1B3IA

Nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (minimized average structure)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
ASVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PROTEIN (PLASTOCYANIN)
publication title NMR solution structure of plastocyanin from the photosynthetic prokaryote, Prochlorothrix hollandica.
pubmed doi rcsb
source organism Prochlorothrix hollandica
total genus 12
structure length 97
sequence length 97
ec nomenclature ec 1.10.99.1: Transferred entry: 7.1.1.6.
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1b3iA00
1HFUA 1M9WA 1BYPA 2TSAA 1PNCA 1SNRA 3CDZB 5B7EA 1AZBA 3IEAA 1N68A 1WA0X 3S3CB 4A2GA 3QPKA 3G5WA 4A2HA 1ASQA 3OMAB 2XU9A 3T71A 1JZGA 3FPYA 2QPEB 3EF4A 2LLNA 4HCGA 1J9QA 1L9RA 4DP9X 2OJ1A 1L9QA 2DYSB 3ERXA 1MG2C 1MDAA 2N0MA 7PAZA 1PCSA 3X1FA 1HAUA 5EHFA 4NAJA 3KW8A 2DWTA 4DP2X 5I6MA 4NB7A 3X1NA 4KO7A 4YL4A 3T6VA 1T5KA 1W6LA 2XX0A 2XVBA 4GYBA 5B1BB 2B3IA 3PXLA 4QKTA 1JZFA 1ASOA 3ZDWA 1V55B 1CUOA 1BYOA 1JZJA 2JFCA 2X87A 3U25A 3WIAA 3IN2A 2IWKA 3FYEB 3T6WA 4FAAB 3GDCA 3TU6A 3NYKA 2VW4A 2CJ3A 5D4HA 4BWUA 1KBVA 2MRYA 1L9TA 4KNSA 3X2QB 4A67A 1ASPA 8PAZA 5F7BA 1OOWA 3NJGA 2BHFA 4UF7C 2PP9A 2H3XC 2IWFA 4FA7B 3TA4D 3FQ2A 4KNUA 5PAZA 3S8GB 3N2JA 2DY2A 2Q5BA 4AZUA 1RZQA 2AFNA 3DTUB 2PCYA 3PLYA 5B3SB 2PPDA 1TKWA 2PLTA 2H47C 4G70B 5AKRA 1GS7A 4E9XA 1XMEB 2MTAA 2OV0A 2HX9A 4EF3A 1WAEA 3NSCA 2FQGA 4DP4X 3V9EA 2UXVA 3FYIB 1JVLA 5A7EA 1JXDA 2W8CA 2WO3B 1NPNA 1TU2A 4WKXA 2ZXWB 1SFDA 3CZUB 3FT0A 2PPFA 2H5UA 3FU7A 1GYCA 3TBBA 4E9YA 2PP7A 2BWDA 3ZX1A 1GY2A 1KGYE 4A2EA 3PAUA 4DPCX 4DPBX 4A68A 4E9TA 3IN0A 2HX8A 5I5MA 3WNIA 2XXGA 3FSVA 2QDWA 3AG4B 3AZUA 1ZIAA 1CYXA 4YSPA 2QPDB 1NTDA 1R1CA 2VSMB 2Y69B 1AAJA 4F7KA 1PZAA 1BQKA 1SF3A 2FJSA 3FU9A 2UXGA 3BQVA 4JHUA 4YSSA 1NIEA 2AZAA 3CG8A 3N55A 1AACA 2FT7A 5I26A 3NSDA 4BWTA 1X9UA 2EINB 2PPEA 2JXMA 2I85A 3NJNA 2FWLB 2CBPA 2W88A 3UAAA 4F2EA 1SJMA 3NP4A 2GHZA 2XX1A 4YSDA 1PMYA 1SFHA 4HALA 1WS8A 4KO9A 1V10A 1NDTA 2XUWA 1E5ZA 4F2FA 1M57B 4N8UA 5I6KA 3SBQA 1PZBA 2FTAA 2PP8A 3WI9A 2CUAA 4YSAA 1AG6A 3T9WA 1HAWA 2YAHA 1DZ0A 4DP1X 2J55A 1OE3A 5I28A 2UX7A 3QJUB 2YAFA 1OV8A 2R7EA 4Q8BA 3QJQB 2RACA 4BK5C 1SHWA 2FNWA 2YAPA 3ABMB 1AS7A 3NJJA 1OCRB 3BVDB 2YQBA 3ZIYA 2GI0A 1KCBA 3X1GA 9PCYA 2VM3A 2IH9A 6PAZA 2GC4C 1BXVA 1SDDB 3OQRA 4MFHA 4YSQA 3CVDA 4JKNA 2BO0A 5B1JC 3QQXA 1A8ZA 1ET5A 1SHXA 2IAAC 5I5IA 2I7OA 5B7MA 1A4CA 1AG0A 1OCOB 3DIVA 3PAVA 3RYMA 3S8FB 2YARA 2BP8A 1IUZA 1E5YA 4A2DA 3FQ1A 2BP0B 3C75A 1JZIA 1GS8A 4HAKA 5I5JA 1DYZA 1J9TA 1FFTB 2EIKB 3NJMA 3DKHA 1A4BA 2I7SA 1J9RA 1BQ5A 1IBZA 2FQDA 1QNIA 4M4RB 1ZDQA 1NIDA 1NZRA 4BDVB 1EZLA 1IC0A 4HCIA 1RZPA 4HIPA 1AS8A 4KO5A 5LDUA 1KDIA 2BW4A 4KOBA 1VLXA 3QJSB 3FSAA 2OCCB 1PLAA 1N70A 3PPSA 4KOCA 1JZEA 4QLWA 4YSUA 3OMNB 2EIMB 1J5CA 4YVNA 4WTQA 1B3IA 4N4YB 3JTBA 1AS6A 4M3HA 2HX7A 1L9PA 2DV6A 1XB6A 4HHGA 1MZZA 1ILUA 4GP8B 3T6XA 4CSPA 3GXUB 2B08A 2PPAA 1W8EA 3WG7B 4HHWA 1BXAA 2IDSA 3ASOB 2HLEB 3NP3A 1JOIA 2IH8A 3UACA 3AY2A 4YSRA 1GY1A 2CAKA 1PLCA 2HRGA 1QHQA 3NJFA 4HCFA 3WKQA 4A66A 5B7FA 2QT6A 5B1JA 1ADWA 3ASNB 3IBOA 1FWXA 2R7EB 1NIFA 1PF3A 1MG3C 2ZWNA 2WO2B 1AZRA 2NRDA 1CC3A 1ZPUA 2AVFA 2GB2A 1WA1X 2P80A 3QJTB 4YSTA 2ZONA 1OE1A 3NJLA 5IY5B 1JXGA 4AKQA 5TK4A 5TK2A 1OE2A 3QJRB 4UANA 4UAHA 4YVUA 1CURA 1NWOA 2Y1AA 3FSWA 4DP0X 2VSKB 1W6WA 1I53A 3FS9A 2XYBA 5ANHA 4P5RA 1BEXA 1TEFA 2UXFA 4G72B 5F7AA 4AX3A 1EHKB 2IDQA 2UXTA 3WKPA 3NT0A 2BP8B 2GIMA 1AQ8A 4W9ZA 5AZUA 5E9NA 1IBYA 1WS7A 3EH4B 5B1KA 3UADA 3KW7A 4E9SA 1JERA 2YXWA 4E9WA 1JXFA 3UAEA 1ZIBA 1CYWA 4AI7A 3MBWB 2J5WA 3WNJA 3ZBMA 1ET8A 1IKOP 1GR7A 3X1BA 2PCFA 3HB3B 5AFAA 4G7SB 5D4IA 1E65A 2XV2A 1A65A 2HRHA 2IDUA 4GP5B 3SQRA 3PAZA 2FT6A 2DYRB 3D12B 2VW6A 2GSMB 1NIAA 2J56A 1JZHA 4KO6A 4DP8X 1GSKA 4L0PB 3UGEA 1PLBA 3SBRA 1XB8A 4A2FA 2GC7C 1NWPA 4YSEA 3FQYA 4GXFA 4Q89A 1UATA 4DP6X 1PZCA 1YLBB 4G7RB 4E9QA 2P80D 2YAMA 3PCYA 3H4HA 3NSFA 2HXAA 5FC9A 4G71B 1AZNA 3FU7B 1A4AA 4DP7X 2XWZA 3UABA 4DPAX 2IDTA 1RKRA 4PCYA 1X9RA 1AIZA 5I6NA 2VMJA 4K9JA 4TXVB 1A3ZA 2CALA 2XV3A 3L45A 4GP4B 3FU8A 1NPJA 2XXFA 1ETJA 2AZUA 2WSDA 2XV0A 4HZ1A 3ABGA 1BXUA 2JKWA 1KDJA 2EIJB 1E30A 2A3TA 1J5DA 1OCZB 3X1EA 1PNDA 1BQRA 3CDZA 3NJHA 4YSCA 1L9OA 1V54B 3GYRA 2FT8A 3JT2A 4GY4A 2BWIA 2BZ7A 2CCWA 4ZK8A 1KV7A 2BW5A 2UX6A 4BWWA 1RCYA 3IE9A 2HZHA 2VW7A 5I6OA 3AG2B 4JHVA 3ABLB 1AOZA 3QJVB 2EILB 2XLLA 2IDFA 1XB3A 2VM4A 3ABKB 3V9CA 1NICA 3OMIB 4RH4A 1KCWA 5I6PA 5D4JA 4G7QB 3SBPA 4DP5X 1OF0A 3EH5B 1M56B 3H4FA 3EHBB 1JVOA 1SDDA 1ID2A 1NINA 1PAZA 3AG1B 4AKPA 1ZDSA 2YAEA 1KYAA 7PCYA 2QDVA 3S3DB 6PCYA 3TBCA 3HEIB 1E67A 3S3BB 1OCCB 4BXVA 1AANA 1AZUA 2BP0A 1KBWA 1AR1B 2J57A 3EH3B 4PAZA 3OD3A 2YAOA 3MX0B 2YXVA 4BXSV 1WA2X 1URIA 2Q9OA 4E9VA 1PY0A 1FA4A 2GBAA 1GW0A 5I6LA 2X88A 4P5SA 2FQEA 1BAWA 3NSYA 5PCYA 4BDVA 1ET7A 3AW5A 3FSZA 5B1AB 3CVBA 2YAQA 1F56A 4W1TA 4E9RA 3NJKA 1L9SA 3H56A 1AZCA 2BZCA 3TASA 3AG3B 4KNTA 4YSOA 4NERA 2E86A 1MZYA 4ENZA 1NIBA 3NJIA 4X4KA 2AANA 1TEGA 3T6ZA 1ZV2A 1QLEB 1J9SA 1GS6X 3FPXA 2PPCA 2TSBA 2VN3A 4AKOA 4CSZA 1SF5A 3CVCA 2DWSA 2ZOOA 2IWEA 2FQFA 3OM3B 1ILSA
