4M5YL

Crystal structure of broadly neutralizing fab 5j8
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
SYVLTQPPSVSVAPGETARISCGGNNIGTKVLHWYQQTPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEVGDEADYYCQVWDISTDQAVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 5J8 heavy chain
publication title Antibody Recognition of the Pandemic H1N1 Influenza Virus Hemagglutinin Receptor Binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 211
sequence length 211
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5yL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5yL01
3K81A 1JPST 5IVZA 5F9JB 1TMCB 5DHXB 3MODH 2EE3A 1F2XK 5DEFA 2BY0A 1OTUC 5DQDL 5DJZA 1E6OL 5I8OL 32C2B 1HWGB 2VLJD 1KT2A 1VFBB 4KKBC 5FF6B 1DEEA 2AEPL 4KK6C 3WIFA 1IGIH 3G5YA 4PRIB 2ATKA 3WDIA 5KTEH 2P5WE 5IMMB 1Z3GL 3GMQB 1BZ7A 3FQRB 4QYOB 1A6TB 4PYHA 3CSPA 3GMLA 2YK1L 2PTTB 1R5WA 2XZQL 2UWEB 4FFVD 4HUWA 3SQBA 3F58L 1G0DA 1YEIH 5IR1B 4I5BB 3OKNA 1KJ3L 3DUUB 1Y6KR 4X6BB 5K9OA 4M6MH 5F21B 3SY0B 2P47B 2BK8A 2NY4C 4MB5A 5GGUA 5ELIA 1INQB 5I8CA 4QXTB 3L95B 4GMTL 2D7MA 4N0YH 3FMGL 2YPLE 2DQHH 4LKXA 6CGTA 2A74B 3ZHKA 4Y1AE 5DURD 1FG2B 1YNLH 3QULA 1GOFA 2QR0B 3SPVB 3IJSB 3CD4A 3E6FA 1SYSB 3GJEB 1V3KA 5ANMB 1SBSL 1JK8B 4JRXE 3TBVB 1QEWA 3RDTA 4O51A 4D2NA 1IEHA 3TNMA 5DT1L 5IFJB 3IU4L 1FSKC 4JQVA 5K9QG 1OVZA 4JREC 3P0YH 1I9RH 4BKLA 1ZSDA 1OAKL 4ELKA 2PXYB 3GGWA 3MRPB 1UACL 1KB5A 3E8UL 5GGRY 4GW1B 2NW3B 4G43B 4GMSH 1CICD 3HAEB 2BY2A 1MJJA 3HMWL 4JN1L 2P43B 4QRPD 3O6ML 5I76B 3OGOE 4ZFZA 4JGUA 4EUPH 3RNQA 3U7WH 5BMFH 3QXUA 1G0XA 3GMNA 3VJ6B 1R5VB 2C3VB 2P8MB 4C59B 1IRAY 4X4ME 1XF3A 3CLFH 1BM3L 2LTQC 3TN0D 4XTRD 4PS4L 1CFNB 4MQSB 3VFSA 5BS0D 8CGTA 2NYYD 1DCLA 1F58H 2A9MH 5AYQA 1CXKA 1VFBA 1RJYA 3WUWA 4UNTA 3SDAB 1F8TH 5CKAA 4JZNB 3BMVA 5CINL 4PRIA 5IMMA 3GMQA 2BY3A 2FLRT 3QNYA 5KZCD 3FQRA 1MQ8A 1A6TA 4LNRA 4NKIL 3FAWA 4MCYB 1U3HB 1D5IL 4QWWD 1JFQL 4WFGE 3LKOB 1QSEB 2DBJA 2UWEA 2QHRL 2MCG1 3SDXA 1KYOJ 4AMKH 4I5BA 4P5KA 1U8HB 2K3TA 4X6BA 2ENYA 2P8PB 4NN5C 4JFEE 4ZFOB 5L2KD 2ZCLL 3FT2A 2X9YA 4PUBH 5I1EH 2E6QA 5KVEH 4KKCC 1KYOK 4U0RC 1DBKH 2DN7A 2CLRA 4JDVB 1U8NB 1IM9D 3ARDC 4FQCH 1C7TA 3E2HB 2ZP0T 3I50H 3I02B 4FQ2H 3OB0H 3AREA 3MLRL 4Y5VB 4R97B 4EBQL 3IAGC 1AGCA 3IJSA 1SYSA 4YBQD 3GJEA 3O3AB 3T0EC 1JK8A 1NCDL 4FZ8H 5C09D 4N9GB 4Z7UA 5HHXH 5IFJA 5IVXF 2DJUA 5IFHL 5A1AA 2P1YA 3B9EA 4KI5D 1YMMA 1NDMA 1FH5L 2OZ4L 5AZEH 5IV2B 2PXYA 1INDH 5DQ9A 1YY9C 4DGIL 5D1QC 4OLYH 5D9SA 4EDXA 4MLSA 2BCKB 2IBZX 1AKJB 4GW1A 5C0AD 1SVCP 3HA0A 2NW3A 1HXMB 3MLTA 5DEGB 4AJ0A 5JXAH 5CMAA 5IQ7H 4IIQC 1DQQA 1S9VB 3CU7A 1ZAGA 1SHMA 3IKKA 5B8CB 3MV7A 5DD3H 2IAMC 1K4DB 1CVRA 5FYJE 1DQLH 4X7SL 4XH2B 1FVCB 1WZ1H 3MJ8A 1G0YR 1PKQE 2BY1A 3RVWC 5T3ZL 1UYWH 3IKCB 1JVKA 3PHOB 5IP4A 2FECL 4NKQB 4W6WB 2VZUA 1R5VA 2C3VA 4QEGA 5EZIH 3WFHB 1PFCA 2F8XC 2FZ3B 1CFNA 1JPGA 5ADPH 5J6GB 3L5IA 1JCKA 1XGQA 4OI8A 2AQ2A 3SDAA 1J18A 1YUHA 3QNZB 1Q9KA 4G8GB 5ETUB 3ULSB 1KGCD 5LWYH 2EKSB 4NQTA 3VXSD 2L4OA 2AK4E 3GI8H 3MUGA 3OWEA 2EC9T 5CIPH 4GXUM 5EC1B 5HDOA 4XC3H 2DYPD 4DCQB 1I8KB 1BFOB 1DLFH 1YJDC 4UV4L 3RWEA 4ZFOA 4XNXL 2F5AL 1OAUL 3BKCH 2QQQA 3MO1B 2D4FA 1UH3A 2I60H 1U8NA 3LPFA 2P5WA 5KSAC 2VDKL 3VXUD 5LCVH 4MGXA 2W0KA 4Y5VA 1OAXH 3DVGA 1MAML 3VA6A 5L8KB 2IMNA 3BFOA 3TLRA 1XGUB 2EE9A 1RIHL 5F70A 5LGHL 3O3AA 4MQTB 1T1YB 3S5LA 2VNCA 5FCUH 3D39D 1PDKA 1A6PA 3W0WD 2F54B 3RWFB 4XMPL 2W65A 3LZFL 1MEXH 1HYSD 3ZHDA 2H45A 4PJHB 5IV2A 4DVBB 4LVOC 2H6PA 2XIDA 3TPKA 2YPLA 1BF8A 4FQHB 1LO2H 3RBSA 2WW8A 2ITCA 2BCKA 4OZFH 1AKJA 4Y1AA 1U2CA 5I1GL 4F3FA 1AO7B 4XVUD 1MCHA 5SWSD 1Q9WB 5DMKB 2YSSA 3EYFB 4I9WD 1MCKA 3PDOB 1YNKH 1OAZH 3M8OL 5T33L 5B8CA 3T08A 4G6JL 4PJHF 3C60D 2J4WL 3BO8A 3HNVL 4XH2A 1N2RB 1UT9A 3DYMA 5F7YC 1FVCA 1PLGH 5IG7B 3VXMB 1WVZA 1BIIA 3PGCA 4XPFL 4ZUWB 3W5NA 2VXSH 4TSCL 1ZTXL 1TPXC 2HKHH 1Z5LA 4ODVL 3WNKA 1IM3B 1CICC 2PYFA 2X4RB 3MJ9L 4V2BA 3JVGC 3MRCA 1P4BH 1J5OL 1PG7L 1YC8A 2FZ3A 4KHTL 1X4XA 2VABB 3T65B 5E6YA 1I8MA 4U6YB 3CPLA 1A6UH 1CE1H 1WCBB 1CYGA 3BGFC 3DX7B 1GZPB 5CJ8A 5J6GA 1OLLA 5KANG 1IKFL 2OYPA 3TPUA 3HC3L 1U8PB 4G8GA 1PKQB 1K4CB 5T3ZD 4M48L 5DJ6A 1FQ9C 1JWMB 4IMKA 4XCEB 3RWGB 4GRWB 4NQCE 3O2WL 1BMGA 4YGAB 3TN0C 3L5XH 4X4MA 4XTRC 4Q97A 4U1MA 4ORGB 1S5HB 2NYYC 3KDMB 2DKMA 1CK0H 2CXKA 2YN3A 4TSAL 3WIHH 4L4VE 2AABH 4XWGL 4HGMA 4QLRA 4L3EE 3F7QA 4F7TB 4S10A 4LU5H 1IC7L 3V6OE 2BVYA 1ZV5A 4U49A 1PZ5B 5DDHA 2OR9H 4QWWC 4PLJC 5E6IB 1MIML 1FYTE 3DMMD 3QFJE 1WUNT 2D7OA 2HT3C 1QBML 4OCSL 5AZ2L 1A7QH 1XGUA 3LPGA 3GI9L 4P4KC 3EOBB 3G6JB 4JFZH 4P57B 1RK0B 4JZJB 5J8OA 4EI5D 5KAQG 1KIRA 4RWYH 3IGAB 1IAII 2NMSA 3QJHB 1HSAA 4FQHA 4H8WH 4HC1H 5BZDB 4G8FB 1H5BC 2R4SH 3NN8A 4KUCD 5DRZA 4QF1A 1Q0XL 1Q9WA 4J3VA 3GHBH 1DQTA 4JE4B 5GQBA 2X40A 3PDOA 5EOQH 3RX8A 1VFMA 1F6AA 3QFDB 3MRKB 3MOBL 4YHZL 2CMRL 3VH8B 5IROA 1GCFA 1CFBA 4KI5C 3TV3L 4J23A 3RTQC 3VXMA 2AERT 1I1YB 1A3RL 4YFEA 4PJGB 3O8XC 5KVMC 3NCJL 3RPIB 4WU7B 5J56B 1CDUA 4DTGH 4U1JB 1AGEB 2X4RA 4ELME 2GT9A 2D2OA 4ZS6D 4Q0XL 2VABA 3K74B 5HHQB 2XKSA 3PP3K 4HF5L 4U6YA 1BWWA 4PJGF 