4Z18A

Crystal structure of human pd-l1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
212
structure length
212
Chain Sequence
b'FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 1 ligand 1
publication title CRYSTAL STRUCTURE OF HUMAN PD-L1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 42
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z18A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z18A02
3R0MA 2Y07L 4X7FC 1IM9A 1WGOA 4JFEE 4JFQA 5BZDB 3WIHL 1NCCL 3C5ZA 1D6EB 4M8VA 5D93B 3H0TB 3SO5A 4YAQB 4X6BB 1K4CA 3HPJA 4XRCA 3QAZC 5DO2D 4YXHH 1M71B 2XN9D 2QQLL 2AV1A 3I02A 3S8WA 3GGWB 4HIXL 2CXGA 3SJVD 3TNNA 4JREC 4F58L 4Q2ZA 4KQ3H 2HFEA 3ZKXC 1VPOL 1IL1A 5B4MD 1JUFB 4OLXH 1JGUL 3QHFH 1F02I 4LCWE 5D2NB 4G8FA 4JO4L 3IDIB 4XAKD 1TZGL 1WICA 1A5FL 4JFDA 4X7CC 3STZB 4YR6B 1T2QH 1YEKL 2WBJC 4G42B 3UCRA 4PUBL 4F7PA 1QR1B 2Z8RA 3RWIB 4ZUVB 1QA9A 3MGTA 4BFIB 4W6XB 4PJ8D 1FVDA 2CRMA 3Q6FA 4TSCH 4KUCD 3SDAD 5SWZA 4UIKH 1B90A 4UT7L 5A2KH 4OBSA 1VFMA 3T3ME 3L5XL 4F9LA 4HIHB 1UKTA 4NQEA 5I0DA 5T1LA 2XA3A 4KVCH 1F3RB 2OSLA 1EBAA 2IH3A 4MQ7B 4XCFH 4OKVB 3MUY1 1JYXA 5K9KB 2VZOA 5J3HD 4KH2A 4GRLC 5I1IH 3OKOA 4KJQD 2H3NA 4XMPH 1N5AB 1P2CB 4NDMA 3S34L 1OPGL 4UZGA 3GSNA 4I48B 3CCHB 3C5JB 3ZO0A 4RMWA 4L3ED 4PJBB 4X6DB 2XICA 2M8XA 4IRSA 5CKAA 1QBLL 5TQ2H 3MNVB 4NO3B 4GRWH 4MAYD 2DKMA 3IYLW 4PJHA 2YD6A 2CRYA 4H25A 1S3KL 1DTUA 4JQXA 3QAZB 5TPWL 4DZ8B 1ZXQA 5IFHL 4N8CH 1LVEA 4AEIH 3DI3B 3MA7A 1A6AB 2DQJH 1KLGB 1ZVSA 1MRDH 4XNQA 5J6GB 2ZP0T 4JREB 2BY1A 1JHKH 2NLJB 5LGHH 5T33L 1JPFB 1AGBA 1J87A 4OLZH 3ZKXB 4DUXA 2DQUL 1TFHA 4JVUA 1YMMA 2HJFA 1BWMA 2FSEA 5F3BB 4PB9L 5CSGA 4R7NA 3O3BB 4PJXF 2ZSVB 3JVGC 4N0CD 5EZOL 5DQDL 2GJJA 4MJ5A 1HHJA 1LILA 4X80H 2WBJB 3L3IB 1RK0A 2BVQA 4LU5L 4O51A 4GW4B 5HI5D 4TULH 4ODVL 1DQMH 3I9GL 4Y2DA 4KHXL 1KLUA 2EXYC 2XTJC 4XXDB 4LEXH 2HT2D 1A4KB 2YD4A 4ZNCD 2VB5A 3S36X 4LSUL 4QXWA 4WI2A 5T5FH 4M02A 3MLUL 1FVEA 3F6LA 2ADFL 4LLAA 4NQXA 2RBLA 4GRLB 3NOIA 1U2CA 4X4XB 5E8PA 5F1IB 5D7JD 3HNSH 2XN9A 3VXSE 3SJVA 3G5ZA 4YJZL 3U36A 1JNHA 3C2AL 3GSNH 4JJHA 4P9HH 5MP6H 5JXEC 4P2QD 3GMLA 3O81A 3H9HA 4HXAH 2IFFL 1TZIA 2DQFA 1PJ9A 4QF1A 4M6NL 4MD0B 2QKIB 5EO9A 5DJ2B 1G6RA 3FOMA 3S37X 4OM1H 3ALPA 2ESVB 1S7SA 1JFQH 1YN7B 2EDFA 4WGVB 4I1NB 5EC1B 3LB6D 3BUTA 5D72H 5DWUL 4GXUN 4U6HA 1U8NA 5C0AB 4RISL 5CEXB 2RIKA 3VI4F 3LHPH 4E41D 4Q0XH 1MFCL 4FQCH 4KGLA 3OAZK 4PJ8A 5T3ZH 3HZYA 5BVPL 3VXUD 1HSAB 3SDAA 2GK0B 4HWNA 2R15A 3T1FA 2QADD 4G6JH 2ZSWA 3QUZC 3DVGA 4OTXH 4ZG1A 3L7EA 1JWSA 1A14L 2VXQH 3EYUL 5DJ0B 2ZOLA 5HGDA 3W11C 4X6FA 3GRWA 2D4DA 2BZDA 4IEFB 3QEQA 4FQJL 4JQIH 4YBQD 5KSUB 4WI6A 3QA3A 3KNBA 2Q87A 1BFTA 4QXGH 1XIWD 2XTJB 3OR6A 1OAXL 1KJ2A 1ZHBB 3MRPB 5F6IC 1KACB 2PF6A 3QUYD 4KFZC 1MUJB 4Q9RL 3QCTH 4L3EA 3CJJA 5IBUG 3W9DA 3TEUA 1I3GL 2AK4B 3C8DA 2MPAH 4MAYA 2EDDA 2XI9A 4PJCF 1OSPL 5EA0L 4KKCD 4LHUG 3DURA 3CH1A 4OZIE 4PRHA 3TJHD 1ZHNA 1RIUL 4YEFA 4U0QB 1XGYH 3NACH 2X4UA 5IMOA 1F6AA 4X6EA 2J5LC 2XQBH 3SKOA 4OCYH 4OQTL 5DFWH 4XT1C 3BDYH 3RPIA 1N2RA 2WQ8A 4S2SA 3MO1B 5IR1B 5C08B 1CN4A 1FP5A 2DJUA 4X0KA 5C6TH 4JKPH 4YWGH 1G6RH 1S5HB 1DBMH 2ATKA 2EO1A 5IG7A 1KPRA 3ULVF 4YHLL 25C8L 2LQRA 2NX5B 4LSPL 3C08H 4JFFD 1KCVH 4TVSa 2AEPH 4YDVA 5E9DB 5BXFA 3STBA 4OCWH 4HF5L 1DVFA 4QRUB 4QYOB 1E6JL 2PCPA 3SCMC 1QVOB 1ZSDB 3P4OA 1CXHA 4M6OL 1MFNA 4XXCC 5C9JB 3QUZB 3QXDB 5CUSL 2VDKH 1TVHA 2YUXA 4YFLI 4K7FA 2MCPL 3IDGA 5IV2B 3LN4A 5ABDE 3I3EA 1KSRA 4HS3A 4TSAL 1XZ0B 4FHBD 4WJ5A 3GRWH 3O6LH 5ADPL 3ULVD 3BI9X 5IBUB 5D7JA 4LF3A 3X13B 4HWEL 3MACH 3UBXI 4MJID 2R69H 1A1NB 1KJ2H 1FJ1A 5CBEA 3RVWC 4P2QA 2YWZA 4HX1A 3L95A 5D5ME 5DRNA 1FNGA 3BJLA 1CDYA 5E08H 1JPGB 4LHJB 5HHOE 3QUKB 1UCBL 1CGYA 4OSUH 4GG6A 3JWOL 3MXVL 4M1GL 1NGPH 4MA7L 2FJGB 3HI6L 3OR7B 4LRNL 3ZKMD 4L3CA 2J5LB 4R8WL 2EDTA 4JZJC 5L2JB 3QG7L 4ORZC 4J6RL 2X4OB 3DGGB 4OV5A 4OFKA 1TQCC 3OXRB 3TO2A 4LPWA 4NQCD 3VXUA 2OJEB 4AMKH 5C09A 1KB9J 1WWWX 2W0PA 1HINH 4UV7L 5ANMA 5EO1B 3OZ9L 5BV7H 2AJYL 4LGSB 5HHNA 5CD3B 3T0AA 2R2HA 2IADA 3UPRA 1BZ7B 2WQRA 3TO4D 4IMLB 4OCLC 1NFKA 2IAND 1VCAA 3V5KB 4HFUL 1J5OH 1DBKL 2Y6SC 3QDGA 4A6YL 3LKQA 4Z77A 1HQ4B 3SCMB 2NTFA 3LSOA 3WSQL 3GSXA 2CH8A 1M7IB 4OLVH 4ZTOH 1BGXH 5ISZB 2Q8BH 4ZNEA 5INDB 4YHML 5D9SA 4LQFL 4R6UA 5EPMB 3IXAB 4KAQL 2YWYA 2O93L 4OI7A 3B2UC 1OM3H 4JRXE 2HTKC 2DWEA 4O2FA 4W4OC 3L1OL 2NPLX 2VMFA 5GS0D 1QHOA 3O45B 5IQ7L 1NJ9B 1JZ8A 3WXVH 4R4BB 1QSFB 3L5HA 4X5WB 1FVCA 1NGWA 1I8LA 2D03H 4HJ0C 3OGCA 5EOQH 1BAFL 2WUBL 4LASH 3QDJB 4XVJH 4BSJA 4FA8A 3QI9C 2VO5A 2Q76A 3T0DA 3FN0H 2B5IC 4S1QH 4P9MH 2CSPA 1MWAB 2X4TA 3IDNB 3RIFF 3TT3H 3CH8A 4J23A 4U6VL 1ZHKA 3IFLH 4JFFA 3S35L 1R3LA 2FWOB 4PJCA 4JDVB 1AE6H 1DLHB 3CFBB 4JZJB 1IGFL 5KJRH 5DD5H 4QRPD 1OOAA 1LO0L 1ULVA 5JOPD 3ZT5A 1TQCB 5EBLB 2E27L 2J8UB 3I6LE 1U95A 4MDIB 3MRBB 1RU9H 4ZSOE 1PVHA 4Y19D 5F71A 3QFDA 4KJWD 2QQKH 4MJ4A 4NRXA 3K8MA 4X4YB 3D2UD 4YIQA 5LWYL 1BWWA 1GL4B 2AKRB 5GZNC 1CLOL 4MHHG 4NN5C 4YFDB 5EZJA 4KMQA 2PKDA 3PJSB 1E27B 2C1PB 3C6LC 5C2BH 4F7EA 4ZPTB 1R24A 1N8ZA 3MNWB 4Z7VE 