1O9ZA

F17-ag lectin domain from escherichia coli (ligand free)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
177
structure length
170
Chain Sequence
AVSFIGSTENDVGPSLGSYSRLPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSSRYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Fimbrial Adhesin F17-G of Enterotoxigenic Escherichia Coli Has an Immunoglobulin-Like Lectin Domain that Binds N-Acetylglucosamine
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lectin
molecule keywords F17-AG LECTIN DOMAIN
total genus 45
structure length 170
sequence length 177
ec nomenclature
pdb deposition date 2002-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1o9zA00
2BSBA 4K0OA 3F64A 3F6JA 1ZPLA 3FFOA 1O9ZA 2BSCA 2BS71 1O9VA 1OIOA 1ZK5A 1O9WA 2BS8A
chains in the Genus database with same CATH superfamily
1OK8A 2ERJC 3L95B 1C8PA 4B27A 1QUNA 4K94H 1A6PA 1FO0B 3PUCA 5C0JB 3QIWA 4MLSA 5DJ0A 5D1QA 1Z5LB 2YFNA 1UOKA 3B9DA 3GNMH 4A6YB 4G6AD 5KBNC 3JWDL 5HVWA 3DSFL 4PG2A 4M8QA 2XTJC 2PPDA 3POHA 2FQDA 2NTFB 4BH7B 3LPPA 1D6EA 4DUVA 1UOWA 2Z91B 4KHXL 2CJSA 5F7AA 2RAMA 1RI8A 4ATWA 1TQWA 2WLLB 3ILPB 5C09B 4NEHB 5CJQH 5BVJA 5KJRL 1XH1A 1ED3B 2BSBA 4MWFA 4L3FA 1QA9B 2AQTA 2DJ4A 4FEIA 3BZ5A 4GEIA 4OLVH 5FCUL 4HUKB 4UIMA 3QQ3B 3WKYA 3ZDZB 4K71B 1FV1A 2FIRT 1CYGA 3AWEA 4N0YH 5JW4Q 4DK6A 3HG2A 4Y5YB 4MS8D 4PD4J 3AREB 1AGBB 2WVVB 5EU5A 3D0VA 4TM9A 1HSBA 2AQ3A 4JM4H 1DFBH 2UWEA 5IJVA 2FBJH 2JKXA 3MV9D 1VGKA 1UENA 4FQHA 3OZLA 2WOBA 2IOIA 5D7JC 3WFEH 4UTAL 1KJVA 1YYMH 4NXKA 1ZXQA 4X7FC 3TZVC 4TPRH 4XP6L 1U8IA 1DLFH 1WPCA 1LO5A 2HT4D 4O51A 4LU5L 4JHWL 4DO6A 5L9DL 3OGCB 2NX5E 4GRLD 4N0CD 1H15A 1UM4H 3VFGL 3NCYP 2JQZA 1G1KA 2G0LA 5EOTA 2VO5A 1TSRA 5D2NC 5TPWH 4HOXA 2HYMA 2M1KA 4WNQB 5F7DB 1NGXA 1AO7A 3QWOB 5AVZB 3DIVA 3TNMA 2QSVA 4CJ1A 5DMYA 1VJSA 3QDGA 2ICWA 4GKZA 4JFYA 3NSJA 4ZUUA 3X17A 3BSZL 4F8PA 3IFPB 4LSRH 3KZ8A 2OX5A 5DVPA 5KSBB 3BAIA 3ZLQC 2AK4B 4K9EH 2NCEA 4S1DC 4MJ4A 5BZDA 1AD9B 5DLLA 4UYQA 4FD0A 2H2SC 1DN0B 3O3AB 1IKNA 4G80A 4HXBH 1KBGH 2APXA 1QSFB 2HAZA 2WAQA 3L3KA 3ARED 3HN8A 2PYFB 3P3RA 5D6DA 2W91A 5J0BA 5T8IA 3FSVA 1F2XK 2JCCE 1YNLL 2ZCKH 2K4WA 4PJIB 5E6IC 2OCCB 2AZAA 2YD5A 1VEOA 3WD5L 1TJIH 4IIQC 1HTYA 2K6WA 1ORQA 3P69A 5LG6A 1WT5C 1RZPA 5GQBA 1DQMH 3PGFL 1UT1A 2MQ0A 2A5UA 1Q1JH 4YHOH 3K3QA 2HH0L 3F7YA 1EH9A 2AI0L 3PREA 1KDJA 5DK0B 4HUVB 2D7MA 5I73C 3G5ZB 1TTGA 5EUOF 2VNCA 4IOSD 1KT2B 4LLUB 1M4KA 5A3IC 3RIAK 4AVHA 3FO0H 2Z31C 1EERB 1HCYA 3G5YA 3LZNA 4UQDA 3A4DA 4NP4H 2AJXH 5FO9B 2P7TA 5AVSB 1TJGL 2VXQH 1HAUA 5E8EB 4CADA 2E7MA 1QQDA 2JKNA 4UIMB 3KLAB 2DKSA 3QIUB 5IVXF 3AMLA 5CBEB 2OM5A 3MROB 2W07B 4OY9A 3BH4A 3MI6A 4ZOBA 2IBGA 2XV3A 3MCLH 2IWKA 3EUDA 2EC9U 2AW2A 5DTFB 3VFVA 1MG3C 2ZSVB 1D6VL 3AU0A 2I9LB 3FTWA 3K8KA 3V4PA 3SCMA 4H8UA 3FT2B 3FUEA 3QIUD 4GQRA 5BJTB 2QDWA 1YC7A 1UQSA 2OW7A 4JQVC 5D72H 1BFOB 4NNYB 4R6UA 5IKCB 2V2TA 2BVOA 4D9QD 1KIRB 4LHJB 2QTEA 3TTSA 5F9OH 4E42A 1A3RH 2JKIS 3VA6A 4HS3B 3JBG7 4NQVA 2Z8SA 1MHPL 2R56H 4PJ9C 1MVFA 3KYKL 4O9HL 4KROD 3SKOB 4KQ3H 5EU6E 2JH2A 1C5CH 1FPTL 3V9CA 1HQ4A 3IB4A 3SDDB 2P5WB 3D39B 2DB8A 1DQIA 2DIJA 3FONA 4ZS6D 5FYKD 5C9JA 3V8CA 3PCYA 4FJYA 4RIRB 4UTBL 4DKTA 4XBMA 3LKNB 1OAZL 1URZA 3C5SA 3ESVF 4GI8A 2MKLC 5FS5A 4ATTA 1I31A 1OL0A 1PD0A 4LCIL 3MR9B 3QDGD 3S5LB 2UY7A 2W95A 2R4SH 1U8NB 3ZR5A 4MNQE 5CUSH 1EGJL 4UYPA 4H1LB 3PYCA 4PJAE 2YJLA 4XAKD 2JE8A 3DHUA 4I13B 4XH2B 2VDQB 1OTTD 4NN7B 1YQ2A 3GLDA 3WEAA 3HTLX 3D69B 4LEOA 1A9VA 3T1FB 4I0PD 3MSPA 4APQD 1YEFH 5F6IB 3NIGB 3P2TA 3DV4A 3FO1B 4PRIE 5GS2D 3RAJL 2UX6A 2QGCA 1UB6B 5F0PB 4QXTB 2FVNA 2FNBA 2ZCLL 4X8GA 1C12B 2PPEA 4Z7UA 1BWMA 1KTRL 5E6SB 4ABQA 4FP8H 4U3CA 4NQDB 2CGRH 3HFFA 5D55A 2QSCH 4QXUH 3H55A 4WY7L 4FJ6A 2VL5A 3QSKB 3MRDB 3G5XA 3P0YH 3CTTA 3EFFB 1AAJA 4PV8A 2P5EE 1O6SB 5F3HB 4WEBL 4NC2B 4CN1A 2IDQA 4FQHB 3MBWB 1E40A 1MREH 3L2LA 2ED6A 4D8PB 4HS6A 4QRRB 5DFVC 5FFOA 4YNYA 1XV8A 2D31B 3TPUB 3KPSA 2NY4C 4MD4B 2VZTA 4X9IA 3H9YA 2OTPA 3GTNA 4NKIL 2NY1C 2KZWA 1FO0L 4I1PA 5CJOL 1GGBH 3OMAB 4YSEA 2W92A 3GEFA 4QOKA 1FRGH 4AYMC 1QSED 2DQCL 3BUIA 2J6EH 2NDFA 4D9RE 2ZUSA 4Y19B 1RP8A 1LMKA 4G1MA 4XP6H 4UT7L 1Z9PA 2BHZA 2UWEE 3CVHL 3GO1H 2DIAA 4UZUA 5T1MA 4AXWA 4ETQA 1JHLL 2BVQB 3OQ3B 4D9RD 1T0OA 3PGCA 1HHGA 3N44B 4ZQKB 5KYNA 5F88A 1HXKA 4GAFB 3MRIA 1SJEB 2BPBA 5I8CA 4X6DA 1WIPA 2ESVA 2G3XA 4QRBA 1BQ5A 2QELA 4F9PA 2JB6B 3N1PC 1PZSA 4YE0A 5C86A 1A66A 5EV7A 2WBXA 4XNZB 1NDGA 3RDJA 1TEFA 1CT8B 3DROB 5KVEH 4P5KA 1Z9NA 3G6JA 1F6LL 2P44B 3BP7B 1QLEH 3UJTH 3SE8H 1ODAA 5GSVB 2VUOA 3CMOL 3WYRA 4YGVA 1TEGA 3BGMB 1K4DB 3QJHB 2ARJQ 3QARA 2A6DB 3WN5C 2HUHA 4IW4C 1D5BA 1QW8A 3F7VB 4B0MB 3AT8A 1CGXA 3BMWA 3DX8A 3O6LH 2VR3A 3U7YH 4TOYL 1KIQA 5EBLB 3O2DL 3MRPA 4DKEL 1XAKA 2ZTBA 3LKQB 3GXMA 3Q9PA 3FUDA 4PGJA 1I1YA 3ZE0B 4TTDC 5CJ8A 4APQA 2LTQB 3STLB 3QW9A 4ZD3H 1E4HA 4M9PA 2ZG2A 5LQBH 4DFHA 4PRID 1ADQH 2F18A 4WFFE 4EEEA 5IJKA 4JPWL 3U1SH 4OFIA 1BFVL 2VR9A 2APVA 2IEPA 1CI5A 2VKWA 1D5MA 2EYRA 4QDGA 3CE1A 2ZD0A 4PRAB 3KLKA 3O4OC 4OCLC 2R2EA 3WHXA 4AOFA 4P9HC 1H3VA 1W2KT 5K59F 3TT3L 1TMCB 3L48A 