chains in the Genus database with same CATH superfamily
4LAQH 2A74B 1ZANH 2ED9A 2VO5A 3FB8A 2R69A 3K7UA 4U7SA 3KXFA 5IJKC 3MV01 2ZUSA 1A7NH 5L6YL 1KEMH 1WA0X 4HOMA 3OSVA 5DCCA 3E1F1 1AQMA 2YJLA 2FEDD 3A6CL 5F89B 1KPUA 1F6FB 5JIHA 3ZW3A 1N5AB 3T4YB 1OARL 2OXGB 4IRSA 4ZQKA 1YQVH 4ETQA 1NC4A 4NWUL 1QOKA 2IIJA 3L9BA 3S96A 4AL8H 2QPEB 4B95C 2YRLA 1T83C 3BSZH 5FECA 3B2MA 1EWHA 4OCWH 4WFFD 3DUUA 1T4WA 4EVNA 4LSQL 1SLVA 4JCWA 4YL4A 1IT9L 5JHMA 4NNYA 4R7DA 2APBA 1OQOA 5CJQL 1CLYH 3N3EA 2X2HA 1CZ8H 3CBKB 1BEYH 4LHUG 5GRJH 1HCZA 1QKZH 4JO2L 1NSNL 5J6HA 3K72B 3KEDA 1OPGH 3U25A 5CJ8A 1IVLA 2PW1B 3BD5A 4LP4A 5FHAL 1YEKH 1SDYA 3MGAA 2YD4A 3C60D 3AU0A 3BSZA 3MJ8B 2VN6A 2FRGP 1BAGA 5F6HI 3SDXE 5D1QE 3SJVB 2P8PB 4WDIB 1BVOA 3QEUA 4HWBL 4IHOA 5C2BL 3VE0A 1MJ7H 2VKWA 4YC2C 3VFMA 2H41A 1DN0B 1CDYA 3TIEB 1MRDL 2OA9A 4MGXA 5IFJA 4JKPH 3PUCA 2WIIA 1I1RA 5JZ7D 4IDLA 4K9EC 4OFQA 4PYHA 4ZOCA 1IAIM 1J7VR 4RVBA 5FGCB 4B3EA 2MTAA 4XB8A 1MW3A 2HX9A 4R2GC 3I9IA 2XRAH 3NN8A 1FPTH 1HZHL 3WN6A 3WTWA 1MREH 1NEZA 3UBFA 4PIRF 3IFOB 3ZTJG 4MDIA 2G60L 2OMWA 4L37A 2XZAL 4L8BB 5AVRB 1EANA 1XEUA 5C7XL 2BNRA 4L05A 2J4WH 1SQMA 2DL2A 3CSPA 4G6FB 5F1IA 3WKYA 3P3TA 1WFOA 4F58L 4TNWK 1FZJB 3UEQA 3QDMA 4LCWA 2AAAA 2VR6A 3B4NA 5L2KA 3ARBB 2WKOF 4L3ED 2VRAA 2LR4A 1OAJA 3BZFA 1OHZA 3QDJD 1JNLH 2FEEI 4X9HA 1MJUH 1HXKA 4OZHB 3ZX1A 5EU7E 4TPRL 2I9TB 3D85B 4MAYD 4A68A 2YUZA 3WIHL 3RGVD 2W92A 2XXGA 4KGLA 4UV7L 5D8JH 2VJ0A 1RIUL 2DBLL 4U1NB 5AAMC 1LP9A 1H9VA 3S5ZA 4XMLL 3TYFB 4YFLI 4ELDA 1CK0L 1ZAGA 2FX8H 4GQZA 5C0EA 1UM5H 3QUML 3RWFB 1AAJA 3P30L 4G9FE 2AJZB 2XY1A 1MCDA 1IQWH 2UY7A 5CS7A 1GRWA 4LOFA 4LB8A 3HC4H 3BPNC 3HZKA 3Q48A 2I85A 4C54A 3W1ZA 1RZJH 2P9RA 1G7JA 4KV5E 1U8JA 1NCJA 4HALA 3IXAA 1MH5B 1TZAA 2A74C 4OI9A 5KW9L 2F8VA 3SGEI 3F6LA 1E5ZA 3A4DA 2L7EA 1SYSA 5C0IB 1JZDC 5CZRA 1G9NC 4L0YA 3QUKB 5EUOA 2G3NA 1VACA 5G55A 1G9ML 4G83A 1N5YH 1OM9A 5KVMC 3CVIH 1AQDA 2WWNA 2VDPH 4OFVA 4U1HB 2Q1EA 4B6ZA 2VDMB 3OG4B 5B4MC 4FFYH 3FQRB 5TDOA 2JCCA 4M1CD 3JWDH 4LT7A 1SBSH 5HVGB 4OJFH 1JSYA 2R2EB 2Z31B 3GNMH 1NBVL 1HSAB 3EYQD 3QFGA 4KMTH 4PJ5A 4ZUVA 5JQ6L 2GAZA 2B15A 3PHAA 4IJ3C 5IHLB 3A23A 3BH9B 1HWWA 4U05A 3ASWA 1KJ2H 2F15A 3B2VL 3WTUA 1HHGB 1KBKA 4ZO6A 2EYSB 2VM3A 1B0GA 4JAMB 3DPBA 4MJIE 2ERJB 2F54D 3DVGA 3OQRA 4MFHA 3RZCD 3FN3A 5HI4D 4X6DB 4O2FB 1A8ZA 1SHXA 3P02A 1TU2B 5J1AA 3GZQA 1UA3A 4PJCF 1N26A 1JWUA 1XGRB 5T3ZH 4A2DA 3FQ1A 3ZOAA 5KBDA 2X10A 2PXYB 4M4PA 5L7XL 4ELMA 1YJDL 2MKWA 4PI0A 1A4BA 3FT2A 3G9AB 1CXKA 4GKOA 3ZT7A 2VLKA 3R1GH 3RWJA 4XBGA 1LO3H 4XT1C 4WW2C 1T21B 1QYGH 1KJ2A 3P4OB 5ICXA 2EAEA 3GXMA 3ESNA 3WV0A 4MQ7B 1YHPA 2A9AA 2DRUA 3C12A 5CLXA 4BDVB 3IDMA 4KJWD 2CLVA 3IFNL 5E2JA 3RA7L 4GINA 1XGUB 2BNQB 1YN6A 3LQZB 1IO4C 3HI5L 4HF5H 3OR7A 1T5XA 1V7NL 5CWSA 4FG2A 5GRXG 4L5FL 3TT3L 3UH8A 4PN6A 4JQIH 4BKTC 1CFNB 3BEWA 5CD3B 1XCXA 1B3IA 5KSBF 4DO5A 1RIHH 4NO3B 5E2WH 5BRZB 1E4WH 2P4AB 4MJ2A 3HZMA 3B3IA 1F4WH 4HYTB 3W5MA 1MIEL 5JORB 2BY2A 4M1DL 3LMJL 3D2UA 1F4YL 5KBPA 2DICA 3UTQA 5H35A 2KKQA 4B60A 5EH1A 5C0GB 1O5PA 2EYRA 3UACA 1W72B 1V3LA 4N3UA 4YSRA 4APXB 2PYEB 1U3HD 3UPRA 1YAZA 4DW2H 4UM9D 4UM8B 3RDTB 1CBVL 4HUXA 4XWGH 2BVOB 1XF4B 4X6CB 3QDGB 1WA1X 2WQRA 1OCWL 1R5IA 2K9FB 1ZWIA 3NJLA 3FN0L 1S7TB 3PJSA 4GG8B 4F15C 3VRJA 1JGLL 2EADA 2QQKH 5FA4B 4IBQA 4YVUA 4U0QB 4OZIA 3VFTB 3TFKD 3UZEC 4QJ3B 3UJJL 3OKDA 1RJLA 2FSDA 2GITA 1E8ZA 2KERA 3G6DL 3HZVA 2DJUA 3IJSA 4MJ6B 3S5LB 3K71A 1OF2A 4TNFA 5CD5C 3CZSA 5EEYA 3F83A 3TVMD 4R7VA 3CC5A 5IV2B 5E94B 1GW6A 2WMPA 2WN3A 3QP3A 4N2BA 1O0VA 3T6QC 3UGUA 5D1ZI 3HVDA 4Z95H 5A2IH 2J21A 3BN9C 2PO6B 2DEYX 3WELA 4RQQB 3UAEA 1ORSB 3O2WH 3NJXA 2QKIA 5EORL 3D06A 1UWGH 1YZZA 1H6EA 4AW7A 1SOQA 1ZLVK 3E7JA 2MNWA 4HC1L 5T1MB 4UDUA 1YPZE 2YFOA 1E4KC 4C4BA 3GRWH 4OGXH 2YSSA 2AXWA 5DO8A 6CGTA 5FO8A 5KVEH 5DEFA 2BDNH 3O6MH 4PFEA 4U2YA 2Z91A 1A1MA 3O9WD 1GSKA 1NGPL 4NN6B 3MX0A 1I8LA 5F7FA 3LEVL 3FCUB 3SGKA 2UY6B 2ERJC 3A67L 4A2FA 1MLCA 3W39A 3BLPX 4PJ7E 3EJTA 4QXUL 2V5SA 3DRQA 1L0QA 4YWGL 3W0WB 4AC4A 1VRSA 1A22B 2P7TA 4JFPB 4E9QA 1XX9C 4TSCL 3VWJA 1VFMA 3LNFA 4YHKH 2V3DA 3BKCH 1QHOA 3FQ4A 4O4YH 1AGBB 3WDHA 4QD2E 1CQYA 5I1HL 2IQAB 5IROA 1MCNA 2PXYC 3BHBA 3RWDA 3GRWA 4B3VA 5AAWA 4M62L 4NI6A 1JV2B 1UYWH 2XV6B 1NMBL 1UD5A 1ZK5A 4GP4B 4K55A 3RTQB 4FTVE 1P2CB 2AXGA 3FT9A 1HOEA 2XV0A 2Y7SA 4AT6A 2DKSA 1IAII 1NGZA 3GSXB 3R4RA 4KKCC 5LJYH 4GG6F 4Q2ZA 5C0BA 3BC9A 3MCLH 1QLFA 3D69B 4FF9A 3LSOA 5GGSA 3U36B 1RUQL 2QADB 1L9OA 4OZ4A 2ZKXA 2KLSA 3BZEA 5I8KH 3OKLB 3IBEA 4NLHA 4W68A 4KK8D 3GYRA 2VZOA 1QSEA 1S7UB 1NQBA 2E6JA 1PKOA 4GIOA 1FH2A 1I3UA 1TZGL 3V5DA 2BWIA 5I74C 4ZFGL 3Q01A 4UQ2A 4PJCE 1J0JA 1LE5A 2GSGB 3VACA 2AXFB 3WDJA 1ZLVH 4ETYA 1GOHA 4K07A 4JHVA 3CLEH 3GI9L 1KXVA 4WEEA 4CKQA 5DMGD 2Y7LA 1TYJA 2JKTM 3GSQB 5I18H 4ZXBD 2VM4A 1JRHH 3FTWA 3HLAA 1NLDL 1UURA 1Q0YH 3AS3A 3K2UL 4RH4A 3T8XB 4I13B 4BZ2H 4MD4A 2EZ0D 3JVGC 3U2SB 1MLBA 2EICA 3VD2A 3KPLB 4TUOB 1DUZA 3BRGC 2ZX9A 3BVNB 2ALWA 1EAPB 4WHTA 4FNTA 1ID2A 2CHWA 3L95A 5IQNA 2NXZC 1PAZA 