1O9ZA

F17-ag lectin domain from escherichia coli (ligand free)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
177
structure length
170
Chain Sequence
AVSFIGSTENDVGPSLGSYSRLPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSSRYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17-AG LECTIN DOMAIN
publication title The Fimbrial Adhesin F17-G of Enterotoxigenic Escherichia Coli Has an Immunoglobulin-Like Lectin Domain that Binds N-Acetylglucosamine
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lectin
total genus 45
structure length 170
sequence length 177
ec nomenclature
pdb deposition date 2002-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1o9zA00
1OIOA 2BS71 1ZPLA 2BSBA 3F64A 1O9VA 1O9ZA 2BS8A 4K0OA 3FFOA 3F6JA 2BSCA 1ZK5A 1O9WA
chains in the Genus database with same CATH superfamily
1E6OL 2IALB 3TBVA 4TKWA 1ZGLP 4YXHL 4X7DC 4WTXA 1ICTA 1BD2B 1IT9H 4Z7UB 4TQHA 3IGUA 3CPUA 2D7OA 2OJEA 3FH8A 4LBEA 3TJHD 1H19A 4LHUG 4DH2A 1I9RL 2WXMA 4UYPA 1NFDF 2ZYHA 4RX4A 1MW3A 4PSRA 2JCCA 1UA6L 3FT4A 4EO5A 4NM8H 4Z7NB 4AL8C 2TRHA 1PAZA 3DPBB 2BIQA 1WC7B 3DV4B 3K1DA 3PGDA 2BSDA 5D2LE 4J27A 2X0VA 5EEXA 1A1MA 3W56A 1J8RA 1G9ML 3N1GC 4TVUA 3I3DA 1ECZA 2IMMA 1HHKA 2DWTA 2CCWA 4I2XE 2VXQL 5FYKD 3IK2A 2W94A 1CB4A 4JQXA 4JR9L 2X1XR 3PPEA 3NIDF 2DM7A 1EVTC 2CPCA 2VH5H 3LZRA 1NEZA 1L7IH 4HWZA 3ALXA 3MV11 3DSFH 4M48L 4WF7A 5HD8D 4PRPE 2OMZA 3P1VA 4M6OL 3VFTA 4TVPH 4HT1H 4Z7QB 1G7QA 1S7SB 2M83A 1UA3A 1N5YL 4L8DB 2E7CA 4P3CH 5DWUH 1OAUH 1SVZA 1E4HA 2X4TA 3OJDB 2PXYD 5FGSA 2GSMB 2AJUH 4X6BA 5F7WC 2L7UA 3MGTB 3LEVL 1YUHB 1S9WA 2E8YA 1OALA 1UD3A 4WK2B 1ACZA 5KVEL 4CJ1A 2J8OA 1MH5B 5D7JB 3I85A 5I23A 1F45A 4Y4HA 5JQHC 2WLLB 2CLZB 2WINB 1RUAL 2AS5M 4KKZA 3C5SA 3CXHJ 3R8BB 3SY0A 1NEZG 4IRZH 2A9NH 5KVDH 2VO8A 1IU1A 5F44A 3F83A 2VLJD 4QRSA 5K9OA 3EFFA 5K59E 2ZG2A 2ZPKL 1LP9E 3QUYA 3ARBC 1FNHA 3CU7A 3G5WA 4IOIB 2EH8H 1JZ4A 5DS2A 3RY4A 3RKDD 1E4XL 1UUSA 4R0LA 4YHPB 4RIRA 3QZMA 3JXAA 2VZ3A 4Z7UF 2HX7A 2NXYC 3QQ3A 1CGSL 3M1OA 4IMKC 1L6ZA 1Z0MA 3RU8H 3MFFA 5I71B 1UZ6E 3LMJL 3VW3H 4J2XA 4H8VA 1NMAL 2NQDA 3MLRL 1HS6A 2X4OA 5D7SH 4ZTPL 3TM6A 4W9KC 4AIEA 4HALA 3RY6A 4KO7A 3MJ7B 3QFDA 5IBTH 1CDJA 4L3ED 1HYSD 2NW3A 4NAQA 4ZX5A 1TF4A 3UTZB 3MCLH 1Y1DA 3JTTA 2JWYA 4K9JA 3GHEH 4TLSA 3MRCB 1RI8A 1N18A 1AQMA 3CBKB 3W3BA 3KNBB 2IAND 2J8UA 1KIUB 1G7JB 2XWTB 3IAPA 4TYUA 3SBQA 1KIRA 1F3JB 4J3OC 3MCKA 4LEXH 12E8L 1LL1A 1INDL 1OTUD 4OCXH 4XTRD 3ULVC 4IIQA 2AZAA 2BRRL 3HI5L 4HWBH 4AH2A 1UM4L 3BKCL 3SDAC 4HJJH 3B9KD 4FZEL 4PRDA 2B1OA 1R5IB 2WWNA 2F7RA 2WOBA 1NDGA 3VXMD 4NC1E 4LSQL 4ENEC 2O5XH 1GYAA 4DSYA 5L8KB 1NCDL 3QS3A 3LRKA 4FFZA 4XWOC 4AG4L 1ZA3B 4DEPB 2WLYA 2Z7ZA 4F27A 3A23A 1E67A 3QFJD 4NHCH 4IBVA 1CD8A 4MAYB 1AR2A 4E9TA 3AU0A 4DP2X 2R2BA 3EO0A 4OCYL 2A4CA 3SOBL 3ARDD 1XGRB 2DQEL 4DPCX 4PCYA 2B08A 1I7TA 2F61A 4B5ZA 4X4YB 2CRZA 1A7PL 1HC1A 3GSNL 4OF7A 1NFKA 5DSCA 4X9YA 3RVXC 1SBBA 5DJXA 1R0AL 4HKJA 2VXUL 1GTNA 2PPEA 3MR9B 4XMKL 4CNIB 2GHWB 3NCWA 4JQVA 2QADD 3HRZA 3B3BA 1EAJA 4NPKA 3Q7JA 1CJYA 4FLSA 4H0IA 3QIUC 3MLTB 1E4WH 4BXSV 1KCRL 2JXMA 3GSWB 1I7ZB 2PTTA 2EDXA 3BC9A 4HK3J 3EHBC 4U6YA 3FF7A 3TBTA 4LOUD 1H8OA 3ZXAC 5EOQL 5M94B 3T6XA 2FL5A 2NY4C 5T1DH 3D06A 1TZHB 3L5XH 5JHMA 2ORBH 1HQ4B 5ISZB 2VN5A 2X4NA 4TNVK 2UZYB 2X6VA 4Y5XA 4PGEA 4DF9A 3ARGA 2ITEA 1OCWH 3BKYL 4WU7B 3HHSA 4HIEB 2IGFH 1CICA 4Z0BL 2IOMA 3LKSB 5DF0A 4HIPA 1K8DA 4NB7A 3FB6A 3TO4C 1CS6A 1HH6A 1G1KA 3ELAT 2HFFA 3BFOA 3VYPA 4YMPA 4XB8A 4JY4A 2YK1H 4BBWA 3QT2A 4RQQA 5I1EL 4YXLH 4HPYL 3UACA 1S7UB 4X5RA 3ZTNL 4GG6A 2VAJA 2WXJA 2BPBA 5T3ZL 2G9KA 2ZJSH 3F64A 1KXHA 5H94B 1NOFA 5DC4B 1ZDQA 5FK9A 1EXUB 1FYTB 3L13A 2X42A 4OGAD 4KAQL 5D70H 1D7DA 4C54A 5HYEA 1YMHB 3HE7D 4YDLC 3QG7L 5KUMA 5I1KL 5LGHL 3WIFB 1BVNT 3SKMA 3CQQA 3DECA 5FM5O 2WNWA 1BREA 3BN9D 4YHIB 3GDCA 5GJSH 3K8LA 1J5OH 1O6VA 2M26A 4PLKC 3T0VA 5A1AA 1VERA 2AXWA 1HZHL 5IW1A 1OF0A 2FJGA 1FCCA 1QEXA 2EEDA 3L4ZA 1RIUL 1SEQH 2C1PB 3WENA 4NYLB 4WI4A 5F7HA 1E50A 4H5SB 5MEQA 1MLCB 4Y2OB 2YMOA 4G6MH 4M8RA 3V6OE 2X4SA 3MV8E 4HBQA 2VUKA 1OCCB 5HGAB 3QZNA 5GGVH 4CDHA 2YEZB 2J1KA 3FBQA 3CHXA 4P3WA 3O6FB 1TTCA 2CCVA 4HS6A 5TK2A 4D0BB 4UTAA 3RNQB 1SUHA 3QYNA 2FSEA 4Z3JA 1KTJA 4JJHA 3K8MA 3FB8B 3FTXA 3MKGA 3HC0B 3K91A 2HB0A 4PGDB 5DD5L 4BFIB 5A2IH 2NY0B 1F4YH 2VZ1A 2V5TA 3IPEA 3GSQB 3MROA 4IU2A 4Q58C 3UTOA 2UZIL 5C0RH 4E42B 5C86A 2CALA 3B5GA 1JDDA 1PYWB 43CAA 1UH2A 3FCTA 2DWDB 2BSSB 1WK0A 2HG5A 3GNMH 3HAEH 4QF1A 2MQ0A 5T8IA 3DVNA 3IXAB 5C0CB 1RK0A 4KTYA 3NIGE 1DVQA 2LFEA 3GXTA 4MZIA 5CLYA 3MNZB 1L9QA 2OMXA 2EP6A 4ETQB 3SO5A 4XMUA 4EDWL 2C9VA 2JIXD 2FTAA 4EN3D 1GGIH 2APWA 5EO0B 4DTGH 2VSCA 2WWKT 4LLAA 4ZDHA 3TCTA 4O00A 4Z18A 3WS3B 1NEUA 2WM0A 2WXQA 4KKBC 2KKQA 3MLWL 3DO3A 2VLRD 4N6RA 5G4OA 5HYJD 4IBUA 1LE9A 4LCWE 5L2KE 1AGBA 1JF5A 1WLHA 1ZGLB 5F3BB 4Y1AD 5IB4B 1G6RL 3NFPA 2D3LA 4NZTL 5EOCH 5DQJA 4B3EA 1QSZA 4G7VH 2WANA 3IJHB 1U3HC 2I25N 4HAFA 3IGAA 1OP4A 5I2IA 3OKOB 3WL9A 3OD3A 3HUJA 5D2NB 3FOMA 3PJLA 3V0IA 3S37H 3US1A 1JGUL 4FQ1L 1DP0A 4CKVX 2VABB 4UV4H 3NZUA 5CR8A 4HFUL 5FYJU 