1E4KC 4WI7A 3MREB 1FL5A 5D2LE 3TYGH 3UBFA 5AAPA 4XCCH 5KVFE 3U4KA 2ADGB 4PG2C 1DUYB 4WWID 5FWRA 3T08A 4RISH 5KVDE 4Q6IA 4WKZB 1CLOH 1HE8A 1NCOA 2XNAA 2DYSB 1JHKL 1MWOA 2AJZA 4X5XB 5IG7A 2IDFA 5AENA 1O6VA 4LOUC 5E70A 2XG5A 4HH8A 4AX3A 2IADA 1QI5A 3RWIB 1UFGA 2DQHH 3BGFB 3O6FD 4NQUA 2PXYD 1GC1L 5K93A 3VQ2C 1OTSD 4LK4A 4OZFH 3N50A 1QSEA 3HB3B 3IKKA 4LPYA 4MMZB 2YPKB 4X6DB 1ZHKA 4RBPK 3BAKA 4O2EA 4N8VA 1KCWA 3HHSB 4HOWA 4G7YL 2G3ZA 5HJGA 1G0XA 3JUZA 4PP2A 5HI3C 5CMAA 3UGEA 2I9TA 4BBWA 3RGBA 4WCYL 3UO1H 2VXTH 4PP1C 4X83A 4FNUA 4F2FA 2MQCA 3FN3A 4X8XA 3RUGF 2Y23A 4HS8H 5F0JB 4AK2A 5DMJB 3EFDL 5C09A 3G6JF 1NDGB 3G5VB 4HPYL 1HHIA 2CHWA 2E6JA 4HFWB 4U1GC 3TWYA 4HPHA 3M7OA 3WIAA 2X3BA 2FEDD 3VI4B 1NIFA 1M53A 1PZ5A 1VZHA 4APXB 1CIUA 2HKHH 2WQRA 3CFBB 3VU1A 3IDYC 3ZKMD 4NWTL 4GFTB 1PAZA 5B1KA 5F1SA 1J5OL 4MD5A 3FMGH 4UV4L 4UMSA 5CCKL 4NRYA 1SXCA 3BFOA 1SQMA 2XG4B 2VDQL 2ROYA 4MNHA 3P4MA 2WANA 1WLHA 4OGZA 3C5SB 1I3GL 4JFXB 1NTDA 2AGJL 2FUQA 3KS0J 3RGVD 4J39A 5FYKL 1O6SA 1TJHL 5F3HA 1G7QB 1GH7A 2WM0A 3X2QB 4DVBA 1EX0A 1U3HD 3HMWL 1TZ8A 4PJEA 4KJYB 3T65A 4L8CB 1I9JL 4XMUA 3QG7H 1EAPA 2PCFA 4FQIH 1E8ZA 2FX8H 4XH2A 1QRNE 4HK0A 5FGCE 3BKML 1MLCA 4FQJL 2JXMB 4N1HB 3RX5A 3D85D 3SO3B 4G9FD 5KUKA 1HCVA 3AXHA 1H3TA 4R90H 4Y9GA 3P30H 2CK2A 2XJKA 1BZ7B 3ETSA 5C09E 4S1QH 3N1GC 4RMWA 3VI3A 1HZLA 2HXAA 2NY0B 4X8JB 3WDIA 1I3RA 3FFOA 1MI5D 5HPMB 5H37G 1FIGH 2EIJB 1I3VA 3RYMA 1RUMH 2BOBA 1XZ0B 4H0IA 4P2QA 1EO5A 2GYSA 3SQRA 3UABA 4AVIA 4R4FL 4JJOA 2BXYA 3HG4A 5CNHA 4HKJA 1FLRH 1QZNA 4XNUL 4NQVB 4MZ3A 4UNUA 4ZMVA 1AGCA 3RNKA 2WZ5A 32C2B 1EJ6A 2G5BA 5GHWL 1L9TA 5BNXD 2P49B 5DK2A 4HX1A 3MOBH 2TSBA 5ADOH 3DOIA 2EZ0D 5I0XA 5L2JB 1RK7A 2DM2A 2OJ1A 3EG9B 3CSYA 2BNQA 4UV7L 1NLBH 2H26A 1WAEA 2VXUH 5CP3H 2K70A 1VPOL 3U30C 5GGSB 3C6LB 2Q9OA 3QI9A 4GW1B 3ZE1F 4EQ2A 4JQVA 4ACTA 5I19H 1KELL 1K6QH 4DAGL 3II1A 4UNVA 3C5ZC 1WCBA 4BEIA 3I6KB 1FZJB 4N3UA 3L9RB 3IETB 3S48A 1U91A 1BQLL 1MCCA 4FHKA 5FO9A 2DJSA 1KTBA 3B9KB 2B1AL 3TNNA 2YK1H 5SV3A 4CSSA 3L4VA 4O9HH 1GOHA 2UUDH 3LRKA 3ZU8A 4HWEH 2BSEA 3NPSB 4RGOL 1UYWL 1UA6L 2P43B 2XC8A 5FPIA 3U7AA 2X4SA 5LN8A 4LOEA 1H8OA 4NN6B 3AS1A 2Q3ZA 3AACA 5JW4N 4OB5H 1NAML 4PS4H 1J05B 2NW2A 2FIKA 4Z7VA 4OZGA 4WU5A 5CM1A 4LSQL 3GLAA 2WXFA 2PWEA 3ORJA 2PN5A 2X6MA 2V2TB 4L4VA 4XPHL 4PJEB 3T65B 4TQHA 4L8CA 1KXVC 2I9LA 4NZTH 1DHKA 4YWGL 4YQXH 5GHWH 1T5KA 2P5WD 3H7BB 5ICUA 3T77B 1OP4A 2GJZA 4XPAH 1NAMA 3NRQA 2Y6TE 3W11D 5BPPA 1WWWX 5E2TH 4NPYB 3APCA 4LCUB 4POYA 4KJQD 5K39A 3K6IA 4U1LA 1IZJA 5CKGA 1WV7T 2XKNA 4IIQB 5TE6H 3JWNH 1HDMB 4TQEL 5EBWA 4ZTPL 4C56A 2E9GA 3L3DA 3D0LA 4MCMA 3BZ4A 2EVIA 3FB7B 3IM1A 2ZWZA 5TDPA 1U8LA 2NY3C 2QTVA 3VFWA 1ZE3C 4YHPA 3WNPA 4QYOA 2GBTA 1DVFB 4OCRH 5E4OA 1HHIB 2Q20A 1MDAA 1FVCA 2PETA 1A3LH 4CVUA 4PJFB 4EE2A 3FRPG 4U7SA 1RVFH 1UT9A 3LPGA 4CW1A 5C0DA 4HUWA 4OT1H 1HESA 3D50A 3F7LA 4X0NA 1RZIA 5KYYA 4M1GL 5FYKE 4G83A 1Z7JA 4F3FA 2EDBA 5FO7B 1FFRA 5D7JB 4K3GA 2NY0C 1ZMYA 3VGHA 1NCNA 4Z7IA 3OLEA 2HMIC 4JX0A 4GG6F 2Z35B 4M00A 1PEZA 1WCBB 1CPUA 1OSPL 3OB0H 2WZPD 3T6WA 2YEVB 4QTHB 4YC2B 1WZ1H 2YAHA 5BRPA 5GGTH 1YAZA 2EECA 4NS0A 3QXVA 3MRBB 5B38A 3K2UH 1RIVH 2AQNA 4OLZH 4NWUL 4Y2NA 2AI0H 4I85A 3N9GH 1LO2L 2V7NA 2R51A 3IS1X 2ZUTA 3ZTNL 2Z6FA 1E7UA 1UB5A 5D70L 5IJCC 3O8XD 3WG7B 4NN7C 1M71B 4PJ5D 5ANHA 3MRRA 2OMNA 3O6KH 3U4BL 3E8VA 1T0MB 3C08H 4UQCA 2PPAA 3BT2L 3WTVA 1X6NA 4KPHH 4MXQC 2C8NA 5E23A 3BEWB 1U33A 2YA0A 4BUQA 4P9MH 1RJZA 5AEAA 1Z9MA 3HC0B 1NPNA 1BV8A 1CGVA 1ECYA 1FNHA 3D7PA 4M7KL 3C5ZB 4Y7MA 1G7IB 1PTZA 3KDPB 5DEGB 3LXAA 5E00B 3ARXA 4BSWB 4PVBA 2I60L 2VLJB 3TP4A 1DYZA 1EEZB 1AXTH 3D39D 1CTNA 3DO7B 3VW3L 3MBEB 4TF4A 3BAEH 4G3YL 4MX7B 1ZGLP 3RU8L 4P06A 4EN3B 4NAJA 5DO2C 4PLJD 4J8QA 2H9GA 4J8RB 2Z7WA 1AP2A 3LSOB 3BP4A 3HG3A 2WAHA 2XWXA 4NO5A 3L9EA 5FFGA 1OCOB 3HCVB 3QQXA 4S1RL 3NIDE 3EGSA 5KYXA 1RZFH 1ESOA 1S7RA 3PIQB 5HYJD 2OL3A 3MV9B 4XNDA 4WSKA 2AJVH 2FWUA 3WFEL 1XB6A 4NLAA 2VJ0A 3MX0A 4KXDA 1PDKB 4LEEA 3ZHNA 5B3JE 4AVKA 4JM4L 3WKMH 1WZAA 3KPLB 4XPTL 5D1QE 1MLCB 5LCVL 4N6QA 1CK0H 2KZ1B 5BO1L 1DVXA 4BRJA 4KNQA 1E4KA 4XPGL 3QHTC 3II3A 3MRJA 5IQ9A 2HJFA 4J12A 4E9YA 5KVGE 4KRMB 2XRAH 5ANME 2B1AH 2AXWA 5GS0C 5F9AC 1WK0A 1ZS8A 2DZEA 4ILDA 4ZMOA 3VH8G 4WJ5A 1BX2A 2F7IA 1CXFA 4LNRA 5DS2A 3UPAA 1JF6A 3LDBB 4YFDB 3BKCL 5CWSA 4PREA 4MA8H 3D33A 2WLJA 2YEZB 5HJ3A 2G2PA 5FECA 2LW3A 1FF5A 3WXVL 3RDTC 2IH9A 4K7FA 2QQQA 1IKNC 3VNYA 2VERA 2YKLL 3GF8A 3O8XB 2IH3B 3D30A 3SDAB 1RLBA 4HWZB 3ET9F 5HI3D 5GRVL 3C87A 4IMKA 4JRXA 2UZXB 1ZWIA 4GRWF 1NCAH 3QIBD 4AMKH 3ZSTA 1X7SA 4IIQA 4PBWD 4Y5VB 1OTSC 3L45A 5DJCA 2DMKA 4HCFA 3SJVA 1CFNB 2A83A 2CLVB 1N5AA 1UXSB 3ZZLA 3KWUA 4Z6AT 4MNHB 2CDFA 3S37X 1IGMH 1LMIA 3L54A 1FVCB 4P5TD 1NCWH 3I6KA 1MCBA 4WIQA 3E9UA 4CBZA 3KW8A 3HS9A 3TN0B 2Z8VC 2WKOA 1UXLA 4MJ6A 2VLME 1MCFA 4X7SL 1KXHA 2ESVD 4OZ4B 1P1VA 4RMBA 3RGVC 5EIQA 3Q6GL 4Z7OB 3MOQA 4JZNB 3KLDA 4RMVA 5T3XH 1JGUL 4NUGH 1XR9A 4HISA 2J4WH 5EC1B 1FFPA 2ENPA 1C1EL 2ENJA 3NIFF 4LIQH 1XL6A 3TYFA 4P3CH 1XGQA 5HGBB 4PGCA 1IBHA 2ICWI 1NICA 1USZA 4WTQA 1F2QA 5IUSA 3GHEL 3QBTB 4NC1E 