3BFOA 4AEHL 1WK0A 4GKZB 3VI3F 2YKLL 1MNUL 4U6YB 1HSBA 5DZOA 4EDWH 3MBEC 3TESA 3PDOA 2HVKA 4ZFGL 1LK3H 4RMVA 5FECA 3FT4A 2KZ1B 4N0YL 5D70H 4P5KA 3H9SB 4ZO9A 3NPZB 3G5XB 3WFCH 5DJAB 2LVCA 3L3HB 3BKMH 4QRSA 4HK0B 1S7QA 2HTLD 3VXMB 3WLBA 3IDXL 5I8OL 4OAWA 3EZ8A 1S9WB 4X9HA 3M8OH 1JPSL 2QLVB 1S7RA 3B9KC 3RY5A 1S7WB 4NQCA 3BVNA 2A0LC 4NQDB 3O4LA 3PGCA 3QI9B 4P2OC 3O9WD 1EJOH 4PG9A 5KVEL 2B5IB 3BZDA 2I60H 1BFOA 4KMTH 2EYSB 5EU3B 2GUOA 2ZJSL 5C71A 1ZS8B 3HR5A 1U3ZA 3TO4A 4ONFH 2IANA 1K2DA 1ZLWH 1RIHL 1MI5D 2UWEE 1KTDB 1OLLA 4GMSH 4ZYKB 2YPVH 3VGHA 5IOPB 2Z8SA 4LKCB 1MEXH 2P42B 4P23C 3C8KB 5ID0A 4C83B 1T7VA 5K59E 2JIXD 3V7AE 5I1KH 4U3CA 1JZ6A 3SGDH 5HYSG 1CFNA 4NO0D 4XPGH 5DSCA 1AI1H 5DRWB 4PRPE 4NN5B 2FB4H 1F42A 5IHZA 1VEOA 5LJYH 1H15B 5JOFB 3P0VH 2GTWB 4Y1AB 5IB5A 1U8QB 1XF3A 4UUJB 3JSSA 4FQIH 4KTEH 1Z6JT 4OFYA 4ZUUB 1M6OB 3C6LB 4KJYB 3EZJB 1ZT7B 2V5SA 2F19H 3RPKA 4D0CA 1R5IA 2B20A 4G9FE 1DEEA 3M1BA 1T21B 2BY3A 5DDHA 4DEPC 2NNAA 1FFNA 4QHUA 4HCRA 4CNIB 1BZ9B 3QULB 5AZ2H 1HH6B 3MA9H 3MBEB 3PHOA 2QJDA 1QEWB 2BOBB 5EU6D 4U1HA 4BK4A 3RWHA 2O5ZL 3B4NA 4EQ2A 2FL5B 4RMUA 1MCWW 3BN9C 3GO1L 1XGRB 4DKAA 1DQTA 1FYHB 3PGDA 1UKSA 4MA8L 2BHZA 1D7FA 4R0LC 2V5RA 4F2MB 3D85B 1RSFA 1A6TB 4JEGB 1Q9OA 4QRPA 4GMTL 4ELKA 3B9KB 3V6FA 5ERWB 3V5HA 4D9QE 4BKLA 4R26L 3IFPA 2NY6D 5C07B 3VXNB 2R0WL 1ACZA 1G9NL 2JJSA 4NM8H 1KIRA 3PIQB 1H3WM 4WHCA 4Y19A 2BSSA 4G6FD 4DJMA 3LMJL 3D2UA 4WUUD 5FGRA 1I85A 2FBJH 2R1WA 4KC3B 2SEBA 5AAWA 3VGEA 3QQ9D 4N1EA 4N0UE 5I0ZA 4P23B 5C0EB 5K93A 5T1DH 4OLUH 2B4CL 4JO3H 3O11A 4PGCB 4JPWH 5I17B 5FYKL 1T1ZB 2NYYD 1KPVA 3DV6A 5JZ7C 2X4QA 4GAGL 4WY7L 4JFYA 3MXWL 1VESA 1Q0YH 2H26B 1JNNH 5JIKA 4QEGA 3X12B 1EGJL 5IW3A 1NAMA 3BX7C 3MRCB 3QUMB 5F7LB 4DGYL 4DKEL 5HDQL 4FQ2L 1AY1L 3B6SB 2X44D 1S9YB 4DEPB 1ZLVH 3IDMB 5GZOD 1GHFH 3HAEB 4HCRH 3PGFL 1I1YB 1RULL 3O9WA 4POZD 1HQRA 1IAIH 1YEIL 4H5SB 3VFRA 3INUL 4TRPH 4U1LA 2OS7A 3FT3A 5IIEA 2YD7A 4FQPA 3WYRA 4U2YA 2W9DL 3FFCB 1OGTB 1RZGB 4WWKC 5MENB 4M61B 2G2RA 4R0LB 1LQSR 5EO0B 1MI5A 5I1AB 4NBYB 1Q38A 4LIQH 2NY3D 3GIVB 2ADGB 5K9OB 2QHLA 1Y6MR 1NCWH 3C6SA 3AXLA 4NNYB 1Q9WA 3O3UN 3IJHA 1ZTXL 4NKIL 3V6ZA 3QIBD 1KOAA 1F11B 1HI6B 4WFGD 5FO9B 1G9ML 2JIXA 4NCC1 3EKCA 5DD0L 1BF8A 2FX7H 5EUKB 1LDPL 4LLUA 4NO0A 5J7CC 3AC0A 1WCQA 3AROA 3SE4C 2ZUVA 1K8DA 2N4IA 3W39B 3HPLA 2ZCLH 1BEYL 1KYOK 2ORBL 2JCCF 3L3OB 2L7UA 1BX2B 4AIOA 5CZXC 2IPKB 1PDKA 4CN6A 2W38A 2Z8WC 3LKOB 2A77L 2HJKB 3RWFA 2QQQA 2XWBA 4GSDL 3MRMB 1EJ6A 3E6HA 5ITBL 1L9MA 4XBPA 3QEHA 1UXSB 4HS8L 3BE1L 1IGIL 2Y36L 3EOBA 2JCCB 4Q9BA 4CVZA 5JW4Q 1IEBB 1WBYB 4NZJA 3QSKB 4FZEL 4OZHA 5EU6A 1G9EA 3HI1B 3S7GA 7FABH 4KXZH 3V4PL 3L7FA 1JPTL 3QT2A 5T1MB 3RL1A 2APWA 4XPTL 4MX7B 3QFJB 2OTWB 4GXUM 4OD2A 2ICWA 1NAMH 1PSKH 4Q58C 5LAXA 1II4E 5ALBL 4FTVB 1PG7H 4LSRL 3AS2A 1QFHA 4CKVX 5D6CA 4XMKH 4OF5A 4Y16C 5HGHB 2KL6A 2FGWL 3SGKA 4WI7A 4KI5E 3F7PC 3TFKD 1FRGL 4ESKA 4WWKB 1R3HA 2CIKB 3G6JF 5JW3H 3IDUA 1CG9A 1ZANL 5CCKH 4HBCH 1N0LA 5JW4R 1BJ8A 4PV8B 2AXGA 3E8UL 1JGLL 4NQVB 4ZUSB 4X9BA 2J8OA 2R9HD 1U93A 5I16B 3NFSL 1CXFA 1CFQB 1FDLH 5DEGB 5HI3C 2HVJB 3BEWA 1WV7T 3OB0H 4B5EA 3LKSB 1HEZA 4WU5B 1OARH 1IC1A 2AJVH 2A6IB 3UYOD 5F8RC 2O5YL 5IB3B 5HYJE 3C5ZC 2ZKHL 5LVEA 1BM3H 4ZUWA 5HVFB 1CIDA 2DL2A 5J0BA 4OZGA 4G6MH 4IDJL 4Z95L 4JM2D 3BGFC 1MCPL 1EH9A 5SX5K 4GKNB 1ZGLA 4R7DB 5CJOL 3RWEA 4UBDC 1T03L 3QIUD 4HJJH 5I8KH 1U0QA 1Y0LA 2AXFB 1YQVL 5D7IB 3P4MB 5EORL 4NKQB 3EJJX 1DL7L 1DE4A 5E1AB 1OL0A 3DUSA 2DWDA 4M3KB 1PW3A 5GGSY 1INDL 4R2GB 2PTVA 3U83A 2YK1H 4NUGL 3S98A 5C0NC 1W0VA 4GH7B 3TCLB 1EAJA 3GI8H 2FYYA 5FAAA 2C3VA 4GW5A 4OKDA 4YZFE 4Y16B 3F12B 3NCBB 5JR1H 2W60A 5LXGL 2GKIA 2F53D 4HUXA 1P4BL 4XTRD 5HSFA 1U91A 4OV6F 4FABH 5D2LB 3LQZB 3QIBA 1OCWL 3QHZL 2Q8AH 1N64L 4IOFC 2CRZA 4OZ4B 1JIBA 1GOFA 4NBXB 4QY8B 2P43B 3LEVL 5ILTH 3KGRA 4GO6B 4M7JL 2X9YA 5E8EB 1SJEB 5KSAC 3PQYD 2DQDH 3QDMB 1HHGA 4HZLB 1CVSC 3MRNB 4HKXB 2DM2A 4HKBA 1NL0H 5JO5A 2PTTA 2VAJA 1BQUA 4RA3A 3VRIA 2Z4QA 3BP7A 1B2WH 1JPST 3W5MA 3KLDA 4GRWB 3VXTB 1N3NA 2HFFA 2Y25A 4JFQB 1KJVA 1RZ8A 2NZ9D 3C5ZB 4I9WE 4OCXL 4FQXA 3SE9H 4YDKH 2H6PA 1K4CB 3HPJB 4ZDHB 2F5AH 4XWOD 4UOJA 4P99A 1MCCA 4NO2B 1UB6A 5B8CC 3IRZA 4MNGE 4AZ8A 2AV1B 3VWJC 1G7PA 5HDLA 3L3GB 2X1PA 3BGFB 4WI8A 4MD5A 1RHHA 4Q2ZB 3RA7L 2HFEB 5ACZA 3U6RA 4J2XA 1IL1B 2CKNA 3GHEH 5D8JH 5CIPA 1GH7A 3RNKA 2D7TH 4OM0H 2W9EH 2A83A 1XF1A 1AGEB 4G8FB 3LKPB 4BQ6A 2AJXH 4ZS7H 3HE7D 3RJQB 1QBAA 5TDPA 1J12A 1L7TH 3UTPD 4IMKC 3DYMA 4OB5H 1D5IL 5F1KC 4N1HB 4F7PB 1EMTH 4JHAH 4L8SA 3SEPA 1Q72H 4JO2L 3I85A 5IW1B 2EC9U 2GEEA 1AQDA 4Y8AA 5CSBA 4Y2DC 4LK4A 4M7KH 3T3MF 1NDGB 5SWZB 1CE1H 2ZG3A 3MODL 4OF3A 1T22B 3FQXB 3MRRB 5KN5A 4NQEB 5F7MC 4F8QA 3BRFA 2DIBA 4O9HL 1I8IB 2OSLB 1EAPB 5DD1H 2FD6H 5D6DC 2E9JA 5KSAB 3SKMB 3E3QE 4EDXA 5FK9A 2CIIA 4FS0A 1J0ZA 4M7LT 4MZ2A 3FCTA 3MCKB 4NDMB 4TUOB 3EOTL 1CDHA 3QCUH 4JM2A 4N9OB 1N4XH 2CKBA 4Q9QL 4TUKL 1E4XI 1ZVYA 2DTMH 4QT5B 5CJQL 3ZKND 3QIUA 3QWRD 5I1DA 4Y4FC 2DQCH 3MRLA 4PV9A 3DUUA 1KCRL 4AIZA 4M6MH 5B8CB 5IF0A 5HYQB 4LLDA 4NRZA 2O5XL 