1DBJL 3VXOA 4MYPA 5F88B 3ZIMA 3HBZA 1SPDA 1X7QB 4LP5A 4MZ3A 2GIXA 3SPVA 4PJXE 3O41A 2XG5A 3F05A 1ZEAH 3FCBA 3QUMA 5DJZB 4MXVE 3CUPA 3CVCA 3UTTB 3CVBA 4XMWA 5CJQH 5C08D 4RMBA 3F2LA 5HVHB 4IGBD 1J7VR 1S7QB 4OZGB 4OZIE 3KPTA 1WCBA 1CGYA 5AUMB 4JZNB 4PJAB 1EHLH 3SGKA 3O6MH 15C8L 1WGVA 1FH5H 2NQCA 4KU1A 4N2FA 3ZE2E 1V7NL 4LCUB 3CLWA 2OTPA 3ORJA 3DI2B 1BFSA 3P3UA 1A66A 2P9RA 2WCSA 3VGHA 2GQHA 5IJBC 2HJFA 5L88H 1VHPA 3QJOA 4A2GA 3K71A 4ALAL 1PLGH 4BM7A 3DUUB 2QFPA 5I16A 1UH4A 5IHHA 1KEML 4ANXA 1WF5A 3LQMA 5KVFH 3F84A 5D71H 1EPFA 3IDGB 3Q8CA 1U8KA 1E3XA 3PWLB 5FC9A 3CFEB 5KYXB 4Z7VB 1KIQB 3RTQD 1E5CA 2B2XH 4ZO8A 2EYTB 1J05B 3NCYS 1TQSA 2CK2A 3NCJL 1NCAL 1W8EA 2FD6H 4G8FB 3UTSA 4F15C 3FPYA 1A5FL 4FG6C 4NNYA 1OAJA 2WW8A 1J11A 2ZKWA 5IGXL 2J5WA 4CVZB 4XC3L 2J55A 1A9VA 1FFOB 3AXLB 4UQ3A 6PAZA 4EIZC 4K5PA 3ZR5A 2NZ9C 4YPGA 3QDGA 1XF3B 3T4AA 4Y16A 1OAXH 4BWWA 1CFVL 4APXB 1NCBH 5C0DB 4QRFA 5F1NA 4UQIM 2CKBB 2RIKA 5PAZA 2XETA 4NP4H 2DH2A 4N0FA 4PVLA 5E03A 3RP1A 3VDAA 1CI5A 1MJJA 4JHUA 4GRWE 2J2ZB 2NTFA 1BVNP 1FFTB 3MYZA 1NPJA 1S7WA 2Z31B 3QJQB 2EO1A 5I6LA 1X9QA 1P5VA 4I2XA 5JW4R 2ZZUT 5FYJH 3BN3B 4N68A 1LXMA 1MVFA 2OKMA 1R3LA 1OSPH 4WW1A 1FO0A 3QORA 3EH2A 4YBQC 5JW4M 1JNHA 4U1GC 3T3ME 4RGMB 4PRPA 5DJDB 2YKLL 5IM7A 2DQDH 4MAUL 2JI2A 3AWFA 1NUGA 4NKOB 4JJOA 5B3NA 3JQOB 4PJAF 1T83C 3U46B 2V9UA 2WXIA 3P69A 5HDRA 3WMQA 1R47A 3MUGA 3US9A 3T8VA 3VI4E 2M2DA 3D34A 1RV6X 2L7JA 5DI8B 5HPMB 3V52H 1NC4B 5A16B 1L9MA 3FQNA 4PB0L 5CBEA 5I8OH 2FAUA 2AMGA 2J6WA 2G4EA 3CU1A 1F2QA 2ADFL 4J4PA 5I1DB 1XXDC 1LMKA 2LT9A 3QI9C 3MI6A 4MA3A 5EZOL 5DJCA 2VDPL 2DKSA 2MJWA 1OAYH 4MSWA 5AL0A 1WT5A 3UBHA 1LP9A 2EH7L 3REVB 1CK0H 4YL4A 3GT6A 4MXWL 1K2DB 3O8XD 2WXLA 2L8AA 1P1ZA 2W07A 5EUOF 2EEAA 4P5MB 1LEIA 2R0LH 3Q8AA 1F0LA 1NLBH 2Q5BA 3FMGH 4KVCL 5T1LB 5TDNB 2OQJA 3NJNA 1A6WH 4FL4B 4ABVA 4YHYC 4BZ1H 1P5UC 4JKKA 4KHTH 3MBEC 2AVGA 3RBGA 4PPTA 1HH9A 3K6DA 4X7TA 1MI5B 3BE1L 3V79C 4QHKI 4Z77B 4KX9A 5B1KA 4A67A 4R83A 1TIUA 5CWSB 1CGTA 3SKJH 1FZJB 5FYKE 4ZMTA 5F7EL 4OUUA 2IDSA 4YGVB 2P1YA 5HDBB 5IOKA 1T5KA 5IHLB 1E2WA 1L9TA 5FKAA 3LCYA 4FQXC 4NQDD 4OJCA 3NIFB 3VWJC 4P0DA 1H6UA 1HEHC 4GRLB 2ZUQC 4LLMA 3TL5A 4X4XA 3QEUB 5IQ7H 4Z7IA 1NL0H 5EBGA 1EA9C 3T77A 4XPGH 2BHFA 2N1TE 1BQUA 3G7TA 5C0BD 5E9DD 3D25A 4IKLA 4JO4H 4YGAB 4HUVA 1P4BH 1T66C 1A3LH 4JFPA 4LLQA 3CH1A 4YN3A 2FWLB 2QMKA 1NCGA 1G1YA 3BMWA 4FEIA 3L3KA 3QPXH 4XH2B 4APQA 1DVFD 3N0PB 1NANI 4DW2L 1LE5A 3LZQA 5TFSH 3CDZB 1N64H 3E8UL 1MAMH 1A6AA 4NJAH 5E4AA 4XN7A 2BNQB 2VXVL 1ZT7B 4G59C 2BOCB 1C5CL 3G6JE 4WWKA 4AQ8C 5SWQB 4JHAL 4XX1E 5GRWA 4PHZA 4EKXA 4EVNA 3PP4L 1DL7H 4JFED 2VLJE 4A04A 5AKVA 2CHNA 1N7MH 3GO1L 3T5WA 3A4DA 3H7BB 1LEKB 1D5ZB 1MLBA 3QJTB 4K7PL 2JJSC 3LNFA 3ARFA 2WIIA 2KHAA 3WNIA 2G2PA 2ZT9C 2DRUA 4PV9B 4MMYA 3RFZC 1AQKL 5BUAA 2XWJB 5DT1H 2LQRA 1I1AA 4XN9A 4WO0A 3VXUB 5I0YA 1M1XB 1YEEH 1L4IA 1CE1L 1LGVA 3SDXF 5EU5B 2CO3A 3L95A 5I1GL 2WNGA 2YRBA 5GGRY 3QH3B 4M8UA 4X7FC 2CHDA 4L3EE 1ONQB 4OGYL 4ZD3L 4ANWA 5JZ7D 1KYUA 4J39A 2YRLA 4AM0A 5TQ0L 1URLA 5FO7B 3QIBD 1H3WM 2XI9A 2IANE 4X9FA 3VH8A 4HD5A 1GXEA 4NBXB 1KDIA 2YRZA 5DURB 4MB1A 1KNOA 3NCMA 3QNYB 3C2SA 3NIFF 2QSCL 1E7UA 5JUEL 4OIBA 3ZTJG 4W9JC 4F7KA 3K72A 1T1ZA 3IDYC 1ZS2A 2XDHA 5E94B 4AEEA 4PJ9C 4Y1TA 3DX9B 5CP3A 2AK1L 1RZKL 2IC2A 4NS0A 4PP2B 5GGUB 3AMLA 1KYFA 5DYOB 3VXME 1ZTXL 2W5PA 5HP5A 5L8JB 2PF6A 5ALBL 5AB1A 2YGNA 4YNYA 5KG9B 1QTYT 4PRHD 5IREA 3K0WA 3KHQA 3QFJE 4GW1B 4PJGB 5GXBB 4BV1A 2ZCLH 3D3VB 3MRHA 2HTLD 1J12A 3D87B 3ZDYE 4A7GF 4X8XA 2CLVB 1BQHA 2NDFA 1FL5A 1ZXKA 2H5UA 1Z3GL 4P5KB 5GHWL 2OI9B 4M9PA 5CIPA 4U1HA 4CADA 3ECUA 3L2LA 4KY1L 1IGIH 5J1AA 4LCVA 3P4LA 1HXKA 2IGLA 3Q2CA 3O2WL 1OTTD 4QRBA 2QZ5A 5L0QC 3HTLX 3L6FB 1U3NA 2ZSWA 4IEFB 3V6OA 4A6YA 3MV8A 4OTXL 5L7XH 5KTEH 1BPVA 2DIAA 3OJ2C 5A6LA 2IPTH 2Y2YA 2BNRD 4K8RC 3IDIA 1SNRA 5BMFH 5JW5A 2MOVA 2JLPA 3GSVA 2I07B 2BXZA 4F33A 4HPHA 3RVVC 1LWRA 5HI5C 3OL2A 3MRLB 1DVYA 3WYRA 3V0VA 1SEBA 2EJ1A 2XKNB 5C8JB 2GSIB 3LKNA 3WU1A 2FVNA 4RMQA 4KI5C 3DDFA 4OCWL 2OR7A 3Q9PA 2C9AA 3II2A 3FKUS 1TITA 2JJVA 3DOSA 3BAYA 2OMBA 3IRPX 2X89D 4G43A 5CJXA 2FQDA 2HVKA 4U3XA 4O2EA 2GHZA 4AW4A 5HGBA 4MDIA 5GS1A 1FV1B 4XBPB 5HHPA 1RVFL 1H3UA 3IN2A 4GJTB 2IFFL 3B83A 5DC9B 3FJTA 1NWOA 3WS6A 1TJGL 2B3IA 3FFDA 4YVUA 3BUYA 2CDFA 4QAWA 4HBCH 4ZUUA 1KG0B 3WJLA 4LCWA 3Q2NA 3ZL4L 4MD4B 5L2KA 1KN2H 5CP7A 3MRRB 4ZS6D 2DIJA 3X1GA 4UTAL 3ULSA 5EORL 1XGTA 1QLRA 5IROC 1T0MA 5DDHB 4FFWD 4CGTA 5IB2B 2X9ZA 1BXAA 5FYLL 2WBKA 4EI0A 1Q1JL 3EYSL 4LLUB 4WI0B 4UWQB 2QQLH 4L3FA 2D0HA 3AG3B 3LZNA 4KRPC 5I82A 1N4XL 3AADB 3H4FA 4ELKA 5C0JA 3HC2A 2ZCHH 3DOHA 3F7VB 3H9HB 4JLRA 4XBMA 3SJVB 4HH9A 4JPKL 1IEBB 5DVKA 3N44F 4PJXA 1YHPA 1HZLA 3P0VH 3BZDA 1KB5H 3FT3A 3OPUA 4ZMLA 5J6HA 3WKMH 1VSCA 3ECVA 4PJBB 2C7UA 5DQ9A 4GAFB 4NFDA 2Z4QB 2VE6B 4HF5H 2AQNA 2UWEE 2H8PB 4MMXA 3HZYA 3GBDA 1FLTX 1O6SA 5EIQA 4OZIA 4ZPVA 2EYSB 3FAXA 5AW6B 3IJSA 1SLXA 4XCCH 5KW9L 5I1JH 1S9VB 3CDGB 3JWOH 3QC5X 3X3GL 1YMMB 1DSFH 4TUOB 3HRPA 1SJHA 1EIBA 2LE9A 3FYEB 2RB8A 1JI2A 4KKRA 1DEEA 3HEIB 4ZO6A 3AG4B 2YGOA 4M1DL 4TTDD 5GRJH 