1B3IA

Nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (minimized average structure)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
ASVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of plastocyanin from the photosynthetic prokaryote, Prochlorothrix hollandica.
pubmed doi rcsb
source organism Prochlorothrix hollandica
molecule tags Electron transport
molecule keywords PROTEIN (PLASTOCYANIN)
total genus 12
structure length 97
sequence length 97
ec nomenclature ec 1.10.99.1: Transferred entry: 7.1.1.6.
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1b3iA00
4DP7X 1BYPA 1PLAA 1TEFA 3PAVA 2BO0A 3PPSA 4DP8X 3MX0B 3QJTB 2EIJB 3PAUA 5AFAA 1A4CA 2VMJA 5PCYA 1JXFA 1N70A 1OCRB 3EH5B 2HXAA 1WA2X 1YLBB 2BWIA 3V9CA 4YSUA 1L9PA 3T6ZA 4EF3A 2EINB 3C75A 1M9WA 3WG7B 1JZEA 4GYBA 1GS6X 5B1JC 4P5RA 3EHBB 2GB2A 2VSMB 2YAOA 4YVUA 4N4YB 2HZHA 1GS8A 4P5SA 5D4HA 2FTAA 2Y69B 2CAKA 3T6XA 3DIVA 2X88A 1JZJA 1SFHA 1PCSA 2FQEA 2P80A 1BEXA 1HFUA 1NZRA 2J56A 3N2JA 1SDDA 2P80D 1X9UA 1ILSA 2BP8A 1JERA 3NYKA 2OCCB 1ZPUA 1AS8A 2TSAA 2IWFA 4JHVA 5TK2A 6PAZA 2XXFA 1IC0A 1WA0X 1JZGA 1TKWA 3NJJA 4BXVA 5TK4A 1W8EA 5I26A 3WNIA 1ILUA 1JVLA 3GXUB 1J9TA 2VM4A 4FA7B 3WKPA 4DPAX 4YSCA 1BQ5A 2HRHA 3X1GA 1ASOA 2IAAC 2GBAA 4A2HA 2VW7A 2H3XC 3H4FA 4AKOA 3AG1B 2FT6A 1XMEB 2PPFA 2YXWA 4YSTA 3TBCA 1PZAA 4HALA 1AZNA 4PAZA 3FU9A 3RYMA 1AG6A 1I53A 4HAKA 4HZ1A 1SHXA 2J55A 2PP8A 1CUOA 2BP8B 4KNUA 3FQ2A 2FQFA 1NICA 1GR7A 2LLNA 2WO2B 1JXGA 2XVBA 1WAEA 4GP8B 4HCGA 4F2FA 1AS6A 4DP1X 2JXMA 1M57B 2ZONA 3BVDB 4MFHA 1RZQA 3ZIYA 2WO3B 1SFDA 3NT0A 4YSEA 7PCYA 2HRGA 4G7RB 2OV0A 4M3HA 1NWOA 4QKTA 4KO6A 3X1FA 3MBWB 2B3IA 5B1AB 2FT7A 5E9NA 3NJHA 4KNSA 4YL4A 1VLXA 2CALA 1XB8A 1BXUA 2DWSA 1ASQA 1L9SA 3FSZA 3NP4A 3X1NA 4A68A 4YSSA 5IY5B 1FWXA 2GI0A 3AZUA 4KO9A 3UABA 4UF7C 1PMYA 2BZCA 2EILB 1AZBA 1JZFA 5AKRA 3BQVA 4E9WA 1OCOB 1BQKA 2BWDA 1BXVA 1JOIA 1PY0A 3L45A 4RH4A 1OV8A 3T6WA 1MDAA 2A3TA 4CSZA 1IKOP 1JZIA 2W8CA 1PAZA 1J9SA 1AANA 3FYIB 1J5CA 2GHZA 9PCYA 2CUAA 2FWLB 3FYEB 3IBOA 4Q8BA 3ZBMA 3ABMB 4CSPA 2N0MA 4M4RB 5I6NA 3IN0A 1ETJA 1EZLA 1GY1A 1NIBA 5I5JA 1ET5A 1RCYA 3NJMA 5B7EA 3S8GB 1HAWA 2CBPA 1M56B 3AG3B 3JT2A 1ET7A 3AG2B 2WSDA 2QPDB 3CVDA 3EF4A 4YSOA 1MZZA 3FSVA 3FSWA 4UANA 4YVNA 3TU6A 2EIKB 5B7FA 5D4JA 3X1BA 2PPEA 2UXTA 4GY4A 1EHKB 2FJSA 5B7MA 2XLLA 3FPYA 1WS8A 4DP9X 3S3BB 1GS7A 2XV0A 1L9OA 2GC7C 1B3IA 2PPDA 4DP5X 1QLEB 3OD3A 3FS9A 2CCWA 1V55B 3WIAA 1NTDA 5I6KA 1FFTB 1KCBA 3UACA 1AZRA 2FQGA 1NIEA 4WTQA 2UXGA 1KBWA 2FT8A 3NSYA 1L9RA 7PAZA 4KO5A 1MG3C 2BP0A 1GW0A 4A2GA 3CVBA 1CYWA 4PCYA 1NIAA 1JZHA 3AG4B 2Q9OA 3SBQA 1AZCA 1KDIA 1PNDA 3G5WA 3SBRA 1DYZA 1CC3A 5B1JA 2XYBA 1KCWA 1BYOA 1OE3A 4YSRA 2VN3A 1AR1B 1QHQA 1UATA 2XWZA 3S3CB 3ABKB 1ZDQA 2YARA 3CZUB 3QJUB 2BW4A 4QLWA 1L9QA 4KNTA 3NJIA 1AACA 1OF0A 3KW7A 1AG0A 3IEAA 3OQRA 2HX9A 1OOWA 2MRYA 4NERA 6PCYA 1T5KA 3V9EA 4HHWA 1V10A 3QJRB 5AZUA 2I7SA 3UAEA 3QPKA 5FC9A 3NJLA 4E9SA 2QPEB 1L9TA 2VSKB 1SJMA 1OE1A 3FPXA 4HCFA 4G7SB 4A2EA 1BAWA 3OMNB 1A4AA 1GYCA 1X9RA 1E5ZA 1J9RA 2JKWA 2YAEA 4UAHA 4E9XA 3ZDWA 1ZDSA 5B1BB 1ZIBA 2XV2A 2JFCA 2VW4A 3H4HA 1XB6A 5B1KA 4DP4X 4GP4B 4GP5B 3JTBA 3WNJA 4W1TA 2IDQA 4W9ZA 2OJ1A 4DP6X 2AFNA 3FQ1A 4G70B 4E9VA 4WKXA 2W88A 4G7QB 2GSMB 1OCZB 2UX6A 2AZAA 4NAJA 3S3DB 2XV3A 1NDTA 1ZV2A 3PCYA 3ERXA 2H47C 1NIFA 1SDDB 1CYXA 2QDWA 5F7AA 2E86A 4BWTA 4BXSV 2RACA 5I5IA 1ADWA 3DKHA 3T6VA 4DP0X 1PZBA 8PAZA 4A67A 2BHFA 2PP9A 3NSCA 3QJSB 2PPAA 2YAHA 2XU9A 2HLEB 3UAAA 3S8FB 2BZ7A 1TEGA 2X87A 4YSQA 1ID2A 1PF3A 3UADA 3U25A 2DYSB 3HB3B 1GSKA 4BK5C 1NPJA 2ZWNA 3FSAA 4K9JA 1AS7A 5EHFA 3OM3B 4KOBA 3TASA 1SF3A 1SNRA 1KYAA 3TA4D 3UGEA 4L0PB 2TSBA 1AZUA 3HEIB 4A2DA 2YAFA 3NJNA 3OMAB 1RKRA 1W6LA 2XX1A 3FQYA 3QQXA 4Q89A 1MG2C 2PPCA 4TXVB 1PZCA 1PNCA 1ASPA 4AKPA 3NJFA 1SF5A 2HX7A 2QDVA 3NP3A 1FA4A 3ASNB 2UXFA 3AW5A 3PLYA 2QT6A 3FT0A 1CURA 1KV7A 1NPNA 4YSAA 2IWEA 1E30A 5A7EA 1A4BA 1V54B 2YAPA 5D4IA 3FU8A 1KBVA 3TBBA 4A66A 1BXAA 2DWTA 4N8UA 2IDUA 4ZK8A 4BWUA 2R7EB 2I85A 4G71B 3NSFA 3WI9A 1URIA 4AZUA 3IE9A 5F7BA 2R7EA 2YAMA 2BP0B 2VW6A 2AZUA 3QJQB 1PLBA 3X2QB 3CG8A 2GIMA 1ET8A 2IH9A 5I5MA 1NWPA 4E9QA 3SQRA 4BDVB 1ZIAA 1IBYA 4DP2X 1WA1X 2YQBA 2J5WA 1E67A 3EH3B 4YSDA 1OCCB 3GDCA 4E9YA 1A65A 5I28A 3NJGA 1BQRA 4DPBX 1KDJA 3IN2A 1JXDA 4F7KA 3DTUB 1HAUA 2J57A 1AOZA 3CDZB 4G72B 4JHUA 1KGYE 2DYRB 3CVCA 1A8ZA 3ZX1A 2HX8A 5I6PA 3ASOB 5I6MA 2FQDA 1XB3A 2ZOOA 5B3SB 2DY2A 5I6LA 1IUZA 2YAQA 2PP7A 4YSPA 4KO7A 1J5DA 2PCYA 1GY2A 3OMIB 2H5UA 4X4KA 2BW5A 3X1EA 4KOCA 1WS7A 1W6WA 2AVFA 1R1CA 3SBPA 5LDUA 1SHWA 1JVOA 1OE2A 2IDFA 4AI7A 1TU2A 3NSDA 2XUWA 4AKQA 3AY2A 4BWWA 2EIMB 2IDTA 1AAJA 1AIZA 4HIPA 2IH8A 2YXVA 2NRDA 2UX7A 4NB7A 4DPCX 3T71A 5I6OA 4BDVA 1MZYA 3KW8A 2Q5BA 2B08A 1IBZA 4AX3A 4E9RA 3H56A 2XX0A 1J9QA 2MTAA 3ABGA 2FNWA 1F56A 1E5YA 2AANA 2PCFA 1PLCA 5PAZA 1N68A 4ENZA 3D12B 2CJ3A 2UXVA 3N55A 1RZPA 2ZXWB 1A3ZA 3WKQA 4HHGA 4FAAB 3GYRA 3PAZA 2IDSA 3EH4B 4GXFA 3FU7B 2XXGA 5ANHA 1DZ0A 3QJVB 3ABLB 3PXLA 4E9TA 4HCIA 1NIDA 1NINA 2VM3A 1E65A 2DV6A 2I7OA 2Y1AA 2PLTA 2IWKA 3NJKA 1AQ8A 3FU7A 4A2FA 2GC4C 4JKNA 3T9WA 4F2EA 1QNIA 3CDZA
