1YYCA 1S5HB 2MIZA 3GBNH 4YSOA 1IM3B 4JKWA 1QLEB 3ECWA 4NP9A 4W9EC 1G7MB 3GC3A 3VE0B 3CFJA 2NY1C 1KCVL 4M5SA 5E95B 3TZVD 2XKSA 4K3GA 5IW1B 2VDMB 3C5ZA 2OMZB 1CDCA 3UYPA 5EN2B 5D9SA 4LLAA 4HX1A 4IOSA 4PHZA 5TF1H 3C8KA 3KR3L 5EZJB 4KJPC 4ILDA 2ZWLT 2F54D 4NRYA 2LFGA 5BS0E 5B8CA 4F58H 4CL7A 4JFQB 2EVIA 4YEEA 3EFFA 3BESR 1ZSHA 3R7QA 3Q6GH 1A6PA 1B2WH 3NACH 4RFNB 3L4WA 1B0RB 3QG7L 4ZFZB 2V7HA 3V6OC 1F3DJ 2KERA 1ZWIB 5I1CH 3BX7C 2PWEA 5DA4A 4X2UA 5IMOA 4FQQB 5TK2A 4BXVA 1H0DA 2RJMA 3WEBA 1CXFA 2VDOL 3LQAC 3UO1H 1DJSA 4NPKA 5C09E 1LNUA 5IWLC 3VSUA 3MO1B 1AHMA 4PJAE 1BIIB 1I8KB 2DIAA 4FXTA 4Y7MA 3VFNB 2VO5A 5AG8A 5KJRH 1W72A 4TLKA 1BA9A 4ZUSB 2DB8A 3WS3B 3ZSTA 2R0WL 5GRJH 1ITBB 4UQAA 2OJZH 5KUMA 3CLEL 4Y4KA 1UD3A 3DDGA 5DO2C 2PUQT 4KKBD 3U9WA 4Z3HA 4I1RA 1FSKB 2UYLA 3QEUB 4W9IC 3K2UL 1P6AB 1MFDH 1INQA 1U6AH 2UXVA 3AROA 4PJDA 3VRIA 4Y1SA 5ALBH 1GJUA 4JPVH 5IVXE 1C1EL 4DW2L 5I1LA 4JY4B 5C0NC 5FYKU 4Z7WE 2EUZA 4XO5A 1KJ2L 1NMCB 2DQHH 4M8VA 1Y07A 1RZIB 4Z78B 2BOBB 4G80B 4DPAX 5HYSB 1Q90A 1BAFH 3OPZL 2FX8L 4LEXH 3BN3B 2H47C 3UEZA 2F54A 2CUAA 5KN5B 3MYZA 3PAZA 2BCMA 1G7JA 2W38A 3DSFH 4MB4A 3GXPA 4N0UE 3Q2NA 1OANA 5DJYB 3K5SA 3WE6A 1ILUA 3GHPA 4HDIB 4YDZA 3F65A 3NOIA 4N2AA 5JOEA 2F8VA 2X4RA 4JLRA 4MCNA 4JO1L 4Z7NB 2I60L 5EOCL 4P3CH 3NYKA 1WAAA 2MQCA 3O3BB 1E67A 5JMOC 1KTCA 3MNZA 1U8KB 3OKMA 4PCSA 5I66B 2DQCL 5FOJA 1BZDA 2MPAL 4GAGL 4KV5E 4RZKA 2XVLA 2F2HA 3VYNA 4NN7B 3WSQL 3FAWA 4L9DA 5F0PB 5C70A 1NCBH 1VACA 2X2UA 1A3RL 2VXQL 1UTDA 4EI5B 3K46A 1JUFB 4I2XB 1G6RH 2HT2C 2RFXA 1G6RA 2X4QA 4IJTA 5JHDE 3TA3B 2AK1H 4XNQB 4W4NA 4BCYA 4Q9QH 3P0GB 4C47A 4EMZA 1DQQB 1FNEA 2JKJA 4AC2A 4PGDB 2IH1B 3IDGA 2AV1A 1E8WA 2VLKB 3SD5A 2JJTC 5KSAD 1SJEA 2BZCA 3ML8A 3B9KB 3O4LD 1S7WB 5IFJB 4N1EA 1UD8A 3Q05A 3MRMB 3BZFA 4Q97A 3ZTJG 2Y07L 5I9QC 1CL7H 4JDZA 3SOBH 4CMMB 4IGBD 3QPQD 4C54A 2J72A 3CVIH 4GRWB 2E6JA 3MFGB 3U79A 3AY2A 5DRZA 3ETTA 2DM3A 4LL9A 2C3VB 1KV7A 1HJCA 1OIOA 1CYGA 5FV2A 2E74C 1J0KA 4GB9A 3ROOA 1JZ7A 4G6FD 4LVHC 3HB3D 3H53A 1CLZH 3R4DA 4HWZB 2ADFL 