1O9ZA

F17-ag lectin domain from escherichia coli (ligand free)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
177
structure length
170
Chain Sequence
AVSFIGSTENDVGPSLGSYSRLPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSSRYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Fimbrial Adhesin F17-G of Enterotoxigenic Escherichia Coli Has an Immunoglobulin-Like Lectin Domain that Binds N-Acetylglucosamine
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lectin
molecule keywords F17-AG LECTIN DOMAIN
total genus 45
structure length 170
sequence length 177
ec nomenclature
pdb deposition date 2002-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1o9zA00
2BS8A 1O9VA 1O9WA 1OIOA 3FFOA 1ZK5A 2BS71 1O9ZA 4K0OA 3F6JA 2BSCA 2BSBA 1ZPLA 3F64A
chains in the Genus database with same CATH superfamily
4RMWA 1DANT 3GSOB 5E6ID 5ACLA 1JZIA 1KTDB 5DR5L 4JHVA 4JFOA 2WP3O 4RFNC 3VFMA 2V0AA 4MXVE 1ZGLA 1RJYA 1K4DA 2LOEA 4UQBA 4G6KH 4Y5VB 2R0WL 1MEXH 3LS4L 5MERB 4MJ6A 1QNZL 1SY6A 5FW7A 2MCPH 5IF0A 1QA9A 1CG9B 3WKYA 1RY7B 4JHZA 5M95B 1CFNA 3LKSB 1T1XB 4NUMA 3UAFA 1A4JB 1OALA 5DA4A 4EE2A 3NA9H 1MJJA 2DQGH 4L37B 5K39B 2O6PA 3WLWC 5L4MA 4G70B 1HWWA 4TNEA 5TDOA 1V27A 1ACYH 2DH3A 2IOMA 5CP3H 4MZIA 3HMXA 4JO2H 4NWTH 2CLRA 1E2ZA 2OMWA 2NT1A 2MTPA 1XTMA 4FFVD 5CHNA 3VFPA 1Z9LA 2VR5A 4OIBA 1GTNA 2IANE 3L4WA 3RY6A 4OB5H 1TXKA 3JVGC 2JVUA 3BGFC 3GSQA 4JE4B 1J8KA 5JQHC 4PS7A 4U1GC 1AE6H 4TTGA 2ZUUA 3ABGA 3LN4B 1A02N 3VFVB 3BCFA 3LHPL 3GUTA 2R8SL 2PF6A 4J23A 4FTDA 1OM3L 4NHCL 3IXAB 4PJBF 1HHKA 3VI4B 2VXQH 4RGNE 5I0WA 3KLQA 3V79C 3BXNA 1UXSB 2KI6A 4OUUB 3MRKA 3IE9A 1UM5L 1XF2B 4GLRI 2YWYA 1HL4A 5DS8A 4HJTA 1ZHLB 4X98A 5FWQA 3V0EA 5GZOC 2GQHA 2G75B 5I1CL 2NSXA 3SB3A 4AKPA 3UPRB 3HUJB 3MJ8A 3RWDB 1MELA 3PHAA 3TXAA 1NCCL 4LLDB 2IDTA 1EAOA 2I07B 5HVHB 3HUJF 3P4OB 1NCBL 1AZZC 1OAXL 3MR9A 4NQVA 1KEML 4EUPH 3K2UL 2EH8L 3PUUA 5I1AA 4Y16B 1OTTD 4UT7H 2PCFA 4JFSA 4PV9B 2KLSA 1JPGB 3RWGA 2EEXA 2C9XA 2M1KA 2E8YA 3I75A 3LH9A 4K3EL 2HVKB 4OKVB 4WFGE 3RY4A 1S7QB 3WHXB 1JNJA 4DERA 5TF0A 4WTQA 5EN3A 3PWJB 1A6WL 2LAAA 4A63A 1XFPA 1VJSA 4EKXA 4PGCB 5IBTL 4H25A 1D5BA 2J71A 1F11B 3Q01A 