1B3IA

Nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (minimized average structure)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
b'ASVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PLASTOCYANIN)
publication title NMR solution structure of plastocyanin from the photosynthetic prokaryote, Prochlorothrix hollandica.
pubmed doi rcsb
source organism Prochlorothrix hollandica
molecule tags Electron transport
total genus 12
structure length 97
sequence length 97
ec nomenclature ec 1.10.99.1: Transferred entry: 7.1.1.6.
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1b3iA00
5F7AA 5I6LA 2AFNA 3FQ1A 1N68A 1XB6A 4W9ZA 2QDWA 3S3BB 3UADA 4ENZA 3H4HA 1TEFA 1M9WA 1ZIAA 2J5WA 2HZHA 1BQ5A 4P5RA 3IN2A 1WA0X 5B3SB 2H3XC 5TK4A 3PAUA 5I5MA 4YSEA 5AZUA 4N4YB 3NSCA 2J55A 1JZEA 1SDDA 4E9VA 4A68A 3GXUB 5F7BA 4HALA 2PP7A 2VW7A 1GS8A 1ZIBA 3OQRA 4HCGA 2GC4C 2W8CA 4YSOA 2PCFA 3QQXA 2GIMA 4GY4A 2XV2A 2BHFA 4DP8X 1JERA 3UAEA 3AG1B 2GSMB 1A65A 4PCYA 3T6ZA 4F2EA 2WO2B 4NAJA 4BDVA 1GY1A 4YVNA 3C75A 4FA7B 2CAKA 3TU6A 3EH4B 3PLYA 1ZDQA 1NWOA 3H4FA 3NSDA 4F2FA 2DV6A 1NWPA 2R7EB 1QNIA 3L45A 1RZQA 1JZIA 1E67A 1V55B 1ILSA 4GP5B 1MZYA 4KO5A 3NSYA 4KOBA 1AIZA 3FS9A 4YSSA 2PLTA 1ET7A 3BQVA 2HRGA 2IAAC 3T9WA 2BP0A 3UGEA 3CDZB 1DYZA 2H5UA 3FU9A 4A2GA 2BZ7A 5FC9A 1SF5A 2IH9A 4GP4B 2B08A 3FSWA 1PZBA 1PZAA 1I53A 2CCWA 4JHUA 1AZCA 4DPBX 4WTQA 1NIDA 4YSDA 3OMAB 1A4BA 1SF3A 4AKQA 3SQRA 3T6WA 3TA4D 1VLXA 3FSVA 1A8ZA 1OF0A 2YARA 1V10A 1GYCA 2GC7C 3NP4A 5D4JA 1IBYA 4P5SA 2XVBA 2QT6A 4UANA 1V54B 1DZ0A 4F7KA 4GP8B 3QJUB 5B1JA 2XV3A 1KCWA 4E9QA 2VW4A 1NTDA 2H47C 1GS7A 2HX8A 1OE3A 2FTAA 1AZRA 2FWLB 2WSDA 3DTUB 2XX1A 3QJQB 1ZPUA 2TSAA 2GHZA 1ET8A 3NJGA 4G71B 5EHFA 9PCYA 2J56A 4HCFA 1BYOA 4E9YA 2XXFA 7PCYA 3FPYA 3X1NA 2Y69B 2QDVA 3NT0A 4YSRA 4KO9A 1WAEA 3X2QB 4DP0X 5I5JA 1OCRB 3N55A 1KYAA 4A2FA 4QLWA 1JZFA 4CSPA 2PPEA 1N70A 3G5WA 3CVCA 3GYRA 1NPNA 5AFAA 1OCCB 1KDIA 5I6OA 1AOZA 3D12B 1CYWA 1L9RA 2CUAA 5D4HA 4A67A 2I85A 1CYXA 4Q89A 3WI9A 3CVDA 3WKPA 2X88A 2PCYA 3EH5B 2AVFA 3X1EA 3TASA 1W6WA 1FFTB 4WKXA 5B7FA 1AANA 4HIPA 4JHVA 4G7QB 2LLNA 3S3DB 4CSZA 1MZZA 3ZBMA 2XWZA 4BXVA 1WS8A 1PCSA 1ASOA 1ASQA 2UX7A 2DYSB 1A3ZA 1CC3A 1MDAA 1SDDB 4AZUA 1SNRA 3V9EA 3AG4B 1BAWA 1J9SA 1A4CA 4PAZA 2FJSA 2UXFA 4E9WA 4E9TA 3MX0B 2GB2A 1AAJA 2YAQA 1GY2A 2IDSA 4UF7C 3WNJA 2PP9A 4DP4X 2HXAA 1PAZA 3KW8A 1PZCA 3QJSB 4BDVB 1J9QA 2XLLA 1J5DA 4KNTA 3SBPA 1OCZB 2Q9OA 1BXUA 3NJNA 3S8GB 3FYEB 2DWSA 1GS6X 2JFCA 3SBRA 2VM3A 1NIFA 3NJKA 4UAHA 4HHWA 2VMJA 1ZDSA 2EINB 1PNCA 6PCYA 1BQRA 2UXVA 3CZUB 1JZGA 1URIA 1KV7A 3X1BA 3QPKA 4TXVB 1BEXA 3OD3A 3QJRB 4YSUA 2IWEA 3ABMB 5ANHA 2HX9A 1ASPA 2FQEA 3PPSA 3ZX1A 1TU2A 1JZJA 2BP0B 2Y1AA 2CJ3A 4G72B 1WS7A 4AX3A 2YQBA 1ZV2A 3WNIA 2YXVA 5PAZA 4GXFA 4DPCX 1AS8A 2PPFA 3CG8A 3HEIB 1KBVA 2B3IA 4N8UA 1AZNA 2MTAA 5AKRA 5I26A 1RZPA 3ERXA 1AS6A 1AZUA 1NIAA 3SBQA 3FSZA 3ABGA 2YAMA 4QKTA 1J9RA 2P80D 2PPAA 1OE1A 2CBPA 3ZIYA 4A2HA 1PNDA 3TBBA 3BVDB 1HFUA 3FQYA 1E30A 4KNSA 2FT8A 4HHGA 1GSKA 4DP9X 1JXFA 1GW0A 4BXSV 1HAWA 3HB3B 3JTBA 2ZWNA 2GBAA 1PLCA 3V9CA 2NRDA 4BK5C 4M4RB 5D4IA 1PLAA 3WG7B 1M57B 2UX6A 5B7EA 1HAUA 3JT2A 1NIBA 3AG3B 1L9SA 2I7SA 3WKQA 3PCYA 2WO3B 1AZBA 1AG6A 3FSAA 1IBZA 4YSAA 3OMIB 1RCYA 5I6NA 4BWWA 2BW4A 2OV0A 2P80A 3EF4A 1IKOP 3AG2B 1E65A 2XX0A 2BW5A 2OCCB 3X1GA 4A66A 5IY5B 3TBCA 1JVOA 2BWDA 1TEGA 2I7OA 1MG2C 4G7SB 1NPJA 3NJLA 5B1AB 2J57A 3U25A 2BP8A 1A4AA 2IDUA 2UXTA 2JKWA 1WA1X 2RACA 2FQFA 1KBWA 3IEAA 3T6XA 3AZUA 2E86A 4G7RB 4NERA 4BWTA 2IWKA 1W6LA 3IE9A 3FPXA 4YSTA 2XXGA 3NJIA 4K9JA 2PP8A 3FQ2A 3IN0A 5I28A 1OOWA 2CALA 2VW6A 2PPCA 1L9PA 5I6PA 4YSPA 3N2JA 3T71A 1BYPA 3H56A 3S3CB 1PF3A 1KDJA 1QLEB 3EH3B 2JXMA 1WA2X 4E9XA 1PLBA 1XB3A 1L9TA 2Q5BA 5I5IA 2VSKB 2HX7A 3X1FA 2GI0A 1QHQA 6PAZA 3PAVA 1EHKB 2EILB 2AANA 3RYMA 3IBOA 4HAKA 2XYBA 1BXVA 1L9QA 1NZRA 2VSMB 2HLEB 3UABA 1NINA 2A3TA 1ID2A 3NJFA 1AACA 5I6KA 1AS7A 1SFDA 1UATA 4DP6X 3NJJA 1B3IA 2YAPA 4KOCA 2YAEA 2ZXWB 1IC0A 4M3HA 4A2DA 1ETJA 2YXWA 4W1TA 4DP2X 1L9OA 3CVBA 3S8FB 4HZ1A 2QPEB 1NICA 3T6VA 1ET5A 2FNWA 1TKWA 4DP7X 5B7MA 1AQ8A 1R1CA 3KW7A 1KGYE 2OJ1A 2AZAA 1XB8A 5LDUA 1E5YA 1JZHA 1MG3C 4Q8BA 3FU7A 1E5ZA 3FU7B 4BWUA 3NJHA 1JXGA 8PAZA 1XMEB 5I6MA 3ASNB 4DPAX 1NDTA 1PMYA 1IUZA 3ABLB 1ADWA 1FWXA 2PPDA 5PCYA 4X4KA 4YSCA 1SHWA 2R7EA 1JXDA 2UXGA 3FYIB 2QPDB 2IWFA 1J9TA 1AR1B 2ZOOA 2FT7A 2YAHA 3DKHA 1FA4A 2FQGA 3PXLA 3CDZA 1SHXA 3MBWB 4DP5X 1W8EA 2ZONA 1J5CA 5B1KA 4YVUA 3WIAA 2IDTA 4E9RA 3AY2A 7PAZA 2IDFA 1JOIA 5A7EA 4KO6A 3PAZA 2EIMB 4ZK8A 2DYRB 2EIKB 1SFHA 2FQDA 2HRHA 4E9SA 3GDCA 2AZUA 1M56B 2XV0A 1OCOB 1BXAA 2DY2A 3FU8A 4KNUA 3DIVA 4NB7A 4AKOA 4EF3A 3QJTB 1ILUA 4KO7A 1KCBA 5E9NA 3FT0A 3NSFA 3NJMA 2N0MA 1OV8A 3QJVB 4AKPA 1OE2A 2TSBA 3ZDWA 4GYBA 2IH8A 2BP8B 3UAAA 2BWIA 2DWTA 2YAFA 3OM3B 1CUOA 4YL4A 5B1BB 1YLBB 1RKRA 4JKNA 1PY0A 3ASOB 4L0PB 3UACA 1NIEA 3EHBB 4G70B 4AI7A 2VM4A 1EZLA 3NYKA 5B1JC 1GR7A 2YAOA 2BZCA 3ABKB 2BO0A 4MFHA 1CURA 4HCIA 2EIJB 4RH4A 4YSQA 1BQKA 1F56A 1JVLA 2VN3A 2XUWA 1X9UA 2MRYA 2X87A 1SJMA 1X9RA 3NP3A 3AW5A 2XU9A 1T5KA 2W88A 4DP1X 2FT6A 4FAAB 5TK2A 3OMNB 4A2EA 2IDQA 1AG0A