3B5TA 4I3GA 1SMDA 4MS8C 1NLBL 1YPZE 5D7JC 3TASA 1MJUL 2XWRA 5DK3A 2PTTA 4IOIA 3TIDB 3RWJA 3QDJE 1LE9B 1SVBA 2LVEA 2Q86A 1I1YA 3SE9L 1NCWH 1L6PA 5DJ6A 3JWOC 4GSQA 4R0LA 5IBLD 5G55A 5JO5B 2VLRB 2BCKA 1EHNA 2HTKC 3BSZL 5GZOA 4PY7B 1CGSL 1OP3H 1BF8A 4HXBL 3PHQA 4LCUA 3ZLQC 2EUVA 2H0EA 2UV3A 3BJ91 1J9RA 1ZLDA 1P9MA 3BKCL 1U8HA 3KPSE 4QIRA 4AGLA 4AIZA 2DWSA 1A4KB 3WELA 2Y5QA 3WLBB 5FHBH 3SO5A 1N8ZA 2E7CA 4QD2E 1GZPB 1RIHH 4ES9A 2Z65C 1CR9H 3GSRA 1JFHA 4U4IA 3P69A 5IMLB 4PJCE 3IXTB 2C4FU 4O51A 3SDYL 1NANI 2BP3A 3M17B 4Z7UF 5KSAA 5INCA 1LQSR 4TMPA 3O4LA 4JKKA 4BELD 5CEZD 4I4WA 4DOHB 3H4HA 1KTDB 4NRZB 4KQ3L 3WJMA 2XWZA 1R3HA 3WDIA 2XI9A 4IGBA 3LN5B 4X7TA 1CTOA 3MA9L 3SODB 4JFEB 5LWYH 1A7PH 1LO2H 1YDPA 4N6QA 5FO7B 3WENA 3INOA 3AQXA 3IF1A 3QPKA 2BSRB 4ONOA 1HX0A 5FAAA 4RFOL 4KDWA 1MLBA 1IM3D 2YPVA 4G1EA 4LLDB 3FHEA 3N9GH 5IMMA 1MQKH 4FXGB 3WHE1 1E3ZA 2WNWA 1FN4A 2VN4A 3KYNA 4MA7L 2OR9H 3MRFA 3UZQA 3F7VA 4UT6L 4ONFH 3HNTH 2H3NB 4NX0A 4KU1A 3TYFA 5EC1A 1KTBA 4PJEF 4YSSA 3ULVF 1LGVA 2AANA 2WVSA 2C3XA 4ORGA 4HWEL 5C9JB 3LHAA 3MLWH 3N40P 4H8WC 4TNGA 4LPWA 4XXDB 3ZOAA 1FBIL 4J28A 4CW1A 3FU7B 5F6HJ 4FYTA 1I7TB 5DUPH 4F57L 5C0CA 4IBUA 2J55A 3BLPX 4ENED 3GUTB 4XO8A 1ZIBA 4D2NA 3OKLB 2EEFA 4DO4A 4IBWA 4PWHA 5TK4A 4G7VH 1A6TB 3CVHL 4MZ2A 4ZDHA 1CN4A 2AQ3A 5E4EC 5AVVB 1NGYB 3AXLA 4A37A 1E8ZA 5I1GL 2GUYA 4ELDA 3ZO9A 2BY3A 3GHBL 3TO4B 2BPBA 3UJTL 3NJGA 4ODUB 3ZE2B 2WP3T 4JPQA 4GIPD 1XH2A 5DK2A 1RZJL 4RRPG 5FXCH 3D34A 2A99A 2XWXA 3B2UD 1CDUA 2QVFB 4HUCA 3ABLB 3OMNB 3MGTB 4XPAH 3SKJH 1S7QA 1XD0A 2ZOLA 3OB8A 4M62L 4D9LL 4JG9A 2GYSA 3DYMA 2E86A 2F1EA 1I53A 2YMXL 2FWOA 4NKIH 1ND0A 1XD1A 1XIWB 1C12B 5IUCA 3H7LA 4ODHL 4HW6A 4WGKA 4M93B 5EN2A 2V3FA 5IQOA 3QQ3B 1QMUA 5E9NA 2CDFB 2ID5A 5ESAB 5T3ZD 5FECB 1JGLH 2ZX6A 4JAMB 2W92A 3C6SB 1IAII 4G3YL 2OYKA 1LO5A 3MPCA 3QRFM 4X8XA 3BMVA 1KBPA 3GUFA 2XV2A 5EU3B 2WQVA 1BOGB 1MCWW 3SY0B 4ZFZA 1KENL 2DMGA 1OPGL 1FH5L 4JL2A 1NPNA 2AEPL 3GLDA 4XC3L 3RI5F 3WFEL 4A7TA 3FW6A 3RLSA 4XAWH 4D9QD 4GSUA 1F18A 1D2OA 1BIIA 1ZJBA 