3QDJB 4JO3L 4XPHH 4X7DC 2YD1A 4WVRA 2LVCA 5DVOA 1PKQA 5BJTA 2B39A 1WITA 1P4IH 2DOCA 4WTZA 4ONGL 5GRWA 1KLUB 2Z91B 5H37H 3F65A 4JPKL 1S7WB 2R0ZH 2G75B 1S5HA 3KDMA 1I3VA 1RUKL 1KC5L 4FFZH 4RA0C 3J8F7 1ZA6B 1XZ0A 5BRZB 1JF1A 1NMBH 3PQYE 4TVPE 1C5CL 1CT8B 3BKJH 4HUVB 3MLVL 2XQYK 1HIML 5HHOD 2OI9B 1QPXA 1X5KA 1ZOXA 3MA9H 3N06B 3RIAK 3QXDA 1U3YA 2IALB 4YAQA 2CKBH 3BDYH 2AK4A 4JPVL 3V6ZB 3CFEA 4P46D 3UO1H 5JXED 4KRPC 1F5WA 1XR8A 3UTSE 5J4MA 4AT6A 4DVRL 5C0JB 3T0EE 3PABB 3CLEH 5I1IL 3KPPB 4JM4H 4LSSH 4WEBH 4CN4A 5DK0B 3W11D 3FT4A 5I1KH 4OZHB 1K6QL 4J6RL 1B0RA 4P9HH 1S5IL 1LK3H 4PJIE 5E0QA 1ZT7B 5ICXA 1KN4L 1SM3L 4O9HL 4APQD 4NN6B 4UIKL 5C08D 3KVQA 2XXMB 3VRJA 3AXLB 3MOQA 3BI9X 4HFWB 4LHUD 2DJ4A 3OKDA 4PY8I 3UPRA 2AVGA 4MJ2A 3X13B 4BFBD 1U8JA 4LSUH 1KFAH 3V0VA 1PEZA 5EZOL 1YY8B 1HYSC 1K8IB 4JM2D 5K9JL 5AG8A 5E5MA 4WJ5A 1EX0A 1I1YA 1MCBA 5JOPE 2V7NB 3CFBB 3RPIA 3STLB 3MFFB 4WU7A 4XVUC 3FHQA 3FQXB 4CAGA 1Q72L 1AGEA 4ODSL 1AGFB 1G6RA 3NTCL 1RZ7L 3PGDA 4CN6A 4ONFL 1JNHB 3HI6H 4FZEH 1KEGL 1OF2B 3KYMA 1PZUB 4GRMA 4FG6D 5D71L 4PJ9D 2C1OB 4TOYL 3QDJA 1D3CA 2CJUL 2EEBA 1FIEA 1QPPA 1UKTA 4L8SB 4WUKL 5I16B 3AU1B 1YEGL 1JUFB 2VIRB 3E6HB 2F8OA 1JGLL 4GW5B 1KLUA 3VFUB 3QIWD 2DQCL 1NAKL 3QCTL 1F90L 4KROD 4N8CH 2ADFH 5FYLH 1DE4B 1A4KA 1E27B 2G75A 2JB6B 5HVGB 1G7MA 5BW7A 43CAB 2XNAA 2VLJE 2YRZA 3C6LB 4HIEA 3ARQA 4O4YH 1V7NL 1MCNA 5T3XH 5BRZA 3HN3A 2LU3A 1PQZB 3RWHB 4AENB 1NGYA 2YRLA 3W9DA 4U33A 4OCYH 4LARH 2A0LC 1T4KB 3JUZA 2IBZY 3HI1B 1FGVL 2K1MA 2WWKT 3J7HA 2WUCL 3P30L 2GY7B 4XPBL 3V6ZA 4NQCA 4J3XA 5E8EB 3PWUB 1HDMA 2E9IA 4XBEH 2WP3O 1EBPA 4M1CD 4OLZH 1X5IA 3DVIA 3EYSH 1CXFA 5J3HD 4O58L 2WWMD 4LLYB 1M7IB 1A6AB 3IT8D 1L7IL 5A2KH 3H9YA 3PQYB 4K94L 4TQEL 4OCXH 1RV6X 4L3EA 2G5BA 3GSWB 4QT5B 4OZHA 1QFUH 3BP7B 3QA3B 3X11B 3MLSH 1ZT7A 3MA7B 4JO2H 1CD0A 3FQNB 3FRPA 3V6OA 3C5JB 2R23B 2V9TA 1YEKH 4JKKA 5C8JB 1FYTA 3AXLA 5F9AC 5DUPL 3QFJA 1UH4A 2UVFA 3A0OA 5EO1B 1JRHH 1JPFB 4QTHB 3GSRB 4LLQB 3OAYK 4CDHA 4ZOAA 4YDKH 4PBWD 1T83A 4EI5C 2HKFH 1K8IA 2ICWB 1IKNC 2YS4A 5DC0A 2VZ1A 4UBDD 1RURL 4HEPG 3ZTJH 3CFBA 4DWHA 3IF1B 1N5YH 1W72L 1L0QA 1P2CB 4K7PH 4JCLA 3WN5C 4HAGA 4LASL 3NZ8A 1D6VL 4I18A 1JNHA 3MBED 4QRPE 3HTLX 1KBGL 3QIUB 4M43H 5F7LB 4PGBB 3OB0K 3N1QC 4YHYC 5JDJA 4RMRA 2XG4A 1FVDA 5AAMA 5TE6L 4L8SA 2QSQA 5IMLB 3AU1A 3V4VH 1ZHKA 1JUFA 2VIRA 3TWCL 2GK2A 2DIBA 4LSTL 3VFUA 1JP5A 4OCWL 3O45A 4ZS6C 5BS0E 4DUWA 5CEZL 2XQBL 4X83A 3C6LA 5DRNA 5IWLC 1DQMH 3MODL 3O6KH 4Q9BA 3RKDC 1NCCH 1R3HA 5DEZA 1PQZA 3RWHA 2H32H 3DX6B 4W6YB 1HXYA 2B5IC 4PJFE 5C86A 3NA4A 3HZMB 4RMWA 4I48A 4Z0XA 1UENA 3RY6A 4YGVA 4I4WB 4NZDA 2YHGA 1EPFA 3O41A 3DVNB 4D0DA 2H2PD 3HE6B 1IGIL 5B3JF 2F74A 1BJMA 1F3RB 5E8EA 5KTEL 3BQUA 1F3DH 3PWUA 3HG1E 4DOHE 5L2KE 2Z93A 1V05A 4S0SD 4KKLD 1YN6B 4GKNB 1A6AA 1RU9H 3QO1B 4GBXB 3PQYA 1YEIL 2A6JB 2WUBL 4ODBD 1VB9A 4WDIA 4KHXH 4WO4B 3X11A 4KK8C 3H2WA 1OT2A 5JXEC 1ZK9A 3FO9B 3C5JA 1H3PH 3I2CH 4ZDHA 1I85A 1IQDB 2AJXH 2VSCA 4N0YL 3SQOH 5IQ9A 4LHUG 4Q2ZA 3WO4C 2NX5B 2DQHL 3UTSA 4YQXH 3JWDC 4MMZC 4QY8A 1JPFA 5C09E 1J11A 1YNLL 4LLQA 2WV3A 4G42A 5B4MC 1YEJH 2APWA 4XBPA 1DTUA 1FNEB 1RUPH 4FQXD 4NIKB 4Q6IB 3MZGB 2XWBB 4KI5E 1M7DB 2ICWA 3RA7H 4X6DE 3GSQA 4F58H 3TJHC 4TUOA 3S35X 2VO5A 4PJIA 2VJXA 1H3WM 5C0AE 5JUEH 3P0YL 1I9RL 1WIUA 2A2QT 3LRSA 4U2YA 5IB4A 2VISB 1J1PH 4CGTA 4PJ5B 2YZ8A 2E8ZA 4G9DB 3MRMB 2VL5B 4GKSA 3TH3T 1CXEA 2DICA 3QIUA 3T2OA 1UCTA 3AS0A 4GMSL 3I3BA 4Y16B 1D5MA 3ZE0E 3WLBB 1D9KC 4OLUH 4Z9KB 2IPTH 1IFHH 4W4OC 5IMLA 5D5MF 2LAGB 2G2RB 5TQ2H 5KW9L 5IF0B 4M7LH 3U7WL 1T1XB 5FO7B 5BMFL 3MLUH 4PGCB 5D7JC 4W4NA 5DA0B 4KDWA 3ZDYE 1XT5A 2ZUWA 1L0XA 4FG6C 4U1KA 4PJ9C 1NGZB 2VDPH 3CLFL 2X70A 1BGXH 2BZDA 3KPSD 4NHUB 4YHIB 3TO4D 2XTJB 2VH5H 3B5GA 4UDUB 1F58L 2A9ML 5F9OH 1KGCE 3VRIA 3CSBA 1IAIM 5K59E 2DM7A 2CUMA 3BIKB 5BZWA 3D18B 1W0WA 2CXGA 4RIRB 3QIWC 4ZXBD 1F8TL 1MQKH 2YC1B 1CXLA 3QI9D 4KROC 3BD4A 5F1SA 4E0RB 1ZHLA 4R4BB 2WIMA 1WSST 5IW1A 4M4PA 2VL4A 4RGMC 2DI8A 5CEZD 4I3SH 4M9OA 3DX8A 2PO6D 1MELA 2P5EB 5D7IE 5C0IB 4UV7L 1PD6A 4GKNA 2EZ0D 4DFIA 2HH0H 3GB7A 3QO1A 4MJID 3JV4B 2NY5H 4WV1A 3VXUE 2ED7A 5KSBE 5C0DB 4LVHC 4UZGA 4PYGA 4PUBL 5KVEL 4UDTB 3MRGA 4U6VH 4PREA 4QHKI 1KTLA 2IH3B 2NX5A 4FQCL 4EVNB 3SN6N 1OPGH 3I50L 4HUUA 4LKCB 3D39E 5LKNA 1INEH 4FQ2L 3W0WE 5F7WC 4YC2C 4PRAA 4HBCH 3F6IA 1DJSA 4Q6IA 2F5BH 4FZ8L 3TIDA 5HHXL 3VFMA 1ZMYA 3GBNH 2QADB 4Y88A 3RGVB 5SWSE 2NLJB 3D9AH 5AZEL 3QB7C 1INDL 1T1ZA 4PJ5A 3L9RA 4G9DA 5C0CB 1OP5H 4OLYL 2VL5A 4OI9A 4Z7WB 1ROWA 1QNZH 4X4XB 2BFVH 3ARFB 1A21A 4LEXH 5IQ7L 4P0DA 4ENED 1PAMA 2A73A 4Y16A 5JW5B 4UBDC 1MCIA 4XXCA 5DD3L 1CD1A 1NEZB 1KG0B 4IHOB 4GH7B 5ALBH 2JCCE 1DQLL 1JI1A 1HILB 1WZ1L 1U2HA 2EDBA 2B1AH 4PGCA 1LO0H 1KB5H 2E7HA 2EDHA 4QRPA 1NGZA 1QSZA 5EZLA 1UB6B 1J10A 3ROLA 3M17B 1U95B 4GAGH 4MJ4A 3B6SB 5T3ZE 1R5IB 4UDUA 2XPGB 5C6WH 1KPVA 1QO3B 2EYRB 2PNDA 3CSGA 3BIKA 2PCPA 2WBKA 1U8OB 3TA3D 4RIRA 2AXFB 3REVA 3GUTB 2VKWA 2YC1A 4OZGE 4E0RA 1NC2B 4OCMC 3QUYA 5AWNH 3IXAB 4HJGA 5SWZB 1KLGA 1FBIH 1UJTA 5LWYL 2CLZA 3GI8L 1AY1L 3H7BA 3EDFA 3O4LB 