4W4NA 1C5BL 1FAKT 1SF3A 1X9QA 2A9AA 2IBZX 5EPMA 5KS9B 3GGWB 4IJTA 2F15A 5T3ZD 1FH5L 1MHCA 4QXGH 1ZIAA 3WIFB 3MTXA 3LRHA 5C0AB 2FYYA 4WGWB 4M5TA 4MD5B 3KNBA 2BNUB 4N90D 2X1OA 5B8CB 2YMXH 3HZKA 3QH3A 3ATAA 4CBPA 1KCRH 1UZ8A 1U91B 4NNYA 3WJLC 1NIAA 3FN0H 3GSWB 4JRLA 5FDWA 1G6RH 2IGFH 4GYBA 4BWTA 2YXMA 5G2NA 1INDL 4GUCA 3RTQB 4LBEA 4FLHA 4J6RL 3K72B 4K7PL 4P2RE 4AV5A 2A74A 4TV3A 3OXRB 5I1IL 3RL1A 3LKSB 2WBWB 3MNZA 3L1EA 2G75B 5IEKA 1RJLA 4LZKA 2DOCA 4E36A 4P2RD 5FF6B 3JWOH 3SODB 3SY6A 5JOFA 2VT0A 2BNRE 4HWNA 1CIDA 2YGVA 3FPYA 2IVFC 4X6EA 3VXRE 3EH3B 5CAYB 1U58A 2F8IA 2H6PA 4D7BA 5GZOA 4ZUSB 4EO5A 2VDOB 2R59A 4G7RB 1DLFL 2ZYHA 3V52H 1UCBL 4BUHA 3MAWA 1GHFH 3LVEA 4AEFA 5C0IB 1MNNA 4RWYH 1T4KA 3UJIH 4XN2A 2WCSA 4HAKA 3L4WA 4F8NA 3P3UA 4PTTA 2VR6A 5AW1B 3UAFA 4PGCB 2CBPA 1J5IA 1HL8A 4Z7AA 3TBVB 4BFFA 1X5LA 1WFNA 4PAZA 1QRND 4X4ZA 2DLEA 3FUMA 2A6IB 5F9DC 3NSFA 5KN5B 1BEYL 4EKXA 5EEWA 3HVNA 1XH2A 2FSEB 4LSSL 1P6WA 3L5JA 1D7BA 1LK2A 1OAYL 2KBGA 1DANT 1NWPA 2D03H 3T4AB 4JFYB 4I0PC 4E9QA 5T1LA 3CD4A 2FECI 1ETJA 2VL4A 4CNIA 2OP4H 4L1TA 4A2HA 1CYXA 1CDHA 2CIIA 4B9PA 1JXKA 4XN9A 1BQHA 4LVNC 2YGQA 4ELDA 5EEXA 4LASH 2HH0H 2YUWA 3HB3C 3BP6B 1F86A 3EOBB 3CX2A 3RWGB 3D2UD 3LAFA 4XVSL 3BKJL 4FNLH 1MXGA 1C7TA 1CCZA 1FZOA 1S7SB 3H53A 2RH0A 4G9FA 1NMCC 2QMKA 4GAAA 3V0IA 5DEJA 3UX9B 3CMOH 5KANG 3JV5A 2NY6C 4C58B 4FC3E 4KQ4H 4XX1G 1UKQA 4PJ8A 3VRJA 2GTQA 2YBRA 4YE4L 2FJHA 1VACB 3KYOB 3P4LA 2E47A 5D7LE 5HDOA 3NCCB 1U58B 3DSNB 4TQ8A 1MCRA 1U8NA 1XT5A 2VDMH 4IHOA 4Z0BL 3SOTA 4V1DE 3O6LL 3VI3F 3R0NA 2EC9T 1QPKA 3N43B 3S5ZA 2L8AA 3L5HA 4WI9A 1AQDB 2YJQA 4JQXA 2W88A 4NO0D 4DVRH 5HJ3B 3DC0A 4MDIA 4OUUB 4PJDB 4ZFOL 5I16A 2BOCA 1CFSB 1K8IB 4LNRB 3VFVB 1X5HA 4QF1B 3SO5A 5EF0A 3R1GH 2YQ2A 2AK4E 3MOAL 3QE5A 5GZOC 2BX5A 4DOHB 3DX3A 1BFSA 4DP2X 2IPKA 4MCZB 2V5MA 5C6PB 2XWZA 3X3FH 2XFXB 2DLHA 2VN5A 4WO4B 3US9A 4RAUA 5D1QB 4DEPC 5BOJA 1HXYB 4WDIB 5D71L 3TX4A 3QJQB 3VFOB 3EO9L 2YD2A 4XMKL 1NL0L 2Y3NA 4KDTA 4PI2A 5IFJA 1DDHB 3V6ZB 1UXSA 2UZIL 4AEIL 4ZX3A 3ZO0A 1B6DA 1JZFA 3GKZA 5DQ9A 5JOPD 1JPFB 2ZOKA 5JUEL 1DBBL 1AZRA 1DQLH 3HPLA 4BUGA 4QLWA 3MVSA 1SJVA 3TT1H 4JY4B 5IK3B 4R2GD 4RISL 3KLAA 4JKPH 2NDGA 4ZSOB 4P5SA 1WAPA 2EXWC 3TJEL 4QRUA 3L2NA 4TNWK 1YN7B 4G8FA 2Y7NA 3B2VL 4U6HA 5I66B 3TVMA 4MSWB 1N5YH 4EOWH 2X0UA 3SKJL 4JFQB 2HT2C 1ROWA 2BY2A 2K3HA 3CZKA 3DV6A 5FF6A 2P28B 2X1PA 1XGPA 3GDCA 4F58H 1JF5A 3ABLB 1I1AC 5JA8B 4QXWA 4PGBB 5KYWB 2AEQL 1KWGA 4JDZB 1JL8A 1G9MH 1OAKH 1PW3A 4Q14A 1JHTA 1P6AB 2EDEA 2VZ1A 4JO2L 4PWFA 1A7NL 1FWXA 5ALCH 1A6TB 4LEXL 5GRUH 4XP5L 3EW3B 1QNZH 7FABH 1UA6H 3IFLL 3QRLA 3K6SA 1L4IA 2BSDA 1XGUB 2GJJA 5DURD 1PG7L 1KIRA 4MA3A 1DN0A 3S5YA 1JZ4A 12E8L 2DQIH 3QCUH 1NIDA 3FH5A 5FKAA 3MACH 2MFNA 1NBYA 2XN1A 2Q8AH 4I9WD 1P7QA 3PV6B 2N59A 2WLIA 2OX5B 3MBWA 1CXEA 4XPTH 2A9NL 3SYPA 4KY1H 3TZVD 3DIFB 1NCAL 1IEHA 2CO2A 4FQXA 2AXFB 2FEDC 3ZT5A 4E9SA 4RRPM 5D7JD 2I5YH 2XT1B 5E8NB 5E5RB 2AV7A 4W1TA 1L9SA 3BUBA 4OM1H 4N8VG 1U21A 1B88A 2OMUA 2WQUA 4CAGA 4JRWA 3MR9A 1CYWA 2C1PA 3REWB 2ZT9C 2CJ3A 1QBLH 1WH0A 1QO3A 5D2NB 4IU3B 3Q44A 5I0DA 4HZLB 5CGYD 4Y4HA 4LGRB 4L2YA 3LZPA 1BXUA 4GRLB 5KYUA 3DI3B 1RZQA 3FT0A 5HHVH 3T0WA 4W70A 4C8XA 3P9WB 1LO2H 3GMOA 1ASOA 2DAVA 4FQJH 3SCMD 1BLIA 4XPFH 4HEPG 3VXSA 4HJTA 1KLUB 4UOJA 1O7VA 3VXOA 3QULB 4YHIA 2LGNA 3R8QA 3HAEA 1W72H 3D2UB 3CH1B 3V5KB 1KIUB 1GOFA 4TYUA 4FADA 3GIZH 3U9PH 3BIBX 1FNEA 4PY8J 1TF4A 2RIKA 2H2SD 5I1EL 3UZEC 1YQVL 1NPJA 3IDUA 3F7KA 4JDEB 5C7XH 1LVEA 1VCAA 3GSRB 1K85A 5FW6A 1AI1L 1D3CA 1PX3A 1OTUC 2F1EA 3VFRA 3GTTA 4GQ9L 5AL0A 3DHJA 5GZNA 5KVMC 1AVAA 2CDEB 1EHKB 4DN3H 2HZHA 3VQLA 1XGPB 3FB8A 5F3BB 1C1EH 1TCRB 1SNRA 4NO2B 4A7GA 2X6AA 1QX1A 3D0VB 3PHQB 1B2WL 5T1JA 3WNIA 2A6IA 4TQIA 3VXUE 3AVEA 4Z3HA 5IHHA 3B2UD 4HUCA 1XD0A 1DQTA 1X4XA 3KXFB 4K3EL 4XODA 5ICZB 3LRGA 4LQ1A 1FFOB 2FDBP 1W0YT 3PDOB 1YNLH 5AVYB 5LN4A 3R7QA 2GSMB 4PLJC 3NQIA 6FABH 1TZHA 3ASNB 4ERSH 4P4RB 2XVKA 1QFWM 3S37H 2EYSA 4O51B 5B39B 4LHUA 1Y1UA 1E6OL 4N0FB 3NACH 2OFQA 4PR5B 5AOLA 3OG4B 5FYJU 2F53B 3K72A 2D7QA 3QWOA 1IAIL 5AYUL 1BJMA 2Q87A 4A38A 2IG2L 3VFTA 5AKTA 3APDA 1L9OA 1LHZA 2ICES 4NGHL 3K81A 4LSQH 2WO4A 3HE7D 1OGTA 2F5AL 2NOYA 3GI8H 3HRZB 4HV8A 5DJ0B 3VXUA 4DN3L 1TFPA 5EIVA 1C5DA 1XIWB 2XN9A 2X70A 1YN6B 4DGYL 4JNXA 4AV4A 3I6SA 3OKLB 3U4AA 1O7DC 1Q0XL 2C34A 4BWUA 1WBXA 2P5EB 3C6EA 4N9OB 5T5FA 5GS0D 4XZUB 3PXLA 1W72B 3AQDA 3I3BA 2X4NB 4M6MH 3AG4B 2RQ8A 3S4SB 4M7ZC 2R7EB 4GRWH 4FA6A 2QR0A 2ZUQB 5A2KH 3V0VA 4J3OH 3MUGB 5DEFB 1QTSA 1NCIA 1BXXA 1NKGA 3O2VH 4H8PA 4M1CC 2EKSA 2R1YB 3SPGA 1UD6A 4IOFC 1TVBA 1FNGB 3UMTA 1WA0X 3NEEA 1CQKA 1WZLA 1N26A 2EIKB 1VB9A 4LP8A 1MCQA 4PVMA 2EAEA 3FOMB 3QIBA 3VG9B 3ZL4H 5KTEH 1JDAA 1U8MB 1P7BA 3I6GB 2ZPKL 3JV4B 1NAMB 3D06A 4HDIA 5IFHH 5J57B 3FTVA 2NY4D 5HGHB 2CUHA 3U4EA 5AZ2H 3LZLA 1BG9A 4R26H 4NQCD 2D9QB 3TS8A 2G30A 3RWHB 4PJIE 5IBTL 2PW1B 5HTSA 2I27N 5LDSA 4CJ0A 5LGJA 2KPNA 2RCSL 4JG5A 4HETA 3GBNL 2XBTA 3JTTB 3A22A 3EXLA 3WN5B 5CD3A 1MFAH 2HWZH 4Y4FD 1ONQB 3GMQA 4DGYH 1K8DA 3BHBB 3EOAA 3KPPB 3WIIH 5JOPE 4PLOB 4WWKB 3GKWH 3HC2A 3IEAA 