2H9GA 2MJWA 2Q3ZA 1WRFA 2WXQA 4MKMA 3PWJB 4Y88A 1TMQA 4EI5D 3GM8A 1XGQB 3TA3D 2A6IB 3DPBA 4J6RL 1L0YA 1VFAB 3E80A 5AOLA 4D3CL 3RZCD 1CDBA 5DZAA 1IBDA 2OR7A 2XSKA 4CILA 5E9AA 3CN0A 4IHOB 2VLKD 2YGNA 1EX0A 2VRQA 1FL3B 3SQOH 2DKUA 1RIVH 4BGLA 3EG9B 4URKA 3B9KD 4PGCB 1BZEA 3RA7H 1RZ7L 3REVB 4KK5C 4W9LC 5KVGH 4X6EA 1NMAH 1UATA 1E43A 4JREC 4A2DA 2XZAL 3F7PC 3IDYC 5FW6A 5IM7B 3B7YA 4WU5A 1S9WB 4CKQA 3DIVA 4ZI8A 2ODIA 1NFIB 2BNRB 2VXUL 3MX0A 3KLLA 4WI0B 1BBJA 4DT2A 4KI5E 3I6LD 3QO0B 2BSSA 3LZFL 1F6AA 3ABGA 3WLWD 4N90E 3ZK0A 4J2QA 1MPAL 3Q5TA 6CGTA 1AGEA 1JK9A 1I9JL 1KGYE 4ZNCD 1PZ3A 4LSQH 2YK1H 1G1CA 4PJIE 3E6FB 3OV6A 4XO4A 2E7MA 1X7TA 2W9EH 4HDIA 2AXHA 3ZL4H 3WIIL 4HGMA 3ZMNA 3QEGL 4NRXB 3T6VA 1QG3A 3KL3A 3KYKL 2IFFH 4PJ8B 3EBHA 3UC0H 1FFTB 1ZVSB 3W2DH 4WFFD 3QDGE 3FONB 1DBMH 1RSFA 3UDWC 5J1AA 1JYWA 1TQSA 5BO1H 2WZ5A 1Z6JT 2Y2YA 4L4JA 1KCRL 1OW0C 4I2XA 1UT1A 3SPCA 3MOQA 4AYFB 1SXNA 3TA3A 4XNQA 2NR6C 4M6ML 1U2YA 1Z0MA 2F7RA 5FWQA 4G42A 3RZCA 3VXQA 3WNKA 4GO8A 1KB9K 1JAEA 4GRLC 4RDQG 4PRIA 2CGRL 1Y6MR 1FFPA 3WFCH 4MCZB 3VO0A 3K2KA 4JZNB 1BLNA 4HS6B 4P2AA 3MJ6A 5E6RB 3GINA 2R1WB 4U1HB 4WTWA 5E1IA 3UTSE 1GJWA 2OYMA 5DO8A 5I1JH 2CO3A 2PR4L 1JIBA 3L3OC 1ZLWH 1OOWA 5DHXB 4JFED 3MCKA 4N0YH 4FQIH 4QY8B 5G4MA 5MP6H 2Q2LA 3DO7A 4EOWL 3W38A 4Z8FL 4ODSL 4PGJA 5SWSA 1CXEA 1SYSB 4P9HH 43CAB 4Z7QF 2MCPH 2A6KB 1FDLL 1X5XA 3J27A 2IV8A 4U2ZA 5CLTA 5D7HA 1NUGA 2H1PH 4DP4X 3RDTD 3OLGA 4WWKB 1F4YH 3W57A 5A2IH 2MHAA 5HYSG 1MELA 3EIFA 2BDNH 4XOCA 4M7JL 1HIMH 1OHQA 2A0LD 4I3RH 4WLCA 2XN1A 2VW7A 1LE9A 1WZ1H 1A8ZA 2GVYA 4PWKA 3U4EA 2YIHA 4HF5L 2B16A 5EO1A 4ZMWA 4WSKA 4XCYA 4JRWA 5CJQL 1N19A 3EOAB 3FZUD 1OT2A 4MSWA 4X6CB 2B4CL 5I18H 3UCRA 4NIYE 2V33A 1M6OB 2YN3A 3TN0C 1U30A 4LSVL 1MFBH 2P48B 4JFVA 4OFKA 5DD1L 3SYAA 2K45A 1A4KA 1OL0A 1U58A 1BFSA 2BOCB 2OQJB 2OTPA 3LKNA 4KRPB 4PJ9C 1CD8A 3ZHLA 5CZKA 3T3MB 4EN3C 1GYCA 2B0SH 3RKPA 3BUQA 4L4TD 5IMLA 4IDJH 5I0XA 5FYKL 4FZ8H 4OGYH 3SOTA 5IF0A 1QUNA 4IDLA 2ZP9A 5L8KB 3VRJB 5D2LE 3LKQA 1AQDA 5LBSL 2ZUQC 4XNAA 5FCUL 