1X44A 4NRZA 3DPBB 1XD0A 4Z7IA 2BNQB 4QMEA 3CFJA 4FEIA 3BWAA 3LH2L 1IM9A 2ZONA 3FSAA 1IC7L 5B3NA 3U0PA 1P84K 6TAAA 4ONFL 2H32A 3BP6B 4OLVH 1JGEB 4JVUA 1JZFA 1MW3A 4XMLL 3RLSA 1UB6B 3NIFE 4LXFA 3V0FA 4LCCC 5DS2A 5F7FA 4ACTA 2VZSA 1RZJC 4J6RL 3J7HA 5I1KH 3WFDH 1KNOA 3MKGA 4ZS6C 5IHUL 4PR5A 4BELD 5AFAA 2GTZA 2MCMA 5L6YL 5EBLB 3UBXI 5BUGA 3QORD 1E4XH 4ELDA 3O45A 1EX0A 1BZ8A 1ETJA 1DVZA 3N5AA 4MQXC 3LZFH 3TO4A 4GBXA 3CZLA 4E0RB 5LG6A 2P1YA 2ADGA 3IAQA 3APNA 1LHZA 5DJ2A 4X5WB 4N2HA 3B56A 3GM8A 3LOWA 1WIPA 4O2CA 1SJEA 2J4WL 3FYIB 4GW4A 5L2JA 1JDAA 3L4XA 1BLIA 5GS3A 1FL5B 2BVQA 1GPOL 2YPVH 1GGTA 4OGXH 3VGAC 5D72H 3VWJA 2NNFA 2V9UA 2QLYA 1CIDA 1PZCA 4F7CB 1MHEA 1JZEA 4UINH 3SODB 4DGVL 2X38A 5L0QC 5GSRA 3MRPA 1KGUA 3P2DA 3KNBB 3R0MA 5HHVL 1SZNA 2JQZA 2R23A 4P2AA 3MUZ1 1JGUL 3X13A 2WWOA 4KXZH 2CHWA 1A21A 1A22B 2WK2A 1W16A 1DL7H 4XRCA 4KXCA 2MNWA 3N06B 3FSOA 4BSVB 2A99A 1JGVL 5T1KA 5LCVL 3FUIA 3C5SB 3VB9A 3X11B 1ET7A 4PRPD 5HYEA 3VGHA 3QEGH 3BX7C 1FYTA 1YG9A 1F1AA 1T2JA 5E51A 3AM8A 1GKEA 3VXSD 5DUPH 4I2XE 3N42B 1R3IH 4U1KB 4HX1A 2ZWLT 2K4AA 1RZKL 5DYFA 3N43F 3KGUA 3QH3A 1A1OB 2HH0L 4OCLC 3G5YB 5DJAA 3P73A 5HYQA 3TEZA 3OAUH 1AP2A 1XV8A 2D7NA 1R19A 3VXSA 1AKJD 3QWOB 1OP5K 2O5XL 3TH2T 3NN8A 4HCFA 3FUMA 5BXFA 1LE5A 4NO0A 5E1HB 2X4TA 3S48A 5FYKL 1RULL 1AQKL 2EDKA 2GKIA 1OQOA 2ZTBA 2WLIA 2XN9D 5F7EH 3P69A 2YPLD 4Y88A 5CLTA 4XWOD 3GINA 1PZUB 3NAAL 4NI3A 1NDMA 1EEZB 5CD3B 1CGXA 2TAAA 2QHLA 2WJ7A 3CTTA 1HCVA 1F4XH 1G9NH 1R3LA 1T21B 2LR4A 4F7MA 2HMID 4QXTB 4O5LL 3AS3A 4YPJA 5B7EA 4J3SA 2F08A 2HT4C 4XBPB 3EJUA 5F7BA 2BNRA 5JW4N 5FO7A 4RQQA 3B34A 3SE3A 1G1CA 3BKJH 3DWTA 1R9FA 4JFHE 3WSQH 4S1DD 1G84A 5T8IA 2EEDA 1AG6A 3SDXE 4HLZG 4UT6A 5LQBH 5FHAH 5I82A 4EDWL 3U7WL 3KPRB 1L0YA 1OE1A 1TLKA 4JFQA 1CUOA 1SOXA 4H8WH 3DMMD 3KVQA 5FCSH 3GSNL 2J6EL 1DJGA 5GRYA 3O4LE 1C7SA 1A6ZB 1QFHA 1UWYA 3MROB 4DGYL 5CEYB 4AX3A 3ES6B 2WXHA 4R97C 4UOW0 2P42B 1U92A 4OI9A 4G42B 5C3TA 1TVBA 2YD0A 3QEQE 4JG5A 4MMXB 2HRPH 4KHXH 4XBEL 3ZPDA 1KENH 2BY2A 3G5VB 1N67A 4FA8A 2QHRL 2RACA 4FQ2H 3SDYL 4BH7A 4HWUA 5ITFA 1AYRA 4FTVA 1UWXK 5JR1L 4LDEB 4Z7WA 4M03A 1ZLEA 3F7KA 5AKTA 4WU7B 1E4WL 2FLBT 3AREB 4M5ZL 4XN9A 