4WENB 3TCLB 1NGXA 3FFCD 4JFSA 3RDTC 4C83B 1KYAA 7PCYA 5IIEA 3UTPE 3FJTA 5K59F 4NOFA 1RHHB 3HBPA 3OWEA 4OT1L 4CU6A 4FNLL 4HIJA 3EH3B 4PS4H 3OD3A 3AQYA 2VQ1B 2WLYA 2D7TL 4OM0H 4FHKA 2BFVH 4I0PB 2BSTA 4P2QB 3VG0H 3S4SB 2B9AA 2X1PA 4B9CA 3MLZH 3C8DA 1R9FA 3KPSA 4Z0XB 4LDLB 4K8RD 4M3JA 2EACA 4WTWA 3FO9A 4XNQB 4KQ4H 5I16B 3VXRB 1X5XA 2LTQC 2V9RA 4QO1A 5BNXD 4JZNB 4Y4HB 5F88A 1HOCA 4QYOB 1BVLA 3RPIB 4E9RA 3SDAB 2ZICA 4ZO9A 4N2GA 1F11B 2GEEA 5GQBA 3ARGD 4Q9QL 3TASA 3RVXD 1X9LA 1CLVA 5FIEA 2F5AL 1DJSA 1XVSA 2E86A 2BY1A 2G9HB 4GLRH 3LVTA 4TL5A 1AH1A 2B14A 2W9EL 2V7NB 3QXVA 4JRXA 3T6ZA 3ARYA 4GAGH 1QLEB 4PR5A 3RPKA 3C08H 5EOQL 2B0SH 4DO4A 1TTCA 4QRUA 4JM2D 2X4TA 3HPLA 1CI3M 4PJXB 5FYJL 4ZMNA 2VR4A 4WAFA 1QP1A 4X8XA 2Y2TA 4RX4A 4MVBC 5LB1A 4BD4A 1KB3A 3HE6A 1X44A 3IDJB 5H37G 1P5UA 4BUGA 1IC7H 3OVUB 3QIBA 3VXUB 2OQJB 2EDYA 3B8YA 2ZD0A 2C4FT 1OIOA 1VJSA 3C5JA 3FPYA 3V6ZB 3X13A 1KULA 3WLBB 1ZK9A 4J8QA 4MD5B 3H9SE 4OF3A 4FA8A 4UIKL 3CGTA 3TBWB 4I3GA 1S9WA 4H1LH 4KH2A 5HDBF 3ERXA 2ROXA 1T03L 1K8DB 3ZE1F 2R0WL 1EJOH 2BC4B 4K73A 1Q4NX 3QDAA 3B7YA 3ORJA 4U6TA 1N59A 2Z0BA 3N0PB 3UJIH 2CDFB 5K9OB 12E8H 3CZKA 4BFJA 5HVHC 2XA3A 5E8OB 1AQHA 1T89C 2A9ML 2Q87A 5JQIB 4BFRA 3VXSE 1LEIB 2HCZX 4HXBL 2B3IA 1OXYA 2DWDA 1C5BH 1JZFA 2QVFB 3GZOA 4PJGA 4OLZL 2ZAGA 5SWSE 1P1ZB 2M2DA 3QQ9C 1KV3A 4PSRA 1HN1A 1CGUA 2J1KA 1C5CH 3FHAA 1N6UA 1KCKA 1G7IB 1W0WB 2QADC 2E47A 4M7KL 1VADA 4TKWA 4BINA 1RXLA 2ITEA 5DRXB 2IPKB 2LLLA 1CDUA 1LD9B 1FG9C 3NCJL 5AOLA 1C1EH 5IKCB 4XN1A 3RHWK 5J57B 5I6XC 4Z7WA 2OYKA 1L5GB 4NC1C 5PAZA 3OPZH 5FR3A 3CTTA 3MJ9L 4AQZA 2EECA 1UCBL 5IHBA 4K23H 2W0PA 3RX9A 2JJTA 1O6TA 2X44D 3PWPD 5I1IH 3EYVB 3HA0A 4KU1A 3CFDA 3LHPL 1RD6A 2Z6FA 1XT5A 4EE2A 3J27A 4MB5A 3BVVA 5CP3A 4A7UA 1RPUA 3GSNB 1W91A 2HVJB 1KCSH 3QQDA 3O0RL 2ZKHH 2PMZA 4FHBD 3KPNB 4L4VD 1A02N 4YDIH 2VR8A 2ZNXA 1XCTA 3WSQH 4O2CB 1U92A 1DVUA 2ICEC 1H9DA 2E0PA 1Z2KA 4E9YA 2PP7A 4ODWB 1NOAA 3EIFA 1T6VN 1Z9LA 2VDNH 4JDZA 3EO9H 2XETA 5F0MB 4EUPB 1BMZA 4XZUA 5AB2A 4MJ5B 1LO2H 3T0AA 4N28A 4WWKD 3GSVB 4U3HA 5J8OA 5DK2A 5T33H 3IAQA 4GOSA 5JHLA 3G6JE 2Z93B 3CFBB 4Y4HC 4HUVB 1BGXL 2UYLA 3AUWB 4HIEB 5GZNA 1J0KA 5B22A 3RU8H 4Z3FA 1PZAA 4S1QH 3W11C 4W9CC 5D7SL 5I1CL 1HEZA 5DD3H 4L3CB 1BBJA 5JQHC 4OVVA 3BAEL 3V8OA 1DQLL 3KR3L 5BMFH 3WDIA 5CZXD 2WXIA 2ADJB 3NH7L 3QBTB 2Y7QA 2V7HA 1A6ZB 3S3PA 4TTGA 1DO6A 2E7LC 4OF0A 4HJEA 1XL4A 4QOKA 1NDTA 1DEEB 1IEBA 2VO8A 4UQ3A 3PL6A 4XP4L 3ECUA 2BVUA 3BPCB 3V5KA 2SEBB 3WY4A 1DZ0A 1CCZA 3HPJA 2YEZA 4H4NA 3J2PA 1EEYB 1S3KH 3DOHA 4KC3B 5I75B 3S35L 3QHFH 5JXAL 5KOMC 4PUBH 3H0TB 1BJ1H 4ZTOL 1R3KA 4DGIL 1HL8A 5J13B 3D4YA 3ARSA 4N2MA 3FFDA 3DA0A 1SHWA 2ZOUA 4JRYB 1QQDB 1M2VB 5D1XA 2OK0L 3GZKA 3D4ZA 3LZFL 4NJ9H 4L9LB 4OY9A 3D1MC 4XAKD 4BKLB 1KYUA 4F80A 1FRGH 1N8ZB 3Q2WA 4XOBA 1T1WB 5HDRA 4JFEE 5I82A 4DVRL 1HHKA 3MV9E 4FMFA 3BYTA 2ZYRA 5F21B 4YSQA 1XSJA 2Z8SA 2BO0A 3O81A 3OLGA 4DOHB 2YK1H 1UZ8A 1ZT4B 2YQ2A 3P11H 4KXCA 4E68A 5DC2A 5D1ZB 3DIVA 4D3CL 3GI8H 3CN1A 3DETC 3FCTA 4LPXA 1RU9H 2JI2A 3C75A 3GFUA 1JZIA 4MZRA 4N1CA 1I8MA 1SMOA 5CJOH 1MOEA 2AJYL 1EBAA 4Y9BA 3N85L 3CZLA 4UUJA 5C0AE 3TNMB 1C9SA 2G75B 3HRPA 2B8OT 3STZA 3V6OE 2WVSA 4Z18A 1U8LA 2EH7H 1ITCA 2CO6B 3PQYB 2DQFB 4KI5E 1YEWA 2I32A 1UGKA 3H42H 3LHAA 3PJNA 2WCSA 4Y1AA 3P69A 4RWYL 1CGVA 1OD9A 2OXHB 1P7QA 2KQNA 2JB6A 1NC2B 1G7QA 4O51A 3DX6B 3WE6A 4WWID 1G0YR 3ZTJH 5IJKA 4PJEB 2K0RA 1IZKA 2DDQH 3VU2A 3A5VA 2HT2C 2P49B 4NQCE 3AGVA 1MY5A 4PW9A 3UP1A 1HL5A 1UKQA 3DXAE 1OY3B 4H0GA 2HUEA 3GSRA 1JPSH 3CFMA 1AS6A 4K3HA 3MLSL 5IR1B 5FKPA 2A4ZA 2NY5C 4MBRA 3MLVL 1CE1H 5AW4B 1FLRL 2XN9B 1ILUA 2X4OA 3KHQA 4F7CA 3LPOA 2VH5L 3JWOC 4YHNB 3RL1A 4Z7NE 4IRJC 3SE9L 3WG7B 4NO2B 4LLMA 3HHMA 1XGTB 2YMXL 2J3SA 3O6FA 4RGND 4S2SB 3Q1SL 3M7FB 3UTTB 4NN5B 1GY1A 5F0LB 4D9QE 3BZ4A 4PRBA 3G5ZB 3DC0A 1AKJD 3L1FA 4HCFA 5CU9A 3WKQA 1P9MC 5AENA 3LZQA 4AEIL 2L8AA 4QRAA 4U1IA 3O3EB 2YBRA 1KTBA 2FECI 3NUKA 2CWRA 2FX9L 3LN5A 4K9EH 1QSFD 4C56D 5ISZD 2TAAA 3GMLB 4GRWB 2ICWI 3TESA 2H6OA 2Q7AA 4MQTB 4DUVA 4WK4B 3NFNB 3KPRD 4KRPD 5IBTL 3D52A 3RAJL 4NKIL 1OP3K 5FGBA 1Z6JT 1KCUL 2RHEA 3QUXA 1YRKA 3DDFA 1EO7A 1R75A 5ANHA 2ZCHL 4TL4A 1TEFA 2JIXA 1S8DA 5GGTL 2ESVD 1UM4H 1A9EA 3TXAA 4HOZA 2FJHA 4MWFA 3TWYA 3INOA 4BELD 1OAYL 2H2PD 1JPST 2BP8B 3NT0A 4M3KB 5L8KB 3D34A 4G6MH 3UTSD 4PRPE 5AZUA 1OP5H 2HFTA 1J87A 3QXTA 4ALAC 1ACXA 2WCPA 1CT8B 3O45B 2I9LA 3VD3A 1JXFA 4ZUWB 4G1MA 4QXGL 4UAOC 4AV5A 1MDTA 4WU7A 1JGEB 1DSFL 1J48A 3DYMA 1E4XL 4NX0A 1HH6A 5CZVH 5J13C 2NQCA 1YNTF 4P46D 5KS9E 4HJIA 5ENWB 1EZUA 1G9NL 1VZGA 2GSIA 3HMXH 4OLEA 2HJKB 5CHNB 3BP6B 2R2BA 2FGWL 4L9LC 3OZ9H 1FE8H 1U8CB 2YFNA 4M7JH 2XWJB 4IBYA 1E9QA 1UCTA 5E2VL 3MPCA 1I1CA 5DK3A 3FB6B 3WTTA 5F2FA 1YLBB 2XXCB 4I2XE 4UZSA 5IVZA 1QSVA 5D1ZC 2J71A 1UJ3B 3Q3GB 4WCYH 2APVA 4J3SA 5AVWB 3MRPB 4N2NA 3VFUA 4L4TB 1E6JH 2A6KA 5DO2D 3IU3B 3I50L 3GUFA 1PD6A 4J3OC 5TGBB 4HUMB 1MAKA 2IFGA 3REWA 3UMTA 4DGVH 5LQBL 5T5NF 3VXPA 4L1DA 4N6QA 2EE3A 2BX5A 2XKNA 4HJ0C 3UO1H 3HMXA 2J88L 5K9JL 4G8EB 4LSVL 1OP3H 4PREB 4OFYD 1ZGLA 1N7MH 1XTMA 3T04D 2DLTA 