1O9ZA

F17-ag lectin domain from escherichia coli (ligand free)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
177
structure length
170
Chain Sequence
AVSFIGSTENDVGPSLGSYSRLPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSSRYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17-AG LECTIN DOMAIN
publication title The Fimbrial Adhesin F17-G of Enterotoxigenic Escherichia Coli Has an Immunoglobulin-Like Lectin Domain that Binds N-Acetylglucosamine
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lectin
total genus 45
structure length 170
sequence length 177
ec nomenclature
pdb deposition date 2002-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1o9zA00
1O9VA 2BSCA 3F6JA 1ZPLA 1O9ZA 2BS71 3F64A 1O9WA 1ZK5A 2BS8A 4K0OA 2BSBA 1OIOA 3FFOA
chains in the Genus database with same CATH superfamily
4XB7A 4QRTA 2NY2C 5DMYA 1MI5D 2NY2D 4M4RB 3SKMA 4X6CF 5LCVL 4HXBH 5DWPA 3CSTA 5K1NA 2R29L 2WK2A 4B41A 1WVZA 1FIGL 2X09A 4LSQH 2BVOA 1A3LL 2WBJB 2Y7SA 4LLMB 3V6BR 2KPNA 4OM0H 5KJRH 3VXOB 4Z7UE 4L4TB 4BWWA 3HPLB 2Q8AH 4Q52A 5JOFB 1QEWA 1OVZA 2QSCL 5CR8A 5I18L 1AZCA 3S3BB 3OV6A 1J86A 5IB5A 3D33A 2CK2A 5DK2A 1AO7A 5EBMA 2YBGA 1JWMA 3BP6B 1A9BB 5FOBA 1NFDA 3F05A 3N0AA 1EIBA 3I9AA 4N1HB 3RUGF 5HHME 1A7PH 3HRPA 4S1RL 5DT1H 3GJFH 3BUPA 4TNVK 2OYKA 4WI5A 2X70B 3H6JA 1MCRA 2WINA 5SX5K 5SWSD 5KYUA 3LEVH 4L3CA 4BQBA 2QQKL 1ROWA 2XXFA 3MUGA 1KNOA 2F54E 1AFVL 1NC4D 2AK4B 1RZFH 3MLYL 4JPWH 3RZCB 3JWNE 1J8HA 4TL4A 1C5CL 1EJ8A 4WNQB 4YEFA 2BNQA 1YYMH 3K2MC 5A2IH 3UERA 2G60L 3QCVH 1KCVL 3HOGA 4HKZB 4XPHL 3IDIA 3V0WH 3FFCE 3HUJE 3ESPA 3WENA 3F7KA 3MUUA 1RZPA 4RLDA 4PV9B 3S98A 4N0YL 1BZ9A 3BVVA 3CZLA 1HIMH 1CXEA 3OWEA 4P23A 4D0BA 5BQ7A 1GYAA 3ZRSA 4UM9B 1U3NA 2DMBA 4DGYL 5HHNA 2R4RH 3U6XS 3MLXH 4ACTA 1SBBA 2WZPA 5GZOC 2I07B 3ROOB 4MA7H 1EEUA 3GZOA 4YXKH 5CCKH 4ISVA 4D9QE 3DYOA 1IC7L 2VLRE 4XT1C 5E2WL 1FO0A 1KCUL 2BFVH 3ECWA 3OPUA 4JQIA 2GPZA 3GMOB 1JHLL 4QR7A 2R0ZH 3U79A 2R2HB 1CF8L 2IF7A 4X0KB 2XG5B 4X6EB 4I88A 3RL1B 1IARB 4RFNC 3ZKMC 4ELKB 4E9XA 1FZJA 3D6GA 1K5NA 3QCUH 2XUWA 1S5HB 2LQRA 3P0GB 4WI4A 3V10A 2X89A 4OFIA 2EE9A 4BFNA 4ZOEA 2EH8L 1MEXL 1OQOA 4P2QB 4N8CL 4FFYA 1C8QA 1NCBH 2CCWA 4OY9A 1KDIA 1H9VA 3QUZB 3E3QC 2FJGB 3ILPA 1T2XA 2XWJA 1OSEA 1RZIA 3ML9A 3WAKA 1FFTB 4GBXD 3DUSB 4CC1A 3SYOA 3R4RA 1CGWA 3HZYA 4JVPA 2RFXA 4UTAL 2KL6A 1QI4A 3KYKL 2OSWA 1TCRB 3X13A 4NWUH 4OLYH 5HVWA 2WO2B 4U6VL 1CUOA 1HH6A 2XI9A 1E5AA 3UBXB 1FN4B 4W9IC 4YWGH 1X6NA 3LEXA 4HHAA 1JF1B 1UVQB 1LEGA 4U1MB 5LLIC 3GM0A 2CDEB 2QL1A 3GMPA 1G7IA 4KNQA 3AS0A 2Y2TA 4L9LB 5ALBH 3CC5B 4P23C 4R7NA 3V6ZA 4P23D 4L37B 1VCBC 1JGDA 4JRYE 4LPTA 1Y18A 5I8CB 1U8LB 3KPSE 4I18A 5ES4B 1ZS8B 5DYFA 1G9NL 1LP9B 2KZWA 2WZPD 2RHEA 4ZX3A 3QJTB 1U8OA 4JR9L 3UCQA 5IQMA 3EOBA 1S7XB 1A21A 1T80A 3LKQA 4GP4B 2ZXGA 3D69B 1I8KA 4FQQB 4AT6A 1DLFL 5JO5B 1M71A 1DQVA 4AJVA 3GXDA 2DMGA 5A6MA 3DARA 4U7KA 2R51A 1BXXA 3E8VA 5KAQG 3OKLA 1N26A 1RZ8B 4N2BA 1IM3A 2E0PA 2K9UA 4ILDA 4PW4A 4WSJA 2DJMA 5EU6B 5HI4D 3SCMB 4N9GB 4Q9RL 3EJJX 2N3JA 5F88B 3QO0A 2CO3A 3MLWL 4DO4A 2NNAB 4KX8A 3RPIB 3R1GH 3VX1A 2H8PB 5IB1B 1B6DA 4JG0H 1HSBB 1K72A 3CTTA 4X5QA 3F6IA 4JCWA 4Z8FH 3F65A 4S1QL 4HUUB 2QPSA 1GGTA 2WD0A 1M7DB 5DUPL 1HYSC 3X1GA 4NUGH 5K9KA 1YJDH 1NPNA 4GI6A 3BXNB 1JIBA 1W0WB 2YGPA 3GPSA 4RX4D 2GC7C 4XNZB 1FZMB 2AJYH 2BW5A 2H4EA 4K94L 3BPCB 3EH1A 4G9DB 2XZZA 3V6OE 3BDYH 1LD9A 4AVKA 3DPDA 4N86A 4WUKH 5MHSE 2XWBA 1T4WA 4HIIA 5DHYB 4ODUB 3BQVA 5C0BD 3VRJB 1QOKA 4I18C 1TLMA 2EE6A 3FCSA 2CE6A 4PJCB 3P0VL 4PGCB 3I9GH 1UOLA 4EAEA 1QBML 3S3DB 3IVKB 1DP0A 3T6QC 2LU4A 1CDIA 1H3UA 1R3IL 4PB9L 1GS7A 4Z77B 5LXGH 2WCSA 4XAWH 3UEZA 4NKMA 4EEEA 5H35A 1GW0A 2P5EA 1AE6H 3EKCA 3ABKB 3VCLA 2OS7A 4J2QA 3MOAL 1MFDH 4E0RA 5DJ6B 3FT2B 3LXCA 1IM3D 2Q76A 4NSKA 5B3JF 4E42B 1I3GL 3ECUA 5HHPB 1OSZA 4GSXA 3O4OB 3PPSA 3UTTA 1ZT7B 2H47C 1YN6A 4ZZFA 5I2IB 1U6AL 4PBXA 3OAZK 1UCBL 3ES6B 1M9WA 2VXQA 5C92A 3V9EA 4JHVA 1MCWW 3GMLA 5LKNA 2EIDA 5HDLA 4JO3H 4ZO6A 2WB7A 2LABA 1OAXL 2X4NB 5GGVH 2CR3A 2PMZA 3WXVH 5J06A 3IDNA 2GK0A 3OKMB 4PJEB 2ZG3A 4G8GB 4AM0Q 1Y07A 2DWDB 5AAMA 3WYRA 3OJMB 3B9KB 2AJSH 3SGEI 3RY4A 2Z8WC 3WIFB 3ISRA 4DOHB 4JO2H 2Y6SD 3CCHA 4RGNB 2C7UB 1U58B 3SPVA 1ZAGA 3QB7C 5AYUL 4N0FA 1XGYL 1XCTB 3FQTA 4YHNA 4ECNA 1E9OA 1A6UL 3I02A 3RL2A 4B3EA 2X6CA 4PSPA 1EZVY 3LN5B 5JTWA 1GR7A 2ATPB 4Y16A 2EDYA 3Q1SL 5D1XE 3OVUB 4TUOA 3U46B 1U3HA 2C9UA 3PNRB 3IF1B 2X12A 1DBKH 3MJGX 3QCTL 1I8MA 1IGFH 5CJXA 5DRNA 2GTWA 2HH0H 5BRPA 3SKNB 5EUOF 3MRQA 2ZXAA 5D55A 4NO2B 3DA0A 4L29A 4ZJ9A 2IVFC 3DX4A 1P9MA 1P0SE 2XZAH 1R47A 2NUPB 3E1ZA 3FTXA 2DM3A 4WFGE 4UNVA 4A6YH 7FABL 5L0QC 1RHHA 3PQYA 1DBBH 2P5ED 2K7QA 2Y1VA 4JN1H 2Q9OA 4OFVA 5CJ5A 4N20A 3K2KA 5A7EA 1N64L 3BE1L 5D1QC 3TFKC 2ZKMX 5D1QD 4YO0A 4LSPL 5CCHE 2ZCLH 4PJDB 1QLRB 4G8FB 3PHQB 5EOQH 4OI8A 2Z6FA 4LPWA 4N2FA 3UGUA 3IFLH 4PQXA 4UUJA 5JLZA 5FF6B 2H7WA 4HSAC 5CF3A 2B2XH 3BN3B 5E8DL 3S36L 3U4KA 2LVEA 1O7DC 1Y6NR 2EEXA 4R2GB 4ZYKB 2FHFA 1L7IH 2AXGA 3NGBB 4M7LL 5IJKA 5F97E 3VO0A 2Y72A 5AAMC 3RWGB 3EYVA 2I69A 1L4IA 4YDMA 1XGUB 3PHOA 