3UADA 4DN3H 2V9TA 3ASOB 1DZ0A 1EZLA 3WEOA 3P11H 3RA7L 3S8GB 1MF2H 1VFBB 5JHLA 3SZKC 4AK1A 1MG3C 1TZGH 4Z3HA 2E6PA 4KDTA 3AITA 4LPCA 4ZPTB 1XCTA 4S11A 2O6PA 3R7QA 4LPXA 4PR5B 4CW1B 3VFSA 4I9XA 3QUML 4DGUA 3TNMB 4X5WB 1KSRA 4GP5B 4IOFD 4NOBA 4PN6A 1AZVA 5ISZD 3GZKA 1KXVC 3V4VH 5HYJE 3GLEA 2VLRE 1BBDH 2MNUA 2XY1A 3WFBL 1XIWA 1H5BC 3MV9D 3ZTEA 4FHKA 1OAQL 4DFIA 2B5IC 2R23B 2X4PA 1D6VL 3B56A 4GMTH 4L8SA 4MASA 1DSYA 4Y1AE 5EU3B 4HS3A 4UOW0 4HHAA 2R69A 2XWDA 4N8CL 5C70A 2R0KH 3CZUB 4OM1L 3JWNH 4L5FH 5E1AB 1KBWA 5J3HC 1RP9A 3DUSB 1TDQA 1GSKA 2OTWB 4HWNA 2B8OT 5HHXH 1MNUH 5IR1B 2NY3C 4P4RA 2IAMC 2OMVB 4XVSH 2GTWA 1IFGA 3FDWA 5J8OA 3R4DA 4W9LC 1Z9NA 3MNDA 4ELME 4ZQTA 3ZQWA 1F3RB 3TT1H 2P24B 3QQDB 3OJMB 3DJ9A 4YPJA 5AB9A 4GIOA 1IGJA 4TSBL 3N41F 4A2HA 2KLRA 5CN2A 3C60B 4HHWA 1PGRB 5I8CA 1C16A 3U0TA 3WMSA 5C08E 3QPQD 5I6NA 4HIHA 3DIFA 1SFDA 2NCMA 3QIWC 4L29B 1F4WH 4PJBF 3T8MA 4CC1A 5CILL 3H2WA 2ZXGA 1Z5LA 4G2AA 1EDQA 2ZYRA 4QTIL 1U2YA 3RGVC 4ES9A 2J56A 3WN6A 3IJ9A 2WCPA 4MTMA 1ZANH 1QBBA 4NNPH 1GYWA 1WAPA 1Q0YH 2A9AA 4JCMA 3FHQA 1MUJA 4DP4X 3W39A 5SWZD 4X9HA 2AEWA 3QCTL 3D18B 1NBVL 4WTZG 1BAFH 3S3CB 3FT1A 3L3JA 4XNAA 2VMDA 3VI4A 3PWUB 4RAUA 3ZBMA 3C08H 1RSFA 1JGIA 2OR8A 2Y4SA 3H3PH 3WCYA 2OMTA 4DERA 1LO2L 3O6FD 5D72H 5KBKA 2YLKA 2MMXA 1J9RA 2BH0A 3GB7A 4K55A 4OU3A 4MLSA 3CXDL 3U0WH 1OGSA 3TU6A 1YN6A 3DTXA 1NCTA 1G0XA 2FYYB 9CGTA 1J8HB 1G0DA 1URZA 3UYPB 1PNDA 4OKVB 4AXWB 1T20B 4DUWA 1CU4L 4KMTH 1CGXA 1T5XB 1BVLA 1FO0L 3HI6L 1PSKL 2CIKA 5I1LA 4HPOL 4N0CD 5C0CD 2D03H 2VR5A 4JCLA 2A73A 3HW7A 1MCCA 1E8ZA 5DRWA 2FX7L 3BUTA 1QFOA 3BP6A 4KO6A 3KPRD 5GJTH 4XMVA 1N8ZA 5C3LD 4PRIB 1HXMB 4AIOA 5IVXB 2OW6A 3RBSA 3FO9A 1XF2A 4M62L 3KVQA 4ZNEE 1I9IL 1AMYA 1QR4A 3LN5B 4NRXA 5DVMA 5MERB 1OTSD 1GPOH 5SWSB 4HOZA 2F19L 2PPDA 5AVQB 3STLB 3QCVL 4M6NH 5ADOL 1KN4L 1KGCD 5B22A 2VDOB 3FQTB 3QHZH 1I8MA 4Q9CA 3ZE1B 1IVLA 1H3TA 5F9WC 1F6LL 3I9PA 4LVEA 3H9SA 3D48R 2AV7B 4FYRA 3SGDH 5F1IA 3EGSA 5F9JB 2AKRA 1JD9A 3S3PA 5A3ID 1DQMH 4A2MA 1IGTB 4P59L 3ZE0E 1TVBA 2OFQA 2E4FA 5E2TL 5CEYB 3F04A 3OAYK 5DC2A 2EVFA 1AI1H 2O5ZH 3TEWA 3GK8H 1FNGB 1QLEL 3BIAX 2XWRA 1G7IA 2XN9B 4N25A 2IDCA 4KVPA 1ACYH 3FQ4A 2PXYA 4HGWB 1A8ZA 3QQ9C 3EBIA 4AENA 2BIMA 5M7QA 1OLZA 3H4HA 2KZBA 4HUNB 3T2OA 2X44D 3QUZB 1ZTMA 3WIHA 1ETZB 1MHPL 2HT4C 1GZPA 1PKQE 2A1WL 1QACA 1Y6KR 2DM4A 1ZCRA 4JHVA 4NN5B 4RRPA 5DJ2B 4YDJB 5IHWA 2GVYA 2GUOB 2GTZA 4NAMA 1RZJL 4R90L 3O0RL 1S3RA 1HHGB 3TX4A 5JDSA 3ML9A 4C83B 1NKRA 1YRKA 3Q2WA 2F54D 1WQVT 1X7TA 3VGAC 4DZ8B 3ARYA 3P3TA 2Q3ZA 4XE5B 5GSRA 3DTDA 3CDYA 3G6JA 4PJ8D 3MLUH 3D3VA 4XMXA 2PWGA 3W9EA 4EI5B 3G5VA 5J1SC 4GEJA 4I77H 2VLJA 3D2TA 4CMHC 2A4EA 3DGGB 1KT2A 3X2QB 4OCSL 5LXGH 3FUIA 2NY7H 3F01A 2PMZA 3RIFK 3QZLA 3QNFA 5C2BL 4KPHH 4BFRA 1RPQA 2KMWA 1CDGA 2P5EB 3NG5A 5IVXF 4GG8A 5IMKA 3QULB 1MKFA 4FG2A 1DQJA 3EAKA 2JJTA 3K6OA 1SUJA 4ACTA 5EZIL 3HMWH 4WGWB 2DZEA 3DA0A 3IFPB 3WELA 2IAAC 4L3EA 4QRQB 2X1QA 2QELA 4PGJA 1NFDE 1LQSR 1U30A 2JKTM 5E95B 1T3FA 5JMOC 3ILPA 4PJFF 3FBKA 3N0AA 2XRAL 2IANA 3VFVA 3QZWB 5HGHA 3NA9L 1UENA 4NQDE 1KYDA 2V17H 4FMKA 5GRVL 4WTQA 4YHLH 3WIIL 5C0IB 3BH4A 3GXDA 1PG7L 1A4KB 1RHFA 4XNMA 4XMTA 3NIDE 4JRYB 3BWUF 5IMLA 1UHVA 3B7RL 1T0NA 2DYRB 2WLKA 1GKEA 1PDKA 1VRSA 2QKIC 3EJZD 3NK3A 5E9DE 5C0BE 4LE8A 1MPAH 3PJSB 1KENL 4MD5A 4I3SL 5BVJA 2EE9A 1M42A 1WWWX 4GSXA 2DQUH 4B0MM 4HUXB 3WKNA 3INUH 3KYNB 1JZFA 3AREB 2DWYA 2P5WD 3SDDB 5JR1H 2DLFH 3K4AA 3OZKA 3QFJA 5IQOA 3BEVB 1CYXA 2DWEA 3FQ1A 3MRJA 1MQ8A 4D0DB 5IVOA 3PWVB 4HXAH 4D8PA 4YFLF 2WPGA 3EIFA 3LQAH 3LZFH 3VXPB 1JWMB 3ARDA 4FG0A 5LWYH 4WO4C 3Q5YA 4DQOH 5CD5D 1PX3A 4OFKA 1AGDB 3I6LD 2NMSA 3MLYH 3KLKA 3MRNA 4JREB 2DTMH 4RISH 4JFEE 3LKRB 4ONGH 5CZXD 5IHZB 1MCQA 2GJ6B 4L4VD 2B7DT 1WO2A 3G6AA 3P77A 2OJZL 4GXVH 3TV3L 5TE6L 2FBJL 3TN0D 1RMFH 4P9HH 4KVNL 3TZVC 4PUBH 1SDAB 4G6FB 2XTJD 1A14H 5FO8A 2NYZA 4DHLA 3T3PF 3MYJA 2EINB 1GYVA 1JPFA 4KRMB 4KKCC 1BLNB 3FUMA 3F00A 1TJHH 1XF5B 1ZK5A 1R5WA 3NACL 4XN5A 4CU6A 3W5MA 1O7DE 2YAMA 1FC1A 1OO2A 4DO6A 2J21A 4BQ9A 1M6OB 1UD4A 4FAAB 4MCYB 1BWMA 3V4PA 1FNAA 1OPGL 1P7QD 1DQKA 4XBGB 4XP4L 5E8NA 2IADB 4PD4J 1UA7A 5F7KC 2MQ3A 1IGMH 2FO4B 4D9RD 3OPZL 4CU7A 3IKCB 1E6JH 3WDHA 1J9SA 2EDKA 4CL7A 3IU4H 4JFFB 1XQ4A 4MNHA 4P2AA 3MLXH 1GYCA 1YLBB 3D9AL 3KPSB 5I8EB 3L5HA 3VACA 3PL6D 4XXWA 2J44A 2FO1A 1YNTF 4FTDA 1TLKA 1MNNA 1Z9SA 3BPCA 3LRSB 2IDQA 4LNRA 4POUB 5I6OA 1RPUA 3MCYA 5LGJB 2O6DA 2TRYA 4NSKA 3ZLQC 3GHBL 4PGBA 1G7MA 5CSGA 2EDYA 1KIPB 4W6YB 5IT2L 1AFVL 3IGKA 1GY1A 3ZZ1A 5JXEC 2OR9L 5DK0B 3U30B 4ZSOB 1FP5A 4PRHE 3DIVA 1TTBA 3HE7A 5ADPH 3T1WA 1TU2B 4RGNC 7FABL 2KLTA 3P4OA 3NJFA 4RZCA 5G4NA 1SMDA 2L3BA 2P28B 1J5DA 4S1SH 4M43L 3GMPB 1K5WA 5DFVD 4ESKA 2JK5B 4CSZA 1GZHA 1DBAH 1FRGL 4PU2A 2RJMA 1QRKA 3OKMA 3O3AA 3JUZA 2CO1A 1IKFL 3VI3F 4PREB 2UWEA 2NOYA 4HWUA 1FYHB 4S0TD 4OR1A 4DP9X 4IDJH 1ZLSH 2BNRE 4QGTA 3ULVF 5GS2H 1T1YA 2VLKB 4DGIL 1KLUA 3BAEH 1UD2A 1VGKB 5DUPH 2VJ0A 2AXFB 4A63A 3NFSH 2XBTA 1EO7A 4RMRA 2CBTA 3KVDD 1E4KA 3MZTA 3I02A 2VOTA 4EXKA 5CEZH 5I75B 1TQBB 1F90L 1TCRA 1OP3H 4NQEB 2FB4L 1OF2A 2QQQA 