3OKMB 4GUPB 3DTXA 1CDJA 3QZLA 2ED7A 4PQXA 3BT0A 1NWOA 4J2XA 3QJFA 3N40F 1JGUH 2WLZA 2J8UF 2JF1A 1HSAA 2BLFA 2GUYA 4QYOB 3H6JA 4WW2B 3DMMB 2H3KA 2F8XC 4P2RA 3KG5A 1A7QL 4LEXH 2MCMA 4PWHA 2A73B 4PHXA 5IFAL 5HYQB 1KELH 3KBHE 4Y8DC 3AXLA 1I8MA 3M7FB 1XIWA 2XN9B 3FO2B 5IBLC 2YGNA 1MPAH 4KK9C 4QHLA 4AQ8A 3G5VA 3O4OB 3QISA 4FGMA 5ADPL 5IHWA 2BWDA 2R1WB 3VFTB 4PGBA 3RWJB 3WNMA 2BY1A 3ZMRA 2OA9A 1IFHH 4Y4HB 3ARFA 3V0GA 1YUHA 1YEHL 1RZ8B 1G7LB 5DJZA 2YD7A 2CXKA 1A3QA 2J7LA 3MLZL 2ZOOA 3CFCH 4G6ML 4CRPA 1S7QA 2ZPKH 5IFHL 3OKLA 1G9NC 1RV6X 3LKOB 1XXFC 3L4TA 2YO3A 3OAUH 4L8BA 1NC4A 1CLZH 4HXAL 5SWZD 4PB0H 4Z3GA 3ZVVA 4AYDC 3OXSB 1A2YB 5E2WH 3CFQA 3VFMA 35C8H 3V7AG 1OV8A 2D3NA 4N28A 3Q6GH 3NG5A 1JYVA 5AW8B 1UWXH 5D7LD 3UTTA 4EXKA 3QUXB 4UQ9A 1SFHA 3EYFB 4J4PA 5E2VL 1L9MA 1M7DA 4HC1H 3GZPA 3WE6A 3GZKA 1EJ8A 2B2XL 2OXHA 4LHUG 2LT9A 1OAUH 1TZOA 4HSAC 3L17A 3DOHA 4LPCA 4OCNC 5E6RB 1G7JA 3LD8C 1MCLA 5D7KE 1A5FH 4PJEE 5SX5K 3AITA 1CI3M 3ILEA 4FHBD 3SDYH 3UAEA 2DM7A 3VFWB 1JVLA 2PO6C 4KZEL 1IKFH 2EXTA 2MH4A 3APNA 4NO3A 1C08A 4Q8BA 5GS2H 2EDHA 4N6RB 5CFHA 2VC2B 1U30A 4NZJA 1SY6A 5DYOB 3GSNH 2IWEA 1OGAA 3W5MA 1VACA 3KYOA 3VSQA 1QNIA 2AGJH 4HALA 5C92A 1PJ9A 1W72L 2NT1A 4KRNA 2YC1B 4PWJA 3UBXB 3DOSB 3WJJC 4Z3EA 2OL3B 2C3WA 2N56A 4FKKA 1ZT7B 3INOA 3DYMA 5KSUA 4R9HA 3RWDA 1AGCB 3Q5YA 4K5LA 4OF3A 5C08B 4BQCA 2X28A 1KG0A 2YPVA 3ARPA 1P2CA 4FFZA 4OQ1A 3DBSA 2BH0A 2Y72A 2BRRL 4G6FB 2X9ZA 5E6ID 1BMWA 1RPKA 4YBLC 1WIOA 1QTYT 3W38A 1GAFL 5D1XD 1U3HC 3A5VA 1DSFL 4UT9A 3RB7A 4H0LC 1L7IL 4JPQA 4RA0C 5ITBL 4O2CA 1NMAL 3QNXA 4U0QB 3ROLB 1LO4H 2IH1A 3ARDC 2LAGB 5I30H 4S1DD 1S7XA 2DMHA 3BUYA 4ZAKA 5EU6A 3SDAD 1NGZB 2N0KA 3LQAH 3P73B 1LDPL 1T7VA 3JTSB 4XXWA 3C5XA 4YSSA 1PSKL 2OR9H 5IOPB 4AQ1B 1ACYL 3ISYA 1W0VB 4L8BB 4X6CF 3OR6B 4EUPH 1YYML 2AV7B 1WSST 2OTUB 1AZBA 2EO7A 3FHEA 4A2EA 4L18A 1JWSB 4NENB 2I85A 1AIFB 3BWUC 3EBGA 2JCWA 4LF3A 5DC4B 3CFEA 2Y3AA 1E4WH 4ODXA 1CLYH 3JWOC 5JW5B 1NFIB 4PP1D 5FB8B 5DD5H 4MQ7B 5HHVL 2LOEA 1H3UA 1DQKA 2ITFA 3QDJD 4FMVA 3STLA 3SZ6A 5I1CL 4J4PD 3WTYA 1JV2B 1YEEH 4HAFA 1Z3GH 1AGEB 2VQUA 3QHFH 1VDGA 1YEDA 1BWWA 5B7MA 3ZDYF 4KMLB 4WTXA 2Z35A 3V4UH 1HSAB 3EO1A 5JQ6L 3BW9B 3T0VA 1WFIA 4MAYB 3T8MA 1EDHA 4L5FL 1SHMA 2AQQA 4B5ZA 1AQKL 3V4VB 3GJFH 4FF9A 4ZXBC 4WWKA 4E0RA 3NPZB 1CICA 5DJDB 5D1ZC 4QHPA 4AYID 3DDGA 1BJ1J 3GSRA 3QJXA 3ETTA 3QNYB 3FQTA 5K9QI 1PD1A 3OKEB 5HI5D 1F90H 4HU8A 1IQWH 1EZSA 2Q1EA 4NBXB 4QTFA 5CJXC 5CXPA 3S3SA 5HYQA 2JCCA 2N0MA 5CIPH 1JTTA 5TFSH 4KTYA 4NO2A 1KNOB 2H4EA 1IAKB 4XVOA 3QPQC 1FYTE 4RNRB 1YMHA 1QMUA 5GGQH 1EEYB 2Z4TA 5IW3A 5ECJE 5AB9A 2DWYA 1JGEB 1P7QD 4JFPA 4I88A 4OLYL 2KUTA 2OBGA 1WFUA 2ESVE 3BUQA 4P23B 4OZHA 1T2XA 4F7KA 1TR7A 3MCKA 2HCZX 2J21A 2MPVA 1HHHB 1PBYA 4TTDD 3CVHB 4MNQD 2FH8A 1MIEL 3BZEB 2AZUA 1JV5B 3G6JE 3ML9A 3F00A 4PGEB 5F9WC 3UAJD 1B2WH 4F7CA 2BZDA 3QDGE 3CH1A 2BMKB 3DUUA 2RBLA 1TQUA 3L4YA 3I02A 1QW9A 4KNUA 4PH8A 3BRDA 1MFNA 3CDGB 4JAMB 2CG9X 3SE4A 4NIKB 1CD1A 2MIZA 3QT2A 5LNEA 4GQPH 3VB9A 2VABA 4OUOA 2NX5A 1OY3B 3VXSB 5J9PA 4FG4A 3S37L 1MHHA 3VNZA 4KV5E 1QSVA 3RWEA 5T1KD 3BH9B 3FQWB 4WFHE 1UM5L 1YMMA 1TQCC 2D7TH 5EO1A 3LKPA 4C55A 1BXVA 4NQEE 1AD0A 3GK8H 3H2PA 1ZT1A 1OWWA 3IDNA 4OT1L 2QQNH 4WHCA 3SDCB 4AVJA 2HN7B 4GLRI 2ZAIA 4CKQA 4O2FA 1MZYA 1UACL 3OSKA 1JWMB 3CK0H 1VERA 2R7EA 2N7BA 4HJJH 1ZGLM 5KSAC 3WLWD 2AVGA 3L1OH 1Y18B 4MJJA 1CZ8H 4FYSA 1FFPB 3AY4A 1QKZH 2HTKC 1SUHA 1OK0A 2J8OA 3ABZA 3MU3A 3BC9A 4WHTB 1Q38A 2VB5A 1A47A 2EDRA 4MAYA 4HIIA 1L3NA 4YDVB 5KOMC 3HUJF 4KZCA 43CAB 4IKJA 4ZMNA 1BFTA 2Q86B 5FK9A 4BV1A 3TF7C 1CDIA 1GKEA 2R4RL 4ODTH 3MXWH 3WENA 5A2IH 5CZVL 1WEJL 3HG5A 1JUFB 3D09A 3TOPA 2F1AA 3NFPA 4RFEA 1V54B 4WWKD 2X9YA 4OI8A 3MBED 5G5DA 4LAJH 4Y1AD 2ICEC 1FG2B 4XCNA 2UXVA 1NCCL 1LGVA 4OF6A 2WGNB 1T1XB 2NMSA 2EH7H 1ZD6A 2PCPA 1T89C 1TETH 4AL8C 1MCEA 4HJJL 4JDVB 3PDDA 4BKSC 2WYIA 2H0JA 1XGYL 3WMQA 5C9JB 12E8H 3LN5A 4G9DB 3VWJC 5B1AB 4ZW3A 5DVKA 3EJRA 2MOQA 4ANUA 3IJSA 3OJVC 3DXAD 5CEYA 5BUGA 2X6BA 4AZ8B 1CG9A 4OJDH 4KZDL 3GMRB 4CVZB 2ZX5A 1ACZA 4M7JL 4WSGA 2Q76A 3HBQA 2E9WA 4BA8A 2JIXB 4BFKA 4N2EA 1EUUA 5DZPA 3N1QC 2FLMA 1IGCH 1YEGH 2NY3D 2XZQH 1I82A 2VZVA 3R06B 1X5IA 1K6QL 1QLFA 3MMEB 2FQFA 1BIIB 4AY0A 4FQLH 1TSHA 1IU1A 4GINA 4WNJA 3M86A 4KJPD 1G7MB 3OJMB 2NY5H 2W07A 3X14B 1NCJA 3MFGB 3OF6D 1GGIH 4BE5A 1TZGL 5IY5B 5LNDA 5GZND 2V5TA 1KGXA 5G4NA 1Q94A 1JWMA 3HN3A 4BFIB 4PV9B 4CMHB 5D93B 4UDTA 1SM3H 3C09C 3MUZ1 3QNFA 3OX8A 2P8PA 4XMKH 5AOMA 2ERJB 3PWUB 1KPRB 2ZXWB 4XNXH 3WIFA 2XG5B 2LR4A 4XNZC 3FDWA 5F21B 4J7RA 2E27H 4QF1A 3MV9E 5B22A 3UYRH 3BLBA 3EGSB 1HQRB 1S9XB 3LIZA 3SQBB 5B1CA 3BQUD 5HHMD 3WFCL 3VGAC 3EH1A 2PYEE 1M7IB 2J44A 3QQ4A 2DWDB 4ZO6A 4MHHG 5E8EA 3KBEA 1QFWI 4XE5B 5FYKH 3FO0L 4JG9A 4CADB 1FZMA 5GRVK 1FAIL 3BN9C 1N0XH 1JXDA 1RHHA 1DQLL 1U0QA 3CC5B 3KPOB 4PJBB 4JN1H 4KMTH 1G9NL 3WFBH 1T7WA 5B8CA 1J8KA 1QRKA 5EC1A 3BH8A 1SLVA 2D0FA 4FCHA 4HFUH 4Z7WE 4L9DA 2YC1A 4BQ8A 5A2AA 2Z4QA 4MAYD 4LMQI 3S3PA 1DVUA 5KOVC 5HBBA 5L2JA 5MEQA 3ZBMA 3OC5A 4JFPB 1Q9OA 3CSTA 1EZVX 3Q6FB 2P8LB 3QZMA 4M8VA 1KCBA 3IN0A 3AG2B 