3TO4D 3VXOA 1KTDA 4BM7A 5BV7C 1J87A 1R4XA 4ZW3A 5C0BE 4EVNA 1Q72H 2A9CA 4PLKD 1KZYA 3TJEL 4QGYA 5DLML 5B3SB 3S4SB 4Q56A 2B3RA 1FZJB 3ZDZE 5I5IA 1EGJL 4XH2B 2O6DA 3PGFL 5TE4H 2BSRA 6TAAA 4U0RC 2AC0A 1JJUA 5ACZA 5E8DH 1XCQB 5IROC 3LSOA 3GI9H 3IFLL 1PLAA 3LX9A 5L7XL 1ZGLB 2IGTA 2UWEF 3VSQA 1NGXB 2R15A 5E8EB 3RDTA 2UY7A 1DQKA 5FHAH 2FBJH 5KUKA 2X70B 3BUDA 1U3NA 4LHUB 43C9A 3NH7L 3LIZL 4FOMA 1CDIA 3Q2CA 2ZCLH 3PAUA 2EACA 1QACA 1PVHA 2BRRH 1OP3K 3IDNA 4MA1C 2GBAA 3GPEA 4GUOA 2EIKB 4G43B 1UWFA 4H8PA 4JHAH 5FYLE 2RQ8A 4GO9A 4TVPH 4NQVA 2G5UA 1AZUA 3NMEA 5GRUL 5GQBA 3VXRE 3WS6A 1AY1H 4K23L 5AALA 1DQDH 4Z7NE 1EHLH 5TPWH 3TFKC 4OZ4B 4X5WA 2DICA 3TF4A 2IDSA 1HVXA 2V9RA 2EIBA 4NZTL 5DS8B 4AEFA 4O2CA 4H26A 1H15A 1ZGLP 4MRCA 4JN2B 4KVNH 2YD1A 2QSVA 4L4TA 2XCMC 5BZDB 4P4KB 4AKOA 1A6TA 4XXCA 3RVXD 5C08B 3W5NA 2B1OA 1DN0B 1CMOA 2E7LA 4PRDB 4QTHB 3WTVA 2IWGA 3GKZA 3TO4A 1BMGA 2V37A 5CN2A 3NK4A 4UMSA 4FS0A 1UZ8B 1E4KA 2NNFA 1RJLB 3SKMB 1JPSH 4FX5A 2AJ3A 4PB0H 1WZMA 5A7EA 1YNTF 1IAIL 4Y9EA 4AL8L 1FYTB 2JJSA 5DZ9A 5MI0C 1BOYA 3UG5A 4JZJB 4GRWE 1XSOA 4UTCA 4YDVB 3BVWA 1NQBA 4FQHA 5CCHE 2J25A 3PV6B 3VD4A 4KNSA 1AQKL 5J12B 4A67A 4HISA 1Q0YH 4K71C 4FFVC 2BNRD 3ABKB 1WFNA 3TCLA 1XBRA 4U1JA 1S7XB 2BIHA 2YEVB 5LXGH 2WAHA 4PEEA 1ACCA 1UM6H 2DMBA 4U4BA 3RWCA 2V2WB 3WXWL 4J23A 3OKKB 1DLHB 1FGNH 1QAWA 1ZDQA 1NCGA 4CU8A 1S7SA 2CR0A 3DTUB 4HUXA 4L1LA 5AYTA 2KBGA 2IG2L 3UG4A 3RZWA 2JB5H 3L5WB 4MNHB 3P4OB 4AG4L 3K0WA 2I7OA 3VFVB 1R5VB 2PYFA 3QJSB 3H9ZA 3BWUF 3JWNG 4PJ8D 4ZMAT 2FB4H 1DFXA 1T7YA 1WK0A 3X1NA 3MUY1 2FO4A 4GKOA 2GBTA 4B9IA 3N41F 2M83A 3P77B 1G9MH 1KPUB 3KGTA 2E8YA 2EICA 1K4CB 3BQUC 5F2FA 3OSVA 3C2SA 4S1RL 3NABL 3EDKA 4LQ1A 1ZHKA 1J1PH 4X50A 4KXZH 4NQSB 1IE4A 1KPVA 2BOLA 2G9KA 4LESA 4PGCA 4TOYH 5I19H 3IDIA 3KVPA 3OHXB 3REVA 3UJIL 1HEZB 4HUNB 4WU7B 4UAOC 4JRXB 4NT6B 2FWLB 2EH7H 3L2LA 2VDQL 4PJ7A 4JO3H 5GISL 4QDGA 3EGDB 2QVKA 3UYOD 4PN6A 4JM4L 1NOLA 1SF5A 4XBGB 3K6SA 4TL5A 4I9WD 3D51A 2MNUA 3CPLA 3VDAA 4AMWA 3U7AA 1SBBA 4RWYH 1JSYA 1PYWA 1F41A 1OARH 