4IRSD 1KV3A 3G9VA 4XC3L 1ZLVH 4LAJH 3JTSB 3NIGF 5IK3B 1CG9B 1S7RA 3PP4L 4R2GC 5JHDB 3HI5L 3HMXH 4PJFA 1DLFL 4DW2H 5C0DA 3QDHA 3RVTD 3EOYG 3VD4A 4XZUA 2R1WB 1GYAA 4X5XA 1RZKH 4UDTA 1E4XI 1Z9SA 1RY7B 2I60L 2IH3A 3DXAD 2PF6A 4OFVA 2WBJC 3D3VD 5E7FA 3V6FB 3GMOB 4EVNA 1JPTH 4KKLC 5ISZB 3ZKQD 1BBJA 3ZKNC 3B9KD 3QWOB 3HG1A 3RZCC 3MJGX 1OLZA 4P2OB 4YDJA 2OTUB 1X3DA 3U83A 5LCVL 1OAXL 5DJ8A 2DQTH 3ARBB 4XAWH 3WXVH 1IM9A 3ARGD 1M05A 3TESA 4LFHG 4LMQE 5FCUL 5HHPA 5IJKA 1TZGL 4RISH 5JZ7C 1CGYA 1FO0B 4S1QH 1S9XB 2ESVD 1SMOA 1IC1A 5JMOC 2DKUA 2ICWI 4X5WB 1LO2L 5J89A 4Z7WA 1XR9B 4KWUA 5C09A 5BO1H 4FQXC 2YD7A 1N4XH 4H25A 4BQ6A 3QQ9C 3WKNA 1NFIB 1XCTB 1Q9LB 3DRTB 2EYTA 3IETB 3O9WD 4WFHD 1YNKL 1OAZL 1RZGB 3SDYH 3ECBB 4KZDH 3TH4T 3QHFH 5MEQB 2P48B 1KG0A 4IHOA 3RVXC 4KMTH 5AG9A 1QBAA 3DO3A 1NL0H 3BPNC 1HILA 4WI5A 5C0AA 2CDGA 5HGDB 1PLGL 5FO8A 3KYAA 2UZXB 2VXSL 4NNXB 4DKDC 5IMKA 4UIMB 1OARH 2HKHL 1WZMA 2VDMH 3H42H 3UTQA 4NJ9H 1JZ4A 4EI6A 1UB6A 2XQYG 3M17A 3HAEH 3B6SA 4U3CA 3BPLB 4YX2H 3S7GA 4IS6B 2FO4B 4PJCB 1R5IA 1A6UL 1LEGA 4Z77A 2XPGA 1CE1L 5GRVL 2UZYB 2FIKA 1MY7A 1DP0A 2GAZB 2AJZB 1P9MC 1DQJA 1N0XH 2BJMH 3P77B 3MRDB 3C09B 2A6IB 4HPOH 3IRZA 3RFZC 3L5XL 4N8VA 5DI8B 1OGAB 1M71B 3GMRA 5HHOE 5GGRA 4J3SA 5IK3A 1CK0L 3VFVA 1CG9A 5EBMB 1CDYA 3WIHL 3DV6B 4ZXBC 2AABL 4NBYB 4F7PB 5FA3B 1HCFX 1NDGB 3CC5B 2X7LB 2R1WA 4AEEA 1BZ9B 2IAND 2NNAA 2YD6A 5SX4H 4LU5L 1CL7H 3U0PA 2OR9L 4WENB 2RAMA 2EZ0C 1X5ZA 1HYRC 3TCLA 3GSNB 1VKXA 2VWEC 2VRAA 3S4SB 4KFZC 3D85B 4P99A 3I3EA 1A7QL 5CJBA 4PLOB 3QXAB 4HMCA 4MB3A 4M5YH 4BQBA 3LVEA 4RFNB 4K8RH 5KSBA 5C08E 2UY7A 2YRPA 4JFZL 1I8LC 2UY6A 4G6FD 4RWYL 1FGNH 5BV7B 4M61A 4OBRA 1N5AB 1QRNB 1NFDF 5HHMD 4HC1L 4L3AA 4YUEH 5MEND 1KPUA 4F2MA 2R4SL 3MRLB 3LV3A 4MNHA 2JJVA 2X89D 1NFIA 1ZHNA 3V5DB 3GHBL 5ID0A 4WI9A 5EOQL 1RZGA 3OKOB 4MVBC 3ECBA 4CKVX 5A2JH 4UAOB 4TNVF 1F3JB 1HQ4B 4MA7H 3VD3A 5T1LD 2DQDH 2EH8L 4NRXA 4F37K 3PWJA 1VPOL 2PYED 1X44A 3FJTA 5F8RC 4G8IB 5SWSA 3SDDB 3T0VA 5IB2B 4MAYD 3GNMH 3MXVH 3C60A 4DTGL 5C07B 4RX4D 4ENEC 4TYUA 4J3WA 3T1FA 2PW2B 4XNQA 3DYPA 3MRFA 3CFIC 2OZ4A 3FQWB 12E8H 4RFEB 1R3KA 3QDGD 5FK9A 3U30B 4P5MB 4MS8C 4TUJB 2JCCA 3MRBB 4EUPG 4XPHL 2AJZA 3OZ9H 4NQXA 4LLDB 4QHNA 4U1LB 3UAJD 4OCRH 2MJWA 4OLWH 5EU5B 1P4IL 3P77A 5SV3A 3CSYB 1T0NB 3O81A 3MRDA 5E5UB 3MLZL 3OG6B 3JV5A 3PWLA 5DI8A 2R0ZL 1I75A 5CJXC 1MRFH 1I3UA 4LLVA 1HKFA 5TGBB 1VFAB 5EBMA 5E1HB 3WMSA 4FFZL 1IVLA 4LRNH 3M07A 4J1UA 2NTFA 1NMBL 4X8XA 5FA3A 2BNQE 4I0PD 3BKJL 3IDYB 3CC5A 4Y8AA 3MA9L 5HVHC 1A1OB 4RFOH 2CKBL 4IRSC 3T2NL 3BDYL 4Y5YB 3FOLB 3DNKA 3L3IA 3GSNA 3UO1L 2B4CH 4G5ZH 3S4SA 5EULV 3D85A 3W2DH 2R1XA 3IFOB 4K2UH 1ZA3B 2IQ9H 4NZRH 2XYCA 1ZVYA 2Z8SA 1U58A 5GGQH 4JM4L 4LSSL 1NCBL 1YEFH 4WEBL 5I8EA 1UZ6E 8FABB 4OZIE 4P59H 4ACPA 4NZTH 5I1KL 3DMMA 2AKRB 4PR5B 1TQCC 4P9HL 5HGHA 1LK3L 4NP4H 4F9LC 3B9KC 1NUDA 4ZUSB 1F3DJ 1QRNA 2P46B 5D93C 3P9LB 4P3CH 1CFTB 3WFCH 3V5DA 4HUXA 2JIXD 3ARGC 4JRYD 4LSUL 1KFAL 2J8OA 4U1HB 1KSRA 4AEIH 1FNHA 2D3VA 3IFPB 4PJEE 4ZNEE 1JZ3A 1RQ5A 3SGDI 1NUFA 3OR6A 1T7YA 4DAGH 3OHXB 4HWZA 3KLDA 1FFOA 3SDDA 2EDFA 1KTDB 1G7PB 3D0VB 4BSWB 1TQBB 4QTIH 3KPRB 4ODHL 1UKSA 2I07A 3L3KB 3W39B 5C07A 5KVFH 3MV8D 1NKRA 3MRJB 3O9WC 1DBJH 2VSDA 3HI6L 4FZEL 4GT7A 4QGYA 4RFEA 4CMMB 4P5MA 3DROB 3PWVB 5H94A 2X4PA 4Z76B 4OM1H 4C55A 4LLDA 4U1LA 1MH5A 2CDFB 1BEYH 5JR1H 2JB5H 5I8KH 2OK0L 2QSVA 1IMHC 1N8ZB 4N8CL 5FYLL 3SKOB 4H0HB 3MGAA 4TVSa 3HRPA 5I1CH 3SKNB 5TGBA 5D1ZB 5JA8B 4AG4H 1TTUA 1VFAA 1AD9A 4O4YL 5C0FB 3KPTA 5T3XL 5TH2A 2AV7B 4OTXH 5FYJH 3MJ9A 4ISVB 4OCYL 4LARL 1EA9C 4K9EH 2FWOA 2HFTA 4Y4FD 4DZ8A 2H26B 1AC6A 1A6VH 4ZUUB 3NIDE 3UDWA 1T3FA 5J9PA 4GRWH 4N0FB 5HHVL 2VAAB 2R2CA 4LVNC 4U7SA 3CZFB 3QJFB 1QSFB 4XBEL 3IFOA 5D6DC 1R0AH 5HHOA 4OLZL 5HGBB 2HVKB 3U2SB 2EXWD 3EYSL 2P45B 4W81A 1F4YL 2X44D 8FABA 2VQ1A 1SMAA 4P46A 2BNQB 1QFUL 4ZTOH 3MLSL 3VXRD 2Z4QB 3MYJB 3OB8A 4JO2L 4ZUSA 3REWA 1N6VA 3TYFB 5C0EB 1ZE3C 1YEKL 2O5XH 3P9LA 1CFTA 3VCLA 2Y36H 4J2XA 2Y5TA 1JRHL 5F97E 4JY4A 5D6CB 5DHVB 4ODXB 1T7WA 3VFWB 5I1AB 3MGTB 4YDKL 3IFPA 4APQA 3CFJB 3SCMD 3KJ4B 4OZIB 2HKFL 3K46A 3HLAB 4HK3J 5DFTA 2J5LB 4KJWC 3QHTC 4LCYA 3L6FB 5L9DH 4BSWA 1G7PA 3CVHB 3D0VA 5IBLD 1ACYH 3KPRA 3WS6C 3E3QE 4OZFG 3CIQA 1U93B 3L3KA 4UOJA 3W39A 3MCLH 3X3GH 1C7SA 5JO5B 3QG6A 3MRJA 4JFOB 1EBAA 4JM2A 4PP1C 1E6JH 2IH1A 2Y23A 4M43L 3R0NA 3V5KB 2XN9B 1HHIB 1H8NA 2NY1D 1GC1L 4KDTA 3ABZA 3AM8A 3QEQB 5L6YH 3WFBH 3V4VL 4MAYC 1TCMA 1UEYA 4J8RB 3KPSE 2D7TH 4OD3H 1N8ZA 2B1HH 3SKOA 2Z8WC 2ITDA 3U7YH 1L4IA 2PR4H 3SKNA 3G08B 3QBTB 4NUGH 3QPQD 4UTBH 3EHBC 1G9NH 4HDIB 5F1OB 1DQML 3O6KL 1NCCL 5C2BH 4YNYB 2FGWH 4X98B 5LAXB 4HKBB 1RVFH 3B2VH 3G6AA 5EU7E 4ISVA 4CADB 2Q3AA 1K5NB 4PLKD 4V2CB 5CEZE 2APBA 5IBTL 5E8PB 4ZUUA 1OW0A 1QFWH 4MA3A 2VAAA 3U4AA 2EDTA 4MJIE 4R3SB 2VWEE 3QJFA 2X42A 5IEHB 5FYLD 4NM4H 4IDJH 3RP1A 3HC4H 5HGBA 1OQXA 2V9RA 3DSFH 3SE3C 5T3XD 1VGKB 4WHYG 1RU9L 2X4UB 2FH8A 5J11B 2BNQA 4R0LC 4MNQD 1R3LB 1A2YB 4JQIH 5HJ3B 4KHXL 5I17A 1KIUA 3QUXD 1LE9B 5D7LB 1GGCH 4PJBB 2BHYA 4CRPA 1VADB 1S7XA 1H3PL 3I2CL 