4QLRA 5DMIL 2CA3A 5DJDA 3BUQA 1NL0L 3B9KD 3SCMD 4KJQD 1E28B 4Z1PA 4J3BA 5D1QD 4JMXA 4LVOB 1J05B 4LMQI 2CO4A 3GMOB 3QNZB 1V54B 2Q2LA 5E2TH 1RUPH 5F89A 4YPJA 1NFDE 5DQDL 5D9SA 1N5AA 2F53B 3IAPA 1WBZA 2UX6A 3G9VA 4HSAC 4KTDL 1CL7L 1M3IA 1OAKL 1PY4A 3NDZE 4MD0A 3A0OA 4E5XB 4M56A 1J5OL 1NICA 2CIIB 3OMIB 2IGFL 3K5RA 3GMRA 4J3OG 3CDGB 1WIUA 2KC0A 4KKLD 3GXTA 2YHGA 4CDGC 1F41A 1IB5A 1MFAH 2NY6C 3SQBA 3V4UH 4FYTA 1KJVB 4GT0A 3W3BA 3QJXA 3EZJB 2NNFA 3AG1B 2KZKA 2QGEA 5FFLA 3S3DB 3D30A 3LNDA 4HIQA 3L7EB 1TJHH 3ZDXF 2EDDA 5D7LB 1E67A 3PP4H 2OULB 4RFEB 2OL3B 4X9GA 3S3BB 5AAPA 4UMGA 5JUEH 3K72A 1TUPA 2F8XC 1C8PA 5A3IC 4RGOL 4EOWL 2OW7A 2PW1A 4IKJA 4N8VB 4MA8L 2EXTA 3VRIB 3MJ8A 5A2LH 1ZXKA 4HK0A 1CDIA 3HE7D 3SJVA 2P8PA 3C5ZB 4WDIA 5KVEE 2GJRA 3OXSB 2X4RB 3LRLA 3MOQA 3QR1A 3KCPB 1JHTB 1DN0A 4G9FD 1UVQB 4QHUA 1Y1DA 3FSZA 5FO9B 1J0HA 1L6PA 3WKNA 3ZL1A 2ODHA 1F56A 2F18A 4IGBD 3HCVB 4LSSL 3NIDB 1FV1B 1NOFA 3VI3E 1AYOA 4TMPA 2XTJC 1HHJB 3FQUA 2J44A 2A73B 5TF1H 1QBAA 3FW6A 3IFOA 1I3GH 4QRRE 1ZT1B 3O3AB 2ZOOA 1FVEB 4GQQA 1S9KC 3AAZB 3MA9L 2WKGA 4LOUC 1FO0B 4CU8A 1PNCA 2Y25A 1R4XA 2ZOLB 5JPMA 4W9JC 1FZJA 1THAA 4K3GA 3VQ2C 4FYSA 4HKXB 3ARBA 3L3KA 4PJ8D 4UZUA 4RIRB 4NO0B 1BMGA 2LOEA 4CN6A 1F5WA 2VITB 2X4UB 4ANKA 2IBBA 2OYPA 4I5BB 5IEKB 3CFJB 2CZNA 5JLZB 1WFIA 2I9TA 2AK1H 2VE6B 2EABA 3ZL4H 2BXZA 1EUUA 4QJ5B 3VWKB 1Y0LA 4TM9A 4LEEA 2BVPB 3QYMA 3O4LD 3QCVL 4ZS6C 2V5YA 5EWIH 2X38A 5CILL 3FOLB 4DCQB 4R3SB 4V2CB 2EQDA 4AYFB 4LPUA 4B9GA 1U8OB 1KMGA 3T0WA 3RWFA 2VDMH 1XAUA 5ICZB 3VFNA 2BVYA 3GHBL 2ZX7A 3VW3L 2RMNA 4HEPG 3EJSA 1RJCA 4OZGF 3RX5A 3T6VA 4G7YH 4OCMC 4ZAKC 3PXLA 3QEGH 1EIBA 4JVUA 3KLDA 1MH5A 2H8PA 2QSCL 3ARXA 3EOBB 5E00B 1DANU 1F4XH 3VI4B 4S1RH 4OCRL 5DFVD 5C0IA 4LVOC 3T2NH 4B0MM 4F92B 3QUKA 4PRDB 4TS6A 4EBQH 4J8RB 3VTAA 1B0RB 4U0RB 2VMDA 3C5SA 1IX2A 5E4AA 1NEUA 3HBZA 4PQXA 4A67A 1ASPA 2CR3A 2Y6SC 3M86A 4J7RA 4NRXA 5JDSB 2F8IA 3KL0A 3HZYB 3NQKA 4NQXB 2OMTB 3TA4D 5LHDA 2R2EA 2Z31A 3QEHB 1HSAA 4B7IA 3DTUB 1WUNT 2B5IB 4N20A 4NUJA 3ZO9A 3TEWA 2D0FA 3BH9A 1S5IL 4YX2H 1FGNH 5BV7B 3ZHNA 2OI9C 2BZDA 1HHGA 4ODVL 4E9XA 2EYSA 3QCTH 4JAMA 4XP6L 3UEZA 4LSRL 3EF7A 4G59C 3V9EA 3D9AL 1P7KB 3QWQB 4FCAA 3APCA 3EJYC 4K7PX 4X6DA 4O2FA 3L5XL 2GW5A 1TU2A 5JPNB 3ECBA 1KTDA 3O8XC 5ADPL 4V1DE 3WN5B 1XGRA 5IK3B 4Z3GA 2H5UA 1PDKB 1I9RH 3FU7A 4HEMA 2IPTH 4LL1A 1L9NA 3LZPA 2CGYA 3CFUA 3QJHB 3FO1B 3P0VH 4BFEA 4HS3B 4NXKA 1W8NA 4CGUB 3F84A 4QNPE 1OB0A 2JB5L 1YEIL 3C5ZC 1T7WA 3JV4B 4ZW5A 1T21A 2NMSA 1ADQL 4MQ7A 1HVXA 1IM9B 3AZUA 4OLVL 3LTVA 3ZR6A 1FN4A 3PNWB 3MLYL 1W72H 2IANE 1XGUA 1A6AB 1H8SA 2BNQA 4QRPD 5EIIB 3LQZA 4B9IA 2NYKA 5BO1L 4QTIH 4GJTB 3MQIA 4PJIE 2DQJH 4FZEH 1BQKA 1HHHB 1SF3A 5GRVL 4PJBB 2WZ0A 3KPMA 2NYYC 3KPPB 3V0FA 4RGMC 5I1GL 5D72H 1M71B 2AAVA 1RFDH 5FYJE 4NIYE 5DJ0B 1A6UL 4LCCB 4MAYB 3L4XA 5AVYB 4H8WH 3RGVB 1MVYA 4OD3L 4XX5A 1MELA 4YGVB 1M57B 3HC3L 5GJTH 3SBQA 1PZBA 1QNZH 3MRCB 5IF0A 4MNGB 4N8VG 5C0GA 5LG1A 1JFHA 1W72A 3HMWH 3SDCD 1SOKA 3LCYA 3TNNA 4APXA 1V3JA 5LBSL 5H2BB 2G4GA 4LLVB 3RWHB 1N8OE 4UIMB 3TJHD 3VGHA 3CPUA 5CUSL 4H8VA 1EQWA 2KS0A 2NSQA 4P5TA 4RA3A 3F62A 4F9PC 4UQDA 1A6VL 1XF4A 1JL8A 1XF5A 2OMXB 3QDGA 1HCVA 4X6CA 5C6TL 4UZGA 1S7VB 3PXJA 3U1SL 3NJJA 3QZOA 3P73B 2X6VA 1S7TA 4GG8A 2GI0A 3FUDA 4LK4A 3QQ3A 1V7ML 4GSQA 3AROA 3GBMH 3QUYB 3VFTA 5E4IA 1NFIA 1CXFA 3S5LA 3VTMA 1VGKB 4MJ6A 1WCBB 3CVDA 4UNIA 3T3PF 1PSKL 3N1FC 3ZT6A 4UV4L 2DAVA 4ZNCD 4P8QA 5IV2A 2VDRB 1QAWA 5E94A 2YARA 4N24A 1WZKA 3HR5A 4N25A 5AW0B 1E6OL 1Q9KB 4MYPA 5IFAH 1EUTA 1WSST 2O5YL 1W0YT 1NAMB 1CLZH 2PO6A 3KYKL 3CX2A 5C0CB 3K80A 1CN4A 2ZCKH 4ERSL 1ORSA 4S0SD 5J7CC 4MA1C 3NK3A 3X3GH 5HHME 1SN0A 2G3MA 4LVNB 3RX8A 1PKQE 4ZI8A 4XRCB 3NIFB 4Q4IA 4KKBD 1SMDA 1DQKA 5T1MA 2ARWA 3A21A 4AK1A 1AS8A 4NUGL 3WJLC 1ZVNA 5BV7C 4FLOA 1TJIL 4MX7A 2IAMD 3HG3A 2PYFB 4TV3A 3FSAA 2UY6A 5IVXE 5F8RC 4H8HA 1JZEA 4J28A 3WEOA 3QIUD 4YSUA 4GRLA 2EVIA 4MSWB 5HHOD 3LRSB 1B6DA 4QAMB 2EXYD 4JFPA 5T3XH 3ES6B 3WNPA 5JPNC 5C7ZA 3VX1A 1AGBA 3WN5C 3WNNA 1QASA 5FKAA 2IQAA 3ULSB 4TQEH 3T8MA 4DQOL 5KVFH 4AG4H 3BVXA 3O6KL 4ZUTB 5EFIB 4TLTA 3TLRA 1JV2A 5BXFA 4WJ5A 3ELAT 3UTPD 1E50A 3TH4T 2AV7A 5HHXL 1I1FB 1T89A 5B7FA 5CJBA 3RTQA 3D3VE 1P2CA 5F1OB 3OTTA 4IHBA 4X6EA 1MHPH 1DN2A 5LUMA 2I69A 2WO2B 3BAWA 2AEPL 3GSXA 3WNMA 2AVFA 3ETBF 3I9PA 4LGPB 5HDQH 4DIXA 1GGBH 3D69A 4KVCH 3U36A 3EFDH 4ZD3H 3QJRB 2HN7B 5AZEL 3QSKB 3OKLA 1AHMA 3L4TA 4GXVL 4JPWH 4PJAB 3ZDZE 3T3MF 1D7CA 4R26L 4XMXA 4PWHA 1S7UA 5F96H 3WIFB 4F37K 1JWMB 3LS5H 1OQXA 4XVTL 2HPTA 2XYBA 1AQKH 4LCCC 5L0QC 2CMRH 3R0NA 5F7AA 2GSGA 4IOFD 2AXFA 4XPBL 3DURB 3P2DA 4AL8L 4KUZL 4Q97A 4DH2A 4AGLA 3GSQA 3VQ1C 1N6QL 4Q9RH 3BCDA 3RWGB 1K8IB 5DDHB 2JI3A 2P5WB 3LEYL 2CRMA 3W2DH 1SY6L 4ZNEA 4R8WL 1MFCL 3U2SA 3IM1A 3FQXB 4TUOA 3SKOA 3BVNA 2R29H 1XF3B 1EAPA 3MUGB 3TCLA 3TJEH 3X1BA 5D2NC 4J6RL 3Q8AA 5CJXC 1O7DC 2YD7A 5I0ZA 1CFVL 3V7MA 4Z78B 4HW6A 3RVWC 5LO7A 1RHHA 5DJCB 1FYTD 1KGIA 4IU3B 3QK0A 1TKWB 1AXIB 1HKLL 1QLEH 3UGEA 2VQ1A 1PBYA 4I0PA 4Y8AA 1E4JA 3S4SA 5JA8B 1JYNA 3IJHB 3K0WA 3P4LA 3EBIA 3S37L 1QRNA 