2XKUA 2X44D 4XMVA 1DBBL 1WG3A 2GITA 1KLUB 5DC0A 3L5XH 4PS8A 3ZT6A 5F1NB 3S36H 3IMUA 2VDPB 3EW3B 1G9NL 1MW1A 2DDQH 1FG2B 1LD9B 3JWNE 1BYOA 4LEOB 1B3JA 3CN2A 3W39A 3JZ7A 1KEMH 2V9UA 3ULUD 1G4RA 1UD6A 2IPKA 1HS6A 2DWTA 2EZ0C 1ZVSA 2HFGL 2XWCA 4RH4A 5EIQA 2DLGA 2XVKA 5J13C 1OP9A 3BW9B 4OKVB 1FVDB 5DLLA 1BD2B 4HEPG 3P4LA 4H88H 2EDLA 1NZRA 4ES8A 4YEFA 1VGKA 5IHZB 3NCBB 4AYFA 3SE8H 4K94L 2XFXA 4APXB 4AQ1B 2VN3A 4TSAH 3U7WH 3P3YA 2AHIA 2B9BA 5C07E 3LQZB 4W9ZA 5EU5A 5TE7L 2R2BA 3QHTC 3TNNA 2V5SA 3A3YB 1G87A 1JGVL 2J7LA 2BX5A 1BF2A 3IN0A 4K3DH 3RVWC 2NMSA 3SPVA 3CIAA 1MDAA 5ENWA 5HPMB 2QL1A 2E4FA 1EZLA 3UAEA 3WFHA 3EYUL 2BFVH 2EDNA 3DUSA 3WHE0 1E2ZA 3JVGA 3QISA 5AZ2L 4EIZC 1LO3H 5IB5A 4D9RD 1JK8B 1UZ6F 5EBGA 2F19H 4OZFB 4JFOA 4XPHH 1JNLH 4FJZA 2CJTA 4YWGL 4P3DB 3FJTA 2NSXA 3WY4A 1OQOA 1PPIA 4JFFE 4LOUC 4HOMA 3MV9B 4N1HB 3NIFF 5T1JA 4ZX5A 5CCKL 2ATAA 3BPNB 2BNQA 4IRJA 5ABAA 4LHUD 4MNGB 3V7MA 4B9KC 3PWUA 2BVEA 3B3IB 5FB8A 3IU4H 1BZ7B 3FN0H 2J1ZA 3D08A 4WJKB 4RZCB 3F2LA 3A6CH 2X4NB 4Q7DA 1BFOB 4N2MA 3O3AB 2X12A 4HZ1A 4NBZB 4KZ0A 1FE8H 1XR9B 4JQXA 1CE6A 5E6IA 1FNHA 4U33A 5TDOA 4HKXB 4KPHL 3WEXB 2OQJA 4OIBA 4RGOL 5BXFA 1N0XH 2ZYRA 1NM9A 3FB7A 6PAZA 3RG1C 1MF2H 2R4SH 2PYEE 4P4KD 4NM4L 4MQ7A 2COVD 4PG9B 3JV4A 2K70A 2NNAA 3T2OA 4DPRA 1OAXH 5DO2D 5F3HA 1ZSDB 4HOWA 1G7LA 1OAUL 5JZ7C 1UZGA 4HK0B 4OCXH 4AW4A 2CUIA 5JHMA 3VUAA 3NPSC 9CGTA 4HIJB 1EVUA 3GS7A 4DGIL 2KKQA 5GJSL 3R1GH 2BW5A 1QX1A 4P5SA 5C0AA 1FZJA 1R0AH 2BJML 1IMHC 4XH2A 1JNNL 2VDKL 1ETA1 1Q1JL 3IEAA 1FYTD 2X40A 1UD4A 1G5GA 4GAYB 4WI6A 1TO5A 4LLYA 4Z3IA 1ZGLA 1XTLA 5GGUA 1WCBB 3F00A 3MBEB 3BKYL 4UDTB 3BIKA 3FB5B 3W0WD 4M5YL 4MLIA 1WFUA 2DQDH 2IF7A 4NP4L 5D8JH 4BH8B 1QFHA 2V5MA 4HPOH 3QUMA 3VVWA 1SOKA 4DKFH 2ZD0A 1B2YA 4J3OD 1JZDC 1TQCB 4N2HA 1H9DA 3INUH 3V6OA 2HWZH 1JVLA 3HKFA 3O8XB 2EE0A 3Q0HA 5B1AB 3ESVF 4AUUA 3UERA 1GYUA 1HKLL 3O9WB 3B3BA 2Q76A 4LHJB 5I0WA 3LQAH 1AS7A 4C59B 3NFPA 2EIJB 3QDMD 1DJZA 2E47A 1J1OH 1QSEB 2X5PA 2O5YH 3BZ5A 4LASL 4QJ5B 5IWLA 3QQXA 1NDMB 4ABQA 4XX5A 4JFDB 