4AQ8A 3S34L 1YDPA 1DSFL 4AEIL 3C09C 4QXVA 5IROA 4BKTC 2E6QA 1UB5A 3NFSL 5I5MA 2XTLA 3BIKB 4QRSB 1SYVA 5SV3A 3QZWG 5CM1A 3QARA 4N2DA 5E08L 1HEZB 4H8WH 4K3DL 4MB1A 2VDKH 2YBRB 4ZNEE 5CJXC 4OAWA 3D85A 5DDHB 5SWQB 1FH5L 1QFWH 3WKYA 2OMWB 1MAMH 4HGWA 2EVIA 2IH1A 2Y1AA 1Q9WB 4HV8A 2YN5A 3P4NA 3ZTNL 1VZGA 2A83A 1P9MC 1PD1A 1T20A 4BQ6A 4Q56A 1A0QL 2HFGL 3BPOB 5F1IB 5HVHB 1DBJH 4WK2B 4DFIA 1H8OA 5HPMB 3T0BA 1IEAB 5T3XL 1BZOA 3PU7A 2JIXA 3M1BA 3NESA 5TDPB 3ESOA 2FX8L 2MOQA 4YNYB 3TO4D 1M6OB 3MA9H 2I26N 1QLEL 3PWNA 5BOZG 1P4IH 2VDMB 4EDXB 1S78C 4Z78A 5KVEH 5IM7A 3DBSA 1S78D 3SY6A 2D31B 1T6VN 1WC7A 4P3WA 4FL4B 4DP2X 3T0XA 3EYQC 3TH2T 3FYIB 3EYQD 5IJKC 2J2ZA 4JRXB 3ZKXC 4E9YA 5D72H 4AQ8C 3V7AG 4K0OA 4X6DE 4Z5RB 3P1VA 5IROC 4MB4A 2FX7L 2OV0A 5DYOA 5IROD 2ZSWA 2AP2A 1GOGA 4HIPA 2OJZL 1N5YH 3AU1B 4FQIH 3QRLA 3F6LA 1HZKA 4ONHB 4JFYA 1OPGL 2X2UA 3FBKA 1F00I 1UC6A 1O5DT 2C3WA 4R4FL 4ZTOL 1UH4A 1T1YB 3GXMA 2H9GB 4LLYA 1RFDH 4JBSA 2AEPH 4NC2B 1X5IA 1LILA 4PV8B 4YC2B 4TN9A 3K72B 3O4LA 1GZPB 3HI1A 5AVRB 1P4BH 3BAKA 4GOSA 5DJYA 2UY7B 4QJ3B 4QHKJ 2H0PA 3G5YB 5C8JA 2W80C 4JO8A 4RSYA 2HJLA 2CO6B 1PIGA 5I71B 2OQJB 2CUAA 1NMCB 2H1PL 3NRQA 5E7BA 2VKWA 3KS0J 4I1RA 3TJEH 4I77H 4XR8C 1MKFA 5EIVA 3K6DA 4AM0A 1TCMA 4YDNA 5CJQL 4MWFB 2FEEI 3QJQB 1Q1PA 1X7QB 5F44A 1P6WA 4IU3A 5FIEA 3ZO0A 2E76C 3IAQA 4IRSC 4PR5B 3V8CA 2VAAB 4IRSD 4PJXE 3ARUA 3FQWB 2FL5B 32C2A 4URTB 5AALA 4Y2DA 5CP3H 5IOKA 3KH4A 1WZLA 3WN5A 1DBML 2BP5M 1ES0A 1EEYB 5DR5H 3DVGA 2GITB 2CD0A 4WW2B 5CS7A 2BNRD 3N50A 2Z31D 4OLWL 1NLDL 2VDOB 4OFPA 4OF8A 3CPUA 4O5LL 4XOEA 5ESQB 1YO4A 2AQPA 2Z93B 1X4YA 5D6DA 2J12B 1IQWH 3EH2A 2AJZA 4JDEA 1TMQA 1VACB 3QULA 3QQ9C 4PJ9A 4L18A 4C8XA 5DJAA 2CBPA 1V3MA 2MPAH 3PGDB 5KJ7E 2VXTH 1IAII 2QEJA 3O0RL 5D7LB 5E9AA 4BFGA 3I50L 3H9SE 3RB7A 1P84K 1A2YA 2APVA 3W9DA 3ZQWA 3FH5A 4WO4D 5I1KH 3A3YB 2ITEA 3ZIMA 4TQEH 2A7BA 2AEIT 1RZJC 1CTMA 2XN9E 1CI3M 2X4QB 1HHKA 1YQ2A 4YS4A 1IBFA 2XIDA 3OB8A 2DQCH 4LSTL 4RA0C 1HL4A 1N6QH 3HC4L 3HR5A 3JUZA 5F1NB 1LK3L 4U3HA 3KCPB 4Q4IA 1NGYA 8PAZA 4RGOL 5F2FA 4WK4B 1FYHB 2VC2L 1R3KA 5E0FA 3PWLB 3NCYS 2BFGA 1OF0A 2WXOA 1TXKA 1VEOA 1G1CA 1JJUA 2E7MA 2C3VB 3LNFA 4WFHE 4Y2DC 3T65A 1K4CA 2IAMA 4Y2DD 3WN5C 6PCYA 1CG9A 3VXUE 1I9RH 1BSIA 3OMAB 3WHXA 3ZL4H 1HZLA 3AUVA 1EMTH 2P5WB 3DX9B 4G7QB 4PJHE 3PXHA 2JQMA 2AAVA 3LNGA 1V10A 4JPIB 1L9MA 4L1SA 4Q0XL 4DIXA 3IS1X 4Z7OE 2YEQA 5FGBC 1NOFA 1J8RA 5JIIA 4GAGH 1BREA 1T7WA 1W0VB 3I3EA 3UYPB 5C08E 2ZCHL 5D6DC 3NPSB 3V4UL 1N9PA 1ZJBA 2A6JA 3U2IA 4LPVA 4YE4H 2Z4QA 3HNVH 4A7GA 1NANH 3F7PC 3BH8B 3QPKA 4JFOA 2XVBA 4FFZL 1U21A 3VFNB 4AGLA 1JHKH 4FNQA 1IGYB 2P80D 2ZWKA 3L7EA 2G4EA 2Y36L 1RUAL 2ZZUT 3OBAA 1E4XI 4EUPH 1BFOB 5T3XE 1BIIB 1QHPA 1CD0A 3C60A 4Y89A 5IW1B 4U0RC 4Q97A 3JYBA 1PCXA 3LQAL 2A74B 4FNPA 1MF2L 4DESA 1JGEA 2G0KA 2Y06L 2OW6A 5BRQA 1FFOB 1C16B 3H9ZA 1LHZA 3QIBB 4EI6A 4N2MA 1JOIA 4YHOL 4ZTPH 3FKUS 4YFDB 5FHAH 3W5NA 4JFHD 4WHDA 3NH7L 5IB4B 1DANT 3QPQC 2BDNH 4ZNCD 3QQDB 4NP4L 3MXVL 3QPQD 1DYZA 2IAMC 4KGLA 2HFEA 3AT9A 2IAMD 3CFDA 2ADIB 3IDJB 1HHJB 5JPNA 1MCPH 1QD0A 2QTEA 5J1SC 4DP5X 1QSFE 3FO2A 3T8MA 2DLHA 1KLFA 3VFRA 2YD4A 1HKFA 5GGTL 1BPLB 4BWTA 4YSEA 3NRPA 1WCBA 2OI9B 3EYUL 4PREA 5F3HB 5C7ZA 2X7LB 2IPUK 3AADB 3EDKA 4P07A 4P99A 3O2DA 5MP6L 1S7UA 1QPPA 1JNNL 3CQFA 4Q74A 2DWEB 5E70A 3VTTA 3CFNA 3DOHA 3EFFA 3IFOB 3N1QC 3OKEB 3TZVA 1KZYA 3LMJL 3QUXB 2LTQC 3BQUC 3K6SB 3BQUD 4YQXL 1CU4H 2WLJA 1DJSA 1U2HA 4IBUA 1CTOA 3IGKA 4Z0XB 1ZY9A 4XPAH 4UQ3A 1E5YA 2W59A 2NSXA 4XCEA 2C7FA 3WEAA 3C60C 4L8CA 1W72B 3C60D 1CXFA 2EDTA 4HIHA 4JM4H 3TF7C 1KELL 1QI5A 2JCCA 1HL8A 5DCCA 1HDMA 4YDZA 3S35L 2IIJA 1KGUA 2ED8A 1XF4A 1NCWL 1S6NA 2BVTA 2AKRA 1UWXH 5CLWA 4NKIL 4P9HH 1KACB 3BWSA 1VPOL 3E1F1 4OFYA 3TESA 5FXCH 4B9FA 3HN8A 1QATA 3MMEA 5CUSH 6PAZA 3MCKB 4R7DB 4DO6A 3DX1A 2XN1A 4AYDC 3REWA 1CQKA 5JPNC 4N2OA 1KSRA 3DV4B 2TRYA 3RWIA 2BCKB 2QZQA 2QZ5A 3QGVA 4M62H 1J9SA 4M4RA 3D2UB 1F4XH 5DUML 2LOEA 3IWVA 1IFGA 4EO5A 2YZ8A 2HXAA 4I3GA 5FFGA 3F2LA 3T0EC 3T0ED 1ADQH 2WBJA 3H9HA 4D2NA 1NMBH 5D7JC 3ARDD 3VXOA 3OR6B 5D7JD 4L4TA 3HPLA 3RLSA 1PJ9A 2VDMH 1OT1A 4GRLB 1UT1A 3I2CL 4U1NB 3TZVC 3GMMB 1FNEB 3TZVD 2A1WL 5IIEB 3IGAA 1F6LL 1NCDH 3BP6A 1A9BA 3D12B 4GSDH 3WLWC 2RTTA 3QE5A 4BGDA 4XMKL 3ARFB 4AVIA 4AL8L 4FA6A 3LDBC 4LEBA 2ZXEB 2P7TB 2WOBA 4NQUA 4Y2OB 3GMQB 2NR6A 3D39B 4PJGF 3WGVB 1BIHA 3VXME 2WC7A 2X0VA 4XP1H 3WLBA 1CBVL 4P4KA 4A2EA 4TKWA 2FWOA 1C08B 4OF7A 5EUKA 1TQSA 4U6TA 4R4NC 4E36A 1FNSH 3WELA 4KZCA 2Z8RA 4WNQA 1RZ7H 3F3HA 3FZUD 3NIGB 4WEEA 2H1XA 2MIZA 3VWKB 3RJOA 4XAKD 3V55A 1BAWA 35C8H 4LP4A 5E9DD 4HKZA 2FJFB 4GRWB 1XD0A 3UH8A 5FWRA 3T2OA 4GW5B 5EEXA 5J11C 4FEMA 1OOWA 1J12A 1INQB 1AR1B 4CL7A 1P7HL 4ERSH 5IB3B 3MCLL 4F2EA 5HGAB 3CHXA 4ZXBB 4QD2E 4Q8BA 4QKTA 1VAHA 1PEWA 3F84A 3ZKSD 5E6IA 1OLZA 4ONFL 1FAIL 2BK8A 3DURB 2I07A 3ROOA 2GABA 5BRZD 2R0KL 2DI9A 4GQZA 2WBJC 1V5JA 3WKNA 4Z9KB 3D8MA 4ACPA 5ETUB 2YXWA 5DI8B 1AJ7H 1EXUA 2IEPA 2R2HA 3RHWF 4FABH 4FQ1L 4I1NB 2XG5A 1PKOA 1F58L 1QABA 2PPDA 4AEEA 4AYFB 1I9JH 4PJ7E 3VG0H 3MRIB 3ML8A 4RAUA 3G6DL 4OD1L 4L3EB 5DLML 1GW6A 