2YAMA 1TQWA 4Z0XA 4HOXA 2R29A 4XNQA 3ZJAA 5I16A 3KL3A 3GB7B 3MXVH 4MXQD 4KQ0A 1I9IH 2ZCLL 3MRIB 4JZNA 2EIBA 4FJYA 4QYOA 2VZVA 4FRWA 1A4AA 3MBED 3SDAA 5KSUA 3RFRA 3STLB 1F11A 1YMMD 4GO8A 3SDYL 3N44F 1PS3A 3QPQD 4DK5A 4A55A 2G9HA 2WQUA 4LVNC 4PLKD 1OPOA 5D7JD 2XV3A 1KWGA 3QULB 4TNVK 1NPJA 4FA6A 1BG9A 1N0XL 1NCDL 2F7QA 3C9NA 4DZBB 1FNEB 4PJHB 3K81A 2JKWA 4XBEH 4UTBL 1M6OB 2DBJA 4PJXA 4M7LH 3FRUB 3EO1A 3OXRB 3FF7A 3PJLA 3BO8A 4R90L 4Z0BH 4DN4L 4ODTH 3JT2A 4LSUL 3IDJA 3S98A 4XPAL 2J73A 4FNSA 4BSWB 2E8YA 4WGVB 1WAPA 5TPWL 3CV5A 1KV7A 3VXUA 4KXAA 2OQJA 4Q6IB 5I1DA 5GHWL 1K5NB 3WLBA 2DJ4A 3H2QA 4JRFA 1TOXA 2R4RL 1VCBC 3LNHA 3KXFD 4MD5A 5BQ7B 3ULVL 3IXTA 4JJOA 3N1PC 3TBWA 2QQLH 5I6PA 1K8DA 2YOCA 2ITCB 2BC4A 5HJDA 1YUHB 4PVBA 4HXAL 2ZUUA 2KHAA 3IRZA 2X2UA 1MNUH 1CGXA 3H4FA 4IRSD 4HG4J 5K9OA 1NC4D 1A7QH 1DJHA 1LXMA 5E8OA 3S88L 1YUKB 4PLJC 3VG9C 1SYVB 3JWOL 1YO4A 5AB0A 5FYJU 1RK0B 1DFBL 1DP0A 2Q3ZA 5TE7L 4JO8A 1OANA 5HYSB 4G8AC 5AB9A 1QBML 1G7IA 4KTEH 4N1EA 1YEGL 3QS3A 4O58L 3GSNH 1X5KA 4KKQA 2YXVA 4M7LT 4O2EB 1MI5E 1SJEA 3ARDD 2I26N 1MAJA 2UUDK 3OAYK 2IPKA 5DRXA 2NY5H 2Q9OA 1KB9J 4PJDB 4J23A 3UC2A 4E9VA 1LD9A 2WQWA 4JFHD 1IL1B 5IOPB 4OU3A 2YC1B 5IKCA 3FTSA 4P5SA 4NAQA 1AJ7L 3M1BB 4PRIB 3L1GA 4AQAB 1D9KB 4WV1C 1DUYB 2ZG2A 4JUSA 4PY8I 4ZSOA 4ZW3A 3HIZA 4EUPH 1AY1L 2ZWSA 4GBXD 4OZFB 1OGAA 4K7PY 4CMMB 4AMWA 1BF5A 3H56A 3EYVA 3U7WH 4BH8B 1V27A 1CF8L 3NOIA 1PG7X 4Z7VB 3NJIA 3AQZA 1QMUA 1TCMA 3BN3B 1E8XA 4JG0H 2XSKA 3GSNA 5BS0D 2HVJA 2DWSA 2FUQA 4WJG3 1BQSA 3MRDB 5I66B 4WKZA 1SZNA 3PHOA 5TH2B 3ZSTA 4U1SB 4LRNH 4KFMA 5ILTH 4XBPA 4O2CA 1VCAA 1OAZL 1DO5A 3IU4L 3U0WL 2F68X 4JW3A 4XE5B 3K0YA 1DBBH 3Q6GH 1XSOA 1Z32X 1GAFL 4EUPA 2B4CC 1DFXA 2Z34A 4MJ5A 4W70A 3DX4A 2BNRD 4DQAA 3GSVA 3RGBA 4JREB 4ALAH 2LV4A 3BLKA 1P4BH 1OB1B 5E23A 4AYDC 1PZ2A 3NCYS 2R56L 3SEPA 1T1ZB 2Z7UA 3BE1L 4LCWD 4HUVA 5L2KD 2DYSB 2WUCL 5JW3H 2YIHA 3MV9D 3NAAL 3VMNA 2AS5M 2WOYA 1CR9H 3QCUL 1HAUA 4W9IC 3R7RA 3V5HB 2DWTA 4DP2X 2J6WA 4L3CA 4NKMB 4MLSA 1Q94A 2UUDH 1F18A 2YQGA 3MLTB 3OAYH 4LU5L 2JSFA 4KMQA 2ADJA 2D7PA 4ONFL 4XVJH 3DLQR 4YLQT 1A6ZA 1ASOA 3FK3A 5D7EA 1GYVA 3QHZH 2C9XA 1KCVH 2RQEA 2JFCA 2KH2B 2ZKMX 1G87A 1DEEA 3D48R 2ED6A 3H3PH 3NABH 4XTRD 3C6SB 4FAAB 3MRJB 3BPCA 3GDCA 1J5IA 2G5BA 4WO4D 3CLFL 3SQOL 2SEBA 4BWUA 3BWUC 1RMFH 2P3YA 3FO0H 4HV8B 4WFGD 4G3YL 4UTAL 4EKJA 4IBSA 5I15L 2P26A 4WI2A 5FGCE 3KBPA 4OGAC 5F7BA 1RZFL 4Q6IC 2NY3D 5HXMA 1PG7W 4XB7A 4Y9GA 4FI7A 3FQ2A 1NBYB 3LN9A 1SOSA 1Q90A 3CVHL 5ID0B 4BBWA 4OI8A 4JRYA 3VGDA 1UOLA 1QQDA 3DROB 3ZRFC 1M2VA 1RUAH 1EO8L 2VDQB 3W82A 2XFXA 5B39B 2GIXA 4L9LA 1TZOA 4BKLA 1N8ZA 2P8LB 2KT6A 2OR9L 1T1WA 1KCLA 1KF9B 2AXHA 3B2XA 2R1YB 2ZF9A 2UXVA 2V4LA 3SE4C 5J3HD 4PJ9D 4POZC 1ZT4A 4YZFF 5DZVA 4RRPA 4PJ5D 4DVBB 3APDA 5EBMB 4WI8A 1UD2A 5DEZA 3B3BA 2Z65C 2VRQA 3FTUA 1YYLH 4D9QD 4TF4A 1X6LA 1IAIL 2I25N 3VFRB 2A6DB 4BGLA 2BWDA 2E9BA 4TSAH 3TNMA 2G75A 3MYJB 4DPCX 1X5MA 4HIHA 3G5YA 5C8JA 2C9SA 2DM2A 3IN0A 3KDMA 2R0KH 2CO6A 4XPHH 3PQYA 3QZPA 2DQFA 3WNIA 5KBNC 3T0EA 1CYXA 3VFWB 2DIAA 2WC7A 5GGVL 3DX6A 4QHMB 3U6RB 1IC4H 4L29A 1A3LL 2R8SH 3FU9A 3ZKMC 1TQCB 4M9OA 1Q72H 3SE8L 3CG8A 1SEBB 1Z66A 2ICCA 3MRMB 15C8H 2OMYB 3EJJX 4AIZB 3ZDYE 3LZLA 5GS1A 2EDBA 4K2UH 1T0PB 4GRWH 4XNBA 1EAJA 2WUBL 4JY5H 2ODIA 4FQIL 1T1XB 4U4IA 5FLVA 4KK5C 2XN9A 2P24B 2NY2B 4U6VH 2VT0A 1B2WL 4YHNA 5INCA 2LW3A 4NO2A 5T3ZD 2UWEB 4J5VA 5JR1H 3JUZA 4S2SA 2VN4A 4JDTH 4W4NA 2J55A 2VQ4A 2ZOTA 4IKIA 1BV8A 1A25A 3TGXA 2KPNA 2BM3A 3CQQA 4JREC 4EZMA 1WAAA 4TSBL 4G8IA 4KGJA 5DLLA 2NSMA 4BK5C 5E9AA 2DW5A 5A6MA 4GKLA 4LCIH 5IFHH 4DUWA 5CINL 2K70A 1KCBA 3CBJB 3NFNA 3U30C 5HVFB 5I0DA 4P4KC 4WNJA 2WQVA 4IDJH 3SD5A 3KMDA 3UL4A 2NDGA 4FLSA 3WKMH 5IB5B 5ESVA 1MCWM 4HUWA 3OB0K 5G4NA 4BQCA 4X5XA 2G2NA 4I77H 4M43H 2Y5EA 3DI3B 2BP8A 2AI0H 2AK4B 2HVBA 2J1YA 4R9HA 2O93L 5ES4B 3W57A 5LDSA 3OGCB 3CXDL 4UINH 2ZXQA 5I5JA 4L2YA 1CT8A 3F3HA 3O45A 2EIKB 3GBNH 4ZUWA 3HS0B 2DM3A 4WZ9A 1IBZA 3N1MC 5LNEA 1BM3L 4JG1L 1JGEA 2WTRB 2YGVA 3R19A 5F44A 5ENWA 3DK0A 4NQTA 1JTPA 4X0NA 2HJKA 2OR7A 3C8KB 5CHNA 3VSQA 1IC5H 2KMWA 3PGCA 4PU2A 3BQUD 1HILB 1KLFB 1U8CA 2X3AA 3CHXA 2XWJA 4EDWL 1DVFB 1ZT7B 3MCG1 4NZTH 4YVNA 3FB6A 4J4PA 3ZKSD 2EUVA 3CFCH 3DOSB 5FYLL 3EAKA 3QEQD 1L9PA 2R2HB 1UJ3A 2ZJSH 3Q3GA 4JB9L 3RX7A 4KX8A 1CD1A 3MRPA 4XN2A 5E99H 4L4TA 1CS6A 3IU3A 4HIXL 5TGBA 3SOTA 3V4VB 4UT6H 5C92A 1JG9A 4CBZA 1ED3A 3LH8A 3NPZB 3FUMA 4KKAC 4LLAA 4MNQE 2OSYA 1WFNA 4G8EA 3OLDA 1M7IB 3PABB 3ZKXB 5FDWA 3D6GA 3VWJD 1RJZB 4O02L 3BAXA 5B1JA 3NCEB 4OJDH 4XCNB 5AW1B 1GA2A 3SY6A 3OB0H 2BOCB 3PGDA 3MOAL 2NRDA 2WYTA 4LDOB 3QJTB 2VLJB 3TV3H 1B4LA 3NIGB 5FA3A 2MWCA 4C57C 5EF3A 2C8NA 4M5YH 4YFLF 1TQCC 1J05A 3P54A 1KXQE 3QNZA 5ELIA 4QEGA 5BZDB 4UBDD 1DJXA 4G7VH 3VSVA 3ILDA 4GS7B 4Y1SA 2OL3H 4BHUI 4JLRB 4UT6A 4AENB 2F53A 1MCBA 4JQXA 1BQHG 4G72B 1O6SA 1GGCH 3PPEA 4ZYKB 4E5XA 3I9GL 5C0BD 2FO4B 4F1ZA 1C08B 2GJJA 2XWCA 2NY2C 4KAQL 2EXSA 5L9DL 2NR6D 4W9ZA 3IPBA 2CIIA 1QSFB 2G30A 2HH0H 4LLWB 5ISZB 2KUTA 3CDGA 3GO1H 1REIA 5I1EH 3EYUL 1AO7B 5GS0C 2MOVA 1UXLA 4NHCH 