2JJTA 5LG1A 4HCRL 3EYUH 2AJXL 3SQOL 4ZO6A 1TTFA 3RUGB 2EYSB 4YQXL 3VG9C 1LILA 1JZ6A 4JG0H 2GITB 3NFNA 4GAFB 4D3CH 1YEJL 3VFWA 2YKLH 3MGTA 1RUPL 3CFJA 3GJFB 2WAHA 4OZIA 1KENH 3Q5YA 2UZIH 3RA7L 4M6NH 4F58L 2LAAA 3WHE1 2X4OA 5GHWH 1GL4B 3CVHA 5GS1A 5JUEL 1A7OH 1LP9E 1OP3H 4LMQI 1J1PL 2NCMA 2MFNA 3S36H 1EO5A 1CDHA 4JFOA 2A1WH 4NUJB 4HS8H 4W6XB 4R26H 1YEHH 4LPUA 4PRNA 2XN9A 4ZNEA 4PJEA 4YHNB 1L7TL 2CRZA 4OLUL 3ILQD 2IPTL 1IFHL 5GS3A 5E8OB 3BJLA 2YEZA 3STBA 5CBAB 2CRYA 4H8WC 1IBGH 1BZQK 5TQ2L 1FJ1B 4GXUN 1BF2A 2LABA 3MBEA 4F9PC 4M7LL 4J8RA 3MLUL 2VZ3A 2E7LC 4K07A 2DTMH 1DN0A 5CZKA 3SGKA 5GIRA 3AY4A 2CRIA 1E4WH 4HDIA 2VDPL 1EMTH 1WCQA 1BGXL 3JSSA 1U8LB 5EOCH 4YNYA 4CU6A 5LAXA 3VFTB 4HKBA 2VH5L 4DK6A 4P23A 3I6GA 3MCKA 1K5NA 1I9JH 2BSSA 4JREB 4S1DD 3DI3B 1MQKL 2AV1A 1FL5A 5H37G 1MJ7H 1QRKA 3NCYP 1T5WB 1CLCA 3WCYA 1W0VB 1OP9A 5KJRH 5ACLA 3BRDA 5CSZB 4KMQA 2V5TA 5D2NE 1H15A 1DBAH 3G5ZA 4LSVH 1BHGA 3T09A 4HZAA 1VGKA 2HT4C 4IMLA 5FOBB 1NCTA 1I1AD 5D1XC 4Y4FC 5KBNC 1R3LA 3DXAE 3IJHA 5FUCE 3D3VE 5L88H 5CD3A 1ZT1B 2NY5L 3BZFB 2HRLA 4PJBA 2IG2H 2DWDB 4MXQD 3FT3B 4U6VL 3L5JA 2DMCA 3CCHA 1EEQA 4OSUH 3WBDA 4FS0A 3RUGA 2FD6H 2KQNA 5HD8D 4EDWH 2R1YA 3OSKA 3RI5K 1BBDL 2OJZH 4HX1A 4U1SB 4XMKH 4BJLA 3T0DA 4HBCL 4NQSB 3U0WH 2LFGA 3H3BC 3Q48A 3QIBD 4FQ1L 1MLBB 2F5BL 5FO9B 3VGAB 2DQIH 2HJFB 3VE0B 4P2QB 5HY9B 3F12A 5CEYA 3P4MB 4RRPA 4FQXA 3D9AL 1EH9A 2MTPA 4OD2A 3MR9B 1REIA 4WFHE 3GIVB 3FO1A 4ELMF 1LD9B 2J8UB 1B0GB 1FPTH 2BFVL 4J3OC 3VWKB 2E9JA 5ITFB 4LEXL 4E5XB 2AJVH 1IEBB 3VFRB 4P9HC 1PGRB 2HLFD 5E8OA 1LE5B 3MLWH 5CBAA 1RSFA 2VQUA 5ALBL 2J8UF 1HK6A 3F7VA 2F58H 5FEBA 2KDGA 3ZDZE 3O6FD 3B5HA 2B1AL 1CF8H 1UJ3A 2IPUK 1LO0L 3NPSB 5DJXB 4WI4A 5F96L 1KB5L 1MI5D 3Q0HA 3KHQA 2NY1C 4V1DD 4GAGL 1EJOH 2QV2A 3QAZC 1DN2A 3LH2H 4PY8J 1W72A 2Q86B 5HYEA 1ORQB 1U92A 2CR6A 5F7EH 4HKZB 5DK2A 1G9EA 3D6GA 4GRLC 3BW9B 1AXTH 3ZYIA 4WW2B 5AWNL 1ZLUH 4F7EA 3TO4A 2O5YH 5DHYA 2APFA 1FBIL 3ARVA 4Y7MA 5D1QB 1OY3B 3MV9D 5FA4B 2D31B 3K4DA 4KQ3H 2V5RA 1CVSC 3X3FH 3MRNB 4N1EA 4PJ8B 4IIQB 3U6RA 2GTWB 3QI9A 3TJEH 2IANE 4PLKC 4MYWB 3VFOB 5IMOA 3RWIB 4MJ5B 5E00B 1VEOA 3HMXL 1ZT1A 3BZFA 4DW2L 2IAMB 4MA8L 2PO6A 1MAKA 4Z78A 1P5UA 2PW1A 3L3GA 2DWDA 1RZKL 2ADIA 5JDSA 2XTLA 1Y18B 5E2JA 3QQ4B 1JPTL 4EKXA 3LKNA 5D2NB 5GS2D 5FHBH 3ZZ1A 3GBMH 2WINB 3MCG1 4U1SA 4CNIA 1T5XB 1YQVL 1AXSB 2N1KA 4NQSA 4WFFE 4PFEA 2DQTL 4XAWL 3WXVL 3QUXC 3MUJA 1IC5L 1A9BB 4IBLT 5HHME 5C9JA 3KYNB 4ZPVB 3BT2L 2W0PA 5MENE 3ULUC 2MPAL 4JFYB 2HMIC 5IUSA 3IDJA 4NKMB 4RISL 5I66B 4IEFB 3WDHA 3MRIA 5IJVA 4S1QL 4RAHA 5I75C 4JFDB 5IHUH 1P6FA 3ZSSA 1GZQB 4ONOA 1GIGH 1X5JA 1BFVH 4N0RA 1QQDB 4JDZA 5BO1L 4O2FB 3VWKA 2AQ1A 2ICEA 3LPWA 1N4XL 4UQ3B 3I6KB 2C3HA 2PYEE 3DWTA 2J6EA 4JO4H 4A6YB 5ESVB 3EYVB 3T2PA 3SDYL 4JJHA 1LE5A 3QHFL 2YUZA 3ZTJG 1U8IB 4KMTL 3JTTA 1RHHB 1NL0L 2HFEA 1BOGB 4JVPA 1LP9A 1AP2B 4YHKH 25C8H 1FV1B 3ZE2F 1MHHA 1MFAH 3E1F1 4Z8FH 5KSAB 2G9HA 1T22B 5E4EC 2B7DT 4NQUA 35C8L 3QDGE 1OARL 2VDML 5F89A 3H42L 2BVPB 4NJ9L 5GGTA 4GG8B 4S1SH 3ILQC 1OTTD 4UB0H 1A0QH 4KJPC 2FNBA 4YX2L 2VR4A 4XRCB 3FOMA 5F1NB 3T3PF 3RDTD 1LEIB 1Q94A 1ZGLB 3LS4H 1MHEA 4PBXA 4YXHH 1AJ7H 1KPRA 3H9ZA 3I85A 1Y6MR 3S36X 4BSJA 3BW9A 1RZ8A 1RZIB 4WW2A 3VMOA 1PX3A 1I3RB 1MSPA 4LVOB 1N0XL 5B38G 4XP4H 2BJML 4PV8A 2MOVA 1JHLH 4PG9A 5FA4A 1ES0A 2VZTA 5I18H 3X14A 2D31A 1TNMA 4HPOL 2XZZA 4L29B 3TA3A 1MFDH 3IDNA 4QHMA 3RNKA 2ZUTA 3OBAA 4LCWB 3VFOA 1KULA 4M03A 1QD0A 5E00A 4S1DC 1L6ZA 1S7QB 1XIWB 3FTGB 2X4QB 1RUQH 4HS3B 1FFNB 2APXA 1LGVA 3AS2A 3PG2A 3CDGB 4LPVA 5ICYB 3MRRB 2GEEA 4U6HB 1CL7L 2VITA 4GG6B 5D2NA 1UB5A 2WINA 1EHLL 3QEHA 3BX7C 1CICB 2XFXA 3P4OB 3HR5B 3PXJA 5K9KA 3RWJB 3RKPA 3GZKA 5DUML 4GKZA 1LO4H 2ZOLB 3D3VA 4M5YL 3BGFB 4ZFOL 1A9BA 1NKOA 4K8RL 4MXQC 4ZPVA 3LN5B 5TDNB 4KKAC 3EDKA 4NCDA 4GG6F 2O61B 4MA1C 5TDPB 2BOCB 4PRID 4JFDA 4YHMH 5EFIA 4JRYE 1FGNL 2AJ3B 3F7YB 4NBZB 4YUEL 3WFEH 4O2FA 4HV8B 1NGXB 1HWHB 3RVUC 3I6KA 1X7QB 1BLNA 1ERNA 4A6YA 6FABH 3HE7B 1JTPA 3VXTB 3IS1X 5ESVA 3EYVA 4NWTL 3VXNA 1A02N 4QXWA 1M1SA 1QACA 4OCLC 3VGDA 1XGTB 1ITCA 4MA7L 1BOGA 2DQDL 2EC8A 5DQJB 3UJIL 3MV8E 2FATH 2XZQH 4P4RB 3WLWC 4N0UB 3PJSB 1NBYB 1QA9B 4I77H 3GNML 3MXVL 3HUJF 1TZHB 3F62A 3RIFK 3ZL4H 1KJVB 3LSOB 3QXVA 2FL5B 4GG8A 4OGAD 2CRMA 3EGSA 3K1DA 5HYQB 4QRRB 3LMJH 2YUWA 2YUVA 12E8L 3Q3GB 3GBLA 5KG9B 3KWWA 4NNYA 3PF2A 1ZGLA 4P4KB 1OHQA 2D0HA 3OKEA 3OZ9L 1OD7A 2WQ8A 2PXYD 4OCRL 1I3RA 4OLWL 4F80A 4U3HA 5EBWA 1HHKB 1F45A 1H5BB 2A6KB 1B2WH 3BKMH 4L29A 3WL9B 4ZSOE 4OT1L 3DURA 4XXDA 1MRFL 1B4RA 4X7FC 2M1KA 5DRXB 1T6WA 1FZOB 1XF2B 2MCPH 4XBGB 4LRNL 2P49B 1XIWA 3FTGA 2X4QA 4HIXH 4ALAH 4HS3A 3RTQB 1UCBH 4JY5H 3CDGA 4L1DA 3O8XB 4U6HA 4RFOL 4RCAA 3EDEA 4H0IA 1HNFA 3GIZH 4HJ0D 3K2MC 4PRBA 2XICA 2B4CL 3CDCA 3O6MH 4G5ZL 3W2DL 5C7XH 4C54A 3DVFA 4K2UL 2VKXA 4KI5F 3V5HB 2IANA 3QR2A 3VXRE 1PVHA 2IQ9L 4NZRL 3HB3C 4X6DF 4PGJA 3GSXA 3QNXB 1P7KA 1CQKA 5GGQL 1YEFL 2EIZA 5BXFA 3LN5A 4U7KA 4P59L 3WFDH 4OQ1A 3SDAD 3CMOL 4G3YH 5CP7B 5TDPA 2BOCA 3WXWL 2AJYH 2JJSA 4NP4L 2AJ3A 3VI3E 2OTWB 3T3MF 3RZWA 5FFLA 1OSPH 