1B3IA

Nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (minimized average structure)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
ASVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of plastocyanin from the photosynthetic prokaryote, Prochlorothrix hollandica.
pubmed doi rcsb
source organism Prochlorothrix hollandica
molecule tags Electron transport
molecule keywords PROTEIN (PLASTOCYANIN)
total genus 12
structure length 97
sequence length 97
ec nomenclature ec 1.10.99.1: Transferred entry: 7.1.1.6.
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1b3iA00
2NRDA 3ZBMA 3T6WA 3S3CB 4DP8X 1OV8A 1J9TA 4JHUA 4DP2X 5I5IA 2GHZA 1JZEA 3PPSA 5D4JA 3FYEB 4E9TA 1TEFA 2UXFA 3NJJA 1M56B 1L9QA 1L9TA 2EIJB 2CJ3A 1RCYA 3HB3B 4BDVB 1NWPA 1WS7A 3PLYA 3WNJA 1KDIA 2QPEB 2FQEA 5I6NA 3NSDA 1HAWA 2GB2A 3PXLA 4CSPA 5B3SB 1NINA 4L0PB 2IAAC 2AZAA 4E9YA 6PAZA 5PAZA 2PP9A 1ZPUA 3OMAB 1ILSA 1ASOA 1E5ZA 4CSZA 2PPDA 3MX0B 3WKQA 1AZBA 2HLEB 1AG6A 1JZIA 4YL4A 3UACA 4WKXA 1ILUA 1SNRA 4KOBA 2P80A 1BXAA 1L9SA 2VN3A 4G71B 1B3IA 5B7EA 4EF3A 1DZ0A 3FSWA 1GY2A 2J55A 4KO7A 1FA4A 2AFNA 3EH3B 2BWDA 5EHFA 5E9NA 3OQRA 4BK5C 2LLNA 5B7FA 4M4RB 1IBYA 3ZDWA 1JXDA 2I85A 1ETJA 1PNCA 1KBVA 1TU2A 4A2EA 1BQRA 4AI7A 3KW7A 4F2FA 1AACA 2HX9A 3NP4A 4YSRA 1W8EA 3FSVA 4A67A 1PLCA 2ZOOA 3DKHA 3JTBA 2XV3A 4QLWA 2IDQA 4KO6A 4HCFA 1DYZA 5B1AB 1RKRA 1JZJA 3V9EA 3ABKB 3UADA 2FT7A 4G7QB 1E67A 2I7SA 5I5JA 1PZAA 1GS8A 1SJMA 1AQ8A 1MG2C 4X4KA 3PCYA 4BWTA 3AG1B 4MFHA 2J56A 5D4HA 4DPCX 1CURA 3ABGA 1IC0A 2TSBA 3QJQB 3X1FA 3TBCA 3ABLB 1JERA 2XV2A 3T71A 1BXVA 3NT0A 3UAAA 4E9RA 5TK2A 2MRYA 1AG0A 3SQRA 2WSDA 2Y1AA 1AZUA 3NSCA 2PCYA 4Q89A 3EH5B 2YQBA 1MDAA 2XX0A 3WG7B 3ABMB 5I6MA 1SF3A 3N2JA 4YVNA 2FT6A 1M9WA 4DP1X 1WAEA 1CUOA 2JXMA 3X1EA 1CYXA 2FTAA 3ASOB 1JXFA 3QJSB 1L9RA 4PCYA 4P5RA 4AKPA 1WA0X 1XMEB 1GY1A 1SFDA 4A68A 3WNIA 5I5MA 3QQXA 1JZHA 2CCWA 3UAEA 1JZFA 4E9SA 3ASNB 3CVDA 1ZDSA 2CAKA 2OCCB 4DP0X 4G72B 3N55A 2PP8A 2PPAA 3OMNB 1BQKA 1A65A 1V10A 2X87A 1GS6X 3EF4A 5IY5B 2IWKA 4Q8BA 1NIAA 1AZCA 1OF0A 4E9VA 2DV6A 3CVCA 2XVBA 1ET8A 7PCYA 1L9OA 3GYRA 2HRGA 4DPBX 2R7EB 1EZLA 1F56A 4ENZA 3WIAA 4DP4X 1ASQA 1GYCA 2XXGA 1A3ZA 2IWFA 3NYKA 2UX6A 2VM4A 1SFHA 3SBQA 4HAKA 1J5CA 1MG3C 2B3IA 1L9PA 3H56A 2JKWA 2FQDA 2FJSA 4GY4A 3NJMA 2UX7A 5PCYA 2VSMB 2DYSB 1JXGA 3WI9A 2BZ7A 1A4AA 4YSSA 1AOZA 2QT6A 1BAWA 1RZPA 1PNDA 2GI0A 1PLAA 1KBWA 3IBOA 1YLBB 4YSDA 2HXAA 4TXVB 2IDFA 1AS7A 1A8ZA 2YAPA 2A3TA 1WS8A 1PMYA 1OCZB 3ERXA 4KNUA 1ZDQA 4YVUA 1ASPA 2BW4A 3GDCA 1IKOP 1N70A 5I6PA 3FPXA 3S3DB 5I6OA 5TK4A 3NJGA 3S8FB 2IH9A 2H3XC 3D12B 4YSOA 2XX1A 4KOCA 4AKOA 2EINB 2PP7A 1E30A 1UATA 2WO3B 3IEAA 1NTDA 2IDTA 2VW7A 7PAZA 1NIDA 1MZZA 2XXFA 1J9SA 3NJHA 3DTUB 2EIKB 3AG3B 4KNSA 1ZIAA 4UF7C 3QJUB 2PLTA 3BVDB 1XB8A 4DP5X 1MZYA 3V9CA 1V55B 4HALA 2BP8A 2BHFA 2HX7A 3FPYA 2BZCA 1X9UA 2H5UA 3CDZA 4YSCA 3GXUB 2BW5A 3C75A 1X9RA 2AVFA 1PCSA 2QPDB 2YAFA 3EHBB 2EIMB 1AS8A 3WKPA 4GP5B 4RH4A 3EH4B 4WTQA 2CBPA 1CC3A 3CDZB 1HAUA 1AR1B 4BWWA 2TSAA 1JZGA 3FQ2A 1AANA 1TKWA 2Q9OA 3FS9A 4KO9A 1BXUA 3NJNA 4NAJA 4G7SB 4KNTA 2BO0A 2PCFA 2DWSA 3OD3A 1NPJA 4G7RB 1SHWA 1OCCB 1ID2A 2VW4A 1JVOA 1OE2A 2UXVA 4W9ZA 3NSFA 5AZUA 2XYBA 2YAHA 3G5WA 4HIPA 4YSPA 3H4FA 5B1BB 1NPNA 1PAZA 3AG2B 4M3HA 1BEXA 1N68A 5AKRA 3PAUA 1I53A 3T6XA 3FU8A 4UAHA 2CALA 1SF5A 1BQ5A 1NDTA 2JFCA 1KGYE 4P5SA 8PAZA 3MBWB 3TBBA 3S8GB 3BQVA 3X2QB 5B7MA 3JT2A 4N8UA 3S3BB 4DPAX 3RYMA 1KCWA 4F7KA 1QLEB 1ET5A 3NJLA 4AZUA 1T5KA 2OJ1A 2J57A 5D4IA 3UABA 4A2DA 1J9QA 2H47C 1WA2X 3PAVA 4F2EA 2GBAA 4GP4B 1ET7A 4YSTA 4BWUA 1GR7A 3NJFA 4DP9X 1GSKA 1HFUA 4YSEA 5LDUA 2I7OA 4KO5A 3CZUB 1IBZA 3CG8A 1R1CA 1RZQA 2R7EA 4ZK8A 4BXVA 2GC7C 4HHGA 2XV0A 1BYPA 4K9JA 2MTAA 3QJRB 2ZWNA 4BXSV 2X88A 1NZRA 3ZIYA 2DYRB 1PLBA 2IDSA 1AS6A 3QJVB 5F7AA 2IWEA 2ZONA 1TEGA 4YSQA 1ADWA 1AZNA 1NICA 5B1KA 1JOIA 1KCBA 3TASA 3FSAA 4QKTA 4UANA 3KW8A 2HRHA 3SBRA 4NERA 3X1BA 3DIVA 1BYOA 1XB3A 1URIA 1VLXA 2CUAA 1WA1X 5AFAA 3T6VA 3IN0A 1IUZA 1OOWA 3AW5A 2PPEA 1ZV2A 1KDJA 4A66A 2FNWA 5I6LA 5I28A 1KV7A 4GP8B 3TU6A 1OE1A 4YSAA 5ANHA 2Q5BA 4HZ1A 2XUWA 5B1JA 2IDUA 2YAOA 3OMIB 2DWTA 3NJIA 2E86A 2FWLB 4DP7X 4E9WA 2EILB 2YXVA 2DY2A 2J5WA 2FQGA 2HZHA 2W8CA 1SDDA 3FU7A 2Y69B 4GXFA 1JVLA 2YAMA 5F7BA 3PAZA 1PZBA 3FT0A 4PAZA 2UXGA 4G70B 2XWZA 1A4BA 3ZX1A 2BP0A 1PZCA 2YXWA 1ZIBA 2XU9A 1W6WA 1GW0A 2FT8A 3FU7B 1PF3A 1NIFA 1QNIA 1PY0A 3FYIB 4A2GA 4A2HA 5I6KA 1AAJA 1SHXA 3H4HA 9PCYA 3X1GA 4GYBA 3AY2A 1J5DA 3OM3B 2WO2B 2BP0B 2RACA 1V54B 1EHKB 2YARA 2QDVA 1QHQA 4HCIA 3AG4B 1E5YA 3U25A 4JHVA 3UGEA 5A7EA 1FFTB 3NJKA 1M57B 3FQ1A 2GSMB 1W6LA 1J9RA 3QJTB 2HX8A 2PPFA 4AX3A 3NP3A 3T6ZA 2ZXWB 5FC9A 2AZUA 4HHWA 1NIBA 1GS7A 2N0MA 2OV0A 2YAEA 2BWIA 4E9XA 5B1JC 2FQFA 2AANA 3SBPA 3CVBA 3TA4D 3QPKA 4HCGA 2QDWA 4W1TA 3HEIB 3IE9A 4FAAB 1E65A 4JKNA 1SDDB 4NB7A 2VM3A 1OE3A 3FSZA 3AZUA 1KYAA 2B08A 2PPCA 2IH8A 1FWXA 4FA7B 2XLLA 3L45A 1CYWA 1OCOB 3NSYA 5I26A 2BP8B 2P80D 2VSKB 2GC4C 4YSUA 1XB6A 3FQYA 6PCYA 4E9QA 2GIMA 3FU9A 4DP6X 3T9WA 3X1NA 2VMJA 1A4CA 1NWOA 4N4YB 4BDVA 1AZRA 3IN2A 2W88A 2VW6A 4A2FA 1NIEA 1OCRB 2YAQA 4AKQA 2UXTA 1AIZA