4E9SA 1JERA 4K94C 1LP9F 4G5ZL 4PRHB 3PGFH 1KJVA 4XCCL 3DX8B 1FSKC 2DIEA 3K1KC 4GIPD 2Y1YA 3LKSA 2F58H 4QKXB 2Y36L 1IJ9A 4G7SB 3VXTA 4CNIB 5D7LA 4RFEA 3N1QC 2OL3A 2FATH 5IG7B 4ZTPL 2MQ3A 1EGJH 1UEMA 3HOGA 2P28B 4NZUH 1QR1B 2F5BL 2W0LA 5EBGA 5A7BA 4WFHD 1YEHH 1P4LB 4HPYL 2J12B 2XBZA 3VRIA 4Q52A 1HINH 1VEOA 3OHXC 4QHKI 1KB5L 2AQPA 1AIFB 4WI7A 1QZNA 2H2SD 4KKZA 1BVZA 1FO0H 3BGAA 4CGTA 2NNXA 3OXSA 5EUOF 5FW8A 2P80D 2X4RA 3B1TA 2F8OA 3KCPA 2XJKA 3ULVF 2NY4D 1JHTA 4JQVA 2HXAA 3MRKB 4ZO8A 1M1XB 2VSCA 1AZNA 3ARWA 2QVMA 5DHYB 2OJZH 2JCCF 3HCVA 2HPOA 3JBG7 1FV1A 3EDDA 4HWEL 1EGJA 3IFLH 5E8NB 4M03A 5JHLL 1HHJA 2A73A 3TS8A 3I6LD 5AWNL 1GKEA 4GFTB 5E8DH 4MB3A 1AHWC 4PTTB 3WMQA 2IPUK 1ZT1A 4KHTH 1ETJA 4HZ1A 4UYQA 1LILA 1FVEA 2V9QA 1T5WB 1TG8A 3A47A 3AAZA 3LKOA 3FQWB 1U3ZA 1O9VA 2ZOLA 4NC1E 2XYCA 5IWLC 5AVUB 3NJHA 2AJVH 1IFRA 3QZMA 2X6AA 4HKXA 3AREA 4RIRA 3NRFA 4NO0A 4S1DC 3K6NA 2C34A 4TVUA 3T77B 2FT8A 2VITA 2X4UA 1DVFC 4I5BA 5IEKA 3CFJA 5CCKL 5JLZA 4DSYA 3Q05A 4FQ1H 2HFFB 1KYOJ 1JI2A 4BZ1L 4GUOA 4ELMF 3RFZB 3ABLB 1AOZA 3VWKA 4APQB 2BVPA 1K6QH 2L04A 3Q8CA 2DL9A 2FB4L 4NM8L 3FOLA 4TNWF 5FM5M 3WJJC 4M5ZH 4R3SA 4AYFA 4DCQA 5F97E 1U8OA 5E5MB 3SCMB 5C09E 3SDXB 1ZSDB 2ADFL 5D1QB 4Z7OF 3ARQA 3KLAB 2WXLA 3CX5J 1G0XA 3QIBD 4AZ8A 5FFGA 1ANUA 3ZKXC 2ATAA 4HJJL 2RFXB 2AJSH 1IJNA 4Y89A 2NY0D 1T22A 1PL3A 4XMPL 1CU4L 5BV7H 1ZTXL 3LKQB 3EOBA 1GVIA 5E00A 4OB5H 3LPGA 3VI4A 1FIGL 1JE6A 3HZ3A 3MTRA 1XH1A 1M1SA 4PRDA 4CSTA 3S36H 4J8RA 1AC0A 3FUHA 3LQAL 4AC2A 4P9MH 4Z8FH 1I7UB 3D39E 5TD4A 1I1AB 4M6NL 5ICYB 2D03L 4JM0A 4IIZA 1DSWA 5JDSA 1C5DB 5A40E 3HZYA 4NQXA 1ZA3B 5HYJB 2BS8A 4EKXA 5K1NA 1JHLH 3QEHA 4FI6A 3CVBA 2P44B 5EG6C 3IFPB 3AQDA 4NN7C 1KNOB 1MCPL 1AZCA 1LL1A 4RFNC 2A9NH 4F33B 1NIBA 3C60A 3HHSB 4NZRL 4FZ8L 2WGXA 2AANA 1H0DB 1BIIB 1P7KA 1ZV2A 1GS6X 1FBIL 2EUZA 3KPOB 1MWOA 4OZIF 4XPTH 2V37A 1LO5B 2FQFA 2ATKB 5JPNA 1AR2A 5E6IC 5JNYB 4G9FB 2HSIA 1Q0EA 2VDKL 2ZQKA 1PDKA 3C6LB 2FECL 3RB5A 4YLBA 3BD3A 3IEAA 3QJHA 3WS6A 3QDME 1BWMA 4V2BA 4P2OC 4HS3A 3PDOA 3JTTB 5E2UL 3US0A 4A2GA 4XHQA 2XJLA 4Z3JA 3JV4A 5F71A 4A2HA 1PEZA 3QXWA 1JZGA 5F7EH 5C0NC 2DQHL 3CE1A 2EIEA 1IM9A 2A83B 2LU5A 2WLLA 4YHIB 1HZKA 3WHE1 4GUQA 1A6AA 3NSJA 4GMSH 5EIIA 4BQ8A 5B8CB 3X1FA 4NAJA 5CMAB 1HHHA 3HFML 3P9LA 4M8QB 3NA9H 4PJBA 4W6XB 1DQQA 3KPPA 4L8SC 2ZAIA 4L3EA 4NB7A 4FFWC 5DLMH 3RBGA 5JHAA 4AQ1C 5EEXA 1I8UA 2HRPL 2Z92A 5DUBB 5DJ0A 3STBA 1MFBH 4MAYA 3HNVH 5GZND 3MV8E 3HI6H 1T2XA 4UQ9A 3RGVA 4Y5XA 4CDHA 1V55B 1Q9OB 4TOYL 2LU7A 4TUJA 4X6BB 3WIAA 1OT1A 2AJ3B 4YGVA 5GGUB 3BP4B 4KZ0A 1H3VA 3MRCA 4HUKB 4MJIB 5IBLD 4XWOC 3V0AC 1KBVA 4WI0A 3QFDB 4KK9C 4AJ0A 4DJMA 2J5LB 4P5MB 5EUOE 3L4VA 2VDRH 5HD8C 5H2BA 4Y16C 1XIWC 2W9LA 3LIZL 4PGEB 2MNJB 3RWHA 3LDBB 4UIMA 1KJMB 3RFZC 1CTOA 2H3XC 4HT1H 1IQDB 3QUZD 1NAMH 4D9LH 4UDTB 1KXTB 2WQXA 3ZKNC 2G2RB 2OMXA 3GGWB 1FUNA 1S7VA 3APNA 3P73A 2HT3C 4NRYB 4XP9L 4Z6AT 3ATAA 1ZHBA 3GD1C 2MQCA 3QUYA 1LMKA 2O6PA 4DP4X 1VGKA 2AKRB 2EXWC 1WWAX 1KENL 5FV2A 1MEXH 1OZUA 4L1TA 1RHFA 2V2XB 4WI3A 3S3SA 5IUSA 5D1XD 3T1WA 5I8EB 3BIAX 4NFDA 4JKWA 5LNGA 4JRLA 4J27A 5DS2A 4BRVA 5IJVB 4FQCH 1P84J 4IBVA 4YHPB 1JPGA 2RAMA 3NACH 1PLGL 3BFWA 5DRWB 5MENE 4BM7A 2P5EE 4JBSA 3SN6N 1NAMA 3D3VD 2VUKA 3I9AA 1JYXA 5CXPA 4LFHG 1QW8A 3AM8A 2XG4A 3RZCA 4XRCA 2A77H 1GJUA 2N7AA 5AVXB 4LL9A 1ZEAL 4G6JH 1QATA 5KTEL 2CKNA 2FX7L 2JMRA 2WXHA 5F7DB 4U3SB 3IJ9A 1I82A 3HNTH 4LE8A 4M61A 4F5CA 3UTZB 5EU7C 2FJSA 2PYFA 4XXWA 5BPPA 3P9WB 1SUJA 3JV6B 4MSWA 3DMMC 4NWTL 4Y1AD 4F2EA 5B38A 1HK6A 4GXUN 1YEEH 1YCSA 2H1XA 4NP4H 5IOKA 1J10A 2MIZA 1SFHA 2YRBA 1MW0A 5KBMA 1XWVA 4MZ2A 2ZUWA 4ICXA 2W0KA 4BFGA 3ABZA 4B9PA 3WI9A 3LN4B 4YSAA 4P59H 3REVA 2DM7A 1U58B 5CU5A 4ZUTA 2Y3AA 5EFIA 1N4XH 3SZKC 3DJZA 3MZGB 3SOBH 1I85C 25C8H 1I1FA 3NFPB 3CCHB 3VFGL 2WYIA 3QI9C 5DHVB 1KTRL 5JXEC 4KKPA 4UILH 3UYPB 2X40A 2WHVA 5M7QA 5I9QB 3IPFA 5AYTA 4PGCB 4LBEA 1RZIB 3U46B 3V7AG 2B4CL 4AVJA 1UACH 1BFSA 4CA4A 5CSBA 4PJAA 1UZGA 4CMHB 2EDFA 5ETUB 1UUNA 3WIFA 4OZIE 1HDMB 1JWMA 2F19H 4PVMA 4P07A 4HSCX 1TCRA 3FT4B 5I5IA 4UM9A 2XIBA 4XNYH 1HKFA 5F8QC 2W60B 4XBMA 2EC9U 3B7TA 5F9AC 1GZHC 4OCYL 2MCG1 2H1PL 1T7YA 4NM4H 3RWGA 4U1LB 1K8IA 4HKJB 5DDHA 2VWEE 3L5IA 5J12B 5KBLA 2P5WA 4HAKA 4PJ7B 2AVGA 3MGOB 3UYOD 3DKHA 3EUDA 2J5LC 3FQXA 4BKSC 5IHUL 3O3BB 4HFUL 4G2AA 1FFOA 1XF3A 1DL7H 2JIXD 4GW1B 3WO3B 1U8QB 2D2OA 4P23B 3ILQC 3FTGB 4X99B 2AP2A 1ETA1 5DZPA 2ZXAA 2O6CA 2HVKB 3CZNA 4Z78A 2MPAL 5IQ7H 5DJCA 4RMRA 2GFBB 1U8NB 2FLRT 4IU3A 3QNFA 3SE6A 4NCC1 2WIMA 5E5RB 4PJGF 3MLUH 4R2GD 3TEXA 1HHIB 3T0DA 3F7YB 1MWAL 3OMNB 2LFEA 4FTVB 1P53A 4AGQA 1IAOB 3IJHA 4QXWA 2DB8A 2WD0A 4N8CH 3IVKB 4DO6A 3PHSA 4P5KA 4MBOA 3RRQA 1AXTL 1XCWA 1LDPH 1SEQH 5AW2B 5FB8B 3S34H 1B0IA 3RIAF 3TONA 2HTKC 4CSPA 3GB7A 4KDTA 2B08A 3MRIA 4PCTA 3BOVA 4Z7WF 2BERA 2NUPB 4QHNB 2VZ1A 3STLA 1BOGB 4NOBA 1QFUL 5DUML 4PJCB 2VISB 1PLCA 4PB0L 1D5XA 2Q3XA 4BFNA 1XR8B 1QHQA 1ZHKB 4HU2A 4I48A 4U3CA 3QULA 5G4MA 1B9KA 4MLIA 4DZBA 5IP4A 4KNQA 1GC1H 1P4IH 4PJHA 1BFTA 3IMRA 5CLTA 3WFDH 2WGNB 1JP5A 5A2JH 4YHYC 1M6OA 1XTLA 