4Z0XA 5GRWA 5TFSH 3VWJB 3V6OE 3FQUA 4U33A 1C5DA 3DROB 1UEYA 2OJZL 3VDCA 1UM5H 3WNMA 4OD3L 3P9MB 4F3FA 4O58L 3A6CL 3FQRB 2AJUH 3OJDA 3Q48A 4JRYE 5I30H 3SDAC 5I19H 3P30H 2F53A 2OL3A 5CIPH 3RX5A 5JDSA 3O8XA 5TE4H 4IRJD 1QSED 1WTLA 4YXHL 1U58A 1MLBB 1UYWH 2AJSH 3T2QA 3QEGH 5CILL 3LQAH 3SQOL 4Z7NE 1GC1H 4L4TE 4KQ3L 4XMLH 1T04A 4O51B 4HKZA 1HNGA 2RHEA 3PQYA 1F58H 4MD4A 3TJEL 4Y2DB 2X1WL 4GLRH 3ZKSD 4K3GA 1A02N 3U4BL 1KLUB 1Q8MA 1RAMA 4HD9A 5J57B 4PJ7E 1WEJH 1DFBL 5HHPA 3H2WA 1QYGL 3KYOA 2R2EB 4L8BA 5AD0B 3ZE1E 3RTQC 1DQDL 1FVEB 1AJ7H 4JDTL 1ED3A 3ILPA 4XBGB 5KSBA 1AO7E 4Z8FH 3LH2H 5EU4A 3RZCD 4ALAH 1FG2A 1UM4L 3U1SH 1Q94A 3VW3H 2VLJE 5D7LA 1JYVA 4ODUA 5IVZA 2NCMA 3U36B 5EWIL 2BP3A 2CKBH 3CLFL 3V7MA 4KVCL 3F58H 5KTEH 2JK5A 4Y4FB 5EO9B 4J8RB 1G6RB 4XCFL 3O6MH 4KVNL 3FOMB 1S7SB 3VXSB 1WCBB 2J88H 5KVGH 1LK2A 1KEML 1MQ8A 4RIRA 2ZPKL 4ZFZA 4U0RC 2EIEA 5I1IL 5BV7C 5D71H 5K9QI 3B5GA 3HE7A 2PNDA 1TMCB 3GKWH 2VSDA 1KEGL 5KS9E 2C9AA 4MSWB 2AGJL 2QV2A 2DQEL 4DN4L 1DVFC 4UOW0 3CD4A 3PABA 5TJWK 5DQ9B 3SDAB 3HC3H 3BD3A 5BQ7A 5GGRY 1T1YA 1EPFA 3ROLA 5E5UB 5A3IC 1V7NH 3RY4A 3D9AL 1MRDL 5GRUL 4IHOB 1I7RA 5GGTA 6FABH 1RMFL 4YQXL 4K7PH 5C7XH 1NGYB 2VC2L 5H2BA 4XCYA 3BZFB 3QEQB 4PJIE 1AGFB 3KR3H 1Q0XH 1A1MA 4PJDE 5BO1H 2CO7B 3HLAB 1EEQA 1SQ2N 3K4AA 3QWRA 2ITCA 4X80L 3RBGA 3RTQB 4PGJA 2ADIA 1KG0A 3HUJA 4JG1H 2PR4L 3DURB 3CH1B 3KPNA 1OTTD 4G3YL 4PRHB 1JN6A 1FGVH 2EE2A 2VZUA 1JWUB 1EEUA 4CRPA 5IMOB 1XH3A 3WN5C 4LEXL 4NM4L 4NKDB 2JB5H 4S2SB 1KYOJ 4OZIB 3KS0J 5K33A 5FV1L 4X0KB 4PGDA 4HPYH 1ZOXA 5J11C 1QRND 3WDHA 2QADC 3EYQD 4U0RB 4PG2A 5DS8B 5BV7B 5IG7B 4IRJA 1QSEA 4AM0A 2EKJA 5FF6B 3CSGA 4XP5H 1C5BH 4YDVB 4Q9CA 1MHEB 3OAZH 1DVFB 3B43A 1AKJD 2X4RA 3DYOA 4CVUA 3VD4A 4XCNA 5GRZA 4BFGA 1AD9A 5EIVA 5J1AA 5J4MA 5DQJA 1S7XB 1MCLA 4OLYL 3R06A 4ZPVB 2APXA 2W65A 4L8DA 4AQOA 3SE3C 4WW2F 4FZ8L 5GGTH 2OR8A 1NGXB 2IMNA 4FQCL 1WZKA 2FRGP 3ORJA 3NZHL 5D7JB 4LF3B 2DQHL 2EIZB 3RZCA 4RMSA 3MV8E 1PZ5A 1NFDA 2IPUK 1DSFH 2NR6C 1FJ1B 4LCCC 5D5MF 4I77H 3OKLA 3OAUH 2P44B 3U9UA 3L95B 1FNGB 3RVVD 3VFUA 5F1OB 2OTUA 3PWPE 1MVUA 1BD2E 2ED8A 5E8OB 1R3KB 2D3VA 4YHKL 4HBQA 3A67H 5D5MB 3RBSA 3QDAA 2ICEB 4TNVF 1CFSA 4WW1A 5DA0B 5D1XD 4FP8H 3WN5B 3DSFH 4XP9H 5DD3H 1AR1D 1O7VA 3X17A 3GSRB 3MJ8A 2B1HH 5C09B 1X5KA 5J11B 2ZOKA 2YD5A 2QADB 5DFVD 3VMPA 5ANMB 4XPFL 1A3LL 5IBTH 5ITFA 3VFSB 2X1XR 4MB5A 5HHOD 4MQXC 5IMMA 1D5ZB 1MCJA 2IADB 5I1EL 3UPRB 1XGYL 1WAAE 4M6AA 2BVUA 1B4JL 3WUZA 5DD6A 2WV3A 5A2IH 2BNQE 3QDGB 1QFWH 3BDYL 5KAQG 2D9CA 5E2TH 4NJAL 5FKPB 2AQ3A 3WIIH 2QR0A 3LSOB 3TIDB 3GSXB 5CEZL 1A7RL 3MRHA 3ZLQC 5EOTB 1CL7L 1X6LA 4Z78B 3N50A 2B1AL 3K81A 5D9SB 3RVTC 3VWKC 3D0VB 1WZ1H 2DWEB 4O2FB 5EN2B 4ZFOA 4PD4K 3DOSA 3D39B 4LCCB 3ARZA 3LZFH 3NCJH 3AU1A 1FORL 3V8OA 1FVCB 3GMRA 1PZUB 4JRXB 3UTTE 2YZ1A 3HB3D 2VXTH 1RVFH 3BH8B 1AHWA 1BHGA 2QSCL 3W81A 1QRNA 3O6LL 1LO5B 1T0NA 4I5BA 4UMGA 2HRLA 2D2OA 4Z5RB 2C3HA 1ZHKB 2HRPH 4P4KD 3DJ9A 2VLLA 2EEBA 4FQLH 5JORA 2R69L 4K94H 4MXWH 2VOTA 1KJ2L 1R3LB 5EFIA 4ODSH 3HKFA 3R0NA 3LVEA 3QZWB 3HFMH 3UAJC 1AKJA 1NAKL 2LABA 3KLHC 2Q3ZA 1F45A 4QXTB 5FM4A 1QFPA 3O3DA 4EZMA 2BNUB 1TJGH 3KYAA 4DVRL 4JQVC 1AGDB 3V52H 1NGPL 4NIKB 1BQSA 4NRXB 1LE5A 4ELMA 3D6GA 2EDBA 5D1QD 1WWBX 4JFOB 1MCIA 5GQBA 4K8RH 4KKLC 4ZSOB 4BSVA 2YBRB 3OXSA 5E6ZA 4AMKL 4P5TD 1I9JL 2H8PB 1YNKL 3DPBA 1ZEAL 4W4NA 5MEOB 2IJ0C 4Z7VF 1J0KA 4F7EB 1FE8H 5FYLD 2X40A 2YSSA 3IDJB 4LLWA 4P2RE 5IESL 1QQDB 3U7YL 4AEFA 3K3QA 4U7SA 2FJFA 3ZKQD 1T7WA 1R5WA 3ARTA 1R0AH 1JI2A 3PDOB 1VDGA 3VWKB 3N1FC 1J5OL 3CLEH 1SEQH 5FUCE 4Z7VB 2UV3A 1ES0B 4P5KB 3WBDA 5HHQB 5D1XA 5IB1B 3KLAA 4WW2A 2RFXA 4HHAB 1S7QB 1HCFX 3GBML 2BOCA 4OAWB 2Q1EA 4HUWB 2XQYG 4Z76B 4PGBB 4C4KT 3GBLA 4LP5A 4YFEA 4NQCB 3BVNB 3G6DH 3O4LB 3PGCB 1MJUH 1OAUL 1OM3L 4C55A 2YD1A 1U41A 1BFOB 1OW0A 5DHXB 3QRGL 4LRIC 4KJWC 1SBSL 3HR5B 4UB0L 3VFWA 1GJIA 2IANB 4G8IA 3RVUD 4FQQA 1YUHA 2DDQL 1YN6A 1I1AD 3HNTL 3DHJA 4QWWD 1HYSC 4FQHB 5L6YH 4I3SL 4DTGH 3VRJB 5K59F 4HFWA 3B3IB 5ID0B 3O4OC 2CLZA 1LP9E 2UWEB 3FO2B 1RUPL 2XZCL 3IFLL 3ZTNH 1CFNB 2YMXH 4NWUL 5DSCB 3UPCA 4FRWA 1NBQA 5IHZB 2GI7A 2Q6WB 1DQJA 5FHAH 1H3PH 2C7UB 2BRRH 3ARYA 3ES6A 4NHUB 2YD8A 1ZVHA 4BUGA 2DICA 3QXVA 4D0CB 1Z5LA 4L1HA 2YPKB 4MCYB 2MQ3A 2ADJB 5DDHB 5HTSA 2FZ3A 4XX1G 4A2LA 2NNAB 3B83A 1FFNB 4WTZA 1DBBL 1OVZA 1PLGH 2DKUA 3OHXB 1DN0B 4HWUA 2WANA 1SJHA 4BSWA 4GOSA 4H0GA 1PEZA 4P59H 3RWHB 3OJ2C 3MLWH 1NUGA 4M48H 1Q1JH 2VSCA 4QTHA 5DJXA 1ACYH 3HI5L 4P4KA 3PGDB 4XCCL 2NW3B 1RD6A 3L3KA 4WTXA 4M1DH 2E6PA 4LEOA 4P4RA 3SPVA 2FH6A 1P5UA 3ARFD 1MHPH 3RGVC 3V6FB 3V5HB 4KKNA 4G9FD 2P48B 2J6EA 3RI5F 3RWJA 1WTGT 3DVNB 5FHBL 5I1JL 4EUPH 5E4IA 3BKCH 1I1CA 5EU7E 4Y19B 5D70L 1BMGA 1NUNB 5GRJH 3NIDE 2BDNL 2NY7L 2IF7A 5D1QA 5ESQB 3X14B 1A6UL 2R1WB 1U8KA 4RX4D 4P5TA 2CMRL 4YPGA 5ACMA 4XPAL 1HXMA 2WUCL 2IQ9H 3O4OB 2K7QA 2VDRH 2CDFA 5CD5D 1CU4H 2HG5A 4S10A 3MRKA 3DV6B 4N0UB 4OGAD 5GSRA 4S1RH 4RWYL 1G7HA 2E3VA 3OGOE 5TE7H 4M5ZH 3PL6D 2P8PA 3HC4H 3QNZB 4J4PD 2R0LH 4KTDL 1JHLL 1MHHA 4GMSL 3QNYB 1JYNA 1J18A 3MV7D 