chains in the Genus database with same CATH superfamily
3EJCA 4KZCA 1QFUH 2W5PA 5GSVA 1UADC 5I1AB 5EC2B 3ZHNA 4PRHB 3TN0C 3RB5A 4FLRA 4YDJA 4UT6L 1URZA 4NUJA 5DJZA 1AO7A 4X6DB 3AMLA 4APQD 4GSXA 2ID5A 1X6NA 3HKZA 4OIIL 4AG4L 3FYEB 1P1ZB 3UTSD 1TEFA 3TGXA 3NJJA 1GJIA 4YWGH 3TVMA 3F12A 4X42A 4ZYKA 1WWBX 2ATKB 3W9DA 3LNEA 2VYRE 3WL9B 2F61A 5ETUA 4PJ6A 1IFHH 4JHZA 1NJ9B 4GSQA 3QUMA 3QIBA 4ZYKB 3NQKA 1CQKA 1KIQA 5SX4I 2XKSA 2X4SA 1E4XL 2R8SH 2OJZH 3DVFA 3PNRB 4CSZA 2H3NB 3GNMH 5IIEA 2OMTA 4IOFD 2Q76A 3H6AA 4MVBD 5HYJE 2R59A 1LEGB 2UZYA 3ALWA 3MACL 4ZOAA 5DJXA 4QRBA 4B50A 1AQMA 3SDYL 4G5ZL 2YRLA 1HE7A 4JHBA 1KJ2H 3OQRA 4HWEH 5DTFA 1RJYB 3D30A 4BK5C 4OI7A 1QBLH 1BREA 2E5EA 3L4WA 4ZO7A 3V95A 4XPBH 1ETJA 1KBVA 3UG3A 4IKIA 3WTVA 4AI7A 1C1EH 1DSYA 4KI5F 4N6RA 4UQIM 5EFIA 4X4ZA 3LKPB 2YD3A 4K7PX 1KCSH 2MNWA 1G6RH 1UM6H 3FSVA 1UT2A 4JZJB 2V2TA 3IJYA 1KCUH 3U9WA 2XACC 4KKCC 1G0YR 2A73B 2DQUH 3UC2A 4HCFA 1FSKC 1DYZA 3HI6L 1RKRA 3DYOA 1BQUA 5TDOB 1NDGB 4WI9A 3OQ3B 4OZGB 2FB4H 2CZNA 5E51A 4P07A 1CFVH 5JIHA 5LKNA 3K6DA 2XWDA 3ABGA 2NW2A 4I0KA 5HYJD 5DD3H 1JERA 3H2PA 3TT3L 2MQ3A 4H8HA 1ZTMA 1VADA 3FRPA 4WFEE 4XC3H 1PPIA 1KBBA 4MD4B 1GC1H 4PRID 1H6FA 1AZUA 2BDNH 2XRAL 4J28A 4NZTL 2QADC 1KXTA 5J89A 2FX9L 1XSKA 4OB5L 3SDAA 2X6BA 3D25A 4JS7A 4IU3A 3V4VA 4ONGL 4FNUA 2P49B 1T22B 2CGYA 1QBAA 4KRMB 1MOEA 4DP1X 1N6QL 1MCWM 3VWJC 4WWKB 5BO1H 3W9EA 4P2RA 4WFED 1QG3A 1HEJC 3EGDA 1DLHA 2NY6B 1Y1UA 3QIWA 1GY1A 1I8IB 1XCQA 2KH2B 1FL3B 4HC1H 4L1LA 1WQVT 2LTQB 2VDRB 4UOJA 3VH8A 5KOMC 3GWJA 1W72A 3GBNH 4XP4L 3MLWH 4Q56A 1A6TB 1ZVHA 2E7BA 4WO4B 2EEBA 2QSQA 4K23L 2CJTA 5A2FA 5KN5B 5IQOA 2APVA 3LZLA 2ERJC 3ULVD 4XRCA 1A47A 2VR7A 4W4NA 2ED7A 5C0AB 4ODWA 3SPIA 3UZQB 1W72L 3KCPB 5AOLA 5MEOB 1N64L 3I75B 3IJHA 1GCFA 3H2WA 3SPCA 2OMXB 2WUBH 4LCYA 4U49A 1INDH 2VWEC 1M7IA 1XCWA 2OTUB 3V6ZB 3RI5K 3VDAA 4NO0B 1CU4L 2BOCA 4LVNC 4WDIA 3VO0A 3MRQB 4NBZB 4R5XA 2F15A 4ZOCA 1F56A 3FQRB 1UWEL 2VT0A 3QDJD 1IT9L 1ZA6A 3MRFA 3WIAA 4JY4A 3RVWD 1A6ZB 1XWVA 3IFOB 4XCCH 3VH8G 1GAFL 4PUBL 4HIHA 4DN4L 3B83A 3SDCA 3WN6A 4F37F 1SZNA 1GGIL 1TTBA 4TOYL 2OJZL 5MEPB 4C55A 1ORQA 5BOJA 1H0DA 3QSKB 3M17A 3GHBL 3MROA 2EIDA 3SYPA 2V17L 2DQEL 4H13C 2HVBA 1YEDB 1E4HA 3BPCA 1O6SB 1AGCB 3ZT7A 4L4JA 4NI3A 2ZCLH 1JGEB 2V7HA 5C86A 2DQTH 1JPTL 1R5WA 2XHNA 4N8VB 4P4KA 3C08L 1TTRA 4WGWB 3QNZA 5EU3A 4YWGL 5L2KE 4AXWB 3W0WB 1NBYA 4ODWB 3UZQA 4J2XA 3MV7D 1A8ZA 3AFLA 1WTGT 5AZEL 3IMVA 3TOPA 5E2VL 1CBJA 4PQXA 5HGDB 4MS6A 1T4KB 2J6EA 3UJIL 1QRND 2AXJA 3FRPG 4J3UA 5C09D 5JNYA 5FYKE 3N43F 2HTKD 5B3JF 3TONA 1OP9A 3J27A 2EYTA 2O93L 5EU4B 2WYHA 2IH9A 3JV6A 1U93B 3WY2A 4AKOA 2GW5A 4WEBL 3TIDB 3MJGX 4LP4A 4HH8A 1FORL 1T6BX 1YY8A 1N18A 2EYSA 7PAZA 2H2PC 4AZ8B 1NIDA 3QG7H 2XXFA 1OB1A 4O58H 2ZCKL 2OJEB 4QF1B 2OMYA 4ZMTA 3QCTL 4BFIA 2GTWB 4Y2DD 3T8XB 1RUPH 4DP5X 4LSUL 1SXBA 3QNZB 3V9CA 3L3KA 4PJ7B 2WKOF 2VXQL 2BIOA 2QZ5A 4KQ4L 3CDZA 3RQ3A 1FVCB 2H26A 4L1BA 5HYJA 1NFDE 2AVFA 5GGTA 3LVEA 2K6WA 5EIIA 2E3VA 2V9UA 2MHAB 3EO1B 2WBJC 3WN5B 4OD2A 1J87A 1R24A 3MTRA 3RWDB 2OZ4H 4K94C 4LCWD 5CD5C 1T20B 2L3BA 4P57B 4JG0H 1IQWH 3MNWB 2UWEE 4F7PB 4ZW7A 2E6PA 2TSAA 1ADQH 5FGSA 1BXUA 4Y5VC 4ETYA 1OL0A 4G7SB 4XCNA 3OVUB 4PRPB 2WQSA 3MVSA 2Y7SA 3QAQA 1P2CB 4A7GA 2V2WB 1ACYH 2R0WH 4RISH 4QJ5B 1LO0H 4TQEH 4DZ8A 1U92B 1R6VA 3VXMD 4PR5A 2OSXA 1S7RA 3HNVH 5AKRA 3INUL 3S96B 1AR1D 4JG1L 4UAHA 3QJZA 1J5OL 1QFPA 5DK2A 1TFHA 5E2TH 4JY6A 3SGJC 4AV5A 4EDXB 1SF5A 3GBLA 4FNTA 1JPFA 1WWWX 1U95A 3SDAC 4OFIA 4Z7WB 4AGNA 1KTJA 2VC2H 4I1RA 5EC1A 3BQVA 1UCBL 4MNQD 4HJGB 1JZ6A 3E0GA 2WBWB 4YN3A 3HLAB 4MXWL 4G11A 1MHEA 4MA7H 4OZ4B 4F7KA 5KN5A 3C87A 5E9DE 1G9NH 4Y5VA 3GRGA 4FFYL 2IMNA 2E6JA 3P54A 5FUCC 4AGOA 2Q2EB 4XMKL 3VXTB 1DVUA 2YKKA 3JBG7 3QCUH 4P57A 4NI6A 2XZCL 1I3GH 2ZXDA 3O6LH 4Y2OB 4N8CL 2DKUA 3LB6D 2L04A 4N2MA 4OLXL 5T3ZE 1N59B 2AJUL 3BUYB 3F2LA 3TNMA 1R1CA 3H54A 2MCMA 1JP5A 5D7HA 1DEEB 3DUSA 4Z7IA 3CNKA 2M2DA 3HVNA 1A25A 1GGCH 1HILB 3G5VA 3WE1A 3QR0A 5T5NG 4WI4A 1XF3A 4RMBA 5I74C 1NOAA 4OUOA 4HF5H 3SKUD 5C0RH 5TDNA 3LNDA 4WUUD 3S34H 4JN1L 3FAWA 4NRZA 4IYKA 2WP3O 3EO0B 2JQMA 3N0PB 4X8JA 4GRWH 3MNZB 1SLUA 2VO5A 1VLXA 5IQLA 4CVXA 4UIMA 1HDMB 5ESQB 2CDGA 4KMTL 3IN0A 3GLDA 3MOAH 5C0EB 3AGWA 4ZNEA 2JKJA 2NNAA 2NY5H 2VDMB 4QHNA 4QD2E 2A2QT 1P7QD 4PY7A 3MLVL 4I18B 4Y2LA 4ZZFA 4R4FL 1U2YA 4Y1AD 2E4TA 1R0AH 1A1MB 5ICYA 5J06A 2GJ6E 1RIUL 2C4FU 4I9XA 3BSZL 3TPKA 2Y5EA 2ZIDA 2J88H 4NQEE 3DX9A 4IHOB 2CD0A 3U2SA 3S5LG 3KLHD 3FNKA 4XC1L 2BY0A 1MI5A 3J2PA 4Y16B 2ZYIA 3KLSA 4BQ8A 3MRRB 3X1GA 5DJ8A 1CF1A 4NRYB 4HF5L 4NZJA 2WINB 4PMEA 5LCVL 5DRZB 5KYUA 3GMPA 2G2PA 3VI3F 2OMTB 1KTDB 1GW6A 1J8HE 4PS4H 5MI0C 4ZG1A 4UOQA 1HJBC 1J5IA 4YHLH 3ZZ1A 4BQ9A 4XX5A 3QE5A 3T0DA 2VXUH 4QRTB 4N2HA 4M7LH 4PBWD 2I24N 3NP3A 4LLMA 1CICB 5CFAA 3FFDB 3FQWB 3MODH 4L1DA 4EOWL 2DEWX 4E9XA 2GTZA 3WNLA 4Z8FH 1QUPA 4QXTB 3G08B 1JXKA 3N1QC 4PI0A 3NIGF 1Y18B 4FQJH 3SDXA 3D2UB 4HPYH 3T8MA 5J1AB 4JKNA 1WTLA 5FWQA 3LEYH 4B9PA 3PYCA 2P8LB 3O9WB 1KFAL 3KPOB 