5EOCJ 1MQKH 1S5HA 4Y19B 3RNQB 4RMRA 1J10A 2OJ1A 3KJ6H 5KANI 2R4SL 4AEHH 1RU9L 1TJHL 4LBEA 4QRFA 1IL1B 2YO3A 2ZP9A 4U6YA 1DVXA 4KH2A 4K9EL 3WOVA 2RAMA 2FATL 3GSOB 5FCSH 1F4HA 2NR6C 3C6LB 3OGCA 4P2QA 2FSEB 2QV4A 2C9VA 1XAUA 4FZEH 3QUZA 1R5IB 4P4KC 5FB8B 2FJGA 4OQ1A 1OY3B 2VDOH 3DUSA 2P52A 5BUGA 2OXGB 1D6EB 2L7JA 2L8AA 2R83A 3T3ME 2OK0L 2AW2A 3O41A 4GUQA 5DJ0B 4XC3H 2NYYC 3DXAD 3QDJA 1JPTH 4FKKA 2NYYD 1UXWB 1CZ8L 2XQ0A 5CAYB 4LARL 4HEPG 4PEEA 4HHWA 1OD7A 3I3BA 3HFMH 3LH2H 3CSFA 3VMNA 2VR8A 4CBZA 1JF1A 1E8XA 1UVQA 3MRGB 2ZSVB 4WUUD 3QIWA 3IKCA 4L9LA 3CC5A 3BP7A 3RVVC 3UAAA 1NEZG 5KN5B 3RVVD 3C75A 4L37A 3N06B 2RGSA 5E6IC 1NLBH 3GSVA 4P48A 5D2LE 5AWNH 5I73B 1CLOL 1ZS8A 3LN4B 1LP9A 5IHHA 5CLYA 3U9PL 3VD0A 5H37H 1S7XA 4PGDB 3ARQA 3HBZA 4HD5A 1SPDA 4FJ6A 5CP3A 3ENEA 3SQOL 4RFOL 1I85C 4AUJA 4HMCA 5JO5A 4QO1B 2X38A 5HDBF 3QIUA 4X98B 3CZJA 4KGJA 2E7CA 1ZV2A 4BE6A 2A6KA 3PWVB 4IOFC 4YHMH 3WTWA 4IOFD 4U33A 3L1GA 2YFNA 3MTXA 4ES8A 4I9WE 1URZA 1RZ8A 3Q06A 2VLME 4UQ2B 2NLJB 1Q94A 4K7FB 1R4XA 4N9GA 5F88A 1E28A 5E8OB 4FFVD 1N0LB 4G8IA 4WDIA 4OI7A 4H8PA 1ECYA 4OIIL 3H4FA 2NNAA 3RPIA 3U7AA 3DJSA 3SZ6A 2H8PA 5IB1A 1HSBA 3Q13A 2J5WA 1CIDA 4F15B 1HQRB 1IFHH 3FSWA 4IMKA 4PPTA 4QRPD 3TJPA 4ZFGL 2X41A 4N68A 4PRHB 2DDQH 3RY5A 1TO5A 3VE0B 1A4AA 5GS2D 2W5PA 5CZVH 4I0CC 3T0AA 3PWUB 3BXNA 5AQ0A 5D8JL 4UT9H 3QDJD 1U3JA 4LOFA 1QNZH 2AVGA 3KDMB 3KVQA 4XBEL 1HZHH 3NQIA 3JWOH 4V11A 5EF0A 1MJ8L 4B9IA 4ABUA 3C8DA 1BBDH 2VUOA 1UWEL 3CDZA 5LDSA 1E90A 3W37A 3QIWC 1NQBA 2R2CA 5JDSA 3QIWD 4L9LC 1A6TA 3FOMB 4ODWB 4JKLA 3MO1B 5ID0B 1HH9B 1NGPL 3QNXA 1FSKB 1E4KA 1KPUA 4HCRA 1GGBH 3MLRH 1SHWA 4UOQA 3F7VB 4PJCA 5FM5M 1RP8A 2VMCA 2X4PB 5DXWA 1U41A 3LJ3A 1KCSL 1R5VB 6CGTA 2R1XB 1B2YA 3EIFA 5TE6H 5KSBF 1R5WB 5K9JL 1JGVL 3QIUC 3RTQA 1RULL 1M42A 25C8H 5AW7B 3NOIA 5ESVB 4GXFA 1EGJH 1PZ5B 2WOYA 1F90H 1M56B 5CIPB 3FT2A 2BSED 2F8OA 4P06A 7TAAA 1TQUA 4PRDA 1EO8L 1KWGA 5HHPA 1JZ5A 2CHZA 5EU7E 2IPTH 3IMTA 1U8PA 2DWSA 4G1MB 4UBDC 4H8QA 3ES6A 4UOW0 3CFBB 3CMOH 4IMKC 4K3HA 1J1PH 2ESVD 3K0YA 2E9BA 4PJEA 4G8GA 1PG7H 2XU9A 5SX5H 2DWDA 4AQ1B 3TM6A 4NM8H 3P77B 1YY9C 4XNZC 3KBEA 3KWWB 2F7QA 3LQZA 5C6TL 3EGSB 3ZUNC 1MRCL 1TTGA 1U58A 2C7UA 1IAOB 1FIEA 2KPWA 1PYWA 2UX6A 2FLBT 4NFBA 2X1WL 1U8HB 4IRJC 1WAAF 1XL6A 2A6DB 4IRJD 5KG9A 3E2HC 3U46A 2YPKB 1OSPL 1D6VH 1E4KC 3IF1A 2OMXB 4IU2B 4G7YL 1JZ2A 3UZQB 1W72H 3T2QA 4I0KA 2XETA 4HK0B 1ZV5A 3TA3B 4YIQB 3SKNA 5DJCB 3D4CA 4PI0A 2G3ZA 3EJTA 2PN5A 1GY1A 1A7QL 3V4PB 3HVNA 4OQTH 1NGXB 1AXTL 4WNSA 1PZAA 1HNGA 4ETQA 4ONGL 1TDQA 1PLBA 4JMXA 3PNWB 4NWTL 1PSKL 2OYLA 5ANME 3RTQC 1DVQA 4Z7QB 4J7RA 5GGUA 1JPFB 5IJBC 1ZLWK 1AGEB 1BM3L 2P3YA 3N40F 3NIFF 3Q5TA 2ED6A 4GINA 4PJDA 4ELDA 2BIMA 5JHLA 1ET5A 3WDIA 1EVTC 4AV0A 1DQQB 4XBPB 1CYWA 1BHGA 5A6IA 4JFEA 2ITCA 4WWID 5IK3B 3ZVVA 1GPOL 5K93A 3SOTA 1BG9A 2APSA 2OMZA 3L3DA 4F58H 4ZYKA 4BZ2H 1DFXA 1TUPA 3H3BC 1P5UA 3T4AA 4KZDL 2WNKA 4J3OH 4FDWA 2ALWA 5T5FA 3CHRA 1QASA 5BQDA 3RWGA 2IBBA 4M8UA 3OG6B 1OCOB 1I7ZA 2CMRH 4LVNC 2HFTA 4QHNB 2PCPB 4Q9BA 3FN0H 1U8KB 2QR0A 5FS5A 3ZDXE 4QRSA 1SEBA 3JYCA 4POZD 1JYVA 3QDGB 3LZLA 4KXCA 5D2NB 3CV5A 1Z2KA 4YLCA 1RPUA 15C8L 5LG6A 3NA9L 4XCCL 4OW6A 3L4UA 3ULUF 3HTLX 3GSWB 5E4EC 5AG8A 5BMFH 1XO8A 2OMWA 3MACL 2EECA 2ZXQA 4OCMC 3G6JE 3GSQB 1A1NA 2BVPA 2PO6B 2XZCL 2AITA 4A2LA 3O2WL 1ID5I 1Z5YD 3FUIA 2ZKHL 5TPWH 1NPJA 4DKAA 2OA9A 1AVAA 1XXDC 3FHEA 3ARGD 4JFDE 3S37L 1IEAA 1JGUH 4JO5A 4GRWH 3BT0A 4BZ1H 1YEKH 1X9QA 4CVWA 4KZEL 4JJHA 3JZYA 5BS0B 2AV7A 3O6KH 2R7EB 4YNYA 2C4XA 3WDHA 4J5VA 3FHAA 3KLDA 3EFOA 3CVCA 3WTSA 2WNWA 3VGGA 5ILTH 1ZLSL 2D31A 4HIQA 4XPBH 5KUKA 2UV3A 5HYEA 5D6CA 2AJ3A 1V3LA 1KXTB 4GO8A 4HUKB 4KUCD 3T4AC 1P5UC 1FWXA 2HUEA 1E65A 4LSSL 2IDUA 3QC5X 3P3TA 4HFUH 2XQYG 2E47A 4P04A 4WV1A 5EZJB 1F97A 1PQZB 3GUFA 3P0YH 2FR4B 4G9FE 2D9QB 3A24A 4OLUH 4Z5RA 1KN2L 4YXLL 1PNCA 3BPNC 2DJ4A 1OB1B 5SWZB 3GSNB 5HI5D 1T0MB 5C2UB 3O6FB 3M46A 3AU1A 2VLLA 4I0PA 1JK8A 2M8XA 5GHWL 1JZ7A 4XO3A 4OIBA 4RSVA 3MFFB 4CU7A 2GUYA 4QTIL 3QH3A 3RIFF 3T2NH 1LXMA 2H9GA 5TH2A 4NT6B 2XY1A 3TEWA 4ZMYA 4PV8A 2DQEL 3MNDA 3QDMB 3K72A 4QCIB 3B3IB 1FO0L 5EZOL 1GZPA 5JHDE 5F3BA 4JQIL 4CVZA 2QPEB 5FDYA 3WNNA 1JZ6A 4JHWH 2UY7A 3WUWG 2IFGA 2BS71 1BVZA 1JZEA 1N19A 2XFGB 3FCGA 3RVXD 2X9WA 4FEIA 3G5YA 1PFOA 5HVHC 2X0WA 4JG9A 4PJFF 4Q89A 4WFFE 2D0FA 1DQKA 3NCJH 3P3SA 2GFBA 3ZTDC 4AKQA 4NC1E 5IFHL 4FF9A 1AI1L 1OCRB 3HC0A 4HVBA 2KZ1B 3IBEA 3G5ZB 4XVJH 2AGJH 3KPMB 2VERA 1U42A 4AOFA 1J1XH 3SE9L 4JJ5A 5KTEL 4FFYL 3SYQA 5FA4B 4A04A 5IV2B 1PJWA 1DCLA 2J7LA 1X7QA 1EEQA 5CGMA 1ZGLP 2LAAA 1ZPUA 4PR5A 3MNVB 2VAAA 1UTDA 2P24A 5F7LB 3FRPB 3OAZH 3FQWA 4AYEC 5JXAL 4ZI8A 3MODL 1I7RB 3S8FB 4WV1C 4FJYA 5IWLC 4HH9B 1EEYA 1B88A 2YR3A 2GITA 4WW2A 1BF8A 4KO9A 1PY9A 3VWJB 1PLGH 1D9KB 5FO9B 5KVFH 5LNEA 5E6ZA 4HFWA 4FCAA 5DZLA 3D7PA 4KJPD 4YSPA 3TOPA 4I0PC 1P7KA 3F7YB 4I0PD 3VQLA 2DOCA 4TLKA 2Z93A 4ZAKB 5ITFA 1ETZB 1H3PL 4YPGB 3RFRA 1CD9B 3EGDB 2KZKA 1RIUH 4DN4H 3V5KB 1IBGH 2LVCA 2C1OB 3BSZA 5IB2B 1PD0A 3PGDA 4YC2C 5CCJA 3HAEA 3AQDA 4FYRA 4AYID 5IQ7H 4CGUB 4L1TA 3L5HA 4G5AA 1OAQH 