3MRQA 2W07A 4P3CL 1NGXA 1U3HD 2Z8RA 4U6XA 2W59A 1QSED 1X7QA 4MXVE 3WFCL 1YEEH 4L3CA 2NY5C 3HE7A 4HLJA 3VXTA 4FXGA 5CZXD 1T1WB 3IXTA 4BQCA 4AEIL 2FR4A 4K8RD 1DDHA 5MENA 4OB5H 4JFPB 4DAGL 2EO9A 1D5IH 4P4RA 1FO0H 4NQEB 3PJSA 5ACMA 2HT2D 4PJXB 3VXSB 1UEMA 2IPKA 5F72S 3HS0A 4WW1A 1KJVA 3LSOA 5KVFL 3DPBA 4KRPB 4HAFA 2BMKA 1DBJL 2PYEA 3IFNL 3H9SB 1OAYH 4HIHA 3LRGA 4LSQH 4NO3B 5KG9A 1B9ZA 2HRPH 4PJXF 5K59F 2BC4A 4EQ2A 4LDOB 3MLRH 4HLZH 1BIHA 2FX9H 4FFWC 1RJZA 2AXGB 1BEYL 5JR1L 1SYVA 1RJCA 2JB5L 4KQ4H 5I8KL 2BERA 1AKJD 2A6KA 1OP3K 3KLHC 5D7IF 1KACB 1ZLSH 5IFHH 1MCOH 3VWJB 5HYJE 1CZ8H 1W8OA 4U1GC 5I1CL 3RDTC 2QQLH 3VFNA 5DRXA 4ZQKB 4JQVC 4KV5E 1FZOA 3VA2C 3EO9H 2GW5A 5TJWK 1CGSL 3SKMB 4HXBH 3L7FA 3O3DB 3PNWA 1IC4H 5KS9E 5FYLE 1P5VA 4K9EL 4OKDA 3HC0B 3KNBB 1IGYB 4L8BB 2Q8AL 2NW2A 1U8KA 5F3HB 1A6VL 3IDXH 4K3JH 1C08B 5C0GB 1UG9A 5T3XE 4G9FE 1ZHBA 1FNGB 4I0PA 5J6HB 1R0AL 4NYLB 3QO0A 2GUOB 2LV4A 3DYOA 4S2SA 3V5HA 4XCYB 1JMZA 1U8QA 3QNXA 2Y5EA 3OJDA 3WUWG 4FFYH 1XF5B 2AEWA 3QDMB 1A9EB 3KPLB 4ZTOL 1I1RA 1WT5A 3QZWB 4G8GD 3MACH 3RHWF 1IGFH 2OTWA 2XT1B 4CL7A 4M93B 3T4YB 3GSNH 2O5ZH 1CDCA 3BHBA 2Y36L 3P0GB 1BFTA 4ZFGH 4PJDB 1ITBB 3P4NA 3FO2B 4S1RH 2Z31B 2EE2A 1AR2A 1CDGA 2EKJA 2EDKA 3TNNB 1G1YA 2D03L 2XZAH 5DD6B 4JFXA 4OM0H 5IB3B 3V79C 4L4TB 4L9DA 5BV7H 5INDB 1NBQA 1YYLH 4JRYA 4OKVB 5L9DL 1ACYL 3G04A 5L8JB 1H3VA 3ZMRA 3BZEA 5MP6H 1F6LL 3MCLL 3X3GL 4RGNB 4WFGD 2WQRA 1OAUH 1WJ3A 4B5EA 5GSRA 1E6JL 4M1DH 3NCFB 5CFHA 1UQSB 4HC1A 5HDQH 2F54D 5TQ0L 3HZVB 5H2BA 4OZGF 3MV8A 1G7QA 1A4JB 5L6YL 3K2UH 4PTUB 5DJDB 5DC9B 3UYOD 1MAMH 3WFBL 1KJ2B 5KN5B 2AXGA 4LCCB 2DIJA 4QCIB 1WZLA 3AREC 2HJKB 4X99B 2D7TL 4OD3L 2OMNA 1AO7D 2B1HL 4XMPH 3LZFH 2A6DB 5SX5H 3VWJA 3HAEG 3U7YL 2PR4L 4OGXH 4UQ2A 4NUGL 2ICWJ 4MDIB 4UTBL 2DWEB 1G9NL 3TO2B 1KB9J 2AEQH 5C2BL 2FGWL 4WY7H 4WRLA 4LPTA 4XPGH 1RVFL 3B2VL 2PXYC 3VXMD 3HNSH 2NY3C 4AM0B 4PGEB 1AFVL 3HC0A 1KB9K 1W8NA 2R2EA 5F3HA 1I1FB 5T33H 1QFWL 2YN5A 4D0CB 1C08A 1GGYA 1AIFA 3MNVA 4KAQH 3O2DA 4NM8H 2YD9A 5B39B 4ZSOA 3GKWH 1FNGA 4NM4L 5JOFB 2XWTA 4JJ5A 5DWUH 5HYJB 2GTZA 4NPYB 3HC4L 3PDGA 3WHXA 4NYLA 3DSFL 1IAMA 4YDVA 1M4KA 3ALWA 1V3JA 4YHYB 1WBYA 3VW3H 4KUCF 2X9WA 5SV4A 1CIDA 3QZWA 3S3SA 4G8EB 1T66C 3FRUB 1JYVA 4NKOA 4R4NC 3B2UC 1GGCL 4S11A 4HJ0C 1X4YA 4Z5RB 2YOCA 5AYUL 3EYUL 3PHSA 4X6EA 4KVCH 5ACZA 1ZLUK 2I9TA 1CBVH 1HEZB 1ETZB 4PJDA 4P5TB 5DJ2B 2E7MA 1FC2D 3VXRA 3FO2A 5ENWA 4D3CL 1WWWX 2YKLL 3SDAC 2CKBA 1F11A 1A5FH 3DI2B 2I9LB 2UZIL 4KZEH 5DD6A 4FQIH 2B5IB 2IPUG 2Y72A 4M6NL 2VERN 4L4TA 1PSKH 2VB5A 2BVEA 5INDA 3C5ZB 3S3JA 4JO1H 1A7OL 3QHZH 1PBYA 1U3HC 5E6ID 1VGEH 3SCMA 3S36L 4FA8A 3VDBA 2A1WL 2EIEA 5DUBA 5KSVA 3KG5A 2C3WA 5CZXC 1J0HA 3KS0J 5IEKB 4LSPH 4HS8L 4K8RC 4R7DA 3ZDXE 4R26L 1YEHL 4XWOD 2EDRA 3QXWA 3VGEA 4PJ7B 3VFPA 3P4LA 3HZVA 3S97C 2HT2C 1J05B 2WP3T 2RIKA 2ICCA 4YO0B 3E2HC 2CLVB 3OR7A 4HH9B 1MI5E 4LCCA 5F1KC 1NJ9A 4QCIA 2AJUH 2PN5A 4Z7VE 1E4JA 4U1NA 2BVOB 4Y5VC 4R97C 1YDPB 4NKDB 2W38A 4X99A 4J3TA 4V1DE 3WO4B 2A6DA 2MWCA 3OKYA 2DTML 5EIQA 4PJ7F 3L3OB 1VDGA 4MDIA 3LKSA 2YD4A 1E4WL 3TO2A 4K7FB 5CGMA 4QKXB 5EOCL 2EICA 4R9HA 3DV4B 4AM0A 1Q0XH 1FZJB 5MEPA 2KBGA 1I9JL 4QOKB 2V5MA 3MV9E 3D1MC 4NQDB 5DSCB 4OFIA 4EOWH 5DRWA 3QUMB 5GSVB 4D0CA 1MJ7L 4LHUB 3UPAA 2RR3A 4YHZH 5B39A 1K8DB 2ZOKB 3C87A 3EFFA 3O2VL 4PB0H 3TV3H 5JOFA 5KJRL 3SE9H 5HYJA 4NPYA 5B8CC 4B50A 3ARYA 3MNZA 3O3UN 1A6WL 1DBAL 1YPZB 4LSVL 4X7CC 1HQRA 4OUUA 4UUJB 1MFCH 3G5VA 1GHFH 3MLXH 3QDJD 3BP5B 5ESAB 2HJLB 3WNPA 4BSVA 1D9KB 4BELD 4Z7OF 3OX8A 2FBJH 5L88L 5LJYH 3N1MC 3GSUB 4G8EA 3FRUA 5GS0H 2NY0C 3HCVB 2IG2L 1L9MA 4NC2B 3SO5A 4Z5RA 4WI3A 3T2QA 4WEUD 4G9FA 4OSUL 3V7AG 5D7JB 3RU8L 3S34H 4BQ8A 4MMXC 4EDWL 4P5TA 3UPCA 1IGJB 3MPCA 4OIIH 5DJ2A 3PUCA 4YIQA 2OJZL 4XMKL 3OXRA 5BRZD 3U0WL 4J7RA 2IQAA 3EYQD 5HI5D 2I9LA 2PKDA 3K3QA 4LAQL 1SY6A 4XP5L 4QNPE 5EDXA 2DQIL 2QSTA 4IMKC 3MYZA 3RRQA 3C5ZA 3JV6B 1RUKH 2HYMA 3HKFA 5E2WH 2B4CC 4KROB 1MAJA 3TBSB 3CUPA 4RGMB 5M7QA 1CQYA 5EBLB 3GO1H 4MCZB 3QCVH 1FPTL 4XAKE 4JZOA 1C5DB 4X6CE 4XVSH 5DHVH 3RQ3A 3U36B 4MX7B 4LEOB 4BFIA 4DKEH 3KPNB 5FDWB 3IDMB 5DFWH 1J05A 3QRGH 1I9EA 5IB1A 3NFPA 4HH9A 3CVHH 2E27H 2F58L 3NA9H 5EUOB 3P9MB 4NKDA 3LEXB 3WD5L 1CDBA 1FYTD 4JFFE 1CF8L 2Y9RT 4N5UA 4MQ7A 3DTXA 3L3OA 3ZKMD 3FB7B 3GSVB 5EOTB 4DGVH 2CO6B 1OTSD 2YD5A 4K7FA 1WV7T 4YC2B 4O9HH 1UH2A 2FEDD 1EJOL 2V2TB 4LF3A 1QFHA 3LH2L 1I7UA 1FZJA 2DMBA 2BXZA 2UYLB 5F7EL 4JLRB 5GGVH 3QUMA 2DTSA 2W1NA 1AXTL 2CIIA 5CUSH 4ONHB 1AQKH 3KXFE 2O5YL 1D5BA 3LN4A 5TDOA 3WS3A 5J57B 1WFOA 4KQ3L 1YPZA 5HI4D 5IROC 4UUJA 3MUHL 4L9LB 1NGQH 4H26B 2NZIA 4YPJA 3TJEL 4LGRB 3BP5A 2HJLA 4HXAH 1NBZB 2HN7B 4CMHB 2OP4H 1MHCA 2ADJA 1EHXA 4LPCA 3MRHA 1RK1A 3VI4E 5F1IA 1BD2B 4GSDH 5EIIA 3HCVA 1BJ1H 4WTZG 1KEGH 3EOTH 1J1XH 5J1AB 5DZNA 2CIKA 3AS3A 1I1AA 2CJUH 1TVHA 4YEEA 5FHBL 3G6DH 3C6LD 1YEGH 3GBML 4G7YH 5GRYA 3C8KB 3FO0H 5H35B 3H9HB 4PRIE 3QCTH 4LVEA 3BP4B 5SWQB 2F53B 2BOBB 2P24B 4OUOA 4LLWB 3PV6A 5F93C 5IM7A 3T0BA 2AI0H 3A6OA 5T5NG 3RVVD 3OXSB 4YWGH 3TC9A 4B41A 5IHUL 3TBSA 4AEFA 3QIBA 1AHWB 1GIGL 