3QI9D 3QXVA 1R17A 2DZEA 3FK3A 1D3CA 3I3DA 3KYOA 3PWJB 2CM6A 3WHE0 2NUTA 5HGAA 3L3DA 4PEEA 2J25A 1I1YB 2Z9TA 4YDJB 4Z0XB 5E6ID 6FABL 4AVIA 4RDBA 4ANVA 4OGQC 5F0MB 5HHPB 1WV7T 4JY6B 2R2CA 4AMXA 2F1AA 3MGOB 2UZPA 2VW6A 3P2DA 4OD3L 5CBEB 1FNAA 4LGSB 1SN0A 3DROA 2F7IA 3OWEA 1Y6KR 3SY6A 3IPBA 2Y22A 5JMRA 3K4AA 2WKLA 1JF1A 1TO5A 4XTRD 1IC7L 5AD0A 2AXFB 4NQCD 4O02A 1AR2A 3LEYL 2D2CC 3NGBC 4M1CD 5E8PB 3RWCA 4BGLA 5HVHB 4NS0A 3QC6X 2X70B 4OJCA 2WW8A 1X3DA 1OLLA 4MMZA 3V0VB 3MODL 5BS0B 1OP5H 1GVIA 2W9DL 3ZKNC 1DDHB 1MW3A 1ZJBA 3EBHA 3NZUA 4FG6C 4YHNA 1JZ4A 2ESVE 4IK6A 1ZGLB 3BAEH 3SHSA 2BSRA 1FBIH 4ONFL 4Y5XA 3LSOB 4LZKA 3IDMB 4H0HB 2OYPA 5EU6A 3N1GC 2P44B 5DR5L 3GSXA 5LCVH 1QEWA 1FL5B 3OB0K 4WKXA 2YPLA 5DJ2A 5DS1A 43C9B 1MFDH 3RUGA 1VFBA 1WEJH 2VDML 4O58L 5C07E 3EH3B 1RH8A 1UJTA 4RQQB 3P0YL 5ACZA 2W0FB 1U4EA 3HG1A 2ZXBA 1HEZB 2J8HA 4UT7H 1SM3H 3UBXI 3BMWA 2UY7B 4EQ2A 3OPUA 5HTSA 3EGXA 2Z8RA 4MSWA 4ZMQA 3FO0L 1AACA 2HX9A 1UUNA 3CXHJ 4NNYA 5L2KA 1NKOA 1V27A 3L7FB 1BFOB 4R0LA 4XNXH 1IMHC 2C3XA 2ENYA 3OF6A 4WQOA 5FW7A 2C5DC 4KDWA 5JORB 2EKSB 1LP9B 1HX0A 1X9LA 3C09B 1KCLA 1CZ8H 1OGSA 3CC5A 4G8GA 1LK2B 3UGXA 5B1AB 5FECB 3MLZL 1HH9B 2IAND 5ALBL 2FT7A 1F02I 2ARWA 4R4FH 2WZPD 2EO9A 2AJSL 5IFJA 3ZN6A 4Y9BA 2JK5B 3VXMB 3PCYA 3LKNB 1CQYA 4NO5B 1YY9D 4YGVA 5SX5K 3N1MC 2W65A 5D4HA 3LDBB 4JFPA 4I77L 4KMTH 3IDMA 4NSKA 2ZKWA 1AJ7L 1FE8H 3ARXA 3PJSA 4PY8J 4D9QD 4Q9RL 1IC5H 5E8NA 5DZOA 4HKJA 5EUOB 3PNWB 4G1EB 3JUYA 3E1F1 3ZE1F 3VFGL 1JWMA 4OBRA 2ESVD 5IB2B 5GS2H 5D1QD 2XG4A 2NW2B 3PE9A 4JPWL 5FKAA 5EU7C 4NWTL 3MO1A 1WCBA 5F3BB 1UM5L 4F1ZA 1NBVH 1TYRA 2YEZA 3OB0H 3QRBA 3NRFA 3CZNA 1SN5A 2FT6A 4MJ4A 1YNLL 2X4NA 3BHBA 4FZEH 4ZTOH 3T77A 1SEQH 5AAPA 1IT9H 3ZDXB 4PJ5E 3BP7B 5EZLB 4X7CC 5F97E 1FLRH 3QJSB 1BM7A 1L9RA 4W70A 4BEIA 2OP4H 3R4DA 2FX7L 3ARVA 1R3HB 5DD6B 4NWUH 5CJOL 5DFTA 3RVWC 1NANH 2DRUA 2ZXCA 3KPMA 2ADJA 1JZFA 3TFKD 2BOBA 1XD1A 1XO8A 2BNQA 2R69A 4PR5B 5KBKA 4FMVA 2K4AA 1I4FB 3V4UH 4BKSC 1I1YA 4Z0XA 3U1SH 3BC9A 3KCWA 2FZ3B 3KHQA 4B9YA 1T04B 3OMNB 2F58L 3BMVA 3QUYD 5AB0A 1DUZB 3X14B 1LMKA 1KJ2B 1S78C 3OKOA 3UOAB 4RFOL 1HSBA 1MVUA 1VCAA 4KI1A 4OSUH 2QV4A 4MD0B 4W9DC 3THML 5I8EA 1WCBB 5JIIA 1G7HB 1F4YL 3F7VB 5H4YA 2DJUA 1G5GA 4PWJA 3CDYA 1RLWA 2P5PA 2RH0A 2H0EA 4P59H 2R0WL 1CD1A 2XVBA 3DX7B 3LQAC 1L9OA 1XGTB 4Y1AB 3IWUA 1HDMA 2GPZA 2J43A 5ESQA 3TEZA 4GLRH 1J5HA 3D07A 1KLGA 4JN2A 1AP2A 4D0BA 4TPRL 4TF4A 1ASQA 1UASA 1X7QB 2A6IB 4LKXB 1CT8B 3LVTA 4W93A 2MCAA 1RJYA 4RFEB 3DGCR 1RPUA 3NFPB 2D3VA 4OKVB 2Z64C 2XRAH 4JPKL 2DIJA 3F84A 3QH3B 1LD9A 2FJSA 3F7KA 1GC1L 3BXNB 1JGDA 5D1XB 1T1ZB 2CLRA 3U46B 1T1XA 1CT8A 1YJDL 3LPGA 5ACLA 1OSZB 3N44F 4NX0A 2NQ3A 2OR9L 2ZX8A 1OT1A 1BVKB 1KBWA 5AYUH 4NQQA 4P23C 4PJ9A 4U3CA 3VWKD 1M05A 2W0LA 4CVZB 1Z5YD 2ZCHH 1WS8A 4FQHB 2Y36H 1F4AA 3FOMB 3ERXA 1WUNT 3WKYA 2YQ3A 3C5ZB 4Q9QL 3SQBA 2ADFH 4UQ3B 1UEYA 5GXBB 2BNUA 2OPCA 4XE0A 4OM0L 4R2GD 5BV7L 5KSBE 1UWXK 3S5YA 1RZGB 2Y07H 3GUTA 4OGAD 1J05A 2XG5B 1FV1B 2WVVB 3JT0A 3NJGA 5HGDA 1RVFL 3S8FB 2WYIA 4NQEB 3ZKMC 3LKPA 2OKMA 2NQDA 3IMSA 4MNHB 1NOLA 4LVEA 4XPBL 5K9QG 4IDJH 1JYVA 1REIA 3VXSA 1HKLH 2Z91A 3BGMA 1UZ8A 3SDCD 2PXYC 2BFVH 1IU1A 3ILPA 3JTSA 1SJEA 3LX9A 5M95B 5DC9B 5I23A 1XB8A 4G42B 5B21A 1U8JB 3C08H 4FJ6A 3ZE0F 4FQQA 1VERA 2ZCLL 1JF5A 1CI5A 1GCYA 1U8LB 4ZZKA 3QZWG 1WAAA 4BSWA 1SXAA 4J6RL 4ZUSB 3UTZB 2O5NA 2DLIA 1QLRA 3VD9A 2FWSA 3R4RA 5EZJA 2APTA 4UNIA 4A55A 1RURH 3ZDXE 2ZNXA 1KXVC 4N25A 1EO8L 3PU7A 5I30H 1IGML 4DOHE 2OYKA 5AG9A 4QO1A 5AKSA 4A7UA 4FULA 5A2AA 2H1PL 1AXSA 2P28B 4KO9A 1S9KC 1EEUA 3VFUB 1G0DA 1SJHA 5IW6B 4TSCL 5E9DD 4AM0Q 2FLRT 5KSUB 1UHVA 2MIZA 1EUTA 5IVNA 1HHGA 3B7YA 3KPOA 1E9PA 4PP2A 3SO3B 5K9OB 2HJLA 2CGRL 4CSTA 4KKBC 1SUHA 4ZXBD 2H7WA 3MMEA 3SQOH 4APQC 5IHHA 5JOEA 4DEWA 2YK1L 3V0WH 1U8PA 4B96A 3EJSA 5T33L 4P2RD 2E7HA 4RGNB 5IHZB 4FQXA 5IW1B 3TO4B 5DMGC 2X10A 1BOGA 4K23H 2BSSA 5I0VA 4Q9QH 1PQZB 1LDPL 5IBUB 3JT2A 3K74B 1U2CA 3LRKA 3GM8A 1LQBC 2Z8VC 4UT9L 1Q9LA 1SPDA 1J1OH 1YECH 1ZTXL 3MREA 2GSIB 2BZDA 4PRBB 4P5TD 4Z7NE 3CFBB 3QFJB 2EABA 4MJ5A 3VRIB 4GXUN 5EU6E 5F1SA 1XGUA 1C9SA 5TDNB 4N28A 3OJVC 5DJAA 4G9DB 3OHMB 5JMOC 2APXA 2ROYA 1IBZA 2XFXB 3FUKA 4HGWB 4NN5B 2AABH 1A3LL 3IDUA 4KRNA 2EC9T 5JIQA 2CO4A 2VDLL 1BAFH 3QUKA 4ONGH 2VDNL 4N0UB 3D3VE 2AQ3A 3GXDA 3CFJA 4S1SH 1YPZB 1QPXA 3U2JA 5ADOH 1CCZA 3VD5A 5C0NC 3QNFA 2IDSA 5DQJB 5FECA 2Q8BL 3MV11 4UTBA 4AL8C 5C6TL 4GRLD 3BD3A 1AZNA 1GTFA 4GKSB 3KPSD 3WLWC 1JBJA 3PABA 3TFBA 5EEWA 5GRUL 3MA7A 3BPNB 3SZ6A 5A6IA 3L4UA 2UY7A 2PPEA 1KGWA 1T2JA 2FNWA 1S7XA 4NJAH 1QEXA 4ODXA 3R18A 3OKNB 3DK2A 3UAJC 2XJKA 5HYQB 3F58L 3MN8A 3KPQB 2D4FA 1HI6A 3ATAA 4JM2B 4PB0L 3Q06A 3V0DA 2R83A 4KUCD 4DP7X 5E03A 4E9WA 2ZCZA 2Y23A 4W9LC 2W8CA 3I3BA 4DF9A 5IQNA 2GJZB 2DYPA 5H4ZA 4AEHH 5F7BA 2BVTA 5ID0B 5JZ7D 2H6OA 3Q2VA 4HH9A 4KJQC 4TLKA 3U36B 4TUUA 4PJBE 2DQDL 2XQ0A 5D1ZA 2OP4L 3WEBA 3MV9D 4HWEL 1KJ2L 1QNIA 1FZMA 5BJTA 4OU3A 2MSPA 3BYTA 3BAWA 4GYBA 2H1PH 3AY2A 2RACA 2P24B 4ZTPL 1UH3A 2OR8A 1Z7JA 4FQQB 4RBPH 1C7SA 3LEVL 2MOGA 4JEGB 4F2ME 3L9RA 3QORD 2OCJA 