1LK2A 2J8UB 3VMPA 1G94A 4JHZA 3T1FA 4HWUA 2ZG2A 4YOKA 5F9JB 3RX8A 2HT2D 1Z5YD 5DSCB 3NJNA 3TGXA 3NA9L 3O41B 2FBRA 2P46B 3DGGA 4TQPA 4NZUH 1A22B 1IBZA 3RHWF 2F74B 2H45A 3FU3A 2FHCA 4QOKD 3UPRA 1AOZA 2VABA 4Y4FC 1B0GA 3HUJA 1TZGL 5E8NB 3H3PH 1RJZA 3D1MC 5D6DC 3IJYB 3MGOA 4B95C 5J1SC 1QLRA 1I8IA 4G1MB 1GA2A 2KS0A 4WW2B 3PS6A 1A6AB 2CKBB 5T1LB 4WHTA 1MHEB 4CDGC 3UX9B 4BIKA 1VDGA 1WP6A 4OCSH 5LLIC 5CJ5A 1JPGB 2FK9A 4LIQH 2ZSWB 3W0WA 4JRXD 2G30A 1QEWB 4O9HL 1BJ1J 3S4SG 1QABA 2E7BA 1QR1B 4E2OA 3OR6A 1F00I 2WVTA 1UXSB 3EJZD 2V2WA 2P9RA 5D7JD 2JI2A 3OKKA 1AKJB 3QQ9C 4UT7L 4S10A 1EUUA 2R27A 2J8OA 4RAVB 2N59A 2GEEA 3RPBA 1CDGA 1N4XL 1JXFA 4NO0B 3F64A 5EEYA 3WD5L 4LHUG 1AZBA 1W91A 3BGAA 5DZPA 3REWA 3QDMA 1EO7A 2HTKD 4WFGE 4UQ3B 4X0KB 1KT2B 4JUTA 1MCPL 1AXSB 1GSMA 3SO3B 2J1YA 1CLOH 1EFXB 1PJ9A 2F58L 3TC9A 1YEHH 5CILL 3S88L 4XZ4A 1R5VA 2E9IA 4JDVB 2DL2A 1QSFE 4KMLB 3GIZH 1BFTA 2VCOA 3B2VL 3O6KH 4LLUB 4TUKL 1QNZL 1UM5H 2VN6A 3DVNA 1YMMA 1BVZA 3CH1B 4OLEA 1N8OE 1BD2D 3FSVA 1PG7H 1FWXA 3JTBA 4QOKA 3RU8H 3T3ME 1AGCA 1UADC 2JJTA 1JGDB 1T4WA 4UZUA 4NNXA 4X4XA 3V6FB 5CF3A 2Z7UA 1R17A 1FZMB 1L7TH 3RX7A 1EMTL 2YAEA 3BCFA 1E4XH 2AP2A 3FCSA 2P28B 4NQSA 1XV8A 3CVDA 1K9TA 1XB6A 2E9WA 3F5WB 4QJ4B 4PRBB 2K8QA 4PTTA 1Q9WA 4AT6B 4TUOB 5JDSB 5ES4B 4WY7L 5I15L 2H5UA 1F6LL 5BOJA 4MMZC 1PSKH 4UU9B 3CBKB 4EIBA 1JZ2A 1W9XA 4OQ1A 3LDBC 4OLVL 3MHZA 2RR3A 3QAZC 1ORSB 4G6AC 4UZGA 1KYAA 5DHVA 4NHCL 5EU6E 2WLIA 2LU3A 4AIOA 2EC8A 3UTPE 1ZIAA 3ARFC 3EJCA 3PGDB 3AY4C 5D7JA 2UXFA 3P9MA 4EF3A 2MQ0A 4ATWA 2VE6B 2W9DH 5L2JB 4WFHD 5EHFA 1A3QA 1NCCL 3MV9D 3EOBB 4XN9A 4WJ5A 1KLUA 3LNDA 5FOBA 4YR6B 1FIGH 1MRCL 2NUPA 4J3OG 1HAWA 5CINL 2H0FA 1RPQA 1IM9D 1TZHA 5E2WH 4YHYB 1DEEB 4G9DA 2K6WA 1AMXA 1MFNA 3KEHA 5I6KA 1JFQL 4PP2B 3OVUB 1PL3A 2WJ5A 1IZJA 2EC9U 4LARL 3U2SB 3BW9A 3IYLW 5FV1L 2HJFB 4RNRA 1ZV5A 2XPYA 3MYJB 4Q6YA 5I0YA 4XMKL 1D5XB 2GJRA 5LGYA 1GGCL 3WY3A 2NT1A 1R5IA 4QWWC 5DZNA 3UL4A 4APXA 4KZDL 3TEZA 4X9FA 4BSVB 5C08E 2JCCA 2YD3A 2N1KA 2QDWA 1DBJL 4L9LB 1SPDA 4JRYD 4ZW7A 