4X0KA 1JZ2A 5EBLA 1BFVL 4MCZA 2DL9A 4LQ1A 1CE6A 2BXYA 2LVEA 4NC0B 3U36A 1XMWA 4RAUA 3DBXB 3UYRL 2IBBA 2X4SA 3KPNA 3GJFH 3PE9A 4EN3B 3PQYD 4JO4L 4YR6A 5JORA 5FDWA 2E6JA 4HCRA 4R2GB 1X5GA 5CZVH 4N1CA 1X5AA 2OL3B 3KPMB 3P11L 2NY2D 5D72H 1YEDA 4YHKL 1T04B 25C8L 4PRDA 1P6AB 1AI1H 4K94H 4TQEH 1MFAL 2ZUVA 5ANME 4UOW0 2WBJB 3ZT7A 5JHLH 5E24E 3E0GA 3R0MA 4NO2B 3RZCB 3GSVA 4JAMA 2BDNH 4KVNH 3OMZA 2FDBP 4S1SL 4UB0L 1FL6A 1A0QL 4MD5A 4GLRH 2V2TA 3O6FA 5HGGS 2HVJA 3A6BH 3LS4L 5JPNA 4YXHL 1A14H 1RFDH 4JLRA 1AJ7L 2P4AB 2OLDA 4V1DA 2QHLA 4ONHA 3GHEH 2VMFA 4XP4L 2WIIA 3FONB 1BX2B 2E9WA 4HG4J 5JA9A 3QIUD 1QHOA 2P8LA 3BGMA 1MFDL 4L9LA 2WSKA 5E6ZA 1RI8A 4H26A 4UNUA 4BZ2H 4JKPL 5CEXB 3C8DA 1W72H 4HG4K 1S9YB 2EXYD 1RUQL 3ALXA 1KEMH 4JFQA 4KJYB 3CH8A 2BNRB 1P53A 1C12A 1ZS8B 2F15A 5DK3A 4EXKA 3NCMA 3C8KA 1X5YA 5H35A 1U8MB 3H9HA 5JQHC 2N56A 1LO4L 3DGGB 1FCCA 4IOFD 1NFKA 1LMKA 3ARXA 2BOBA 4P3DB 4LLWA 1QSEE 3HE6D 3TYGH 4OF3A 3OXSA 4R7NB 4YHML 4WUUE 5EU4B 5BW7C 1AHWA 4WWKB 3UYPA 5GRJL 2ZCKH 2XG5A 2ZSWB 3WFEL 1SEQH 1ZLWK 1QLEL 1JWUA 5HI5C 4L1HA 4XB8A 1T0MA 2EC9U 4X4ZA 3BE1H 2X1XR 4GBXD 4KTDH 2OI9C 4EN3A 6FABL 5GGSB 5JLZB 3LQZB 3AMLA 4WO4D 2MHAB 1JBJA 2HG5A 4Y4HB 4KJQD 3FRPG 2OL3A 4AZ8A 2V5YA 3O6LH 2FATL 2FLBT 1T04A 4I77L 2FX7L 2NX5D 2F8VA 1MLCA 2WUBH 2IFFH 2DDQH 1FLRH 3RIAF 3NGBB 1JRHI 4X6CA 3ZL4L 4MSWA 3TBYB 2C5DC 1QSVA 2J6EH 3ILPB 3LMJL 5FOJA 3QUZB 1XF1A 3V6OC 4LRIA 4RMSA 4NN6C 1QR4A 5F9DC 4PY7A 5DS8B 1Z9MA 4PJ5D 5E1AB 4JFFA 4HWBA 4NRZB 5EU6B 3FONA 1OTSC 5I73C 1Z2KA 4MQXD 4ETQA 3HPJA 4HIJA 1B2WL 4ZNCD 3BKML 1T83C 5GGTH 1CIUA 5CEXA 4Y16D 1WQVT 3VRLF 1ORSB 2MCPL 1OAQH 2YA0A 3NAAH 2HTKD 3BXNB 4EJ1C 1S9YA 4HIXL 4ALAL 5TF1H 1MF2L 4M8QA 1UCBL 4JY5L 4CVZB 3T77B 2VLLB 5C9KA 4C83B 3KXFA 4I18C 1NLBH 4FOMA 1ZS8A 1M6OB 3CDFA 5HI4C 3T1WA 1XGPA 3GIZL 5KW9H 1IAKB 4BFGA 1XFPA 5C7XL 2VR5A 2RQ8A 4L8SC 5SX5K 2XTJD 4G8GE 4HIIB 4ZD3H 3MUZ1 3C5SB 1FIGH 5F6HJ 2G60H 2CH8A 3DGGA 1NC4B 5T1KB 1U41A 1N64H 4P3DA 3WFDL 5F9JA 2XKUA 3V7AE 1AQDB 1JL8A 4G3YL 3QUYD 5I9QB 2AJYL 3LRHA 4R7NA 5EU4A 2Q76B 1KNOB 3C6LC 4WWKA 3P2TA 4BFEA 4KH2A 2WANA 3HMXA 32C2A 4JHAH 1OSPL 1BQSA 2P5ED 5FF6A 3CFDB 5E99L 1YEEL 5JLZA 3KGRA 2FJGB 3VMPA 4FABH 3RY6C 2XXCB 2GJ6B 4Y4HA 4QYOA 1D7FA 2FRGP 4XVJH 2X2YA 3S88H 1GGBH 1JGEB 1A7NH 4OB5L 1ZEAH 4UV7H 1A1NB 2PTTA 3BQUC 1FO0L 1U3JA 3BPCB 1H0DB 3ORJA 4WUUB 3X17A 3WUZA 5IR1A 3DUUA 3HG1D 1KUMA 3BN3B 3SY0A 2F54E 1UM5H 1INQA 3LKPB 3HR6A 4QXTA 3TBYA 1OAYL 4OD1L 4A6YH 4LSQL 3L95A 4PJHE 3WEXB 3QUZA 1A7PH 5IVXB 3UTZB 1YJDH 2HRPL 2NY2C 3RX7A 2A74A 3EKCA 1J12A 3NACH 5E2VH 2QADD 1FG2A 1I85C 3BESR 3WFZA 1AO7E 3C08H 2QR0A 3RGVD 2FX9L 5TE7H 4L8CB 5JIKA 3SPVA 2XA8H 5ANMA 4NRZA 4OAWB 4KQ4L 5EU6A 5C0CD 3TBVA 5CHNB 5D93B 1T7XA 1JPSH 1QYGH 3ARFD 3F5WB 1ZLSL 1MCOL 1GOGA 5HYSB 4ZOBA 1CZ8L 5E03A 3VXME 2OBGA 4A2LA 2QQLL 2UVEA 1AGBB 3GSOB 4D8PB 1QBLH 1Q1JH 3EO9L 3MRPA 4ZFFB 1FHGA 3BEVB 4HXBL 4CUCA 1IC4L 4G43A 4CVZA 3T77A 4CU7A 1U91B 3HAEA 4C83A 4B7LA 3IDXL 3QIUC 1EZVX 4K3JL 1M6OA 2C3GA 5IVNA 1TVDA 1FNSH 1LEKB 5ILTH 2BSTB 1IAKA 5I76A 1DFBH 3OKKB 4DUXA 3GMMB 4G6KH 3C5SA 1R24B 2VC2H 4QRTB 4ZAKB 4TNWF 3ARSA 1NAMB 1NC4A 5T1KA 4C56B 3VJ6A 4GRWE 4FFYL 3TEUA 4D9RD 2P8MA 1B0WA 3BEWB 4LIQH 1NC2D 3V4PH 3D48R 3MACL 3MSPA 5SWZD 2Q76A 3TCXA 1IGFL 4HPYH 5HPMB 4OGZA 5E9DB 1U42A 4LP4A 4Y19B 4UTAH 3O4LD 3HNTH 3GSNL 2O5ZL 1J8HB 3TZVB 1T6VN 3KPQB 4QXUH 5CAYB 4N0CD 5D70H 4ZFGL 4JZNA 2H2SC 4IOFC 5JHDD 4S1RL 4XCFH 4Y5XB 1ED3B 2GJ6A 2BSRB 1MREL 2J8HA 1AY1H 1DUYB 1JGEA 5FYKU 2XZAL 3VGFA 4MCYA 1U3HA 1A1NA 4OM0L 3LKOA 1QSEA 3BPCA 2KPNA 1H0DA 5BV7L 5J0BA 4WUUA 1YYLL 4YXKH 3PP4H 5ISZD 4HFUH 1U8HA 3HI5H 3MGOB 1WAAE 5CGYD 4ODUB 4ZO9A 2P8PA 4P2OD 2W9DH 5MP6L 3G6JE 4LVNB 4GBXC 1I4FB 3LKPA 4WO4C 2CD0A 3WEXA 3WNMA 4WV1C 3BUTA 5L2JB 4JDVA 4M1DL 5IVXA 3UTZA 5HDQL 1RMFH 1UVQB 3I02A 4FFVC 2DQGH 5CP3A 5MI0B 2JJUA 2GYSA 3K2UL 4L8CA 4NFDA 5BQ7B 4YFLI 1XCQB 1EHAA 5CHNA 3CFKB 4PP2B 4N9GA 1JF5A 1TVBB 4OZ4B 4Q6IC 2BRQA 4FQPA 1JHKH 1TZGH 2C4XA 4ZO7A 4OGXL 1KELH 4XPAH 4C4KO 4PJGE 1AGBA 3FB8B 2Z92B 2AEQL 4JHWH 1BOYA 4OIBA 4WY7L 4XPGL 4G6FB 1XF4B 3AB0B 1HXMA 5DEGA 3HNSL 1TJHH 1UADC 3ZTNH 3ULVH 1S9VA 1DVFB 4YZFE 4MD0B 4PG2A 4WFED 3EZ8A 2EDQA 1K4DA 1LEKA 4KAQL 1CLOL 4NM8L 4Y16C 3QDJE 1LO5B 4PTTB 3NIFE 3GKWL 4HKJB 5DWUL 4XXCC 3ALPA 4ZAKA 1KCKA 3IKCA 5FUZL 3PHOA 3WFHA 5CLWA 3BEWA 3VW3L 3CK0H 1MRCH 3Q1SH 4E41B 5E9DA 5BRZE 4ZUVB 4KDVA 1J8HA 4KVCL 3TZVA 1OGAD 1CBVL 4WI6A 3QEGH 3QNZA 1FP5A 1YN7B 2VDRH 3ES6B 5ETUA 1NPUA 3ULSA 4Y2DB 1ZVHA 2QLVB 4Y5XA 1KTKE 3KLSA 4TRPH 2EKSA 1ED3A 3D2UB 3BPOC 1BJ1J 3ETBF 1A5FL 1DUYA 3QUYC 4QO1A 4KZEL 4FQIL 1JNLH 4O2EB 5EC1A 5FM8A 1PSKL 1VENA 3UZVB 3DIFB 4DCQA 4Q9RH 1I8KA 4JO1L 1BFOA 3MGOA 3QHZL 1XAUA 4ODUA 1VGEL 3PL6B 5TE4H 4MZ3A 3D85D 4OZHE 3JWOC 3MO1A 4LSPL 4LPYA 1AD0B 1I7TB 4KXZH 1ZANH 3EOAB 4I3RH 4POZD 5FGBA 4AQOA 1VERA 3ARTA 1MJ8H 4PJAB 4R0LB 1EEZB 2X4TB 4I0CC 1HZHH 5JNYB 1QRND 2AJUL 1T1YA 4CVXB 4WNQB 5CJOH 1S3KL 2F54A 2FJFB 2K9UA 3RWFA 3KYOB 4DQOH 1OB1B 4PJAF 1MVUB 1XGYH 3SHSA 4PJHA 4DVBA 1WISA 3FB8A 5IJKC 1K85A 2VXVH 