2FWSA 3EO1B 3WEXB 4DKFH 4RFOL 3KL0A 2HVJB 1GA2A 3KS0J 3DTUB 3BCFA 4YSAA 2JIXA 1MRCH 2QHRH 3DX6A 3R4RA 4YE0A 4EN3A 5HYQA 2RTTA 4M5ZL 5BW7A 4L0YA 3C6LC 4F9PC 5HYJA 2QQNL 2VLRA 4X6CE 3OAUL 2VKXA 3RJQB 3RVTD 5E00B 4O2FA 2H41A 1T20A 4FQ2H 3KPOB 3GS7A 3TJPA 1CMOA 1CN4A 3MX0B 4Y1AA 8FABB 3X1EA 3VWKA 5KBLA 1UWGL 1K8IB 5BRPA 2IXQA 3INOA 1CO1A 1UJ3A 1H6EA 3E2HB 1E6OH 1A4AA 4LKXB 3U2SA 3PPSA 4YXHH 2Y9RT 2QPSA 1OOAA 4F3FA 4JKPL 1L9OA 1KCUH 5JHLL 3VD3A 3BW9A 1EH9A 2A77L 4ELMA 1XV8A 5D1XD 3D0AA 1I3UA 1MFAH 3QNXB 1FLRL 1UA6H 2AW2A 2PO6D 3H0TB 2VZUA 3M1BB 2FJHA 3HCVA 4L8CA 9PCYA 3JV4A 1OXYA 3CC5A 4Q6YA 2Y5TA 3WN5B 4E5XA 3PNWA 1P7BA 5C08A 3TESA 1G9MH 2Q2EB 5EPMB 1MAJA 4YHZH 4Q9RL 5FO9A 1IM3B 4IGBA 2ICEB 1UACL 2ITCA 3QJZA 2VXQH 4FA7B 5AVRB 3JTSA 4JR9H 3WNPA 2QBWA 5DUML 5FUOL 1FVEB 2IPKA 3OF6D 3AWGA 4K7PX 2R69L 4ZFOA 4HAGA 2FEEI 3HAEB 4M48H 1AO7B 4P8QA 4Y5VC 2EDFA 4M6OH 2CMRL 5B8CC 3PY9A 4F20A 1Z9PA 4FNTA 4ZOAA 2RR3A 3ECWA 1N5YH 2D31A 3PE9A 4K94L 1U8QA 4DK3A 4CVWA 3TLRA 1OLLA 5C0FB 5E6IC 2F5AL 3HB3B 5ENWA 1F56A 1D5BB 1NFIB 5FM4A 1LO3L 3JVFC 3TVMD 3O3EA 2VXTL 1IEAA 2VQ4A 4LVOC 2FK9A 1W16A 5E8EA 3L3GA 3EH5B 4F92B 3DRQB 4P23D 2QGBA 5K9JL 5ISZE 5AAWA 2Y7QB 3RTQA 2AF2A 3N40F 1GS7A 1TVHB 2G4GA 3F58H 4M6MH 2YPVA 1AGFA 3MV9E 4S2SA 4WI9A 4XO5A 3ZYOA 4YSSA 1F8TH 1MQKL 4KQ4L 1A25A 4FQQA 3EFOA 4G7QB 2ZCKH 4Z7WE 3SYAA 3VMPA 1SLUA 3CSGA 1WZLA 3NH7L 1X9UA 4TMPA 4ZODA 2IQAB 4CN6A 4N2DA 3G04A 4KQ0A 4B9YA 5D4QA 2ZXWB 5BQ7B 3ULUH 2GY7B 1YEDB 5CN3A 5IHUL 1E4XH 2E9GA 4X98A 4KX8A 4PG2C 2LLNA 5D9SB 1FNSH 1HILA 1LNUB 4CA4A 3D39A 4UOJA 1RIHL 1T5WA 3A6BH 1DHKA 5JLZB 4DKDC 1BJ1J 4M7KL 1JWSA 2BVQA 1TTGA 1NMAH 1PMYA 4HZLA 4QTFA 4ZTPH 3UJTL 2FT6A 5EEUA 4P46D 43C9B 5IQMA 3IFNH 5KWYC 4YO0A 1G7PB 4Y4KD 4JM2C 3MJGX 4IRSD 2HLAB 5DJ0B 4M29A 1A2YA 1RUQH 4JO2L 5T5FA 3VFPA 1F5WA 3ULUC 4PV8B 4P05A 4JPIB 1FJ1B 3SJVD 3ZKXB 1AYRA 3TA3C 3BP5A 2VSMB 2CWRA 2VCOA 2B39A 3N06B 3P3YA 3ZYJA 5ABZA 4YDVA 3S2AA 4XN4A 3ZMEA 3SYQA 4M8QB 5SWZE 1INDH 1C5DB 4HMCA 5D55A 2CRMA 5F21B 3HI5H 2BRRH 3BKCH 2A83B 4OB5L 4K5MA 3N85L 3STBA 4FZEH 4QKXB 2Q9OA 2AGJL 4P4KB 3WUWA 1KTLB 5J6GA 3QO0B 4LSQH 1T04A 5DA4A 1PKQA 1G7LB 4LPWA 1NCDH 3KYNA 4LLYA 5EIVA 5IVNA 4J5VA 4LFHD 5EG6C 1SDDB 4FHBD 3AQDA 5FYKL 1F4AA 4TXVB 1RZGB 5CGYC 4X5QA 5KAQF 1Z6JT 1DVTA 3RDTB 3UYRL 4F7MB 2BIIA 2TAAA 4G1EB 1ZHLB 2HFTA 2R1XA 5C0CE 3HE6B 3HS0B 2H3NB 3QXTA 4FG4A 4LO9A 4XP6H 3SOBH 2PR9A 2D8KA 2W60B 4CUCA 1EDYA 3HNSL 3F5WA 2FATL 2HCZX 3QZWG 3SEPA 3TBYB 4H25A 3SPGA 4M1CD 2YQ3A 3VD2A 2WLIA 5HTSA 1QEWA 1A7PH 3GSNH 3KPRE 3BH9A 1Z5YD 3FU6A 1BQKA 1R0AH 4U33A 2XFXA 4X80L 5DVLA 2VXUH 3O8XA 3HIZA 3MXVL 1KGXA 3NABL 3SQBB 4D9QD 1Z5HA 1IGYB 2Z8WC 3UC0L 2BIPA 3THML 1DFBH 4WFED 4EZMA 1X3DA 2A74C 4F57L 1M2OA 2XSKA 4JFDD 3CVHH 5FCUL 1KCRH 3L08A 4QPEA 1R5VB 3K0YA 1JGEA 3WIHL 4H8WH 1KGCE 2KZWA 3QR0A 3WO4C 2H26B 1RJYA 4FGMA 5EOQH 5CEXB 4H1LH 1NFDA 4OIIH 2EYRA 5IESH 3I6GB 3OGOE 4IRJB 3ZKQD 2BWIA 1W8OA 1MEXL 3IXTB 4F7TB 4Q74A 6PCYA 4AQEA 1ES0B 1QQDA 4NQDA 2Z92B 3TCLB 1FFNB 2VC2L 3M7OA 1YY9D 4Z0BH 4HKBA 2C9RA 3MLPA 1LO0L 3NZSA 1JF6A 5I74C 2Z7YA 4BZ2H 2OTUA 3MRKA 5F7AA 2QQKH 4X0NA 3VGGA 2JI1A 4UI2A 3RVWC 3OAZH 5E9DA 5IVZA 5F7NC 3DWTA 2VQ1A 5I1EH 1HX0A 3KPNA 3BO8B 3ZTNH 3ZN6A 5IKCB 2GITA 4U6XA 4IMLA 1G5GA 5DFAA 5GGRA 3KWWB 3T0EC 3IF1A 1DVFA 4MYWB 5AWNH 1U21A 4ELDA 2D7TH 1Q90A 4G8EA 5DEFB 2AK4B 4KAQH 4W9IC 3EDKA 3TH3T 3QG7H 1NBYA 3PUCA 5EDSA 2F54E 4UT6H 5I1KH 4AQAB 4FN0A 5DRXA 4JHWL 5LGHH 3ZK0A 5CJBA 2R1WA 4X6EA 3FH7A 4HWEL 3MV7B 1BSIA 2Y3AA 4JFEA 1OCZB 2XACC 2W95A 4UUJB 5E7BA 3MC0A 1HZHH 1F11A 4IHBA 4LEOB 5EULV 1AYOA 2P8LB 3M17B 3FUDA 1RIUH 4K7FB 4LDLB 3RG1C 4ZAKD 1RLBA 4NC0B 4JNXA 1T7VA 2H1LM 2DPKA 4UU9B 5HGDB 4F8PA 3ZKNC 1C12A 1FORL 1XF4A 2CLRB 3IMWA 4WGVB 5F6IC 2CBQA 2PWDA 3SDCB 3WE6A 1HESA 3OB8A 5B38B 2X3CA 1TNMA 2K4WA 3DO7B 1FNLA 2MNWA 3HG1B 3U48A 1IO4C 1E8WA 3FO0H 3L9YA 5K39B 1T0OA 2XXFA 5DD0L 5EUOE 3JWDL 4GAGH 3QUXD 1AR1C 5F7YC 5HYIA 2E4TA 3BP7B 1UYWL 3GEFA 4BUQA 4Q6IC 5DD5H 1I3GL 1JPEA 1YNKL 2W9LA 5IB5B 2LABA 1KJVA 3QIBA 1SJEA 2UZIH 5F89A 3V0HA 1FBIL 4D3CL 2VL5B 1AQHA 2H2SD 4RMWA 4F37F 1FN4A 4H0GA 4KJPD 1HHJA 3LH2L 4GIAA 1I1FB 4LASH 3MXWL 2VM3A 5SX5K 1WEJL 2I9LA 4ZNCD 3B4NA 4MXQD 4RETB 4HX1B 4FDWA 3MTXA 4QHNB 4R2GB 1BDYA 4J1UA 5LCVA 4EDWH 3QO1A 2BFVL 5I6XB 3CXHK 4LSUH 4GRMB 3JT2A 3SDYL 3UCRA 3MLWH 3MOBL 1NDMA 5FCSH 5TDPB 4O02A 2Q7YB 5D7HA 1JYWA 1ULVA 3ESUF 3PP3H 3U6RA 1ZWIA 4X6DF 4EIBA 5L4JA 3BUPA 2HYMA 4B95C 3MCG1 3GBNL 1G6RH 2P5WE 1T2QL 2HMID 3KLQA 4PRHA 3OZ9L 2EDMA 4BSVA 1HJBC 4NIKB 4DNLA 4L8BA 2JNZA 2VYRE 1WFMA 1ID2A 3RZCC 3V4PL 1QRNB 1YQ2A 1TR7A 3KPQA 3N1QC 3OC8A 4M4RA 1KTBA 2YD8A 3BT2L 2OYLA 5ICXB 3TEYA 1JGUH 3DBSA 4FQ1H 3BOVA 3B7TA 4N1CA 3HZVB 4Z3TA 1Q72H 3I6LE 2P80D 4J12A 3DX1A 4HUUA 1YAZA 4WSKA 2P45B 1QKZL 4ZW8A 1CVSC 3R8QA 3WDIA 1TTRA 1UADC 4XTRC 4LDOB 2MPVA 4L4VE 4PSPA 4S10A 3STZA 4AEHL 1MFUA 2NY2B 3SB3A 1LDSA 4ODXA 1H0DB 3OHXC 3B9KC 1T6BX 1VKXA 4WUUA 3VJ6B 4E68A 4OZ4B 4CMMA 4JN2B 4ICWA 2B14A 1FFPA 2XTJE 4RAVB 2BNRA 5CR1A 4MJ6A 4Q7DA 2WBWB 2QPEB 5EUKB 1MRFL 5KSAB 1ZS8A 