4DK3A 3BP5B 1OF2B 1W2KT 4G7YL 1BFVH 5IM7A 3STLB 4S0SD 3WEXA 1G7LA 2R56H 3GSOA 4FQ1L 1I9IH 2ZUQC 5C0JA 1AI1L 3FHAA 2FB4L 1AXSA 3NN8A 1HQRB 3T0EA 3OKEB 4XVSL 1X6NA 5IIEB 4AL8H 4POUB 3ULVL 4V2CB 3MJ9L 3TBSA 5E5MA 1EBPA 4I0KA 3ARBA 3BP6A 3GMQA 3RRQA 2G2RB 2YPLE 3JZ7A 3RVXD 3GJEB 1MF2L 5F89B 2RCSH 5FUOH 12E8H 1I1AA 4KK5C 5BS0E 1FFOA 4KI5C 1PYWA 3C9NA 4Y4HD 1CR9H 1DR9A 3QQ9C 5F7EL 1FGNH 1IBGL 2QSTA 1JNJA 3NCYP 3FAXA 2R29H 4H1LA 4C54A 2CO6B 1T0MA 5IT2L 2BK8A 3T2NL 2NXYD 2NYYC 4LLUB 4NO0B 5EIIA 4ACPA 1HH9A 1RFDL 1K8DB 1A7QL 3BPLC 4QRTA 2VXUL 1QZ1A 2VR4A 4PJAA 5C8JA 5ETUA 4FXLA 5F21B 1EX0A 1T2JA 2XWBB 1DUZA 3E6HB 3G6AB 1KN4H 4XBPB 1GAFL 4KPHH 3QEHB 2BSRA 5IHBA 3EOBB 2C1OA 4BH7A 3BESR 3NZ8A 4P3WA 1DDHB 1I3VA 1YJDH 3GIZL 3FFDB 3L7FB 2VXSL 3LV3A 5E56A 1TITA 1JNLH 2I24N 4NWTH 3K2UH 4OD2B 3FB7A 3N85L 1J1XL 5T1DL 5LAXB 4HIJA 1CDBA 2V17H 1PFCA 3O0RH 5M7QA 4DQOH 3QQNA 1FL3A 3NH7L 3ARFA 5D6CB 1J1OH 1CD0A 3RKDC 2ZUQB 3FO1A 4UILH 3WHXA 4JGUA 5KSVA 2GQHA 3FQNB 4KI5F 4YNYA 3V4UL 1F8TH 3JV6B 1Q0YL 5DUPL 2V2TA 1JNNL 5DJZB 3ZE0E 3KWWA 3CDYA 1FZJA 1DLFL 1R3HB 4JZNB 4LPTA 3U82B 1N6VA 2PYFA 1CG9B 1DQQA 3LN5A 1KXQE 1P4LA 5GS0L 2APVA 5FCUL 5HDBF 1U8HA 5D1ZC 1UACH 4RX4A 5E03A 4TVPE 3QWQB 4HWZA 2NY0D 4E5XA 1U93B 3WE6A 1I8MA 3TNMA 2YEZA 5C70A 3BEWB 1S7TA 2DN7A 4H1LH 2UZIL 5E8DL 3ARDC 4LSQH 3HMWH 1IEHA 3BAEL 4UIMB 1F3DJ 4JN2A 2YA2A 3OWEA 2BHYA 2Y07H 2Z31C 4FQXC 1NBVH 1RZIB 4RWHA 1NCCH 3K74B 3MV11 3PL6A 4J4PA 4WUKH 3BPLB 5FEBA 5DXWA 3C60A 1QSVA 5CLTA 5IROC 3GDBA 4OZGB 3MV7A 5HYJB 3KHOA 1B0RA 1QO3B 4LQ1A 5IQ9B 3V79C 1UXWB 2QQLH 1ZGLB 3AVEA 3HCVB 5A2LH 3VD3A 1FZKB 5FA4A 1QKZH 1VPOH 2FHBA 2R1XA 4MMXC 1MJJB 1T5XB 1DE4B 3VE0A 3DUSB 4YDLB 1JGUH 1QFUL 2DI7A 4S1DC 3ARUA 1W0VB 4U3HA 4JO4H 3TBWA 3GUTB 1GC1C 1TZGH 1JZ2A 1A5FH 4LGPB 3SHSA 1MIEL 3V0WL 3TA3C 5BRZE 5SV3A 1YEKH 1UENA 2C3VB 4PUBH 2NY2C 2W60B 4UQ3B 4QHMB 1CD9B 2R9HC 3ABZA 5MEPB 2O61A 4IS6A 4N0RA 4UQ2A 1BBDL 3QIBB 1ZA6B 4YHOL 4N8PA 4HSQA 1I3RA 2VXVL 3L5XH 4B0MM 1PSKL 3GK8L 3TC9A 1CLYL 5IMKA 5JHDE 5SWQA 4PLJC 5F9JB 5F9WC 3M17A 5D1ZB 1YEJL 3SGJC 4ONGL 3ULUE 3B9AA 4TNWK 5JO5B 2H2PD 3GMOA 2PTTB 5ESVB 3S34H 3VRIB 1OPGH 3WNPA 2EO9A 3ARDB 3E3QC 3MYJB 2EYTA 2HFFB 1YNTB 1KJVB 1RZ8B 5JW3L 4Y5XA 4HBCL 2Z31B 4FQXB 5L8LB 3G9VA 1QBLH 4ZS6D 1G0YR 4WU7B 3ECBA 3MLRL 3EYVA 3KPTA 3L5WA 3TZVD 2A74A 5TPWH 1S3KH 4JFZL 5IFHH 1G7PB 3IXTA 4G6AD 1HXYA 3TPUB 2VDPL 3W2DH 4ERSL 1RHHB 3EHBD 5SX5H 3MQIA 5EBWB 1XCTA 2VLKE 1OARL 4F37F 1ETZB 5T33H 4HWBL 4LVHC 5CIPB 3WXWL 2UZYB 2VQTA 1WWCA 4MNGB 3RNKB 5JPMB 3VD7A 4LSTL 2ARJA 4YHNB 3VXRD 3VGGA 3O8XC 2XG5A 4PGEB 4I9WD 5FYJL 1JI1A 2UYLA 4PB9H 1WFUA 5KOVC 5TDPB 5HD8C 5C2UB 3EJZD 5JMOC 2E7CA 2OLDA 1KENL 1XR8B 3ARGD 5GIRA 5GRVL 3BUYA 4JHBA 2DYPB 3ARQA 5DQDH 5F44A 1CWVA 2FCBA 5C0CD 2G5BB 1IGJB 5D2NE 1FL6A 2ZNXA 4LU5H 2NY2B 3T2PA 4ODVH 4HDIA 1KPUB 1GYAA 4KHXH 5KN5B 2Z35A 3OG4B 5ICYA 5JNYB 1SYSA 1OSZB 1EEYA 4WEMB 3R1GL 4LPYA 4LSUH 4O02L 3RWCB 5JXAL 5F9WB 1HHKB 4HJGA 2XKNB 4PY7B 4EDXB 4DCQB 3MLUH 4XWOC 5FK9B 2ADFH 2CIIB 3UTOA 3U0TB 4JGMA 4NHCL 5JR1L 3FCTB 3VJ6A 3WHE0 3IJSB 1MY7A 2JJTA 4M93C 4JM2B 5LG1A 4GG8A 2CKBB 4XNMA 1X5XA 5AZEL 2B7DT 4OQTA 3C2AH 3QIUB 3H7LA 5I1DB 2IFFH 3MRLB 4PJFE 4M6NH 5ILTL 1EXUB 5INCA 4AIZB 3O3AA 3ZMRA 1NC2B 2VDML 1XCQA 3JTSA 5BZWB 4LLDB 3DWTA 4NRZB 4X6DE 3WS6C 3UTQA 3FQUB 5DWUH 3AREC 4JPKL 4JDZA 2BVEA 2X2YA 4RISH 4YHIB 3TBVA 1MFCH 4WHDA 4BQCA 4Z7WE 4I3GA 1HKLL 5JDSB 2F5AL 3O8XB 4JG0L 4O2EA 4U1NB 4Z7NF 2WP3T 2BY0A 4ODWB 1UA6L 4ZMAT 4ONHB 2EIBA 3BMVA 1ZAGA 3IU4L 3MCG1 2J1KA 2OX5A 3MV9E 3JUYA 4IOSD 1MCKA 4FQJH 2CQVA 1J8HD 2D7TL 4P3DA 2F54D 3BXNA 3H8NA 3B9DA 3GM0A 2PETA 2A9ML 4L4TB 5HHPB 1P1ZA 1OAXH 1WLHA 4JRYD 4PRBA 3HG1D 1T89C 1I8KB 3ZE1F 3MJGX 2E8ZA 4Q9RH 4XVUD 4KDTA 1ORQB 1I3GH 1NSNL 3TH2T 5JMRA 1IEAA 2XNAA 2Z92B 3D69A 3TZVA 5EU4B 1OSPH 1FG2B 5EA0H 3EJYC 4LDEB 4M93B 3NCYS 1AFVL 5D7LB 2ILLA 5IVZB 2BVOA 1RIUH 3WFHA 3O6KL 1AO7B 2JK5B 3ZDXE 4OQTH 4BH8A 4PGZA 2HFTA 4NKMB 2VLJB 3SGEI 5A16A 4ZFZB 4I18A 3RHWF 3VXRA 1RZ7H 3BN3B 5KS9F 4LCUB 4PFEA 4EI5D 4X6CA 5DMKB 2M1KA 3AREB 1KXTB 25C8H 3ARGA 4LSPH 4OF8A 4MQTB 1YPZE 4NYLA 5C0CA 4C56D 4HF5H 1DP0A 8FABB 1UZ8A 5I8CB 1FNLA 4NRYA 1T1YB 3VFOA 1MH5B 1E6JH 3BEVA 5E94B 3QPQD 1YEFL 4M6OH 3AB0B 5SWSA 5ECJE 5IMLA 1I7RB 4PJIF 3MRIA 4XCYB 1Y6KR 5IBLC 3BPCB 1BLNB 4PJDF 1I7TA 3WFBH 2AJUL 1HHHB 2G75B 5ADPH 5CMAA 5CGTA 2H9GA 3P30L 2BXZA 2IG2L 3MJ7A 1A7NL 4FMKA 2GY7B 1PQZB 4LNRB 3WNNA 1UYWL 4L1DA 1INQB 2BXYA 4OJFH 5SX4I 3QEGL 3ZYJA 4XI5D 3LQAL 1FC1A 1ZT4A 1UWEL 4JLRA 3E1F1 4M43L 4XHQA 2XTJE 2ADIB 1FIGH 5JOEA 4OGZA 3HUJB 4HG4K 1IQDA 3KPNB 1F58L 2EKSB 4I2XA 4I4WB 1UCBH 2GSGB 5GGQL 1JN6B 2VE6B 1N5YL 3WNOA 1XH3B 3JWOH 1IJ9A 2GT9A 3MXVH 3QUXD 4M1GH 4MA7H 3CDGA 3HI6H 1UJTA 4QRRE 4BQBA 4KKAC 4LRNH 1KCSL 2BFVL 1RJLB 1BIHA 2ZCKL 4RZCA 3QG7H 2WIIB 4D94A 2FATL 1U92A 1AJ7L 4J6RH 4AG4L 3OKKA 5CJ8A 4K3EH 3VXPA 1YY8A 2VDOL 1QSEB 1YEEH 4UV7H 3BWAB 1FAIH 3MOAL 5HI4C 1KF9B 3OZ9H 4ZD3L 2DLHA 5C08E 5DRXB 3UEZA 3OKMB 5L2KD 4K8RC 2Q20A 3DXAE 1T4KA 2EEAA 3HZVA 