chains in the Genus database with same CATH superfamily
5F7EL 2AFNA 1RIUL 3HG1D 4G8GB 5DJ0B 2FSDA 2NYYC 1A1NA 3GC3A 4IRJB 1GYVA 2WWKO 1HQ4A 1AD9B 1IBFA 1UXSB 3QIWC 2CO7A 1RZJC 2X2YA 1NEUA 3MXWL 5MEQA 1BF8A 4Y1AB 4LVHB 5DJXA 2Y9RT 1YEJL 4IK6A 4O2EA 4U1LB 4ONGH 2NNRA 1EGJH 4KDVA 4HCRA 4X4XA 2W91A 4E9VA 5F7BA 4JZOB 4F5CE 4APXB 1T4KB 4KQ4L 5IHUL 4GXUN 3LYRA 4BELD 3ENEA 4N1EA 1T80A 5IJDC 4J2QA 2W8CA 4JRYB 4Z7VA 1XAKA 2YA1A 4F37F 1NEPA 4KDTA 1URLA 1OB0A 1JFHA 1B6DA 3AMLA 5L4MA 5HDBB 3V4PA 3O6KH 4P46B 4PBWD 1XGUA 4TPRH 2Y72A 4V1DA 3MRKB 3H3PH 4XTRC 1NWOA 2WP3O 1BHGA 3OKEA 1M6OB 3S5ZA 3A5VA 3IBEA 3HNTL 3KPPB 3GD1C 2MNWA 2QBWA 3O8XD 4KDTC 1V7NH 3ARBA 4LCWA 4R7DB 2PLTA 4WUUA 3HVDA 2EEAA 3QUKB 3MRHB 2FATH 4QOKA 5IFHH 4X99B 3GEFA 4HT1L 5TF1L 1AZVA 1MREL 1VESA 3WO4C 2YKLH 2QMKA 1H15B 2DM3A 2D4DA 3HBPA 3PNWB 1B3JA 3ZK0A 2ADIB 1RSYA 3DUSA 3DWTA 2B0SH 4UT6A 3HI6H 3OJDA 4Z7WF 2J3SA 4I0KA 4NWUL 3VD1A 3AS2A 1DLFL 1UYWL 3MV8E 4H2AA 4ACPA 3O3AB 3MLUL 3PFUA 5DJAB 3UYRL 4KRPD 4PH8A 5T5FL 4AVKA 2CO6A 5KS9E 2DS4A 2M26A 1LP9E 1E4KC 1U95B 2IANE 1A8JH 2CKBB 3Q3GA 4Y89A 3MV11 4F57L 1NMAH 2IGFL 2I5YH 4PJ7F 1TTFA 5CLYA 3QJUB 2UWEE 5I16A 3EGXB 1JNHB 1Q9OB 1RULL 1UJ3A 4PJFA 2AABH 2X0UA 3FU6A 3O11A 2K3TA 4GEIA 5DK0B 5E4AA 4L0ZA 5CR1A 5HPMA 5HYQB 2AK4D 3FAXA 2EE0A 1H8SA 1KTDA 2CZNA 5C3LD 3H54A 5IFJA 3MI6A 4HMEA 1TYEB 3W2DL 3KGRA 3CH1A 3HZKB 3FQXB 2VMCA 3NEXA 4TQEL 4IJ3B 9PCYA 4AE0A 1G7JB 2DEYX 4AGMA 1MCHA 4XN5A 3SDAA 1NCOA 5E9DD 1UM6L 2HMIC 2WVSA 4W9LC 5FFOA 5FA4B 1GSMA 1GYAA 3HZMB 2XWJB 1Z9SA 4P57A 3FTZA 3H9HA 2WTOA 4FHKA 3NRQA 3AU0A 3CLFL 1UJ3C 5EEZA 3P0YL 3WY4A 5I5JA 4BH8B 2ITFA 3VFMB 3HKFA 4U1GB 3DVFA 3B9KB 3QJZA 5LO7A 3CVCA 3QIUD 3GYRA 2GEQA 4GAAA 3GI9L 1K72A 4QHKJ 4MA1C 2PR4L 2WCPA 4HBCH 2MPAH 3SDAC 3K8KA 3KEHA 5J7CC 1T22A 4HMDA 4IM8A 3H9SD 1SVBA 2VISB 4MNHB 4A67A 3E6FA 4MKTA 5A6IA 1XTMA 1T7WA 4AXWA 2EEDA 3CVHB 4K94L 1N3NB 1HI6B 1KN2H 2ZJSH 1F8TH 4K7PX 3QG7H 1QLFB 3QQ3B 5BZDA 4JHBA 1YUHB 4P4KC 3MJ8B 5IJVA 5L2KB 3ZBMA 1UT2A 3MCYA 2QTEA 1UURA 4FS0A 1XGYH 2O72A 4HXBL 3QPXL 2EE9A 1PY4A 4UDUA 4OBRA 1ASQA 4ZSOE 1BZ7A 4V2CB 2DH2A 4Z7OB 3II2A 1FIEA 4K3EL 2VITA 1CZ8L 3FN0H 3UEZA 1TJHH 3QFGA 5DMGC 1XH2A 4L3CB 5EU6A 4E9TA 3DIDA 3RIAF 4OLVH 1QFUH 4O02B 5LDSA 1IIKA 4PLJD 4XWOD 2PR9A 5D7KE 3MBXL 4X7EC 1XIWB 2WWNA 4O58H 3BVUA 5I1AA 2YLKA 1QLRB 5CMAA 4L4VE 5GGSY 2WLHA 5SWQA 3A67H 5AOLA 1OAKL 2FLRT 1CGTA 3ARPA 1H8OA 3E1F1 3QORA 4U1MB 3P30H 1EEYA 5IW1B 3DO7A 1P7KB 3SYPA 4W9HC 2VMJA 4OIFA 4MJIB 3B7SA 4RA0C 1TVDA 4ILDA 3K6SB 1FN4A 3DUUA 4LDLB 1MSPA 3CXFA 4LSQH 5ANHA 1MJ7H 1G0XA 2GFBB 3GFUA 4XZUB 3ZX1A 1L0QA 3MJGX 4G1MB 2E9WA 3GXMA 3S36L 3OLIA 3UDWA 2Y2YA 3ROOA 3EJZC 3EDKA 1KXVA 4NQEE 4YDLC 3DRQA 3MBEC 4Z7UA 4YDVB 1UTDA 4FI8A 4P4RB 1WBZB 5SWZE 3RJDA 2B3IA 4WI2A 2EADA 2BNUA 1AR2A 3TJHC 1X5FA 1RZPA 2F53E 4Y19D 2WIMA 3ABGA 1BX2B 5IEHA 2X4NB 4OCLC 3RTQA 1EV2E 3MOBH 4XHJD 4L8CB 3L1OL 4M4PA 1GC1H 3UDWC 1EBAA 3FB5A 5TDNA 5CBEA 4DP9X 2PTTB 1TITA 2DTSA 1KXVC 2NX5E 5K5YA 4E0RB 1YNLL 4Z78A 1CLZH 2BNRA 3APNA 2ZXAA 5D1QB 1ZMYA 4WK0B 3SQBB 1TZ8A 1A4JB 1OCWH 5GS2D 5HGAA 3F04A 3QUYB 3IGAB 1NIBA 4LSTH 3RTQC 5J13C 2DQFB 3TYFA 3RZWA 3VD7A 5ACZA 4PJAB 1BAFL 5A7BA 5LNDA 4UTAH 3HZVB 1P4UA 2UY7A 4UTCA 4DN4L 4WF7A 4M6NL 3ECBA 4Z7NB 5JXAH 1RUAL 1M3IA 4HWBL 3T3PF 2R1WA 3MRIB 1ZA3B 3TEUA 3EYFA 1JPEA 2DD8L 1MIML 1QUPA 1BMZA 2B1HL 3U6RA 3BLPX 3ARDA 2WJ7A 1J0IA 2IWKA 3IFPA 2XXGA 1HCZA 3T8MA 4I48A 3RGVD 3OB0H 1FL6A 4P49A 4O51B 4NI6A 1RUQL 2HVJB 4FL4C 3LH2H 3WXVL 4N6RB 1AGCA 3S2AA 4XOCA 1U8JA 1WWBX 3DX7A 5DUPH 5LGHH 3KL0A 1JMXA 3MLRL 1ORSB 3BE1H 4KV5E 3EHBC 3GDBA 5I1LA 4U49A 2OAAA 5HHOD 2OJZH 3HIZA 3SY6A 3BOVA 3MREA 1RIHL 1MCNA 3FTXA 5HHQB 3QA3B 5L0QC 5IIEA 5D1ZB 5LUMA 1NDMB 3OGOE 5DJ0A 5AUMB 3U7YL 6PAZA 2OL3B 4JM2A 4IRJA 1XSJA 3WLWC 4ZW7A 1UXSA 3ZSTA 5ICZB 4IDLA 3CHRA 4U6HB 5KVDE 1XF3B 4PS4L 1G9NC 4HFWA 3D18A 1QQDB 3DJSA 5ITBL 3ARVA 4OLXL 4AYGA 3C6LC 4GW1A 1BBDH 4QRSB 4U1LA 5DR5L 5ID1A 3MLXH 4JPIA 1AR1D 4PJBF 2MEJB 5BQDA 4APXA 1D7CA 1T4KA 4C54A 2WB1A 1MW0A 1L6XA 4JRYA 4M48H 12E8H 4IRJC 2FNWA 3OR7A 5J57B 3H1ZA 2O5ZH 1I9EA 4Y4HB 3MV9A 3IFNH 4AQEB 4K8RL 4PR5A 1NFDF 4JX0A 4PFEA 5JMOC 2YXMA 4ZMPA 4LVHC 5CM1A 1HESA 1MW1A 4P46A 3MJ7B 3ASNB 3MRKA 3RVWD 1IUZA 2HG5B 1A6AB 3HE7B 2J8HA 1MRDL 2UXGA 3NRFA 1RZIA 3KPPA 1QBML 1R3JB 4LSUH 2QQNH 4PW4A 3WGVB 3FHQA 3W39B 3BVWA 2VZOA 2XG4B 1OWRM 4H40A 2R4RH 1C5CL 1AFVL 3IETB 3VXRE 1JGVH 5DEZA 2FX8H 3P11L 3PXLA 4O9HL 4AMKH 4H8QA 1VFAB 3MRHA 1Q1PA 4P46C 3H42L 3VSUA 4R5TA 5DMKA 4IBWA 3PREA 4O02H 4E5XB 1QAWA 3WIAA 1H15A 2DKUA 1JWMB 1ORQB 1F1AA 4D9RE 1ZLWH 1QPPA 1A4KB 1DJYA 2ADIA 4AGLA 1C16A 4XMXA 1T0NB 4L37B 2FQDA 1X4XA 2HRHA 2VM9A 2P7TB 1G5AA 4YDZA 1B4RA 1KCRH 4ZOAA 5DJAA 4PRHA 5D1XD 2BLFA 5E2WH 2JCCB 2OX5A 2XV0A 2XICA 1U95A 2CKBA 4OZFH 2XOTA 2XA8H 2GJ6A 5B39B 3MCLL 1IBGL 2AAAA 2W38A 2VDQH 4FG0A 3SDDD 3AC0A 3EGXA 4FNSA 3EO0A 2VDLL 3BZDA 4LU5H 3NCJL 4BFGA 5DK0A 2ZX9A 5HYQA 3HR5A 2YRLA 1ES0B 1M4KA 3D3VE 5ISZA 5FOBB 