1MNUL 4M93C 4XE0A 5D7LA 3N41F 2WO3B 5C0JB 1YMME 3HE7A 1E3ZA 4N2EA 2ICWB 4IBZA 4LHQB 1IRAY 2X4QA 5I71C 3LRSB 2A9NH 4J8QA 4XZUB 2OTWB 1LO0L 1TJXA 1KTDB 3JTSA 3Q8AA 3IN2A 4S11A 3CVDA 1RMFH 5F1NA 1DL7L 3LHAA 1QVOA 2N56A 2VLRB 5SWSE 1UD8A 2FD6L 3UDWA 1Z9MA 4AQOA 3QAZC 1OGTB 1LE9A 1ZANH 3PWLA 4JZNA 4PJIB 4XP4L 2CK0H 1JPSH 3ZHDA 5DA4A 2NDGA 2YPLE 4P2RA 2FH8A 2C3VA 2J43A 1Q0YH 3DK0A 1KG0B 4DKFH 5GRUL 4J12A 4DK3A 1N8OE 4Y9BA 3NZHH 4WW2C 4YDLB 2P5WA 3KNBB 3MHZA 4LBAA 3FPXA 4ELMF 1L9QA 3HFFA 1JPST 3PXLA 4JPIA 2YWZA 1AHMA 1HSAB 3N44B 3EDDA 1G87A 2IALB 5DEJA 2KZBA 3LRKA 4DQAA 4ODVL 5F7YC 2ATAA 5E8NB 5ACLA 3A67H 4OFDA 1OALA 1C7SA 1WF5A 4OZGA 4P5SA 1MCDA 4KRPD 2Y25A 1A3QA 2WCGA 1PY0A 3F04A 2X4RA 3OKNA 3UBXG 1JF5A 2Y7OA 1PPIA 3PIQB 3HHSB 3QWNA 3RP1A 2E8YA 4BSWB 4ZMQA 5D7EA 5DUJA 4GNKB 4KXDA 3BH8A 3QG6B 4I3SH 4QI3A 3VFNA 1KYFA 3MJ8B 4HW6A 4JRLA 1CK0H 4UDUB 3FO1B 3OXSA 3HE7C 1AO7E 2Z1PA 3HE7D 4U2YA 3UACA 2ZKWA 1NFDE 5TFSL 1EEZA 2BSBA 1Q90A 2XA8H 4N8VG 5GRXG 3MBWB 1OQXA 4RRPM 3L16A 2ZUUA 4JRYB 4NRYB 4ZODA 2W8CA 4FP8L 1FPTL 3E9UA 2A74A 1N18A 4P2YA 1SN5A 5JIPA 1PL3A 5BV7L 3E3QE 4PJAF 4FQ2L 4EF3A 1SF3A 2Z92B 2DYPA 3P4MB 1C16A 3P02A 3QIBA 4GW4B 4NJ9L 3MXWH 4MQ7B 2VXQL 1DQMH 3H42L 5FKPB 5FX3A 3VXRB 3DSNB 2EDMA 2J5LB 2CCVA 3VH8B 2ZOTA 2WV3A 1J8HE 2CLVB 5IB4A 4Q9QL 4QYOA 2HPTA 2BNQE 3QQDA 1BQHA 4P2RD 4YE0A 2BX5A 3X3GL 3T4YB 2F1EA 1BFSA 1GJUA 1K4DA 2ZKXA 4WHTB 5GSRB 4GUCA 3TBTB 4OKDA 3U7YL 3IS0X 1HHJA 1FFPB 1K6QL 3T6VA 5IUSA 4MCZA 1T03H 1O7VA 4LCCB 5BW7A 4I2XB 5HTSA 4X2UA 2D0HA 1XGPB 2ICEC 3KLKA 1KYDA 4Q9CA 4JFQB 5KYWB 4M7KL 5DVPA 4Z3GA 4EN3C 2AERT 4JHAH 4EN3D 5FYLL 4Y4KB 4FTVB 4KK5C 1FP5A 3TNMB 3V52H 4KK5D 3IFOA 2NY1C 5ECJE 3OKEA 1BJ1H 3CSGA 2O93L 2NY1D 1CS6A 4NDMB 1T0OA 1CVSC 3QUXA 4UILL 2WBXA 3K6SA 1E4WL 3OJDA 5B22A 3WE6B 4GSQA 4Z0XA 1AYRA 4KX7A 5ITBH 3SPHA 1BXUA 2VLKB 1TNNA 4OGXH 4WZ9A 5JOPD 2NY6D 3LHPL 3MRRB 2I9TB 1MFCH 5CKGA 4JZOA 4AENB 1KLGA 1KJ3H 4PVMA 2L4OA 3A6OA 3ILEA 4OLVH 5BCAA 1V27A 2YSSB 2CDFB 2D7TH 1TOXA 1TZGH 2DYPD 2K6ZA 2R23A 2DEYX 2GCYB 5FO8B 2O5XL 4U3SB 1NCIA 5D7KE 5AKRA 3NZ8B 4G6AC 5DMKB 1YECL 1CFNA 3TN0A 3DRQB 2PR9A 2VDNB 2PW2B 4TQIA 3C8KA 4JPKL 3B37A 1HJCA 3IN0A 1PZ2A 4M3KB 3CX5J 4PM1A 2MQGA 4ENZA 5J6SA 4PRNA 5IVOA 1HTYA 5IF0B 2OI9C 1LE5B 5IBLC 1OP5K 4R7VA 4NERA 3AT0A 4KQ4H 4QMEA 3CN0A 4OSUH 1SRDA 1DFBL 4EUPG 5F89B 3HG5A 5DD1L 3TPUA 4M7JL 2N7SA 5FM4A 3TBYB 1JVKA 4LZKA 3FB5B 4GRLA 1VGEL 3UOAB 1VERA 3B2UC 5HGBB 3GMMA 1FNEA 3GJEB 1SDDB 5IIEA 3S88H 3NYKA 4XCYB 1TFHA 3KW7A 4NCDA 4S1DC 1CFQB 2B1AL 3ZQ9A 4KMQA 2VERN 5SV4A 5I0XA 2P7TA 3D9AL 1FNFA 1VF5C 3GMQA 1E5ZA 3D39A 5D1XB 5TK4A 3APDA 2QGDA 3MLVL 1YNTB 1MFAL 1KY6A 1NAKL 2Q20A 5I1JL 3SB3A 2BS8A 4Q14A 4F5CA 2GYSA 1C08A 5E00A 1G6VK 4D3CL 2UUDK 3P9WB 5HYQB 1M3IA 2Z7YA 4K55A 1QYGL 5I8EB 3M07A 4JG1H 5CJOH 1WT5C 4BM7A 2AC0A 3IDGA 1IU1A 3S3SA 4NI6A 3TN0C 4LCWD 4YAQA 3TN0D 3EH3B 3FMGL 4LCIH 5CD3B 5IB3A 5J6HA 5HGAA 4MAZA 3VFTB 4CDHA 3PJNA 3STZB 4WEBL 4PSRA 5HGGS 2QJDA 4A7VA 3MLUL 3O6MH 5JNYB 1ZA3B 1BMGA 2ARWA 2CO4A 3ZT5A 1GIGH 1H8SA 2UZYB 2JJVA 1JD7A 4C56A 1Y6MR 2AEWA 1PCSA 2WANA 4GUPA 4I5BA 4J6RH 4NKOA 4OM1H 4FG2A 4ONOA 4AYFA 1CJYA 5K5YA 4JLRB 3MRIA 4UQBA 3RZWA 1XMWA 1NUGA 1E8YA 2B9AA 3IGFA 3EF7A 3MV01 4L4JA 4Y19A 3RNQA 4HWZB 2P5EE 4IQHA 4LQFH 4NLHA 1FI8C 5CBAA 1IL1A 1TTRA 4OR1A 1U9KA 1JDAA 4JY4B 1RZJL 2CBTA 4MCNA 2H3KA 1VB9A 3LS5H 2OYPA 1DE4B 5EA0H 3K4ZA 4ZUSB 1E4HA 4DTGH 1IEHA 4F8LA 3S3JA 3KYNB 2VSMB 1R5IA 1H5BC 1TYRA 3UTTE 4RAHA 1YEDA 3U6XA 1A8ZA 1JMXA 2GJPA 2XPGB 2ICWJ 3FCTA 2X6VA 2EO1A 1O7DE 4PMFA 1G7HB 2K6WA 3LKRB 1ZT1B 1OGPA 2YAMA 3P4OB 1BFTA 2QQNL 1GYUA 4UTBH 5DJ0A 5E8PB 4M6OH 2NNCA 1G7PA 2NZ9C 1UXWA 1XSIA 2WIMA 2MTPA 4XRCB 3JWNH 1M7XA 5INDB 5AKTA 1ZE3C 5DRZB 4AG4L 2OSLB 3UGXA 2W1NA 3QORB 5FV2A 3S8GB 1YRKA 3O81A 2ZSVA 1D5XA 4N3TA 4HJJH 1T22A 5IQNA 3CN4A 1EHKB 2R27A 3VW3H 4XPFH 5B21A 3GLDA 2W88A 5D1ZD 4ABWA 3SQBB 2WYHA 5F21B 3LN4A 4R96A 2XBTA 1JP5A 3V0VA 4CW1B 3GI8H 2XHNA 1EDHA 3TCTA 5FYLE 4BK4A 4LLDB 1Q1JH 4W4NA 4WI8A 1H15B 1UA6L 2WUBL 1PKQB 3O3DA 1D5IL 4WI7A 2F15A 4C56D 4FI8A 4XO8A 3KEDA 2FJHA 2V5SA 4QO1A 1VGKA 4UOZA 1WITA 2VR7A 4X98A 1YN7B 4GS7C 4UQCA 1WFOA 3HA0A 4X6DB 2BERA 3FHQA 1IGJA 2IGFH 2J8UF 1E7UA 2NXYB 3NMEA 3PQYE 4UQ2A 5L88L 2NLJA 3TF4A 3BIAX 5DVLA 4L5FL 1GRWA 4IBQA 1N0LA 3KW8A 2PLTA 3SGEH 4HUMB 4KJQC 5AZEL 4LOVA 2DJSA 4KJQD 3Q8EA 2R69H 3VRLF 5C7XL 1QA9B 4GRMB 1WZ1H 2KS0A 4JFZH 3B9EA 3UJIL 1PNDA 2JKLA 2YD3A 3WXWL 4PRHA 1E40A 4JUTA 3W39B 3WDJA 2BVQB 1A6PA 3EOAB 3VE0A 4JVWA 5AVQB 1WICA 3AW5A 3QFGA 4GKLA 5LBSA 3H7BB 3PWUA 3GZPA 1G0YR 3L9BA 1QFUH 4U1GB 4N3UA 4YDVA 3QVAA 2VQ1B 3OPZL 4KXZH 1QR4A 1RL1A 3U0TB 4PIBA 3MJ6A 3QA3B 1V54B 2PWDA 5CWSA 2JXMB 3FOMA 4HOXA 4ODWA 3FC8A 1COBA 3MO1A 5ID0A 4KOBA 3OAUH 1BEYL 4DZBB 2RD0A 5FPIA 1Z5LB 3C5ZB 3JVFC 4ZUWB 1S7SA 5HJGA 1NIFA 3BFQG 1CL7H 4L1BA 4LEOB 4PU2A 2XV0A 1S7WA 4YZFF 4ZDHB 1K2DB 5GQBA 2D3VA 4PWIA 2X4PA 1R5VA 3DPBA 5FYJU 1U2YA 3GI9H 3K4AA 2R1XA 1UKTA 3T71A 1HINL 4NQSA 2NTSP 4C4BA 5F7EL 2C26A 3NEEA 1NDGB 1MXDA 4IOSA 2DQUH 1GYVA 5ISZA 1F4WL 1C8PA 5CIPA 3R8BB 