5GZOC 1BFOA 1AQDB 3MVSA 2YGVA 1V7NH 5KZCD 1NKGA 1N6VA 3IE4A 1WZ1L 4NRYA 4TNWF 1O9ZA 3VUAA 3F8UB 2CBPA 3EYQC 1S5IL 3KM2A 4D9RE 2QMJA 3T8XB 3SDXE 2CGYA 1AJ7H 1EEYA 3RWFB 1OE3A 5A2BA 2QGDA 1W72A 1U95B 2EC9U 2XYBA 4JUSA 5LAXB 4ALAH 1TZIB 1G1CA 2EIZB 1FAIL 1KBBA 5B1BB 2R2CA 3VX0A 4JFXA 3ZR6A 3HN3A 3QQNA 4CSTA 3APCA 4AE0A 4MMZB 4Z78B 2EUZA 4ZO7A 1RXLA 4X6CA 1INEH 3MBXL 5D1ZB 3WUZA 1V3KA 5EC2B 1HNFA 4NQCD 4HCGA 3QJVB 4Y4FB 1F58L 2FGWL 1NCAH 3AFLA 3VD1A 1KYOK 2FCBA 5IGXH 2A6KA 4MX7A 4XC3H 5DRZB 3DX7A 1XH3A 2IBGA 3ARBD 4WJ5B 1CL7I 3NJKA 4YQXL 1NBQA 1FH2A 2VR9A 3D85B 2BS8A 1QTPA 4OZHB 5E23A 4AKPA 5I5JA 4NI6A 2WB7A 2NXYD 1QSFB 2CHWA 4JE0A 4X99A 2O61B 2VW6A 1R9FA 2EE0A 4JDEA 1GJUA 2VRKA 1NC2B 4R84A 2NY6B 1MJUL 1QZ1A 2FEEL 3ARED 5JOPD 5GS0C 3QJSB 1MVUA 1SN5A 3GSUA 3NGBB 1T89C 5BS0D 1HEZB 2NTSP 4AGOA 1MOEA 5C7XL 3QYMA 1DBML 1KV3A 1U3ZA 2B1HL 3VRJA 4QRTB 1WISA 1EK3A 1LMIA 3MREA 1BZ8A 1HHHB 3VRIA 5ACLA 1BJ1H 3GZPA 4MQTB 4ADGA 5BXFB 1BX2B 3MGAA 1LO5A 4N3UA 5AYTA 1B4TA 4EN2A 4XXDA 5FGCE 4J3OD 3UZEA 1WBZB 4FYQA 3QQXA 4MAUH 4OD2A 3GKWH 3FUEA 3TBWB 3D69B 1KMGA 1JXGA 1N10A 4FXGA 3ULVD 2JKNA 4DGWC 2IH9A 3SDAD 1YY8A 4FTVA 1J1XL 4LF3A 4EI6B 1KCWA 2UUDK 1OW0C 2F7PA 4Q0XH 1TSHA 4I0PC 4ENED 2QT6A 4EXPX 2X2JA 5E99H 3ZSSA 4X8JB 3L7EB 1WZKA 2DICA 4UV7H 4URKA 3REWA 3C5ZC 4DGYL 2Q6WA 1M7UA 3PDOA 2P8MA 1T03L 4JRXB 3GM0A 2VKWA 2EDNA 2I26N 1RURL 5D7IB 1Y0LB 3MV9A 5T1KD 1OGAD 2D9QB 1HVXA 4MBOA 4P2CG 3S34L 1SMAA 2ADFH 4UM8B 2YGPA 4Z7WA 4B7LA 5J12C 1B88A 2NY1B 3O9WC 4TM9A 2DQTH 1PG7X 5DJ6B 4ZFOL 2GCYA 5C6TL 2A2QT 3RVXD 1K9TA 3SHSA 2VDPH 3TIDB 2DQFB 4HAKA 3A0OA 2AQTA 4PI0A 1XR8A 5ID0B 1T1WA 1OE2A 3IB4A 2EQDA 5CMAB 3T04D 1LK2A 5BO1L 3O4LD 1DBKL 1KB5B 3QIUD 4PJ7B 2YJQA 3WNOA 1MAKA 4OZHF 1R3HB 4KI5F 4MJHA 5D1XE 4E41B 1IBFA 2MPAL 4I48A 3EHBD 4KVCH 4PRNA 3U0PA 1SJXA 3T1FB 2EIDA 3OC5A 1DE4A 5AZUA 2GABA 1LD9B 2NY4D 4JGUA 3L7FB 1ACXA 3LXAA 3BE1H 3A67L 4HK0A 1THCA 1P7KA 2YPVL 2WO4A 1QA9A 4KNSA 2DEYX 1HKLH 1VZGA 5F7EH 3K6IA 3UGXA 4NKIH 3OKNB 5I1HL 1G1OA 4P2OC 3PV7A 1UWEL 2D7NA 5EU6D 4OLXL 4OLZH 4PVNA 5FA3A 3CPLB 4KKQA 2ZD0A 5SWZA 3BXNB 3ROOB 5KBMA 3RWGA 2X0WA 5BV7C 4PP1C 4LPVA 1VACB 3SE4A 4OFYD 3EFDL 3VTAA 1HCZA 5A40E 2R83A 2VZVA 4XOBA 1NAMA 3O3BA 4RA0C 2FLMA 4X0KA 1BG1A 4QYOB 3Q44A 4O5LL 3GMQB 1DUZB 3V4VB 2BFGA 2FH8A 3FSZA 4WUKL 2PPAA 5A7EA 4X7SL 2WBJC 2AJVL 3PWNB 1SXZA 4PRBB 1JN6B 3WTUA 2P8PB 3W9DB 2PWHA 5I66A 2XNAA 4MS6A 4DW2H 1NFAA 4PJCB 3A4FA 3GUTB 2BZ7A 3E8UH 3QG6B 4GQPH 5T5FL 3UOAB 2A5UA 1IRAY 2Q76B 1KY6A 4QHKJ 5KJ7E 4L9LA 1U9KA 4NO3A 3PHOA 4IIZA 4PLKD 3BUBA 2F58H 5GSVB 3S6CA 1RZFL 1C5CH 4JHAH 2RAMA 5EIIA 3KPRA 4NBYB 4ZMNA 1ZVSB 3MRGA 4KZDL 2PW2A 1G7HA 4UBDC 1A7RH 4K7PH 1GS6X 3FFCB 1ZV9A 3WHXB 4Y2NA 1JVOA 2ENSA 1IC4H 3FB7B 4RWHA 1CXFA 3ISWA 1AQKH 3D0VA 2FT8A 4LL1A 4N24A 5HSFA 1WWCA 4IYKA 5BVPL 4MA1B 4PJ7F 5D6DC 4HIQA 4FFZH 4Y0GA 3QRLA 4HIIB 3L1FA 5AW1B 5IV2A 1CE1H 2VR7A 4ZXBC 2Q20A 3CSYA 4OGYH 4PTTA 1MN4A 5CBAB 1U8LB 5L4IA 3FQUB 2JMRA 1QBLL 4N2GA 1AGEA 2VJ8A 5ESQA 4Z6AT 3SJVE 1XZ0A 3OSVA 3U2JA 5H35A 5JYLA 4M61B 5KSBB 5E4EB 4JZOA 5EIIG 2HRPL 4JFSA 4JANB 2H32A 2X6BA 4MJ4A 4PJBE 3LXBA 2YOAA 3PGFL 2QSCH 2FWOB 4EUPA 1B0RA 4ANVA 2YEQA 4KKBD 1KCSL 5DS8A 1WBYB 3DX8B 5C07B 3GBML 3IU3A 5T3ZD 4KUZH 3K2MC 1CXLA 4UANA 2AK1H 1RZKH 4EZKA 1L7TL 3QBTB 2XQBL 3J2PA 1ZTXH 1OM9A 5ALBH 3O2VH 1JMXA 1MHHB 3AU1B 1U3HD 2IDUA 5ESAA 4N1EA 3O45A 1TFHA 2DYPD 4ONOA 1OAKL 2DKUA 3U9PH 4TUKL 2ICCA 3VXNA 5I15L 4L18A 2BXYA 1A3RL 4PJ8A 3RWCB 4PJCF 1NCIA 2G3MA 4KK9C 2OP4H 1U93B 4WNQB 2MCAA 4B53A 1Z3GH 4OSUH 1NMBH 5GHWH 4XP9H 3WFCL 3DHPA 4KY1H 1OARL 5DJ8A 3DBXB 2O30A 4Z3IA 5FB8B 5EBMA 1OSZB 1D7CA 3IJEA 3ZRSA 3O2WH 1S3KH 3ZKMC 3CDFA 3EYVB 1GZQB 5D96B 4G8IA 4D9QE 3ATFA 3G5XB 3GXIA 2BJML 3NRQA 4LCYB 4OTXH 4P5TA 3BLPX 2EEFA 3BI9X 4AV4A 4WFEE 3LYRA 4BH7A 2PCPB 4JFDE 2PCXA 2ZX9A 3C5JA 3BPLB 2CHXA 3FRPA 1PX8A 4XC1L 1YO4A 5EUOA 1P84J 4NQXA 5EUKA 2DH3A 3HZKB 5IFJA 3B5TA 5H2BA 2YUWA 4W9HC 3ATEA 1K4CA 2Q8AL 4N2KA 2QJDA 4OCWH 2Z9TA 2DQIL 4GINA 4OLUL 2XBZA 4QCIB 4BEIA 3JV6B 1M7IA 2X70A 1RPKA 4P5SA 1KJ3L 5E7FA 4J8QA 2YBRA 4W1TA 3CHOA 1EZVX 1RVFH 3MRQA 4UQ2A 4PCSA 4JFUA 2I7OA 2E7LC 2IFFH 4B9GA 5I5MA 1XWVA 4UINL 2XA3A 4H8UA 1KXTB 2YAFA 1TJGH 5ITFB 1N9PA 1WBXB 3A21A 4C4KT 3MRPB 4MB4A 2FJUB 2XBDA 4PJEB 2ZWZA 4FG6D 5FS5A 3RWIB 4UMGA 5A2FA 3PABB 1UUNA 2P5WA 5ICZB 4UTAH 2Y6TE 5EORH 3RHWF 5T3XH 4TL4A 4A2DA 3L3OC 2FJFA 4DO4A 4M5YH 1FC2D 3TH2T 2B20A 2W0KA 2G2NA 2NZ9D 3WY1A 4R96B 1GOGA 1RQ5A 1CGWA 1OGTB 4OCRL 4DVBB 1NQBA 1Q1JH 3EYSH 2DQHL 3BIKA 1Q4NX 4I18B 4AIZA 4XO4A 5JPMB 2HKFL 3U7YL 4UQBA 1N4XH 4N8UA 1A4CA 4R4FH 4L1LA 4JL1A 3IS0X 3QDMD 4L4VA 4C4KO 2Y06H 4JPKH 5FUCE 1AD0A 4F9LA 1MFCH 4KBPA 4H26A 5LCVL 3TN0A 5ACZB 3CSBA 2CO6B 1T1XB 4DP7X 5EC1B 4JVUA 1ECYA 3R7RA 2C3XA 2NYKA 1UKTA 3AY4A 35C8H 3FK3A 4WI3A 1R3KB 2VWEE 1ODAA 2AQ1A 4TQEL 3ZDWA 4Z95L 2PP7A 2DQCL 4YBQD 4LKCB 5E5MB 5ETUA 2R0WL 2P26A 5KW9H 3CFDA 1OQXA 3GRGA 4PJIB 2EE2A 2KQNA 4GI6A 2BC4B 4WU5B 5HDOA 2XWBB 1USQA 5CD3A 5GGSA 4JDTL 5JO5A 3MO1B 1BM7A 1U8JA 1P7QA 1TJIL 1YN7A 5LN4A 4BUGA 3LQZA 5JPNB 