3UEZA 4U3HA 3GMRA 1HWWA 3HFML 3T0XA 3U4BH 4CVZA 3MC0A 4AUYA 4H8VA 1QOKA 3CIAA 2GUOA 3ARYA 1KULA 1RUAL 4OGAC 3GUTA 2ZUUA 3QQDB 5E9DE 4DETA 4G1EA 4HUXB 1YG9A 1Y1DA 4KKBC 2VDLL 4MA7L 3FONB 3UTQB 1JD7A 1LWRA 3N43F 1N7ML 2ZOLB 5E0QA 4KQ4L 4AC4A 3D4GA 1WVZA 4N5UA 3MZTA 3N41B 5EHFA 4YDKH 5F9JB 5DJCB 4LO9A 4OI9A 4ZD3L 1FC1A 5MI0C 5E7FA 3MRFB 2QPUA 4HXBL 5GSRA 5J1TC 1HEJC 3EF7A 4HWZA 4QXVA 2Q0ZX 1XH0A 4ONGH 1TTFA 3PPEA 3ZTNH 1AGDB 4NN5C 5JHLL 3P9LB 1CVRA 1YZZA 2QPSA 2XWJB 5EFIA 4NIYE 1BVNT 3QR2A 2JELH 2YA1A 3I2CL 3LIZL 3VXPB 2OP4L 3D9AL 2DQJH 4D7PA 2HVKB 2R2HB 3EBHA 1JI2A 1FORL 2OYPA 1RZJL 3CFEB 4I8DA 1KBPA 3CFNA 4WHYH 5LXGH 5E0FA 3OHXB 5I23A 4E9XA 2IQ9L 1T66C 2AHIA 3WN6A 4RFNC 3RTLA 3CC1A 1GGUA 3G7TA 4P46A 3WS6C 3LOWA 3TBTA 3E6FB 1RD6A 1AIZA 3PFQA 4U1GB 3T0EA 4XXDB 4QRSA 4KMQA 1RSYA 5EORH 1CLYL 4X6EB 2XOTA 3JV6A 1M2VA 1SGKA 4M6OH 4JK0D 1T89A 1I1FB 4ODTL 2ADIA 4NFDA 1HWGB 4X6BB 3MO1A 2ZUVA 4U1IB 2FT7A 1BJ1H 1E9QB 5CN3A 4TSCH 5MEQB 2PO6B 2COVD 1OT1A 2W0LA 3AU1B 3HMXA 3DETC 5T33H 1E5CA 2WO2B 4P4KD 3S97C 5D4QA 5C3IA 2DY2A 3DBXA 3ES6A 5LAXA 1QAWA 4ZTPH 2BCKA 4NM8H 5DD5L 4LSPL 3ULVH 1TNMA 3S2CA 1UH3A 3GQFA 2GUOB 4P2OA 5ACZB 4FAAB 1CGWA 1GGBL 4NSKA 3VGFA 1KY6A 3ARBA 3IVKA 2QADD 3JYCA 1ZOXA 1G7HB 3MXVL 2W9LA 3EJZD 4QRRD 3GSUB 3VXOB 3LIZH 1LD9A 2VXQL 1V3MA 2CRYA 1WD9A 1KTLA 5I6LA 4MJIE 2WNXA 1MNUH 3DWTA 1SJXA 5MENB 1O7SA 4F2MB 2CRIA 3D48R 5HI4D 5HY9B 3EXJA 1F4HA 2HRPH 3NTCH 1P7HL 1SN2A 2GBAA 3BLPX 3BUPA 3CVDA 4H1LA 4HP5A 4JO2H 4WEMB 5I1DA 4HHWA 2XTJD 2JJUA 1RZGB 1KPVA 3FF8A 4HEME 4DFIA 5D7SH 2FCBA 3C9NB 4ZDHA 4U6YB 1VGEL 2L4OA 1SOQA 1G9HA 4FX5A 3STBA 3I9GL 2YD6A 3FFDA 4TLTA 3T6ZA 4E41E 2DKMA 2MNWA 1D5ZB 2ZXAA 4UIKH 4XMPL 4K73A 3ZKSD 4OU3A 4PG9A 4C4KO 4UM9A 2AXFA 4FKEA 1U8CA 1NCBL 1K72A 3B2VH 4MZ2A 5JMRA 4CDGC 2NXYC 3EFOA 1ZWIB 2XN9D 3CLWA 1K5NA 1E8XA 3SDYL 4IOIB 3NZ8B 3Q1SH 4HKBB 1PKQE 4F7PA 5I17A 5L4MA 2J8UE 1Q72H 2YSTA 4LAQL 3GHEH 4K71C 4GH7B 4KTDH 4W9ZA 5ITFB 1FAIH 4DWHA 4PLKC 1OQOA 1M57B 3O6FB 5E95B 4GMTL 3MKKA 1A14H 2WXLA 3NJFA 3PP3H 4K3DL 3WFDL 4X6CA 4MZRA 1ORSA 1V55B 2YN3A 2WK2A 1QP1A 3QIWC 3G6AB 4Y1AB 1TTRA 5D1XA 4JFOB 3NCBB 4XPFL 3BWAA 4Z7WA 1F4WL 1R5WB 1ZSDA 5LXVA 1MFDH 5TH2B 5IBTH 4Q2ZA 3UG3A 5BW7C 1OSZB 1S5HB 2WOYA 3EUUA 2FL5A 3HLKA 2YN5A 4V2CB 2YD0A 2PYEA 2BNQB 4JPKH 4YDVA 4YHMH 2BSSA 3GSQA 4MMYB 4H20H 4IMLB 2GBUA 4I4WA 5I76B 3TEZA 1MCDA 2GKIA 2MEJB 3JT0A 3SGKC 3ZDXF 4GMSH 5KVFH 3VD1A 4KKCD 3FQNA 4BZ1A 1E3ZA 4NX0A 4NBYB 3CG8A 1PZUB 5AVWB 4NB7A 3IJEA 3MRNA 4YDZA 1HOCA 5KBKA 1AR1D 3L13A 4EF3A 2ADJA 2M83A 4S1RH 4NQDD 1JP5A 1KJ3H 4TULH 2HKHL 1FFQA 3B37A 5DSCB 5C0NC 2NT0A 2XPZA 1OHZA 2W9EH 3DYOA 5DJYA 4Q0XH 2AP2A 4OCWL 1WS8A 4IJ3B 3FCTB 4K3EH 5J6SA 1QFPA 4B97A 4IDLA 1A6UH 4HULB 1KJ2B 3ML8A 5EU7E 1XVSA 3S36H 5I1DB 1TYEB 5I5RA 4PGDA 2FYYB 1OAJA 2CSPA 2OJEB 2XKUA 3DUSB 2GJRA 3Q6FA 1E43A 2NY1D 4W9IC 4HFWA 4YHOL 5D2NA 2EH7L 3AQXA 3CPUA 1EJOH 4GP4B 4MCYA 3O4LA 2CGZA 4JM2F 1TPXC 4Z7QB 1D6VH 4YR6A 2HFTA 3FK3A 4N5ED 4CU7A 5JHDB 4XTRC 3UPRB 1RK1A 4H0GA 3G9VA 1BBJB 2HG5A 1G43A 4U3SB 1T04A 2A38A 1M71A 3FB5B 4OBRA 3CHOA 3UZVB 4I18A 4WV1C 4FQXB 4HIJB 5DVOA 1I9IH 4JFXA 5I26A 2EXYC 2E8ZA 3V10A 2V2WB 3PWVB 4U1IA 2X4NA 1P7QB 4LPTA 4LVOC 1NIBA 1YNKH 4G6KH 4KKRA 4NKMA 1J8HD 4M7JH 4LP4A 3RURA 1MHPH 1ZA3A 2B5IB 4N8PA 4HIPA 1HU8A 4PRPB 4AGPA 5J13C 4N68A 5EMYA 1KPRA 3OAWA 4OFYD 5KWYC 5EOQH 2HKFL 2W60B 3UC0L 3NJHA 1AGDA 1FZJA 1JFQL 2OPCA 3HJ0A 5EZOH 5IW1B 3GSVB 2FEJA 3J7HA 4LSTH 5D2LB 3BWAB 4MDRA 3STZB 4N86A 2V2XB 4X9FA 1CURA 1PLGL 1NSNL 1AE6L 1S7QB 3OZ9L 1IIIA 3Q2VA 4GAGH 5C3LD 2A6KA 2R0WL 3RHWK 4OTXH 3B83A 3ULAB 3CHSA 1FLRL 4GP8B 1M1XB 3BVVA 3HC3H 4YX2H 3BD4A 4JGMA 3WEMA 4KMTL 1BIIA 1TZHB 2ENSA 5HXMA 5MENA 2JLPA 2BC4B 2NZIA 3QORD 3FS9A 2Y0SA 4UBDD 2PXYA 3RFRA 2J25A 4G6JH 3WFCH 1GJWA 2FH6A 3ASWA 2AQ1A 3P11H 4L37B 3C60A 3QDJB 4XMLL 1VIWA 3F05A 3ULUF 5DHXB 1DVYA 2CDGB 3QNZA 2ZYIA 1G7PB 1UFUA 2E9JA 3CAFA 3MYZA 4N26A 1YMME 4IGBA 4UTCA 3TWCH 4NQDE 3PWNA 3ARGA 3D52A 3FT4A 2DQDH 1D5ZA 5LAXB 3WELA 3IMBA 4MQTB 5HPOA 2Y5QA 1HXMB 4BELD 2WUCH 3FSOA 4OCYL 1QFUL 3DX9A 1XF4A 3PDOA 1QD0A 1GW0A 5GJTL 5DRNB 2BNRB 3GSNA 1HAWA 3IDYB 3CDFA 2XZCH 3W2DL 1N7MH 5TDPB 4JO4H 5FUCC 4RH4A 4KI5D 1M7IA 3QQ4B 3IGFA 1DFXA 5F7KC 2BS71 4TXVB 2AV1B 2V0AA 5EUKB 2EDFA 5CP3A 3UERA 5IB3A 4URKA 5E9DB 1OM3L 4BZ1L 2YBRB 4ZAKD 5F6HI 2X4SB 5FA4A 4QJ5B 3IDMA 1H3GA 2JKWA 2W9DL 4WI0A 3LY6A 2X4TB 5DEGA 3NSXA 4NKDA 5JUEH 1E5UI 5AKSA 2DQCH 2Z4QB 2C3HA 3CN2A 3OKOA 4JANB 4UT6H 3CBJB 3GHPA 1F97A 1SEQH 3FQUB 4TUUA 3P0VL 2R2HA 3PABB 4MB5A 3SBWA 4KX8A 4MDIB 4XPAL 4LCCA 3TFBA 1EEUA 4UT9H 4KTDL 5L88L 3TV8A 2OK0L 5C08D 2XXMB 2EIMB 4J8RA 1IUZA 1QG3A 1NPUA 2HJKA 3HS8A 4YHIB 3ZTCC 4XC1H 4YOKA 4ZNEA 1TPXB 3KPNA 5FHBH 4Y16B 1XBRA 2DQUL 4LLMA 4BFJA 1GZQB 4F20A 4X4XB 2J3SA 2XLLA 1RMFH 1XGRB 1IBDA 2DM3A 1M42A 4B9FA 3OHMB 4A63A 5EEZA 3LS5H 3TZVA 1UD4A 3KW7A 4OFKA 1FH2A 4AMXA 4QRPE 5JQ6H 2BVEA 1TZGH 1A22B 4JFFA 3CFTA 3KDMA 4NO3B 4WTZA 1JPST 4TQEH 3MRLA 1D9KB 1F1DA 2DQTH 4I3SH 2ZUXA 1OF0A 1PG7H 4PS7A 1WTLA 3TA3C 4EVNB 4RFOH 1HE7A 5JHDD 5DR5L 5LLIC 