1E6OL 2X4RB 4RDQF 4HFUH 1DBKH 5E99H 1J8HA 3KPOB 4KJPD 2J88L 2F54A 4XCNB 4X5XB 5I76A 1HIML 1AD9B 3WCYA 1JZ3A 5H8DA 1EO8L 3T65B 5J1AB 5E9DE 2HKFH 3HG1A 3WSQH 4RFOH 3WL9A 3GKWL 5E24E 1N59B 1EEZB 2W65B 5FYKD 5HVWA 2XWJB 4RGOL 3MLZL 4G5ZL 1LNUA 4NZDA 1LE9A 3FO9B 4LQFH 3K4DA 4KAQH 3S4SA 1CXEA 3CU1A 3RZCB 3MUZ1 3N1MC 4NCDA 4U3XA 1PZ5B 5IB4A 1RURL 2OL3L 4WIQA 5GSVB 1CFTA 2C3GA 3OKLB 1V7NL 1IQWL 1N0XL 3LDBC 1U8MA 4N5EC 4DKDC 1S7UA 2ZUXA 1IC4L 5GS1C 2W07A 4W6WB 1AHWC 4M3JA 1ZMYA 2V2XB 3S3PA 5KG9B 1BAFH 3A6OA 2WUBH 3J8F7 4EN3A 5KZCB 4Q6YA 3W0WD 3QB7C 5ALCL 4YGVA 5BO1L 2BSED 4JZOA 3LKNB 5CINH 4EI5A 1EFXB 4WEBL 3BZ4A 4JFHD 5DMIH 4YUEL 2Z9TA 1S8DA 1W0WA 1YY9D 1BD2B 2XZAL 3PWPB 3DX9A 3D0LA 4JVPA 5F7YC 3VGBA 2VDNH 4U6VH 1D9KC 4Y5VA 3Q5TA 3MV8D 3S35H 5DI8A 4C56A 4PRIE 1C1EL 1IGFH 2EDWA 2VISA 2X4NA 3ZDZE 2ZOKB 1LO0H 1TTGA 4KROD 3MRDA 3O6FD 4OT1L 2E27H 2A9NL 2GAZA 1WAAF 1X4XA 1T83A 1JK8A 4JY5L 4OFPA 3HRZA 3T2OA 5DD6B 2JB5L 4I0PC 5LWYH 2F8OA 3I75A 1CLOH 4WHTA 1QSZA 1HCVA 4F7MA 3EYOB 3VXOB 2YRZA 3MRHB 1EO7A 1IKFL 2BNQB 2V2WA 3RNQA 2E7BA 1T7YA 2G9HB 4XP5L 3WDJA 1DQLL 2PW1A 4AEHH 3DV4B 4BM7A 4E0RA 2YKLH 1MNUH 3V5DA 4ZFGH 3FKUS 3FT2A 4PJIA 2P7TB 3BKJL 4N0YH 3D3VE 2YUVA 3QUXA 3FB5A 4OZFB 1JZ4A 2YC1B 3GMRB 3LDBB 4NSKA 2VLRA 4YGAB 4ZO8A 3HZKB 4Q74A 5FUCC 1CTNA 5GS1B 1TZHA 3IDXH 5I8OH 1MCOL 1EA9C 1AHWB 1OHQA 4MVBD 4PTUB 4F7CA 1JPSH 1QRNB 3FB6B 1NBZB 4L4VE 5DFVC 5KANG 1GOGA 3VA2C 4I5BB 4UU9B 2XG4A 4K3JH 1KIQA 1S9XA 1SYVA 4KRPC 4EUPG 5L2KA 2ZJSH 3IGAA 4NZUL 2IAMC 1D9KB 3OAUL 2OTPA 3TWCL 3MZGB 1JF5A 1AKJB 1RIHH 3VFGL 1QLFA 5DHVB 2FR4A 4X4MA 1VGEL 3FL7A 4LVEA 3GJFB 5E2VL 3O3DB 4D0BB 2Z0BA 3U79A 1TLKA 1O7SA 3UDWA 3P73B 3QDHA 3WJLC 1CI5A 1OAKH 4FG6D 4XCEA 4U7KA 2HWZL 1LE5B 2NY5L 2J8UE 4I0PB 1EUUA 1JP5A 3TVMD 4BSVB 1BJMA 3JV4A 2NXZC 4M8QA 3T77A 3ELAT 2VLMD 1EGJA 3UMTA 4GW1B 1SM3L 5HYEA 4APQC 4U4BA 3MLTA 2YSSB 3RY6A 4ZXBD 4LLWB 4BA8A 1KN2L 5IWLC 5IB2A 4ODXA 1VADA 3G5YA 4KK9D 5FOBA 4UNTA 5BW7A 1GGIL 1U3HC 4POYA 3KXFD 4LLQA 4B7LA 2CJUL 1B4RA 2GJZA 2JB6B 3W0WA 3RDTD 4WTZG 3IAPA 2IEPA 2NW2B 1WC7B 3KLAB 4P5MA 5E70A 1FZOA 2RFXB 1A4JA 3GO1H 4HGWA 1R5VB 4XNZC 3P9WB 4M7LH 4PLKD 2CK2A 4MA3A 4MA8H 1EUTA 3K80A 4G6KL 3NFNA 3VXQB 4TQEL 3H9SE 1MJ7L 3MFGB 1KTLB 4GMTH 4EUPB 2GITB 3N9GL 3O6FA 1PG7X 1PY4A 5CGMA 4R26H 1NEZA 2OZ4L 2ATPA 5A2JH 4JY6A 4O00A 1G9NH 3TCXA 4KRPB 3HTLX 3VFWB 2ZWLT 4FFYL 5IEHB 4G8IB 4NQDE 5D1QC 2IAMB 3AAZA 1I9EA 1KT2B 1YUHB 4JFPB 3LMJH 1YN6B 5IVXA 2IALA 4U6TA 3HMXA 4DFIA 5EU7C 4KK6C 1RVFL 2HLFC 4JPVL 3KPQA 4RSVA 5L8KB 1LP9F 3OTTA 1C12A 2CLZB 1KCUH 1KIPA 3MRJA 2B4CH 4R3SB 5CBAA 4ZAKD 4FQLL 5FYKH 4E42A 2C4FT 5BJTA 1E4XL 1YJDC 2EE6A 4HK3N 1DQJB 4GAGH 2NXZB 3ROOA 5FB8A 4X7TB 1INEL 3HS0A 4V1DD 4KK8C 4APQB 1EGJH 1TJGL 1Z5LB 3FZUD 3CXDL 5HDQH 4DKEH 4DGYH 4FQ2H 4FFWD 1S7VB 1AY1H 2APFA 4Y1AE 1BIIB 1U3HB 4XPHL 4GRMA 4LCIL 1SJHB 3RAJL 3T0EC 2CUHA 2BVPB 3PGFH 5DJDA 1RULH 5GJSL 5DRZB 1YEIH 4ZOCA 4QTHB 1WBZA 3INUH 3WMSA 4U1SB 1FNEB 4L29B 1OAYL 3ARBC 3RUGF 2W9DH 3L3KB 2DLIA 1FE8L 4XNZB 3QQ4A 3VFMA 3AS0A 3LN9A 4LEOB 4LPUA 5I1LA 2R0KL 3UYPA 5AYUL 3SN6N 5JPNA 3EFFB 5FO8B 2Z91A 3TBTA 3VFTB 1HKFA 1I7UB 1SEQL 4JJ5A 2AEWA 3WV0A 2CR6A 4CU8A 4IJ3C 2P5WD 3DRTB 1N7ML 1ZTXH 3NIDF 5EUOA 4NKIH 5JW5B 4F7TA 1G9MH 4AIXA 4ZFOL 5D1QB 5C07E 5FKAA 2FEEL 5DD0H 4H1LG 5ID1B 1LDPH 3DETD 3TVMA 1U8KB 3ILQD 5DEFB 2PW2A 3HMXH 4PP2B 4G8EB 1NH6A 1BEYH 3PWLA 4KU1A 4YPGB 4RAUA 2ORBH 3FRUB 1HXMB 1ZLUK 1X4ZA 5BVJB 4X7EC 3GMMA 2HG5B 4OUOA 5DEZA 4W6YB 5GSRB 1RZJL 4GSDH 3E0GA 1LEIA 3KXFA 1G7HB 1CDJA 5ITBH 4D9RD 2VDLL 4HS8H 5DUBB 3BE1H 1IGIH 2Y36H 1MHHB 5CWSA 2PO6A 3RDTA 3F62A 1J88A 4FZEH 1E4KC 2WBKA 3LD8C 2W1NA 3V4PH 3CSYA 1JPTH 3RIFK 4XPTH 1G7LB 3GSOB 4QHKJ 5ALBH 1QUNA 4PJEF 4CJ1A 1P7QD 3NN8B 3T3PE 3T0EB 4R4FL 2FGWH 2BRRL 4FFVD 2Q86A 1RUAL 1TNMA 1U8LB 3TBSB 1A6ZA 3WKNA 2LU3A 3U0PA 3MROB 4AH2A 3ARBB 3GMQB 3KPRD 5CGYC 1FRGH 4DZBA 2AJ3A 1ZANH 3JWDL 1I1AB 5E4EC 1PLGL 3FOLA 1P53A 3P9LA 4MB3A 5B39G 1WVZA 3E8UH 1JGLH 3FFCE 4RGND 5MENE 3HC0A 2HJLB 3ZYZA 4H1LB 4IJ3B 2YPLB 4Q6IC 2VYRE 3L3JB 4M48L 1Q1JL 1T0MB 3S6CA 2MSPA 1ACYL 4LLYA 3MGOB 1QG3A 5E2UH 4ZAKA 2CDGA 4OGAC 3E6FB 1SY6L 1Z9OA 2BC4A 1HH9B 2O5YH 2DKSA 1UVQB 3H42L 4OUUA 3I3BA 3PL6C 1B0GA 2ZKHH 4OLEA 1MHPL 3BQUD 2P8MA 3C60C 3DYPA 4NNPL 3U4AA 1JRHI 4V1DA 5E6IC 3KDMA 4YE4L 4PJ5D 4IDJH 4Z95H 3S97C 1MCPH 3WUWA 2GJ6A 3SBWA 3SDDD 3FAWA 2FHFA 1JGEB 3BPOC 5CJOH 1LEGA 5A1AA 1T03H 1DANU 1DEDA 4BH7B 1N6QL 5F72S 3T4YA 2V7HA 1NDMA 3VCLA 2P5ED 1YQVH 4Y0GA 3GFUA 3O41A 5EORH 2HN7A 5JIIA 3LV3B 1P7HL 1NMAL 3B8SA 3LD8B 1L7IL 2LAAA 4D9LL 1NMBL 1INDH 3FB7B 4PRDB 3H3PL 4NUGH 2D7OA 2R2CA 2GSIB 2GW5A 2I9TA 3D18A 5GRVK 2XWTA 5DMGC 1RJYA 1RJZA 3BP4A 4PYGA 3WHXB 3S96A 3FTGA 5KSVB 3QFJE 3UPAA 1ZKAA 2V2TB 1ZLSL 5LXGH 1X5GA 2P5WA 1P4BH 3KWWB 5B39B 1I4FB 1OCWH 1BVKA 2NXYC 3QHZH 4PRAA 1Y18B 1P4LB 3A6BL 4MYWB 4NUJA 3IF1B 4M1CC 4H8WC 2YR3A 2R56L 1JTPA 1OGAE 4L9DA 3TN0C 1U8HB 5E4EB 3LEVH 3OB8A 1D3CA 2N1KA 3FQWA 1U8PA 4X9IA 1IAMA 1I9IL 4HWZB 3PHSA 3R8QA 5GS3A 4YPJA 5DZNA 3RUGA 