1NBVL 4KQ0A 3HHSA 4R6UA 4I0PD 4QHMB 5CD3A 3S37H 2VZOA 4H5SB 4N2CA 2EUWA 1UFUA 2ZUXA 3IDYB 3QJTB 2WINA 2A6DA 2GT9B 3V5HB 2C26A 1YUHB 4Z7VE 3Q6FB 4BGDA 4Y4HB 5AW0B 1CE6B 1E6OL 4AWJC 2K4WA 4XBGB 4RDQG 2FQFA 3LKOA 4WTWA 3SBPA 3TBVA 1JPFB 4FFVD 1A2YA 3D50A 3HEIB 4WU5A 3ME0B 4P2YA 5ICXB 4QLRA 2WIIB 4AG4H 1QTPA 1T7XA 4D94A 2VERA 4P9ML 1LXMA 1NEZG 2NYZA 3EYFB 3KPNB 2BK8A 2WWKT 2AJSH 5D7JD 2QGDA 2IPTL 3RKPA 2WC7A 4MKMA 3WMSA 5KVGL 1MCEA 1V8HA 4LCWA 4JKPH 2NY4C 3V0HA 1L3NA 1FAKT 2N0KA 4Q6IB 4OTXH 3MRBA 1MLCA 4DP6X 1TETH 2OQJB 1KPUA 4JO1H 4HJTA 3GJFK 3KEDA 3KD4A 3FN0H 3NEOA 2DMHA 3ML8A 4XPGH 4WTZA 3T3PE 2ZOLB 2W60A 3A67L 3P9LB 3M88A 4S1RL 4L3ED 4LL4A 1U8MB 3T5WA 4A2FA 4N0CD 4C4KO 2QADB 3PXLA 1A5FH 2UXTA 4LVOB 2NRDA 4UT7L 3C2AH 1O9VA 3ZBMA 3AS2A 4LB8A 1AHWA 4B9JA 4WU7B 2G3ZA 3CMGA 3HRZB 1F6AA 3MR9A 4TVSa 5TE7H 4DP2X 2BM3A 2V5YA 2Z35B 1NSNH 3QZBA 3CCHB 4MHHI 4HS6A 3X3GH 3V79C 4RRPA 1GHFL 1MCPH 4UBDC 1U8NA 4IBYA 4AGQA 2CJ3A 3V0FA 2R2BB 4WTXA 4LEOB 4GQQA 4JFDD 2O30A 3UMTA 3CFBA 3FAXA 3QFJA 3QJFA 4EXKA 1HXMB 2QPEB 4DKDC 3PGFH 5FYLD 3ZPDA 2WQXA 3L9YA 4NQCE 4KXBA 1NINA 1RZ8A 2OA9A 4BINA 1AH1A 4QOKA 1M2VB 3O6MH 1WHOA 4GT7A 3O0LA 5LBGA 2ZWSA 2O6FA 5JDSA 2FD6H 4WGVB 2BXYA 3FB6A 5F9JB 3VGDA 1BFOA 1X4ZA 4R0LB 2WLYA 3A6OA 1RL1A 4F24A 4XAWL 4WI2A 1B3JA 2YQ2A 2ATKA 4UNTA 3VD1A 1HH6A 1JRHH 2C3VA 3O2WH 2O6EA 2AJZA 1PZ3A 2ZD0A 3U7WL 2ZX5A 1A6VH 5FK9B 4IEFB 1NFDF 4I4WA 4JQIL 5DO8A 3Q5YA 5JNYB 5LXVA 1P6WA 5GIRB 2G75B 5JHLA 2W07A 4AUUA 3VE0B 2VXTL 4M62H 3ROOB 4UIKH 4TULL 3IGKA 2FUQA 4CVXB 4JDVB 3WS6A 4G3YH 2F54B 4CMHB 1PFOA 4JFOB 3WDJA 4F9LA 4WCYH 2VRQA 5IROA 5KAQF 2WXKA 5E9DB 2B4CH 2ORBL 1AGDB 1MCQA 4MNQA 4LEBA 2O4EA 5ANMB 2EDFA 4A2LA 4DQOH 5JXED 3O8XC 4JFFB 1MCSA 3ZDZB 1JZ7A 1SRDA 1FNEB 3RVUD 1G7JB 3C6LB 5JPNA 2DM3A 4JFED 1EZSA 4FQCL 1XXDC 3VGFA 2OZ4A 3FL7A 5F7DA 2NNRA 3CSPA 2QTEA 4MJ6A 5C9JA 3T77B 1HE8A 2FCBA 1GJUA 1K4DB 1HQRB 4RGND 5ISZE 3GMLA 1CLZH 32C2B 3PL6A 1FPTH 3IAPA 1ETA1 2XBDA 4KMLB 4ANKA 2MHAA 4GUPA 4NRXB 1FAIL 1XF5B 5CSBA 1MSPA 2Y1AA 4OLUL 4M7LL 1YYLH 5AYQA 4Q89A 3VXUA 1H19A 5FV2A 4BHUI 1N67A 3K6IA 1MDAA 4M5ZH 4NC1C 4TSAL 5F1KC 4MS8D 2WMPA 1EGJL 2NY3D 2FEDD 1A7PL 1WE5A 1PJWA 1LILA 2X3AA 4JCLA 4JFOA 2X2UA 4JREC 1WAAE 2L4OA 1N8ZA 2QLVB 3FT2A 3HRPA 2OFQA 3QEGH 3UTPD 5J11B 3I85A 2P5WA 4PSRA 5E4EB 2B8OT 2IBZY 3EJTA 3OX8A 1M71A 3O3EB 1S7RB 3A5VA 4J5VA 1N3NA 3X12A 4JZOB 3QYMA 5HSFA 2HLAB 1MCIA 1Y6NR 2EDEA 4JO5A 4R7DA 1D5ZA 2IH1A 1ACXA 2VUKA 1E4JA 4E5XB 5IWLA 3QDGE 5K39A 3WFEH 1KGCE 4XXWC 5J1SC 3BKJH 1P5UC 4OGYL 4P46C 5CWSB 4HS3B 1N4XH 4WWKD 3T4YB 4WWKA 2YLHA 4PJAE 2XQBL 2OTWB 1NEZB 1DJIA 3EOAB 4PJHB 3PWUA 5KYXA 2CKBA 4OGYH 1D5XB 4JQVC 4BCYA 1QFWH 1JGVL 1FFOB 4N0CC 4PRIA 5ICZA 2ALWA 3P40A 4XVOA 4U05A 5H94B 5LWYL 3OR7B 4MCZB 4QJ4B 1OAXH 2AK4E 1Y07A 3GHEL 3FB8B 5D6DC 3HFMH 3UPCA 1OF0A 2YMTA 4E9VA 1PG7L 3GK8H 1H8SA 4HJSA 4JFTA 1FVCA 1Q94A 4WO4D 4R84A 1VSCA 2B14A 3CCHA 1Q0XL 1DEEA 3DUSB 5I71C 3IMWA 3GBEA 4FKHA 1W0YT 4AQAA 4N8VA 4MTMA 3BUDA 1EGJH 4Q14A 3SE4A 4F3FB 5DR5H 1EVUA 1I1RA 1SFHA 1XGYL 5EWIH 1NCBL 4UU9B 5FIEA 5F7HA 4TSAH 2JKSA 1TVHA 5FA3A 3MV9B 3BESR 4OCRH 3O6KH 4XAKE 1Z1WA 2GIYA 2G60H 3FQRA 1NEPA 3BVTA 1CLZL 3QDJB 1R19A 4UI2A 1I3GL 4QXGL 3DIFB 5GPRA 2N1TE 3DI3B 1PG7W 3A4FA 2GI0A 4LASL 3LNFA 2VLME 1C08A 2BSCA 3U83A 3B6SA 1NCDL 1IC7H 1LE5A 4EJ1C 3K2UL 4EDXA 1SOQA 2DWYA 4BKTC 4MBRA 4MMYB 1KCVL 4NP4H 3MRPB 3C5ZC 5J8OA 1WGOA 1IKOP 2FHBA 3Q43A 4Y4HD 1H3WM 2WLLB 1RHFA 3KNBA 2EDWA 4WCYL 2W07B 2ADIB 3QIBD 4MQ7B 1W9XA 3I6LD 4NFCA 4QHMA 1YY9C 2WXMA 4E9LA 4H20H 4OW6A 5GGQL 5BXFB 1G7PB 4FFTA 4K7FA 5HD8C 2CLVA 4JE0A 2R1YB 5K33A 4ANUA 2FBOJ 3TT1H 6FABH 5E70A 2BMKB 3MRNB 5T5FH 4JNXA 3BOVA 1V05A 3D0VB 3UTZA 3I9GL 2Z93A 1J0KA 2CDEB 4MA1C 5DZJA 1RZIA 1WO2A 2HCZX 4NHCH 3V2AR 1LHZA 3O2WL 3VWJD 1DLFL 4U1NA 3NCBB 4XAWH 4JGJA 4HPYL 4C47A 3GSNB 5AALA 1KCRH 2Y24A 4HSAC 5JW5A 1VKXA 2VIRB 4XBMA 1YMMA 1KF9B 4L3EB 3EZJB 2H5UA 1BBJA 2KL6A 1HHHA 2CU9A 3MRLA 5AOIA 1ZT7B 4EOWH 3K80A 3TBWA 3DNKA 5H37A 1FG2B 4U1MA 1EIBA 4R7LA 3ECWA 3U2SB 1RMFL 4RAUB 4PS4L 3BZFB 5C0CA 4BZ1A 1J0JA 2RR3A 1F3JB 3PY9A 1JPSL 4FG0A 1MCPL 1S9WA 4PJ8A 1RUPL 3FQ2A 3MUJA 5SWSD 3L16A 2JI3A 3NZSA 2CBTA 3I6LE 5EIIG 5I1LA 4M61B 3MRJA 2R51A 4MB5A 2BCMA 3FQUA 3QUXA 1H15A 5HYSG 1EH9A 2CO1A 4XMZA 4LCWB 1M71B 2K6YA 4IU2A 4N0FB 5B4MD 3KJ6L 1N68A 1NAMB 3FH8A 1I53A 4FGMA 4F7MB 1G4MA 4YZFF 4KH9A 3VRLF 4EN3B 4M4PA 1BQHG 3ZTJH 3BKML 3GSWB 3AXLA 2JFCA 1KGYE 3MLYL 3LQMA 3FT1A 1EDHA 4O9HL 4HGWA 4JKLA 4G7VL 3ARBB 5M7QA 5ITFB 1EXGA 2CHNA 1V7ML 1YUKB 4L4TA 4OZGE 3LZOA 2ADGA 2D31B 1T5KA 3KXFB 4PRNA 2GKIA 3UABA 1KJMB 3E38A 1N2RB 4NQSA 2F54D 3KLAB 3O3BA 3T08A 4RIRA 4KRPD 2R9HC 1HHIA 1AKJB 1RUML 1L6PA 4KKBD 1MELA 3V6FA 5I2IB 4YHZL 3WIHA 4WNJA 5IMMB 2YWYA 2CG9X 3QNXA 4QCIA 1J8KA 4BXVA 2ATPA 2D0HA 1DVFB 1SJXA 4HCRA 5CBAA 1PZDA 5CZXD 2TRYA 3L8QA 2A9ML 4B9IA 4BQ6A 1H15B 5JA8B 4I0PA 1K8IA 5D7LD 3H7BB 3QJVB 1AS6A 4QOKE 2IWEA 1KEGL 2XKUA 1ZLUK 2ZONA 2OMXA 1FAIH 4U1JB 4HEPG 1QYGL 3HAEB 2AXHA 3FSAA 4J3OH 2IPUG 4I3GA 4J4PD 3C8HA 4RCAA 5EZPA 1SN2A 4CJ0A 