2DLFH 4J4PA 3FHAA 1LDPH 5L0QC 1AO7A 4MD4B 4YBQC 1R3IH 1JZ7A 5IGXL 5DMKA 3SDDD 1DANU 1J0YA 3EYFA 4EOWL 1DVFA 2QJDA 3ZKSD 2NXYB 5L7XH 5A43C 5C07D 2MQ0A 1Z0MA 1LO5A 1NMCC 4PTTA 4PB0L 4HKJA 1N2RA 2EH8H 5IG7A 3SE9L 3QRFM 1VPOH 2X9XA 1G9MH 4ZUWA 2Y7QB 1KTRL 3QT2A 3UTTB 1MFCL 4LSRH 1GHFL 3MLXL 1ZVSB 1E28B 1IM3A 2A77L 5IHBA 2FBJL 3UBXB 5GS0L 4FN0A 4NSKB 3T65A 4E41A 1WCBA 3DX7A 1GZPA 4Q7DA 4ZUVA 4N8VG 3O2DH 5DGQA 1I7RB 4JB9H 3S34L 3RL2B 1U8PA 1YN7A 3ES6A 1K4CA 4OIIL 4Y2DA 4FTVB 5DFVD 1JWMA 1HOCB 1HSBB 4XCEA 3AAZB 3RWGA 1CFVH 1EGJH 5CS7A 4AYFA 4HGWB 3MLZH 4ESKA 1BFSA 4ORGA 3GRWL 4HQQH 5SX4I 5E2WL 1IEAB 3LEYH 1SEBB 2EECA 4ZUTB 1CL7I 2YWZA 3PL6A 3SBWA 3WYRA 4F7TA 3GO1L 3QCVL 2OR8A 2ZUYA 4HMDA 4LDLB 4XVSL 1T7VA 1AD0A 4DKEL 5J06A 3S35H 2ADGB 3T2NH 3O4OC 1PZ5A 5E6IA 3IJYB 5IESL 5D1XB 1EEZA 2EDDA 1F4HA 4YE4L 3QRGL 1KJMB 3VXPB 1TITA 4OIAA 5CGYC 4B0MM 3CVHL 1TFHA 2E27L 3NA9L 1WAAA 1SJEB 1NCBH 3EOBA 4JR9L 3G6JA 2EO1A 4P57A 1RK0A 1QLFB 2N7BA 4JZJA 3OKLB 1OB1A 5GGVY 3IGAA 1MUJB 3QJHA 4DGVL 2P7TB 5BZDA 3STZB 4G8FA 4JCMA 4NDMB 4M62H 3LIZH 2NR6D 4QRSB 4HLZG 1OCWH 3CZJA 4KI1A 2WZPD 5I6XB 3WJJA 3MV01 2A38A 2FGZA 4HK0B 2ZUXA 4XVTH 1GRWA 4BK5A 3B9VA 5GGVL 3KPRD 3QFDA 5AEAA 3MRKA 5CUSL 5JPMB 3VH8A 1AQKL 3O0RH 1I9IH 3C6SB 4PJGA 1CTNA 2VN4A 3FFCB 3SJVB 2X6MA 1NGQL 4ODHH 3MJ6A 4M3KB 2XOTA 1E28A 4U1JA 4HXAL 4WI2A 1UXSB 2OP4L 1UM4H 3UBXA 2NY6B 2FJHB 4GSDL 1V5JA 3C60C 5B3JE 5HHQA 3EOTL 2NXZB 1J1XL 5A16B 2FSEB 1N59B 3BPLC 3S6CA 5CCKH 3CXHJ 2GY5A 1P7QB 1CXHA 2Q3ZA 1A1MB 3N0PB 1DQDH 3RL2A 5D1ZD 3G6DL 4G7YL 1X5LA 1HSBA 1BVLB 3FO0L 4P48A 3AAZA 1MFBL 2OK0H 1KIQB 3CXHK 1JGVH 2Z91A 3R4DA 1S7VB 3QAZB 1FDLL 1ONQB 1S7WA 2B0SH 5GS0D 1T21B 1Q9OB 1YA5A 1TETH 2C1PB 2AI0L 4GRLB 1SEBA 3EIFA 5DTFB 2ZSVB 4ZUTA 1ZA6A 3T4AB 2CK2A 3T0XA 3CVIH 5ITBH 3AGVA 4YWGL 3S4SG 1CT8A 1QSFD 4HUVA 4UT7L 4KGJA 2VLKB 2IALA 5HHVH 3LN9A 4GXVL 3LCYA 3IJYA 2BNQD 2VTFA 1V7MH 1SY6H 1EZVY 2NX5E 5CZVL 3B5TA 3V7MA 5C0JA 3PABA 1H3GA 5I1HH 3QWQB 5DVNA 5F9WB 3TVMB 3KPPA 5D72L 1MPAH 3THMH 1F4YH 5DK0A 1A7BA 1AI1L 5JHLL 3OKLA 5F7MC 1J86A 1UWGH 2BDNL 4NO5B 2V7HB 1MUJA 4KVNL 3M45A 2CDEB 2P7TA 4N68A 2ZKHL 4KU1A 5I2IB 4NDMA 3DMMC 1EXUB 3N85H 3DGCR 4PJ5E 3A6BL 4FXKB 4HFWA 4NCC2 3L3DB 5FCSH 4HWEH 5KS9F 1JZ8A 1A14L 5CJ5A 2V2XB 1CFSB 1RFDL 4HK0A 3X13A 4Z95H 2IADB 3CFCH 2RHEA 1ZXQA 4NO0B 5C0RL 3UEZA 1YY8A 4R8WH 3GHEL 3FQUB 1DANT 5GPRA 1IL1B 2FX8H 4GJTB 4O2CB 3I3DA 3C6SA 5FYKH 1CFQB 2V7NA 2VDNH 4YXLH 3SJVA 2Q8BH 3WHE0 2XN9D 3MFFA 2ILLA 3STLA 3ULUF 4BA8A 4BZ2L 3FQXA 4TULH 3OGCB 3QEQD 1EJ6A 3SDDC 43C9B 3BN9D 1AGFA 3CH1B 5HDBE 4RMVA 5LGJB 1KOAA 1HINH 2VLRB 1LNUB 3QUMH 1OF2A 1KEML 5D2LB 4X7TB 1SJHB 2C1OA 2XTJE 4F37F 4D0BB 1GC1H 1MCQA 3UC0H 5E4EB 5I16A 3E6HA 4LL9A 2ORBH 4PB9H 1BVLA 4MZ2A 1H3UA 2FCBA 4GW5A 1MCWM 1S7VA 4P23D 1DLHB 4MLIA 5DMGD 5D2LF 3OJVC 3WKMH 1DE4A 1E27A 2JB6A 4LCUB 43CAA 1Q9OA 2P5EE 2X1OA 1MWAB 3T4AA 1E0OB 3TYGL 4AENA 1FL3B 3N1GC 5FKPB 3M1BB 5DFVC 1XH3B 5CGTA 1T4KA 2ZCKL 3HI1A 1SEQL 3WIIH 4LBEB 5IBTH 2VLKA 3IDYC 2XI9A 3BE1L 4KTDL 2KZ1B 1UWXH 1N0LA 2ARJQ 2EIBA 1NCNA 3BMWA 3C9NB 3UDWC 5D7LD 2BHZA 1EO8H 3TVMA 3O6LL 1WFUA 1P69B 2QKIB 4LLYA 1M7IA 4DN3H 4UOW1 5HPOA 3X12B 5B38B 3LDBC 1HHJB 3ELAT 4N90D 5D7KD 4QT5A 3GSWA 2IFFL 4NJAH 2DDQL 1FLRL 3BP7A 3QA3A 3V8CA 4BH7B 1QLRB 3DO7B 5FGCB 4NO5A 1VFUA 2W91A 5C6PB 3MA7A 5TPWH 1TZIB 2CDEA 1F00I 3FQNA 4P46C 4Q6YA 3RWCB 2J6EL 2R23A 5C8JA 1G7HB 4HCRH 5EORH 1IT9H 2R2BB 3HFMH 5LQBH 4FXKA 3ZKXC 1JTOA 5C0CE 5EO1A 4Z7WE 4QTHA 1G7JB 3W11C 1DL7H 3GSRA 3UJTH 4PGDB 3EDJA 2E5EA 4NO0A 4XNMB 4NC1E 3DX9B 2A83B 1BECA 4MNGB 2R39A 1UZ8B 4APQC 5C6TH 2GSGB 5JW3H 2NR6C 5GGTL 3IF1A 2HFGH 4K71C 5D5MB 2XRAH 1RZFH 1P2CA 1JV5B 3MREB 3U9UB 2D7QA 3CH1A 1TQBC 3FN3A 1IGMH 1OAQL 3NAAL 2DIAA 5TF1L 3U9PH 3BDXA 5MERB 4PGBA 4JM2C 4X7TA 1RD6A 5IB5B 1L7TH 4D0BA 3DRQB 4NNPH 1NLBL 4JQXA 3ZE1F 3UBXI 4ORZC 5I74B 2OX5A 3RY4A 1XGRB 4D9RE 5TFSH 1C1EL 3NIGE 4I13B 4TUKH 4KDTC 5E7BA 3AM8C 1QKZH 1BQHB 2D0FA 3FQTB 4ZD3L 1ZWIB 2DQFB 4OLEA 5C0BB 1DLHA 1FIGL 5E95B 5SWZE 2G60L 4NQVB 1PYWB 1EEUA 1N64L 1ACZA 3O4LE 2CGRH 1QFOA 1PJ9A 4K3GA 4F7CB 1MWAA 1QFWI 3CAFA 3PHQB 2BSED 3DX6A 1WIOA 2IC2A 1KIPB 5JHDE 4DGYH 4JHAL 4MWFB 3HZMA 4IJ3B 2E3VA 1IE5A 1IJ9A 3BH9B 4I4WA 4XNUH 3DVNA 3BAEH 3HE6A 2B2XH 4LLMB 5C92A 5HYIA 4FABL 5ISZE 1OW0C 3C9NA 5GS2H 5FM4A 5IVOA 1IZJA 3S88L 4XVJL 1GGBL 1A7NL 4Z7VF 3RWDB 1SJVA 2VDLL 1YN6A 1ZEAL 4C57C 1KCLA 4G6AD 3CX5J 3V52H 1KCRL 4HH8A 4LCIH 3X12A 4GBXA 1I8IB 2W60B 2A6JA 2WLYA 4ODWB 4OGYH 5I1JH 3MC0A 4WO4A 3EO1B 3DO7A 3RBGA 1S9WB 5GRVK 3CX5K 1UM5L 5F7DB 1CXIA 3FO9A 3FN9A 3RWCA 4A6YL 1QR1B 1IQDA 2R2BA 4M1CC 1A7PL 2ZG1A 4X9IA 3H3PH 1YJDL 5J3HC 2HFFB 2WWMC 2OL3H 4P2QD 2JJTC 3NACL 5E2VL 1G7JA 1BBDH 4PGDA 3C08L 4XNMA 5TE7L 1FNEA 3DX9A 4I2XB 2H3NB 2XWBA 2UV3A 2XA8L 1M7DA 4FQ1H 3T04D 3MMEB 2FB4H 4OBSA 5DEFB 1JGUL 1JPSL 4LOUD 1QYGL 3KJ4C 3VWKD 5DJZB 1TXKA 1QHPA 2VISA 5D5MA 5GRZA 3D5OF 1KT2B 4LDEB 3MREA 5GS1C 1QBLL 1Q1JL 3MRMA 4WFEE 3WIFB 3G5YB 2ATKB 2CUHA 3WLBA 3DRQA 4HWBH 2VXUL 4PJCE 1F02I 3GMLB 1R5WB 1FNSL 2G2RA 5ILTL 