chains in the Genus database with same CATH superfamily
1MJUH 4DN3H 3RKDD 1KBGL 1PLAA 2O61B 1NBQA 2B1OA 1MIMH 1UB5A 1A1OA 2NYKA 4JDTL 1X4XA 1GZPB 1B2WL 5CEZH 4UB0H 5EU7C 4WCYL 5F21B 4DGIH 4ES9A 1INQA 2X4TB 1JZDC 1M71A 3NACH 5IF0A 1EBPA 1FORL 3AS1A 2P24B 3LXUX 5EV7A 1TZGH 3U1SL 5JDSB 4YHKL 1LMIA 1BZDA 4GRWB 4PRNA 5EUKB 3TT1H 5JLZB 3RFZC 2XXMB 3RI5F 4JFZH 4U1GC 2CK0H 2ZXDA 5BV7H 5K9QG 1JGIA 2DQTL 2VSMB 3BGAA 2HP4A 4KUCD 2XBDA 1UB6A 4MVBD 5JXEC 2BFVH 1IAIL 4YN3A 4L3AA 3EXJA 4PRPE 3THMH 2Q87A 2HVJA 2Y22A 4B96A 2VXUH 5C2UB 3SYAA 5H37G 2P49B 4QY8B 4X4MA 4F57H 5LGJA 4GMTL 1KN2H 4MHHG 5JORB 4PJGB 5CP3A 3KZ8A 2WXMA 1LVEA 4UV4L 4NQEE 1BX2B 2E56A 3F58L 3SD5A 3TT1L 3RZCD 4M8UA 3WN6A 1FC2D 2ED8A 3BH9A 3KVPA 1OSZA 1CT8B 3GMQB 3MZGB 5C70A 2ERJB 1D5ZB 3G3LA 1N6VA 3DNKA 2UVFA 3SY0A 4XO3A 5IMLB 2VDKB 4P2QE 2YPLE 4WHTA 4NHCL 4TNVF 2AQSA 4R2GC 3V0JA 3MR9B 3TEWA 4V2BA 3W0WD 2C8NA 4P5KB 4Y4FC 1W0WB 5C0IA 1OTUC 1X7QA 3IGAB 4YHIB 3II1A 4JM0A 2ZUYA 5E99H 4ZMWA 3KPNB 2EUVA 4XMPH 1QBMH 4Q4IA 1DVFB 1G84A 3F00A 4XCNB 2J1WA 3CLFH 2I5YL 2IJ0C 4HFUH 5TJWK 4F8LA 4V1DD 3W37A 2GUOA 4ENEC 2W0KA 4KMTH 1OM3L 4WW1B 4PY7B 1FN4B 5JNYB 3HPJB 1T1XB 1WWWX 2FQFA 1OZUA 2CRIA 5T3XE 5F8QC 1UWGH 2XN9E 2ED6A 1AS6A 4N24A 4OGXL 1SGKA 3QIUA 3CXDL 2GJ6B 3EGSA 2X1OA 1A8JH 3UDWC 3TJEH 3L4YA 1SBSH 4R4FH 5ADOH 2JKTM 3HI1B 3SOBL 2ZKHL 5CNHA 4QNPE 2VITB 1BW8A 1JFHA 1NWOA 5FK9B 4O9HL 3TEUA 3TPKA 3BUQA 3OB8A 1DVQA 4LLVB 4AWJC 4JVWA 1OP9A 3OPUA 5EC1A 4ZXBD 3PL6B 4YLQT 1SY6A 2VXTL 1QVOA 3H53A 4OCNC 1DQQB 4PJDF 3FZUC 4IMKC 2VERA 3CFJA 4BSJA 5HYSB 5LGKA 4XP4L 2JKSA 3T5WA 1G6RB 3QFDB 1O9WA 4PGBB 2E27H 2G2RB 3IFPA 4G82A 4XTRD 4YHNA 3OKKA 2YJQA 3SGJA 4JK0D 5ICYA 3FYIB 3P4OB 1ONQB 5KYXA 4G9FB 9PCYA 2YFNA 3VFPA 1LO4L 5EN3A 3B1UA 4JANA 4RWYL 3PP3H 1HKFA 5CEYA 5I8KH 4J1UA 4PJ8B 1OVZA 4NT6B 1CQYA 5F97E 5LBGA 2AC0A 3MREB 3UG5A 3AY4A 4S1SH 1ZLSL 3QUYC 1HH9A 3DTDA 4G6MH 1FLRL 2PCXA 1M71B 1F02I 1LWJA 1QMUA 2QV2A 2N0KA 4S0SD 4L48A 1BYNA 5MEND 3L3GA 2K9UA 3CUPA 1NFDA 5ETUA 3FSWA 1XMWA 4MZ2A 1BG1A 4G59C 4GIPD 3RUGF 5FKAA 4BCZA 3P9LB 4HZAA 2OS7A 5F7MC 3RE0A 4IIQA 2APXA 2EDEA 2J1KA 2XLLA 1IT9L 5CD3B 5A6MA 5JHBA 1VCAA 1GS7A 2AJ3B 2YPKA 5DJ0B 1HOEA 3ZYJA 3GKZA 3KNBB 3GKWH 2NYYC 2OMTB 3ETBJ 4ZDHA 4PRHD 1A4KA 3L8QA 5KSBB 1HHGB 3FS9A 3K80A 3FO1B 4XAWL 4AV5A 2FLBT 1RJCA 2C34A 3HI5L 2CLRB 2DTML 3IB4A 1SEQH 4F37F 2XPGA 2WVVB 4JFHD 4FFWC 2A0LD 2UXGA 5DA0B 4NDMB 1GMIA 4JJHA 4JY4B 4P07A 4N5UA 2A4CA 4W9EC 2Z92B 3BP6B 3P4OA 3PHAA 1YJDH 5EOCJ 1CT8A 5KYXB 3I9GH 5TFSL 4M5TA 4Q2ZA 4PBDA 3BLKA 2ROXA 4XNYH 3VXMA 5A2FA 1N18A 1CI5A 3RGHA 3GXNA 3TM6A 1RSFA 2XYBA 1QHPA 4MHHI 4RSYA 3BGFC 2CJUL 3BSZH 5LVEA 2WYIA 4NZRH 1DBJH 2VKWA 3ME0A 3MUGB 2QFRA 3EFOA 4WIQA 5FW6A 1JGEB 3DV4B 4HETA 2A38A 5EZOH 3D52A 1AACA 1HHHB 3GHEH 2YQGA 4ZTPH 3U7YH 2Q6WA 3TIDB 3HAEG 1QR4A 1A1NA 4NQCB 2XG4B 1G6RH 2VC2L 5IQNA 1UUNA 1V10A 2KI6A 2VITA 1E3FA 1T5XA 2DWEB 1TQCC 3QPXH 2GUOB 4Y2OB 3N1GC 2E9BA 4JHWL 3RDTB 2VSKB 1TTRA 2NY3C 3E1ZA 1H8OA 4FL4B 1QO3A 2R1WA 5DC2A 5LQBH 4X8GA 4LEXL 4PJHE 1ZY9A 4TTDD 3LIZH 1QPXA 1UM5L 1T2QH 2JF1A 4WW2C 4WWKD 2NY0C 2JI3A 3PXJA 4EI6A 3DVGB 1GPOH 2GJZB 5C0CA 1JHTB 3G5YB 3OPZL 2ED9A 2P43B 3MBXL 2AXWA 3EJQA 2ID5A 3BIBX 3CIQA 4NAQA 2J88L 1J0YA 2XC8A 4WFGD 2AZAA 5HY9A 4JM2C 1HKLH 1NIFA 3RVXC 3WIFA 5FEBA 4NUPA 1AGFA 4R90L 1KLUB 3LS5L 3ZKMC 5AD0B 3VDAA 3GXTA 5D6DA 2DZEA 3N41F 3RILA 4EIUA 1DANT 4DESA 3R4DA 1HS6A 5CJXC 3E1F1 3L3JA 4J12A 1KIQB 4A7QA 1UEMA 2DMBA 1O7DC 4TLKA 1P7QD 5JW5A 1Q1JH 2HLEB 2V5MA 4PVLA 1ULVA 2JJVA 4AY0A 4YC2C 4XPTH 5IKCB 1RZ7L 4U1NB 1VFOA 3GFUA 1RXLA 3U25A 3FUHA 1NCWH 5EOTA 5J13C 4U7KA 1J10A 2XQ0A 3DDGA 4M7KL 3VGFA 2V9QA 3P2BA 3IFNH 5IW6A 1W8NA 5I9QC 1SF3A 2APBA 2EVGA 4KWUA 1KYAA 2H1LM 2OULB 3BVWA 3DURA 3SQBB 3LN4A 5IVNA 2F61A 4PJBB 1E42A 1RFDL 5GRVK 1BMZA 4HUUA 1NCIA 3ESNA 1FZJB 2ADIB 3G6JF 3N85L 3VI3E 3UYOD 2ZOLA 1TTGA 3INUL 2LE9A 3BQUD 2H0FA 4MJJA 4W9JC 3OL2A 3PWPE 4QWWD 4U2ZA 1NFAA 3PHOB 5E56A 5GGQH 2ED7A 2EXWC 1E6JL 4JREB 4L8CA 1CURA 4L8SB 2ICEB 3K72B 5SWZA 4CKVX 1OAKH 1ZGLB 1AGFB 3BP4A 3VQ1C 4H2CA 3ARGB 5FM8A 3MBED 3FFCB 5K9JH 3KPOB 4WEBL 2HFEB 3D33A 3OZLA 4KGJA 2BRQA 4YO0A 1OOAA 4K94C 1ZHBA 1EGJL 5L6YH 3VRJB 1HHIB 4E41E 1KIRB 2O6DA 2Z3FA 3FRPA 3SGEH 4APQB 4JQVA 3AXLA 2EYRB 3EOTL 1H0DB 3HZKA 4M3KB 4TQPA 3VXSE 5KYYA 2V0AA 3CG8A 4IOSD 2NXYD 2HUEA 1C5BL 3FUNA 4J3TA 3V10A 4E9QA 3VE0A 4BDVB 1T6WA 4ELMF 5DTFB 4XMPL 2KKQA 3QUYD 2K3TA 2XG5A 5GISH 3NCYP 4TLTA 3MA7B 2UWEE 2Z31A 3QUMH 3QZNA 3NFPB 3O0RH 4MD4A 5A3IC 2NCEA 3QFJB 4KRMB 2VZTA 1OAUH 1I1AB 3RTQB 4NHCH 4Y9BA 2VZOA 3O8XA 1JGVL 1KGYE 3E3QE 5F7HA 4WFED 4MB1A 1F97A 2GITA 4XMWA 5F7KC 2Z0UA 2PWHA 2DMHA 3K72A 4RMWA 5GHWL 5IHLB 5J6HA 3FTGA 3OKOA 4KU1A 4PGCA 1GL4B 5GGRB 5ISZD 5JIKA 2R23B 1IMHC 1JDDA 3UJJH 1CE6A 4KOCA 2TRHA 1BXXA 1ZT4A 1MREH 2HUHA 3VRLF 4JDEB 2WSKA 1MFDL 1IC5L 5C0CE 5F0LB 3Q2VA 1RZJH 1QHOA 3TO4D 3WXVL 4LPTA 1RQ5A 3D3VD 5HHME 3NPZB 2EIMB 5E2UH 4F7CA 3RWHA 2EO9A 3PQYD 4JL1A 3VGDA 4PD4K 2FUQA 1AIZA 4KKCD 