2AAAA 1A6VL 1MJ8H 3C8KA 3FONA 5GIRA 3DARA 4M1DH 4B7IA 4MD0A 3SDXA 1MHEA 4UB0H 4F7PA 2FZ3A 3RA7H 4OT1L 1JZGA 5GRUL 1Q9LB 1QP1A 3LY6A 5JORB 2G2RA 1UQSB 1VADA 3PL6A 1I1YA 3DK2A 4PJFE 1CL7L 1QHPA 4AQ1A 1Z7JA 3ME0B 1S7VB 4Q9QL 3LNEA 3QUMH 4M7ZC 1D6EA 2C26A 2Y2TA 1UB5A 4GKNA 3EDEA 2EIBA 3FU8A 4RFNB 2NLJB 1OQOA 3EOBA 3APDA 3QI9D 4ZFGL 1RULL 1P4LA 1SJVA 1OAQH 3OR6B 1WPCA 3IMVA 3Q6GL 5DWPA 2JJWA 3O11B 5IZ7A 1J5HA 1D6VH 2WKOF 4PJEF 3L3DA 3W0WB 1HDMA 1IFHL 5AVTB 2WUCL 4JG0H 4DZBA 2R56L 1J86A 3BKMH 3NN8B 4KMQA 5ILTL 1Z9LA 4NN6B 3I6SA 4FX5A 1UWYA 5AVSB 2QLVB 4YHNB 3BVVA 4JZJA 3K6SB 1N12A 1W72L 4UAOB 3SGEH 2OMWA 3MRIB 3MLZH 3MBED 2ED6A 2WSPA 3QJUB 4FABL 2AK4D 4FQCL 5EO1B 4LSTL 4A7GA 3I75A 1W0WA 2VR4A 4TSBH 2VN3A 4YX2H 3P54A 1A9BA 4CVXB 1TTAA 2Z34A 3H2QA 1V7MH 5IMOA 1CG9A 1B0GB 3MRBA 1PZ2A 4XNZB 1MCSA 3UBXB 2NNRA 3BT0A 4PJHB 4FQXD 5CILH 4G8GB 3RL1A 1J8SA 5IY5B 5LAPA 3VWJD 4QTIH 1USZA 2ENPA 1XSIA 3KL5A 3WY4A 1FNEA 4LLDA 2H6PA 4Q6KA 4UDUA 1NGXB 1WA1X 3T3PE 3S3DB 4DO5A 2K4AA 5EWIH 4J8RB 1B4LA 4QEGA 3ESMA 4GSUA 1EWHA 2WTPA 5J7CC 1T66D 4NWTL 2GFBB 5JQ6L 1MY5A 2AC0A 5LO7A 2NDGA 1JV5B 4OH2A 2NX5D 2R1YB 2JI3A 3Q1EA 5D7JC 1XH0A 2EDBA 1E8XA 5FUZL 1ZHNB 1M2VA 3X3FL 2OL3A 3CXDH 4JDVB 5L6YL 2FO8A 3FQRA 4W4OC 4EDXB 4QHMA 3D05A 2K9FB 5HJDA 1OCOB 3K4ZA 3G6DL 4F2EA 1CU4H 1QI5A 5FHBH 4M02A 5KYUA 1D9KA 2VN4A 1FO0H 1UCBL 1PSKH 3HI6H 4NQCE 3LKOB 2WWOA 2XU9A 3VTMA 1IKNA 2VERA 5DHXB 3P4MB 1CE6A 4E9RA 3QEGH 4DGVL 2FX7H 2YD7A 2PNDA 3ABZA 4G7YH 4Z0XB 3KPLB 2Z7WA 5BUGA 1RJLA 1T22B 2OXHB 2EEBA 3QNZA 4FYTA 4U1MB 1F86A 1I9IH 3MMEA 3NJMA 4K3DL 5I71C 3PFUA 1CCZA 1EMTL 4OF0A 1N59B 4NQVB 3WHXA 1MG2C 3DMMA 5ANME 2F19H 2OCCB 4PGCA 5D1XA 4E9WA 2PO6A 3QCVH 4K73A 2MQCA 4JFYB 3HNTH 5JOPE 3H1ZA 5ADOH 5CZRA 1YEHH 1KN4H 2F6AA 4OAWB 5BS0E 3CX5K 5EU7C 4L37B 4DPAX 3SE8L 3V0EA 4ZMWA 4ZS6C 4QWWC 2OSXA 1JMZA 1AP2B 3GMLB 1I7RB 3N91A 3BX7C 5JW3H 4I3GA 4OVUA 1G9NC 5B3SB 2W9EH 3OF6A 3VI3E 3JWNG 4PLJC 2ARJB 5A2KH 4LLWA 5DEGB 2PLTA 3WSQL 5I30L 1NANH 3B3IB 5L9DH 4U1JA 4MWFB 2RQ8A 1Y6MR 4GKZB 3MJ8A 2X53A 3ULVE 2WQXA 3N9GL 1NTDA 1QLEH 4PJ9D 3TWCH 1M05A 3BEWA 1EUTA 1IC5L 1A1NA 1D5XB 1EJFA 3KWVA 4DEPC 3TVMA 5J6SA 2AJ3A 4OZFA 3P0GB 3GMMA 2BVEA 4MAYC 4JY5L 1CLOH 1AXSA 4P23A 1MHPH 2A1WH 3U1SH 3KYMB 2ERJB 3Q48A 4POZC 4AJ0A 5B1JC 4WVRA 4WCYL 1RZJH 4R90H 4TS6A 3O0RH 4FCAA 4Y5YB 3V95A 1OGAE 3QUGA 3V5KB 1QR1A 2YQGA 4W81A 3EBHA 4HZAA 1KDJA 1DLHA 1KTDA 2KL6A 2ZWKA 3Q8FA 4MJ2A 4CSSA 3P30L 3P02A 3O3DA 3VMOA 5C9KA 4GW5A 1WHOA 3E6FA 2K6ZA 3UZQA 2UX6A 1AKJD 1CDYA 4OCSH 4OQTH 3BZEA 5HY9B 1BGXH 4JHBA 1UT2A 3O4LE 2NUTA 3QZBA 5D1QB 4NFCA 1KWGA 5C2BH 2ZWNA 4PS3A 1MCHA 1CTNA 1NAML 1XL4A 2FQEA 3QDJB 3QWOA 5D7LB 4K8RD 4LIQE 2PN5A 4UIMA 1WICA 5CJ8A 1OY3B 5DHVA 3SE3A 3T65A 4FFYA 2L7EA 1KBGL 1ODUA 4IJ3B 4LK4A 4M00A 5DGRA 3Q0HA 5CUSH 3RVVD 5HI5D 3K2IA 1HHIA 4XGZA 5IW6B 3GXUB 2AJZB 3ES6B 3CFMA 1W0VA 2IOOA 4JY6A 4P46A 1IQDA 3FO1A 2JVUA 5IF0B 4KXZI 4QT5B 4Y4KA 1DYZA 4IRSA 3LKPB 1W91A 1E28A 4KI5D 4AYFA 2HKHH 1KJ2A 4KITB 1UM6H 2V3EA 3LV3A 4JFQB 3FTGB 2V37A 2K7PA 3K74B 2XRAH 3F7YB 2BP8A 2J1XA 2Q3XA 3QFGA 5C0AB 4PVBA 4TQIA 3NA9H 4B97A 2QGCA 5EU6E 5LB1A 5DHYB 4BKSC 2Q7AA 3HN8A 5F0JB 5GRYA 2N7AA 3VFUB 3WIIH 4BWUA 1OK0A 2N3JA 2FIKB 1N0LB 3ZO0A 2AERT 3T2NL 4FXKB 1ZHBA 4LARL 3G9VA 3S88L 2A9ML 2DLGA 3GQFA 4P3DA 2W92A 3DXAB 2DIBA 3G5ZB 4QIRA 2EKSA 1XGYH 1XEUA 3HZMB 4NZ8A 4AZ8B 4LGRB 1FE8L 3A6CL 1RZIA 4I3SH 5CS7A 5FLVA 4HLEA 1U8HB 2YD2A 4JFHD 3ZUCA 2I9TB 5TQ2L 3SKOA 3LZLA 4DP5X 2VUYA 4ZX6A 1TYRA 3D09A 5IROD 1N26A 1MFEL 2RH0A 1A21A 1LYQA 4QRRB 2SODB 3QAZB 4V2BA 2QDWA 5DZNA 1GW0A 1RU9H 2R29A 1ZLVK 1GJIA 4KRPD 1BF5A 4XPTL 3TONA 4JDZB 5KS9F 5INDB 1K5NB 2ZCZA 4RH4A 4NKDA 4J3SA 1QZNA 1OKEA 1XHHA 4H88L 4O58L 4Z5RB 1BZ9A 3BWAA 1E65A 3CFIC 5C3IA 4YSDA 2VW4A 1AOHA 4PTUA 3QHFH 3DJRA 5FA4B 2XA8L 4XE0A 3NPSB 4PJDF 3GXPA 1RHHA 5TE6H 4DP8X 2FBJH 4O51A 3IDNB 3O6FC 4NRZA 4Q2ZB 4KVNH 1ZE3C 2WNKA 5CP3H 1EFXD 2YMXL 3TC9A 7CGTA 1P6FA 2J1WA 4JFDA 4KROB 1OP3K 2WXRA 4FLRA 3UPAA 4QNPF 1KTCA 4ZUVB 4OI8A 2VZTA 2NY0C 4DKAA 4OW6A 3VG0L 4QHUB 1XR9A 4IBQA 4K4KA 4MJID 4AMKL 5KN5B 2EXYC 3HG2A 3DRTB 1M3IA 5ESVB 2G5UA 3BVNA 5FKPB 1RJZB 4XP4H 4PS7A 2DY2A 1SF5A 3BAXA 2APTA 1Z66A 3ZT6A 4OV5B 3OPZH 2F5BL 5T5NG 3FU3A 5CIPH 5DYFA 3AS1A 5I6PA 1QO3B 1RZ7H 3EOAB 1U0QA 3D9AH 4XO3A 2FBOJ 3V0DA 4ORZC 4AOFA 1I4FA 1RY7B 4XCNB 4A6YH 5IBLC 5T3ZE 2W38A 2YWYA 3VXQB 5MEOA 1DEDA 1IBZA 1JXKA 4QHLA 1AIFA 5IT2H 1F42A 2B4CL 4NENB 4BYHA 5D2NC 3BISA 4GW4A 2OR9H 3GINA 1EAPA 1KGJA 4WW2B 3EJYC 5J3HD 2CKBL 1Y18B 4P2RB 3HS9A 2OXGB 7FABH 2AABH 3MA7B 3FQYA 3GSNB 2NY3D 3BQUB 2IAMD 2I60H 2FWUA 1QUPA 1RZ8A 3QQ4A 2IDTA 4ISVB 4M43H 4OJEH 1NSNL 2M8XA 1U8IA 1JJUA 4ODTL 3DVGA 3ULUF 1NGYB 4HUWA 1NICA 1UWXH 3U25A 4S1QL 4B9FA 5HVHC 3KZ8A 4AT6B 3CVHB 4PM1A 4ZAKA 4W9DC 3ABMB 3JBG7 3UPRA 1J1OH 3QJHA 1CD1B 3C12A 3DGCR 3JYCA 4NKMA 5FIEA 1IKFH 3VCLA 3FTSA 5DMYA 1JF1A 4MRBA 5FHAL 2ATPA 3QIWD 1IBDA 4PG9B 4G42B 3FNKA 4H1LB 4FULA 3L3IB 1QTSA 4KFZC 3RGVD 4JG1L 1Q94A 4DGIH 3C9NB 3HR5A 3AG1B 3CK0L 3E1ZA 3IGFA 1RUML 4L4TD 2X4RA 3FUHA 1KB3A 2V8LA 2JF1A 