5HTSA 2YA2A 3NJXA 5A7BA 1IAOA 2ZF9A 4O58H 4ZFGH 4LVOC 5I6XC 4IBVA 5LAXA 2WO4A 1QTPA 2QPSA 1RMFL 4U0RB 5DHDA 3EFDH 4L2LA 3WMSA 4AV5A 1BFVL 2FJFA 2IANA 4JMNA 5C0EA 3QDHA 3UTOA 1G5AA 3BOVA 5E1GA 2BIOA 1E2WA 1JK8A 4BKLB 1JL8A 3CC5B 5F97E 1KTJA 4TRPL 1PKQA 2AV7A 1UJ3C 1XF4A 5KBPA 1SYVA 3G5ZA 3GO1H 2R69A 4LCCC 1PCXA 2V5TA 1SQMA 3PF2A 4Q6IA 5FYJD 5KVFE 5B3NA 5AD0A 1QP1A 3C2AH 3LN4B 4TULL 4R7NB 4M48H 3HC4H 5IJKC 4XX1E 4YNYA 1GIGL 1L5GA 2N7AA 3DGDA 4H8QA 2VC2H 1SM3L 5AVXB 1IM9A 2IBZX 4I9XA 4X80L 1HZHH 2EYSA 2XZQH 3RIAF 4R2GC 2YRLA 2ALWA 3PDGA 1IL1A 4X7CC 3FULA 3ZYOA 3O8XD 2CRMA 4OSUH 4NBXB 1BFOA 4TQIA 4U1SB 3IRZA 3O9WD 2OCFD 1IAIM 4RLDA 5GGSA 1XR9A 1JNHB 5TH2B 4PV9A 4HAFA 1QSED 3NESA 4GG6A 2AXJA 3BXNB 2DIBA 3GBEA 3Q8FA 4GI8A 1YEEH 2X38A 1HJBC 5E8OA 4JFDD 4OQTH 4PRAB 4OQTA 2IXQA 4RA3A 4Y5XC 4BUGA 2C9XA 5C0DB 1SHWA 3OX8B 4JRYA 3OKOB 3UP6A 3ALXA 4MJIB 3I9GH 2HG5A 3TL5A 3VXNB 2Q8AL 4IKKA 1F90H 4QHLB 3EOTL 4M1GL 4NB7A 4K9EC 5I73B 3QZBA 4HHAA 4BK8A 1PLCA 5I1DA 2PPFA 4NQTA 1TTRA 3ASWA 4OV5B 1DUZB 5CZVL 2D03H 4NKDB 3GMPB 1LK3H 4KKCD 5HD8C 4S0HA 2ZAIA 3LQMA 4GAYA 2P24A 5FYJH 5T1LD 4ONHA 1WA0X 3OLEA 4MZIA 5EU7E 3TPUA 4R26L 1FL5B 5B38B 1U21A 1TJIL 3AWGA 2Y25A 4IW4C 5F9OH 4H0IA 2PW1B 3BEWA 5HDBE 3FPYA 3FH7A 5T3XH 3BE1L 4OLWH 4OZFG 7PAZA 4Y5VB 4H8VA 1JMZA 2PP7A 3V4VH 1JZJA 5MENE 4JFXA 3EFOA 5J6GB 4JO2L 1AKJD 1LHZA 5KBNC 1DFBH 3MLYH 2F18A 5I76A 1RLWA 2JKLA 1CBVL 4NO0D 1VPOH 3OQ3B 3HG1B 3O0LA 2B59B 4JY6B 3LPFA 4G7YH 4YUEL 1URZA 5E7FA 1ROCA 3O6FC 4PWJA 1TTGA 5ADPL 2J8UA 3ZSSA 3QCTL 2EDXA 4S1QH 4U6HB 1VFBB 3ZKSD 5HI5C 3PWPB 3DBSA 1CQKA 2FIKB 1XCTA 5GRWA 1AG6A 2G2NA 1LMIA 2X1PA 3UCQA 1JF5A 2D7TH 4FHJA 4HWBL 1AHWC 1QHPA 3BYYA 4IOFC 1RUML 4GRLD 4OJFH 4A7QA 5KSVA 4RFEB 2EKJA 4PJAF 1OV8A 3D0VA 4GAAA 5EO0A 2VGLM 4AMKH 4WW1A 2QQNL 1YQVH 5MEOB 1ZTXE 1J9SA 3LEYH 4KGJA 4JY5H 3FTGB 3CBJB 2C9UA 1JVKA 1L7IL 5T33H 4A7UA 2EDMA 2EAEA 5B1KA 1KLGB 2I9TB 1MHEA 3ISWA 1VKXB 4BCXA 3GEWB 3FTVA 1D5ZB 5I1EH 4NQEA 3SKNA 5I1IH 4NYLB 5H37H 5FM8A 5H37A 3FDWA 1BVKA 1FNLA 2ZSWA 