4P06A 4KI5D 1IT9H 2BVQA 5CN1A 2OL3L 3WO4C 2LLGA 2C1PA 2C9AA 4BDVA 4L05A 1QO3B 2R1WB 4N2MA 3EJJX 5LLIC 4BRVA 3ARZA 2QADB 1QTYT 2A1WL 1MSPA 3U2SA 1J9QA 2MWCA 5IBUG 2KS0A 5C1MB 4PSRA 2YD7A 1M1XA 2VR9A 1PU0A 4KJYA 4PTTB 4Z3FA 4DCQA 1A3ZA 3PWUA 2VJ0A 3EJZC 4YBQD 5HDRA 1GZHA 2ITFA 1ZWIA 2IDSA 4HXBL 1T1ZB 3KGTA 5DMGC 4J3VA 4UT6A 2VDPB 2OZNA 2AF2A 2RFXB 4K3JH 4FNQA 5D7JD 3NJKA 1T0OA 3PL6C 1CBJA 2CGYA 3D3VB 3LHPH 2Q7AA 4ERSL 1RZJC 4W68A 5LNEA 4IBYA 4WJKB 1KBKA 2C9SA 1B0GB 3MX0B 2AGJL 4CADA 1NUGA 1A9EB 2P48B 3LH2L 4MCZA 1RUKL 2Z91B 4Z7VE 1D6EB 3V5HB 3OXSB 3II2A 2UUDK 3PAUA 3SDDA 1BPVA 4L4VB 2BMKA 4YLCA 5CJOL 4EBQL 4MMYB 2ZOUA 4QAWA 2PWFA 1R3HA 3DOSB 3A0OA 4JFDD 3SKOB 1QRNB 2VLKD 4NXSA 4UV4H 1XWVA 5ECJE 1MLCA 1OGAD 1OAZH 3RWIB 1BZ9B 5CJQH 2MQCA 2VDPL 2WC7A 5ECGA 4MMXB 3SO5A 5D7JB 1MI5D 1SJVA 3LHPL 4R90H 4Y1AB 2V3FA 3PWJA 4NXKA 5HVHC 1UWGL 3BWAA 5JYLA 1GKOA 2O5ZH 2Y69B 1DN0B 4LCIL 5FB8A 1HHJB 1URLA 1YN7A 1R46A 3ROOA 3DXAA 2X88A 2OMYA 3MBXH 4U1JB 4KJWD 2W1NA 1QSFB 2B1AH 4BZ1L 1YYCA 2GK0B 3C87A 5DVKA 1IBGL 1QBML 4RAVA 4MCYB 2BOCA 4OZFA 1HILA 1OB1B 3GJEB 2EE0A 3ZU8A 1OZTG 4H40A 4OKDA 1JERA 4KC3B 5I1LA 3QCVL 3AM8C 5FUOL 1U2CA 4UQ2B 3U4BL 2ZG2A 1ZLEA 5DYFA 3VFUB 3NRQA 4ONHA 1URZA 3X13B 4MKTA 4UBDD 4EZMA 1KELH 4AQEB 4NC2B 1ASOA 5DDHA 2GBAA 3INUH 5EFIB 2F7OA 4ATWA 2PPFA 1U8NB 1L0XA 1DQQA 4LU5L 3U7YL 2FWUA 1MJJA 2HVBA 3SDYH 3VFVA 4PJAE 1OAXL 1IGIH 4K7PY 4XC1L 4OCWL 2H9GB 3LZNA 4W4NA 1TQVA 4OLUL 4A55A 4OLYH 1HI6B 3DO3A 2WN2A 4XX1E 2H0JA 4YBLB 5KANI 1T22A 2O6FA 2EIZB 3QXTA 2HYMA 3C08L 4N8VG 1NICA 4D0DB 5C7XL 2PXYA 3PWLB 2RA1A 2LLNA 4G8GE 3TCTA 3U4BH 3HC0B 2OKMA 1BBJB 5C0BE 5KG9A 1S4IA 1KTLA 2BVOB 1G9NL 2D0GA 4JKLA 4XB7A 4WV1A 4KHXL 4JZOB 5FCSH 1FZOA 3K2UH 5ACZA 1GCYA 4TUOA 3B1TA 3QIUB 3WKMH 4X8XA 2NW2A 3HI6H 4YX2L 4EI0A 1CBVL 1J8KA 4TULH 4M3HA 1SPDA 5FYJU 3X1FA 5CZKA 3OKOB 3A67H 4NPJA 3PIQA 1S7VB 1TZGL 4QRTA 2CKNA 4KNSA 1OO2A 3U1SH 3BDBA 1JTOA 3O2VH 1NCUA 1YEJL 4L4TD 1NGQH 1QFOA 4I18A 3FB5A 3L1EA 4FTVD 1FWXA 2C4XA 5HDOA 4KI5E 3T0WA 1NGZA 5E8PA 1ZWIB 3CSTA 4PCTA 3V4VH 1HSAB 1QVOB 3DMMB 1UH4A 3H54A 5DDHB 1HCYA 3T6WA 1UWXK 2D31B 1UEYA 2VQTA 1CLYL 4XVSH 4U6YA 5J1AB 4HXAL 1YRKA 1JZIA 1CTOA 2OXHA 3IJSA 3KWTA 2GHZA 5DJDA 5GS0C 5I1JL 4X83A 4CVZB 3T0VA 2H9GA 3LHAA 3BIKB 1WBZB 1E6JH 4Z78A 3EOAA 5KEZA 1S46A 3IJEA 3FQTA 3UEZA 2H8PB 4PU2A 3AG2B 5CO1A 4Q52A 1OSEA 1DQML 3E3QC 4W9GC 1MCEA 1P5VA 3CZGA 4UM9D 4WZ9A 2YMOA 3TWCH 1FFQA 4PJXE 1U4EA 2A6IB 2V8MA 1AGEB 1Y07A 1TYEB 4TLSA 5JXAL 5E8OA 4HPHA 3UGXA 3QO1B 2DICA 4FNSA 2HVJB 2Y36L 3AFLA 5EOQL 1ECZA 2X6VA 1RJYB 4WUUB 1A6ZA 2CU9A 1XO8A 2J8UE 3CDFA 5CEYB 5B7MA 1FE8L 1I31A 3NZSA 4S11A 4FF9A 1CFQA 2X89A 2IBZY 1AYRA 4PTUA 4UILH 2XV0A 3WFCH 1L9OA 1C1EL 2VXQH 3CQQA 3GJFA 4X50A 3UTTE 4NQXA 4L0YA 1DBKH 4JHBA 2BDNL 4UUJA 5FO8B 5JW3H 2ZF9A 3DXAB 2X0WA 2Z93B 5KS9F 3EJZD 3HW7A 3CK0L 5JUEH 3B2DC 5EIQA 4D7PA 1RUMH 5MP6L 1IM3B 3GS0A 4S0HA 4FZEH 3VFSA 1JBJA 3BPOC 5FFOA 4CGTA 1TT6A 5IQLA 1AHKA 3S35L 4EOWH 5JHLH 1BLNA 1H3VA 4E41D 3TA3C 3CVBA 1BZ9A 1WCBB 5SV3A 2EZ0D 3D08A 2EADA 3BD4A 4JNXA 1YEGH 4OIAA 4I18C 3G5WA 1DR9A 5DZLA 4ZFQA 1KYFA 4KJWC 5B39A 3G5ZA 4LAQL 4Y2DA 1X9LA 2Z31C 3L5WB 4U1HB 4X9GA 5GSRB 5IQ9B 5FLVA 2AQNA 4HP5A 2CZNA 5IQMA 4QLWA 1SEBA 2EVHA 3NJIA 3PV6B 1GA2A 3NFSH 4JFDB 3ZTNH 5D93B 3EYFB 3QJHB 3IXTA 2L8AA 1IQDB 4LCYA 5DURB 5E8OB 4AGQA 1IL1B 4JCWA 1FF5A 2NNFA 3JYBA 3VFRA 3QARA 4K5NA 3TVMA 1Y6MR 1NKRA 3IMTA 2V2WB 2VDOH 2ZQKA 3EDKA 3PWNB 3ULVD 1MFAL 5BV7B 4U4BA 3MVSA 5AKSA 2DI8A 4FFYA 4GUPB 5EOCL 2YAEA 4UAHA 4L8CB 2F5AL 4UTAA 2X9WA 1L4IA 2XETA 4Y5YC 3TOPA 1YAIA 5DFVC 4XWGH 3O2DA 1VACB 3BKCL 1GTNA 1J5IA 4W1TA 2DQCL 3ARGC 5AG8A 4PVBA 5BS0E 4AYFA 2J20A 3D25B 2AFNA 4PB9H 5E9AA 1A14L 3X3GH 1FZJA 4YEFA 4PJFE 3STZA 4YO0B 3DSNA 4NS0A 3C6LB 4UNVA 3JYCA 4L8SC 4F92B 5BRQA 4OLVH 3ZE1F 4B9KC 1T1WB 3GMMA 3LKRB 1BJ8A 1IIIA 3FB8B 1X9QA 4OCXL 1JFQH 3KH3A 4Q9BA 4Q6IB 5HGBB 1II4E 4IK6A 1RY7B 4IYKA 4P05A 4AK1A 1JHLL 4S1RL 3SOBH 3BAEL 1T0MA 3FULA 4F8OA 3QQDB 1G9ML 3RWFA 3QWRA 5IEKB 3L2NA 2E7MA 2C26A 1EFXD 1JRHH 1CD9B 2X7LA 3AQYA 3IMWA 4X0KA 1G7HA 4YSQA 4RNRA 3U7AA 3H3BC 2EH7H 1FORH 3WTVA 3QZLA 4MD4B 3I6KA 3T0DA 3HS0A 1JK8A 5CGTA 3OM3B 4ZOEA 3DGGB 4F8TA 4NJ9H 3NOIA 3KH4A 1IVTA 4U0RB 1TNNA 4KMQA 5JW4R 2OQJB 4KKPA 1GC1L 3ZKND 4TXVB 1H6UA 5LG6A 3GB7A 4BH7B 3T2NL 4Z7UB 3W9DA 2IV9A 2UYLB 3K2UL 2NTFA 2V33A 3VDBA 1G1CA 1LNUA 1O7VA 3LNGA 3V4PB 3SGJC 1D6VH 4XNMA 5A7EA 1EJ6A 1NFIA 2AABH 2RMNA 4HJGB 4WWID 4N9OB 1E8XA 1HNGA 2IDCA 2UZIL 3E8UL 4UYPA 1TQUA 3TA3D 4U1HA 5FX3A 1QI3A 3SN6N 3QG7L 4KI5F 3PE9A 4GNKB 2HLFD 4KRPB 4BWUA 1HWGB 2AERT 2W91A 4BZYA 2FX9L 4N2KA 4FD0A 4Z3HA 3NSFA 4M5YL 3GEFA 3TO4C 4CN4A 2P5PA 3LZQA 5INDA 2E9IA 2HVKA 3QJHA 4OTXL 5IUSA 3ZQWA 2OXHB 4MBOA 5EZJB 3S2CA 1DFBH 2QKIC 2VW6A 4M8QB 3KPTA 1BQHA 4CRPA 5BVJA 3OG6B 1JGEA 3DV4A 1WFMA 3QSKB 3U1PA 5DQDH 5SWZB 4JGNA 5DFTA 4HCRH 5I5MA 2EEAA 3QORA 1ZIAA 2ZPKH 1G4MA 4LNVA 3WAKA 3L3HB 1X5YA 4R5VA 4XPHL 3GDBA 1MEXL 3JUYA 4POZD 4MQXC 2UZIH 4MX7B 5TH2A 4HX1A 3KNBA 2XHNA 1BJMA 1B90A 1LDPL 2EXWD 4PY8J 3UTQA 3A6CH 