2J57A 5JR1L 3TA4D 1C12A 4EDWH 3SJVE 4CSZA 3T3PB 5CJQL 3CDZA 3DIDA 1QHQA 4JLRB 3GRWA 5FEBA 4RX4A 3QB7C 4MB1A 1W8NA 2YZ8A 1MIML 4A7GF 4Y16C 4BFRA 4PRDA 4WK2B 2IAND 3BEVA 3DV6B 1B6UA 2E75C 1XZWA 3ARGC 3OKKB 3GJFA 1U36A 4RAHA 4EJ1C 1YEFL 2HP4A 2IH3A 4NPJA 2VZUA 4QD2E 3T6QC 4UOQA 1P84K 2LVEA 3ARGD 1GCYA 2IANE 1NC4B 3LEVL 3HUJE 3NIGE 4QO1A 3W9DB 1P84J 3OLGA 2X2HA 1WAAE 4XNUH 3HJEA 2O5YH 1I8IA 2J8HA 4IBSA 2J1WA 2ED9A 3E7JA 3GEWB 1MQKL 2FB4H 1RZKL 3H54A 3IE9A 4IDJH 3MRMB 4L2LA 2EKJA 2KQMA 4F9LA 3SDXB 1MCIA 2YUZA 1XBDA 3TIDB 3U2SA 2A74B 3RIFK 1ANUA 3PWPA 4JGUA 1FVDB 5D96B 3N42F 4W9FC 4ANWA 4W9JC 4P46D 2Z31A 3WDHA 2DS4A 3B56A 4JZOA 3EBAA 2P7TB 1PNDA 2N3JA 5L2KB 5JIMA 4XP1L 5BS0D 1QUNB 5T1KA 4R97C 4ETQB 1RZFL 3JXAA 1JPGB 5CSGA 3HZMB 3MCG1 2ZSVA 3V4VL 3CZSA 4XR8C 2WVTA 3FT2A 4N85A 1MHHB 3ARFB 1BOGB 2LFEA 2WSDA 2QFRA 1CT8A 4U3SA 5CZRA 2QSTA 3V0FA 1FH5H 3L4UA 2F8VA 1Z5YD 1U41A 2C9SA 2J55A 2FD6H 3AM8C 4PS3A 1CZ8L 1SYVB 5C08E 3MLSH 3D3VE 3T4YA 2DYPD 3SDCA 1XGQB 3KPSB 4U0RB 5GISH 1JZ6A 2H1PH 1K3ZA 2X9XA 5I30L 3SGJA 1B4TA 5J12B 1YMMB 2P9RA 3MQIA 3KNBB 4NKMB 1BD2E 3EJJX 1KLGB 3Q2CA 4PYHA 3QO1A 3MLUH 4LE8A 1S7UB 1XTLA 2EYTB 1ZHBB 1IE5A 3K8LA 4QCIB 4KKAC 5EUKA 4R97B 2F8OA 1I3GH 4DK3A 5E8OB 2OAAA 5IQ7H 3IXAA 2CNYA 1AGFA 4AH2B 5GXBB 1LLAA 5KBPA 2H8PB 2JCCB 4BINA 3RPIA 3W57A 1ZEAH 1ZLVK 3V4PH 4QUOA 3FCSB 1EAOA 1GMIA 3RDTA 2F6AA 1H15B 3WCYA 4OJFL 5KJ7E 1JGEA 1O7DE 3RWDB 4R5VA 1M9WA 1WHPA 4OVVA 3ARFD 2YLKA 1AQ8A 1L6XA 1TEYA 2R2CA 4OZHB 4FA7B 3ILQC 2L0DA 2WLIB 3HUJB 2HPTA 4BZ2A 4FLSA 3V79C 5E1AB 4K3HA 4GS7B 3LHAA 1WBYB 4PGDB 2X4QA 4UB0H 3IFPA 1J12A 2BFVH 5CP7A 2YMTA 5HYSB 4IRZA 3FTXA 2VGLM 3E1ZA 4DF9A 5EOTB 1RPQA 5A2BA 4KQ0A 4U1NB 1XHHA 4FNQA 5I82A 3PL6B 2HLFD 4EI0A 2BVYA 5ANMB 1CG9B 3UBGA 5EC2B 4PLNC 4FQQB 1J1XH 1SPDA 2PCPB 5C0CD 1BMGA 1EDYA 1TQBB 4J3SA 4XX5A 1I4FA 4QJ4B 4GO8A 1RLWA 3WL9A 3HI1A 3TTYA 4ZS7L 3OF6A 3V4VA 5DQ9B 3SJVB 1R47A 2GY5A 2FBJL 1FGNH 3VD0A 3FQ1A 3R06A 5I75B 4E41B 1GCFA 1LP9F 3VFPB 3AADB 3APFA 1T4KB 4QTIH 1XGRA 2R8SH 1EXHA 3D39A 2J88L 1BF5A 1MF2H 3ZY7A 2H6UA 2AJ3B 5F93C 4LU5H 2ZOWA 4DZ8A 2QGEA 2WD0A 4TUJB 5C0BD 1YNKL 1KIQB 4G6KL 5EBLA 3RB5A 3ZQ9A 4OGYL 2DRUA 2ITDA 2ZXBA 1U2CA 4Z7NB 5CBAA 3TBSB 4PWKA 2NNAA 3IDIB 3CFMA 5E1IA 4C4KT 1E4XL 4I18C 2F2HA 4XVUD 2AK1L 3WIIL 1OCWL 5DR5H 4FFVD 5DUPH 4PJ7E 2DIEA 5B4MC 1KXTB 1KJMA 5D9SA 1GTNA 3CHQA 3L4XA 3Q8AA 5IEKB 5LAPA 3MCKB 4XC3L 4F8LA 1T03L 3K2KA 4L4TE 4QLRA 5HGAA 2A6KB 3MRJB 5IQ9B 2OJZH 4KO5A 3VE0A 3MUJA 2C7UB 1I8LA 4DN4L 2H6PB 1IGJA 1QSFD 4KDWA 4JKLA 2WINA 5C0RL 5C07A 3EOTL 1E50A 3O9WD 4IBWA 4LIQE 5IWLA 1KSRA 3ZRFC 4HBCH 4XRCA 3GRWL 5I6XB 4WU7B 1L9PA 5JTWA 3EDFA 3ME0A 2ZSWA 1YSOA 3NT0A 5J5EA 3GK8L 4U6VH 5JLZA 3CBRA 5GGSY 1NGWA 3VRIB 1F1GA 1O5PA 4LLVB 5D4IA 1K3IA 2AQSA 3S36X 2NZ9D 5D8JH 2MHAA 3EYUL 3VFNA 3HG1E 4QTIL 2R8SL 3UP6A 1TDQA 1PG7W 3D6GA 4I18B 3H42H 3WN5A 4YSDA 4NN6C 1NCHA 4P5TB 5EO0B 5CR8A 3SYCA 5TK4A 5EZLA 3TIEB 2O6EA 2G2RB 2ZOTA 3TEYA 1XF4B 3FH8A 3HC4L 4P23A 4KKQA 3IMRA 2YFOA 3LZRA 2QV2A 2YIHA 1YO4A 4YBQC 1OGAD 3ISWA 1BD2B 1A21A 4N8CL 1YMHB 1JZ3A 3S8GB 1AR1C 1MCHA 2XQYA 4PRNA 3N42B 2AV1A 1MPAL 3SJVD 3BP5A 5IQMA 1BZOA 5GRJL 1NBYB 4KKCC 5K33A 2LU7A 3L6FA 3QUZB 32C2A 3TWCL 4QOKE 5CCGE 3HNSL 3B7SA 4Z9KB 2EEFA 5C0CA 1MEXH 1HYRC 3QRFM 4F8TA 4KJPC 3K2MC 1MRFL 2CO7A 4W81A 3MJ8B 1VFOA 5C0GB 5IEHA 1N67A 4X98B 3L7EA 4NQED 2J72A 4GXFA 1TQVA 5GRZA 1MCOH 2AXHA 4Z76A 3QI9B 4GW1A 3MV7B 1IVLA 1IGML 4JM2A 4OQTL 4KWUA 1Q0EA 2WWMC 3CPLA 2W9DH 4XCFH 4A1RA 3EJQA 2Q3AA 3MRCA 2ODIA 2NUTB 4KXBA 1JMZA 5MENE 2XWJA 3MRQB 1ML0A 4M61A 2IAMD 4X4XA 3U2JA 1QPXA 5HSFA 1UJ3B 4UTAH 3IKCA 4ZOAA 4NDMA 2OS7A 4YGAB 4B0MM 1IGIL 4IKLA 3QXAA 3V4VH 1AKJB 3RY5A 4QRUB 3IBOA 5FR3A 4PJHA 3HLAA 4BK5C 3K0YA 1HKLL 3KWWB 1PMYA 1L6PA 4AQ1C 4PRIA 3QJHA 5CS7A 1AYRA 5I1AA 4OZIA 3LTVA 5KVDL 4PJ5B 2CO6A 5JXAL 4PR5A 3KPQA 3U7WL 1NFAA 2BOBB 4IBZA 4S0HA 4N8CH 4EIUA 3OKMA 4ZO7A 3KHOA 4POZC 3QEQE 1BBDL 4GKOA 1S9YA 2YOCA 3AROA 3B7RL 2QSCL 3FAWA 4GRMB 4QXUL 1JZ7A 3A21A 3WXWL 4ZMPA 2H1LM 4FQQA 2B15A 3NTCL 1MWAL 4LSRL 1J9QA 1YPZB 3U9UB 4EDXB 2B9BA 3CZFA 4JFDA 5IB3B 5ESAA 1OGAB 4UZSA 1J88A 1HL5A 1NAKH 3MV8D 4KI5E 1G84A 4Q89A 43CAA 4OFYA 1BVKA 2B08A 3AXLB 1SXSA 2UY6B 3HR5B 1FL3A 2H3NB 3VXRA 4G82A 1AS7A 1H3PL 2QVIA 3UC2A 4JW3A 4OZFA 2X4UA 2GSGB 2HFFB 3LPWA 5ENWA 2ZOLA 4ANKA 2ZUQC 1NFDE 2F54E 3PQYE 1YY9D 2RCSH 1JS4A 2IDSA 3K71B 1ES0B 3SD2A 3WFBL 1X5YA 2WQAA 2Q8BH 2CHXA 5LHDA 1J0JA 4ALAC 1TO5A 3QCTL 1DSFH 2UYLA 5C8JB 2XG4A 4KZ0A 3E9TA 2VMJA 1RZKC 2EIZB 4Q97A 1T20A 3M1BA 5IOKA 2NYKA 4F91B 3NA4A 1NDTA 2IBBA 3V0WL 1ZHKB 4AM0A 4W9EC 2D0HA 4AW4A 5KS9E 3PL6D 3QDJE 1IILE 3VGGA 4OZIF 1KYFA 3G08A 2WQVA 3A23A 2AJXL 5I2IA 2WWKO 2PWGA 4W9LC 5HDRA 3RBGA 4HDIB 3TO2A 4IM8A 5EOCH 4WLCA 3VXTB 1U4FA 4PJ9B 3UTZA 5A40E 3LEXA 1LEGB 4NZ8A 5HDLA 1BAGA 4XRCB 4PLKD 4UDUB 3H9HA 4KO9A 2FTAA 1NANH 5H4YA 3TC9A 3N85L 2UZIH 4AEIH 5E03A 1A14L 4JFFE 2OL3H 1HHKA 1ETZA 2WLMA 1R34A 2FBRA 3OJDB 4M5ZH 3U36B 3PFUA 4GAJL 2X1XR 1JGLL 4HEPA 4PJ8C 1PX4A 5KW9L 4NO0A 1UB5B 3IKCB 1KB9K 1MF2L 2P46B 5FGBC 4BXVA 3FQRB 4WW1B 