5HPMA 1QW8A 1CGUA 5K59F 2R29A 1F6LL 3WDIA 4BQCA 4WW1B 3S9DB 4G8EB 4UOW1 3IJSA 1S9VB 1N5AB 2YD2A 4MA7L 1WBXA 4MXWH 2CBOA 5CNHA 5ANHA 4KHTL 4WUUB 5LG1A 3T1FB 3LNGA 2B4CL 3OHXB 3SZKC 5B39A 1OTUC 3TZVA 1JZ5A 1I3UA 1DBJL 5LGHL 1QHOA 2J5WA 1E9OB 1EUUA 2GTQA 3LQZA 3B43A 1A1NB 3QDGA 5G4OA 4Z7OE 3F7RA 4JFXB 6TAAA 5C0FA 2Q20A 3FT0A 4FHJA 4XT1C 4U0RB 5EULV 4NCC1 2JCWA 5LO7A 5KYUB 5F6IC 4XGZA 3QZMA 4HISA 4OZHB 1SY6H 4UMSA 4HPHA 4CJ1A 5FKAB 12E8L 1RUQL 4X7FC 4A2GA 2EVFA 3ECUA 4DKEH 2IBGA 2O5ZL 2SEBB 2WVUA 1NGQH 3VCLB 5I15H 3FTXA 3BGMB 4GXVH 3CQFA 3PFUA 1KY6A 4WGKA 3FCUB 5HHOD 1OQOA 5IK3B 1IM9A 2K9FB 4GKNA 3NK3A 1TENA 4LAJH 1SYVB 3VFSB 1KBGH 4IIQC 1FJ1A 4NO5A 1ETZB 2I27N 4Y1TA 3UO8B 4QRRA 3KYOB 3PWJA 4YHPB 4RDQF 4IEFA 5IWLC 1A66A 4XC3L 1IAKA 1OPOA 1U8HB 5BRQA 2YBRA 4LRIA 2CR3A 2VH5H 4UCFA 4AYMC 3UZVA 1R3JA 4LPXA 3L6FA 3UERA 5DWPA 3U4KA 4K3HA 4C83A 5D5MA 1BQHA 2ITEA 1ZTXH 2JKNA 3MZTA 4DSYA 3IKKA 1IKFH 2D7OA 2FSEA 2QQNL 5TGBB 1F58L 1CYWA 3N41F 3FRUA 3LH8A 2JV6A 1CICD 4PS3A 3MGOA 4X8JB 4PG2C 2Z7YA 4OV5B 2PYFA 3CUPA 4DN3L 4FI7A 4JANB 2CUMA 4PLJC 1B4TA 2GG1A 4N22A 1DBBL 1I9RL 2DKMA 2X1WL 3K3QA 1N8OE 2GQHA 5DA0B 2R0LH 3QDAA 2DLTA 2ZTBA 3QI9B 4NEHB 4OVVA 4XCFL 3G3LA 1OCRB 3UJIH 1QBLL 3FS9A 3EJZC 3TP4A 2ICES 3BZDA 2VL4A 3QDMA 3TJHC 5I73C 1HILA 4S11A 4JHUA 3PF2A 1RHHA 4BUHA 1PZSA 4NQUA 1AR1C 3Q1SL 4LMQI 2EO7A 4KHXL 5IVXE 2HLFD 5BS0A 1IE5A 3CFEB 3HMWH 4YXLL 1PS3A 3OKEB 3LS4H 2GJPA 1F11A 2PTTA 3QIUA 5EBLB 1MEXH 1KYDA 2AJYH 5DK0B 2ZOKA 4OAWB 3IFOA 3US1A 5AUMB 1T5XB 4A63A 2Z4TA 1KPVB 1JMXA 1KDIA 5IB3B 4R96B 3S36H 2IH3B 5IM7A 4MLSA 3G9VA 1ZSHA 2AZAA 5ID1B 2WKGA 4AVJA 5FYKH 1COBA 4XBEH 3RTQC 2ZUTA 3A0OA 2RFXB 5AW5B 4TOYH 1KELH 4LPTA 4M6NL 1N3NB 3B3BA 5C3TA 3HLAA 5KYYB 3JWNG 3C5JA 3IFPA 3WV0A 3HMWL 1HU8A 2BFVL 2WNGA 3T4AA 3UP1A 2NCEA 1NDMB 2AFNA 1NMAL 4L9LC 3BDYL 4FQ2L 2YPKB 1HKLL 4Y7OC 3AMKA 3HG1E 3B7RL 4NC1E 4H40A 4WHYH 2DQDH 5HPMB 5EMYA 3TJEH 2IQ9H 3GMQB 5L0QC 1O75A 4YAQB 4L3EA 5I82A 3RKDC 3TH2T 1ED3A 1W8EA 2VITB 3QO1A 3NA9H 1I7RB 3QXAA 4LF3A 3AT9A 3GINA 1EHNA 2XV3A 3QIUB 4M9OA 4X50A 5EBLA 2PO6A 1JK8B 4PB0H 3NUKA 1DLHB 3HAEG 2DW5A 1DJHA 1SMDA 3MLWL 3EOTH 3G5ZA 2NTSP 3LKSB 4G80B 4I2XE 4I3RL 3D0VA 5KSBA 1QSED 3AVEA 1ZD6A 5K9JH 2CBMA 2EEDA 2B1HL 2DMGA 4Z78B 1AQ8A 2AV7A 4BWTA 4IIZA 4POZC 4CKVX 1B6UA 5IB2A 3RWGA 3FTGB 1OTTD 1WLHA 2PCPB 3LIZA 1S8DB 4NFDA 4PBXA 2Z7ZA 4NO0D 1YJDH 3GSUB 4C59B 3QP3A 3WKML 2J73A 4NQDE 1HOEA 4PVBA 1MHPH 3CBKB 4EI0A 1MAJA 3ULSB 5ADOL 4YO0A 2NDFA 3NESA 3H8NA 1Q0YH 3ZW3A 1E5CA 1M9WA 4W4OC 2NXYC 3VI3A 1JD7A 4R83A 2W91A 2BDNL 2C1PA 2DWDA 2XA3A 1KPUB 3SKNB 3BT2H 1VPOH 1RJZA 1RUQH 2EH8L 3DO4A 5HDLA 1JZ3A 4X5WA 4AKPA 3ZDYE 1U8HA 2ZJSL 4GH7B 4TNFA 2WKOA 1DVFD 1XVSA 4B0MB 1TDQA 5AG8A 2C1PB 5A2LH 3UTSA 4D8OA 3THMH 5CSZB 2BSTB 5FR3A 5HYSB 2IADA 1TJXA 1NFIB 2GUOB 2OCCB 1WBYB 4NPKA 5AAWC 2ZP9A 3RUGB 4Z7WA 3MV7B 2F7PA 3SPJA 3KPNA 4NQTA 3ETSA 4JJ5B 5JIKA 4F8QA 5AVQB 4YDIH 3BVVA 3L5HA 4PVNA 4KHTH 3EF4A 2PN5A 1BCIA 3V4UL 5GZOC 3G5YA 3E2HB 1KJVA 5C09B 1FCCA 1QPKA 3P1VA 1G6RL 1UM6L 4TNWK 4XI5C 3PHQB 4EO5A 1BBDH 3MC0A 4KTDL 3ZL1A 5LVEA 2VLKE 4KVPA 1AZCA 2CGRH 3UROR 1MY5A 3V6BR 4CW1B 3NCXA 4Y5XC 2NY2D 1JF1B 4OCYH 4DKTA 5MEPA 4XX1G 4K3JL 1M3JA 3F5WA 4JFYA 1B2YA 1F11B 5E4OA 1RK1B 2P8MB 2BSSB 4YQXH 2NMSA 3UIYA 3NYKA 2QKIA 4UTAA 5DZPA 4M6MH 5I8EB 3IU4L 3ZZSA 1I1CA 2HT3D 3D4YA 3O4LB 4NWTH 3BLBA 5HHOA 4ODVL 1QSVA 4YDZA 2JB6B 2LLLA 1H5BB 4GY4A 1H8OA 4ICXA 3C9NA 4YHZH 4D7PA 5FDYA 1JDAA 4HBCH 3RVXC 3KNBB 1HESA 2SODB 1RZGA 1BAWA 2DMBA 4J12A 2ZKXA 1MCRA 4X4ME 3U7AA 5HHOB 5MEQB 3IBOA 4MDIB 3ATFA 4ZRGA 4D8PA 2IAMC 4KVNL 3D69B 3SCMC 2Y72A 4XVJH 2X2IA 3DIFA 1ZVNA 4MXQD 3OKYA 1DE4B 2WBJA 4ZOBA 3VFWA 3ET9F 2FBJH 3BP5A 3WTYA 2EE6A 1DANU 2AJXL 1TXKA 2JJTC 4D0DA 2R4RH 3GJFB 1SQMA 3I9IA 4MB4A 3DETC 5F7MC 4YR6A 3ABZA 4LFHG 4MYPA 1BZQK 3PABB 1E7VA 1D6EA 4XXWA 4M5TA 3FO0H 3L4YA 2WB7A 5FHBL 4EDWH 1JWUB 5EBWB 1SJEB 1QEWB 1I3RB 1S4IA 3C5XA 1XF2B 2V5MA 3KPSA 2VW7A 5DJCB 4P2OC 4MNQB 1MZZA 1XGRA 3D4GA 4LBEB 4QRPA 2JLPA 3P4NA 3QC5X 1DVTA 1JGEA 4XPHL 5EU5A 2XG5A 3D5OF 5JW4N 4YHOL 3NSJA 1T3FA 4HIIB 5E94A 2I60H 4P4KD 2CHDA 3LTVA 4YSCA 3KXFE 3Q5TA 2HWZH 3UJTL 1Q90A 1BZOA 1YEEL 2E4FA 3Q2WA 3QXWA 4I13B 3UTQB 5IBLC 2MH4A 1C5CH 1U33A 2BNRA 1HCZA 4LFHD 2Z4QA 1FZJA 4X99A 4AQZA 1YSOA 4S10A 2AHIA 4K5MA 4UUJA 1CDGA 3AY4C 4UINL 2TRHA 1UXWA 5HJBA 2RTTA 1S9YB 2D3NA 1JZGA 1XZ0B 4BWWA 4CDHA 5C7XL 1BJ1H 1CD0A 1DLFH 3EGDB 3T3ME 3U9PL 5DHYB 1FZJB 1OAQL 4P3CH 1T1ZA 1BLIA 5T8IA 3DV6B 1HIML 1HCVA 1W8NA 3DMMC 2RBLA 4I3SL 4ODSL 4UV4H 2R4SL 3CSGA 3VFMB 3FT2B 5LBSL 1T89A 4HIPA 3X3FL 4OFQA 2WAQA 2WOBA 3JYCA 2OK0H 2OMVB 3TS8A 1OAQH 4RGMC 3CSYA 4GBXB 4OSUL 4ZSOB 1FVDA 2ITFA 4U6YA 3TYGL 5L4FA 1Z0NA 4ALAL 1F6AB 3MR9B 2X4SB 1FIEA 4ZW6A 3DO7B 5E2UL 2WQAA 5EOTA 3KVPA 3UBXG 3GS4A 4XOEA 3U1SL 5KSAD 2V7NA 4I7ZC 5IVXF 5CCKL 4Y2OA 2DQGH 1U91A 1NCDH 4P2QE 4XVSH 1JK9A 3ZZLA 1XR9B 3EG9A 5E99H 5C6PB 5E6IC 2J8UF 3HBZA 2HWZL 3UJTH 5EO0A 2AS5M 3STZB 5AB2A 5DLML 5I16A 3FHEA 1E8ZA 4FD0A 4Z3HA 2D0GA 1T0NA 4YSTA 3NCWA 4BD4A 1QFWI 2Z31A 3D39E 