4Z7QE 2MNUA 2YD3A 4PJGE 1I8MB 2PXYC 4K71C 4Q6IB 1M05A 3U4EB 4AL8L 3CVHB 4CADB 4OF7A 2A2QT 2EDXA 4JN2B 4K23H 3SDXA 3ULUC 1TXKA 2HH0H 3GHBL 3MLXL 3K1DA 1RZFH 3PL6B 4OCXH 3C60B 2BNRE 1UGNA 5GISL 3C09C 5E6IB 2VAAB 3MV7B 2J6EL 1CBVL 1CT8B 4OI9A 4D0DA 1MCWM 3GNML 5JHLL 4Z7UA 2C5DC 3MR9A 1B0WA 4GAYA 4MNQE 4BZ1L 5IW6B 2ERJC 3RA7H 5FA4B 3NVQA 1UWGL 3VE0B 1TJIL 3NCCB 1JF1A 4CN1A 5D93C 1MCEA 2Y5TA 5DHYA 1L6XA 1GZPA 2XTLA 1TIUA 3UTSD 4UTAL 3KPRA 3G5VA 3BHBA 3THMH 5D7IE 5C92A 1V3JA 5F3HA 5I18L 2P49B 4MS8D 5FYLL 1CZ8L 5IGXL 1D5IH 1KN4L 2A6DB 4YXKH 2EDNA 1HOCA 4U1JB 4JO2H 4FXKB 5F1SA 3QO1A 3B9EA 4R4NC 1NGZA 1AP2A 4UQ2B 5KOMC 1XGQA 1MAML 3U2SB 2I9LA 5BRZB 2C3XA 3MODH 2BCKA 5L7XL 3OF6A 4PJEA 2NXYB 3OSKA 4ZO7A 4PY8J 4EIGB 5C0FA 4RAVA 3QXAA 2FX8L 4O9HH 2MWCA 4GBXC 4G8GD 4NQUA 1TCRB 5E2JA 2V17L 3LKRA 3MC0A 3TN0B 3M17B 1PKQA 4DQOL 3BQUA 3CC5A 3ULUF 5B22A 1NANH 4K7PX 4FFZL 5TF0A 3CXHJ 2PXYB 5JHDB 4K71B 4PJ5A 1IC5L 2EYTB 1BOGA 2P4AB 3SDDA 4Q9QH 4TUKH 3WS3B 4Y5XB 4MXQD 1EV2E 1VFAB 2D9QB 4I3RL 3X3GL 1KCRH 2P5EA 3ECBB 3O3EA 3EYVB 2W0FA 4FXGA 4UDUB 1UT9A 5I1CL 1QNZL 1UEMA 3C09B 3I6KA 3IXTB 2CLVA 1LD9A 2ENSA 3BW9A 4N90D 4QOKA 2O5XH 4N9GA 1XAUA 3SDCC 2VDQL 1XCTB 2APTA 1NPUA 2ERJB 3H9YA 2WWKT 2OJZH 3KPSD 3ZHKA 5FO7A 4OD3H 2HT3C 1NBVL 4O58H 3A6CH 3GZKA 2YN3A 4XNXL 1MIML 4WUKL 4IRZL 3WHE1 3GSVA 2VLKB 2Y5EA 4HUUA 3KPPA 2D31A 5T5NG 3FB8B 3BUYB 5DT1L 5JQHC 4J3XA 1VEPA 5CILH 3SQOH 3N0PB 1FL6B 1RZKC 1HILA 1KGCE 3MRFA 1QKZL 4JFDE 1HN1A 1H3TA 3TJEH 4WV1C 2DS4A 1U9KA 3U4BH 3L6FB 5CEZD 2Z35B 1H5BA 2XACC 2PYEA 1DFBH 1A1OA 1QYGH 1IAKA 3P3YA 4KDTC 4RFEB 4GBXB 5SWZE 3DVIA 4WCYH 3BIKB 1IMHC 1XT5A 1FLRL 1DQDH 5C0BA 4Y4KA 3BOVA 4JDTH 2X70A 4NQEE 1T66C 1IGTA 4OCMC 2X4PA 3ARVA 2NMSA 4XB8A 2OK0L 4GG8B 1UM4H 3VMOA 4WFEE 1V8HA 2BJML 5EWIH 4BUHA 1F4XL 3CLFH 3CFKA 2B2XL 4G43A 1YC7A 4KVNH 4PJBF 4X6DF 3PWUA 4LKXA 4KZDL 1KEMH 5DK0A 1XCQB 2ZPKH 5C0DA 4JPIA 2D7PA 3UTSA 2I5YL 3QWOA 4KKBD 4PJFB 4PJHE 1ADQA 1KEGH 3SDCB 1FNFA 1WBXA 1MFEH 2AGJH 1CFVL 2DQEH 3REWA 4DN4H 4PRNA 1I7ZB 1SVZA 2I25N 4O2EB 4XH2A 5T3ZE 5J56B 1KNOA 1YMME 2DBJA 3TM6A 1U42A 1M7DB 3W2DL 4Z7WB 3D9AH 5GRUH 4OFIA 3P2TA 4G8GA 4CVWA 3RWGB 3MGAA 2FX9L 2V7NA 3QCVL 4ZOAA 1RMFH 4YQXH 2OR9L 2VC2H 4HKJA 1UJ3C 1OB1A 4D8PA 4O5LL 3BXNB 4WV1B 1YDPA 3QH3A 3MMEA 4NOBA 2ZUYA 1P1ZB 4PRBB 1XGUB 3MV9B 4QTIL 2ARJQ 5DR5L 1AH1A 3H7BA 4PTTB 2FLRT 1IEAB 2XNAB 4HMEA 4HW6A 1UWXK 4K9EC 2PR4H 2Z8VC 3QQ3A 3REVB 4G3YH 2ITDB 5AUMA 43C9A 1G7MA 4L8CA 2AEIT 5TDOB 2AABL 3ZDXF 1WF5A 4NM4H 1IGCH 2WBJD 3KPSA 1VKXA 4Y8DC 4NFBA 4U1KA 4BH8B 4JB9L 1A6PA 2MJWA 2DL9A 2XN9E 5GGVY 3SJVE 1F90L 5JQ6L 1AGCB 1MQKL 3MUHL 2DMCA 2E7LC 4GQ9L 4X6CB 1SBBA 3EYFB 1XGPA 1F3JA 4GJTB 3T0XA 1YPZF 5DC9B 4Y88A 3ARGB 3CGTA 1BBJB 1T80A 1W72A 4NYLB 4OCNC 4CDHA 1ADQH 2EXWC 1X5HA 4A6YB 5I75C 3MREA 2CXKA 4YAQA 1UZ8B 2RGSA 2VZTA 4GRLD 4NRYB 3VFOB 5IKCB 4XP4L 1YPZB 3R4DA 4Z7OF 5SWSB 5IMLB 3B8YA 4P48A 1XF4B 3WLWC 3WJJC 3S3JA 4OLYH 2HP4A 4D2NA 1I7TB 1CDUA 3QIWC 4FZ8H 1TPXC 1JUFA 1UJ3B 2ESVD 2H9GB 5LGKA 3NZHH 1DUYA 2DQHH 2OQJB 1NKOA 5HHMB 3QEQE 2H41A 4YR6A 2EDYA 5C0AD 4G42A 2IPUG 1OQOA 3S4SG 3VGDA 4JLRB 2NQCA 4ZUVA 1CGXA 4MJ2A 4B41A 4EN3C 2WINA 4I2XB 2NY4C 2FBOJ 4L3EE 4YHKH 3WNKA 1AXTL 4HIHA 3CDGB 1MFAL 2VIRA 4CW1A 1T1XB 2DIAA 5DURD 2XKUA 4MQ7A 4RZCB 1U8OA 4PRHE 2B0SL 5K9KA 4K55A 2P8LB 5DJCA 2XA8L 1MRCL 1N5AA 4QRRB 1P2CA 2EXYD 4NC0B 1C7TA 1HWGB 4I48A 4XPFH 1A3LH 4XPBL 3C5JA 4LAQL 4NZRL 3IFOA 2R23B 4N68A 4MQSB 1T4KB 4OFVA 5I1EH 4PJBA 1W72H 3HZVB 5C6PB 1B4JH 2JJUA 2AK4D 5I75B 4NO3A 1ORSA 5H35B 2HMIC 2R0ZH 1J8HB 4KY1H 2F54B 4DZ8A 4NJAH 5I76B 2V9TA 1MAJA 3LIZH 1RZ7L 1A6AA 3DXAB 5ENWA 3HG1B 3BT2L 4KHTL 1KLGA 2LV4A 3T4AB 5J6GA 2FECI 5CEZH 1A7RH 2NLJA 1CL7H 4QO1A 3HZMB 2E6QA 4DGVH 4E9LA 4JR9L 4C4KO 2B1AH 3S9DB 1FN4B 4KZEH 3ZYOA 5C08D 3QIWB 1TPXB 3S4SB 3ARRA 5EC2B 3MTRA 1QLEL 1YQ2A 5IB4B 2EDKA 1T20A 3O3BA 2ZSVA 2NX5D 4MLSA 4WRLA 2ICWJ 3P0YL 3PP4L 4HPOL 2WBJA 1A47A 4O2CB 3OPZL 1FORH 4UDTA 1I75A 2YRLA 5E9DD 1MHCB 5KVMC 4GW4A 4EN3B 4GUPB 3U7AA 4XBEH 3PNWB 4BZ2L 4HGKC 2YN5A 3WFBL 2QSCH 1G9NC 4YGVB 3F5WA 2NY4B 1QACA 4P2QE 4WDIA 1A6WL 4XXDA 3HE6C 1ZT1B 2VZ1A 3KPMB 4PJXA 3QUZD 2VNCA 4JHWL 3ZDZF 3W11D 4OJFL 5C0GA 4GG6E 4LHUB 4C56B 1OT1A 4QKXB 3TBYB 3EAKA 1FIGL 4GRLA 1ZHLB 1NAKH 3UDWC 2B4CC 2GAZB 2VWEE 5CJ5A 4H26B 5E6YA 2A73A 5DC4B 5AEAA 4DVRH 3BISA 5HDOA 4HLZH 4PRIB 4F15C 3DIFB 3VXUE 5EB9A 5C09E 3SKJL 1CTOA 2X10A 5EBMB 2AXJA 4MD0A 5ANME 2QKIA 4YX2L 4E41A 2ESVA 3MUGB 1NC4D 5GRYA 4F7MB 4K3EL 4D3CL 1I9JH 3V95A 1YNKH 1ZEAH 1YEEL 3SO3C 1FAIL 2Z93B 3QDGE 2OP4L 1JHTA 5C0AA 2KKQA 5BW7C 1MAKA 3U7YH 5IESH 3MSPA 4WO4C 3GMNA 4E0RB 4YK4C 4CAGA 2GCYB 3V5DB 4DVBB 4XC3L 1U8JB 5E99L 4YFLF 4NC2B 3IETA 1E28A 1U6AH 4ZNEE 3J7HA 1CD1A 4EOWL 5CHNB 2F8XC 4MCZA 1XIWA 2HKFL 5HGAB 4RFOL 2VLRB 5DJ0A 3QUYA 3GBMH 1JTOA 1TZHB 3DTXA 4UI2A 5MERB 4LPCA 1Q9LA 5T3XD 2DQTL 1I1RA 4KROC 5KSUA 2MKWA 3D39E 3D3VB 3ET9F 3MNZB 4HXBL 1OAUH 3SCMD 3T8XB 1T0PB 1J0YA 3HE6B 1ZHBA 3MRPA 3IS1X 1G9MC 4X9GA 1OAQL 1S9XB 5DMYA 1MUJA 2R1YA 3QRGH 