2DM4A 4XT1C 2GJ6D 1CL7I 4BYHA 2QVMA 3BQUC 4WUUA 3W57A 2DYRB 3CFNA 3CVCA 4W9LC 3SDXA 3L7FA 3FUIA 3MV9D 2JIXA 3I9AA 4LPYA 5JZ7C 4IU2B 4L4TA 5I71B 2ODHA 1FLTX 4PY8I 5FKAB 3RVWC 1IAOA 2WOBA 1B4JL 2V8LA 4P5TD 2X3AA 4QRRE 3X13A 4YSPA 4P59L 4MAYC 5FDWB 5LKNA 5GRJH 5HYQB 4Z7QE 3ECQA 4LSQH 4X4XB 3TX4A 3MYJB 4LEEA 4LLVA 2XWXA 1Z5YD 2DH2A 1CICD 3BVUA 5AL0A 1IGFL 1Z6JT 2ZKMX 3VXSA 4PJAA 1R1CA 4H5SA 1JGUH 1M6UA 1WD8A 2CMRL 4PJBE 5L2KA 1OE2A 4CU6A 4B97A 4OZHB 4YEEA 2LAGB 3FQUB 5FYLL 2FWSA 3BDXA 1XF2A 5C0GB 4DKEH 5FUZH 2ZZUT 4KITB 5AZEH 3QRFM 3CQFA 4OI7A 3TYFA 5KSAB 5E8NA 1RHHB 5C07A 1WO2A 2JKIS 1ITBB 1IBZA 1P6AB 2KLSA 4PJCA 4KKNA 3F3HA 4FP8H 1LO3L 5EBMB 2FX7H 5TH2B 2MCPL 4DGUA 5FXCH 3WDHA 1IVLA 1GJUA 3GGWA 1C08B 2Q20A 1DHKA 4HBQA 3BSHA 5JXEA 2X89D 5HYSG 4K23L 1CG9B 3RQ3A 5CSBA 1U58B 3NIDE 4LL9A 1NM4A 4QHMB 4XMXA 3DMMD 4TS6A 1UADC 1QRKA 3GT6A 1HNFA 3NIDB 5FLUA 3MN8A 1ED3B 1QD0A 3EDDA 4OCYL 1N26A 5A2JH 3RNQA 1KJ2H 1OTSD 2OCFD 3IDIB 4NN5C 1BYPA 3OSKA 1KLGB 3ZDZE 3PS6A 4PV8A 5HHVL 5T1DL 4FA8A 2QSCL 5CLYA 4ADIA 3WIHL 1A64A 2VMJA 4PW9A 2BC4A 4Y19E 1BJ1H 3R19A 5DD5H 1LDPH 5D7IE 4YSUA 1YHPA 4NJAH 3NACL 4Y2DD 5F7DA 3U36B 5KVDE 4HC1H 1PX3A 4D9RE 3PFQA 2YPLD 1E4KA 3T3PF 2L7QA 2W0LA 1I8IB 2MKWA 1DJYA 3QNZB 3SPVB 4AC2A 2PW2B 2EE9A 4XNQA 1B0GA 2J6EH 4KZEH 4H8VA 5EN2B 5MEQA 3HBZA 4CW1A 5IVZA 2MCAA 3TO2B 3EOBA 3WUWA 2CDEA 4OQTH 1PYWB 4N4YB 5F9AC 2HZHA 4BUHA 4FXTA 3CX5K 1XGTA 2GVYA 3EAKA 3MAWA 2FTAA 4HLZH 5AOLA 3WTWA 1L6PA 3TVMD 3L4TA 3OB0K 3P3TA 5JR1L 4MYPA 2BX5A 4PB0H 2AW2A 2WVTA 5BMFH 3MJ9A 1Y7VA 3ESPA 1I9EA 5HBBA 4GRLA 2FECL 1KULA 2VLJE 4XPAL 2GY5A 1G9HA 1E5UI 3ATAA 1BVKA 1YVLA 2HKHL 5E6UB 4ANWA 1OQOA 1KZYA 2YD2A 2OMZA 3MXWL 5E9DE 1NMAH 2YPLB 4JHVA 4ILDA 3Q2CA 4AGPA 3IMSA 1P9MA 2CM5A 3C08H 3K7UA 4GO8A 4GG6E 4ZUWB 2AXGB 1ZTXE 3HB3C 2K4WA 3ZR5A 1ORSB 3WKPA 1K8DB 3IT8D 5LQBL 3J07A 2AEPL 4HVBA 3L6FB 2J8OA 1RJLB 3AWFA 4YSTA 7FABH 2E3VA 1BM3L 1YMHB 1S8DA 3I3DA 5IKCA 3BT2H 3ZKQD 5LNDA 2J88H 4X6CA 5IEHB 2YO3A 1I8UA 2GCYA 2JB6B 3MCLH 1BJ1J 1NDGB 1QBLH 4IGBB 1TMCB 4WI5A 1AO7B 2J55A 4M02A 1CUOA 1KTJA 4ODVL 3RBSA 4M62L 2LTQC 3QE5A 3HR6A 5DGRA 4OLVL 4N0RA 2WTOA 3EZJB 4YPGB 4BFIB 2O61A 5E23A 3O41B 3T4AC 3OKNA 3CFQA 5C0JB 1FG2B 2WBXA 3HNTH 2EH8L 3REVB 4LVOB 5C0NC 3KXFA 3GMRB 1AZZC 4XWGL 4GQ9H 3FCTB 1G9MH 1ML0A 1MLBB 3G08A 4NN6B 2VLJD 4X5QA 3O8XB 3W11C 3POHA 3MBWB 1M05B 4C83A 3NJHA 5FYLE 5K9KA 4HWZA 4RFEB 2E8ZA 2J1ZA 2N1TE 2DPKA 2OXGA 1TSRA 2WUCL 4L5FL 4TMPA 3D34A 3C8KB 5EF3A 3T8MA 1E0OB 3A6OA 1JNLH 2K8QA 2MNUA 4XN5A 4EQ3A 4E9WA 1Q38A 3GRWH 1Q90A 4PJHF 5F3FA 5D2LE 3BZFB 3MV7D 3TBYA 1E9PB 2ZYIA 4CSSA 2B7DT 4J4PD 5D96B 2X1WL 2E76C 1Q1JL 2FWLB 4TOYL 3ZVVA 1X6LA 1DJGA 1B4TA 3IBOA 4QIRA 5FUCE 2W65B 5IVOA 1HL5A 5KVEL 5KBKA 3RX9A 4DVBA 1SXSA 2IAMC 5I5JA 3GMQA 2P47B 3WFDL 1FZMB 4K0OA 5MI0B 2ZAHA 1EGJA 1UH2A 1YA5A 1YPZA 3NTCH 4PGCB 4Z7WE 3QNXA 4FKEA 5IMKB 4DTGL 2BIMA 3KPLA 2QADD 3TTSA 1U3HC 4Y16D 5C0JA 1JK8B 5B39B 3AQXA 3CN4A 3FSVA 4MS6A 2ZX9A 2JELH 4APQA 4XBMA 4FZEL 1PZ5B 3X1BA 4ZMOA 5CGYC 4ABWA 5KS9A 1VA9A 1MIEH 4Y5XA 5FKPA 1R3JB 5DFAA 1PY9A 3PWPB 4JY5H 2YFOA 2FLRT 2QQQA 4MXVF 5LGYA 3NH7H 4Z7AA 3FXIC 4DP5X 5MERA 3SDAC 2X3CA 3GBNL 3BEVB 1P5VB 2R2CA 2CCWA 3OJMB 3OSVA 2BXZA 3CCHB 2NY2B 2P28B 2A74B 4Z23A 2VC2B 1A25A 2QFPA 1TFHA 4FFZL 5KVFE 3RNKB 4AGOA 4I3GA 2MKLC 4F91B 1M7DB 3MA9L 3EGXA 5AVTB 1SM3H 3IU4H 4B5ZA 3UYRL 1LQSR 2Q9OA 1NCOA 1R33A 4JRXB 1A6AB 3O9WA 4LCIH 4OM1L 2CDGA 4RMTA 4PJAF 5JDJA 3CFCL 1YDPA 3QJXA 4K7PL 2G75B 1SBSL 4R4FL 5IB3B 1N5AB 5EEYA 4BSVB 1O9ZA 1TCRB 5DRWB 2ZCKL 1MPAH 3MJ8A 4U2YA 4Q58C 3IAGC 1UCBL 4WI9A 2YARA 3H9YA 3UJIH 3ABZA 5GHWH 1KTDA 2I9LB 4TYUA 5DRXB 4OM0L 5IFJA 1R75A 4ODSH 3EFFB 1CFVL 1HT6A 1U8LA 3IKCB 1N12A 1CXEA 2VN5A 4KFZC 3N9GL 3QUZB 2YHGA 1SYSA 1UD4A 4LSRL 4MNQE 4PJCF 1RIHH 5B3JE 3ETSA 4NUMA 1C16B 2V9RA 4N0UA 5BVPL 2EE3A 2CUIA 2VDKL 2OYKA 3D4CA 5J4MA 3U4EA 1KB5A 3BPLB 1JF5A 3R1GL 3CZJA 4NT6A 3DI2B 2VQ4A 5FM5M 1SLUA 4UT7L 1JMZA 1B0IA 5I1EL 3VVWA 3BZ5A 5FECB 1LO2L 3CBKB 3H4HA 2OL3B 4QXTB 4W4OA 4WI0B 2NUTB 4HSAC 2LW3A 3WD5L 5GSVB 4W9ZA 3KM2A 4ZFOA 3DVNB 2VWEE 2WWKO 4HS8H 2IV8A 2XRAH 4NEHB 2H6UA 2XV3A 3CXHK 2VL4A 3D1MC 2KQNA 1MAKA 4HGKC 4K7FB 4M5ZH 2ZOKB 4WI6A 1U8MA 2R69A 3QH3A 3ZZ1A 4DH2A 3RY6C 5F1IA 3FT4A 3LDBC 3MO1B 4WO4C 4JPWH 4JO1H 1ADWA 1PQZB 2K3HA 2MH4A 3IE4A 2DAVA 4ODWB 4U49A 1KF9B 3IK2A 3MRDA 3NSCA 4PIRF 1PJ9A 2PXYC 4Q2ZB 4WU5B 4A63A 3WY3A 5DLLA 1E4HA 3UAAA 1WFIA 5D6CB 1TO4A 4ZMLA 4PJCB 2LVCA 3CZEA 3K2IA 3F58H 3DPDA 1GSKA 3LRKA 4IW4C 4LDEB 2QZQA 4KX8A 4BK5C 5DWUL 5IB4B 2LT9A 4PRIB 1KJ3L 2ICCA 4HU2A 4X2UA 4YZWA 4JG1L 5SX4I 5DK2B 4AIXA 1UD5A 4FYRA 2OTUA 2WNGA 3F12A 3MREA 3ESMA 1OT4A 3MLYL 4W93A 1AZUA 1NUNB 1AQKH 4H8QA 4XBEL 1S7WB 3SKJH 1A9BB 4A7TA 2AJVH 3UAJA 2F54D 2B16A 4M7LH 3BZDA 5D5ME 4G3YL 1MG2C 4MS8C 4GUOA 2AJZB 3FQ4A 2Y6TE 1MWAL 1QWHA 2BNRD 1HHKA 3HG1D 4HIHA 1A7QL 3BUYA 3JWDC 4XP1L 3FFCD 4H1LB 1S5HB 4L8DB 3P9LA 5HGGS 3W11D 1A3LL 5C3TA 2O5ZL 1HSAA 3FNKA 3MDJA 3V0DA 2HG0A 4BJLA 2WGXA 3M8OH 4RA3A 2H26A 5D4IA 5C0GA 1CGSH 2AJ3A 2YPKB 1U8MB 2BC4B 3QH3B 