3HZKA 1BREA 3FQXA 1B2WL 1D2OA 1HDMB 4IMLA 1FZOB 2DQEL 5L2JB 2CK0H 5FA4A 4PRPB 5KZCD 2EICA 2XWJA 4S1DC 2ZCLH 3DXAD 4MWFB 2YAOA 2EDKA 3FB7B 2M2DA 5IREA 4RZKA 4F7TA 4OZ4B 5FYLL 3VFMA 4QWWD 4JJHA 4X83A 3B9KA 4GFXA 4UNUA 3HTLX 1FAIL 4FTVE 4XNMB 2FD6H 2X87A 4Z77B 4IJ3C 2YN5A 5E2TL 4S0SD 3IM1A 1CE1H 1GGYA 2E47A 1O9ZA 1HZHL 4TUOB 4FAAB 3ZSSA 1KTLB 2AF2A 4YLCA 1YEFH 4JO4H 5EU7C 2B1OA 2I69A 2VISA 4AX3A 3SBWA 2R56H 4K7FA 1ICTA 2NXYB 4JHZA 2TRHA 3CVHA 4U1GC 3H4HA 1M9WA 3B9KC 1N3NA 1HI6A 1N6UA 5AKVA 2QR0A 1ZHKA 1YEIL 1QLFA 2QADD 3MJ8A 3UTTD 5B3SB 5L2KA 3X12A 4LOFA 5FKPB 1IEBA 4ZMLA 5CEZH 1W16A 2NY7H 4PRIB 5BQ7B 1RD6A 1NCJA 1F4XH 2M83A 2XWBA 4XO4A 4P2YA 1ZVSB 1PDKB 1RIUH 4QRRE 3SBWC 3VQ1C 4Y2LA 3IPBA 3GIVA 2HWZH 4H1LH 4MNQE 4GBXD 1WAAA 4JFHD 4G6KH 3MXWH 2B1AL 2CLVB 4AK2A 3PP3K 1ZT1B 3QQXA 3MXVL 1KB5A 2ZQKA 5HGBB 2BVUA 3D4YA 5AAMC 4UUJB 2X1WL 5EZJB 3PGFL 4R90H 5C0BD 3DARA 2CAKA 2R8SH 3V8OA 5I9QB 4U1MA 1LDPL 2QKSA 2NZ1A 4Q56A 1P7KA 4HUXB 2Z4QB 4MYPA 3NEOA 3N1PC 2R7EB 2D0FA 4MJIA 4MZIA 4ZUUB 1QNIA 3ZR6A 1JZIA 1V55B 5F2FA 4CN6A 4FYQA 3VFGL 4LDEB 2ZYHA 1XIWC 3VH8G 4KMLB 1IBDA 4XZUA 2IAAC 1MWOA 2IPKB 4G6AC 3RZCA 3MRMA 3LCYA 1X4YA 1H0DB 4B7IA 4B3EA 4GP4B 5T3ZH 2WLMA 3BIBX 2Q8BL 3T3ME 1NEZB 4GI8A 4P4RA 2ROYA 1WBZA 4Z3JA 4PEEA 3FFDB 4JHUA 4BQCA 1BQUA 4DPBX 3RA7H 4WLCA 3PHQB 4GQPH 3UBHA 2XZCH 3D39B 1BX2A 5T1KB 4CN1A 4YXHH 5F7FA 3SKOB 1SY6H 4HT1H 2X4NA 1AO7B 2X4UB 1A8ZA 2IH1B 4L8CA 3FL7A 5CSGA 5FCUH 2YFNA 5CXPA 4M6ML 1SLXA 2QT6A 4E0RA 1EX0A 5DJCA 4OGXH 5KOVC 1DLFH 1ZXQA 1UYWH 2XQBH 2X4QB 4Y5VB 1KENH 4JG0H 4B9JA 4FQIH 5JHLA 1HJBC 1A4JA 1J05A 2XWTB 5FV1L 1JAEA 1SEBB 4L9DA 2WSDA 1DJXA 1YEKH 3DROB 3IGAA 2ZG2A 4LLVB 2WWMC 3SODB 1NGZB 2FJUB 2ODHA 2XWDA 5C0NC 5ALCH 3CPUA 4K7PH 4ZAKD 1O6SB 3BN9D 3FPYA 1WEJH 2EC8A 2ZF9A 1YDPB 5B38G 4QRPB 2W81C 4LCYB 1BQHA 1N0LA 5CJ8A 5GS3A 1LHZA 3FT2B 1NC2B 3AXIA 3IRZA 4HEPG 5D1QC 2VMFA 4EKJA 3EDFA 4OTXL 1OCRB 3HE6A 4JN1H 5AWNH 4R84A 5A43C 1F58L 4QXWA 1N70A 1Y1DA 3JVGA 3QUYC 1ZA3A 2OYLA 3CZFB 3GNMH 1WFUA 5DUMH 5AW0B 3VXOB 3W38A 5SV4A 1HE7A 4AEHH 5A2LH 1FZMB 1SMAA 1E28B 3N41B 2XFXB 5EO1A 1OGSA 4GAGL 2GJPA 2CGZA 4O51A 4Q89A 2K4AA 1TETL 3BP7A 4JO1L 2NY6D 2AVFA 1UM5H 2VDKB 3ZDYF 2HVJA 4J4PA 3NIDF 4M5ZH 5IHWA 1EFXB 1ZV9A 2QSCL 1DVXA 1MZZA 1KMGA 4BXVA 1Y0LB 2AQSA 2ZUYA 4Z3FA 1U30A 2D9QB 4G2AA 4KUZH 3TH2T 3UG4A 3P0GB 3KR3L 1C5BL 1JSYA 3ABZA 4F20A 2CJSA 4K94H 3MJWA 3QA3A 4OAWA 5D1ZA 5KSBB 1J9SA 3EOBB 2OL3A 3FKUS 3PPEA 5CEYA 2H0PA 4J4PC 3MCKA 3ZO0A 4QRAA 2X28A 4HKJA 5J6HB 3QPXH 4PGCA 3IDNA 1XF3A 3C9NB 2N0KA 3HUJE 1QQDA 3MODL 3FOLB 3H6JA 1QA9B 1N64L 3SOBL 2JJTA 1HE8A 1DCLA 1OCZB 4PJIE 3GHBL 3VD2A 3FO9B 4ZNEE 4FFZA 4UV7L 2WINB 3DVGB 5D1ZC 4B9GA 5IROD 3UJJH 1NCWL 1WAPA 2F8OA 3KGUA 1YPZE 2I24N 3DX8B 4Y1SA 1CF8L 2FBJL 4NKMB 1QRNE 4S11A 4Y4HA 1OM3H 1CFSA 3KYOB 3RFRA 4J3BA 5D55A 1LXMA 2JLPA 4Y0GA 2FH8A 1JK9A 4AV4A 1U6AL 4OCNC 4N0UE 4XZ4A 2JJTC 4G72B 1D2PA 3JUZA 3MJ7A 3W11D 4F7MA 1EMTH 5E94B 2EIZB 4BUGA 5I0YA 2HG5A 2DZEA 3JUYA 2VTFA 3O6FB 5JORB 4FXLA 5GRYA 1R3JA 4KY1L 3PWPD 2BRQA 3GBNH 4EDXB 4RMWA 5D71H 3W39A 5IW3A 4Y4HC 3PYCA 3VI3E 3MPCA 4FQJL 3V79C 5F7HA 3IETA 5SX5K 5CZVL 3GEWB 2P80D 2Z35A 4BKLB 2QPFA 5GRJH 3UJTH 5F0MB 1NA8A 3VU2A 1GW0A 3HE7C 4LRNL 2GK0B 4QT5B 3GJEA 1JWMA 4FXGA 1VEPA 5G4OA 4H8WC 2BSBA 3WBDA 2X44D 4FNLH 3ZO9A 5D7IE 1BYNA 2B7DT 1T0NA 2NRDA 4UILL 4G82A 4L37A 2YD1A 2P7TA 1EHLH 4BZ2A 2FK9A 2QZQA 3AQXA 1KJ2L 2UZXB 4U6XB 3CN2A 1G7HB 4MMXB 1E40A 4F7CB 2WO3B 3ALXA 3EG9B 3HR6A 3ULUE 3CUPB 1G0YR 1I8IB 5IUCA 1DBKH 3L2NA 2BW4A 4LSSL 4XN9A 1G7PB 3AITA 4YHMH 4QRQA 4LSRL 5IY5B 3N1MC 3WN6A 4R0LB 1I85A 3TN0B 5JNYB 1ES0A 2KKQA 4L29B 3MRFA 4QRBA 5B1AB 5GGRY 1RK1B 1RZKC 5C0JA 5FOBA 1C5DA 2IDUA 3VRIA 3JWDH 1MCIA 2FIKB 3SKNA 1HDMA 1JZ2A 1FZOA 5ANMA 1N8ZB 4N6QA 4YHOL 5L2JA 2VRAA 4M6NH 1TYJA 4LCUB 2WXMA 4MWFA 5DWPA 4XCYB 1JYNA 2ICWI 1S3RA 1J1PL 3FB7A 5GRVL 5HTSA 1GKEA 1SLVA 3BPNB 1I85C 2E7LA 4ANKA 2F54B 3UTSD 4EDWH 3OAZH 2VDNL 5FFLA 3ZKNC 5KBPA 4P2OB 3ARGA 4XNMA 2B2XH 1CF1A 2AXWA 1OZTG 5EOQL 4Q14A 3T0EB 4XO3A 2BOCA 4Z77A 3HKZA 3MNMA 1GAFH 1MWAL 1QLEB 4L5FH 4LP5A 3C87A 3QEGH 4ONOA 5DU7A 1Q9KB 2WTPA 4KFMA 2J1YA 2DQGH 3RJQB 3UC0L 1EWHA 4PD4J 1D5MA 1A6PA 4DN3H 4Z3GA 1SUJA 2PW2B 4FN0A 5G55A 2AANA 2JJVA 5EIIB 1IFRA 4ZS6D 2VXQL 1HJCA 5FKPA 3NJFA 5D96B 3RVUD 4FNTA 2WLYA 5DHVH 2DDQL 3TO4D 4OGYH 3UBXG 2ZXEB 1M7UA 3H9YA 5F96H 2C7UB 2A9AA 5FYKE 4ODHL 1UWEH 2X4OA 1FGNL 2NXYC 1XH0A 4I4WA 3MLVL 4XVJH 1O7SA 3DMMD 4N26A 4G43B 3T6VA 3F6LA 4FERA 4AE1A 2AJYH 2CLVA 3CJJA 1HVXA 1AQ8A 3P1VA 3QAZB 5TPWH 5HGBA 4R4FH 1KIQB 4JQXA 1WDAA 1S7VB 5DFVD 4X7CC 1P0SE 4XH2B 5DDHB 1EHAA 3LRHA 1YN7B 3ML9A 3CGTA 3LV3B 3ZHFA 1FO0H 3ABLB 1ZJAA 4JFDD 1FWXA 4HUXA 3ZHKA 4U1IB 2Z4QA 3QS3A 4N0RA 4OD3H 4MKMA 1J8SA 2R0KL 2R7EA 3FYIB 4LDCA 3WNMA 5JZ7C 1L6PA 4WO0A 1NUGA 3VWJB 2VRQA 2ZOOA 4JQXC 3BH9A 1J1OH 1ESOA 2YAHA 2IXQB 1R3KA 2NCMA 4XP5H 2IPKA 2ZKHL 1KY7A 3I2CH 5IJKA 3EDEA 3MLSH 2ZWSA 1JUFB 3EGSA 3MFFB 5I9QC 5D8JH 4K3DH 1NCDH 5E1QA 2ZOKB 2JKLA 2E3VA 4PJDE 3RKPA 1A9VA 5AOJA 3FFDA 1UFGA 3NJXA 3D85A 3VFRA 