2C3GA 1BOGB 1MAML 3VGEA 4EBQH 1IQDB 1VFOA 4Y16D 1MWAL 3FUDA 5ALCH 1UZ8B 5JO5B 4NQSB 3R06A 4NYLB 1SEQL 1QSEB 5JHLH 1RQ5A 1CG9A 2PO6C 4HHGA 3VFPB 4ETQA 5HJ3B 1M9SA 1AFVL 1UXSA 3DPDA 1XL6A 2A77H 2APFA 5D9SB 1ZCRA 5F7AA 1RD6A 4NYLA 4M29A 3T0AA 5EF3A 3PXJA 1ZHLA 2O61B 2Y1VA 3NIDB 2FLBT 5SWZA 3VFGH 3TESA 3FU3A 5CO1A 5AENA 2IF7A 2H8PA 4ANXA 3GK8L 1YDPA 4XB3A 1PG7H 1FLTX 3GRWL 1WA1X 1XCTA 2VE6A 3BAIA 5KVDH 4F33A 4YMPA 5DWUL 1F4XH 4I77H 2H45A 1B4LA 1ZLSL 3ULUD 4H4NA 5LWYH 2I5YH 3EG9B 3NJXA 5GS1A 3BSZH 4N9GA 4X6CA 5JDSB 5LAXB 1HEHC 3GRWA 1GA2A 4GRLB 5EOCH 3RGVB 2XQBH 5IVZA 4KVCH 2DWTA 1BD2B 1FZOA 4J4PC 4YO0B 4PH8A 1KACB 3N91A 1XIWD 1GJWA 1UD4A 1YNTF 5E6ZA 3WAKA 4JFPB 3SYOA 4PJ5D 4ZFGH 1P1ZA 3B2MA 2FDBP 4ODVH 2B5IC 2O1AA 3QRGL 1PZBA 5BVPH 3RPKA 1ZXKA 2XPGB 3F7QA 5SWSA 3DK0A 3NIGB 3EYOA 2Z91B 2W65B 4M5SA 1XF3B 4OLZH 4O2CB 1C8QA 3KLLA 4FF9A 4JM2A 2GTWA 3QEGL 4HU8A 1CFTB 1UB6A 3H4HA 1WEJL 2VDMH 1XGPA 3S34L 3DVNB 5HYEA 1PSKL 2OMUA 5D7JC 1CDHA 3QT2A 4K3JH 1QHQA 2NZ9D 2RFXA 3O9WC 5GGRA 3DGGA 5FUCE 5K93A 3D87B 1X4XA 4OUUA 5BQ7A 1PTZA 4FABL 2X4QB 3OKLB 2XZQL 2ARJQ 3W39A 5FB8A 2HVKB 5GS1B 5BVJB 3NRPA 3H85A 2HX8A 4A7TA 4PU2A 5IB4A 4LDCA 5D70L 5BS0D 3T0EE 1MRDL 2UWEF 2ZT9C 4TNVF 1KMGA 3B9KC 2C34A 1F90L 1EEYA 4PJCF 3VVWA 2VZTA 5C0CB 3QORC 4FQCH 4H44C 3PGDA 1KWGA 3P9MB 4GS7C 3O4LD 2HVJA 2ADJB 2DYPD 3L45A 3PUCA 2VDNB 4R7XA 2EDOA 1I75A 3EJRA 4NJ9L 2DQMA 2AK4A 2Q7YB 3UTOA 1EJ8A 1E7UA 3BVXA 5JHDB 2G9HB 3F7YA 3MYJA 2ALAA 3SE9H 3S37X 3BW9A 1A6UH 3KJ4B 2XN9E 2UZIL 2EQDA 5DJ6B 5EPMA 3M17B 4JG1H 5D2LF 4Z7WE 1S7VA 3FKUS 2HG0A 2EO1A 2R2EA 1MFMA 1EFXA 1UXMA 2RIKA 4TULH 3BIKB 4L8CB 1VEMA 4AE1A 2H6PB 1M1XA 1DQKA 3O81A 3N50A 2PCXA 1E4KA 2B15A 5HDRA 3CZFB 1MJJA 3AABA 2X4RB 3L3HB 3T6WA 3MCG1 4JQIH 3QUMB 2R0ZH 3CK0H 1J9TA 5DJYB 2JTDA 4LCVA 1SMAA 1J48A 5C07A 4F3FA 1MHPL 3DC0A 4HEME 4YZFE 4F91B 3OKMB 1JZEA 4XNMA 4E9TA 3WKMH 2BSEA 4ADGA 2XVLA 4JO4H 1GOGA 1N0LB 5HXMA 1G7QA 2WQRA 3WNJA 2QELA 1FIGL 5I6NA 2QADD 5HBBA 4X9HA 1QAWA 1LEIA 1MJUH 1MPAL 4S0HA 4QRPE 2A74A 4E9YA 5CILH 5IFJB 4HJIA 3E6HA 1E8WA 5GRVK 1RK0B 2X1QA 3G04B 2K9UA 2VDOB 3PL6D 4RA0C 4AEFA 4G83A 4H26A 2F5AH 3VXUE 4I4WB 2F1BA 3ZGIA 2J1KA 4QTIL 4YL4A 1J86A 4Q6KA 4OZFB 3I02B 4QTHB 1UH4A 5HVWA 1Q9OA 2WSPA 1YEJL 3HZKB 2A74C 3U4EA 4QXWA 3U7YL 3NA9L 1EFXD 4ZFFB 5L2KB 3MUUA 3RFZB 1KFGA 2N7AA 4KI5E 1SXNA 2LLNA 1LQSR 3B9EA 2D7PA 3D52A 2EVIA 1KNOB 5IQ9B 3BP6A 4ZW3A 3RWEA 3A67H 4HOXA 1XDTT 1HCYA 5IF0A 1E3FA 2WCSA 4XNZC 1UQSB 5MERB 4AGLA 1TETL 4JO1L 4MDRA 1KXHA 3CHOA 2HB0A 4OCXH 3WD5H 4WY7H 1LJMA 4QLWA 1SVCP 1FC2D 4TNVK 4HPOL 1TQCC 3QIWC 3WUWB 3NACH 3BKCL 4MD4A 5IK3A 3QUYB 5KVGH 1BX2B 3B8YA 5KBMA 4XMPL 5E8NB 3S3JA 2Q10A 1W80A 5EORH 5AZEH 4M8QB 1YVLA 5C8JA 1SJMA 2DPKA 5JW4R 1ZGLA 1OM3H 4QRSA 5ANME 1MJ7H 5AAMA 2WD0A 1CURA 4GBXD 2HPTA 2VQ4A 5AW2B 4BFIB 1XXFC 1UXLA 3VXUD 3QCVH 1NCNA 5FF6B 1X4YA 4G6KL 3PXHA 2W9LA 5J0BA 1S7SA 3IGFA 4DO6A 1UCTA 2N3JA 5BUGA 3IBEA 4FFZL 4FQ1L 4HIEB 2VWEE 5C6WH 2X6CA 2K8MA 4JFWA 4JFEB 4M93C 3SN6N 2VB5A 4MSWB 1SF3A 3LEVH 5K39B 4I88A 1S7SB 4OUUB 3D69A 4TTGA 4JZNB 5AZ2H 1F8TL 4M5YL 4GW1A 2IOIA 1OD7A 4TVPL 3WNPA 3X1EA 4GAYB 1SYSA 3HE7C 2ZUWA 1HYSD 4QAWA 5I66A 2CGZA 1QKZH 5D1XD 3ZTEA 4EN2A 1R5IB 4N8CH 5DZ9A 5JLZB 1OZTG 1DSFH 4A68A 2HFTA 1ZT7A 3UL4A 3AITA 1DL7H 1E9PB 1INDL 4YH6A 1NGWB 4ZAKD 2WUBL 2QGCA 3N06B 3UAEA 2V8MA 2LABA 2FE0A 1N64H 3GS7A 3IAGC 3TBYB 4BFGA 5L4JA 2NY3B 3ELQA 3HUJF 1M1SA 5JPNC 2VISA 4PREA 3HPLA 3C2SA 2CIIB 2P7TA 2CO7A 4KMQA 2HP4A 2ZYRA 4G8GE 1A65A 3C5ZD 3K6SA 3B8SA 4PLNC 2VABB 5HHXH 3DX7A 4GUOA 1RFDL 4R2GB 1H8LA 3WL9A 2YZ1A 4MDJA 1QSFA 1TMQA 1RZ7L 4KJWD 1M1XB 4ZBJA 3GKZA 5JA9A 1H3VA 2XIBA 3CLEH 3TCTA 1P9MC 5CLWA 4M1DH 1OK0A 3HN5A 2VMCA 2CK0H 4TYUA 3KDMA 3FTSA 4FG2A 3LAFA 3LS5H 5F6HI 3RGVD 3TO2A 4KI5D 1QTYT 3D34A 7PCYA 3HRZC 5HDBF 1DN0A 4RETB 5I1GH 4Y19B 4DPBX 2VDPH 4ATWA 4DZBA 2ZPKL 4RSYA 3MLXL 3PQYE 4HUWB 1F13A 3ARED 3OXSB 4RAHA 2XXGA 4OGXL 3RX9A 3MRIA 4HUVB 12E8H 4PJ5B 3HMXA 1EEZB 1FNSL 1MREH 2G2NA 2LE9A 5AVZB 3VNYA 1OT2A 4K7PL 5HI4C 5F0JB 3SE8L 3IVKB 4OB5H 5DEJA 4TSBH 1A3RH 5HJ3A 2X0WA 5E1GA 1QLEH 3BO8B 5DUBA 2AABL 2A4ZA 4OF6A 4LL9A 4B53A 2J4WL 3FU5A 1C5BH 4N6QA 1IV8A 3SODB 3NJVA 3HIZA 1PBYA 2V2WA 4X4XB 4KQ4H 4J1UB 2WBXA 4XXDB 3QUXB 5KJRH 4JFDE 4S2SB 2QT6A 1JPST 4MJIE 2ZYSA 2BX5A 1OAUH 5IT2L 2DOCA 5IJKC 3ZR5A 2HJKB 3QCTH 5ACZB 3QEQB 2YAPA 4WF7A 1FP5A 4PSPA 1EBAA 5BV7C 2VMDA 2D03L 4UNVA 4WW2C 4KNUA 4L1TA 4HAFA 1XIWC 3FO1A 5C2BH 3CVIH 1UVQA 3TNNB 2RCSH 4K7FB 4PWHA 5A1AA 1SY6A 3DGGB 2GJJA 2XKNB 1MCHA 4GB9A 1RZ8B 2CBQA 1KTRL 4GAJH 1NC4B 3MNDA 4X6CE 4LLUA 1FG9C 2QL1A 1KJMA 1BWMA 2KLTA 4LCIH 2A6IA 4LKXA 4HUKB 2XN2A 5AZ2L 4W9CC 1KB5B 3U2IA 4PJXF 4JFZH 5IBUG 4Y2NA 5DRNB 5KS9E 3BAXA 3OL2A 3LH2H 1UD2A 4GI6A 1JTOA 3VXSE 1MFAL 3O4LE 5J5EA 1FFOA 1RK7A 3QQ9C 3FHAA 3QQ3A 4Z7WF 1KULA 4G8IB 5CP7B 1TNNA 4JRXB 1C7TA 5I18H 3U79A 3GDBA 5D6DA 8FABA 1UXWB 5MENB 1T03H 5IHZA 3DJSA 3E3QE 2BHFA 5ICUA 1UD8A 2HJKA 3ULVF 2R1YA 1OSEA 1TIUA 3HOGA 5D5ME 2CO6A 4ZQKA 4JHAL 2HVKA 4JMXA 4L23A 3G6AA 3ZVVA 1QATA 2V17H 5E94B 2GITA 