5DJ0A 2AHIA 4A66A 2IDUA 2WKGA 4LLYB 5B8CA 4Q9CA 3SDAB 1IBGH 4N2NA 1NGYA 3WNMA 1JGUL 3GMPA 3W1ZA 5L4JA 3HE6A 1I1YB 5TF0A 4PJ7A 4IOIA 4AZUA 3C5ZB 5AB1A 3GD1C 2XJKA 5FHBL 4FMFA 3FB6B 3IKKA 2ZSWA 5FUCC 3GSNA 2VZ1A 4KXZH 4MYWB 4XP1H 1U21A 4JZOA 5B38B 4AGNA 1J88A 2X12A 4YHZH 3GMNB 2GSIB 2FCBA 3QUGA 3FN0H 2YK1L 2FEEL 2VXSL 2V7HA 4NRXA 1AQDB 1TEYA 1UACH 3IU3B 1VKXA 4L37A 3KLLA 4DPBX 2AQ1A 5FK9A 2E27L 4KRPC 1IJ9A 2QTVA 2OMUA 3LD8B 4XNBA 3QZBA 4NSKB 3IXAB 4P2RA 3OX8A 2FGZA 1LO5A 4NC1E 4HWNA 2DY2A 2W95A 5EO0A 4XVOA 3EKCA 5JOPD 3K8KA 3QVAA 3JV6A 3ATEA 4LF3A 3JSSA 5F1IB 1NCCL 1UGNA 2FIKB 3P30H 4UMSA 1G7JB 1XCXA 3OMIB 1FGVL 3A4AA 4JDEA 1OSPL 1ZLDA 5AVVB 3U9UB 2QSCH 1EJOL 1P1ZB 4ODVH 1WS7A 4QRSB 1OSZB 1F3RB 2R0WL 3EFDH 4LKCB 1SHWA 1D5BB 5DCCA 1KN4L 3VA2C 4A6YB 4Y7MA 4YC2B 4OQ1A 4BWWA 1I1CA 1EFXB 2FJGB 2EAEA 2VWEC 1NBVH 1JNNL 4HZLB 5IHHA 3FT2A 4HIPA 3SDDC 3J8F7 4YGVA 3OJDA 4K7FA 4JHZA 3ZDXF 5DRNB 4LNRB 3BPCB 4LSVL 4N2AA 3D87B 4OJFH 5E1GA 2DQUH 5AW8B 1YEHH 1EANA 2XX0A 4I8DA 4WY7L 2NY4D 3U2IA 5JHDA 1KOAA 4R4BB 4BH8B 1MCIA 5IQOA 2OL3A 1PG7H 3VFWA 3IDUA 2RALA 2ZXCA 1NLBH 3V0FA 5L9DL 3V0WH 1ZGLP 1CD0A 2Z1PA 3ARFD 3GO1H 3KYOA 3VRIB 4OCXH 1U36A 4WJ5A 4ODSL 1RVFH 3L2LA 3OG4B 3ZYIA 5CILH 1E65A 2PLTA 4IRJB 3RA7H 4D9LH 4MB4A 3HMXL 3HTLX 4DP7X 1JRHL 4ELKB 4BZ2A 1K4DB 2V2TA 2ZCKH 3GGWB 5T1MB 4M6OL 1B6DA 15C8L 3FU6A 3SKUD 3ECUA 5IJVA 3VG9B 4Q6IA 1MFVA 2XTJE 2YD4A 5JORA 4NKMA 4YHPA 4B60A 3GC3A 4FE9A 1TQWA 4DO4A 3I6GA 1H6TA 3PNWA 4O2EB 4ORGB 4APXB 1EPFA 1W91A 3IDXH 1ICTA 1VZHA 3N5AA 4HJJL 4JW3A 3FTZA 1Q9WA 1E4XI 4XN4A 1Z9PA 2BVUA 3BEWB 1F6AA 3S5YA 4UINL 3UPRB 2HTKC 5E6IA 3ZDYE 2DB8A 4P5SA 5D6CA 1P1VA 2CAKA 3LZOA 4FQXC 3OB0H 4UDUA 4YHIA 3QQDA 1R0AH 2AQRA 4MMZA 5C0DB 1SUJA 1IAKB 2FQEA 1DVFD 1I7ZB 7TAAA 2EYRA 3VRIA 5MERB 1MQ8A 1SN5A 3OKNB 4NO5B 4GKNA 3NVQA 3CLEH 4JRFA 1VFMA 3Q13A 1HX0A 5LUMA 1TIUA 1IC1A 2PTVA 3L7FB 5DK0B 2OCCB 3WFHA 4WF7A 4ICWA 4P46C 2ESVB 1M7DA 2CA4A 3U4KA 4ZUVB 1JZGA 4OJFL 3JQOB 1UOLA 3ULUD 4KKRA 1C7SA 5E5MA 4JO2L 2C5DC 3KWWB 4ZSOA 4RGNE 3VXMB 4DO6A 3K81A 4LSDA 1WP6A 3QISA 4A2HA 4AKOA 3M07A 2WLZA 4ORGA 1UQSB 3IDNA 2HSIA 4H1LG 3STZB 1LWHA 2A6KB 3SO3C 4HC1A 5HGAB 1Q0EA 1A22B 1RVFL 4HAKA 1LJMA 2BP8B 4ALAL 1QPKA 1OGTB 3DJSA 2VDQL 4NFCA 2D2CC 1X5MA 3N1FC 1JXGA 4GI9A 4L3EE 3ARBD 2N7AA 2VH5H 4HF5H 3QIWA 1O75A 2WBWB 1JPGA 1KC5L 3DIFA 4UZUA 3ZIYA 3EDJA 2WYZA 7PCYA 1IGYA 4YE0A 3P1VA 1WH0A 3UPCA 4WAFA 4D0BA 1JIBA 3HLAB 3K46A 4KO6A 4PGEA 2UYLA 5J1TC 2D7TL 5E9NA 3QDGA 5LXGH 4PGZA 3TA3A 1JHTA 4LVHB 5D1QD 5GGVY 5JHDB 4HWUA 4YL4A 2WAHA 4EIGB 3VD3A 3ULVH 5G4OA 3MV8B 3RUGE 3ALXA 1UD8A 4UF7C 2VC2H 3LSOA 1MI5E 1N8ZB 4APQD 3QDJE 1U3HB 2CCVA 1H15B 1EZVY 2G2PA 3H6AA 4LARL 3TFKC 4MNQB 4Z7NE 4RAUA 2A3TA 1OGAE 3O3EB 4ZTOL 5IMOA 5JYMA 2F1EA 1OM9A 5ABAA 5C0EB 3SGEI 1IEBB 4QLRA 2FX7L 2ENPA 4NQDE 5K69A 3K1KC 2XJLA 3VWJC 5J6GB 3CH1A 3MUJA 4ELKA 5I75C 2D03H 3AU1A 4GXVL 3U36A 1JJUA 2FO8A 3S8GB 4O51A 3GRBA 1E7UA 1NCCH 2B1AL 2CBPA 3MMEA 5GZNA 4BZ1H 3O2WH 4A7SA 4WK2B 3CVDA 4N0UE 3SKMB 1KXTA 2ITCB 3CFBB 4HOZA 1MWAB 2FR4B 1IAKA 4UANA 2H1PH 5C6PB 2J8UB 4Z8FH 2F18A 5HHPB 4G1EA 1YMME 3QQ9D 3AY4C 5H2BA 3LS5H 4M8VA 2H0EA 1F86A 2W9DH 2ZUSA 3HE6C 3NCJL 4YDLC 4F7EA 1K5WA 4ODTL 3CAFA 3BP7A 4AJWA 2DOCA 4QGYA 2FGWH 5C07B 4L3CA 1NUFA 1ZXQA 2VJXA 3SGKA 3UO8B 4GUQA 4TSBH 2EDHA 3ECVA 2E4TA 4WY7H 4F8NA 3IFLL 2CJTA 2NNRA 4GT0A 4KXCA 1QOKA 4IKKA 1AZRA 3D0LA 3P02A 4ZJ9A 1JPEA 3ZE0B 2Y3AA 2BHUA 3T2PA 1P5UA 3B34A 1YMMD 4KPHH 3RDTA 1GW0A 4H88H 4XP9L 2XFXB 1RHFA 1UA6L 3K71A 2DLFL 2Z7ZA 1NANI 3MRDB 3SBQA 2W92A 4N3UA 4UQ3B 1FO0L 1FVEA 1DYZA 2FIRT 4PLNC 1PD1A 3HS0C 4QO1A 5B1JA 1MFCL 3FQXA 5CINH 3TZVC 4JFFD 4WO4B 1BWMA 2VN3A 2Y7SA 2ZPKL 1ZV9A 3BKJH 4R6UA 1ODAA 5GS2D 1T7XA 2QSVA 5GQBA 3QR0A 3MHZA 1RZKH 5KSBE 4PRHB 2DKSA 3ULVL 3MLVH 1IBBA 4LEOB 4OFKA 3N0AA 4XE0A 3NCBB 2ZOTA 4Y4KA 4PHXA 3WD5H 3ZKXC 1KMGA 1TVBB 2DQDL 2I32A 2BNQB 1DBAL 1E7VA 5BZDB 5ID1A 1VKXB 2Q2LA 2D0HA 3Q48A 1I3RB 2LVEA 1U91A 1HE8A 3DX7B 1OE1A 2RB8A 5F9JB 4HJJH 4AEIH 4H8UA 4HCFA 2PCPA 2WXIA 4RFNC 5HPMB 3WNNA 2R29H 1GCFA 1BAWA 1DLHB 1A5FL 4JVPA 2DD8H 1YC7A 4LGSB 4QT5B 2F15A 1E5ZA 1T0PB 2YUZA 4DOHB 1CXKA 2RGSA 4D0DA 4MCNA 4PRDB 5E4AA 2LU7A 1V7ML 1FL5B 1P4BH 2JFCA 3HHSB 4IBUA 4KRNA 2ZKYA 4LKXA 5C0AD 5AW0B 4UNUA 3F7RA 3FQ1A 4PGEB 2FHBA 4A7GF 2ZWYA 1OAZL 3G04B 2BSRA 4G9FD 3BKYH 4XVTH 3VI3A 3L3IB 5A6IA 5EDXA 1F3DJ 2NY4B 3QEHA 1MRFH 4JCLA 5IVXF 2EYSB 4ZODA 2QPFA 4OD1H 3FB7A 3E2HC 2RACA 5FM5O 4HBCH 4KHTH 3APMA 3QZWA 1QFWM 4CNIB 2IALB 4ORZC 2D3VA 4LL1A 1U93A 2BHFA 1TF4A 3CVHA 4N28A 5FHBH 5HYIA 3PL6D 4P4KB 2Y5TA 1KNOB 2BZ7A 4J1UB 4PJ8A 4XAKE 1W9XA 4TNWF 3LH8A 5AAMA 1UZ8B 3UADA 3CDGB 3HNSL 5F6IC 2HTLD 3L08A 3ARED 3DX2A 5DJAA 3SE6A 1LM8V 3IJSB 5BOPA 1S9YB 4QXGL 4O4YH 4HWEH 4RGND 1A1MA 5JUEL 1X7QB 3UG3A 1W16A 3PWPD 3VFMA 3QGVA 2OYPA 4C59B 1JV5A 3H9SB 5JIHA 4KI1A 3TA4D 4DQAA 5F96H 4XPBL 1CDHA 1OPGH 3HE6D 3OKEA 5E1AB 3QPXL 1FHNA 2WQRA 1OTTD 4KJQD 1G0YR 2QQLH 2YA0A 3BP5B 3QUXC 1GGIH 2CNYA 1BREA 4IBQA 1G6VK 5IMOB 2XWTA 4TUKL 1U8JA 3EO0A 1R5VA 4XC3L 5D7SH 3IMBA 4OD3H 