5ISZD 1SBSH 4L4VB 1HZHL 4UB0H 1NEZG 2AK4A 3PP3K 1TJHL 5D7KD 5FGBA 2FR4B 4NFCA 2JJWA 2DDQH 4M00A 3DX7B 3HNTH 4JFFE 1T1WB 5DA4A 1EK3A 1OTSC 4I3SH 5CINL 5F7NC 5DMIL 2J8UF 2VL5B 3RVWD 4F15B 1R3IL 2P24B 3LS5H 1QSFD 2VDNL 2F74B 1RUPH 2XZCH 3PHQA 5I66B 4NO5A 2J3SA 2KPNA 2VH5L 1ONQA 4NWUH 3WNLA 4CGTA 5MEQA 3JV4B 4DW2L 3QDJD 1HHIA 1I1FA 2CUMA 1C5CL 5GS2D 9CGTA 1A22B 2M26A 4MHHI 2NX5A 3SO3B 4ODXB 3G5YB 5FOBB 5IEKA 4LLMB 3QNXA 4WO4B 4MVBC 1YEDA 4NN7C 4YK4B 4DN3L 1DBBH 1HK6A 3GI9L 2GJZB 3IJYB 2BVYA 1QVOA 1B3JA 3MJ9A 4P5MB 3QUZA 1FZOB 1A4JB 3QXDA 5JTWA 1QPPA 1FH5H 3HI5H 4MA3B 3K0WA 1YYLL 4XCCH 4MJIA 1NBYB 1F4YL 1XR9B 1XZ0A 4KROB 2Y6SD 4IOIB 5HY9B 3QRFM 4F8TA 4ZFFA 1L9NA 2AJZB 5I9QC 2X5PA 2ATPB 3Q2CA 3X13A 1NMCC 5I8EB 5FHBH 3JUZA 5I1JH 2VABB 3MLSH 4NQCE 3O4LE 1XGTB 4PR5B 2BDNH 1G7IA 1U36A 2NY7H 5IVXB 4A2MA 1JPGA 3U0WH 3NIFE 1EHXA 2C26A 2DI8A 1A6UH 1NC4A 1JYWA 1DCLA 3B2UD 3KPQB 2HTKD 2CMRH 2IANE 1C12B 4U1IA 1XF5B 4XPAH 4J3VA 2WUCH 3OR7A 4K3JL 5CBAB 3LS4L 3VXMD 2IPTL 1P84K 1HYRC 5BJTB 4LVNC 1RPQA 2X4OA 3GBNL 4HJ0D 4RWYH 3OXRA 3ROOB 2OJEA 2PO6C 3FONB 3QI9D 2WLYA 3CX2A 2FIKB 1MCQA 3VFPA 4KTDH 3PG2A 1JHLH 1J05B 3PV6B 3ARXA 5EO1A 3ME0A 1VB9A 4X99B 4TNVK 5IJKC 4PLKC 5B3JE 5CD3A 1OAKL 4HH8A 3P40A 1OTUC 4G7YH 1BZ7A 5CSZB 4GRMB 3QJHB 4DAGL 4NN7B 3KYNB 4FQ1H 2IBBA 2H2SC 5DJDB 3DARA 3LPWA 1LHZA 3SCMA 1JV5A 5F96L 2N7BA 5FYJD 1WBZB 4XVSH 3WFZA 3BD4A 1M4KA 3ULVH 3MJ9H 2MHAB 5TE6L 5ISZA 1C16A 4U6XB 5I1LB 2DLTA 5INDA 1MF2H 1CXLA 3AM8A 5EPMA 1X5ZA 3IXAA 4IIQA 2Z91B 3TBTB 4Y1AD 1GZQA 5F7EH 5F88B 1IBGH 5I9QB 2IC2A 3UC0L 4N0FB 1NMCB 4LIQE 5EUOB 3C6LD 4QRPE 4BFEA 1UB5A 3O45A 5EDXA 3UBXA 5IT2H 4R4BA 1QSFA 4M7LL 5FKAB 3T2NH 1CE6A 3H3KA 4KUZL 2VITA 3LEXB 1T7XA 2V6HA 3QDJA 4TOYL 4OIBA 3MBED 4Y19E 1RFDH 1A7QH 3PWLB 4RAUB 5B38A 2VXUH 5C3LD 1CDIA 1GGCL 3IDNA 1NCUA 1OWRM 1X5JA 2CPCA 3GMMB 5DJYA 1J8KA 1JBJA 2FWOA 4LCYB 1DLHA 3D85D 3JTTB 1A21A 3SY0B 1GAFH 4LVNB 1MRFL 5EBLA 3O2VL 4P0DA 5CWSB 2PO6B 1RK1B 5C07D 4P2OD 4XZUB 1K9TA 3GIZH 1FBIL 1S78C 2VXSH 4MDIA 3MRBA 5HYSB 5CEYB 4LOUC 1FC2D 1FV1A 1KCUL 5FFLA 1RI8A 3N85H 1J1XH 2FEDC 4XX1E 2VQ1B 1ND0A 1MFDL 2EEDA 1VEMA 1R3JB 3NH7H 1IFHL 5T3XH 1A3RL 3TIEA 3C5SA 2XKSA 4XWGH 3G9AB 3V4UH 4P23D 5KVDH 1E27A 5DUPH 3P77B 3U0PB 4AH2B 1UC6A 3L5IA 1DLFH 3MNWA 1NANI 4DZBB 3CFDB 3DBXA 2D0GA 1CQYA 3TP4A 5GS0H 4U6YA 2AAVA 4XNUL 3HRPA 1D5XA 5FCUH 2YD9A 3HC0B 3RZWA 1W8NA 4W4OA 3KHQA 1MI5E 1SJVA 3S36L 5DJAA 2H1PL 2XXCB 3L3HA 2CDGB 4HK0A 4JCMA 2UZIH 5E8DH 3VXMA 5HHXL 1RV6X 3BAEH 4F9PA 4HS6B 2A6KB 5CJXC 3UO1L 3QI9A 3EOAB 5D7SL 4H20L 5I71C 5FUZH 1RHFA 2EICA 4JE4B 4ETYA 5GS2H 3BN9D 5DK3A 2EYSA 1ZLUH 5MEND 1ZS8A 2GJ6B 5L9DH 5DFTA 3S37L 1LEGB 4NQSB 4HWBA 2NY1C 3T4YB 1SVCP 1NDMB 1KTDA 5IOPA 4ZYKA 1A9EA 4K3DH 3HMXL 3B9VA 4LKCA 3L3DA 3VRLE 1QFUH 3C8KA 1MLCA 3B2VL 3BMWA 4C83A 3DX6A 1P7KB 3V6BR 3MZTA 5ICZA 2I9TB 4OZHE 4ENEC 5EU6E 5MI0C 1MIEH 2XWTB 2KDGA 1RJYB 1RJZB 3V0WH 4NPYB 4H0IA 1QRKA 3S96B 1FL5A 1MPAL 2BSTA 3Q6GH 4R96B 1H15A 4PP1C 2K3TA 1U8QA 7CGTA 2X89D 1BBDH 2KZWA 4ZUUA 1M6OA 3C6LA 1FYTD 1ZT7A 5LCVL 1BVKB 4PRAB 4R2GC 1X44A 4YHOH 1FO0L 1T21A 2VXVH 5I74C 5IHUL 3GK8H 1CLYH 5JZ7D 4CNIA 1BZ9A 3QULA 1HH6A 1U8IB 4RFNC 5AAMA 4HULB 1YEJH 1CYGA 2BOBA 4ONGH 1M05B 2OM5A 2FL5A 2DBLL 2KQMA 1BQHA 4I0CC 1OGAB 4PS4L 4ZOBA 4F2MA 4FTVD 1A6TA 4UAOC 1IRAY 4PJGB 2E5EA 5ERWA 3BD5A 2WWMD 2UVFA 1D6VH 5J12C 5GRXG 4P2OA 4WUUA 2XXMB 5JW4M 1QTYT 5I71B 3MLRH 4D0DB 4JFZH 3MR9B 2WP3O 4GAYB 4WWKD 2VDPH 4ERSH 4LARL 4PB0L 5E2UL 2G5RA 2HFGL 2BNRB 3K8KA 4NT6A 4BJLA 1TVDA 2A1WL 3PWNA 4WI9A 2NY1B 4OZGE 2J12B 1WIPA 4HWBH 4UTBL 3WXWH 3RI5K 3RIAF 4LSTH 4MNQB 5DHYB 5DVNA 4P23A 4EVNB 3ESVF 3FMGH 5D7IF 5FYJH 4WNQA 3EIFA 3G5VB 4HLJA 4PGCA 3BHBB 1GXEA 5F3HB 4Z0BL 5A43C 2CUIA 1KENH 4PLOB 4HIIA 5MI0B 1DBAL 2CK0L 1WT5A 4RGNB 3CFEA 3SOBH 5EULV 4CUCA 5CZXD 5J6HB 3VFNB 3MRCA 3QUMA 3QXAB 1S9YA 5D2LF 5I74B 3LKRB 3IDMA 3R1GH 1PKQB 4Y4KC 4O02H 4M9OA 4K2UH 3CC5B 4WFGE 5JXAH 3HAEA 4LSVL 4RFNB 4FNLH 4TPRH 1I1YA 4XP1L 4QCIA 5E95B 3C87A 5IVOA 4NHCH 2X4SA 4PJ5B 1SEBA 2XT1B 1FQ9C 1VSCA 1OGTA 1RUML 1BOGB 3SDDB 4F9LC 4M61A 5AZEH 1UQSB 4R0LA 3BYYA 5K9JL 5EO0A 3K4ZA 3G04A 4UAOB 5I1AA 3NFPB 3VG0L 5K9OA 1GPOL 4GRWF 2W0FB 5J12B 4NNYA 1A7BA 3I6KB 4ZTPL 3GB7A 2VDMH 3F7VB 1LD9B 2LE9A 4QOKB 1HI6A 3H3BC 5FO9A 4KI1A 4RQQB 4P9HC 4JPKH 1HDMB 4M03A 5EUKA 5FO7B 4MA1C 1ZV5A 2H45A 4K23L 1IM9B 4IRSC 2HH0L 1RZFL 3D87B 3QDMD 1A6VL 1HKLH 1BX2A 2X89A 2OXHA 4JQXC 4LHQB 4XRCB 5LQBL 4J3SA 1MCHA 4G7VL 1FYTA 1V05A 4GQPH 4JG0H 3LKOA 5HI3D 3I02B 1CICD 2B8OT 3TNNB 3X11A 4ORGA 1UA6H 1HILB 2A6JA 5ADOL 1RUQL 1YYMH 2RB8A 3TYGL 2JCCA 3ARPA 3IU4H 3HI1A 4OGYL 4HEPG 3TLRA 5T1MA 2A9MH 3BKYH 4JFED 2PYEB 4ODTL 3RWDA 2V9RA 3TPKA 2CD0A 4JFDB 3THML 4FTVA 4UBDD 5C0BB 4Y4KB 4YXKL 4XAWL 1QA9B 1NSNH 3MGTB 1IGTB 1FVDB 3BJ91 3HAEH 3SQBA 2X4PB 3Q6FB 5H37H 2DLEA 1F13A 2L4OA 1AFVH 5EZIL 4WWKA 3LY6A 2CIKA 3I50L 4AK1A 4HQQL 5JDJA 2OCFD 3D25A 5T1LB 3O6KH 3CFKB 4LCWD 4G43B 4PV8A 4NZTL 2IH3B 5F9DC 4NQVA 2DMKA 2IGFH 3AGVA 5DK0B 5SWZD 5C0DB 3OKOB 1CFQA 4BK5A 