3QUXA 3AM8C 4M7LH 2MCPL 3V6FB 4FKKA 2N7BA 1ADQA 1KGIA 4IU3B 3HVNA 1U92B 2GPZA 1EJOL 4I5BB 1F90H 3ECBA 3WFHB 1EHKB 3B6SB 1VJSA 2ZICA 3L1EA 4QOKB 2F53D 1O7SA 2H1PL 5JA9A 4RFOH 5C0GA 1DLFL 4HSAC 3BGAA 2Z3FA 4PJFA 5FAAA 3MUUA 4R3SB 1L5GB 3VFOB 3N3EA 4I88A 3T6WA 2DQMA 4IK6A 1E27A 4QXGL 4M5ZH 5HJ3A 1JVKA 3Q3GB 3C75A 3JYBA 5AAMC 3KDMB 2Z35A 3SCMB 3BSZL 2EAEA 3OAUH 1CIDA 3GGWA 2L4OA 1AXTH 1P69B 3AAZB 3H55A 4R7VA 1GGCL 4TUUA 2GSGB 3F12A 3WJJA 3WJMA 3UBXG 3APFA 1AMXA 5DR5H 5ABAA 4BH8B 2ZG3A 2FLBT 1UWGH 4JJ5A 1HL8A 3RUGF 2ED9A 1U4EA 5HYFA 1QFHA 4OLWH 1U8PB 5CLTA 1I8AA 4KK6C 3NCXA 1AVAA 2DMBA 5DO8A 4NUJA 5I1IL 2IG2L 5DMKB 1PZ5A 1SYSA 5LG1A 1F4HA 2BERA 3PQYD 3KLAB 2P80A 5JHLH 5KEZA 4LOEA 2Z31C 5DRNA 2A77H 3EDDA 1N59A 1UXMA 3QDME 1FLRH 2CO2A 2YJLA 4ODBD 2X6MA 4GNKB 5I18H 5MENB 1KACB 5JOFA 3N5AA 1S7TB 3BYTA 3PWPB 1IQWL 1K4DB 4BCYA 1NAKL 1FGNH 4FQHA 4N0UB 5JIMA 3BZ4A 4GS7B 4RGMC 2Z93B 3MNWA 4XZ4A 5KJRL 4N20A 4GKOA 1UACH 4JL2A 2A9BA 2VQTA 3RQ3A 2WVVB 1NJ9B 2W65A 5I17B 1LHZA 2YXWA 5DUMH 5I1AB 3BRFA 2YSSB 2PW1A 4MGXA 5C0EB 4WEEA 4YR6B 4R8WH 2PYFA 2R69H 4ZUTB 4FJYA 4F58L 1RD6A 4TTGA 3DV6A 1UGKA 2DMCA 3POCA 2CMRH 3DGDA 3TPUB 4K94H 4Y89A 1A0QH 3UO1L 4YVNA 1NGPL 2DAVA 3UTPD 1AY1L 3MRMA 4UILL 2F5AH 1TQTA 2PP8A 3GSOA 3MTRA 4OD3L 1LO3H 4GRWH 5GGTA 2CDGA 5CCGE 3CQPA 2HT4D 3LB6C 4LCCB 1AZZC 4Z7OB 4ZYKB 3VXSA 4NAJA 4MQ7A 4G7RB 3FCSB 5AW8B 4H2AA 1G6RB 5HYSA 5E6UB 5SX4H 3KH4A 3MFGB 2YD5A 4HKZB 4MA8L 4MKMA 4NQCA 4Y2DB 1Q0EA 4WHYH 6FABL 1YNTA 4R4BA 2R2EB 4RFEB 1MQKH 1FG2A 2ED8A 2P7TA 3D1MC 3UIZA 4KXCA 2GAZB 4YDMA 5BZWB 4YFLI 4XBEL 1S5HB 1BP3B 3ARBA 3KYOA 4U0QB 1AHWB 3UJJL 1S9XB 1FZMA 1URIA 1QUNB 3BPNB 2YPLB 1TZOA 5E8OB 3R18A 5L4MA 5JIPA 2R7EB 4LHQB 4FL4C 4UOW1 4X6DE 2C7FA 1IARB 5IHUH 3WAJA 4FC3E 3GDBA 5ANMA 1PBYA 2X9XA 3L9EA 4TPRL 4IMKA 4B9PA 2DW5A 1S9YA 1S9KC 4XPHL 3SZ6A 3OXSA 3L9BA 3C87A 3QXWA 2JE8A 5BS0A 3LD8B 4KZ0A 2OL3L 2AK4E 1IMHC 3WBDA 4M7KH 1YEWA 4PD4K 2H0FA 3ARRA 3CVIH 3QR1A 3UJTH 3MBWA 2FHCA 4D0CA 3UDWC 2AANA 1SXSA 3ECQA 5G4MA 1IEHA 2YD3A 1YJDL 3OAZK 3OMIB 4HIJA 3R06A 4GRLC 4NNXB 4H0LC 4JO2H 4R7NA 2AXGA 3VI3A 4L1HA 3CHRA 4WJG3 1II4E 3GZQA 2ZOKA 5IUSA 3I74A 1A64A 1NCCH 4AYBA 1TUPA 1TPXB 4N2IA 1R3JB 1UM5L 5LQBL 2K78A 5D5MB 1XB3A 4ZFZA 3RWHA 3SDAA 4XCEA 2I5YL 3RB5A 3OKYA 1JXJA 4BKLA 2X2YA 2FJSA 2QTEA 2NY5C 4ABQA 4U1LA 5BJTA 2O61A 4OB5H 1BIIB 2NX5E 3D5OF 1XAKA 1NBZA 3LIZA 3VFWA 1X5IA 4L0ZA 4HFWB 1BFVL 2AGJH 1S7RA 2WLHA 5E08H 2Z91A 1SLWA 2A99A 1BBJA 1UD6A 2YA1A 4I3RL 4I4WA 4G9DA 4W6XB 4WV1B 1KPUA 5T1KA 1OGAA 2P46B 1RK1A 1JHKL 1SQMA 4YSPA 5TDOA 3GM8A 1JK8B 1DDHA 3EJSA 2R2HB 4WO4D 1XCQA 5DEJA 3UYRH 1HKFA 3KPMA 3VE0B 4HWBA 4AITA 2ZOLA 4V1DB 4ZJ9A 4J3OG 1V3LA 3HNSH 3PV6B 4PWKA 2XQYA 1N2RB 3HPLA 3WOVA 3SQRA 1WA0X 2CUHA 3HLAA 3NT0A 4ZQKB 5DHDA 1JGLL 3O4LA 3TZVD 3ZRFC 2SEBB 2XZQH 2Y5EA 3MXVH 3NABH 4GBXB 4E9QA 3QIUA 3U6XS 1GRWA 1HOEA 4YSTA 3IETB 1JPGA 3RPIA 3THMH 1TKWB 4KKCD 3P40A 3CMOL 5FCUH 3HBGA 2LW3A 3V6ZB 2X1OA 3WIHH 4N6QA 4BA0A 3CSTA 4LSSH 2X10A 5AFAA 3KYAA 3L4TA 3UERA 1XGUB 3D2UB 3K6FA 3TBVB 3LPPA 7PAZA 4W68A 1WWAX 5IQ9A 1WFNA 3KCPA 1OV8A 2OJEB 2PTVA 4HEME 4LBEB 4TRPH 5EU6A 3U4AA 3NAAL 1A6ZA 3TO4A 3H42H 5F96L 2VIRA 3WFEL 3EZ8A 3PP3K 1LO0H 4L4JA 2UY7A 2JCCB 2CE6A 3FT4B 4M5TA 5ACMA 3HNVL 2LU5A 4UT9H 4OFYA 3V6BR 3PGDB 1H6TA 1A1MB 1QD0A 1UB6A 2XXGA 3MRFA 4FFYL 4FXTA 3L1GA 4JAMA 1HHKB 1WUZA 2P5PA 5JXED 2BVYA 1P1VA 3PGCA 3GXMA 5DHMC 1NEZB 1ZPLA 4RGND 4HWZB 1YYLH 4NO0D 1KJ2L 2OI9C 2VDPB 2OMZB 3X14A 3VFTB 5BRZA 1G7QB 4JBSA 3UZVA 2GK0A 3TBSA 4KKPA 1PIGA 2X4TB 3UAJC 2KBGA 4AC4A 3CG8A 2VN7A 3FOLA 5AOLA 4J7RA 4WI2A 1IBGH 2F1AA 4TSCL 5EV7A 1NH6A 3PHQA 4IBWA 4X6BB 1A7QL 1PQZA 1GJWA 1S9WB 1XH2A 3EYOA 1FORH 2OMYA 2BDNL 4Y9BA 3CTTA 2O5NA 3T71A 4Y4HB 5T33L 1DVXA 1QFUL 2BW4A 4S0HA 1TQVA 3ATBA 3C5SB 5CNHA 3SY0B 3HFML 2EDQA 3WTWA 3JWDH 2JKSA 2NPLX 2CUMA 4KI5E 3P73A 4NT6A 5K9OB 4QRSB 1UYWH 3EFFB 1I3GH 2PYED 1Q9KA 2WIMA 4OJFL 1JTPA 3QUYB 3WFDL 4MS8C 3RJDA 1DR9A 3B2UC 1FBIH 4D3CH 4F37K 3LN4A 4R0LB 4RIRB 3PYCA 1M71A 3LH2H 3MXWH 4OJYA 1SBSH 4K9EL 4V11A 5DS1A 4GQQA 3QQ3B 1CBVL 1HYRC 4OFDA 3PU7A 3C6LD 2ZUVA 3MFFB 1X5KA 2IPUK 3CLFL 6TAAA 2BFVH 2Q86A 2WSDA 2X4OB 1DUYA 1L0QA 3B34A 2XOTA 5E2VL 1QWNA 3MOBH 3QFDB 4ZFFA 2NW3B 4JFHE 4PRAA 3W5NA 4ZG1A 2V33A 2VR6A 3QEHA 1U3HA 3QEQA 3GBNH 3TS8A 1T2QH 1WD9A 4R4NC 2J8UB 3OZ9H 3B9DA 2DYPA 1KIRB 4Z3FA 3V4PH 5AB2A 2ETWA 4AVIA 4F1ZA 2WBXA 3MCKB 3BT2H 3DC0A 3HPJA 1C1EL 1N6QH 1QHQA 5ITBL 2VN6A 4WSJA 4FNUA 4IIQB 1RUKL 2A0LC 4N2NA 4RMUA 4XAKD 4AH2B 1XTLA 3MODL 3PG2A 1QKZH 4WY7H 4PRDB 2AJXL 4XHQA 4AEHH 1NDGB 3N55A 2WVTA 5JHDA 4TF4A 2ADGA 3WO3B 3NTCL 4BFKA 2JV6A 5AL8A 1U91A 4ZUWA 4U1IA 4DESA 2ZOOA 4YDIH 1JAEA 2J5LB 4GT7A 5I6KA 2R2BB 2KS0A 3EO0B 2OW7A 1MRFH 2F7IA 4MJIE 1NWPA 1I7TB 4C47A 3FT0A 4YR6A 1T6WA 4UTBL 2UXFA 2QFRA 3QUKA 1V3MA 5DSCB 1PCXA 2XC8A 1WZ1H 2C9UA 2ZUYA 3QS2A 4I0KA 4PJ7E 5DJXB 5E6ID 4DAGH 4HKJB 1D7BA 3I50L 1VFMA 2Y3NA 4JCWA 1BYNA 3HRZB 4QRPD 4LVHB 4JFZL 2AI0L 3NRFA 1E2VA 1FF5A 1RIVH 3PCYA 4K9EC 2EC8A 1F6AA 3PHSA 4P2QD 3TIEA 4XCYA 5BPPA 4YDKL 3SE6A 1FAIH 5L2JA 2JXMB 