5KBMA 1OAXH 2Q8AL 4EO5A 1BZ7A 4K3DH 5I5RA 3X11A 5IVXB 2HG5A 5DEJA 5LGHL 1XCTB 4G6FD 2Z7WA 3U0TB 4DTGH 3IDXL 1E6OL 1LTXA 2AK4D 4G11A 4DK5A 4LLDA 1XZ0B 2GT9B 4W6XB 3U7WL 1KJ3H 2CK0L 4JB9H 4LPXA 4JO3H 4NQVB 3KD4A 2ZG3A 3MLZL 1MVFA 1JV2B 3H7BB 1QZ1A 4HF5L 4RESB 2WHVA 5C6TH 3QQ9C 5AOJA 4JRYB 5I6XC 2J1YA 3FUDA 1QATA 5L2KE 2B4CH 4G6AD 5GRZA 1AE6H 4H8PA 3RZCB 3TBYB 2BOBB 4OD3L 1YUKB 3ILQC 1ET8A 2H26B 3Q1EA 2MNWA 3HG2A 4TQEH 4D0CA 4H1LH 5TD4A 5JZ7D 3BT2L 3FCBA 4P46A 4XB8A 5DS8A 4KVCH 1NH6A 4UV7H 3RL1B 2GAZB 1U95A 1F4XL 1E67A 3ELAT 3EF7A 2CKBH 3TPUA 5MEPA 1RUAH 4HWZB 1AXSB 3DTXA 4MJ5A 5I28A 5DD5L 2VB5A 3JVFC 2JJUA 2EXYC 2R2HB 2LR4A 2VZUA 5FGRA 3F8UB 3PXHA 1I9JH 4L23A 3ILEA 2VRAA 3KXFE 2IO5A 5H2BB 4BFEA 1T0NA 1T04A 2EDFA 3HUJA 2OJZH 1WZKA 3GMRA 2WXGA 1J0JA 3OLEA 4R4ND 4AMWA 2ZOOA 4ETQB 5I6LA 3A4EA 2EDTA 2QHRL 4L3CB 1MVYA 2VMFA 3TBTB 5T5FH 2F19H 2XG4A 4P9HC 4YOKA 3Q43A 1A6AA 3O9WB 1IFRA 1ACYH 3HFML 1FO0B 2D7TH 3X1EA 3FK3A 1YUHB 3MGTB 3M46A 1OT2A 4Z3EA 3TLRA 4JPKH 1F4YL 2DMCA 3WLBB 4X42A 2WNXA 3ARQA 4L5FH 2QKSA 3NSDA 5FA3B 3VSVA 4OFYD 3AY2A 4Y5VC 2WQUA 4TPRL 1CVSC 5TTRA 1G4RA 2X6CA 3SKJL 4KVNL 3RWCB 1Q72L 3S5LA 1BVLA 4N6QA 1E9PA 2JIXD 4GAGL 4HIQA 3FBKA 1FE8H 3SHSA 4LLQA 3CBRA 1JNLL 1JDAA 1R24B 4GKZB 2VQ1B 4IOFC 4UDUB 4ZXBB 1HN1A 3BW9B 1C5DA 2JMRA 4FEMA 2QQKH 4OCRL 4Z3JA 4GSDL 3U0PB 5FS5A 4WNQB 3H56A 4AUJA 2Y07L 1S7RA 4RMSA 3S98A 3CU7A 3CZNA 4M8QA 2NY0D 3V5HA 2J6WA 1F6FB 1Q4NX 4XVJH 4PP1C 5T8IA 1T6VN 4DPRA 4IRZH 4QRPB 5GJTL 4PV9B 2CA3A 1OANA 25C8H 3B2VL 3LEXA 4OLWH 5I76A 4LRIC 3UFIA 1T7VA 2R0KH 3ZK0A 4A38A 5TDPB 3VH8B 5D7JC 3KBPA 3B8SA 3IFNL 4GW4A 1BVZA 1OHZA 4X6DB 1XX9C 1NIDA 3VWJA 1IGJA 4WFFE 3VYOA 1A47A 4OZIE 4B9JA 3HN8A 3KLSA 4P04A 4R8WL 3TBVB 1QNIA 1A3QA 1FG9C 1VEMA 1NBZA 3AB0B 5FYKE 2AEPH 4C4BA 2WXLA 4LOUD 5I82A 4J3OH 5MENE 2IALA 2QVIA 3BKJL 1J7VR 1I7TB 3FO0H 3EBAA 3OQ3B 3OWRA 4JO2H 3VD5A 4ZMPA 2DBJA 3S6CA 3V0VA 1EBAA 5HYJA 2VN7A 2NY7H 4GINA 2YBRA 5BUGA 3ENEA 4GG6A 4XWOC 5ESAB 2E7CA 5I73B 2WN3A 3EOAB 3S37L 1HZLA 3T65A 3V9CA 5I8OH 3ROLB 4JFFA 1FC1A 3GXFA 3CZSA 3NGBB 1A6VL 3PUUA 3MJ6A 4G43B 5CD5C 2DQIL 2G4EA 3M1BB 4GYBA 2BRRH 5B1JC 4CGUB 2V6HA 5FGBC 4PVMA 2GB2A 4ZAKC 1A4JA 1PVHA 1IQDA 2XWBB 3EDFA 5HGAA 4YR6B 4NZUH 4K8RC 3UBXG 4KK9D 5BS0A 1KCUL 3ARTA 2P8LB 4J5VA 3ZR6A 3MUGA 3RZCA 2Y1ZA 4QHLA 4Z7OB 4Z7VB 4NQXB 5F8RC 1NSNL 3ZUCA 2PYFA 3MLSL 2IANA 2WPGA 5A2AA 4XC1H 1XBRA 4AQAB 4HIEB 5E6IC 1YYLH 1JZ8A 3TWCL 1S5HA 1FNEB 1X9UA 2BIPA 3OAYH 3CX5J 1PPIA 3VGBA 5I15L 5JOEA 3ARPA 2OMNA 4IRZA 1WFOA 4JM4H 1EZVX 1EGJH 2CLVA 3RZWA 2NNAA 1IFGA 3TT3H 3T0XA 3UBGA 1WRFA 3CFEB 3RIAF 4XHJD 1JVLA 2X5PA 4JPQA 2MIZA 2R1YB 1D7FA 3DRQA 4FLRA 3P11H 4UQ3A 3F7QA 1I3UA 4QRRB 1GJWA 3X3FH 2W07B 1X5GA 2ZSVA 4V1DE 5FO7A 2BINA 2NXYC 3H0TB 1MNNA 1DQTA 5LO7A 1NCBL 4KUCF 1XGQB 4ZQKB 3ULUL 4EVNA 1AG6A 1FFNB 4HS8L 3ZTCC 4OIBA 4W9DC 5C08B 5C71A 4HZ1A 3UPAA 2BY0A 2Q2EB 5FF6A 2BVEA 3RVUC 1N5YL 5A3ID 2HLAA 2XVBA 4CJ1A 1WHOA 1N2RB 1IU1A 4HCGA 1DJIA 2A0LC 5FO9B 1EXUA 4EOWL 3FCTA 5EEVA 2XN1A 3DX8A 4Z7OF 3B9KB 3FFCA 1YYML 4Q7DA 4QJ4B 2R1XA 4YX2H 1WBYA 4R84A 3TCLB 2FUTA 3KHOA 4OAWA 2GSGA 3NFNA 4G42A 4F33B 4ZQTA 5LDSA 3FB6A 4OF8A 1S9XB 2B15A 2NW3A 5JA9A 4JHAH 5B1AB 4ODXA 4PP2A 1XSIA 1W8OA 3SE3C 3LQAL 4POYA 3V6FB 1G1OA 3C09C 1DBML 1J1PL 3W3BA 1EHLL 5I1AA 4YSSA 4NDMA 3AXIA 1NCNA 2X0VA 2BZCA 4PJBA 2E7DA 4P2OA 2AJVL 3GMLA 4LOVA 2EXSA 2WB7A 4K7PH 2R0ZH 3AB0C 4JN1H 4Z7QB 5CSZB 4CSZA 4H1LA 1RUQH 3FL7A 5HJ3B 1WAAF 1ZHLA 5FYJH 2GI7A 1J5CA 5DUMH 2DMKA 1JPFA 4PGBA 4N0CD 5IK3A 1IILE 1UM4L 3FHEA 1WHPA 3QFJD 2R2BB 3HKZA 4FHJA 2Q8AH 2VSDA 4NQEA 4G6FB 1OP3H 3BPCA 1CU4L 5JMRA 3HZVA 4XNZB 4GAYB 3B5TA 3RPIB 2Y5EA 5MI0C 4MMXC 1U91B 4K9EL 5K39A 4UM8B 1M6OB 4KDTC 2AXGA 4HFWB 4WRLA 2XSKA 5ADPH 4IOIB 4GG8B 5IM7A 4BQ6A 1F4WL 3P54A 3L9RB 4M7JL 4V2CB 1JZ3A 4AVHA 4AQ1A 1WFTA 1Z9SA 4PRHA 1RL1A 3ALWA 1JFQL 2IXQA 3O4LA 1ERNA 3D50A 2P26A 2YSSB 3FAWA 4OCMC 1LO2H 2J8UA 5DA4A 3FUMA 1UT9A 4JPSA 5IQ7H 2ODIA 1B3IA 1FO0H 1BF2A 3VWKA 3RG1C 3AXHA 2M26A 2WLIA 2PPDA 1T1ZA 4YFEA 3TONA 2DTSA 5F7NC 4DETA 3V55A 3O4OC 4G1MB 3IM1A 2SEBA 2Z4TA 1QFWH 1R5IA 1T80A 4Y1AA 3N43F 3TIEA 1EIBA 3IFOA 4JRXE 3CMOL 2CSPA 3NJXA 1QAWA 4HV8A 2VLMD 4KK9C 1JZHA 3TZVB 4F15B 4HUMB 4LOEA 5DD6B 3O11A 4PWIA 5DJ8B 2ZX7A 2HPOA 3SBRA 1CIDA 1Q0YL 1MJ8L 3DOSA 1CLZL 2I07B 3S3CB 2A7BA 3ABKB 4FNUA 3DX8B 4HGMA 4WO4A 2JK5B 4QHUB 5DD0H 2CG9X 2KUTA 5F3HB 4NERA 5E6ZA 4MB5A 2L0DA 3MV7B 3AT8A 5J9PB 3L16A 2R0LL 2XKNB 5DZVA 3HNVL 1CICC 1UOVA 1IJNA 3RRQA 3W39B 3MV7E 4U1GB 1Q9KA 2W9EH 4WO0A 1I7ZA 2VDNB 3KPLB 1SJMA 3CDCA 5C09D 1F00I 5EOCH 1AXTH 3TH4T 4Y1SA 3QB7C 2F58L 3FONB 1U8NA 3QNYB 1IAIM 1XFPA 2O6EA 2X4QB 4AMKH 3VMPA 4ZFZA 3QA3A 3TO4B 3LKPA 4JDZB 2OP4H 1ZIBA 4FHKA 5CEXA 5DRZB 2BCKA 2EJ1A 3E80A 3TEZA 3G6JB 4HSQA 4JG0H 3FQRA 3KJ6L 5DSCB 4J3OD 3SKNB 2NT0A 2AV7B 4G7QB 1N8ZA 3MLRH 1E3XA 2GTWB 2UX6A 3E2HB 1S7TB 5K9OB 5F7YC 3ERXA 4U6HA 4GFXA 1QW9A 4WW2B 2NYZA 2M1KA 3F6JA 4R5TA 2KT6A 4FQXB 3REWA 1SHMA 1UKTA 1NCAH 4QHKJ 1MRDH 2R1YA 3WN5B 3MRGA 5KJ4A 1XEUA 1I8KA 3EJTA 4GEIA 3HRZB 3MRIA 2HJFA 