3FRUA 3OXRA 5TK4A 3MCKB 4UANA 3RZWA 5DQJB 5DEJA 2Y1AA 3FSWA 4DUXA 4GKSB 1PVHA 4MS8C 1YYCA 4BSWA 2XVGA 4QWWC 5KJRL 1TT6A 2XTJE 4Q6IA 3ILEA 1BPLB 1K5NA 3R18A 4LEOB 4I18A 4TRPH 4PG9B 5BQ7A 2E4FA 3F12B 3QUGA 3NCYP 4ZMQA 1WJ3A 1I7TB 4BUQA 2ITCA 2BK8A 3GTNA 1YUHA 2WB7A 2DI9A 2X4QB 5T1LD 4EO5A 4NZ8A 1QUNA 3KWUA 4YDNA 1R3IL 5B4MD 4FC3E 4KFZC 1P7HL 5JIKA 1HJBC 4HLZG 1HNFA 1NANI 1SYVA 3QRGH 2MFNA 4OZFH 4TVPH 1L7IH 3II1A 5C0RL 1RK0A 3OJ2C 5D70L 1MCOL 3SQRA 2E27H 4OD1H 5HYSA 4JPIA 4NKQB 5GISL 2WQAA 3MDJA 3ZIMA 2C3WA 4O2EA 3BDXA 4CMHC 1TYRA 4PJDA 1DVXA 1UATA 5JIQA 4DP6X 4XP1H 1RI8A 2YC1A 2ZWKA 1UH3A 3NFSH 1KYFA 2GG1A 4AQAA 1D9KA 4YFEA 1DUYA 3ESPA 2DI7A 4Y4FC 1ZA6B 4YQXH 3BVTA 5K1VA 1FDLL 4OZFA 4AIOA 4CMMA 5DFTA 3QC5X 3ARFB 3GMMB 4OFIA 5D7KD 3OL2A 5E95B 5EOTB 5AOMA 4BH8A 2NXYB 2JJUA 1DLFH 4K9JA 4H40A 5E03A 5LAXB 1KPVA 1UT9A 1ULVA 3H9SB 4DN3H 5KBKA 2AZUA 1MIML 1Z5LB 4NQVB 4PP2A 1BQUA 3GBDA 3MRDA 4PSPA 2EIJB 3H8NA 4U1SA 2OCJA 1FYHB 4YXHL 4B9ZA 3SE3C 4NO5B 1IBBA 1UJTA 3N42F 1Z1WA 3IGUA 4XP5H 5SX4I 5FYLE 3MBEB 3AY4A 3VXSB 4Z76B 3MROA 5E6UB 2BZ7A 4MA3B 1R5WB 2IMMA 4LAJH 1H3PL 5SWSB 1EA9C 3IE9A 2XPZA 4G6FD 1OB1A 4LARL 4ZUUA 5HHVH 4ATWA 1RZKL 1T1ZA 4OJCA 3I74A 4O9HH 3VFOB 1VZIA 3QRBA 1WZMA 1QO3B 4YHML 3A6BH 5ALCL 2HTLC 4IIQC 4DFIA 2O6EA 3D85D 2WZ5A 3BDYL 3X11B 4HG4K 4X7DC 4H20H 4RMUA 4AYBA 1JCVA 2FE0A 3CN3A 3HTLX 2VDQH 1CWVA 1T0MB 5JHDE 2MJWA 4M6ML 4Y8DC 4D94A 4PJGE 3E1ZA 3U83A 3IYLW 4NSKB 5GRUH 2BP0A 2R0ZH 4LLYB 4WHYH 3T4AB 3ZKQD 5J89A 1DLHA 3B5TA 3I6GA 3MRJA 1B6UA 3QC6X 5LGHH 3GKWH 1J18A 3NIDE 4HV8A 3K74B 1URIA 4A37A 5CD5D 5AYUH 2BS9A 2XWEA 5ANME 3Q44A 1FA4A 4F7EB 5I8CB 5JIMA 3CZGA 2XICA 2YD2A 1NBYA 1Q0XH 4ORZC 1JMXA 5CEZH 5ID0A 4Y2OB 1M53A 2L0DA 2XKUA 3FF8A 3DROA 2OP4L 3MOBL 1QBLL 3BN9D 2AEQL 5B39A 3O3DB 4NYLB 2WCGA 2P8LA 2QSQA 4GSRA 4H88H 2R1YA 3MJ6A 2UZIL 4X4KA 3I3BA 4XPGH 3NZHL 4R7XA 4FXTA 3ZXAC 2J8HA 1I7ZB 1OT2A 4AQ8A 2HFGH 2R1XB 2Z31D 2VLMD 3G6JB 4WY7L 2VZUA 5E8EB 3IJ8A 2XNAB 4DVBA 4JG5A 2FBRA 5EBMA 1JNNH 4AIEA 4BFIB 1GJIA 4K94L 2C3XA 4UNTA 1GOFA 5KVGL 4FNPA 5AW8B 1R3JB 1OALA 3GMQB 3RDJA 4OLXH 1AZBA 4EZLA 3DBXB 1INEL 5BVPL 3VFRA 2A6DA 2WNKA 2WM0A 3HLKA 3MYJA 4MAZA 1GPOH 5LWYL 1CICB 5E5LA 3LD8C 2E7DA 1OSPH 5C3TA 4N68A 3QZLA 3D25B 2LLNA 5GS0H 3BKJH 1LO4L 1VFAA 2PXYD 1BOYA 4QHMA 4LSTL 1V05A 5EHFA 2LQRA 1KIPB 4FXGB 5K69A 4IMKA 1TVDA 2NXYC 2ZNWA 1BIHA 1T6WA 2CJUH 3KJ4B 2OMYA 3FU0A 4AIZA 2LGNA 4JO1H 3D08A 3KLQA 1YEFH 4N9OB 5IEHB 2BNQD 1Z9PA 2P24A 3I84A 3QQNA 3MJWA 2DJMA 4QOKE 4XVUD 2IFFL 4JFEB 3LKRB 3MV9B 2BSRA 3B2PA 5EU3B 5HHPB 5DZNA 2X41A 3GT6A 4J3XA 3RVTD 4JJ5B 2E9JA 4XCFL 4ZW8A 1G6RL 4JHBA 3U2JA 3F00A 3V52H 5BRZD 1PW3A 3SKNB 1AVAA 2E75C 4YEFA 5DSCB 2PP9A 3F85A 4N0CC 1U2HA 5IJDC 4PV1C 4NXSA 2DY2A 4XMWA 3UAFA 4V11A 5HJGA 1RZQA 1Z3GH 4CC1A 4AMKH 4NUQA 4XOAA 3PP3K 1GZQB 3AU1A 2GBUA 2F7PA 3K4ZA 1BZOA 4FQLH 5C0AB 4NQUA 3DECA 1F3RB 1NAKL 4NEHB 5F3FA 5JZ7C 2PYED 1CXEA 3U4BH 1M3JA 4WLCA 2OCFD 1ZTXE 2Q2EB 4WO4B 2NXZD 2TRYA 4HGMA 4KROB 3RDTD 3ZE1B 1NGQL 2WK2A 1DZBA 1AQKL 1KLGB 2VLRE 4QUOA 5SWZB 3U4KA 5A7EA 1EEQA 3FCBA 2DQUH 4WKXA 3QDGD 3TO4C 2NTFB 3E6FB 4XC3L 4RAHA 3CZUB 1JXKA 5TDPB 4MNQD 4P9HC 3OGCA 2PPFA 1OW0A 4NQCB 4ZS7L 3BMVA 3IS1X 3V4PL 5EO9B 3L9RA 1JZ3A 2F2HA 2Q76A 4HVBA 1KG0B 3DXAB 2YD6A 2WVTA 1QFWM 3BEVA 3HS0A 1VPOH 4X8JB 3KM1A 1JHKH 1JZ7A 2WTRA 3F5WA 4Y5YA 4I1RA 3KWVA 4L18A 5D5ME 1UASA 5I1LB 4MRBA 3V4VH 4M6AA 2YA0A 1YA5A 4PJ9B 4XPFH 5FO2A 3AG4B 1ZIAA 4NP9A 3V9FA 1J88A 2ZYSA 5ITBH 1NTDA 1IBGH 4KZEL 3G5XB 3PWNB 4HWUA 3RUGF 3C8KA 4K3DH 2PO6D 2XZQH 5IWLA 1AXSB 1MFUA 2GPZA 4MMXB 2Z7WA 4QPEA 1KLFA 2WAQA 2WO4A 4PD4J 3N55A 4JZOB 4MMZA 3QUMB 4RFOL 1XL6A 4NGHH 1DVFA 4RMWA 3TBVA 3MLWL 1XBRA 4Z7UE 1BVKA 2XPGA 5DD0L 5L88L 3UAAA 3VFVB 1NCHA 2XN2A 5F9OH 3DOSA 3UC0L 2R2HA 3UYRL 4AV0A 5DWUL 1TQBB 5D2NE 3FZUD 1O7DE 1MCQA 3WEBA 3LVEA 1SGKA 3CFKB 3PP3H 5GJSH 4OLYL 3L3DB 1NCAH 3PV7A 3W0WD 5D6DA 2I60L 3ZE0F 4OV5B 5EOCL 1E9PB 2C1PB 1M7IA 3PABA 2BHYA 2EH8H 1HXYB 1RJZA 1RZGB 4DEWA 3WU1A 4TUKH 2ZX6A 3WFHB 4XCNA 3BKYH 4PRPB 4LASH 1FZKA 1IKFL 1YG9A 3ULUH 3P2TA 1I9JH 1IKNA 2VLJA 1J12A 2WLMA 2CKBL 2XQYK 1OCRB 3BISA 4KUCD 4ZUSB 4CAGA 5ITFB 1JZ4A 1JUFB 4GAFB 5SV4A 1NKGA 2VXQH 2XWTB 1KZYA 1FVDB 4K71B 1Q1JL 4F8OA 3RTQD 4DHLA 3CDYA 4JLRA 3MRHB 3QQXA 4AENA 1ET5A 3HG2A 3P4MB 4PPTA 2H0JA 5ADOH 2WOBA 3BWAB 4HIIB 1AKJA 3EW3B 3QQ9D 4ZYKA 4IU2A 1M4KA 2FO4A 3WFBL 1JZ8A 1C08A 5T3XD 2BSED 2G3ZA 3N50A 2J1ZA 1FORH 2QADD 1QSFA 4K7FB 4LLWA 5ISZA 5C07E 3VGBA 5E1GA 3ZGIA 3W38A 1J5HA 1J0ZA 5F7YC 4FQPA 2NNRA 4PB9L 3RY6A 1AO7A 4P57B 1A1OB 1JS4A 5JHBA 2AJUL 4DEPB 4ZW7A 4PRHA 4AV4A 4JM4H 5IJBC 1E43A 3WEAA 3RVVC 1MHHB 2C5DC 2R27A 4LPCA 1FNSH 3RURA 1ZDQA 2EEAA 4ODSH 2YPLE 1HNYA 1FC1A 2A9DA 2DQCH 4CNIA 4EN3B 3QORB 2EDHA 2OX5B 5IG7A 5SWQB 2JV6A 2ENPA 43CAB 4Y4KB 1QR1A 1ITBB 1K5WA 4IRZA 1OM3L 1P4LA 3UBXI 3EKCA 4YUEL 4QLWA 1AIFA 2CK0H 3NVQA 4ZOEA 1QSZA 5AW9B 4IK6A 4WW1B 2WXJA 4WJKB 4EXPX 5DJYB 2A6JA 2ADYA 3GQFA 5F9WB 3B9AA 1A6WH 2BNUB 4I3SL 4P46A 3MRKA 4GP8B 1M1XA 1QACA 2WXPA 2NX5E 4HBCL 4Q6YA 4P3DB 5FCUL 3WUWB 