5EIIB 2FH6A 4RIRB 3BDBA 2E4FA 2I5YH 3MRDB 4B27A 4HC1A 1ZSHA 4ZG1A 3W11C 3V6FA 3W11D 4IHOB 2FGWH 1ZVSA 2JB6B 3OLEA 5CLTA 2C34A 2DWXA 5MEQB 4ZOCA 4M6ML 5DUBB 1UOWA 3UMTA 1GAFL 3VACA 1F4YL 2DQFB 4WCYH 5E24E 1OD9A 5F6HI 4KKRA 5DVKA 4AQ1A 1HILA 4ZW5A 3KVPA 3P77A 3QJXA 3ARRA 3FT3B 5DFAA 5LUMA 1LDPH 1JPGB 2KBGA 4LDEB 5C2BH 4DVBB 5EC2B 4XPGH 3NABH 5H37G 2K4AA 3QFJD 1GCYA 5D1ZI 3L48A 4OCXL 3L17A 1X44A 2ZAGA 4NXKA 3Q6GL 2IPKB 5IG7B 3L3HB 4JM2B 2OMXA 5LCVH 1NINA 1OB0A 3S5LB 3UZQA 2P26A 3ZRFC 4HK0A 1JV2B 5FKAB 2R29H 4C58B 3W5MA 4OUUB 4YIQA 1DTUA 4Z7IA 1HJBC 5DJCA 1FIGH 3BKJL 3KWUA 1A3LH 1MLBB 3V4PA 1HKLL 1FVCA 3O2DL 5EB9A 1NGXA 4LHUA 4FQHB 4G3YL 3JTBA 4KMLB 5FYJD 1SJXA 3T77A 3O4LE 4D0CB 4TOYL 3DJZA 4YL9A 2QSCH 5T1LA 5I18H 1ZJAA 2WGXA 1TYJA 4MBRA 4IMLB 3HUJF 3TTYA 1SYSB 5DZ9A 4H40A 5ISZD 1AGEA 1U30A 2BZCA 3P30L 4PJHB 2Y5TB 4Z7OB 4A63A 2OL3L 5HY9B 3MUZ1 4C83B 4S1RH 1BVLA 1R6VA 2BP3A 3RIKA 4KJYA 3LVTA 3WNJA 1DJZA 1NKOA 5DRWB 5IK3A 2GAZB 3KGSA 4XVSL 1B0GA 3BZFA 4CJ0A 4NCC2 2QQKH 4Z3JA 1AFVH 3MLYH 3CZSA 3VGFA 4AQ1C 1C5CH 2OP4L 2WY3B 3TPKA 5IEHB 1ASQA 3B8SA 1NAMA 1IUZA 1JTPA 2O72A 3GDCA 1VZHA 2BNUB 1R46A 2G60H 2RQEA 1KCVH 2M26A 4QHNA 1U91B 3X1EA 4GG6F 2X1OA 4XPHH 2QPFA 4GQQA 3V79C 1U8KA 4L4VD 1I9EA 5AOLA 4NAMA 5JIQA 3GGWB 3OQ3B 1X9UA 1YA5A 5DU7A 2RIKA 4N0YH 1QLEB 1JNLL 4GKZB 1ZK9A 2YEZA 5D2NA 4AH2A 1Y7VA 1KPVB 4DEPC 4DGYH 4POUB 4G82A 1U0QA 1FL3B 1ACCA 1S9VB 3DX8A 5TQ2L 1T2QL 2K45A 4WWKB 3QJVB 1IC7H 3EG9B 5E2WH 1A1MB 1KCUH 3IJEA 4P2OB 2IH9A 4LHUD 1JHLH 3GSQA 4N90D 3L3IB 1IM9A 4JFPB 1RK1B 4HETA 2ZOKA 1CF8H 2YMXL 4BRJA 3QHZL 5T1LD 2VDPL 4MNHB 3WTXA 4HJGA 4YZWA 3NN8B 1KULA 4G1EB 4L5FE 2Z7ZA 1QSFB 4WKZB 1HE7A 2GSGB 4GIPD 1MWOA 4FFTA 2GJZA 5C6WH 2XBDA 5GJSL 3RVUC 4OLXL 2HCZX 2HKFL 3AWEA 2EH8H 2PCXA 3EO0B 1MEXH 3ZE2B 5E1GA 4E9QA 1U3ZA 5GRWA 4N8CH 4E9LA 1TPXC 1XR8A 4XNXL 4FE9A 3DOIA 4KI5F 4ZX5A 1GS6X 1KXTA 3RDTD 2LHAA 4GO9A 1SFHA 1JRHI 2H26B 4JFHE 4UTAH 2GJ6B 4H88L 3KYKH 4U05A 2J25A 1PQZA 4U6VH 1AZZC 1U8QA 4Z7NE 3D1MC 3NCFB 2FHCA 3SYPA 5SWZA 4FN0A 3GSNA 4Y4FC 1T7YA 4ZO9A 3IDMB 4Y4FD 1JF6A 4MXWL 2Y0SA 3UBHA 2WLNA 2A5UA 3V7MA 3MOQA 1CGSL 4MA3B 3E7JA 4WI0B 2VITA 3MFFA 1OPOA 1GYCA 4ODBD 1BQ5A 3IJ8A 5L4MA 2Q1EA 1G9NH 1O6TA 3EZJB 5F7AA 4X9YA 3DJRA 4ABVA 1XF2B 1Z0NA 2KMWA 3B3IA 3IXTB 4JR9H 4M8QB 2YAHA 4YDIL 3K1DA 4NZFA 1YEHL 2X3AA 1O9VA 2X1QA 4NNYB 5GZOA 3LSOB 4OCWL 2XKNA 4W9DC 1IM9D 5IOPB 4GB9A 5D96B 1Z9SB 3K3QA 4ZX6A 5IQ9B 1T3FB 4KKLC 4NRZA 3WO4B 3VQ1C 2J4WL 3FQYA 2IQAB 3Q48A 4NOFA 5J1AA 3GS4A 4GI9A 1F1DA 3K46A 3G5ZA 4J3OG 2QPUA 3KPMA 2EKSB 2NY4C 4Q9RH 2NY4D 4HKXA 4LGSB 3QNYA 4KKNA 3CFTA 3V5DB 3MLWH 2VIRB 5FA4A 5MEOA 3AS3A 2NXZB 1H3GA 3OKOB 4Q6IB 2RH0A 3PP4L 3TBVB 2J1XA 3MNVA 3A22A 4S1QH 2VCOA 1KYUA 1XF1A 2G75A 1NEPA 5DUPH 1BM7A 1I7RA 4NKQB 5DSCB 1FDLL 3F83A 2G3XA 1UASA 1ZMYA 1ID2A 2XG4B 4HH9A 4N5UA 3QJRB 4HJ0C 3VWJA 2FZ3B 2GEEA 2O5YL 4HJ0D 5DC0A 4K94H 4F7MA 3VFUA 2CJSA 2ILLA 1W6WA 2TSAA 1RZQA 4MNQD 3F7YA 3VXMB 3L81A 4MX7B 1NCOA 3IRZA 4P5MB 1GZHA 1Q4NX 1E6JL 1E2ZA 1N5AB 3LRHA 5EMYA 4ZAKA 3QI9A 2VC2B 4YPGA 3MAWA 1AXIB 1AQKL 3EGDA 4HYTB 3VQMA 5LQBL 3O0LA 1E50A 2O6PA 1BD2D 3ZHNA 2W0PA 2H2PC 4JREC 4ES9A 2H2PD 1YPZB 1PFCA 4X7SH 1QBMH 3FDWA 4DKEL 3GTNA 5DRXB 2VRQA 3ZZSA 1ZXKA 3BESR 4H5SA 3BVDB 2D3LA 2HT2C 2YAOA 4XC1L 1R3IH 4PB9H 4XE5B 2XX0A 5C0JA 5GZOD 3CVHA 5HYFA 2YQ3A 2ICWA 3CXHK 3ZHKA 4KZ0A 3LRSA 3VI4F 3MOAH 2Q7YB 4GG8A 3LNIA 1U8JB 2WNGA 5T1KB 1UJ3B 1H3TA 5I16B 2VL5A 1I3GH 5D93B 1T04A 2QKIB 1ZLWH 5J89A 3CZFA 2JCCE 2DB8A 3LV3B 2C9AA 4X99A 2I9LB 1USQA 1OGTA 1U6AH 1W2KT 2AZUA 3PPEA 1UCBH 2ROYA 5JIHA 2DIJA 2W07A 4PJIA 5DHVB 4OFKA 4P46B 5FEBA 1OAXH 4HWBA 5I1EL 4PJ7B 4XAKE 4TLTA 5IJVA 1KYOJ 1KG0A 1CFTB 4U1SA 3TGXA 2Y9RT 1PZUB 4MD0A 2IDCA 2X44D 4KQ3L 3KNBA 3QUHA 5GXBB 3LNEA 1VFBB 3N9GL 3CBRA 5AYUH 2B77A 4TTDC 1MCWM 2IALA 1FC1A 1A6UH 2WLLB 4TTDD 3WU1A 5E8NA 4BFKA 2G3NA 4MQXC 1GZHC 3H2WA 4LRNL 2CH8A 1WRFA 1BOGA 2EDBA 4MQXD 3Q1SH 3GWJA 3QI9C 4OKVA 4ZAKC 5AW9B 5LN4A 4TLUA 4X9HA 3QI9D 4JB9L 4NN7B 4EKJA 4HCRL 5A2JH 5KSAB 3QCTH 2D03L 4F33B 3E9TA 4N0UA 5C0FA 3HHSA 5I30L 5IBUB 4BSWA 3L3GB 4L4TE 1CE1L 4OJFL 2EC8A 4Y2LA 3MJ8A 5HJDA 1IB5A 5DK0B 1U95A 1HOCB 2OR9L 4HDIB 4CRPA 7FABH 2FHBA 3DX6B 1RI8A 3MBWA 2D2CC 1MFMA 2EYRB 3AB0C 3KPRB 1BVOA 1N64H 3BE1H 3II2A 4AGPA 1FVEB 5D2LB 4LSPH 2R59A 1KTLB 3MSPA 2MQ0A 3CFUA 4FMFA 4CJ1A 1SJMA 2RMNA 3T9WA 1I1YA 4XPTL 4GW4A 3P4MA 5E8DH 3G9VA 4NZRL 4X7FC 2MCMA 1J8KA 3S36H 3VXRA 4YHIA 2X4UB 1EFXB 4L0ZA 3D87B 1NKGA 5BJTB 1E3XA 2F74B 5E5MA 5F9AC 1WDAA 3VA6A 4M7LH 3ZMEA 1BZ7B 1BVKB 4ZQTA 1T5XB 2DWYA 3ESVF 4F57L 2WSPA 5GSRA 1A4KA 3TBTA 1ACZA 3HRZB 2F68X 2NX5D 3ME0A 4JFFD 4YH6A 3S34H 4YDLC 3S4SG 5IMKB 1NMAL 4I2XA 1DSFH 4AEIH 1EXGA 2PXYB 3AG4B 3NFSH 4JS7A 1DSWA 3VB9A 2XPYA 5ADOL 2Y6TE 3IT8D 1EANA 4QRUB 3I6SA 3SGDH 1NL0L 2DL9A 4JFQA 1JTTA 3PG2A 4M3JA 4L2YA 5E08H 4K3DH 4M7ZC 1PBYA 4Y4KA 5TQ0L 4FTVA 1FLTX 5AUMB 2J88L 5GJTL 3TNMA 1FNLA 2AK4D 9CGTA 2GB2A 2B1HL 1FH5H 4B53A 4NDMA 4NPKA 3DGGB 2GTZA 1VRSA 4XGZB 1SJEB 1YEGH 4Z1PA 1K85A 3T8XB 1UACL 2ZNWA 5CJ8A 5EU3B 3ZTNH 3MREB 2BRRH 