1BOGA 4DT2A 5FFGA 4I9WD 3BO8B 2CH8A 2JSFA 3PP3K 5ITBH 4R7NB 2AQQA 2CUMA 1MHHB 3HPLA 2R39A 1A6UH 2V3EA 3IPFA 2WKLA 1HEZB 3H3KA 4DZ8A 5BQ7A 5EHFA 4OB5L 2Z1KA 3OHXC 2CBOA 4PREA 5TQ0L 1LE5B 2VDNH 4QHPA 1OEZW 1SLWA 5F6HI 3TASA 3JTTB 4BFNA 5T5NF 2ILLA 3VJ6A 4E5XA 5BZWA 3IGLA 4WWNA 3SY6A 3B2UD 4LPCA 3UGEA 5HHQA 2X28A 4WKZA 5DYOA 4H44C 3RVTC 4DKEL 5I2IB 1LO0H 4UTCA 4JQXA 3MV9E 3DJ9A 4H20H 4M4RA 2ZAIA 5CHNA 3US1A 4HUVA 1IEAA 2G4GA 4Q89A 3EYVB 1KELL 5HHNA 4JDTH 3SE4C 3DHPA 4WI8A 3UTOA 5FECA 5D71L 4ALAC 1IM9A 3FCSB 1X4ZA 2QHLA 3EFFA 3S35X 3NMEA 1DO6A 3MODL 4U3HA 4K7PX 4QXUL 4O5LL 1SN0A 3FH8A 4NKIH 3GI8H 1ZANL 4HPOL 1EZSA 2WY3B 3HKFA 2HJLB 4I3RL 1Z5LA 5I1CL 2WJ7A 4Y1AE 1RJYA 4DGYL 3P40A 1S9KC 3MC0A 3C6SA 5DZPA 1U8OB 1OW0A 3HNTL 4RCAA 1UOWA 4BQBA 1H6FA 1HQ4B 4IOSA 3HCVB 2VLRA 4HIJB 4JFXA 4XNQB 1QFUL 4P9MH 5D2LB 1UM6H 2BP3A 3DVGA 3E9TA 3L9EA 3PGCA 1OARL 2BP0B 3BAIA 1PKOA 3HG1A 1MCLA 2G5RA 1ETZB 1QACA 3EGXB 3DIFB 4UILL 4EN3A 3NIFB 4Y19D 3IGUA 3L4VA 5AWNL 1XGYL 1IM3A 2WZPD 3SE9L 1G1YA 3FQNB 2ICEA 1JCVA 3JTTA 5GS1B 4H26B 3AITA 4I3RH 1T1YA 4CILA 1OCCB 4R96A 1E5AA 1D2PA 4E9YA 2UY7B 3VB9A 1U8KA 1FH5L 1I8IA 2NY5H 1UZ6F 1JXDA 4K71C 5IMMB 1A7OL 1Q0XH 3QG6A 3QDJB 4W9FC 4UOJA 3GUFA 1FV1A 1OKEA 4X7TA 1LQBC 3ARBB 4IGBC 3OHXA 4BIKA 1N10A 2PKDA 3LEVL 3LY6A 2VH5L 4PGDB 1AGEA 1RD6A 1JWSB 2AV1B 5DUJA 3PYCA 3S36H 3AREC 3UTZB 4ZMTA 1CDGA 1H3UA 4RAHA 1NFKA 4G8EB 1OW0C 1L5GB 2PCYA 3GKWL 1G9EA 4NNYA 3T2NH 2QL1A 2CMRH 1AIFA 1ZPLA 2HFGH 2H4EA 2VDNL 3KR3L 5DEFA 2HJFB 3GM0A 3TIEB 4X7DC 2IDFA 3O81A 3VX1A 3L1OL 1QTSA 3EYUL 2CIKA 3MRMB 3UCRA 1YYMH 3DX4A 4IRJD 4L3EB 2Z93A 1DJSA 1GHFH 5F9WC 4PJXB 4NB7A 1A4KB 2XBZA 2XFXA 4J8QA 4K94L 3FONA 3O3UN 3NCWA 3QDMD 4F1SA 4LSVH 1YCSA 3QJFB 4DEPB 2XVKA 3LVTA 3OR6A 2VE6B 1YEIL 4JZJA 4H0GA 1L7TL 4J4PC 3T8XB 3ZT7A 3EYOA 2EUZA 4FYTA 4CVXA 5GRVL 2V7HB 5J9PA 4M48L 4NQCA 4WI4A 4F2MB 1RIVH 3Q1SH 3WKQA 2C4FT 3B2UC 2GK2A 5JIDA 3U6RB 4XMUA 5F7DB 2Z8SA 1RU9H 2W9LA 5GJSH 3BVTA 1DZ0A 3BOVA 3GLZA 4X80H 3C9NB 1NINA 4YFLF 1V3JA 5ID0A 2GJ6E 3BVXA 3TZVD 5DHVA 2WCGA 4JKMA 3TJHC 2X9XA 2GC4C 4EZKA 2APWA 3L4UA 4A7GA 3CDZA 2X4NA 3VI3F 5F6IB 1JWUA 2KC0A 1WAAE 2MOQA 4X6DF 5FAAA 3SE9H 5IR1A 4HDIA 2Q6WB 4B6ZA 4G5ZL 4ICXA 4JAMA 2YC1A 4D8PA 3GLDA 2J72A 2LAAA 5DVOA 15C8H 3NGBC 5E9DA 4BQ9A 5PCYA 4PW4A 3VFVB 3ZOAA 4OFPA 3DBXB 1D6VL 1OD9A 4JRYD 2AABL 1BFVL 4RRPM 4MMYA 3QAQA 4BFFA 1X5JA 1H5BC 2CGZA 1NGXA 1CMOA 2B59A 1T22B 2YD9A 5I18L 3MRFA 5A2BA 3EHBB 4WWOA 4KKBC 4A6YA 4JG5A 1QLEL 4PJDB 3CFKA 3D85B 2NY6C 3BO8A 1Z9SB 5E8EA 1P1ZA 1LWRA 2E6PA 1TMQA 3C2SA 1L0YA 1JS4A 1KIUB 1U93B 2XA8H 1W15A 3F6IA 3DYMA 3FFOA 4HLEA 1WV7T 4UQBA 4L5FE 5HVFB 3PDGA 1DFXA 4HS6A 1M2OA 2R56L 4NCC2 4TULL 5DO2D 2FAUA 3QIWC 1AO7E 1DJZA 4UYQA 5GGTA 3UTTD 2B39A 3UERA 4XNUL 3AMLA 3UTSA 5T33H 3I74A 2E5EA 3VI3B 2AJSL 1BD2A 5C6TL 4F33A 4PJGF 1YZZA 4YHOL 4KH9A 5GGVL 2DYPB 1QQDB 4Y1TA 1WA0X 4RDQG 2PYED 5CJQL 5KSVA 2EUXA 1JHLH 1Y6KR 4M03A 3G5YA 1ILUA 2ESVE 5I0ZA 3OJ2C 5AW2B 1I85C 2CK2A 1FL5A 3D8MA 1S7XA 4FYSA 1KJ2L 1BM3H 3W81A 4F57L 2WXNA 3D39D 3AQZA 2G3MA 2YXWA 1G7QB 5HDQL 3MQIA 5E95B 5FYKL 25C8L 4FERA 1CGVA 4PAZA 4GW5A 3CJJA 4LRNL 2BSSB 1A0QH 3AMKA 4PJGE 1M2VB 4H8WC 1U6AH 3R8BB 3QWRD 4XE5B 3EXLA 1FL6A 1V8HA 2X2JA 4CKQA 2X10A 5CP7B 1JCKA 2G0LA 1CU4H 3JWOC 2FJHA 4W9HC 5AYQA 2VXVL 5EUOF 1QBAA 3DRQB 5H35A 1WAEA 3GSXA 1AD0B 4HC1L 4IBZA 5DWPA 1TJGH 1OP3K 1FSKC 3TNMA 3WEXA 2XQYA 3SGKC 5FDWA 5HGBA 4G8GB 5EIIG 4Z0XA 5J11C 4Z3TA 3DSFL 2J4WL 5DI8B 4NYLB 5DJ2B 5KJRH 1MCWW 3VXSB 1U8QB 4G6JL 4AYID 4ZW3A 1R17A 4X5WA 4G7RB 2OV0A 5ADOL 1KJ2B 1UA7A 5I1JH 5J6SA 2B3IA 1H6EA 1C08A 4HPOH 1A7PL 2NUTA 2WXOA 4JZJB 4X6EA 2VLJA 4DKFH 1FAIL 1N3NA 2NR6A 3VW3H 4OLZL 1VPOH 5KAQG 4XOBA 4TN9A 1H15A 4UDTA 1IIKA 1U58A 1T20B 3SDCA 5IB2B 3ARBA 3WEBA 4GBXB 4MAYB 5AKRA 4KV5E 4NQSB 4HA1A 1JOIA 1PIFA 4FXGA 3N85H 2PF6A 1FZKA 2I60H 2BY3A 3LXBA 1A7NH 2BSED 1O7SA 4G8GD 2IGLA 3CSYA 1D5XB 1OLZA 1PAZA 4AEHH 1AANA 3KBEA 4ZBJA 1NA8A 1MWOA 1U42A 3ARDA 3FYEB 4HOWA 4ZTOH 4KQ0A 3CSBA 4FP8L 3NTCL 1Q0YH 3ROLA 5DEFB 4FLOA 1W2KT 4QOKD 1OAKL 1CGTA 1E8ZA 5MP6H 2O4EA 4N2LA 3SPJA 4AGMA 1NEPA 4X4XA 4N25A 2NY1C 2E74C 4F7CB 2WIIA 1RAMA 2VAAB 1UB5B 4IKJA 4XP4H 2C9UA 3K6SB 2G5BA 3LEXB 5J57B 4GY4A 1MFEH 3DVFA 1U2HA 4RRPA 4FG0A 5CF3A 2WB1A 1DBBL 3QJFA 2XZZA 4X7CC 5DRWA 3AC0A 1NLDL 4ZX6A 3NSXA 3BW9A 4OJEH 2Y2TA 4S1DD 3QWOB 5C0AE 4FG2A 3QUZC 4CMMB 5HHOE 1UHVA 3OKDB 3D0VB 1ZHNA 4E5XG 4MJID 2WZ5A 4HK0A 2MHAA 5DUBB 3QG7H 5F1SA 1FUNA 1KCBA 2DQIH 4PFEA 3DBXA 4K5PA 4M8RA 4ANUA 4WU7B 3R0MA 5E5RB 3SY0B 5HYJB 2XN9A 1QFUH 3CXDH 4P9ML 3V9FA 3M7OA 1CYWA 4HU8A 3MA7A 5KZCB 3MRIB 4NQTA 4XPBH 2ZUVA 1DQLL 1BIHA 1QWUA 3WTUA 1ZHBB 3KYMA 3OWEA 4BCYA 1A2YB 2E6JA 2OX5A 3D9AH 1ZLWK 1GGBL 2FLMA 4DWHA 3QK0A 1R9FA 2B8OT 1AR1B 4JFDE 4NLHA 5AW5B 2ZCHL 1MXDA 1ZVNA 1FAIH 4X6CE 2OMZB 2Q7YA 1HXYA 4UT9H 2JKJA 1T5KA 1IC5H 1TNMA 3LPPA 4JFFE 5IHWA 1MCDA 1T1XA 3V9EA 4JBSA 3VA6A 1Y18A 4A2MA 3EYFA 3QDGE 5FC9A 1GW6A 4E9SA 1KGIA 5KSUB 3VFGH 1HYSD 1A02N 5DJXA 1DDHB 4I0CC 1BAFL 1MHCA 5F1KC 3ZGIA 4QRUB 4F7TB 4N8PA 4KROC 3WL9A 