5IF0A 2W9EH 1DFBL 4XMLH 4M7ZB 3OKNB 4HKXB 1T1XA 4G6KL 1BQHA 4WI7A 1VHPA 5FO7A 2VC2L 1K9TA 4QNPF 4NQVA 5GGUB 1WK0A 3L7EB 1EK3A 2QSCH 3MBEC 5F96H 2VR9A 5I8CB 1TTGA 1C5BH 4LIQL 1OGAE 1RIUH 4NRYB 3V4PL 5DF0A 3SGKC 4X6FB 3LD8B 4LKXB 4NHUA 4YHIA 1YY9D 3U7AA 5JMRA 4QXGH 3AY4C 3IAQA 3PP3H 4HPYL 1KIPA 5D1QD 4MWFA 4UTAL 3HNTL 3D18A 2N7AA 3E6FB 3N1FC 4PJ8D 4QXUL 2BVQB 4P23C 5D70L 3H8NA 1B6DA 1QEWB 1LVEA 1TJGH 4R4BA 4XCFL 2IAMD 3S3PA 4OF7A 3BZDA 2Z35B 1ZSDB 4GKOA 2P5EA 5C0IA 4PD4J 4OQTA 1B90A 2YBRB 3GGWB 3JBG7 3RVWD 1A3LH 1NFDE 5DMJB 1I8IA 4YXKL 4L8DB 2AS5M 4HFUL 4TSBH 3JV4A 4X9HA 2W9DL 4MA8H 1S9WA 5GZOD 4PD4K 5DD1H 5J11C 2H2PC 1MJJB 4LGSB 4H20L 4P2RE 2ERJC 1EUUA 1QRNE 5I0DA 1C16B 3W5MA 4MXWH 4P9MH 1RMFL 5DC4B 3RNQB 4LKCA 4NN7C 3BSZH 1J9CT 2DQGL 4RRPG 1YQVH 3SE4A 3F8UB 1GPOH 4I2XA 4JFDD 1EVUA 2IJ0C 3MJ7B 3I9GH 2FBOJ 3MMEA 1IC5H 1XF3B 3SGEH 5KVDH 2R8SH 3BT2H 2MPAH 2YD3A 1JHKL 3VFSB 3RGVA 1KELL 2NLJA 4XPAL 1RJYB 3WUWB 4JHWL 5C0CA 5KOVC 3VI4F 3S8WA 5C07E 4X4XA 3ARFA 4K94C 3QP3A 1TJHL 1GSMA 3QNYB 3ZTNL 5JW5A 4AQ1B 4HJJH 3ULVL 3BGAA 5KSAD 4LNRB 4Z7QF 1NEZA 4FHBD 1EFXB 4PRHB 3SDXB 4P5KB 4HKXA 1E4KA 2IFGA 1NGWB 1FORH 5J13C 3FT2B 1W0YT 3L7EA 4Z6AT 2J88L 35C8H 3E3QC 3K7UA 1UJ3C 2CLRB 3CK0L 1MRCL 5EZJB 2BNUB 2UWEF 4NRYA 2KUTA 1U95A 4X6FA 3SDXF 3Q1SL 3Q5OA 2DQUH 4RBPH 3AREB 1QO3A 2EYRA 2EDWA 3F7RA 2VZSA 1S7TB 1AGCB 4FXLA 1U8OA 4YHLH 2AXFA 3ET9F 3GUTA 2BVQA 5FKAB 3QEGL 1A22B 2R29H 5D96C 1NC2A 2VDRL 4LCWD 4O5LH 3IXAA 4Z7UB 5SWZA 3WO3B 4KRLB 4TRPL 1XIWD 2VAJA 2Z35A 3O4LA 1YMMB 1NDMB 1WFTA 5DQ9B 3TO4C 5JW4N 1JNLL 2NY3B 2YBRA 5D9SB 4EDXB 3JTSA 2X10A 3IFLH 3TT1H 4EIZC 4Q9RL 1OM3L 5JHDA 4L8DA 5MHSE 3MLTB 4Z7UF 5CMAB 3VGGA 5TE4L 3QI9C 1DQQB 4XHJD 3NCEB 5IIEB 4X4YB 3LKRB 5EU7C 3MV7B 2V2WB 3LQAH 2XWJB 2PO6C 1C16A 2Y07H 3GMOA 3V6FA 5ISZA 1ZANL 4I3RL 3QWOA 3MJ8B 4UU9B 3SO3C 1S7SB 4G6AC 4P2OA 2OTUA 5E4IA 1EHLH 1MJ8L 5F6IC 1J88A 1HHHB 1Z0NA 3QUKB 1HZHL 3ARBA 1NFDB 4RMTA 3MJ7A 2AEIT 5DUMH 3UX9B 5CJOL 3B4NA 5B21A 1CGUA 2XZCH 4PPTA 4DQOL 4WFFD 4I1NB 3VGAC 1FO0A 1JPGB 1XGYL 1S9XA 3HE7D 4P2RB 1FAIH 4X5WA 4GQ9H 1XGQB 2VXVL 3KPRE 3RI5F 1YUHB 2DLFL 1XR9A 1Q9KB 4AIXA 5ABDE 5CP3H 1LDPL 4Z7NE 3PWPB 1R3IL 1XCTA 4Z18A 1Q9LA 3DRTA 3MUGB 4JKLA 3IETA 3VD7A 4UI2A 3SEPA 3OAYH 4L5FL 4LOUC 4NWTH 3VWKC 2PTVA 5MEQA 4PLJD 2APTA 5L7XL 2D7PA 1EFXA 1P84J 4PRHA 3UJIH 5HGDA 1BPVA 5FDYA 2HT3D 4QRRD 3DECA 1G9ML 3RWEB 1NGWA 2N4IA 4NNXA 2W92A 4JVUA 4P4KD 4LSRL 4UIMA 1P84K 2ARJB 2ZG3A 1KLFA 1D6EB 3MTRA 5EZJA 2BNUA 3NPSC 2P5WB 3ULVD 2X1WL 3DOSA 4IS6A 1A7RH 2FO4A 4PJCA 2GI7A 3W9EB 2DI7A 3DVGB 1S7TA 3O2DL 1T03H 2GAZA 4JB9L 5FKAA 3S5LB 4OLXH 15C8H 4LHQB 1WTLA 1WWCA 3MLPA 1NAMH 4YJZL 2W65B 1YYMH 4J12A 2EDYA 1CFVL 1EGJL 2A6IA 4WW2C 3QH3B 4M4RA 3RTQD 2H6PB 4OT1H 1OGAA 1M71A 1QSFE 4XPTH 1MCEA 1T2XA 2YPLB 4OJFH 3O8XD 4HQQL 2ITCB 4Y1AB 3DUHA 2YMXH 4XP9H 3TA3C 3LEYL 4F3FB 3DV6A 4PJ8C 2HWZH 4YDLC 4F7PA 2YSSB 4H1LB 4GO6B 4FRWA 1NDGA 1VCAA 5HVFB 1LO3H 2X7LA 3LKRA 4X4YA 5IIEA 4U2ZA 1BZ9A 4JRXB 4R4FH 2V2WA 2XWJA 4DJMA 3BO8B 1UM6L 3S35L 5LBSH 5HXMA 3LOWA 3IRPX 4UU9A 1S7SA 1BIIB 2ZCHH 3PGCB 3OV6A 5HDLA 2Y4SA 1HHHA 1RHFA 3QUKA 1NFDA 5D2NC 2X1QA 2NY0B 1Z5LB 3ZYOA 5GZOC 3WV0A 3QXAA 3RVTC 2PYFB 3MRCB 1X6NA 1YECH 3ESVF 3CMOH 4W70A 2J2ZA 1I8MB 1IQWH 3CPLB 5FUCC 3WXWH 4P2RA 1N5AA 4ZO8A 4HHAB 3TPUB 3V0AC 4M62L 3LIZL 5E8DH 3NOIA 4NT6B 1OCWL 3RL1B 3MRLA 4OFYD 1QFWM 1UWXK 5DJ6B 3RY5A 3PWPA 4NQED 3ESUF 5AUMB 2R0KH 1EUTA 1KJ2L 4YK4B 4XVTL 3OKOA 1JTTA 1K3IA 4U1MB 2XN9E 5EUKB 1F3JA 1HQ4A 3UTPD 3O0RL 4KRPD 3QEQE 3H9SD 1NQBA 1HKLH 4G8IA 1I9IL 3FN0H 5IB2A 1K3ZA 1N3NB 2CR3A 4B53A 2ARJA 1D6EA 3NBNA 1UM4L 2PW2A 3IFNH 5DDHB 4ZTPH 4I8DA 4DEPB 3FQWA 3SDCB 2EH7H 5I1DB 3W9EA 1FVEB 4GS7B 1GOHA 4TUJA 5HSFA 2Q1EA 5CCKL 3MRBA 5J12C 3VWJD 3K0WA 4GFTB 1DQDL 5GJTH 2R69H 2WK2A 3HRZB 2G5RA 3SKJH 3OJMB 3B9AA 4HMEA 4JFEB 3TT3H 4F8QA 5EU5A 4G80B 1CGWA 5ID1B 3CSYA 1T0NA 1JGVL 1KIRB 4ODTH 3QH3A 1VEPA 1RULH 1HSAB 1FG9C 5FXCH 2BVTA 2B0SL 5E2UH 3MROB 1TETL 2H41A 3NN8B 1G1CA 2Q7NA 5DRZB 4QF1B 5ITBL 3Q6FB 3CVIL 1T89A 4H1LA 1CGSH 3UJJH 4DKAA 4JRXA 1F6AB 2Q8AH 5D7LE 1XIWC 4PJBE 2OQJB 1A1OA 4Y5YA 3FOLA 3QDMD 1V7ML 1SY6L 4N90E 5D7KE 3RUGE 3BYYA 2IGFH 4IOSD 5I1HL 1ZA3A 1MPAL 3FB6B 4XHJC 3THML 4K23L 3FL7A 4H88H 2GT9B 2CUIA 4JANB 1UWGL 2AKRA 4O00A 4PR5A 4O02H 1CTOA 1T80A 2Z31D 4FP8H 4RMQA 4ERSH 4HHAA 3N85L 4QRUB 4NT6A 5BJTB 2JJSC 3RL1A 4HWEL 2A0LD 4L4TD 4HEME 5AUMA 5K33A 3EW3B 2KL6A 2WLZA 4JVWA 3OPZH 4Z95L 1LK2B 4U1HA 3CFCL 3DUSB 1BQUA 3VG0H 3P0VH 4R6UA 5L8LB 2LU4A 5EUKA 4RGND 1F97A 1ADQH 3PGFH 4R8WL 1CLYH 3HE7C 2D03H 3OHXA 3JWDL 2FX8L 4LPXA 1XZ0B 3AVEA 1NUNB 1JF1B 4WHYH 1KTDA 1M7XA 5FYKL 2VDNL 4YXLL 2Q8BL 1N3NA 4GRWF 1JMXA 1S9KC 4TULL 2I25N 4BZ1H 4AK1A 3QXDB 3KPOB 4YAQB 1HINL 2AK4B 2DAVA 1EIBA 1VA9A 2FO1A 3CFEB 4X8JB 3SDCA 2FYYB 3QUML 1O5DT 5I1DA 2FEEI 4CMMA 4M7JL 1FVEA 1XR8B 3DROA 4WGVB 5IBUG 3U79A 4AT6B 3PWVA 5TQ0H 3PV7A 4Z76A 3UC0L 2ZNWA 4JN2B 3HRZA 2CDFA 4JFEA 1ZT4B 3C8HA 2ORBL 4G80A 3FT4B 4PB9L 5ID1A 3RIFF 1B0RB 5ALCH 5T5NF 3ARPA 1MHPH 3ULVC 3WKML 4RDQG 5ICXB