4KXBA 5IVXF 4UOZA 5JLZB 4JKPL 1UYWL 2FH8A 4C4KO 2PPDA 3NN8B 4TSCH 4Z7WF 3LPGA 3U1SL 2F53B 5I0VA 1UWXH 4R3SA 4W9KC 3APFA 4JO8A 1ID5I 2V8MA 1YY8A 4S1DD 5D7SH 2OMWA 1IE5A 3IBEA 1N7MH 1NAMH 1AKJA 3NQKA 4HA1A 1NAMA 1EUTA 4FF9A 3QNXB 3ZKXB 3MRPA 4HKBA 4HT1L 1E6JL 5AAWC 4NO0A 1UD5A 3S3SA 3TF7C 1ZHNB 4ZO6A 1A1OA 5IEHB 4GT0A 4E68A 1CD0A 1QBLH 2OA9A 2CDGA 4JPKL 4EPSA 1EJ6A 2H6OA 1Z9PA 3KGSA 1MNNA 3UDWA 3US9A 4ODWB 4IIQC 1CCZA 4S1SH 1UM4H 5TF0A 2WKLA 3JSSA 3TN0D 5DWPA 3GSUB 3W81A 4JDVA 1OW0A 4XNXH 4OLYH 5DRNB 4LLUA 2NR6A 4PJ9D 3AS1A 4GKLA 2GQHA 1EFQA 4IU3A 4EN3D 4YHZL 2GAZB 4GRLA 4MQTB 1JNJA 2I07A 2WLHA 4KV5F 5A1AA 1N5YH 3HR5B 4KQ4L 4OFYA 4UDUA 1UXWA 3FQNA 4DZBA 1JGDA 4KX7A 4ZPTB 1CE1L 1ZTXL 3DKHA 1RFDL 4YDIL 1KFAH 4YE4H 3IFNL 5L4IA 1QRND 3NJLA 3L2NA 3MRJA 1AS8A 1HTYA 1JHTA 5GGQH 2FL5B 3L3OA 4BWWA 3SDDC 2OI9C 4U6TA 4LCYA 4PI2A 3RI5K 2X4TB 1P4BL 4UIKL 1OSZA 5JDSA 2CHZA 4PS4L 4TUOA 4AT6A 1D2PA 2IQ9H 3OB0H 5K9OB 3Q9QA 3PWVB 3BWAB 5ALCL 4TTDC 1ET5A 3GMLB 2VR6A 1A66A 3IDXH 1LJMA 1JWSA 1KCSL 1TVHB 3CFEA 5IFAL 2VT0A 4M29A 4YVNA 5IROD 3S5LB 3FUKA 4APQC 3WTYA 2VZOA 2BSTA 5HDQH 3BT2H 2COQA 1WQVT 2NUTA 5IK3A 4DKDC 4CSPA 1NEZA 5F9WB 2ADJB 3PGDA 4AITA 4MDJA 3H9YA 1GGIH 3FB6A 5AKSA 1T83C 2X4UB 4HFUL 2KZWA 1T80A 4Q2ZB 2WBKA 1RURL 1XZ0B 3FQRA 3K6DA 4PRHB 4FI8A 1K4DA 3K72B 5CGBA 2VITB 2FGWH 4QRSB 4ZAKB 1QFUH 5DC4B 2Y36H 4MXWH 1VF5C 4XGZB 5HGDB 1YPZF 3PL6C 1RHHA 3CSYB 1QFWI 3MOBL 3ATBA 3X12B 4F7MA 3TN0A 5J9PB 2PTVA 1XFPA 2UZYA 3X3FL 4YHIA 4PJ9A 5I2IA 2OAAA 3H9SB 1BAGA 1MLCA 2DLFL 3Q2LA 4EN3A 1AP2A 3A67H 5AFAA 1I8LC 1D9KB 4L5FE 1IAKB 3HHRB 3THMH 2QBWA 1W16A 4U6XA 2AEQH 3CTTA 4OCYL 4XP1L 3L4UA 4OLUL 5D1ZB 5DEZA 5BV7H 5HJ3A 3MQIA 3VFTB 4UNVA 1RHFA 1QRNA 2SEBB 2NQ3A 3OG6B 4O00A 2R59A 3S36X 2J44A 2NY2B 3NPZB 5DRXB 4PMEA 5A2LH 4A6YL 3DPDA 3A23A 3MJ7B 1MI5A 4MJID 4PJCF 2GCYA 2ZUYA 5F89B 1A02N 4P59L 2VTFA 4FFYA 4RSVA 4X4ZA 4X4MA 1E5CA 1M2OA 4E5XB 5CLXA 1S7UA 1K5WA 1NBCA 1V3LA 4P5MA 1CFVH 5JTWA 4LPUA 5IROA 3U4KA 3JV0A 1YEDB 2ZNWA 3FBQA 5LVEA 4GAFB 1NLDL 4WFEE