5IB3B 4JFDE 2DYPB 1CG9B 3O6LH 4BE6A 3QWOB 1U2CA 4I0PD 4LMQE 4CC4A 4L1SA 5BUAA 2Z4QB 4P2QD 4B27A 1NFDB 3MGTB 2YKLL 1PX8A 1RK7A 4F1SA 5E8NA 1MJ8H 1U3HC 4M8VA 4JFFE 1D6VL 1UC6A 3IBOA 3VXRD 5FYKL 3V6FB 1A0QL 4M6OL 4WI6A 4Y4HD 1T5WA 2WJ7A 1AZRA 1CC3A 1ZPUA 4DKEL 3LXAA 3B5GA 3FQWA 3VX0A 35C8L 3SDAD 2ZONA 1OE1A 3HG4A 5E4OA 3WFEL 2GY5A 4MMXC 4FQJH 3E8UH 5H4YA 3H3BC 4ZFOA 1ZLSH 3S48A 3T77A 2EO7A 2NNAB 3VD5A 2VSKB 3TFKC 2GEQA 3RPBA 1A9BA 1W6WA 2HRLA 2PKDA 4TULL 5DD1L 3T2QA 4XO5A 3DJRA 2HFFA 2VXTH 1A7RL 2D4DA 2E8ZA 4WWOA 4APQA 3TVMC 5C70A 2GIMA 3ZRSA 3FMGL 1GJWA 3D4CA 3GM8A 4JZJC 1BAFH 1E8YA 5E9NA 2XA8L 2EE0A 4ONOA 5E5MA 3SCMA 5AL8A 3SDXA 4OQTA 4NNPL 1ZSDA 4WFEE 5D1QA 1VHPA 1T2QH 2EEXA 3KLAA 3MR9A 4QTFA 1AE6H 3MBXH 1WTGT 4FXKC 2Z7ZA 3K91A 3LZOA 4WSKA 3VFPB 3ZBMA 2RFXA 1DSYA 1V8HA 4Z77A 1MHCB 4MA7L 4PBDA 3U9UB 3QJFB 3RUGE 4QDGA 1MCRA 4JFZH 3LKQA 2Z0UA 5MHSD 1I8KB 4P2RE 2IMNA 1AHKA 3QXAA 4WQOA 4L3FA 5FHBH 4G6KL 3CXHK 2ENYA 4XN7A 1N2RB 4DTGH 4WI5A 5B3NA 2WXRA 2AQ1A 5D7HA 3O9WC 1SJHA 1VFBB 3G5VA 2A38A 1EHLH 1DBAH 3BPOC 4QRRB 5IGXH 3FQYA 1JPEA 5DURB 1BM7A 1I1AA 4PV9A 5I1JL 4UT7L 1WZ1L 3D7PA 2R39A 3GHEH 1C5DA 3ECVA 5DJXB 2NQDA 5D7IF 1I75A 4ABWA 3IFPA 5JW5B 5CR1A 3ZE0E 1KNOA 1J8SA 4ZX4A 5BZWB 2VR5A 5F7LB 4YBQC 1AIZA 4X6CF 1OHQA 4PS8A 2VMJA 3FOMA 3HHSA 5ICUA 1A14L 2B59B 4BFBD 1H0DA 3HE7A 1BIIA 3OAUL 1KGUA 2X0UA 3SYCA 2Y4SA 2VDLL 5LN4A 3IGKA 1A21A 1LO5A 2ATKA 5DZOA 1JGDB 4EN3C 3QORC 1H5BC 5JNYA 2N56A 4G9FA 1J5DA 5ACZB 3EDEA 3DNKA 4Y4KC 3C6LA 2B1HL 2CG9X 4OGYL 4HLEA 4IGBA 5SX5K 1WGOA 5M94B 2HYMA 4FXLA 1J11A 5CNHA 4KK8C 2JQAA 4QRFA 1BVNT 2FHBA 4CVUA 1WIPA 5FS5A 3QUHA 4BWWA 2WWKT 3ROOB 1AMXA 1R3HA 3TBTA 1EHAA 3D50A 1UM6H 5F9WC 5I6OA 4M1GH 2O26U 1WT5A 4MJHA 2A83A 3ABKB 4YHIA 2WWOA 3KBFA 3PWLB 4ZXBC 1QFWI 4UQEA 5DJ8B 4NQQA 2FR4B 2CUMA 5B8CA 2JKSA 2W38A 2RJMA 3SDDB 4M8QA 2OSLA 3CX5K 4PTUB 15C8L 1TR7A 4P2AA 3F58H 4JJHA 3OHMB 1BJ1J 2Z35B 3WD5H 5D55A 2YAEA 1Q8MA 4QRTB 4W9GC 2EC8A 2IH3B 3N40F 3HAEG 5LBGA 1NCWH 5MEND 4XZ4A 2C7UB 4FG4A 3A4FA 1URZA 4XE0A 4CRPA 4PRIE 4PP1C 5GSVB 2RD0A 1UB5B 1WFTA 4MJIA 1NLBH 4KY1H 2ZOKB 3QZWB 1RUKH 2YO3A 3QFDA 5IESL 2XVLA 3B5HA 4P5MA 4HUCA 4JO3L 3ZSSA 5L8JB 2VAJA 4RBPK 4PRAA 4LF3B 1A5FL 4Z7VE 1W0VB 4KUCF 4PGEA 3MO1A 1KJMA 4V1DB 2NY0B 4WEBH 1U6AH 4YAQB 1FCGA 1CFBA 4ONGH 4UDTA 1KXTA 2G2RA 3V0WH 3GGWA 3C09B 3WUWG 1IM3D 1FC2D 1EHXA 1KXHA 1FZOA 1MCIA 3RTLA 1GCFA 2A2QT 4OLUH 3QVAA 5SX5H 4TQ8A 3ARGC 4NERA 4A7GA 4P04A 4WI9A 3GTTA 2OTWB 4BA0A 4CN1A 4CW1B 5KEZA 1QEWB 4D9RE 2NY7L 2IANB 2J8UE 3BUTA 4Q0XL 4GSDH 3RIFF 2BSSB 5DUJA 3NCBB 3MUZ1 3KJ6H 5I8EA 3U9PL 3CFNA 1DQMH 5IJVA 2EJ1A 4YHPA 5DGRA 1BPVA 5DRWA 4BV1A 5J11C 5HGHB 5BQDA 5C86A 3ZDXB 3QG7H 1PCXA 4HGWB 3OZKA 1UXWA 2XQBH 3G5WA 4MCZB 4B96A 3IDYC 5D1ZD 3VJ6B 3FONB 4FP8H 3AFLA 1KFAH 3BFQG 4NQEE 2IOIA 3THMH 1NBZA 3L3IB 5F6IB 3CIAA 1TPXB 2B20A 1PCSA 5F7DA 1JPTH 2DQGH 2FSEA 4PWGA 4U3SA 3UTZA 4HJ0D 4L1BA 2MQ0A 5DHVH 4IMLB 2CH8A 4K15A 1BBDH 3BKMH 2Q20A 3J7HA 1RLWA 1LK3H 3PQYD 3JV6A 1CFSB 4RBPH 1BG1A 2M83A 4G8GE 1ES0B 2JELL 2XC8A 4JY6B 4I9WD 1NC2D 1T4KA 4Y7MA 1ZLWK 3ZL2A 4ZG1A 2F1BA 1OAUH 2BSDA 3O41A 3FO2B 1H15B 3GWJA 4KQ3L 1GGIH 4LLUB 5C3IA 2AC0A 3IMWA 3MTXA 4LSPL 1MAMH 4YDKL 1BWWA 1DJYA 2AABH 2XN0A 3NYKA 1EAQA 3V0JA 1LK2B 2FJGB 2EDXA 1U58A 1BZEA 2NCMA 4MDJA 4FABL 3HKFA 1A6TB 2CXGA 2DM4A 3HG1E 3LEXB 4PBXA 5D7IE 3CCHA 4N5UA 5DHVA 1VEPA 3K46A 3SGJC 5DD5H 3VQMA 3MXWH 4A6YA 3UYPA 2X7LA 3EBGA 3OMZA 1RZIA 2PLTA 4QHPA 5DS8A 1KLUB 3U46A 3UTTD 1KTLB 3IDXL 1V3KA 3DIFB 5HHMB 1XMEB 3PAYA 3DO3A 1PKQB 2CBOA 3QJOA 3NPSB 1U4FA 5CEZE 4PJXF 1PYWB 3FYIB 1HDMA 1JVLA 3C87A 3SDCA 1AI1H 3TCTA 1YPZA 5C0JB 3DHJA 3FT4A 2WO3B 3TA3B 4GMTH 1PX3A 4GQ9H 2W60A 4MQSB 4KPHH 4OD2B 3ARUA 5A3ID 3RLSA 2B2XL 1BQLL 1A7OH 2Q8AL 4RA0C 4U1LA 4HKJA 1XH2A 1CXLA 1GYCA 4Y2DB 1A3RL 2FUTA 5IVXB 4QAWA 2ORBL 3GSWB 4PJ7A 3LS4H 3MGOA 4ZW6A 2DKUA 1I8IB 3O3BA 1NMCB 5LAPA 2A4EA 4GW1A 1U8QA 4P23A 3FTGA 2F58L 2VN5A 1MHEB 1UA6L 3WIIL 4WWKC 3MODH 4WTZG 4A2LA 3QGVA 5TQ0L 2HVKA 4XCYB 3I6SA 4YSPA 1ZLWH 3GSOA 2F74B 2WY3B 3P77B 5E0FA 1MFDL 5FUOH 3BFOA 2GFBA 1U8NA 5C08E 1SBBA 1XBDA 2Y2WA 2XTJD 4YSSA 1HHIA 3F7YA 1AACA 2UWEE 3D3VB 4FTVA 4HCRH 3CHPA 1H3UA 4KRLB 4LQFL 5KVGE 4BH7B 5GIRB 2FNBA 3IVKA 2JQZA 3H9ZA 5CZXC 4LOUD 2Y07L 4OCXL 3MNZB 2ENSA 3DPDA 3SZ6A 5FB8A 5F3HB 1U8MB 1CFTB 3ZDZB 5FK9B 2NUPA 1IGFH 1WWWX 3UTOA 3P3YA 4QHNA 1BOGA 3RB7A 4O00A 5I30L 5LBVA 1J1XH 1S7QB 2VISA 3OJMB 4J4PD 5IQ9B 2ENJA 3H54A 4KZDL 1ZHKA 1E2ZA 2VLLB 3KEHA 3QIUA 4LHUB 2VUOA 1TDQA 3MLRH 5IMOB 2YAFA 4L4TD 1OV8A 2ZG3A 4E0RB 4HCRA 1NCBL 5F6IC 1AC6A 5GPRA 2HKFH 4ANXA 1QFOA 4KXZH 2ZKWA 3TWCL 1EMTL 1TZIA 3MCKA 3Q8EA 4E41E 1S9YB 4ODUB 3UDWC 4H13C 2HKHH 5DR5L 1ACYH 1SDDB 4GKSA 3VO0A 3S35X 4HDIB 4JKNA 4D7BA 7FABH 4FFVD 2J6EH 4ISVB 4EI5B 3K8LA 5EDSA 2BIHA 1A4CA 3IJYA 4AXWA 5JO5B 5JIPA 4PG9A 3F12A 1WVZA 1E5YA 4JN1H 4QR7A 4ZX3A 1F1DA 3CH8A 1IGIL 4ZMZA 1I7TA 4ZJ9A 3UAJA 3KNBB 3VXME 2UVFA 4JANB 1UXSA 1M7UA 2F53D 2XZCH 2Y6SD 4OSUH 3CK0L 5E9DE 4JHWH 2IXQA 1P6WA 3UCQA 4JUTA 4K7PL 2JJVA 5MP6L 1RULH 3MRFA 4P3CL