3RGVA 4JM0A 1P5VA 35C8L 1JNHB 2WTRA 3DHMA 4X6CB 5JLZB 4EOWL 3T4AC 1N2RB 3VSUA 2XXFA 4NQSA 1DVQA 2V7NB 1C16B 3QI9C 1HS6A 4CVXB 1XF3B 2IXQA 1KLFA 1IT9L 2BSTB 4QHUB 3HC0A 4WKZA 5DK3A 2N01B 3JSSA 1WBZB 2RFXB 3TO4D 2NRDA 5BO0D 1I75A 5KVGL 3ATBA 5I66A 3IFLH 3LN4B 3FTSA 1B4LA 5C1MB 3RP1A 4NCC1 4PJBE 3MLVH 2WSKA 3DK0A 3SDCC 1OM3H 1GJIA 2ZXQA 3UZQA 5H35B 2QKIA 3GBEA 3O0RH 4JO3L 3Q43A 4Z7WB 5A2FA 2HB0A 2MPAH 4B9YA 1W8EA 2XPYA 4JDTL 4LVNB 5J3HC 2O61B 5I1GL 3GWJA 3S35X 3CVIH 1Y7VA 3IBEA 1HL9A 1T5WB 5I24A 5I18H 3UGUA 3KL5A 5HD8C 4WU7A 3WI9A 4HVBA 3WJLA 2D7NA 3CXFA 4H8WH 4U4BA 4MJHA 1NJ9A 1Y6MR 2J12B 1X3DA 3SKNB 2IV8A 2VZ3A 4V1DA 4BA0A 1KT2A 4K9EL 5IVNA 2IGLA 3BO8B 1IBFA 1AY1L 3QDHA 3UH8A 2UYLB 5D7KD 5BV7B 4MJIB 3VSVA 5BS0A 4TMPA 3Q01A 1ZTXE 3NABH 4LSPH 3NBNA 3UIZA 2Q8AL 1JNJA 4GSUA 2BS9A 1QWUA 3E0GA 2CO1A 5SWSB 2AC0A 3FW6A 4NHUB 3WL9B 4IMKC 4XZUA 4YBQD 3NFSH 4L4VB 1GA2A 5F1KC 3W82A 1XTMA 1MW2A 3MXVH 3IPBA 3DRQB 1BQKA 1DZBA 2L7UA 4UQAA 3DXAA 5AOJA 1Y0LA 1FO0A 5K9QG 1PLBA 2NNXA 1F45A 3AGVA 2MTPA 5KG9A 2Y7QA 2HTLD 5LGKA 2BSED 3PU7A 5DLML 5C97A 1E5BA 3WUZA 4FNSA 1NLDH 2BWQA 2YKKA 3H9SB 4PI0A 5BRZA 1R0AH 1SDDB 5INDB 3SGEH 2F53A 2CIKB 3V55A 1P7KA 4HK3N 1G7HA 2Y06L 5AZEL 3JTTA 1OAQL 3LX9A 3GI9H 3D51A 4JHBA 4N0FA 3WV0A 3WNOA 4BK4A 5B38G 3TJEH 4GKLA 1Q9LA 2X4OB 5ADPH 4XE0A 1NAMH 5FGBA 3V7MA 1MUJB 1UWGL 5E8DL 4WEUD 1UD5A 3L3KB 1U8JA 3QXDB 4QPEA 3WKQA 2WV3A 3AY2A 4BDVA 4YIQB 2E4FA 3DJ9A 5GRWA 4NKOA 2W0KA 1XMEB 5MI0B 1A9EB 1NFDB 2F54B 3DBXB 4GB9A 4XPBH 5TK2A 1G4RA 3FSWA 2CUIA 1W72A 2J73A 3Q8FA 4KI5C 5HHOA 4OGYH 1NL0H 3PE9A 3QFGA 5DYOA 1J0KA 1SY6L 3KLHC 1XGUA 3P30L 5J12C 4L4JA 1KC5H 1JZ2A 2DEXX 4J3VA 1I4FB 3UACA 1IQWL 5FUZH 4ENZA 1EGJA 4NYLA 4DN4H 1NCCH 1H9VA 4LKCA 1UH4A 1IGFH 1T2QL 1SVBA 5JIHA 3PQYA 3T3PF 4AT6B 1ZY9A 3O45A 3EDDA 5ADOL 1GPOH 2EUXA 1UCBH 2I32A 2NXZB 3QWRD 1EZUA 3SPVB 4WTZG 3LH9A 2FR4A 4R7NA 3FO1A 1UGNA 3AFLA 2WVUA 2G9KA 5GRUL 3RVWD 3ECUA 5AALA 5ISZD 1D6EB 4AQZA 3GMLB 2X09A 4FQXD 4PJXF 4PPTA 3TBSA 3MA9L 2FWOB 3SZKC 4XWOC 4R7XA 1QR1B 1ZTXL 1O75A 1E90A 3CSPA 3F7VA 3I6LE 4NZFA 5C0BA 3VMOA 3J07A 4L3CA 1X9LA 1HZKA 1A7RL 1SEBB 1E65A 4H40A 3GRGA 1FZKA 1I8KB 1PIFA 4LNVA 2L7JA 3UJJH 1CXLA 3HZVA 1AFVH 4NNXA 1J0YA 3MJ7A 4F1SA 2XICA 1UGKA 3HZYB 2MMXA 2VSKB 2VXVH 4OFPA 2JI3A 4IHBA 5DJDA 3PHOB 2A83B 1VKXA 4JMNA 2UV3A 4GBXC 4XGZA 4V11A 4W9DC 3U1SL 3MLSL 2ITEA 2XWTB 4FQPA 3WS3A 5AWNL 1TQSA 3VVWA 1FG9C 4ORGA 2B0SL 4ORZC 1ZVHA 4XNXL 3GSVA 4XCFL 3WLWC 1UWFA 5F0MB 4QR7A 4L9LC 4QOKB 1M2VB 2WYHA 2Q86A 4I3GA 2ZJSL 4DP6X 3TA3A 4MQ7A 3MLTA 4ZQKA 1BZ9B 4AV0A 2GCYB 1BREA 3VXMA 1D2OA 3T2QA 1J9SA 2KZKA 3VUAA 2QT6A 3QFJB 3JWNE 4PREB 4Q7DA 4GRMA 5CZKA 5EO9A 1IEAB 4JUSA 3Q13A 3RL1B 2KLSA 4KK5C 3NCJH 3VFSB 1F3DH 5I15L 4QHNB 5LUMA 3F83A 3R8BB 3NCMA 5JHDA 3D18B 3M8OL 1MW3A 3FJTA 2VLKE 1P5UB 2DKUA 1NEZG 2CM5A 1TJHH 1H5BA 2YLHA 4HYTB 1UJTA 1A7RH 2X4PA 3SPCA 2DEYX 1A7QH 5DFWH 2ZYSA 5A7EA 3GMPA 5ABAA 2X7LB 2E7CA 5CEZE 2VLJD 3ATEA 5E2JA 2IANA 4GT0A 3MMEA 2VM4A 4Q74A 3IFOA 5CEXA 4NC0B 1J8HB 1E5YA 2B7DT 1E4XI 1IAKA 1K5WA 4AGMA 3UTSA 4M8UA 1CL7H 1YEIL 2N4IA 1KN4L 3A0OA 1B9ZA 3L3IA 4ZXBB 5AG8A 2FR4B 1KPUB 3UBHA 4BGLA 2VQ1B 2VLLA 1N9PA 4LCWE 1UTDA 4YAQA 3DRQA 3WIHL 1UKTA 1J8RA 4ODUA 5DSCA 1SOSA 5J11C 3HIZA 3I50L 4JZJB 3LRSB 4YLBA 3QUMH 4OM0L 2VDNL 4X42A 4P2OD 3U6RA 4CA4A 1YYLH 1KTKE 4LMQE 1HHHA 3GRWH 3DV4B 3GSOA 3PNRB 1GZPA 1I7TA 3ILQD 3QUYA 3MNVA 3NP3A 3UDWA 1YEEL 1UUSA 1XR9B 2EXSA 4V2BA 1E2WA 4JZNA 1FHGA 1O9WA 2OJZL 4Y4KB 1EGJH 5I1HH 4H88L 3RX8A 5AB2A 2NX5B 2Y06H 5AZEH 4UINL 3BJLA 2D73A 3JZYA 3MREA 2A4ZA 2WBJA 2CCWA 3IAQA 4OD1H 4PB0L 5I8KL 2G5UA 1OAYH 4DPRA 2HLEB 3F2LA 1LP9E 2O5ZH 4DKEH 1FZMB 1NBQA 3NP4A 1N5YL 2XKSA 1I7ZB 3HMXL 4YXKL 2OMYB 3GS7A 4FABL 4Z77A 5LNGA 3FBKA 5M95B 2A3TA 3SGJC 2DQUH 3VWJB 3W56A 2EVFA 2E9IA 4K2UH 1T1XA 1PLCA 5HYJA 2WUBH 1RMFL 5ETUA 4KK8D 4Y0GA 5AOKA 1BM3H 3ZQXA 4XXCA 4YGVB 1OAQH 4DOHE 2Y1AA 1G7PA 1VZIA 4QI3A 5TE4L 3S8FB 1O9VA 1Q0XH 4E5XG 1MHEB 3SB3A 4I3RH 3U82B 5C6TL 4BKTC 4W9KC 3QR0A 1N59A 1MLBB 4JJ5B 4X99B 1Y0LB 1R5VB 3QCVL 4HC1A 4MA1B 3TA3D 1PY9A 5KG9B 1MRFH 4WI8A 1NUGA 1Z9OA 4DVRL 1NGZA 3P73A 3FTUA 1ZDQA 4ENED 5B7FA 1OTUD 1DJHA 3NOIA 1N64H 5E1QA 5FYKU 4NUJB 5AFAA 2WJ5A 4JFDE 4PHZA 2A99A 3SDAC 3WIHA 3PS6A 4N2OA 4A2DA 1W80A 1FIEA 3OL2A 4NP9A 5L88H 3X14A 4K07A 5EEVA 3LKSA 1CGUA 6TAAA 4GKNA 1CF1A 1FGVH 4Y4FB 3TVMC 4JM2D 3EH2A 2NPLX 1ZS8B 3QXDA 4UOZA 2JJSC 1T3FB 3DA0A 5IVOA 1KYOJ 3KH3A 3RU8H 3H9SD 2CR6A 4YPGB 1RULH 1J86A 5HI4C 1S2EA 4FP8L 5HYFA 4WO4A 2C9PA 3QUHA 3VGDA 1HHGB 1P9MA 2QHRH 3TYFB 1QHPA 3G6DL 4H8QA 3GB7B 1L6ZA 3ZMEA 3HNTL 4QAWA 3K46A 5HY9A 5L7XL 3IJSB 4RGND 5D1ZD 4M02A 4EI5A 5EG6C 4XXWC 4ELMA 1BW8A 2DICA 3MGAA 1XB3A 2XX0A 2GC7C 4PTTB 3S3CB 3I3DA 4OUUA 4WI4A 3Q8EA 2C3VA 3B43A 2XY2A 1N8OE 1FNFA 3C6LC 2I9TB 2R0WH 3UMNA 5MHSD 4GAYA 3ECWA 3RTQD 2KPWA 4NQDA 3UPRA 1BYOA 3VB8A 5B3JF 4JL2A 3QP3A 1PFCA 2Y6SC 5TD4A 3NGBC 4OZGB 4WU5B 3P02A 3QAZC 3B5GA 4MA8L 5AUMA 2W60A 1PGRB 3TBBA 2DQFA 3B9KC 3NN8A 4KJWD 4Y19E 4CVXA 1CDGA 3SDDD 3N1MC 1S7TA 1X5JA 1SDDA 1R9FA 5MEOB 4YSCA 2AEWA 