1KJ3H 2H3NB 2JE8A 2HVJA 3QWOB 3G6JA 5DO2C 2COQA 4YHZL 3LKSA 3GSNB 2GHWB 4WU5A 4IOFD 2A6IA 3IU3A 2GK2A 3S88L 4MA1B 5DTFA 3SE4A 3U48A 4IRSB 5KSAD 3S35X 5B4MC 4PJHB 3B5HA 4JVWA 4PBXA 1WZMA 1ZWIA 3P4NA 5KW9L 2XZQL 1CL7I 3NA9L 5T1KD 3CVIL 3NTCL 2YXMA 4XH2B 1K8IA 3GMPA 1KB9K 4H25B 2YXFA 3MA7B 1YEFH 4S11A 1G1CA 1YA5A 1ZVSB 4QHKI 4XNQB 2F53E 2V7NB 4P46D 2DRUA 4YXLL 3FO0L 1REIA 4HKJB 1AGBB 3P11H 1AQKL 3WIFA 1FG9C 1YMMB 4PJ8C 4X8XA 4UNVA 5E1AA 2HJFB 1YDPB 3MMEB 5LBSL 2XPGA 2FSEB 2IG2H 1A7NH 3VWJD 4HEME 1MCRA 4P2CG 3PQYE 4R7NB 1IVLA 3H7BB 5T3ZD 4MJ5B 1HHJB 1S9VA 2PTUA 1UWEH 4M43H 1RK0B 3F12A 2BVQB 5J3HC 3BIBX 4HT1L 4LAJH 5AWNL 4KJQC 5D2LA 5GGQH 5AUMB 1XEDA 1N5YH 2WK2A 3IKCA 4L8CB 1E4WL 4WFHE 2ENYA 5KSBE 2Y23A 4OZ4A 3KPSB 1VKXB 4QY8A 1KCSH 2BFVH 1CK0L 2X1QA 4WCYL 5E8EA 1SJEA 2ZCKH 5D7LE 4MAYC 2FATH 4GAJL 2YZ8A 4NQXB 1G84A 3QDMA 3DLQR 4AG4H 1QBML 3WO4C 4HZLA 4OF6A 3MRNA 5E8PB 2VUYA 1F3JB 2VDOH 2VQUA 4OF0A 3MOAH 1QLRA 2XN9B 4ZD3H 1CICA 3SJVB 3VXTA 3G5ZB 3CK0H 1JNHB 2AK1H 3GMLB 3H9HB 3MREB 4HLZG 1TZIB 2DQFB 4QF1B 1BVZA 1TQBC 1E6OH 1P5VA 4ZDHA 3UTPE 3IT8D 1VFBA 1OT2A 4NO2A 5FYKU 1HIMH 4KUCF 4JFEA 3L3GA 1EO8H 3DUHA 2LU7A 4N0CC 4OIAA 4U6HB 1U8NB 3IAGC 3OG6B 5AYQA 4Y4FD 3PV7A 4RGOH 1MFEL 3MLZH 4G5ZH 2F58L 5EU5A 1MVFA 3VXSD 5HI5C 4PJ8B 4LDLB 3HZYB 2IFGA 1A7OL 1AGEA 1DUYB 2PN5A 3LKPA 2FNBA 3T1FB 2W9LA 1RURH 1F6FB 2ZSWB 2OL3H 3UTZA 2HT2C 3DVGB 1UM6L 3RQ3A 3L7EB 1IQWH 1JWSB 1N0XH 4LCWA 4F37K 5HGDB 2ZOLB 1IC4H 5IW1A 4X6FB 1J0JA 2WINB 2J4WL 1A8JH 1UWXH 3F7YA 1NDGA 3IVKA 4XGZA 5DVMA 3QA3B 3BO8A 5DVOA 3KNBB 5ALCH 5D7JC 1T22A 3FQXA 3MRRA 1KB5L 2G60L 3OR6B 4WEBH 1KJ2B 2VIRB 4YUEH 4CW1B 2XZAH 3V0VA 3HUJE 1I8IA 3LOWA 3LRSA 4CJ0A 1EAPA 1U8OB 4L3EB 1WFTA 3MCLL 2R4SL 3W9DB 3QEQD 5DJCB 5KSAA 3SKMA 5CP7A 1C1EH 4MAYB 2C4XA 4KQ4L 3WO4B 4OT1H 5T1KA 3MCKA 4OZIF 4TUOA 2A9NH 1FHGA 1B9ZA 3KJ4C 3CVHL 1JGDA 3LB6C 1ZHNB 2GTZA 1A7PL 3IFOB 4GKOA 2R4RL 4QT5A 2X4UB 1BP3B 1F6AB 4P46A 1IGCL 4TVPL 4JY5H 4X6EB 3SKOB 3RTQD 1ORSB 1QSEE 2VWEC 4L5FL 3RPIB 1TQBB 1N2RB 2KUTA 2BMKA 5GHWH 3NGBC 4FOMA 4PRHD 5B8CA 5ENWB 5HYQA 3T04D 3ZL4L 3VWJA 2ATKB 1JRHL 1KPRB 3MFFA 1IKFH 3DROA 3UJIH 1JZ7A 43CAA 2N7AA 1FIEA 1DQLH 3P9MA 1ADQL 2WIMA 1NUFA 3FQRA 4ZODA 5BXFB 4Y89A 4YBQC 1EHAA 4N8VA 3MJ6A 3DRQA 2PCPB 3F7QA 3CPLA 1XIWC 1A64A 1T20B 3P4OB 4PY8I 1MLBA 3BKJH 1PD6A 3QUYC 4IMKA 1TVHB 4CMHC 4UDTB 4K7FB 3UJTL 1NFDE 3IDGB 1DVFD 1MCOH 3LN4B 4MJ6A 4HS3B 3F5WB 1GIGL 4LFHD 3JXAA 4WDIB 4WJ5B 2OZ4A 4PJXB 4KKCC 3TJHC 5A3ID 3HNVL 3RL2A 4GG6F 4UNUA 2R2EA 2H32A 1Z0MA 5CBEB 3WKMH 5AD0A 5C0GB 4NZUH 5D6DA 4P2QB 5FGBC 4H8WL 4HX1B 5DRNB 3TWCH 4XBGA 1I8LC 3VFGH 4LP4A 1VGEH 1NLBL 5E2VH 3TT1L 5I15L 1VHPA 4MNHA 2A73B 4GG6B 3KJ4B 4U49A 3GM8A 4LL9A 5JUEL 5EOCL 2HWZH 3PWVA 4L3CB 4Y4FA 2NY5H 4J8RA 4E41B 2DF3A 3D1MC 3ULUL 4DKFL 2AI0L 3OX8A 3VXSA 1WCBA 1YECL 4OV5B 2ZG2A 2FO4A 3TO2B 4MLIA 2K9UA 3EO9L 3NGBB 3VXUB 4GXVH 1SM3H 5FV2A 3SGDI 1JHTB 1JZ5A 4ISVA 5HHNB 1KN2H 4MSWA 2ICCA 3GMNB 2R2HB 3LRHA 2V5MA 1GGIH 1W72L 1O5DT 4HC1L 5DQ9A 3GSWA 3DNKA 3PXJA 5C09D 5E5RB 2CJUH 2R0ZL 5C86A 3IETB 4KY1L 3RHWK 3ULVC 1E28B 3LKQB 4JCLA 1CD1B 4BQ8A 4K07A 3ZE2E 4Z77B 3LIZL 3LEYL 2NTFB 4MCZB 1XIWB 2AVGA 1CIUA 4L9LA 3KYKL 4IHOA 3QUYB 5DURB 1LMKA 4CMHB 3DTXB 1KUMA 1Q9LB 1NGYA 5F7HA 4DGVL 3BZFA 4G6KH 1FFPA 3QDGD 1AGFA 2ARWA 1NCDL 4G80A 4TQEH 4KZEL 1MJ7H 1B6UA 3N9GH 3ZHLA 4N5UA 3HLAA 5F8QC 2OZ4H 1Z9SA 2R1YB 4O4YL 2UVEA 3U9PL 4OCRL 1QRNE 3ZKMC 4FFYH 2H32H 3RTQA 3KPLA 5HBBA 1NGWB 1FLTX 1SMAA 3OGCB 2QL1A 4TTDD 4XBEL 3BSZH 2Q76B 4JPVH 1PX3A 1JWUA 2P45B 3D39D 2NR6D 2X4TB 1A9BA 4NKDA 3H9ZA 3GSUA 3PHQB 5KAQF 4NO5B 4JFFB 5C0IA 3TO4C 4JRXD 1ONQB 4OZIA 4PJCB 5MEQB 1I1FB 1HHIB 1E4XH 5CKGA 5DS8A 4B53A 4ELME 1INEH 1U95B 1YEHL 1IC7H 5FF6A 5IEKB 2DD8H 3CXDH 3QNXB 1MHEA 1PAMA 3QFDB 1YEDB 3RU8L 4YIQB 4XPHH 4LCIH 2CDEA 4JKWA 3GSQA 3RAJH 4WI5A 5EZJB 4OLWL 3PWJA 5JA8B 1IM3A 5GJSH 1F5WA 4MQXD 1OAYH 4MJIB 5GS0C 1S7XA 4ZPVA 1R24B 1TTUA 1N8ZB 1LWRA 15C8L 8CGTA 3I6LD 3AM8C 2HA1A 2R0KH 5DUML 1NGXA 1IAII 1RZKL 1W0YT 4IIQC 5FA3A 5AYUH 4ZFFB 1HSBB 4K7PY 2HVKB 2EIZA 3EUUA 2ZCHL 3DVFA 3DECA 5F6IB 3QP3A 5FECB 1U6AL 1N7MH 3FT4B 1MJ8H 1SY6A 4UV4H 5E1HB 4QRSB 3NIFF 5HYIA 1G7IB 3WLBB 3PP3H 1JL8A 1H8OA 2E7HA 5E8OA 3RVTD 3VWKD 1NC4B 5I1GL 1R3KA 5F9OL 1S7RB 3UBXG 1JGVL 1KCKA 4U1IB 5GJTL 5D5MA 2ICEA 4PG9B 2OBGA 2JJSC 3FJTA 2NTSP 4UT6L 3WN5A 4ODBD 3ALXA 5L88L 1K5NA 2GUOB 3SKNA 3T0BA 4WVRA 5HHOA 5B38G 3GSRA 3TO4B 1RZJH 4OIIL 2UWEF 1K2DB 3PDDA 2VDLH 3CMOH 4LNVA 3O4LD 3MOQA 4KWUA 1I85C 3VFPB 3ALWA 4OCSL 1TETL 4DGIL 5B3JF 5E2WL 2R39A 3VFSA 1BQLL 1D5ZA 1KBGH 1C08A 3LS5L 1QR4A 1KELL 1P4IL 3UAJD 4KXZI 5FKPA 3KLHD 1JV5B 3TF7C 4R4FH 5IB5B 2XY1A 4JO1H 3TIDA 1XF3B 1RUAH 3CZFA 3SDYL 2MQ0A 4P57A 5EOTA 1C16B 4Z78A 1R5IB 4AT6A 2HTLC 1DEEB 3M1BB 1KFAH 3I6GA 3SE3A 1DN2A 3NABL 2E8YA 3JWDH 4IIQB 4KKLD 4QHUB 4R97C 2V9QA 1GZQB 5BMFL 3D0VA 1FFRA 3KYMA 3PHOB 3O9WC 5EN2A 4OFYD 1IGML 2N56A 4U1HB 3F8UB 3M07A 1UB5B 3D39A 4LCCA 3UBXB 4TSBL 4PRPD 1FH5L 4NGHL 1CE6B 4F9PC 4JRXA 2VITB 1SY6H 4QXUL 3BH8A