4HUMB 4JVWA 3VWJB 2JJSA 2DI8A 2CBPA 4RGNC 1OAYH 5KSUA 1KIPB 3BKCH 1GAFH 4PUBH 3ULSA 4DN4H 1OF2B 3QZNA 3BKMH 4U1GC 2IEPA 2WYZA 2Z3FA 3FB5A 3WEOA 4FXKC 2PCFA 1ZSDA 1BJMA 1Z32X 2HTKC 1SOKA 3QZWB 4XVTH 5HGBB 5DF0A 3B2VL 1OE2A 5T1LA 4PJXE 3PL6B 1P7HL 3ZXAC 1KN2L 4MX7A 2I9TA 2C9UA 3II2A 1YEJH 1MCDA 1A21A 2JCCF 1BQ5A 3DXAE 1NDTA 1F00I 1EFXB 3CBRA 5L2KD 8PAZA 3H53A 1EV2E 3VJ6A 4OZIB 2N1KA 1FFRA 2DF3A 1GXEA 2BVPB 4N8UA 4PFEA 1KCWA 3A23A 4NRYA 3Q13A 4AZUA 4XN8A 3TV3L 3L4VA 3UXFA 1GGYA 4KI5C 1E8XA 4ZX4A 1OAZL 2WB1A 4E0RB 1H6EA 2P48B 2XICA 2XPZA 4GP4B 2OR9H 1UA6H 1GR7A 1SXZA 2O61A 4YSEA 5DHMC 2I9LB 3WFCL 2DBLL 2CLZA 2I7OA 4EVNA 4JFEE 1JI2A 3ARBD 3MDJA 5IVXA 3RNQA 4QRAA 1EMTH 3EYUH 4JPVH 4FMFA 5IW3A 2VQ1B 4DAGL 3KXFD 5JORA 1CGSL 1BYPA 4LRIC 1HOCA 1D7DA 1U92A 5EEYA 4BXSV 2ZWNA 1SBSH 1QRKA 3MA7B 1UYWL 3VGGA 1WCQA 3P4LA 1N9PA 2X0VA 3JWOH 4RMQA 3ZYIA 5LHDA 3Q8CA 3QDJA 2ITDA 2W92A 5GS2D 5F3HA 4PWGA 4XP9L 5I75C 4X9FA 4BZYA 2ITCA 3Q3GB 1T5XA 1HZHH 4GW4B 1FH5H 1URIA 3UJJL 4PI2A 4H8QA 1OOWA 5DYOB 3AW5A 1Q9KB 1Z0MA 4BHUA 4P3CL 4Z77B 4LEXH 1ZT4A 2FB4L 2X4UB 1NBYB 3RZCB 3UEQA 4YSAA 4HK0B 4RFOH 2EKJA 2DDQH 2Z1KA 2J6EL 4Y89A 5D7JB 5C0AE 1KXTB 1I1AC 4BCZA 4EIGB 4L05A 4PIRF 2EE2A 2GEQA 2DTMH 1HHJA 3MBXL 4LLUB 4QXGH 1Z66A 3DLQR 2EILB 4U1SB 3BZ4B 5IG7B 3RPIB 2ARJB 3I2CH 5SV3A 2YA2A 2OYLA 2VO8A 2DM7A 4N0FA 4LDEB 4QTFA 2YPVH 3RWCB 1JFQL 4U1HB 1MRCH 3SKMA 1RY7B 1ICTA 1DJWA 4FABH 1GW0A 1SXSA 4TUJA 4OQ1A 4KK6C 3WIIL 5IHBA 1I7RA 2X9XA 4XPHH 5LG6A 4V1DD 2IJ0C 2OQJA 2FGWH 4ZMXA 8FABB 5MENA 4NN6B 5D7SH 1CR9L 2BP0B 4I1NB 3AAZA 2FUTA 1YEHL 4WW2A 4C56B 5D5MB 3QQ3B 3SD5A 1DUYA 1OGAD 2G3MA 2YSSB 3FQ1A 3L7EA 1E4XH 3IF1B 2VXQA 4F2MA 1KTLA 3GHEH 2Y06L 3TEXA 2JWYA 2WCGA 2EC8A 1NAMH 4RWYH 4XRCB 2UVFA 2MPAL 1JGVH 5MEOA 2HA1A 1E43A 4NN7C 3W2DL 1ML0A 3CDCA 5CHNB 4EIUA 2WAHA 5JYMA 5D2NB 4ZMYA 1SDDB 2B16A 3K2IA 4U1NB 4JKKA 1B0GA 4PGDB 3O6FA 4YNYA 2YD8A 3H3BC 4Y9FA 3KYMA 1ULVA 4EMZA 3N5AA 3PP3K 4OLVH 3MLZH 5ALBH 5DWUH 3CQQA 5I8CB 4PRPD 3KR3L 3CHXA 4P5KB 4QT5A 3W2DH 3VXRD 3UTTB 1CFQA 3FMGH 3NIDF 1RJLB 1A0QH 3BE1L 3AWEA 3ECVA 4OIBA 1EXUA 2Y7OA 4K94H 4AUYA 4MX7B 2B2XH 4X5RA 3U46A 5FO7A 5JHDA 4ZFOL 4J3OD 5EO1A 2YAQA 1L9NA 3FO2A 3R0MA 1OSPL 5EPMB 1S9XB 4Z3FA 4FLSA 4NQDB 2WQWA 1P5VB 2AGJH 2B59A 3DX2A 2P9RA 5DUML 5K69A 3CZSA 4WIQA 4JFFD 5JHLL 5FKPA 2QLYA 4FQIL 3Q05A 1OAJA 1YYLL 5CINH 1MWAH 4AQ1C 4FS0A 4FXKA 5IROC 4XBGA 4JAMB 3OKKA 3RFZC 4JFDA 5BQDA 3FO1B 3HB3B 5BRZD 1NWPA 1FBIL 2HJFB 4TMPA 2BNUB 1J8RA 1CDJA 2FEEL 5DGRA 3UTSE 5KVFL 1DQJA 1KCKA 1IGYB 3PS6A 3ETTA 5E99L 1LEKA 2XQYK 4HJ1A 3QWOB 1TVHB 4NUPA 4OCSH 3L4CA 4JRXD 1NGYB 4PJFF 4B0MM 4H8WH 4AYEC 1X5GA 4YX2L 2ORBH 1DQJB 3MCKB 2CUIA 2FJFB 5FUOL 2QVFB 3L1GA 4KOBA 4EF3A 3KM2A 1FJ1B 4PJ9B 4QRRB 3D09A 4PTTA 2COVD 5CJ8A 5D93B 4L0ZA 2WLMA 4QHLA 3WMQA 2V2TB 5HYIA 5B7FA 2AI0H 3ZDXF 5LBSH 4PRHE 2ZG2A 1PX3A 3KEHA 4RRPG 4OD3H 4LSVH 1HZHL 2KI6A 1T5WB 4UV4L 1B2WH 1BGXL 4PJ7A 5G5DA 4M00A 5FS5A 2FJUB 3KPSE 3MLTB 4HK0A 3LEXA 3JVFC 1JRHL 3U7WH 1HI6B 1N7MH 4HKBB 2Y6SD 4GG6E 4ODHH 3ZOAA 4X7TA 3FT3B 1FO0H 4P8QA 1XGTA 3FTGA 4XPAH 3O3AA 4PBDA 3QUML 2B39A 3EFFB 1VEPA 4Z7QE 1E67A 3U0TA 3I6GA 4GIAA 3EJYD 4FCHA 1ZA6B 4JDEB 1O7SA 3KMDA 3K5RA 4MFHA 2BNRD 1U4FA 2J56A 3QA3A 1UFGA 3UC0H 5A3IC 3BZEB 1AKPA 3AWGA 1KTBA 1ZOXA 3QXAB 5D1ZB 4PG2A 3QIUD 2V4LA 2CJUH 2DWDB 3MLSH 4JRXE 4NO3B 5AQ0A 5DUBB 2HJLB 1S9VA 1P5UB 5E7FA 4RQQA 3X3GL 2DBJA 3MUHL 2N7BA 2PWGA 4NSKB 5AVRB 3UO1L 1RU9H 3GMRB 1S2EA 5GISH 3VSTA 4AW4A 5IR1B 3TPUA 1S9WB 5DK2B 3VFSA 3KPMB 2ESVA 4JVUA 4U1LA 4P46B 1JNNL 1T89C 5IMLB 1U58B 1TZAA 2ZG3A 2BNQB 4RAUA 4NDMA 3QARA 3IETA 1HJCA 1DHKA 2C3WA 3NCJL 4ONOA 4APQA 1F97A 5I76B 4HULB 4NCC2 3JV4B 2WZPA 1H3XA 1JHKH 2C9PA 1PEWA 4JFFE 8CGTA 3FMGL 4P5RA 3RGHA 4QIRA 2R4RL 4Z76B 4X5QA 3TVMC 2X4NB 3BHBB 4YXHH 1KT2A 4XH2A 3I6GB 3VGAC 1PD0A 4M7LT 1G7JA 1IBGH 2BNQE 3WFDL 5GGUA 4IRSD 4GO6B 3QBTB 4CW1A 4GUQA 2NY3C 1R24B 3RWDA 3BN3B 3EDFA 1O0VA 5I5RA 1KT2B 4XH2B 3REWB 1M6UA 1IGCL 3V6OC 1UG9A 5ECGA 3RRQA 1CICC 4GUCA 2X0UA 3KXFA 5KJ7E 1F3RB 2DLHA 3ARWA 3D39A 4WI5A 2G9HA 3F7YB 25C8L 3MYJB 3ZL2A 1NAML 4Z7NB 4U0QB 3GXFA 4WFGE 3WO3B 5ILTH 1JJUA 2ZUSA 3E6HB 3S37L 3IS1X 3LCYA 4RNRA 5IMLA 4JR9H 1XH3B 4FJYA 4N2BA 4Y9GA 3RZCD 2B9AA 3MI6A 4FL4B 1MEXL 2AJYL 4N1CA 4M6ML 3V5DA 3L54A 1MIML 1B4RA 1YEHH 3CZLA 3IFPB 4OVUA 5AKVA 5FPIA 4Z7UF 4LRNH 1CMOA 3HE7A 3V0EA 5D72H 2NT0A 4GO9A 4NQCB 4OCYL 1EAQA 1FZKB 2QSVA 5F7KC 1P4BH 1XZ0A 3DECA 4HAKA 4CMHC 4FQHA 4AL8L 5HHOE 3BVNB 4M43L 4AEHL 4GPVA 3PWPB 4UDTA 1DBBH 1I9RH 1K8DB 3F04A 5FW8A 3WI9A 4ACPA 4XMXA 3GO1H 3V8CA 5KUKA 3RIFF 4K71B 3QUXC 4XMKH 2RCSL 1AIFB 5E08L 1RHHB 2CLRB 3ZUCA 3GSVA 4ES9A 1KJ3L 5I8KH 1KBKA 4Z0BL 4CC0A 1BX2A 2WYTA 3HS8A 4JO3L 1OP5K 5KANG 1AOHA 1CBVL 3LOWA 4RNRB 4X9YA 5CJ5A 4MZ2A 4BA0A 1YQVL 3ALXA 4WSJA 1OAUL 2VZVA 4PJ8C 5JHDE 2P5EE 5KJRL 1BOYA 4KTEL 2Z92B 3U0PA 1KLGB 3M86A 1TG8A 4JN2B 2EH8H 4D0BB 1M6OB 3GM0A 3US9A 2ILLA 4XN9A 1ZVSA 1L5GB 3QVAA 1DN2A 3WFHA 1DQML 1U21A 3T0VA 3MX0A 3ILQD 4L1HA 4F20A 4FLQA 4PGCA 1M7DA 3JV5A 1BFVL 1CGSH 4QHKI 1QFHA 3CX2A 