1DQLL 2P43B 2PTTB 4MFHA 3ZMNA 4U6YB 4UIKH 3TBTB 3GIZL 4FD0A 1RCYA 1UT1A 3N1PC 3MBXH 3FZUC 2FL5B 3MACL 3WEAA 4H20L 5FGRA 4I89A 4AUUA 4HJTA 4M5SA 2W81C 1IAKA 4ZTOL 1F58H 2FGWH 2X4NB 4Y5XB 4PGEB 2NT1A 5K9QI 3ARGB 4JGJA 4Y9CA 3HHSB 5ABDE 2NXZB 2QKSA 1CICB 1ADQL 2HX9A 4KTEL 4NJ9H 3GSXA 1K8DB 4YQXH 1JGVL 1JBJA 4MNGE 3FB6B 2YFOA 2V2WA 4NPYA 1HH6B 3KEDA 4HJUA 5IEKA 2HFFB 1AS7A 1XCWA 1JCVA 2FE0A 2VDOL 4JY4B 4DIXA 1FGVL 4HV8B 2HUEA 3C60C 4RQQB 3QDMA 4QMEA 5DJYA 4GG6B 5EOTA 4XPBH 4NCC2 2PTUA 3CFQA 4PW9A 4KO9A 4WK4B 3CN0A 2IH8A 2YAPA 5AW2B 2DQGH 5C7XH 1NCOA 2B1HH 4JM2D 5FK9B 3VVVA 5MEPA 4KOBA 3GBEA 4NHUA 2G75A 3ULUD 4L5FE 1D2PA 3TA3D 2CO4A 1UD5A 3KR3L 4L4TE 4AUYA 3SKMB 2WTRA 4FA6A 1AOZA 4PJ5D 4HETA 3SD2A 1T83A 2YUZA 1E42A 5IJDC 4O4YL 5CU5A 4AY0A 5IW1B 2FJGB 5I73B 3QPKA 4Y19D 3LEXA 1WITA 2COQA 1N3NA 1P4IH 4AL8L 4FXLA 2F2HA 5MEQB 5C1MB 2F53E 3IWUA 4OJDH 5B7FA 1PLAA 5IUCA 1CUOA 4B0MB 2X4SB 1JSYA 3BKJH 4RDBA 1X9LA 3GSRA 4XOEA 1E9PA 4P06A 1UTDA 3MUJA 1CGUA 4HS6B 1T03H 2JQAA 2MSPA 5CGYD 2JKIS 3FTUA 1RURH 2FSEB 5L4FA 4BQ6A 1NBCA 3B2XA 5AD0A 1GC1C 3QI9A 4X50A 1FSKB 2QTVA 2E8ZA 3S34H 2UZXA 2KZ1B 3U4EA 4IU2B 3CNKA 3MROB 2OLDA 43CAB 3RY5A 1O5DT 3FCTB 4HW6A 5C6TH 2HG5B 1YUKB 1A1OA 4QF1B 3DVNB 1RK0B 4HJ0C 1DVUA 2BP5M 2GW5A 4X6DA 2OMXB 5BO1H 2H2SC 2WXGA 4AYID 1DBKH 3NJVA 3PQYE 3E6HA 4XMZA 1U42A 2NNCA 4NXKA 4ZDHB 3SBPA 3FQXA 3PXJA 4HJSA 1P5UA 4LSRH 5GGTL 3MBEA 3GMRA 3LN9A 5EZJA 4N6RB 2MPAH 1JDCA 5I0VA 3OAWA 2CU9A 1L7IL 5HI3C 3TNNA 1LE9B 2B0SL 1AGBB 2J25A 2OCFD 3GS4A 1ZT1A 3PWJA 4M56A 3VFRA 3WNNA 3IDUA 5JYMA 3NFPB 4WHTA 4YHML 1I9EA 3A67H 4WQOA 3C5XA 5DQJB 1DSWA 3GRBA 4Y88A 2YPVH 4LRIC 3B2DC 3BWUC 1BXUA 4FQXA 2MEJB 1JWUA 2IPUG 3IGAB 3LX9A 5I2IB 2DEWX 3VWJA 5I1HH 3WL9B 3S3BB 3HUJB 4JO8A 3FOMB 2AJUL 2EKJA 1BW8A 1UWEH 2FH6A 4UNIA 2WSKA 4JMXA 4OLXH 5HVFB 1BOYA 2VM9A 3VXOB 4YK4B 1JHTA 3RVWD 4BK8A 3O3UN 1FZOA 5HHOD 4YLBA 4RVBA 3SPVB 3VXRD 3QUZC 3O41B 3UTPE 2XG5B 5ELIA 3QUMB 3CUPB 2NX5A 3NSFA 4OF5A 3WLBA 4NN5C 4HKXA 1BIHA 2R0ZL 3T0ED 1X5HA 4A2FA 2DMHA 2A9NL 4C57C 1F1AA 4X7SH 4KH2A 2QDVA 2AJVH 1VEPA 3EH4B 1WCBB 1HU8A 3CFJA 3VMNA 1W80A 1G9HA 4EI5C 2J88H 5DJAA 2NW2A 1BG9A 2W9DL 4A55A 1A02N 4AQ8A 1CFNA 1YPZF 3E8VA 2KYIA 2WQSA 4AGLA 1PL3A 5HHQA 2QSTA 1RZFH 5E6ZA 3QJFA 4ZUSB 1CYGA 4M93B 3ATDA 2HJFB 1GGTA 3ULVL 3VW3L 2JJSA 3K71B 5D7SL 5LUMA 3ZKND 3TO2A 5I16B 2XQ0A 2H9GA 1M57B 5DK2A 3VU1A 1W2KT 4PJEE 3RFZA 5F9DC 3MCLL 1RFDL 3LIZL 1U8KB 2Y2WA 5CJOH 2LHAA 2V2XA 2WXNA 1T4KA 2IBBA 5BVPH 1NCWH 4X5XA 3UTSB 1AR1D 4ZFQA 4LEXL 4M03A 2NZIA 4KDVA 4NNYB 5AW0B 5DUBA 1WH0A 1UJTA 4AJYV 3FUKA 1T4WA 4P04A 1BQSA 1IGCL 4HWBL 4UQ3B 1E7VA 3QHTC 1UXWA 4BRJA 3TEXA 1QBLH 4YPGB 3QDGB 2E6QA 2V7HA 3T4AB 4Y16B 2D2OA 5F1NB 5MEND 2UXVA 2O5XL 2YZ8A 4DOHE 4N0FB 2ICWA 2BNUA 2WVUA 3MOAL 1NIBA 1MJJB 4PJ9A 3PGFH 4JRLA 2DI9A 4LIQL 3UP1A 5J06A 2CHZA 4GQRA 4HVBA 5I5IA 2NTFB 1KCSH 5J9PA 1S7WB 3AREC 3SDDC 3U7WL 3GBMH 4ZMOA 1ZA6A 2W0PA 4MDRA 1V27A 4Z7NF 1I75A 1P5VB 4I2XB 1L7TH 1UZ8A 3QRGH 3EH1A 1R3LB 3S5LA 4L3CA 2ROYA 5KOMC 2OYPA 3ESNA 4WW1B 3H3KA 4RDQG 1FO0B 1N5AA 3FB5A 3QORB 1JNHB 4PH8A 3RZCD 3LEYL 1ET8A 4PRPB 2XPGA 3D4CA 4ORGA 5IM7B 1E9OA 4G72B 5I15H 2NNAA 3IMRA 4JREC 2WK2A 1CR9H 4MNQD 1A3RH 4LHJB 2MKWA 2Q2LA 1HIML 3EKCA 1E4WL 1T7ZA 5HDWA 3FT2A 1CXKA 5DEZA 2H6OA 3MUGB 4NN7B 4BCXA 1AKJA 1U8OA 4Z7QF 4B27A 1OARH 1I3RA 2ZOTA 3VNYA 2A6IA 4BKTC 2QVFB 4RESB 3X12A 1A6TA 5IB3A 2CGZA 3FQNB 2CUAA 1U4FA 1ZD6A 3P4NA 5CBEB 4X6FA 4A39A 2ZX7A 4WHDA 4TNVF 2VZOA 4FQLL 4BK5C 3LVTA 4WLCA 3MRDA 1OCWL 4ODSL 4GAYA 2IGFL 2XVKA 4JPVL 4FZ8H 3QDAA 1QI4A 4AUJA 1R75A 2Z0UA 5GZOD 3K3QA 4XC1H 2CIIA 4MA3B 4UZUA 4YHOL 2ICWI 5C9JB 5DJCB 1BOGA 3OGCA 3QA3A 2ZE0A 2YK1L 4J3BA 1SHXA 3UXFA 4FOMA 3EYQD 4MSWB 2VO5A 1LP9B 2F8VA 3BIBX 2Q8AH 4HJEA 1MCLA 4RMTA 5DLLA 3OKLA 4LU5H 4OLUH 5JIQA 1TZAA 1QLEB 5IMMA 1P1ZB 1KYOJ 2W07B 2ZJSL 3FSWA 3RPKA 3NP4A 1BECA 1LEIB 2XIDA 1A6UL 3OKKA 4QKTA 5KYWA 1S78C 2JB6A 2ZWSA 5IK3A 1AANA 2OQJB 5D70L 4AV5A 4ODUA 1ZJAA 4UINH 4AZUA 1HH9B 1HQRA 2GBAA 4X7TB 3NPZB 1PY4A 3BGMA 3L5IA 4JW3A 3U30C 1E5AA 2ZYIA 5GJSL 5BOJA 4UM9D 4IKJA 5KYYA 5H4YA 5IROA 5HHNA 3I9GL 4OUUB 3RHWK 4MJ5A 2FEDD 2LAGB 4IJTA 1NCNA 1WRFA 5FKAB 3VGEA 3RGHA 1CFSA 4RGNE 3ARUA 3NBNA 2N4IA 2GT9A 4LLMB 2X28A 4X4XB 3Q01A 1QSEA 4GH7B 5CSZA 3BUQA 4EIUA 3T77B 2XWXA 4L1SA 3NZ8A 2NUPA 2HKFH 3PF2A 2YBGA 5GS0D 3D25B 4GMSH 3MV01 2ZKMX 4HV8A 4HUVB 4JFPB 4LLQB 3V7AE 4PY8I 3CH1B 25C8H 5LCVH 2D3VA 1QMUA 3BAIA 4Q8BA 3L3KB 3IMBA 4APQB 1EFXA 4QYAA 2CGRH 5EHFA 5G5DA 4NO2A 1LE5B 3WGUB 2HAZA 4O02H 4TQEH 3OHMB 4D94A 1JZJA 3GNML 1F00I 2ZX5A 1A6AB 4LHUD 2R0WH 4U1KA 5JW4N 5I75C 4MJIA 1TQBC 3KPPA 4WNJA 2VB5A 4WWKB 4JDTH 4B9KC 4EVNB 3O0LA 2DD8H 1UOWA 4XODA 1TJIH 3D4GA 3BVXA 3LKQA 5LBSA 2PYEE 1ZT4A 1A6VH 2YEVB 4KFMA 2E27H 1MLBB 2DI8A 3KJ6L 4R26H 1X5GA 4U49A 2IWGA 4I0PD 3ARFB 5IEHA 2WIIB 4OT1H 5GRUH 2NNXA 4YSUA 4TL5A 2OAAA 2DIEA 3WDJA 3BLKA 4MMYB 3C5ZD 3DROA 1KXVA 4G7VL 1SYVA 1I1AB 5C09D 4Q9QH 3ZYIA 1H5BA 5EF2A 3MNVA 3UC2A 4KC3B 3L95B 2YMTA 4PBVC 3GJFA 2V2TA 3O9WD 1MFVA 4CBPA 3E2HC 1RULH 4ERSH 2DQJH 1H3VA 5TF1L