4JRXA 4XC1H 1N4XH 3KAAA 3PHQA 2XA3A 1YJDH 4OZHF 5T1KA 1OAUH 5F97E 4JGJA 2IH1A 1NLBL 3G6JA 5EZOL 4F9PC 5I1EL 2LU3A 3ECWA 3SY0B 2BNQE 2FNBA 3UTQB 3QQ9D 4P9HH 1QSZA 1AGDB 3PQYE 1ZXKA 4MHHI 4OW6A 1Q0XL 3Q9QA 2C3GA 3B43A 3NJMA 2BIIA 5D2LF 1SEBA 4I85A 4YHLL 4KHTH 4NM4L 3I6SA 4ODXB 4GYBA 3DROA 3WFZA 3IJYA 2C1PB 1HU8A 3LQAC 3QDGB 1CFBA 1NGZA 1Z3RA 3GJFK 5CJOL 3O3EB 1YLBB 5B1BB 4U3HA 4XN1A 2IBBA 1NIEA 1ACYL 2G3NA 1OQOA 3WEOA 5F70A 3HG2A 4QRPA 4LCYA 4MXQC 4F15B 4KROB 2WXPA 4UIMA 4Y5VC 2HTLD 1ZEAL 1QHOA 3LEYL 1CURA 5EEXA 2FUQA 4OCRH 4UT9A 2QZ5A 4G6JH 3MV8D 3LS5L 3AT9A 3CZFA 3NACH 3TCXA 1UB6A 2BWQA 3QDME 4M03A 1IB5A 1X9RA 2NY0B 3R0MA 1TMQA 3VGDA 2QHLA 4G9FE 4WFHE 4N2FA 1Z9OA 1VGEH 5KTEH 3QNXB 1D6EB 3T2OA 1N9PA 4Z5RB 4N0FA 3W5NA 2XFXA 4HJUA 5H37G 1I3RB 4WI8A 2FZ3B 2VDML 2XG5A 1WTGT 4HIQA 2NPLX 1T20B 3WFBL 1FQ9C 1XGRB 4Z76B 1EFXA 3GMRB 4K3JL 2WXNA 3B8YA 1Z1WA 2ZE0A 3GSXB 3L3IB 1FZJB 2J6EH 1IBHA 2E7DA 1PEWA 2RCSH 2XTJB 4GG6A 2Z9TA 1Y0LA 5I5MA 1Y18A 5E5RB 5TFSL 2I9TA 4GRLD 3FT4B 2WBJD 3PP4H 1NFAA 5TDOA 3D09A 2VAJA 3MLYH 4LQ1A 4N2KA 5CU9A 1TLKA 2X5PA 3VRJB 2C4XA 1T04A 4EXPX 4F2MB 2FYVA 3CZKA 5JHDB 3UFIA 3EOBA 4HCGA 1T1XA 1ZIBA 2WQ8A 3N04A 1LGVA 2QGDA 4JL2A 5AB2A 5TE7L 4D7PA 1TKWB 4HJEA 2P9RA 5EF0A 5J6HA 4GY4A 3CK0H 4RGNB 5IVZB 3C9NA 3EJUA 3AG1B 4N8CH 3TT1H 3L2LA 5KYYB 5C71A 3SE9L 4F2EA 1NL0L 3GTNA 5J6GA 3MRCB 3DX4A 4K9EC 2YD7A 2B15A 1BQLL 1J1XL 3AACA 3G3LA 4EVNB 5INDB 3ZHDA 3INUH 5HSFA 3CFCL 3MXVH 3VD0A 1ZS2A 1BMGA 2WNXA 2F7IA 4ZX6A 3MRRB 1RZQA 2RB8A 5MHSE 4QHUB 2DRUA 4BUHA 2JI1A 3CZJA 4NKDB 1S78D 1X3DA 3AWGA 3LEXA 5HI3D 2XN9E 3VXNB 3ZT6A 3BQVA 2X05A 2GSGB 3A6CH 3T09A 3ZLQC 5KJRH 4HKXB 2EIZA 3VCLB 8CGTA 1D6VH 3QFJA 1L5GB 3WLBB 3ZT7A 1UCBH 4X98B 4BFKA 3WUZA 4XP4H 5DQJB 5JORA 1FNFA 1KCVH 1HIMH 3DV6B 1A5FL 1WZLA 4EDXA 4LLWB 3GI8L 4NXKA 1NIDA 1VHPA 3HN5A 5GS0C 4LPTA 2CO4A 3PABB 1VLXA 4MJ6B 5G5DB 3FSVA 2R0WL 4KKLD 4X6DF 5EC1B 5HI4D 4PGBB 5BV7C 1K4DA 3IAGC 4MB3A 1VCBC 1INEH 2IOOA 4QT5A 5BVPH 2GK0A 3WKYA 3O6FC 2UUDK 4DERA 3QH3B 5DWUH 3MLZH 5I1KH 3TFKD 3F58H 4FXKB 1S9KC 3AWFA 1E9PB 5DEJA 2ISDA 2HX8A 3EFDL 3FOMA 2WK2A 1OE3A 4G3YH 1ZT7B 4OIIH 2DM7A 2UZXA 4YWGL 4C58B 5K9KB 1G7HA 3QJQB 4MMXA 1W0WA 1K2DA 5K39A 1PD0A 3QZBA 5F0PB 4F7CA 1FYHB 2K45A 1QTYT 2VXUL 4LSVL 5KVGL 4QXGL 1RU9L 3NBNA 1G7PA 1AGEA 4KRPB 3JWOC 4WUUE 5SWZD 1GH7A 2QTVA 3DHJA 3EH2A 4R0LA 3UG5A 1KYAA 5JNYA 3HFMH 5HY9A 4BBWA 4QOKE 1LILA 5D7JD 5B4MD 4WEBH 2VN6A 4JKKA 1F4WH 1P4IL 3D2UB 4MMXC 5F44A 1OVZA 1FORL 3RY4A 4OV5B 1KDIA 1MCOL 3SYAA 5I6OA 2OS7A 1UWYA 3CQQA 3L6FB 5JUEH 4HP5A 1N8ZA 2AK4B 3TBSB 4KGLA 4LCUA 4W9KC 2NX5D 4MXWL 4FABH 1TZIB 1HINH 2AQPA 3GSNB 4R9HA 5GGQH 1SJEB 4R0LC 3TN0C 4BZ1A 3VD9A 3CIAA 3ELAT 1SUHA 2F61A 3PHSA 3V6FA 3Q05A 3PAYA 4P2OA 3T0EA 4JHVA 5GGTH 2OJEB 1VEMA 5LCVA 3V95A 1R6VA 1PZ5B 3SIKA 5DMIH 2FX7H 4PJFE 1S5HB 1I9JH 2E8ZA 1ZCRA 1A14H 2AV1B 3BUTA 3QIUB 2X1XR 4AZUA 4YEFA 2P8LB 4JRFA 2PKDA 4XAWL 3V9EA 4JFED 2Q3XA 3BPNC 4XCFL 5K93A 4ONHB 3RILA 1Z9LA 3AWEA 2UXFA 4HS8L 3RHWF 3L3JB 2FGWH 4GRMB 5FYJU 4P2OC 1AE6H 4X80L 3T0EC 2AJZB 2C9RA 3H9SB 2WLLB 5L88L 3WYRA 4NM8L 3CFKB 4PJXB 1HHHB 2EYRB 3C6SA 1PZCA 3QEQA 1A6UH 4BDVB 4M1GH 5H37H 3SBPA 1C08B 1AI1L 2O61B 5F1SA 4NNYB 3UPAA 4YXKH 2VABA 3L16A 5FHBL 4AGQA 2V5TA 4UAHA 5HYJD 1UH2A 4ETQB 5AOZA 1NCGA 3IMSA 4KKZA 2PW1B 2WTRB 4KAQH 1DQLH 2AEQH 2AJUL 4B53A 1OP5H 3OR6B 1N7MH 1WE5A 4JR9L 4XH2A 4UOJA 5D96C 5AAWA 1TU2A 2Y1AA 3CDYA 1S5IH 2ZG1A 5DJYA 1KB3A 3OKKB 5DQ9B 5H94B 4U1IA 1D5XB 2QL1A 3O4OB 1JNNH 2NW2B 3H3KA 3NCXA 4B5ZA 3WTUA 4Z7QF 3F7YB 4FFTA 3FRUA 4OD1L 3KL3A 1KGJA 2MTAA 3QAZC 4KK6C 3BKJL 1CICD 5GJTL 1I9IH 5DYFA 2IXQA 4G7VL 4WCYL 5AAWC 1U8PB 1U2YA 4LIQH 3MFFA 3VYNA 1RVFL 1IEAB 5E08L 5GJSL 3LDBB 2A38A 3D06A 1Z5YD 2ZOKA 3BIKB 2W9EL 4GKSB 1K8DB 3TJEL 3JXAA 4JO3L 3GIZH 2YMXL 2KS0A 2MKWA 3D33A 1R3HB 3I3EA 3PU7A 4Z0BL 3QCTL 2WUCL 3VWJC 2SODB 2WW8A 4HSAC 4OZGB 5IQ7L 5I8CB 5D4IA 4J6RH 3UPRB 1M7DB 1FNEB 3TA3D 4J3OF 4AY0A 1GRWA 3L5XL 4CU6A 4HZLB 1L9SA 2L04A 3N91A 2WGXA 4ZMYA 2CXGA 5EEUA 3W37A 1OM9A 3SDXF 2QQLL 2X89D 4Y19B 4C56E 3O6MH 3V4VL 4AJWA 4K71B 2OV0A 4TLSA 4MMZA 2Q76B 3MMEA 4UILH 3U36B 3AQDA 1DFXA 2DQCL 3ZL1A 1F86A 4F7EA 4NDMB 4XVUD 5D2NA 2X2UA 4HULB 2H41A 4NIYE 3HNSH 4KVCL 5TH2A 5C08E 1EEQA 3WDJA 2ITCB 2R0LL 3QHZL 1FVDA 1R3IL 2UXTA 4J3TA 3NZHL 2FQFA 3FFCB 3O3EA 2E86A 4IJTA 3BAJA 2R1XB 4GIOA 4NRXB 2D7TH 1KPUA 1ZVNA 3D4CA 4XXDA 1VFOA 2GT9A 1CGYA 2LLGA 4AW7A 1BIIA 1IGCH 3JBG7 3U30B 1G7LB 5F71A 5DURD 2VZSA 4KRNA 1L4IA 4XE5B 5AEAA 1JHLL 3OGCB 2VJXA 1NAMB 4ALAL 2CWRA 3X14A 2K3HA 1E42A 1I9RL 2VSCA 3C08L 5KEZA 3B2VL 1DSFL 1SVCP 2P8MB 1YYCA 3C2AL 4OKDA 3EH3B 2EDOA 2O5YL 3QZWB 4ZYKB 3SJVD 4GRWE 2V17L 3U46A 3QNXA 4JRLA 5E6SB 4HIXL 4Z5RA 5I8KH 4F15C 3DGDA 1I3RA 4KROC 5IQNA 4M9PA 2FZ3A 2L4OA 2YGQA 1T20A 4QHKI 3R7QA 1TJGL 3ZDZF 3ET9F 1VB9A 3BLBA 4GIAA 3CQFA 3E7JA 4P2QD 3GSXA 5A2CA 3D3VD 2NY0C 3RGVB 3MHZA 3WEMA 4ZUTB 3FT4A 4KZDL 4L3AA 4WV1B 2OCJA 3IMUA 1CFVH 5F8RC 4P5KB 4AG4L 4HW6A 1WISA 2G2RB 4KJYB 3VRJA 4F2MA 2VUOA 1S7TB 1YN6B 2NY1D 1ZANH 2YBRA 3BPCB 4M3HA 5IFAH 5JHDA 