4DETA 5DC0A 4Z7QF 4RFNB 1MQKH 2PLTA 2IG2H 1H9VA 3GSOB 3SDDB 2OZ4L 1X5HA 3EADA 3O2DA 4NO0A 3RIKA 2BZCA 4G6AC 4HT1L 5A2IH 1O7DC 4GRWE 1AKJD 3PHOA 5L0QB 3CLEL 4F2MB 1KXQA 1LLAA 3K8MA 4W9GC 1RZ7H 2XPGA 1B9KA 3HS0A 3N40F 2ESVB 3QJHA 5A6LA 1XIWA 1BAGA 2Y7QA 2AEIT 3HB3C 3LV3A 4K3GA 3U9UB 1L7TL 4PRPA 4L3CB 4N26A 5D2NE 1T6VN 4LSUH 3IE4A 3BPOC 1MI5D 5CSGA 3OMZA 3HB3D 5BOZG 5BRZB 2Q9OA 4NENB 2XVKA 5D7LB 4MXVE 2XWRA 5AOJA 3C60D 5T1MB 3WGUB 3Q6GL 2YO3A 1OCCB 2AQ1A 2P5ED 3OKLA 2AMUA 5I1JH 5D7IB 1DL7L 3KYKH 3D2TA 4W9ZA 5E8OB 1DVFA 1T7VA 3RPIA 4A7QA 5IFAL 1RULH 3JWDL 5DD1L 3HC3L 3MLRL 2GJZA 3QFGA 4D9RD 1WHPA 4DFHA 1UJ3B 3JVGA 2FEEI 3AWFA 4KXDA 3BLKA 5TE4H 2X4PA 4XMLH 1HSAA 1TR7A 2FK9A 5EU7E 1DJZA 5J3HC 2BY2A 3EDDA 3OB8A 5T3XE 1OGAA 4PRHA 2A9MH 1KELL 3KPLA 4LASH 4XNYH 5ICZB 1D5RA 1RURL 2KZKA 1ZHBA 2NQCA 2EDYA 4WU7A 3ARGA 3DHUA 2KQNA 3QGVA 3HC4H 1FL6B 2IGFL 3PP4L 4ZPTB 5DRWB 4J3VA 2GFBB 4N3TA 2X4OA 4H1LB 1U93A 2K6ZA 4LLVB 2ODHA 1XGQB 4POYA 4BWUA 4OI8A 1TCRA 1XSJA 2DIAA 4LMQE 5E4IA 2NZ9C 3PJLA 3HNSH 4YDKL 3R0NA 1IEAB 5FUZL 2VZSA 2ZX9A 4HDIA 4KDVA 4L9LA 4AIXA 4ZK8A 2JQZA 1AI1H 3T3MB 4WK2B 2ZUQC 1JK9B 1GGIH 1S5HB 1YJDC 1MW2A 4O9HH 5GZNA 4YC2C 4XZUA 1V3MA 2BCKB 5D1ZD 5I19H 1XTLA 4OCXL 4QRRE 4BH8B 1AGFA 1UZ6E 1JGLL 1WC7A 2CDGB 3O0RL 4N0UA 5IHWA 2MJWA 2H0JA 5DD1H 4QKTA 1HHJB 2MTPA 4JPIA 3MRGB 1CU4H 3CV5A 2V5SA 4FYTA 1YEIH 1JWUA 2ZXGA 5I1IH 3DJZA 3BH8B 3GS0A 3WXVH 1JFHA 5EBGA 1W72H 2D03H 5DJ0A 2BNQD 1EXUB 2G3NA 1W16A 3Q3GA 2ZOWA 3OC5A 3P3TA 4XCNB 2H32A 5FGCB 4Q6YA 2GY5A 3KGRA 4CN1A 1KBPA 1O6TA 3OMIB 5IT2H 3NJIA 3CIQA 9CGTA 1CLOL 1NM4A 3GBNL 3BUPA 3B5HA 3KL3A 2CPUA 3KPRE 3FSOA 4FXLA 2VM9A 3Q5OA 1C5BL 4P04A 5EUOF 2J4WH 4RZCA 2E7CA 1WG3A 4PRAA 5L2JB 1FIGH 4EZKA 4DUXA 4TSBL 1TU2B 4ZOEA 4MDIA 4N87A 4X0NA 5IV2B 5EF1A 4MJID 4KROB 3C60A 4L5FE 3VX1A 4DOHB 1KWKA 1KIUA 2GAZB 2YGQA 4L1SA 4JO4L 5CLXA 5KEZA 2ZG1A 1HXYB 3DVGB 4PGZA 2XWTA 5I15L 4NNXA 3HE6D 3MCLL 2FX8L 1CTOA 2YBGA 3OM3B 3Q9QA 4DKEL 5CCGE 3B4NA 4Y5XB 2VDKL 2YA1A 1SOSA 3ARUA 4HJJH 5KTEH 4OZIF 3S5ZA 3DV6A 4WI8A 3V6OA 4GW1B 1ZLWK 4U1MB 2NX5B 3KPTA 3LD8B 4WTZG 2GSMB 3I3EA 4NM8H 1JCVA 2JKTM 4TUOB 5J1AA 2BSBA 3PQYD 1DUYB 4U3HA 2UZIH 4PJIA 1A6UL 4JKMA 1VGEL 2JI2A 3HHSB 2KDGA 4NOBA 2IQAA 4DKFH 3MNMA 2PTTB 2F9BT 4TNEA 4XHJD 3TZVD 3C60C 2H3KA 3RJOA 2X6AA 1CFVL 1EAOA 4Y8AA 1A1NA 3QDGB 1EK3A 1OE3A 3L9EA 3AZUA 3OJ2C 2WQ8A 2H6PA 2ICWI 2NSQA 3K2UH 4HKBA 1FWXA 4XOCA 2HG5A 5E6IA 1TKWB 4FFZA 2X5PA 1KJ3H 1MAKA 4AQAB 3PWPD 5CEXB 3R1GH 4YPJA 1J0YA 4L48A 3WTSA 2ZKHL 2YFOA 3AUVA 3QI9A 4N2AA 4X5PA 3RDTC 2Z35A 1IEBB 4LOVA 1MRDH 3IJHB 4R90H 3BDXA 3T9WA 2V37A 4G9DA 3FCGA 1JMZA 1UUSA 1HN1A 3O0RH 1LWJA 4PRDB 2IPKA 4OIAA 2YD0A 4YUEL 4MMZB 5FYKD 1BZ9B 3D3VB 5EF2A 5CD5D 2A83B 2QKSA 3ML9A 3OJMB 3S7GA 4IOSD 4LHUA 5A3ID 2JNZA 1AZZC 2MOQA 4XP1L 4MQTB 2AK1L 4UT9A 1AY1L 2GHZA 4P3WA 3UTPE 4HOMA 1JPEA 4G6KH 1LDSA 3CIAA 4YDKH 4CVUA 4BH7B 4OD1L 4HS8L 3KWUA 5F3HB 1NCWL 1TZIB 1RUMH 4P5TB 3MBEB 5DHEA 3QFJD 3O41B 4JR9L 1E2WA 1YCSA 3LRHA 4ABUA 1D9KC 1WAPA 4PMFA 1PKOA 3EYFA 1MJ7L 4NT6B 3POCA 1NANI 4L0PB 2A4EA 4XVUD 2ZXEB 2X6VA 3W5MA 4FNQA 3OX8B 5IP4A 1HXMA 4IMKA 2EVGA 4PV8A 2A9NH 3MLTA 3F62A 4Y1AE 5TD4A 1AG6A 2E75C 5GZOA 1GL4B 3NOIA 5JPMC 4M7ZC 3WD5L 3OJDA 4E41A 1B3IA 2D7MA 1DZ0A 3C8DA 4NZUH 3QISA 4XNXL 4FFWC 1X7QA 2VRKA 2DM2A 3HC3H 1ZLSH 2XKNA 5IFAH 1DDHA 1KTKE 3RFRA 1AHWB 1JXDA 3E9TA 1IX2A 1GOHA 2CA4A 3JYBA 3M1OA 1JK8A 3H42H 4UOZA 4UM9A 4HV8A 4MD0A 1GGBH 1U8LA 2DH2A 4WJKB 4X9BA 1A9BA 1I8LC 2VAAA 2FIKA 1UD3A 2IAMD 3F12B 4WRLA 2F2HA 2F7QA 2ZAGA 4AQ8C 4F7EA 1I9IL 4YS4A 3RFZA 4IDLA 3ABKB 5KYWB 4ZS6C 1RMFH 4M5ZL 4TQIA 1H3TA 1KGCD 1VFAB 1ES0A 2VUYA 5D6CB 1F6FB 2MOVA 5I1CL 4KX9A 2MQGA 3MNZA 4YFLI 2E46A 5ANMA 3OZKA 1DVXA 4MZRA 2G4GA 5FW6A 3KWTA 5JR1L 5FAAA 4TQHA 1HXYA 3BIBX 5DLMH 4X6EA 2R56H 4N0UE 4IRZA 5IESH 4FA6A 2KC0A 1DVQA 1R3HA 5LNDA 4LCCB 2CJSA 4XNQB 5LLIC 4Q4IA 1LGVA 1IEHA 4XWGH 4YDVA 2JKLA 2V9TA 2PR4L 2NNCA 4ALAH 4MQSB 2EZ0D 3AXIA 3LZFL 1M05B 4G6ML 1CUOA 4TLUA 4OY9A 3TIEA 3W3BA 2P7TB 3UBXB 4JFYB 1JWMB 1DP0A 3MBEC 4LQFL 3HA0A 4U3XA 2GFBA 5E8EA 1GOFA 4B60A 4RIRB 3U0PB 4FG4A 4KRLB 1YQVH 3AU1A 4WLCA 1KCVH 3DURA 2YKLL 1PGRB 4HWNA 2VDRL 4R26L 3AM8A 2WO4A 1O6VA 2KZWA 2Q7YA 3LZQA 5FDWA 3CPLB 3PV6A 1PZ2A 1SYSB 2PYFB 2PYEE 3CUPB 5FUOH 5HDWA 4FQJL 3DURB 4D0CB 3EYQD 1V10A 1JZDC 1F90H 1B90A 2HN7B 2BCKA 4KZEH 2AAVA 2NOYA 1WITA 4P5MB 1SQ2N 4GRLC 3DI2B 3O6FC 3L7FA 4B9KC 3FUJA 1DDTA 3ASWA 4L3AA 3K4DA 4H25B 3NABL 3T04D 4X6DF 3V0GA 1P4BL 3REVB 4H0IA 1A6AB 1BQLH 1ZEAH 1A14L 2HRGA 4GSDH 3MJWA 2Q86A 5CINL 3OZLA 1OHQA 1JGUH 2ENQA 4S2SA 4DP4X 3CFJB 4AEIH 3QDMD 3FOLA 5BZDB 1ZHKB 1J1PL 3SGEI 3SOTA 2QSCL 2HMIC 2YUWA 1BZ8A 3CBJB 2E47A 1OAXL 4JFDB 4P4KB 2B2XL 4MJIB 1INEH 2KBGA 4WV1A 1JVKA 3RL1B 5DJCA 3MQIA 4KITB 2VSMB 1TVBB 4KQ3H 4PJAB 3VRIA 2AMGA 2O5YH 1MRFH 3AREB 3JSSA 5DUJA 3DPBA 3S6CA 5IOKA 5MERA 5C09E 1NMCC 2XYCA 3TTYA 1MXDA 4S1QH 3SD2A 3ARRA 1D9KA 2FBJL 4Z77A 5DUPL 5DJXB 2XTJC 1N4XL 4F9PA 1NLDH 2HXAA 3MA9H 4BRJA 1BVOA 1JI1A 4MZIA 5J57B 3PV7A 5TE6L 5F8QC 2EDLA 3S36X 4PTUB 3ATEA