1HFUA 2OZ4L 3VG0H 2C9RA 2MNUA 2R39A 4K9EC 5BZZA 1GYVA 1RVFL 1FNSL 3QA3B 3U6XS 1MFCH 5H35A 1BQHB 2V6HA 2EEXA 1U8JB 1A4CA 2GEQA 3TN0A 4FJZA 2WLYA 4JG0L 4UMGA 5EUOE 5PCYA 1EV2E 1R3HA 3ARDA 3V5DB 4DGVL 4X80H 1ZV2A 2ZCZA 3DX6B 5FWQA 3UTSB 2WIIA 4IK6A 4AGOA 4AMKL 2V7HA 1CICB 2CLZA 4OLYH 2VDKL 1XGTA 1CXIA 5J1AA 3G6JB 4UTBH 2H7WA 5AQ0A 2AQRA 3DARA 5IIEB 1QFWH 4HGKC 2OKMA 4QRFA 4RGNB 1BZ7A 4QRQA 4ZBJA 4FNLL 4YSRA 3MRIB 2IV9A 2BP8A 4G5AA 4G8FB 3C60B 3QDJA 4HLZG 4X9GA 4FQLL 2XBZA 2VAAA 1OSPH 1F90L 2GITB 4JHAL 2GW5A 2BNRA 3GSNB 3VGAB 1R6VA 3HA0A 3QNXB 1KJ3L 5DQDL 3W9EB 3DJZA 1OXYA 1Q0YH 2JJSA 3V6OA 4FLQA 5E2UH 5F7EH 3A6CH 1QA9A 2VIRB 2A9DA 1QYGL 2XTLA 1F11A 1DANU 1UWXK 3Q0HA 3WHE0 2Y5TA 4MYWB 5BRZB 5KAQF 4G1EB 5D5ME 1GSKA 3NFNA 5IOPA 1QFHA 3SE4C 3FHQA 5DJ6A 3HZMA 4JDEA 5DGRA 1MJJB 4P2AA 3DO4A 2Q7YB 2K6ZA 2R23B 3NRPA 2VJ8A 3NIFE 3R18A 5GZOD 4HKBA 3D2UA 2VMDA 3QDMB 5AVVB 1A1OB 1RUAH 1TZAA 1OF2B 1YC8A 3CHRA 4F93B 1OE1A 1KGIA 1MCPH 2FHBA 3UROR 4R2GB 1TFHA 3VCLA 5DC0A 4AKPA 3THML 2XVLA 4HZLA 4ZYKB 4IBUA 1WA1X 5BV7C 2VE6A 4KKLD 2AXGB 1FCCA 1V3JA 4XCEA 3FB5A 3B9KA 5IT2H 4MD0B 3LMJL 4YFLI 1XAUA 1CC3A 2EIBA 1JF1A 1IM9A 3KGTA 4MNGB 3ZE0F 2Z7YA 5IB2B 1KGCE 4WJG3 5EU7C 5JZ7D 1IJ9A 1C7SA 1UA7A 4OGXH 3HMXH 5L2KE 1P4IL 1WQVT 3KVDD 3LSOA 1PKOA 4RETB 1WEJH 4DSYA 4GT7A 3ESNA 1DEEA 3AWGA 4LBAA 2PTTB 1KB3A 5E99H 4FDWA 2QGDA 2P4AB 3H3PL 4X50A 2CBMA 4ICWA 3M17A 1XMWA 4XWOD 1SVZA 5C6WH 3IFNH 2CBQA 3MRBA 1IAIH 4LXFA 4FFZL 2KT6A 2DWEB 5IEHB 1WFMA 5DURB 5C07B 2ID5A 1U3ZA 2VN4A 4BFIA 4LOVA 1JDCA 3K6SB 4Z76B 5SWQB 3GS4A 2QLYA 4DPAX 4JFHD 1SQ2N 1ZVYA 2XN0A 3II2A 4XNBA 3D0AA 5I15H 3BVXA 3ROOB 3QJVB 4DCQA 5KVEE 3S88H 2YAMA 4YDMA 4U6XB 1OE2A 2EDXA 3S6CA 2R29L 3HI6L 1O6TA 4GUQA 3BUTA 5ALBL 3T71A 3C6LA 4WGVB 4G43A 4H1LH 3CZEA 5TDNB 2FECL 3KS0H 1A1MB 1H8NA 1QHOA 4Y5XB 5FGRA 4ZNCD 2NY5L 3WO3B 1MWAB 2VO8A 1XX9C 5E51A 2GJ6E 4OLWH 1FL6B 3QG7L 4FL4B 3BGFC 1UVQB 1RZ7L 3NDYE 2GB2A 4G8EA 2ZF9A 5EZLB 1HEZA 4JFDB 1L0PA 4JFFD 5AW5B 3TEUA 3QPXL 4K5PA 3HC4H 4XOAA 4MKMA 2I24N 3OKDB 5FA3B 1IBBA 3DX7B 5FXCH 5L8KB 1AJ7H 3EO0B 3QQ3A 4JB9L 4R8WH 5DTFA 15C8L 5KANI 2XFGB 4FYQA 4FYTA 4HKZB 4IQHA 4GO6B 4PJBF 5D1ZI 4DO4A 3EOTH 1UXMA 1H6FA 2HVKA 5ENWB 2FX7L 4KTGA 5IHLB 2NTFA 2D2CC 4DGIL 3NEXA 3EHBB 1OAZH 5DD6A 1MDTA 1O0VA 2WLLA 3ILPA 4IOFD 2E86A 2WVVA 5EU5B 3ZZSA 3MLTB 2DYPB 2YPLD 1EVTC 3ARWA 2FL5B 2VLMD 4K4KA 5HYSA 4YBHA 2QPFA 5DQJB 4DP8X 4XO4A 1OANA 2AEOA 1BOYA 5TF0A 5EZIL 2AKRB 2DQHL 3QJFB 4NQTA 3KPLA 4HBQA 2I7OA 2LTQC 4LCUA 2A77H 3CDCA 2XZZA 4XVSH 3D1MC 1IGJB 4R26L 3ES6B 5CN2A 3CPLB 5T5NF 3KCPB 3VRLE 4ZG1A 4LLDB 4O00A 5ICXB 4JFEE 3TFKD 3MRNB 3JYBA 4AG4L 5E8DH 1ZPUA 5KAQG 1X5GA 2BSRB 3VD5A 5DO8A 2GJZB 1KC5L 3AU1A 3BMVA 5JQIB 2ZSWB 2FATH 4NSKB 1MIMH 3EJZC 1AXIB 2JLLA 3ALPA 5FM4A 1A4JB 1KTCA 2VLRE 5DEFA 1AKJA 1E42A 2PW2A 2YAPA 3RGHA 4AIZB 1BIHA 5AAWC 2BP8B 3U4EB 4TUJA 4D0CA 3ILDA 2O5ZL 2XPGB 4IOSA 1GJUA 4W9HC 5E4IA 4H26A 4OQTA 1MLBA 4X99A 1ZLSL 1EO7A 3L5XL 4LSVH 4BKLB 2K6YA 2B1HL 4PWGA 1NCDL 3EJCA 2JJVA 1UEYA 2VLJA 4J3OF 4QRAA 3EJTA 1KJMB 5D9SB 2O30A 1X7QA 1IGFL 1YEWA 1RZ8A 3GLEA 2NR6D 2J88H 3P4NB 1MFVA 1WC7A 3IXTA 4Q9CA 1WYJA 3FFDB 3O4LE 3B8SA 3BRGC 3UJTL 3GSOB 4PJXA 4XXDA 3VRLF 5HHXH 3DECA 3DX6A 4FCAA 1T1WB 4AQOA 2LLNA 1SMAA 4RWYL 6PCYA 2AQPA 3FN0L 3AS2A 2NXYD 2XN9E 2WMPB 2BZ7A 3SDCD 1ACYH 4Y2OB 1KLFB 2BSTA 4QHUA 1BVLA 2E6PA 5JORB 2FGWL 3QUMB 4YSAA 5KEZA 3B2PA 2CRZA 3PRZA 4HJ0C 2VDLH 2NXZC 4MA7H 4Z7NF 2QZQA 1X5XA 4X6BA 4AYFB 3VFRB 3HRZA 4FULA 3DRTB 1N3NA 3NCJL 4TVPL 1RJZB 4E41D 5ESQB 1ODUA 4PVLA 1F58L 2OCFD 3CU1A 4K8RD 3M1BB 4JFSA 4KO6A 1SUJA 4JCWA 1IAOB 1E67A 4OD3H 1LP9B 4ZXBD 1FIGL 3ETBJ 5I6PA 5BV7L 1PIGA 1U8OA 3MRMA 4LHUD 5IUCA 1LTXA 2ZQKA 3O3DB 2E7BA 3UO8B 3QIBC 4M4RA 1KGUA 1AZUA 4DKDC 4P4RA 4UQBA 3PNWB 4FZ8H 5HGHA 1RPUA 1ZDSA 2BHUA 5EOCJ 1F8TH 3E1F1 2DMGA 1BD2A 1U8MA 2NR6C 3I6GA 1SOXA 3F12A 3SPHA 4DPBX 3DX0A 4TVSa 2DQEH 5ICZA 1S6NA 2VUYA 3MUUA 5ID1A 2GI0A 3QZBA 1FSKC 2ITDB 3BSHA 1BVKB 1OW0A 1AZZC 2ESVB 4F37K 4NERA 2EDWA 5DHVA 1KV3A 2YZ1A 25C8L 1P4LA 4AM0Q 1E7VA 3QULA 4OZHF 3MCYA 1XQ4A 2B9AA 3A6BH 3S3JA 3QQNA 1N18A 4Q9BA 4P4KC 1K2DA 2NUPA 3VXQA 1ZJAA 1IAIM 1IM3D 4TTGA 2D0GA 1CFTA 1JPTL 1N8ZB 2B4CC 3RAJH 4AQEB 5G55A 1B3IA 4MAYC 2MOVA 2J8UA 4LARL 2OMXA 2PWDA 3OWEA 2XACC 4P48A 1A9BB 4Y9BA 3GLZA 1YY9C 1G4MA 4L1BA 5BQ7A 1EPFA 3CQQA 3GSWA 2C4FT 3NA9H 1UYWH 3Q05A 1FNEB 2E27L 3H2WA 5EOCL 3RKPA 1BHGA 2ARJA 5IB1A 1T66D 3LV3A 2WW8A 1RQ5A 3F84A 1JIBA 1JK9B 2CJUH 2DPKA 2X6VA 5C0AD 3P0YL 1KN4H 1YEIH 1KCLA 2DTMH 3EYSL 4TUOB 2WXIA 4M43L 4NWTH 3V4PB 1UWEL 1NDMA 3KJ4B 2D9CA 4IEFB 5JIKA 5EIIB 3HE7B 2Z92A 1V7MH 2HT2D 4R96A 2W65A 4LHUB 1SRDA 4RRPG 5FFLA 1DQDH 1J9CT 1R1CA 2CA4A 2IPTL 4HQQH 2AITA 1QSFA 5DD0L 3X3GL 3L6FB 1JZ8A 2IAAC 4XO5A 4ZUTA 4OD2B 3RI5K 4QRRA 4UQIM 1BPVA 2VXQA 2OMVA 3BVDB 3L3OC 3U0PA 1NQBA 4X0KB 3M6DA 5T3ZH 5TDOB 3NGBB 1P69B 2PO6D 1NEZA 3QO0B 2IAMC 2YOAA 2G2NA 3QEGL 1PLGH 4GAGL 2KQNA 3MNWB 1X4YA 5CLYA 3EFFA 4PV8B 3FQRA 4WW1A 5K5YA 2KYIA 4FEMA 1YYCA 4GLRH 4L1DA 3KVQA 3X12B 4YS4A 4PJIA 2KERA 3UYOD 1JVKA 1Q0YL 3G3LA