4W1TA 4RMVA 3S8FB 4AWJC 3QR2A 1TKWA 3WIIL 5I1IL 3X17A 4KU1A 5HHOB 5BZWB 1N6QH 2KBGA 5AOIA 1JGUL 5ESQB 3U6XS 4FTVD 4JDEB 2XTJC 1I31A 3EUUA 2I07B 2IV9A 4E68A 4L1HA 5KYYA 3N43B 3LRMA 3NJHA 3MRCA 4O2CB 5A1AA 4DPAX 2WOYA 3QXAB 3EGDB 4NYLB 1D7BA 5DHDA 5INDA 4HVBA 3UZEA 4X4KA 4LBEB 4P05A 5JDSB 5LBSA 1X7TA 2D7OA 5EZIL 3KVDD 1VKXB 2X9YA 5CILH 1AR1B 4MB4A 2FT7A 4RGNC 1MVYA 1COBA 2YEQA 4L1DA 1D5IL 1VRSA 5JIKA 5C0DB 2GSGA 4YHNB 1HNYA 1MNUL 4JZJA 1IGFH 3TESA 2VN4A 4HKXA 2R39A 4HSQA 4HCRL 4G8GE 3U7AA 3VCLA 1REIA 2JF1A 1P5UB 1J5CA 1L5GA 3WLBA 1ZGLA 3PS6A 4ZQKB 4X0KA 5LG1A 3UZEC 5JW3L 4I1RA 3OLEA 4DKFL 3DV6A 4LLWA 4UZSA 4PJGF 4Y1AE 5IHZB 4J8RA 3EO1B 4B96A 2Y22A 3EW3B 3H9ZA 3N85H 3O81A 4MJ6A 4ZO8A 5G5DA 5B21A 5F88A 5EC1A 3VGHA 3ULVL 1OCOB 1U8LB 4TNVK 4NJAL 4JRYE 3EO9H 3CD4A 3OHXA 3SB3A 3FQRA 3RWDB 5FYJL 1BFTA 4FXKA 5HDBE 1E9PA 1DQJB 3BWAB 4TSBL 1JZ6A 5SWSD 2Q7YB 1LO4L 4H26B 5CCJA 4PD4K 1CFQB 4HWEH 1VADB 4YL4A 4PWJA 5EBMB 1BCIA 2CD0A 1XAUA 1Q0YL 4L0PB 3BYYA 4JFOA 4LSDA 4W9GC 5DD0L 1MI5D 3ZZSA 4HWZA 4UNTA 2EVIA 1BA9A 4GO6B 4NRYB 4ZXBA 3KPOA 4LLYA 1IC5L 2XZQL 3OLDA 5D1XB 4FXKC 3VDAA 5BW7A 2E7HA 1YQVH 2UZIH 2MPVA 3RWCB 5E2VL 2IGTA 2YN3A 3SDDB 1R9FA 1D9KD 4TVPD 4OGZA 3D2UA 4D9LL 1JGLL 3RIFF 2EVGA 2FJHB 4OV5A 2WLKA 2F8VA 2WLJA 3WTVA 1IKNA 3LHAA 3L6FA 5CFAA 4Q0XH 4FQHA 2NY3D 3RAJH 1LP9F 3M17B 5F0JB 4NNPL 2YPVH 1TZIA 3I6GA 4KRPC 2K70A 2WBWB 4NUMA 4MAZA 5BW7C 1MFEH 2UWEF 5IVNA 5JPMB 2GJJA 2VYRE 3VXTA 1WF5A 1NCAL 1S7SA 1S7QA 3DXAB 4X42A 3S5LG 2OJEA 3FQNB 1IKNC 3S3JA 1UA6L 1PZ5A 2OP4L 4J7RA 4YSEA 1WBXB 4ZMTA 1QKZH 3EYSH 1DVYA 3D48R 4GNKB 1RV6X 3QIUA 4XGZA 3T1FB 3DSNB 1A7PH 1UD8A 3IB4A 3AS1A 3WU1A 3KHQA 2EACA 2RALA 3WMQA 2PMZA 3MU3A 2W65A 4L05A 3BRDA 4X7DC 3FU0A 4YSOA 1ZE3H 2F74B 2WLLA 2Z31B 3KYKL 3QI9B 5GS2H 3EZJB 3OKDB 4K3HA 4PJXA 1HHHA 1DN0B 2EYRA 2HRPH 2VIRA 3LZFL 4L8SB 4NKIL 4NQXB 5EU7E 5GSVB 3BIAX 3QFDB 4BDVA 4EKXA 1SRDA 1C08A 2HFFB 3BXNB 1LO2H 4GEJA 2GY5A 3NIGB 3QIUC 3VWKD 1MCWW 2APFA 2O61A 3TBTA 3O2DL 3O2WH 1NAMH 2J4WL 4F2FA 4ETQA 2YHGA 1DDTA 4WWOA 2P5WD 3FMGL 1BZOA 3L45A 2PW1A 4LAJH 4YE4H 4Q9CA 2VXTH 3RWIA 4UQAA 1HHGB 4EMZA 2DQMA 4A37A 2FWSA 4U1KB 5ALBH 1EUUA 3PGCB 1PTZA 4FHBD 4GBXB 2DJMA 1UXWB 1DYZA 3GBEA 4G8EB 2DQJH 1IGTA 5H94A 2VO5A 5IMOB 5L2KE 4HFUL 1A1OB 2ZAIA 3RWEB 3F7YA 3FTWA 1E4WH 3WL9B 4EXKA 1BFVL 2AXJA 4AJVA 2YEZA 3KJ6L 4L8BA 3GBLA 2DH3A 3P4NB 4KDWA 4NRZB 1K8IB 3VFSA 4Z7OE 2ZTBA 1JWSB 3GS0A 4KXDA 1HXKA 1KBBA 2XBDA 1FHNA 3FONB 4Y2OA 2AV7B 2CO3A 2GC7C 1IEAA 1WAAE 4PLJC 1KFAH 4XWOC 3HN8A 5DGQA 5B1CA 3BIKA 4MQSB 4GKSA 3KNBB 1K8DA 3QB7C 1DZ0A 3EJYD 4H8VA 4OF0A 3SE3A 4GP8B 4B5EA 1KBGL 1UCTA 1SOSA 1R3HA 1NGWB 4OZGA 3P2DA 4DFIA 5I8CA 1KEGL 1JVKA 3WFDH 4X5LA 1SXSA 3LH8A 3IJHB 2EDRA 4WI0B 2CK2A 2Q86B 2RD0A 4O5LH 4HZLA 3L5JA 1MJ8H 1LJMA 5IG7A 1A21A 4HCFA 4MJIE 3LDBC 5DD1H 4Y88A 5EIQA 2LR4A 2D0HA 4OZIB 2VQTA 3U36A 4H2CA 1JCVA 4YH6A 1CD9B 4YWGH 2A7BA 3R1GL 2IF7A 1IAII 5KVEE 2PYED 1HQRA 1DANT 3G5WA 1FH5H 5DSCA 2DL9A 1EZVX 3FFCA 4M8VA 5FLVA 4P9ML 1O0VA 4NPYB 1HEJC 1L7IH 2EEFA 4NQQA 4UDTB 2CIIB 2D7PA 4PIRF 3MFGB 4NRXA 2VOTA 4K71C 3B34A 4K73A 4PJHB 4A7GA 3Q8FA 1W9XA 3EBAA 4EN2A 2G5RA 3DPBB 3GLZA 2XVKA 4J1UB 1BJ1J 1G7LA 3G08B 5E5MA 5BRZB 3X1EA 4M43H 4H0GA 4ZAKB 4CDGC 4CSTA 3OGCA 5JDJA 3OVUB 2YRBA 2E46A 2BSEA 1NGPH 1U92A 4AVHA 1P7QD 1MCJA 2OXGB 1P2CB 2BIMA 1MFVA 1HHJB 2YSSB 1EZSA 2P8MA 2RQ8A 2AK1H 3ULUD 1AY1L 5D1QE 43CAB 4RBPK 4HOWA 2Y1ZA 1SYVA 1NDGB 5EA0L 2O26U 2WNWA 1EQWA 3G6DL 4LVNB 5DC4B 5DEGA 3U30C 3B1UA 3BDYH 4E9WA 2FJFB 3BAIA 1XR9B 1UM4H 4N2MA 5GZOA 3P2TA 5EZPA 4Z0XA 3HS0B 2DQTH 1HHIB 4PJAE 1CO1A 2A4CA 3RGVA 1NGXB 5CN1A 5E4OA 4MD0A 3UX9B 4ZUTA 3NABH 4PTTB 3G04B 2NY6B 4WV1A 3RBSA 4Z7NE 4XAWH 2OK0H 3DPDA 2G2RA 3CU1A 4NP4L 1ZTXL 1OHQA 3O0RL 3KPSD 4XPTL 1E4HA 3LQMA 2Y7OA 3WDIA 4PVNA 3BMWA 3PNRB 5BZWA 1PX8A 2B4CL 3NPSB 5GHWH 3RGVC 4UTAA 4NQSB 2WSPA 4LP8A 4XOEA 4YZWA 2VLJA 2XKUA 2QQKL 3VA6A 3ZIMA 5ICYB 1UA7A 4WV1C 5HYEA 2E9IA 3OHMB 4F7PB 1CE6B 2FVNA 4KV5F 4UCFA 4YO0B 3EGDA 4WTXA 1Z2KA 1IAOB 2PPFA 5JDSA 3GQFA 4PP2A 3L4ZA 4JVUA 4WGWB 1OSEA 1VKXA 3RNKB 1KIRB 4JR9H 5IK3B 2A4EA 4OH2A 3AUVA 2DTML 2CUIA 4ABUA 4FYTA 4JFTA 4NZTH 3QBTB 3KYNB 4D2NA 5C0DA 2PPAA 5F6IB 5KVFH 2MWCA 4YHNA 3IMWA 5HDQL 15C8L 1P5UA 1FYTA 4GLRI 1PYWB 4LLMA 2VR8A 5DLLA 5CU5A 3TGXA 3F7LA 2Y2WA 1FIGH 2BCKB 2D73A 1QATA 5FDWA 2BFGA 4I1NB 1PLCA 1WUZA 3QR0A 1AR1C 2JK5B 4G7VH 5IHZA 1E27B 3LN9A 2EH8H 4JFWA 4CMMB 5C0CD 1WWAX 3NFPB 3O9WB 2VH5L 1XZWA 1HAUA 1H6TA 3TBVB 1RJLB 2I7SA 3PWPB 1U8LA 1INDL 1KBPA 1P5UC 5DT1L 3BZ4A 4N20A 3WIHA 1KCLA 3KXFD 3RWDA 3D51A 1JBJA 4AQ8A 4N0YH 2BW5A 1TOXA 3BWAA 4OCWL 3RVWC 4B0MB 1JHKL 2OW6A 2Q7YA 2R2CA 4H26A 3BP5B 4FMKA 5GIRA 4YX2L 1E2ZA 5E1AA 4XNXH 4AT6B 1CFQA 1N5AB 4TSAL 1N67A 1RHHB 2ZX5A 4YC2B 4NZDA 5JIDA 1R0AH 5EBMA 3OPUA 5F9DC 4Q97A 3V2AR 2E4TA 4NOBA 2P5EB 5F9AC 1NOLA 4G9DA 1RK0B 1SXNA 2H1LM 3A23A 3FUNA 4NRYA 4YSTA 1ECZA 4K9JA 3MRNB 2L3BA 1DBJH 2V7NA 4IU2B 1LWJA 4ADGA 4IIZA 4AQ8C 1TVBA 1OOWA 5T3XE 3ZR5A 4QAMB 4DQOH 1S9XA 1O7VA 3LIZL 3SDDA 1KB9K 1ZK9A 5B3JF 1SN2A 1UZ8B 1Y7VA 