4TSAL 1A0QH 2HFGH 3A6BL 2BOCB 2VLKA 1FL6A 1MIEL 4YBHA 4RDBA 1QQDB 3MROA 5T3XH 1DJWA 4OV6F 3MRRA 1NM9A 1V7NL 5LN8A 2JWYA 3QFDB 4AENA 3PF2A 4P2QE 4FCHA 5JHLL 2NT1A 4PTUB 2FX8H 2JELL 2ADJA 1KBKA 4CMMB 1JZHA 1QLEH 3BCDA 2DLFH 5F7NC 4BGLA 3W1ZA 1IGML 2JK5B 1LO5A 3ULSB 5FO8A 4U3SA 1FNGA 2WLMA 3NZ8A 2BZDA 5GZNA 3MRFB 3QDJE 5DMKA 4PP2B 5T5FL 1K3ZA 2E3VA 2PW2A 3NQKA 1V8HA 1SBSL 4ZFZB 1E7VA 3PAYA 1JZFA 1SMDA 4YR6B 3NA4A 4CBPA 4JL1A 4PGEB 5FLUA 1R3HA 4KVNL 5AOMA 3UIYA 5EO1A 2FX7H 1IC4L 3PCYA 5F7DA 5IF0A 2OJZH 3ARBD 4PY8J 1J0ZA 1VLXA 1LE5A 3PDGA 4H0GA 3BGAA 1OPGH 1CICD 1CGXA 5HPOA 1P2CB 1LP9E 4R3SA 3RX7A 4OGAC 1S9XB 4R4FH 4ZTOH 2ADGB 1JBJA 1D5MA 2DM4A 4RAVB 4WLCA 3GJEA 1SDDA 4R83A 4XCYA 4ADJA 4XBGB 1CFQA 2XWRA 2GIXA 3CHOA 3V9FA 2HYMA 4S2SB 5E0QA 3ZMNA 4WHYH 4E5XB 2D9CA 1EDYA 1NBCA 5CINL 2EXTA 4GUOA 2FBOJ 2H1PH 4RCAA 3R0MA 4HEMA 4JY6B 5KYYA 5F9WB 4E41D 1XZ0B 5I23A 3VFPB 3U4BL 1XCXA 3H3KA 4Q58C 3W56A 3VTMA 3QJHB 3DTXB 4X6FB 5T1JA 1TEYA 2IOMA 3GXTA 5E94B 5CJQH 2VZUA 2ESVE 3DVIA 1GSMA 2ERJC 3BAJA 4PRPD 2IV8A 3ZL1A 3B83A 4ZTEA 2FBJH 2FECL 5GZNC 1G5AA 4JGMA 2GSIA 5ANMB 5F96L 5BZWA 1OAYL 5H4ZA 1LNUB 3ZGIA 3WY2A 3N5AA 2IDSA 3IWUA 1DBMH 4KY2A 2L0DA 3BEWB 2CR0A 3VFTA 3STZA 4HG4K 1INEL 4R7XA 2EEAA 1QFWI 3GRGA 1G4RA 2YUZA 2DW5A 4OLWH 1NLDH 1FFNB 2ZXBA 3EO1A 1MJJB 4O5LH 4KAQL 1N6VA 4YHPB 4KXAA 3I6KB 2UZYA 1C1EL 3CGTA 4PJCE 4ODHL 2XN2A 2F6AA 2WZ5A 3U9WA 1TJMA 2XWCA 1L6XA 4HK3J 4C54A 2DAVA 1XH3B 1U8NB 4JLRA 1GMIA 1PDKB 1TJIL 2CUIA 2YUVA 1EVUA 2A0LD 4LSVL 2Q7NA 3O0RH 4Y1AB 3T3PE 3I50H 2EDHA 3BUYB 4K23L 4O58L 3ZDXB 3NCXA 3V4VA 4HS8L 1R3JB 3I9PA 4JFSA 2YN3A 3SY0B 1DANU 1CBJA 4EXPX 3C9NB 3O3UN 4RMQA 4PD4J 4I3RL 4PV1C 4LSTH 3WMSA 4ZNEA 3T09A 3T0VA 3GRWA 3W0WB 3HC4H 3S96B 5TDOA 3UROR 1LK3H 3ZY7A 1G7HA 4NO5A 3LKRA 3P4OA 1WFNA 2MHAB 3L2MA 3MRMA 4RGOH 3RVTC 3IJ9A 2VC2H 4MBOA 3BIBX 5E8PA 4A7UA 1H6EA 3G6JB 4PJEE 4UU9B 4G8GE 1N2RB 3PL6C 5INDA 1J18A 3PL6D 5DRZA 4DCQA 3TXAA 2Q0ZX 4DOHE 5A2AA 4JFDB 1MZZA 1OARL 4RGNE 5HHOD 1J5IA 3MVSA 4I85A 4RRPG 3QWRD 3VI3F 4FTDA 5FV1L 4RWYL 1J0YA 1ZHNB 2MNJB 2DZEA 4OJEH 2N59A 4Q0XH 4KQ0A 1MVYA 3Q44A 4CW1A 2EO7A 1DDHB 4HS3B 3VD3A 5C0CA 2OSYA 3OHXA 4LLDA 5AVVB 1AKPA 1PKQA 4HKBB 5EOCL 3V4UH 2XICA 1MVUB 1I8UA 2VQ4A 3CHPA 3KPLB 4KV5F 5CEZD 3TASA 3BSZL 4YUEL 2F2HA 3MV7B 3UBXI 5H2BB 1K8DB 1YN7A 1PX4A 5DHVH 4YHYB 1LDSA 3INOA 3ESMA 4FFZH 3FTGA 3B9KD 5C97A 1JYNA 3HS0B 2DIAA 3UC2A 4BE5A 2B7DT 2Y36H 1RUAH 1F11B 1DQDL 2WXJA 4HT1L 3LN9A 4M3HA 5F6IC 3BT2H 1B4TA 1I3RB 3BW9B 4KU1A 4PCYA 4B9CA 4PJDE 1D7DA 1UB6B 4NNPL 1QA9A 4WEMB 1NOLA 2DPKA 2FB4L 4IGBA 3LQAH 4JFEE 1MF2H 4P2AA 1SJVA 5HDRA 2WZ6A 3HMWL 3WTTA 3W39A 2BVQA 4X42A 2Y06H 3DBXA 1X5XA 3EOAA 3HS9A 4HLJA 4FA7B 5JHDB 1MW1A 2HTKC 3H7BA 1MWAA 4TSCL 4F9LC 2HTKD 1F3JA 2LV4A 4N0RA 4XMZA 2V37A 4YHOH 1S8DA 2HB0A 3CFIC 4XO5A 4IS6A 1ZSDA 3NH7H 3SDDA 4EI5A 4AW4A 4NP4H 3HE6B 3MXVH 3QA3A 2OJEB 1CFSB 3NDZE 3TYGL 4DGUA 2CG9X 4PRIA 4QWWC 5LBGA 2JXMA 4QWWD 1IKNA 3LD8B 2IJ0C 4HUVA 4KKAC 4XXCA 4AQAA 1MHEB 4FG4A 4KKAD 4HU2A 1OSYA 1Z9LA 5ACZA 5GGTH 4ZUWA 1WAEA 2VAJA 3FRPG 3GZKA 3BAYA 3EYUH 4BDVA 3ASNB 3OHXC 5C0CD 5MP6H 1OP5H 2ZUQB 1OKEA 1JNNH 1MHPL 4HUXB 2YFOA 1TQCB 2Y4SA 1NDGA 4APQA 1Q0XL 2X4OB 3LMJH 4RNRB 5GS1B 4Y9FA 2XRAL 3FTYA 3B2DC 4YQXH 3TIDB 4RIRA 1OV8A 4ODTL 1MI5B 1RY7B 2NY2B 2YA0A 3UEQA 4X8JB 1Y1UA 1RXLA 3JWNG 4TRPL 1PZDA 1Y1DA 1PZ3A 3WNIA 4B9PA 3NEXA 5DD0L 1KELH 2CLRB 5IQLA 3WKML 4IGBC 3W2DL 5MEQA 3S35H 1RJCA 1NCWH 1XCQA 2LU3A 4NKIH 3QRFM 5DQ9B 3OZ9L 3LNDA 5ABZA 3KPPA 4B5ZA 4L8BA 1VPOH 2RR3A 3ARWA 2UUDH 1YMMB 1JPGA 4QAMB 4DVBA 4EI5C 3SDDC 4DZ8B 1JXKA 5EO0A 3SDDD 1B2WL 1NCTA 3RNKA 1FVDB 4URKA 4FQJL 1M7IB 5D9SB 2F7IA 2AVFA 1B0WA 1UEYA 5GGSA 5LO7A 5I76A 4PRID 1IKNC 2IPUG 1OLLA 3R4DA 4XXCC 3BUBA 3F01A 1CFVL 2WAHA 3BUTA 3L3HA 4GP8B 4JM2A 2FX9H 2ZUTA 1OT4A 4JUSA 1NBQA 5SWSB 5DUMH 1NANI 1QP1A 5FKAA 4OUUA 1NC4B 2G30A 5I6NA 3UP1A 5K59E 3IJSA 3PUCA 5GS0C 5GS0D 5LXVA 3U48A 3UPRB 4KKCC 2EIKB 1XSOA 3DMMA 2KDYA 3I2CH 4KKCD 4APQC 5E6RB 2GBTA 2P8PB 4JRXD 4APQD 4IMLA 2A1WH 2FTAA 1SYSA 2FJSA 3O45A 1A14L 4XMKH 1WAAA 4YFLI 4A2HA 1EBAA 3D5OF 4AL8H 4UZUA 4QRTB 5JMOC 5HY9A 2APFA 1RPQA 2V6HA 4C83A 3G5WA 1FH2A 4DHLA 4YLBA 4L05A 3EJYC 2P45B 3ZTJH 2YMOA 3EJYD 3INUL 3K2UL 5FO7B 5DRWA 2BVOB 1CBVH 4ZUTA 5ICXA 2VLJD 4F37F 1FBIL 4MS8C 4MS8D 1KZQA 1KGIA 4EBQL 4FQCL 2K0RA 1QEWB 4CC0A 4NHUB 3BGMB 1K9TA 4X8XA 4WFED 4RFNB 5IEHA 5IB5B 1MJ7L 3D51A 4GEIA 1SJHB 5EBMB 5LWYL 1ZTXL 2E6PA 1YEIH 1JWMB 2H0FA 4IOIB 5E99L 4AGQA 5FOBB 1REIA 5HVGB 1ZLVK 4KUZL 3JTTB 3LZPA 3L9EA 1QRNA 5JHMA 4HHGA 3MCLH 4GKZA 4DPCX 3KL3A 4NIYE 1KPVA 5T5NF 3DJ9A 3K5RA 2CBQA 3VH8G 1TKWA 4ONFH 2WINB 1FAIH 4GBXB 1QG3A 3L5JA 5KYUB 1HX0A 2R0KH 3MUGB 4YPJA 4WWKA 4AE1A 4DH2A 1WP6A 1A1MA 2PTUA 2CKNA 3T3MF 3TX4A 5FECB 2X5PA 1J8HB 1SVCP 3VGHA 3L3IA 3F5WB 4U0QB 1RK1A 2X53A 4FQ1H 4X5RA 3QEQD 3DMMC 1F58H 2VDRL 5D7LE 3HZMB 4MNHA 1ZVNA 1QBAA 2CSPA 5KSVA 3LPWA 3G6DH 2J44A 1WIUA 4OD1H 4F93B 5DLMH 2CIKB 2HFFB 2GSGA 4I9XA 3ZK0A 2HG0A 1ECZA 1XQ4A 1BZ9B 2R4SH 2YPVA 3MN8A 4D0BB 1RU9H 1TJHH 3LPGA 4P23B 5DF0A 2JQZA 3NJNA 