1G7MB 5CBAB 1AGDA 1X5KA 5F1OB 4MNGE 3HB3D 2XXCB 3BH4A 5TQ2L 3SDDD 3UTSE 3RPBA 1S7QA 2XV2A 3AAZA 2VW4A 1WTLA 1AO7A 5E7FA 1EX0A 1KCKA 1KEMH 1JRHI 4AJVA 4GAJL 4X8CA 1U8OA 4AEFA 2EACA 4QAMB 4NAJA 3HC4H 2V5RA 1WWAX 4ELDA 1P4LA 1YY9C 3H3PH 1MAMH 3F62A 2ZYSA 3CC5B 1N0LA 2PNDA 3MRMA 1AD0A 2K4AA 4X6FA 3VXOB 2QQKL 4OCRH 2IPUK 2OMXA 4G80A 5G4NA 4NWTH 2XT1B 4NBXB 4WW2F 3VD1A 2DKUA 2YPLA 2EC8A 2P8MB 1UM6L 3FUEA 3NIGE 3VM7A 2Q7YB 3WFEL 3JTSA 5C0CD 4M5SA 3F84A 1TZ8A 1ID2A 2QMKA 2R51A 4DGIL 2BVYA 1WJ3A 1EEUA 1J05A 1R5WA 2DKMA 2X2YA 3E6FB 1SEQL 2L7JA 3H9SA 4L2YA 2CWRA 2H3NA 3UZVB 3T0EC 3VYNA 4HFUL 1UWEH 2DS4A 3LVEA 4HZLA 1T7YA 4KTEL 5I30L 5E4EC 2NLJB 3BP6A 2P5EA 4NN6C 4A2DA 2ZNWA 3IRCA 4WFEE 2JKRM 2W65A 4BK5A 2MJWA 1W6LA 5IFHH 5IVZB 3V4UL 3GI9L 2VDLL 1MJJB 2CO2A 1DBJL 4RFEA 3SQOH 2DBLL 1CLZH 2HCZX 3SEPA 5CUSL 3IMUA 4OF7A 5L4MA 4OFQA 1OB1A 3GJEA 5CGMA 1A21A 1DP0A 4R0LC 2BVTA 5ETUB 4Q6YA 4L4JA 1GYUA 1TQSA 4OJDH 2ITDB 4JY6B 4LSUH 3UMNA 2YAPA 1FHGA 2ZP0T 3FB5B 3ROOB 3ARSA 4TSCH 4DQOL 2AQTA 3CK0H 3GNML 2R7EB 2Z6FA 2MPAL 4ABVA 1B9KA 1OF2A 4NN7C 4E0RB 4YHOH 1CDYA 1FPTH 3TFBA 3QZWB 1HXYB 4LSTH 1IKFH 2GJPA 2VR4A 5TDNB 2YD5A 2AI0H 3UG4A 5CAYB 3WEOA 1FVCA 1CL7H 5JR1H 1XXFC 2NY3B 5HJBA 2I60L 2DF3A 1ZLUH 3UYPA 5CN3A 2GIMA 5E7BA 2R9HC 3O8XC 5GGSA 2Y5QA 3RUGA 1BVOA 3IVKB 3BWAB 1ZK5A 2WQVA 3VI4A 1WA1X 3T2LA 1K5NB 5CCKH 4RQQB 3DLQR 4LCCA 3OKMB 4QOKB 2V2XB 1L7TH 1E4WH 1JGLL 1BQRA 2V37A 5HHMB 1KDJA 2HMID 3VAEA 1NFDE 4L8BB 1GYWA 4KV5F 5A2CA 5DJZB 3DTUB 3U2JA 4ELMB 3B9KD 4LBEA 3CDZB 4B7LA 4LEOA 5H8DA 2UZYA 3MOAL 4HHAA 3IDMA 4JO5A 4ZMYA 1WEJH 2SEBB 5DUPH 5DRNA 1IGCL 3JV4B 5DO2C 4HUXB 4GMSL 3OBAA 2C9XA 1OGSA 3I6SA 1AFVH 4LDLB 4AENB 1BGXH 1HJCA 3C6LD 4OCYH 3OC5A 4FMKA 3T08A 7FABL 3X11B 5IVXA 4UZGA 3DYPA 1QEXA 4OI8A 3DROB 4OR1A 3O11B 3P0VL 2H5UA 4ZNCD 5CCKL 4FG6D 5K9OA 1MCSA 4OD2B 5TGBB 1R3IL 3HNVH 4G9DA 3GSQB 2X38A 4Z9KB 1M7XA 4KH2A 1NDMB 1VB9A 1M2VA 1T3FA 4OZFB 5F9WB 1NCGA 3D18A 1R19A 1FNGA 3NCFB 4Y5VB 1DFBL 4WENB 3AWEA 4ZOAA 1XBDA 5JHLL 1F11B 3QFDA 4H0IA 5DHEA 2EIZA 4X5LA 4DPCX 3L3IA 3VFUA 5E2TL 2WLYA 2E7LC 4XPFH 2C3HA 5IZ7A 5FHAL 2GTQA 1HQRA 4ACPA 1P7KA 3TYGH 1ADQL 4CBPA 1J9CT 1RZIA 4L4VE 3KLHD 3KLAA 3N55A 3ML8A 1A7RH 3NIGB 4R5XA 5FYLH 2GTZA 4TUJA 3SBWC 3TO4A 1MN4A 3NCXA 4BK4A 3CUPB 3EH4B 3FU7B 5E4EB 4E9TA 5E8DH 4XN7A 1MJUL 2I7OA 4MQ7A 3ORJA 4DN3L 1CG9A 4GBXD 1ID5I 4LXFA 1D9KD 2ENSA 5CP3H 4TL4A 1AD9A 5DJ8A 4Z95H 4DP8X 4GBXC 3QJTB 1ZLWH 4YXKL 4ZUTA 5DVNA 4PWGA 3IS0X 4PJFB 1XAUA 4CMHC 5FIEA 3ULUH 2AEIT 5IVXE 1GSMA 3QIBD 4I1PA 2JH2A 4GO6B 5AVYB 5AENA 4NN5B 4K9EH 3SDXB 3WKYA 4OZGA 3BWZA 2C3XA 4OT1L 2VNCA 5CFAA 2QSQA 4R0LB 4KY1H 5D7LB 1JZEA 5AZ2L 2A9NL 3KLHC 2AXHA 3ETTA 2YAOA 5E1QA 5IR1B 4L29A 1KJVA 1TYRA 1MAML 2BSSA 3SE8L 1MI5B 4HIIB 1NLDH 4H2AA 3RL2A 1BBDH 3TGXA 3FQNA 4E42B 4UT7H 1RUQL 3ZTEA 3GSNL 4FI8A 3DGDA 3S3JA 3MRLB 4XO5A 5C6WH 3DV6A 4LGRB 3IGAA 4PUBL 4O02L 1FP5A 3FHQA 4P9HL 1SFHA 2HFGL 4YLBA 3C60D 1JWMA 2NSMA 5JW4N 3HUJF 4MAUL 4R26L 2X4OA 2NCMA 3ZHKA 1RZ7H 5CS7A 4EN3C 1JUFA 3IKCA 4MZRA 4TVUA 1PLGH 3CMOH 1OGPA 2YKLH 1AS8A 1V3LA 3PV6A 4G1EB 1IGJB 4HH8A 5BOZG 3ZUNC 3OZ9H 6FABL 2XXFA 4PJ5A 3SBWA 4AG4H 1MCPL 1A3RL 1BV8A 4GW4B 3RU8L 2JXMB 4P5MA 5FW7A 5IGXH 5EBLB 4UIMB 5JPMA 3N0PB 4L2LA 5E5LA 3H0TA 4FQIL 4PI2A 3H85A 1XSKA 4P23A 4R3SA 4XZ4A 5BMFL 1TJHH 5IFHL 3W9DB 1KBGH 4FHBD 3CZKA 4GW1A 4EJ1C 1NC2B 3QYMA 3HJEA 3DXAE 4UQAA 1I1AA 3RTQA 1H9DA 2HTKD 3IGFA 3WV0A 4ZFOB 2F1AA 3RX8A 3ZE0E 2CCLA 4I2XE 4AYBA 4N2BA 4N3TA 2NR6D 2V2XA 4PIBA 3WLWD 1TVBA 4PJXA 4M56A 3K0YA 1KSRA 4RISH 4RVBA 1IB5A 4EEEA 4NFDA 4Y16C 4WSJA 4Z3IA 3ZHDA 4JM2D 1EAOA 2GSGB 3NFNB 4G42B 3RGVD 1U8CA 4JVUA 1VESA 1ZVHA 2UV3A 2WQXA 4P57B 3UL4A 5FA3A 4BZ2H 2F53E 3KPPB 3IJYA 3QEQA 3FAXA 3GIZL 1T1WA 5FKPB 4R7NA 1NFIB 2W5PA 3KPRA 3PGCB 2VL5B 5EWIL 4NQUA 2MOVA 3RY4A 1I1FB 2P5WE 2K70A 4ODXB 4ZMVA 3KJ4B 4QRQB 5H37H 2VRKA 2ZJSL 4AT6B 4XHQA 2Q76B 3BPOB 1IAII 4MB3A 2OSLB 3QJZA 4ZTPL 3IETB 2Y24A 2ZXQA 1V3MA 2PTTA 5ID0B 1S7RB 2ZWZA 4FNPA 4HGWA 5GS1A 1BXUA 3X1NA 4A68A 5BRZD 5IY5B 3GSOA 4TQHA 1BA9A 1AMYA 2EILB 5TPWH 3ZDYB 4M6ML 5IB1B 5JMOC 4BHUA 2NY1B 1BXVA 3KYMB 3ZKXB 3L45A 3CHRA 1RFDH 4QXWA 4FLSA 3FT9A 1JL8A 4Q97A 5T3XD 2EUWA 5DZJA 4JUSA 3EG9B 4JJ5B 3IDJB 2V4LA 3CDYA 2ZJSH 3V0EA 4MZIA 5EA0L 4DVRL 2O26U 2XWRA 3QQ4A 3JWNE 3TBVA 5C8JA 5LJYH 4KTGA 3WXWL 4MD5B 4XXWC 2DQEL 2NY2C 2QTEA 4NNYB 4LSUL 1HE7A 4XNZC 5EU6A 1CE1L 4RDBA 5FUOH 1ZANH 1G9NC 3EF4A 1HKLL 5TE4L 3B43A 2W0FA 5GXBB 1AXTL 2CBTA 4YVNA 4W81A 1OM3H 3HAEB 1H3GA 1WFNA 2UXTA 3BUTA 1GC1C 1XF3B 3BX7C 2WXRA 4OKVB 5IT2L 1MCFA 2UWEF 3DIDA 2OK0L 4OD1L 1D9KC 1K72A 2X4SB 1ZEAL 4QYOA 4ZW8A 3VI4E 4TOYH 5J13B 1JZ5A 2G5BB 3ULAB 3RWFB 4PYHA 5C97A 4X98B 4OZIA 2GC7C 1ZHKA 2WMPB 3ZZLA 3DDFA 3MRJA 4LOFA 3I3BA 4NQED 4U1KB 3J7HA 5KYWA 3LN4B 3OD3A 3SZKC 3EBGA 4UIKL 4PRHE 2HRLA 1T83A 5ISZB 3L4ZA 1PD6A 5IJKC 3ESUF 2I25N 2Y2YA 4MXWH 1DANU 4PJ7E 4JE4B 2JI2A 2MPAH 5E2VL 3BVNB 2ALAA 4G83A 1JPSH 1UURA 3A6CL 1KCSL 1ND0A 3IRPX 2AEWA 3AT0A 1TJGL 4MA3A 4A2GA 3TF4A 2WCSA 2A4ZA 3PHSA 1ORQA 2ZYRA 3ZW3A 2DW5A 2GW5A