3L9BA 1Q38A 4J3OG 2Y1YA 4OI7A 1PF3A 1IZKA 4PJ8D 1TNNA 3S88H 3MRLA 2ENPA 1X7SA 2GJZA 5D1XC 3SE4A 4HXAH 4KTEL 2XFGB 4JKWA 4RNRB 2BVQB 4G59C 2JCCE 2IV8A 3SDDC 1N18A 3L3KB 3KLHD 3B5TA 3UZQB 3NZ8A 1G9EA 1BXVA 2PETA 2PYFA 4HIXH 1ND0A 2LQRA 1CK0L 1G1KA 3EYVB 4P0DA 3K6IA 3UTSB 4OVVA 2G9HB 3VH8B 4XMLH 4KGJA 3T1FA 1BF2A 4KOCA 3MLTB 4LGSB 3SE4C 2R29H 1IO4C 2ATAA 1IC0A 4LEBA 1TTBA 5JPMC 1L9OA 3BDXA 3O6LL 4LHUD 3CZNA 5AOKA 2FB4L 2QPUA 1U8QA 1SEQH 1Z66A 1RZFH 2Z31A 1TYRA 3HPJB 3QI9A 2R9HD 4PRPE 3OKDA 2AZAA 4Z95H 5GSVA 4NQXA 5I6XB 1A7BA 5F1IB 4QWWC 4P5TB 2HFFA 3BXNA 1OP3K 3KWXA 3STLB 4CGUB 4KMQA 3DNKA 1JIBA 3VX0A 4AZ8A 3CHPA 5IWLA 4BQ8A 2ZOWA 1JXDA 5L6YL 3OKMA 3TO4B 4OJCA 3CN3A 5GZND 3ZYJA 1HOCB 5K69A 2Z31C 4G6MH 3IF1B 3QI9C 2MNJB 4CN4A 2H0EA 5I76B 3PGCA 4L8SC 1BG1A 3CZLA 1WVZA 1UXWA 4JCLA 1SHXA 3DMMB 4OF3A 4DP5X 4HD9A 1W8EA 2EJ1A 4G8EA 4XAKD 3THMH 1FCGA 4LB8A 3V8CA 2OSXA 2K9UA 5IMOA 3BEWB 4UQBA 1BD2D 2IDTA 2R15A 3OJVC 1A1OA 5IWLC 1JOIA 3RWEA 4HKBB 1GKOA 4O00A 2YRPA 4JRWA 4PRIE 1GYUA 3Q8AA 4YLQT 1U8CB 5B38B 3QARA 4NRZA 3MYZA 1JWSA 3PDOA 4EZLA 4GBXC 2VR5A 4Z7WB 3GPEA 4WI9A 3FONA 2AV7A 4BINA 1SJVA 1R5WB 4NP9A 4CVZB 3HS9A 2NYYD 5DD3H 4AKOA 1DZBA 4YLBA 3QJTB 1IL1B 3A21A 1M05B 5C0IB 3F5WB 1OXYA 5JA9A 1A6WL 4HAGA 4AM0B 1Z0MA 4WUKL 4QLRA 1NGWA 4PJ7B 1QBLH 3MN8A 2EXYD 5H2BB 4X7TB 3GRBA 1OE2A 4LVOB 4WI0A 2Q86A 4N8VG 5DS1A 1J12A 4AEIH 5I8OL 1QR1B 4UYPA 4CMHB 3P3UA 4MJJA 3X11B 3UOAB 1MCCA 3U7WH 2LGNA 2QSQA 2ZWYA 1UOVA 4ZODA 2YWYA 1PU0A 1R34A 4KKCD 5DRWB 3V9FA 2BZCA 3T3MF 3BT0A 1OLLA 3A4FA 4XVSH 3Q43A 1OAQL 2N01B 2CMRL 4B7LA 2G75B 5EOTB 4YSQA 4QF1B 3ARWA 5K1JA 2JKXA 3FF8A 3QPQD 4XTRD 5DD0H 4NPYA 1RXLA 3GBMH 1KTRL 2CIIA 1CBVH 2R0ZH 5F7KC 3JTTA 5KVDL 4PJHA 4JRXE 4LASH 1U8MB 4GXVL 5F0LB 4XPBH 5J11B 3TTYA 2IDQA 1GGCH 3DPBA 1MFCH 3MRDA 1DBBH 4I9XA 4DKTA 3QXVA 3G08A 4W9ZA 5BRZA 2QDWA 2X0VA 5M94B 5JQ6H 1IX2A 1QVOB 2JJSA 3F62A 4V1DD 4AL8H 2P5PA 3ULVD 2OXGA 1P2CA 1DTUA 2CJTA 1HHJA 2YSSA 4GXUM 4OB5H 5C2BL 3GXFA 2MCPL 1WWCA 1KCUH 3HBGA 3W9EB 4L5FE 4DAGL 3L7EB 2JI2A 1H19A 4XBPB 3N9GL 3NSJA 4JFPB 4ELDA 2DKSA 5G2NA 3ME0A 3ALPA 2OMWA 4XMPL 4LARL 5I1HH 1SY6A 3ARBD 4L3FA 4LCWD 1T2QL 1DL7L 2VW7A 2HCZX 4WUUD 5ICUA 2FJFA 3LEVH 4ZAKC 4APQA 4LSPL 1A7NH 1EO5A 1K9TA 3HS0A 1HHIA 1XGTA 1XGQA 1O9WA 3BAEH 1JERA 4QRPE 4PTTA 3FTSA 3I6KB 1JPTH 5TE6H 3RY6A 3ZKMD 2EXWD 4N28A 1AKJA 1QFOA 3C75A 1W0VB 5T5FA 3CMOH 3G9VA 4LVNC 4KI5D 5AB1A 1CGSL 3ZKQD 1VFUA 4WHTA 1A7QL 2DV6A 2IMMA 4NO5B 2Z6FA 4GRLB 3NTCL 4WWKA 1NCTA 2WBJB 4N0CC 1NPUA 3IGUA 3LZFH 3QUGA 3SE8L 3ZE2B 4DUXA 2VDLB 3HS0C 2G0KA 4KOBA 3QS2A 4NQSA 1P4BH 5EU3B 1HS6A 1W8OA 3DI3B 4PJEB 3VXPA 5HHMD 2NY6C 4UU9B 3RY6C 4N3UA 3TF7C 2BPBA 2WN3A 3GSOB 1ZHLB 4M7LT 5CFHA 1U33A 2F58H 2ICWB 4KQ3L 5FGRA 1CTMA 4OJDH 1IAOA 3MNDA 4PSPA 4GT0A 1A7RH 1KC5H 2PNDA 4QEGA 3QDHA 2W92A 1JHTA 4FJYA 3T0BA 4Q9RH 4MJ5B 3AB0B 4UQ2B 4WTQA 4U7MA 5IVOA 3NPSC 4G8IB 5D5MA 3QO0B 4FFYH 1SF3A 4AKQA 4JFXB 4W6YB 3CX5J 3SPIA 4TOYL 3E8VA 5KSBE 1Z5LB 1YCSA 5FFGA 4P5SA 2EO9A 4Q2ZB 4NQCB 4Z23A 4PJIF 1EO7A 2OCFD 4PN6A 1X6NA 1MFBH 2BCKA 4G1EA 4BJLA 1NANI 5IGXH 4L1LA 5EO0B 2V9TA 4CMMA 1XQ4A 1YPZF 2IPTL 4JREB 4MAUH 3KGSA 3NFPA 3O9WA 4I13B 3T2LA 5C7XH 5IROC 3TBVA 5HYIA 1N2RB 3PWPA 3H3BC 3LPGA 5EHFA 1IGIL 5DMGD 1THCA 1BYOA 2XXFA 2GSIB 4GMTL 4JY5H 1BV8A 2OMUA 4LPCA 2H8PB 2Y7LA 2IQAB 3DHMA 3V0GA 1ECYA 2C9QA 2J6WA 5FUOL 3KGTA 5AZ2L 4AK1A 2YOAA 3M7FB 4FTDA 4IRZL 1F90L 1JRHI 5FGCB 4H25B 3O9WC 3VI3F 4WK4B 1NPNA 4JAMB 2OR9L 3BSZH 3RU8H 5I1JL 3DJTA 3QXUA 2P5EA 3UAJA 2ZSWB 1RK0A 5EU6D 1YEDB 3WS6C 3WFEL 4AL8C 3U1SL 3MRNA 3R1GH 4IU2A 3WO3B 3UBXB 3VNZA 2IOMA 1NGYA 2V2XB 5DZVA 1W6WA 5D7IF 5DVOA 3QORD 1JXKA 3QZPA 4JDZA 4G7QB 3VFOB 1CBJA 4LCIL 3EJZD 3FB8B 4YC2C 4AYFB 1WZMA 4PG9A 4W4OC 4UMSA 4X7SH 4ODSL 3WE6B 1J88A 1MRCL 2VE6B 2V9UA 5D7JB 2UV3A 2AQ1A 4HV8B 4NCDA 3J2PA 2YPLA 5HHPB 5JHMA 1YY9D 2XZAL 1YSOA 1OW0A 3U79A 4RNRA 1OHZA 1JPST 2BVQA 4OCSH 4FNRA 2DMGA 3CHXA 3BH8A 1KZQA 2HXAA 4HUCA 4MXVE 2BP5M 3Q6FB 3EYVA 4B6ZA 2IFFH 3SYCA 3UTSA 4Y16A 1UXLA 2G9HA 5G4MA 1DFBH 3VH8A 1B0WA 4I77H 3HMXH 1MDTA 4NGHL 1RZ7L 3NJKA 1LO5B 2J8UB 3T4AB 1CXIA 4XCNA 4RSYA 3RWFB 1P1VA 3RTQD 4OFVA 4DO5A 4F8NA 6PCYA 1JF5A 4M1DL 2P52A 3NQIA 5DI8A 1BFOA 4G5ZL 1BEXA 3ZUNC 2QVKA 2Q1EA 3I50H 4JFEB 2VXSH 3L9EA 5F1IA 3K91A 4ZTEA 1SDYA 3QG6A 2DLHA 4P5TA 5C09B 2A9ML 4PP1D 2GPZA 5EN2B 3PJLA 4KH2A 3STLA 2BNRD 3IU3B 2F54E 1PZ3A 2CA4A 1IQDA 2GBVA 2Y6SD 4PGJA 4FLOA 5F9JA 3T0EE 3K71B 2Z93B 3M88A 1UWFA 1QBBA 5CJQL 1GJUA 4HC1L 1HOCA 1KN4L 3I3BA 3F85A 3IF1A 3ESUF 1YMMD 4RWYL 2FECL 2O5NA 3SBQA 4RFOH 4RIRB 5I6XC 1JNJA 4I18B 4BA8A 5HYJB 4P5TC 2H6OA 3W1ZA 4JQIH 3LKRB 3BVDB 4LAQL 4ZS6C 3NJVA 4YHZH 1NBZB 1AKPA 2QLVB 4MLIA 4LQFH 2FEDC 4W93A 4HKBA 3A6OA 4ZW8A 3TO4C 2FR4B 3QJXA 4XX1E 4WDIA 3UGUA 5B38A 3GRWH 1NGQL 2H1PH 3ARDD 2G9KA 4HEPA 2FDBP 4IKLA 4Z7WA 4F27A 2DMKA 5EO9A 1L3NA 3QC6X 5L4IA 1BOYA 1HCFX 3JV6B 3CBRA 4PRNA 2HH0H 5DFVC 1OTSD 2X3BA 1IL1A 3LY6A 1Z32X 4IBYA 1MN4A 5C0IA 2BVOB 3F5WA 3IXTB 1IKOP 3KPLA 1QFWI 4AM0A 3ECVA 1T7ZA 5JO5A 4PJ7A 1B6UA 1E90A 1CDJA 2HJFB 