2PW1A 1JN6A 4B6ZA 4K9EH 2BSTB 3EO0A 1J87A 1OZTG 2FATH 3QEGL 4U31A 5AW4B 4GQPH 5HHNB 2W92A 2HVBA 2W81C 3EADA 1R1CA 4JHZA 3LS4L 1J0HA 1GMEA 3QNZA 3EFDL 2QQQA 3C12A 3QYMA 4UT6A 4H25A 3R06A 4HX1B 3AQYA 1RUPL 2P8LA 2GJ6A 2WXNA 4MA8L 1FA4A 2DLEA 2EVHA 3GXIA 4P2RE 1BZDA 1CZ8H 4LARH 3DECA 4Z7VF 3BD4A 3LIZA 2B4CC 5JXED 4EOWL 4J3VA 4OZFA 3WGUB 1SY6A 1KCKA 4MA3A 1WEJL 2AXFA 3WJJA 3NK4A 2X0UA 5CXPA 4OZGE 1CLOH 2XWJB 3KLSA 4LKCB 1IFRA 3V95A 1IGTB 4WWKC 3IRCA 4QHUB 3RWDB 3K7UA 4M8QA 4WO0A 3U9PH 2RFXB 2XTJC 5I1IL 1XF2A 2DJUA 3MGOA 2AAAA 2XTJD 4O2EA 3SQOH 3LSOA 4PJBF 4RFOH 1HH6B 5IOPA 1DEEB 3QUYD 2J72A 2LLLA 1P69B 5L7XL 1Z9SA 5IQ9A 3LEXB 4ZUUB 2IQ9L 5AB0A 2IQAA 2YQGA 3NCMA 3NJIA 3STLB 3GMPB 3MQIA 5A2BA 1T0PB 1P4LA 3SDXB 1Z3GL 4U1JB 5C0BB 1LWJA 1S4IA 1Y18B 5AKVA 4I18B 4OIIH 1IBBA 2E9IA 1AAJA 1SXAA 1LL1A 3HG0A 3OKOA 3ULUC 4NO0D 4S10A 5INCB 3ULUD 2E4TA 3L4XA 3ZGHA 4ZFGH 4AT6B 5FM5O 3BAEL 1IO4C 1M71B 5DSCA 3C87A 4QIRA 2E86A 5EIQA 2F19L 5D8JH 3WEXB 2R56L 4PJFA 3OR7A 5JIDA 1MELA 2APXA 2O26U 3OKLB 4XBEH 1IM3B 4P59L 1MJ8H 5AB2A 7CGTA 1QFPA 1SXZA 3SYCA 1UWEH 3RFZA 3QO0B 3T6XA 2MTAA 2DQGL 3EHBC 4ESKA 3WJJC 3EHBD 1NGPH 2G2RB 1X5KA 2QADD 2V3EA 2ZUXA 1UZ6F 3WIAA 3TH3T 5FA3A 3DVNA 4X9GA 5KVDE 3ZDYB 1JTOA 2LE9A 4YHLL 4WW1A 1YPZA 3U0PB 2KHAA 4OF5A 3ATAA 5DRXA 2DV6A 2HWZL 3MV8A 3MV9A 2F8XC 1IKFL 2JTYA 1ZDSA 5K9JH 1JGVH 5D96C 1RULH 4PH8A 1S7RA 2AFNA 2FNWA 2NY0C 5ERWA 1F45A 2NY0D 1LD9B 4P5KB 4R6UA 1U8JA 5BO0D 5T1KA 4HJEA 1UJ3A 1YEJL 5L4FA 4FADA 1EO8H 1H3XA 2XWBB 4PS3A 1Q72L 3WD5L 4HXAL 2IBZY 3QHTC 2I9LA 3V8OA 3FCSB 4G80B 3NJHA 2QGBA 1MCFA 3EJPA 4GSRA 4BWUA 1SN0A 5IFAH 1V05A 2D3JA 4P46A 1T89A 2L04A 3FW6A 2VM4A 4PJ7A 1E8ZA 3NDYE 1Q38A 3SDAD 4NB7A 4Z7WF 2NRDA 3AXLA 5LBSL 2PPCA 1ZTXE 4NKMB 3QAQA 4MXVF 5H35B 1EJOL 2P5EB 4DK6A 5FK9A 5C6TH 3RX9A 3CSBA 1I9IL 4ZUVA 1IT9L 1MRCH 2WVTA 5D1QB 2Q76B 4KY1L 5B8CC 1WBYA 1ANUA 4NSKB 4I48B 2UWEF 3D25A 3LPOA 1OSZB 3RFZC 4AK2A 2VR4A 3N42F 2CO1A 4M1CC 1FRGL 4M1CD 5KBLA 2N0MA 4XI5C 5KSAA 1OSPH 3G3LA 5AW8B 1EXHA 3BKYL 3GMLB 4G7YH 2V7HA 4ZZKA 1FFQA 3C5XA 3FB6A 5I6XC 4KNUA 5ID1A 3L3GA 3NAAL 1NCHA 2SODB 1A7QH 4O4YL 5D7HA 1NUNB 3RJDA 3UIZA 5FYJL 3NIDB 2OULB 1AXTH 3SQRA 5IFAL 4HBCL 1OZUA 2ZPKL 3MV8D 3MV9D 2IMMA 4MASA 1NWOA 4AK1A 5CEYA 1HOCA 4NWTH 1PSKH 3I75B 5A2KH 2IMNA 3C09B 3DX6A 4KTDL 4N0FB 5EEYA 3ULVF 4M29A 4K7PL 4YHNB 1E9OB 3SO5A 3I02B 4JZJA 1QSED 1JG9A 1BM3H 3KPRA 4LL4A 1UJ3C 2V17L 1FVEA 3D39E 5F7HA 1EUUA 1KTLA 4HC1L 5D93C 4GMSL 2FEDD 2ZYSA 4NIKB 1Z6JT 1I8MB 3P11L 5E7FA 3QUMA 4F5CE 2X4UA 2COQA 4J3OD 3MLSL 2X2HA 1GPOH 3MRQB 1T89C 5C07A 1UQSA 5C09D 1SLXA 5BJTA 2F74A 1UWGL 4L29B 1WJ3A 2J55A 3LKPA 3NIGE 4UIKL 4KZDH 1BZ7A 3OLDA 3MJ9A 3FXIC 3OJVC 1RHHB 1KB9J 3L8QA 5AB1A 3IJHA 3V0AC 3ZW3A 1ZLDA 1HIML 3KWTA 2NZIA 1QBLH 2JTDA 2FO1A 2G9HA 2AI0L 2H3XC 5JLZB 2ZTBA 1W9XA 3ABLB 4B60A 4QOKD 1LWHA 4PJAA 3IAGC 4NGHH 15C8H 3UG4A 2FWLB 3NA9H 2ITDB 4XCCH 2AXGB 4BSVA 4C56E 1TZAA 3DGGA 3V4PL 3MACH 1NKRA 4XGZA 4LLQA 3FONB 3ZKNC 1SJEA 3FFDB 1IE5A 1Z32X 3ZKXB 2AQ3A 3EYVB 3HJ0A 3VXTB 3KPOA 5JUEL 3HG3A 3CLEH 3PHOB 5EU3A 2ROXA 4XNMA 4LQ1A 2ED7A 3O2WH 2DBLL 2BOCA 2ZKHH 4Y19E 1AR1D 3UADA 1UB5B 1X5FA 4XHJD 3S37H 1QQDA 3J8F7 1SYVB 4JZJC 1WPCA 4KZEH 4LLAA 4ZD3L 5EBWB 1WWAX 2YRPA 3FUKA 2PPFA 3TIEB 1OK0A 4L3AA 5IBTL 2OR8A 1CXIA 2Z64C 5JMRA 3K8MA 1ZLSH 1MCBA 1WS8A 5DLLA 3ULSA 1OAUL 4HGWB 1NFIB 4NI3A 2IH1B 4PJ5D 1MLCA 5JORB 4KNTA 4HV8B 5EIIG 4OZIB 3Q9PA 4PP2A 5DQDL 2A83B 4LSSH 1ZWIB 3VXSD 3ZDWA 5KS9F 3CFJB 1R3LA 1TQBC 4P9ML 2UXGA 1DLHA 1NAML 1I8LA 1A6ZB 1KN4L 1XGQB 4L3ED 4YR6A 1KN2H 4YXLH 1D5BA 1A02N 2JIXB 4J39A 3D0AA 1INDH 1T5KA 3ALWA 5GHWH 4L8DB 4D7PA 4KJWC 1P2CA 2AJUL 5IM7B 4Z78B 1Q8MA 3KE0A 1S9XA 4QTIH 1KB5A 3SD2A 3U0WL 3WY3A 4M5YL 4FMVA 4BCZA 4IRSB 2DQHL 4RAVA 4LL9A 4CGTA 2DQEH 4TF4A 5EZOH 1BXAA 1FO0H 2J2ZB 2WQUA 2Z1KA 4JQIH 4NN5B 2Z7UA 1MCHA 3QR2A 4TUUA 4OGYL 1EZVX 3R8QA 4S2SA 4ETYA 2UY6B 4E5XA 3S5LG 1U8CA 4U2ZA 5DYOB 3FF7A 1MG3C 2A2QT 2Z31B 4HPYL 3VMOA 5IFHH 5CFHA 2QLVB 4M56A 4N28A 1AI1H 4G6KL 4P3CL 5CJBA 4JY6A 5C3LD 5HSFA 2YUXA 4KKBC 4MJ5A 3CVIL 3DSFL 5G4MA 5J56B 4KKBD 3SE9H 3RGBA 1XBRA 3DTXA 3U1SL 4FFYH 4LLYB 4Y5XB 1GJWA 3KYMB 4PRHE 2GI7A 3DHPA 3BYYA 5JZ7D 3RY6A 2BWIA 3O3EB 3X11B 5DJYB 1LQBC 3UXFA 5ANMA 3D0LA 1IJNA 4WO4B 5JXAH 4HK3N 3MODH 3SE3A 4AX3A 2W60B 4KK9D 3EF4A 4W6XB 1I8LC 2CU9A 1CMOA 2E7HA 2JI3A 3BEWA 5AVSB 2VGLM 5DO2C 3ZJAA 3HZKB 4HALA 1JDCA 5DO2D 3GSNL 1UWXK 4PP1C 4W9KC 4JY5L 4PP1D 3EJZC 3EJZD 1MJJA 3C08L 3N6YA 3KYOB 2BP8B 4DF9A 2V33A 4HUNB 5CN2A 4PVLA 1HFUA 3L9RB 2CUMA 4OJAA 1H3PH 1CN4A 3EYFA 3D52A 4IU3B 1FORL 3EYSL 1XH3A 1SXNA 5FYJE 1PDKA 2N7BA 1ITCA 4FHKA 4Y2DB 4OCNC 2JJUA 3SBRA 3WN5B 4Y1AA 5KWYC 3BUYA 5ISZE 1UM5L 3DVGB 4PGZA 1EWHA 1R3JA 3WN6A 2R9HD 2N4IA 2IO5A 5LB1A 5CZXD 4Q2ZB 5F9WC 1LO0H 3RI5K 1YY8A 3C9NA 2YKLL 1J5OL 1TQWA 2FUTA 3COOA 3VD5A 3W0WA 1ZEAH 5DJ2A 1DL7H 4A2DA 4WENB 2AJZB 2WJ7A 2MHAA 4JDEB 2FD6H 3OQRA 4JQXA 3NJGA 4GO6B 2V9QA 4IJ3C 4UU9A 3RVWC 3RY6C 4XP4H 2W38A 2NMSA 3JVGA 4H1LA 2VE6A 3A0OA 1BG1A 5E51A 4H0HB 1A2YB 1T1WB 3SE3C 3W9DB 4A7TA 5A40E 5K69A 3WIIL 9PCYA 