3DTXB 4X7TA 3PWNB 2X53A 2NY5H 3WFCL 1Z7JA 2C34A 2NLJA 2EDNA 3DGGB 4IOIB 1EAOA 5CKGA 3VGBA 2NNFA 1XMWA 4J3VA 2XXMB 4JM2D 4IRJD 3BESR 2P8PB 3UJIH 4PRDB 3QO1B 4MB1A 3TA3B 3K81A 5FGBA 5KYUA 4Z7IA 3OKOB 1WFJA 4O4YH 2YO3A 4ZD3L 5DRWA 4PJDF 4MTMA 2VW6A 5CD5D 1Q9LA 4R8WL 3GBDA 2HFGH 4LVOC 2G75A 1XF2B 1XDTT 4QF1A 1ACZA 2BOBB 1ZKAA 4CMHC 2KPWA 2ZP0T 4EQ2A 1SN0A 3GSVA 2F9BT 4L1TA 4UTBH 1RUPL 4FQCL 3NFSH 2IPUK 1BQHG 3DJZA 1KPRB 3EYOB 3N42B 1U8MA 4AQZA 1B9ZA 4P59L 5K9JL 2BK8A 1NCCL 5D7SH 3D34A 3H2QA 4JG1H 3MAWA 5FGBC 3MV9D 1GZQB 3TNNB 2XVGA 2YZ1A 4AV0A 1CTOA 4NKOB 4UOQA 1DE4A 4LL9A 1WBYB 3ZE0B 1TIUA 4P46D 2VAAB 4ZUVB 3UMTA 1QVOA 4JGUA 4HG4K 3ECUA 5DZNA 3VRLE 3KPRD 2XC8A 3LZNA 5DVMA 5I19L 4K8RC 3UZVB 3W9EA 2AVGA 3K80A 4JFPA 3NCBB 4FZEL 1F97A 5BOPA 1MCKA 3LRSA 5J11C 4JK0D 4C59B 3M07A 1N19A 2A9DA 1ETJA 3LIUA 3COOA 1G6RL 3L4XA 4UIKH 4MQ7A 4XBEL 1J0JA 3SJVB 5AVRB 3QDGE 3AMKA 3ZE1B 3MOAH 3SGJA 1R1CA 1R19A 2YC1B 4NWTL 1IE4A 3Q2WA 4N22A 3IWUA 2HTLC 1IGYB 1SOQA 3FU7B 1KJ2B 4BWUA 3WAJA 1W0VA 5E23A 2PWHA 3O41B 4WO4A 4P2QB 2DLFH 1TQUA 4Z8FL 3D52A 1NDTA 4L48A 5LAPA 3WTSA 4LNVA 1XTLA 2ZCHH 4NO5A 4GRLA 1PG7W 1UZ6E 1P4LA 1X6LA 2QPDB 4PRHD 5CP7A 4BK4A 4MJ2A 5E8NA 3SGJC 3U4BL 3GSUB 4ZMXA 2JTDA 2XJLA 2GJ6D 3F7VB 4NKQB 5EU3A 1QMUA 3VUAA 3UTZA 4F58H 1NCNA 2OZ4L 2Y07H 3R4RA 4M8UA 4NC1C 4UU9A 1FA4A 1F5WA 5A3ID 4H20H 3QRFM 1ZHLA 1EJOL 4JDVA 1J18A 1XD1A 5E6RB 3SQOH 5I30L 1GIGH 2AI0L 4GRLC 2X70B 2XTJE 3CFTA 5DMYA 5ISZD 3NCWA 4MJ5A 2WBJC 3PAZA 4DVRL 1ZLUK 1SHMA 3M8OL 4G8IA 4QI3A 3ZTJG 5D1ZI 3G9AB 4D9QE 4KTDL 4JFXA 5T5NF 2JJWA 3QCUH 2A74A 2WLIB 4F2ME 1HSBA 2VDNB 1ZSHA 5JHDE 1DQVA 4DTGH 3IFLL 2XXCB 1ZAGA 4PB9L 1BXAA 4DKEH 2WVVB 1ED3B 3REVB 4NQCA 1F3JB 5EZLA 4AIXA 1MWAB 3B9KD 2J6EA 4TRPL 4U0RB 4XP9H 2ARJB 4Q74A 4RGNE 2V2TA 5FAAA 2D7MA 4MZ3A 4CJ0A 2WUBH 1E4XH 1MCPH 1OSPH 3AB0C 3FH7A 3WTTA 5EO0A 5C86A 3OZ9L 5GS1B 1EUTA 4XP6L 1DBML 1IFGA 1T7XA 1TR7A 1DVUA 5CR8A 2A74C 1CB4A 1L6ZA 3ML8A 5JW4M 2CA3A 1MW3A 2W0LA 1PX3A 4C8XA 1S78C 2GSIA 5HI3C 2H8PA 2IQAA 4JM0A 3KVPA 3R8QA 4W6XB 1ZA6A 5HVWA 1KYOK 5L2KD 1Q1JH 2HRLA 4OLUL 5IBTL 4JREC 1TZHA 4S1SH 5T33L 4PJ6A 2Q8AH 2C9UA 4TKWA 1VGKA 2MRYA 4JAMA 4EQ3A 3AW5A 5JIQA 5KSUB 3E9UA 3BW9B 1YEDA 4GQQA 1VFMA 4ODVH 4LEXL 4GUOA 3DX9A 5SWSB 1AGFA 1XHHA 2YD9A 1CFTB 1A22B 3UBXA 3CXDH 3I3DA 4KKLC 3FQ4A 3H7BB 5HI4C 2K9FB 3RPKA 4XPGH 3JVFC 1N68A 5FYKL 3SOTA 2LAGB 2YK1H 4G6AD 5A6LA 1RIVL 1MI5B 3LNIA 4C83A 4E42B 5E8PB 4L9LA 3TEXA 3VFOA 3TFKC 4K7PY 4AYFA 3FB8A 4DGVH 4DF9A 5IJCC 5IHLB 4B9ZA 5ADOL 1SBBA 2W9LA 3K4AA 4IKJA 4OLWL 3L4YA 5EFIB 4OF7A 2XKNA 4DJMA 5D7JA 1D9KB 3EUDA 3EYQC 1QNZL 5AKSA 3LN4B 1UACL 2WNKA 2BMKB 2EEBA 3O4LB 5KANG 5LBGA 4I3SL 3B7TA 1X5MA 4YDIH 2QMJA 3RZCD 2NY3B 2OMVA 1JWUA 4XC3L 4FLQA 3N06B 3N40F 2YJLA 2AXFB 3UAEA 4GSXA 5EBWB 2FX9L 4WJG3 2HJLB 4L4TD 5B4MC 5D7JC 4DGIH 3MLWH 4Y4FA 3SKJH 2ZOUA 3ELQA 4YJZL 4B0MM 4RAHA 4BFEA 2J8UA 2DQIL 4IRSA 4NHCH 3ESNA 4M7ZB 3T2NH 4KHXL 1U8OA 2WWMD 3V6OA 4D0CB 4PJBA 1P84J 4OIBA 4F8TA 1FE8L 1L7TH 4JCWA 1EXHA 2AK4E 1ILSA 5EOCH 3FZUD 2VC2L 2YSTA 1ADQH 5C09A 5KANI 3WUWG 1R46A 4EZJA 5EN2A 1EANA 3BI9X 3IU3A 2J21A 5DQDH 5IB4B 1CLOL 1A7OH 3WE1A 4PJFF 3S37X 2G2NA 4LEEA 1WC7A 1WIPA 5F6HJ 4ANXA 4Q9QH 2Z93A 3ZOAA 3T4AC 2DIBA 1ZPLA 2PXYD 1HXMA 2Z65C 3V6OC 4OQTL 2D3JA 4BSVB 4J12A 4U6VL 3VWKB 4ZTOH 4RIRA 5C0GB 2HN7B 5HYJA 1WG3A 4YBLB 5J4MA 2OYMA 5DVLA 2H9GB 2P5WB 3KS0J 4DUWA 5I1DA 4J5VA 1CD8A 3A4AA 3GMQA 3PP3H 3B6SB 3U0PA 5E2UL 4XP1H 5L4FA 4RGOH 1M2VA 1MXGA 3HE6D 4S1QL 2J88H 2EE2A 2YGOA 3H9SE 4FI6A 5AL0A 1MHPH 4OM1H 2VDRB 4PJXE 4KX9A 4RDQF 4U1JB 2HAZA 3NH7L 2YA2A 2VDMB 1FC2D 3GMMB 1Q72L 1FDLL 3QCVL 4I18C 1LEIA 1X7QA 3AXLB 1RFDH 1PLGL 1DQML 1JNLL 1MOEA 4PJ5A 3OAUH 5HJ3B 5KBLA 1FJ1B 1LO0L 3LMJH 3B9EA 1AHKA 4LGPB 4QJ3B 3FRPG 4K5MA 5GRUH 43C9B 4KITB 2AJVH 3Q2VA 3X2QB 5JIMA 4IMKA 4OLZL 5H37A 5E6IB 4KK9D 1A6TB 3DTXA 3PWNA 1Y07A 4L3EA 4XMKL 2YKKA 4IOIA 5MEPA 1BEYL 4U7SA 3CFJB 1Q0EA 5L9DH 2PO6B 1U9KA 5D1ZD 3D69B 1L9RA 1CL7L 2BVPB 3RNQA 2RTTA 4X2UA 3LQZA 4PRDA 3QO1A 4YXLL 3TA3A 4KJPD 3HHRB 1WFTA 1HWWA 5C0AB 4S10A 3VGFA 4DGUA 3IMTA 1H5BB 4GKZB 1RP8A 3APDA 3WI9A 4FULA 2AC0A 4IMKC 2AEPL 1A2YA 5FLUA 4J8QA 4PREB 1XF2A 1FNSL 4RMBA 1GCYA 2DWXA 3QJFB 5FW6A 1ZHBB 4KUCF 4TUKL 3K5RA 2CHWA 1YC7A 5FEBA 1ASOA 3EYOA 2JKIS 4Z9KB 1CG9B 2A2QT 2PYEB 3O3BB 3SD2A 3TA3C 4OZGE 4GUPA 2H2SD 1TQCB 2CCLA 3QHFH 3QQDB 4Y4HD 3U2IA 1GZQA 4A6YL 3QNYB 4HK0A 1PSKH 4G80A 2X4TB 7TAAA 4I3RL 2GB2A 1RZJL 4Y19E 1F45A 1GGBL 2Z7YA 4B9PA 4NLAA 2PP9A 3IDXH 4D8OA 1NAKL 5K9OA 4CGTA 4QGYA 3U0TB 4F1ZA 4JO8A 1VZHA 2IEPA 5LB1A 3IRCA 4FNUA 3QWRD 1G7QA 1U91A 1MAML 4PLKD 5C07A 5FPIA 2DWSA 3OJ2C 1P7QB 3CX5K 4OJEH 2EO1A 1ZLSH 4Q4EA 5JR1H 1JYVA 4HJTA 3SJVA 4I0PA 4HHWA 3FFCE 4WJ5A 2VLLB 1G9MH 3QDJA 3GMOB 4F8QA 3IGFA 5JPNA 2G5UA 2EDYA 2K6WA 4X6CB 2R4SH 4PUBL 1IGYA 4GI9A 1OPGH 3FT1A 4EOWH 1KJ2A 4KJQD 4ELMF 1FG9C 5GGVY 3HCVB 3O41A 4I88A 2LW3A 4HK3N 4Q7DA 3WNIA 4GRWF 4KZ0A 2YGVA 5TF0A 2YGNA 4GXFA 2WZ5A 2GTWB 2BRRL 3HEIB 4G5ZH 2C1OB 3GZQA 3QYMA 4Z7AA 4TVPH 5BUAA 3C09B 1Z5HA 2R69L 3ERXA 3F7VA 5AW9B 2OQJB 3KPSB 3L5IA 2ORBL 3BD3A 3MACL 5HGHB 1QYGL 3TBBA 3TYGH 1VSCA 1AJ7H 1QBAA 2Y7QB 4KNSA 2CLZB 1XSOA 3FUMA 2P4AB 5CJQH 1U8KB 5MP6H 3ILQD 4HX1B 1AQMA 4FDWA 4POYA 3LNHA 2YMTA 2ICEA 3AABA 3OKLB 1YYML 4UV4H 5E5LA 2CXKA 1T0PB 1GPOH 1OSYA 4HS3A 4QRFA 4DK3A 1A25A 4DZBB 2EDXA 2F5AL 4ZZFA 5CLTA 5E4IA 3QJOA 2WVVA 4HOMA 1F3JA 3BT2L 1MWAA 3S97C 4MRCA 2WIIB 5HHOE 4AQAB 2ARJA 4HQQH 2JSFA 1SJHB 3ARGD 2VDPL 5EBGA 2ZCZA 4KFZC 4PMEA 2BSSB 1E65A 4C57C 2OMXA 1JZ8A 4XOAA 3X1GA 2ICEC 4OJFL 1I82A 2CHXA 5JYMA 1BOGB 3L54A 4RMSA 3VFNB 2JKWA 2NQCA 3BAWA 4CC1A 2CDFB 2P42B 2VXQA 5C6TH 3S5LB 4L4JA 1FZKB 3EYUL 1WUNT 5C0CB 4UMGA 5SX5H 4PJ9A 3Q5YA 4U0RC 2BFVH 4RISH 3U48A 2IAMD 4N5ED 2Q6WA 2VXVL 5BZZA 1PZUB 2WXLA 1RPUA 1SHSA 2UYLA 1AZZC 1U21A 3DV4A 3KXFB 4DKDC 2WCGA 1XL6A 3KH3A 4YR6B 3H56A 3VSVA 2VDRH 3VJ6B 5DYOA 3BW9A 1GZHA 3VW3H 3QNZB 1DJZA 2HFTA 3BDBA 3VFTA 2D4FA 4OR1A 3GHEH 3ZZQA 2PUQT 2WD0A 4JFYB 2HX7A 4AVIA 4ONGL 4D0BB 1EGJL 3L3OB 4HJ0D 3UAFA 5HDBF 32C2B 3PAVA 3OAYK 2EAEA 1EZUA 2AJ3B 5LGKA 2DWEA 1HL4A 3EJRA 4IHOB 1HKLH 2XYBA 3JV5A 5D9SA 3UABA 3K2UH 4OF5A 5ICXB 4EIBA 5EFIA 1AS7A 1UATA 4MMYA 1GZHC 1D9KA 4RETB 5A2IH 2HJKB 2YAPA 3LN4A 2ZXWB 2BMKA 3LN5B 4ZO6A 3HPLB 3O4LA 3CC5B 3O6KL 4DP2X 3Q6GH 1WCQA 4KXZH 4TPRL 5KWYC 3VXSA 3H3PL 1CDIA 3CV5A 3B7RL 1XH3A 3VXQB 2ID5A 3WEAA 2CDGA 2EDEA 1F02I 2CPCA 5EBWA 3QXDB 4M1CD 1DEEB 1I3GH 1E5YA 5D1XE 3W81A 2B9AA 1E5ZA 1V7NL 2HKHH 1D9KC 2IH3B 4HUVB 3RX5A 5EH1A 1JPFA 3G5ZB 3D85D 2W60B 4JRXD 4UINH 3EOYG 3QUML 4B3VA 3BWSA 2FATL 4FNQA 5IFHL 1SHWA 2DQHH 2NY3C 4D0CA 4YIQB 2AQ3A 4LF3A 2FYYB 2YKLL 2ERJB 2D03L 2B0SL 2WKLA 3HI6L 2FQGA 3DIFA 4MXQD 2DKMA 3RVXD 4ATTA 2ZONA 1KJVB 5B1KA 3U9WA 4QHNB 3EOTH 1OSZB 3DXAE 3O3DB 4M7ZC 1NMAL 2IIJA 2I5YL 1E3XA 2ADFH 4AUYA 5A16A 2DJUA 2ZPKH 3POHA 3TBYB 5C0GA 3IYLW 2HN7A 5CD3B 2XHNA 2AABL 1EJOH 1Q9WA 2AGJH 1M56B 1RMFH 3OPZH 2OI9B 1W72B 4CSSA 3B6SA 3ULUH 5ABAA 1A47A 3L95B 5C9KA 4U1JA 3V5HA 3NDZE 2EZ0D 3X3FH 4D0DB 3VWKC 4QR7A 5AVXB 3F01A 4AIZB 5C0EB 5JQIB 1U2CA 5A2AA 3H0TB 3NIGE 1ACXA 4YE0A 3ZDWA 1BD2B 4AITA 2IH8A 3HG0A 1B0IA 2YAFA 5LGYA 1IQWH 4XXWA 5HJ3A 3BRFA 1FJ1A 1HYSC 3WNKA 4FLSA 4GKOA 4JFQA 2OULB 4YDJB 3PXHA 1XXFC 4ZDHA 1EFXD 1HH6A 2ESVA 4HBCL 4BE5A 2MPAL 4I0CC 1Y6MR 2VO8A 3EJPA 3LKQB 3QQNA 4JFHE 1RERA 2XPYA 4Y7MA 1A6TA 5E6IA 4RWHA 1MFAH 1A3QA 4ZX5A 4JO2H 1SYSB 2KZBA 4MQTB 4NZJA 1BVKB 4LO9A 2WHVA 2IQ9H 5FHAH 2OXHB 2PO6A 1KN2L 5EWIH 4B9KC 2ZJSL 1F8TL 1JXJA 3QG7L 1IAKA 4YDMA 5MERB 3TBWB 2EABA 1WAAF 1E9OB 4HLZG 1AGBB 2HFEB 2ZKMX 3LKPB 4GFTB 1XGYL 4KBPA 3HAEH 5C0AA 4A2EA 1NUDA 4GKZA 1AG0A 1KT2A 1K4CB 3VGEA 4FF9A 5E6IC 3WV0A 5JA8B 4HIIA 3UADA 1CL7I 3JT0A 1A3LH 3NK3A 3FN0L 3L4VA 4PREA 2OMBA 5CUSH 3EJYC 5GISH 4U2YA 1TJHL 3BKYH 1HQ4B 4WNQA 3T0WA 3CSFA 5CCGE 2H3XC 3KLQA 4NQDA 4OLVL 2PO6C 1QFUL 5MEQB 4HPHA 4EI0A 4IK7A 1CG9A 3FN9A 2PYEA 3O3BA 5DJXB 4O58L 1MAKA 3WY1A 1T5XA 1XVSA 5C0RH 3QNYA 5GS0D 1H5BC 2CJUH 3A67L 2Z0BA 3GJFH 1NBVH 2ZAHA 5IEKA 1CIDA 2PP7A 2X4TA 5DRNB 3P30L 2Q0ZX 3ATBA 2JI3A 3S37H 4Z7VB 3TIDB 2JQZA 2WVTA 1NOFA 3QFJD 4OZIE 3R7RA 5IBLD 2AQQA 1VPOH 2WO2B 4ZMVA 1EAJA 2GK2A 4LSQL 1BQSA 3NA4A 3TU6A 1MJ7L 1TQCC 2K7QA 4V1DB 1P7QA 4PW9A 4H8PA 1A0QH 3C12A 4E9LA 1MFUA 3T04D 3P4LA 4WJKB 1ETZA 1E6JH 4UQDA 2ALAA 4PG2C 1T3FA 1FGVH 5DLMH 4KO5A 4PJHE 1AIZA 3ARBB 3U0WH 4LCWB 2EKSA 3BHBB 1C7TA 1ET7A 4GAYA 3HCVA 1J8RA 2ETWA 5BRZE 5FC9A 1KOAA 4HMCA 5JOFB 2GTWA 3MOBL 1PZBA 1WJ3A 2H2PD 2C1OA 1OD9A 2ARWA 2V9RA 3LJ3A 4HUKB 4BYHA 3JTSA 3ZGIA 1NSNH 5BPPA 4WEUD 1CLZL 4IBVA 1TSRA 3KPSA 4LHJB 4HIEB 4PJAF 3FUHA 3D0VA 1OCWL 2Y7QA 1IBYA 2CLZA 5FIEA 4Z7NF 4G8AC 5CINH 4LSTL 4G42A 1JP5A 1U8KA 4F7KA 2PN5A 3D30A 5HHMB 5I16B 4RLDA 4KX8A 1FAKT 3CNKA 3OKLA 3C09C 4UTAL 3JV0A 2JELH 4XT1C 2F19H 3CFEA 2F18A 5E8OB 5I0XA 1KTDB 1DVFB 5E2UH 5JXAL 5IFJB 4H88H 2WMPB 4JUTA 4DZBA 3MJ9H 5IM7B 2VLMD 3VTAA 4E9YA 1ZK5A 2A83A 2WIIA 5LHDA 4P2OD 3V0WL 3KLSA 4JNXA 3BCFA 2BSSA 4P57B 3I6LE 1ETA1 2E4FA 3L7FA 4YNYB 1WAEA 4NIKB 4BFNA 5LAXB 5E9AA 1BOGA 3AM8A 5E99H 1G1OA 4NBZB 1KYUA 2BSRB 4EUPH 2L7EA 3MROB 5ACMA 5D2LA 3LH2L 2CDFA 1PZ2A 1QWUA 5GRZA 3S5LA 1FZKA 1XR8B 2J1WA 5C0CA 5DUPL 3HZYA 3DVIA 5LGHL 1TZGH 4M6OH 3TNMA 3BE1L 3L9YA 2C9AA 2GUOB 4N8PA 4JPQA 2OJZL 1W72H 3POCA 1NM4A 4RDQG 2X88A 4TQHA 3TJPA 3WKPA 3QEQD 4X9IA 3AM8C 1H6EA 3GSWB 5HD8D 3F65A 1NJ9A 1AANA 2PCXA 3A3YB 5EPMB 2JWYA 4N2GA 5T1DH 5BZDB 2EDTA 4W81A 4CSZA 5ES4B 5IJVB 4R4NC 3VJ6A 3A6BH 3B5GA 4MJHA 3LZRA 4FD0A 1P84K 1KELH 3LKSB 2ODIA 1B0GA 3U9PH 4PVBA 4MA3A 4FG2A 4KVNH 5T1JA 3GKWH 3QIBB 2N4IA 1BBDL 3OG4B 1G43A 4HH8A 3MLXL 3PWPE 4IKKA 2EIDA 2Y6TE 1GZPA 2WKGA 4JJ5B 1B0RA 4OFYD 5EU6B 3GS7A 4HETA 2R1YB 4IHOA 2Y23A 1J5OH 4EBQH 1EVTC 12E8L 2DWDA 2J1XA 4P99A 5ICXA 3NZSA 3C2SA 3QWOB 3SO5A 2O5ZL 3OB8A 3RPBA 3IFNL 5CMAB 5GRXG 2AJXH 1ZLVH 5SWQB 4GUQA 3T2QA 1AQDA 3TIEB 3V6BR 1VAHA 3WEBA 2E9JA 2X1QA 3QORB 5DZJA 3HPLA 1OARH 2WKOA 3CC5A 5KOMC 3SBRA 4LE8A 3L3OC 3D25A 4EEEA 4ZMAT 1KLGB 2R2HB 4L8DB 4PWIA 1BQRA 4BD4A 4BFIB 2EYSB 3VXQA 2P5EE 1BVNP 1URIA 3VMOA 1FN4B 3DUUB 3QPKA 4WW2B 1UWXH 3DBXB 3X1BA 4AQ1A 1PL3A 4JFUA 4LSUL 3U2SA