4FAAB 1NFDF 1HHKB 1UZ8A 2WTRA 2ICES 5B3JE 3FF8A 4YDJB 4ZPTB 5EU5A 3KEHA 3TCLB 1S46A 4ODVH 3HR5B 2JV6A 3FULA 2ED9A 3PDOB 4HS3A 4ODSL 1WH0A 1X5LA 2VOTA 4WHYG 4HKBA 1ZHBA 1DVZA 5LBVA 3KPLA 4RWHA 1UKSA 4ODXB 5BZDA 3TYFA 2H0EA 3MV7A 5H2BA 4N90E 3D48R 2DS4A 1K8DA 2F1AA 5CZRA 3VFOA 3OB0K 4U49A 3T65B 4Z7NB 2IAMB 3ILQD 1UXMA 3HS0A 4N6RB 4UCFA 1CG9B 4KBPA 1WSST 4WEUD 2JKTM 3CVHL 1E9QB 4PB0L 1UT2A 3VNZA 1F11A 4OTXL 3VI3B 2DY2A 1K8IB 4QY8A 5ICZB 2YGVA 5FW7A 5TFSH 5EBGA 3VFGL 5T1DL 1I3RA 3NVQA 4WGKA 1BYOA 3S4SB 1VFAB 3SN6N 5JPMB 4K2UL 4NQVB 2Q2LA 3EDJA 4FP8H 1F3DH 2VRKA 2FYVA 2JMRA 1I53A 3GB7B 1EV2E 2WXPA 3TA3D 2VW7A 2BW4A 5BV7H 5JHDA 1YNKL 5EO9B 4FQ2H 5DS2A 4HBQA 4NJ9H 4JQXC 1RAMA 2VXQH 3H42H 1KV7A 3MBXL 4JPVL 3SYAA 4HA1A 3ZE1B 4AY0A 2FLMA 2LTQB 5KVMC 3HHMA 3JVGC 2DTSA 1D3CA 3BQUB 3LAFA 4HWBL 5DJXA 2V3DA 4Q9QH 4XCFL 5GISL 1SOSA 1MCSA 3BCFA 3CD4A 3HE6A 4XOCA 3P3UA 3X3GH 2OJEA 3AY4C 3U7YH 3K0WA 1K6QH 4Q4EA 4BHUI 4BK5A 3C60B 1BFVL 4NPYA 5MEND 3OKKB 3LX9A 1MHEA 2WMPB 1BQSA 1FE8L 3ETBF 4IEFB 4MD5A 4MSWA 5D2NE 5I5JA 4QYAA 2RB8A 4M7KH 3CXDL 4M5TA 2BSDA 4KC3B 3CSPA 5FYLH 3RJQB 3BSGA 1R24B 3Q05A 2KLTA 1T83A 4RNRA 5GS1A 4UILH 2BY0A 3PUUA 2HFEB 3CFDB 1E4WH 2BIHA 2OLDA 4PJ8C 5FGSA 4GAYA 3TIDA 5JPNB 1OANA 1AGBB 2CRMA 4PJ8D 1MI5A 4ANUA 4YLQT 1ZPLA 3MA7A 3ECQA 4AJ0A 1ZA6A 2V2TB 3VFRB 1AXSA 3VM7A 5I5IA 4BJLA 3O2VL 2ZICA 3DUHA 3ESNA 3BOVA 1WCBB 4PREB 3LHPH 3NFPB 4UINH 3T0EB 1NZRA 3KZ8A 4XMLL 3QDHA 5J13C 2VQUA 5D7JB 1LTXA 4EQ2A 4R97C 2JFCA 4NUJA 5G5DA 4CC4A 5BUAA 2ZXWB 4N0CC 4EN2A 3EFFB 5DQ9A 3TBCA 4N0CD 3TZVB 4DK5A 2VZSA 5IMOB 2H6OA 2O5XH 4J23A 3S9DB 3CFCL 4N6QA 1XWVA 4KTYA 4W4OA 4DZ8A 1F18A 2B39A 1YECH 2IWFA 3HE6C 1AZRA 2BZ7A 3LDBB 2OL3B 4UQ3B 1M7IA 4JPKH 4LU5H 4WK0B 5SWZE 4FXGA 4IKJA 4BK5C 1ET7A 4L8CB 2XIBA 3LD8C 2PPAA 5B1JA 4PLOB 3WFEL 4L9DA 1CI5A 1WGOA 3BFWA 4M61B 3IMUA 5CGBA 4XHQA 5SWSA 3VVWA 5I1GL 1UD6A 1E5UI 1KENL 3S3CB 5HYSG 8FABA 4LVOB 1Y6KR 1FYTA 5B3SB 2CIIA 4HMDA 5K1VA 1DFBH 2ZUQC 5DD1H 1XIWC 1BLNA 2GQHA 4M7JH 1XIWD 5EN3A 3FTSA 2IANA 1TQCC 1VGEH 1DUYB 5E9DB 1T83C 3MMEB 5G2NA 4FRWA 5GS1C 4QF1B 5J11B 1VADA 3E6HB 5JOEA 2ZG1A 5CILL 3UYRH 2B1AH 3RWIB 1PG7X 2VH5L 2N7AA 1GJIA 3BX7C 1UJTA 3O6FD 2J56A 5BRZB 4PRBB 5FO7A 3MLVH 3MR9A 5IBUG 1TSRA 1MFAH 2FWUA 3H9HB 1NAKH 5B7MA 1JAEA 2Y2WA 5F71A 2HX7A 5I1JH 3MFGB 3G04A 4F20A 4FHBD 3PFQA 2XVLA 2VXSH 4NEHB 4OZHF 4CC4C 4D3CH 5IREA 4FKEA 3EJCA 4NHUA 1H0DB 1F02I 3BGMA 1JVLA 1FL5A 1QPKA 1QYGH 4MZ2A 3D18A 1SXCA 2VDPB 1PU0A 1SJHA 3AXHA 3IGAB 3ATEA 2BIIA 3PGCB 1JZJA 3BWAA 4PIRF 1MCJA 3L4VA 4IOIA 4W4OC 2C3XA 4QNPE 1JUFA 3LZRA 2JKIS 4Z3IA 3JTTA 3HZ3A 2VDNL 4AEFA 2F5BL 2VXVH 5IVXF 3FMGH 4QHLB 2C9RA 4FA8A 1MAKA 4FXGC 1IZKA 3QZNA 5B1JC 1IKOP 5FM8A 3T04D 2WVUA 4NJAL 2KT6A 3L2LA 4WEBH 3AG2B 3WLBB 3WTVA 4P4KB 3MLUH 4GBXA 3CK0L 2FWOB 5EUKB 5L8KB 1A6AA 2HRPL 5FECA 1FYTD 3RIAK 2MKWA 3DXAB 4HF5L 5LGKA 4MHHG 3F5WA 5E1IA 3X12A 1SHSA 4MJ6B 1F6FB 4X4MA 2IAND 4K9JA 3HZMA 4HISA 4NN6C 4QXWA 4IKIA 1B9KA 2WYZA 4OLZL 4GG6A 1KFGA 1KB3A 4WUUB 4O51A 3ZHLA 2CIKA 2HFFA 4MDJA 2DQIL 2OTPA 5AENA 1BPVA 5HHMD 1BMWA 1D9KD 3WNMA 5B38B 3GK8L 2E7BA 1RZJH 1FNHA 2BSTA 3PWPA 5E6IB 2ADFL 3FTVA 5J1TC 3ZDZB 2BJML 3IGLA 5BO1L 4G7SB 5AW1B 1QRKA 5E6SB 2DMKA 4B95C 2F54D 1YNLL 4HX1A 3WS6A 1ZD6A 1EXUB 2J71A 4PJIE 3OKDB 3Q6FA 5DFWH 5E56A 2I7SA 2QQNH 4C4KT 4CU8A 4QRQB 1KIQB 1GHFL 3LKOA 1RURL 2A9DA 3V0IA 2WXMA 4RAUB 3MX0A 5F7FA 3FFCD 1S9WA 3IDUA 4LO9A 4AG4H 4HWEL 3VU2A 1B0IA 1O75A 2O4EA 2OTUA 4LBEB 5FW6A 2HRLA 2OMYB 4U6YB 1DJGA 1NGWA 2XA3A 4Y4HC 3RWHB 3OGCB 4CMHC 4Y4HD 3FQNA 4KVCL 1U2CA 4OV5A 1KCLA 2F9BT 4GBXC 3IFPB 4QRPB 1CC3A 4LKCA 1GZQB 1XDTT 4D9QD 4FQXA 4CKVX 1IGTA 3RWDA 1DJHA 3NSJA 4QHUA 4U1KB 1AGDB 4LHJB 1M4KA 4XN1A 2I27N 2VSCA 1CFBA 1L9SA 1KJVB 3O41B 4N0UE 1UA6H 2WUBH 5CEZL 1KBPA 2APTA 1D5IH 2YK1H 3QDJB 4RX4A 3RGVC 5CD5C 1OE3A 2AQQA 3RGVD 1DEEA 5CD5D 3ZTJG 3H54A 3GTTA 1W80A 2Y3NA 1TU2B 2BHZA 5J4MA 4KTEL 4ZUUA 5B7FA 4ZMAT 1DEDA 3EXLA 1I3VA 1T21B 3STLA 3QIWB 4DP7X 5L88H 3IKCB 3PAZA 5I19L 3WEMA 1NC2A 3BP7B 2IH8A 2Z0UA 4L5FH 1TZOA 3V4VL 3SDXA 4U1JA 5EHFA 1QAWA 5C0BA 4EPSA 3GSVB 3KR3L 3PWPD 5AZEH 4JFVA 2WXGA 5C7XH 4APXB 2MOVA 1RV6X 5AVTB 5INCA 3VUAA 4DUVA 1A66A 3UJIH 2ZG2A 3GRWL 2XOTA 2GY7B 3WS6C 3WXWH 1HT6A 3VXRE 2V5RA 3FSOA 5I1HL 3RG1C 5J8OA 3HCVA 3Q2NA 3QEHB 4L8SA 3QIUB 5BVJB 2ZT9C 4I7ZC 4OJYA 3WEXA 2A6KB 3U30C 3VAEA 5HI3C 1FHGA 5HI3D 3CWGA 5HI4C 2L7EA 3OPZH 4YHZL 3HZVA 1Q94B 4YL4A 1E28B 2VSKB 3AQXA 3VXPA 2XVGA 4I2XE 4G8IB 1JZDC 2J3SA 4WDIB 5IVZA 5C0EB 3BKCL 1EZSA 2AXWA 2G2RA 3KPSD 3J27A 3KVDD 3MZGB 3ZTEA 1BEYH 2XCMC 4KI5C 4TNWF 4WWPA 5DEGB 3N43F 3WIHA 4KI5D 2ESVB 4XH2A 2PP7A 4FQXC 1BJMA 2WQWA 4HZAA 1U8MA 4FQXD 4ANKA 2D4DA 2WBKA 2PUQT 4FTVE 4ZPVB 3U0PA 1WWCA 1Z1WA 2BOBB 2CO7A 1BAGA 1HINH 1MZYA 4PFEA 2K78A 5F7EH 3FT1A 4OCSL 2M83A 3NSCA 1ML0A 4TUJB 3IYLW 1QFOA 3GRBA 3AUWB 4D9RE 2X2JA 1F4WH 3CDZB 4NBZB 2VZVA 4IRJB 4P5KA 5FUOL 2VLKE 3MKGA 4FI7A 3BI9X 4JM4L 3WNLA 5JDSB 1A6TB 3UDWC 1WQVT 3E2HB 3OF6D 1NC2D 1TG8A 4IHBA 3QNXB 2X2IA 1KPUB 5DMIL 1JDDA 1SHMA 4Z3FA 4G80A 3DYMA 4OB5L 4M6NH 4F2MA