4APXB 2IAMA 2ZKWA 4BUQA 4TLKA 4LP5A 2YQBA 1YN6B 4NO2B 4UAOC 4Y2DA 3JV6B 3RX5A 4EXPX 4W9LC 4LHJB 3QXDA 3UC0H 1JE6A 4BCZA 4QYOB 4GSDH 4HBCH 2HJLB 4OGZA 3X3FL 5ILTL 1ZK9A 5IVZA 5JLZB 2XNAA 4NC0B 1YC8A 3EF7A 1G7LB 1CGYA 5IMMB 5C0AA 1JWMA 2P80D 3BDYL 3OJVC 2WNKA 2UUDK 4J3VA 2DMGA 4JPSA 1OGTA 1FL3A 5IFAH 5FF6B 1S78D 2CRZA 2P5WD 3MLWH 1Z9SB 3FFDA 4M6NL 4BQ9A 3ZBMA 2BPBA 5CINL 3BFOA 1FH2A 1KCRL 2YD7A 3DX6B 1MCBA 2I9LB 1NKOA 2O5YH 4J6IA 3BKML 1M2OA 2MOGA 4JN2B 1RK0B 4Z6AT 1BOGB 1S3KH 3QHFH 4L9LC 2YBRB 4ADIA 3P9MB 5AZEH 4X5LA 2F2HA 3ULVL 4K8RL 3GBML 3Q3GB 5JW3L 4U0QB 4P4KB 1MFNA 3TWYA 3ZX1A 2ICES 3UZVB 5BW7C 3UJIL 1SOQA 3ARBC 1EANA 4JQIH 4BCYA 3ENEA 5DVLA 1HJBC 1G6VK 4PJDA 1UJ3C 4RCAA 1XF4B 2X6AA 3GZQA 4V1DD 4EXKA 4IOFD 1F4HA 3N0AA 5CGTA 2E47A 3O2WL 1GH7A 1I8MB 3PDGA 2UZYA 5GGRB 3DX4A 5I1LB 2FJUB 3ZE1F 5JW4M 3UYPB 4AYSA 2GYSA 1DVFB 1WK0A 2XTLA 1NEZG 3H53A 3N44F 4AQ8A 5FO9A 1AOZA 1AHWB 3BVTA 3FUDA 1HE8A 3PGCA 5CZKA 5J56B 5JIPA 4R4NC 3WIHH 1OGAD 1U3HB 1YNTB 2AJYL 3KGTA 5BRZA 2E7LA 2CCLA 1DBBH 2V5YA 1L9MA 5H4ZA 3I2CH 1HESA 2BNQE 4XCNB 1RU9L 2CJSA 1V7NH 4HS6B 2I9TB 4XP9L 1BBDL 2OYMA 3AQDA 3LVTA 4WV1B 3ZLQC 4LSVL 43CAB 3UZEC 2Y2TA 4NSKA 3VFSA 3G6JB 5D1ZI 1GGCL 5FB8A 3FTWA 2CMRL 1A2YA 3QCUH 4TSCH 1COBA 3L3DA 4X7SH 1BFVL 3T0BA 5IFHL 5IV2B 2BCKB 4QRTA 2DBLL 3UADA 2WCGA 3MNMA 3QZOA 1SOSA 1G7JA 2P5WE 2QFPA 4NKDA 5BUAA 4AG4L 4JFWA 1N70A 1NCWH 4PWHA 1ONQB 3U30C 1E9PA 1URIA 5C08A 5I1EH 4RIRB 5IMOB 3LZOA 2WO4A 1S7SA 4MAYB 1IBDA 1E50A 1NINA 2VDKB 4WO4A 4JQXA 4AY0A 1PZ2A 2YGNA 2BS8A 2VXTL 3RFZB 3RL1B 3KWUA 5CJ5A 4G71B 1WHPA 4WAFA 4R84A 4Z23A 3WN5B 1KCVH 2W38A 2Y69B 5C0GB 3NCYS 1XIWC 3DBXB 3B9AA 3IPEA 2WLNA 4J4PC 3BGMB 4L0PB 4DHLA 3T0DA 5FYJD 5ENWB 4HJSA 3MBED 4OLYL 4PRHD 2A4ZA 2JB6B 3EJRA 3NMEA 2B2XH 2P8PB 3WTUA 1KLFA 2Q76A 1CLVA 4FCAA 1Q9OA 2FIKB 1MWOA 3QPKA 1FWXA 3PGFH 1LTXA 2KL6A 4MJID 1PZ3A 4UTAH 3QIUA 4H2AA 1O6VA 3RWCA 1YSOA 1EFQA 4X4YB 2KLRA 1NC4A 5D7IF 1U8PB 4WHYG 1E5UI 1BJ8A 4G9FA 4Y7MA 3AT8A 4X5XA 3ZDXE 3PHOB 4LPYA 2XPGA 1U95A 2YD4A 3IU4H 3QJZA 4FYQA 3V5DA 4BH8B 5FW6A 1YQ2A 4FF9A 4FP8H 1BWWA 3SE9H 5I5IA 1GGYA 2I69A 1OLLA 1EDYA 1W0YT 4I89A 4DESA 5EZOH 3GJFA 1H9VA 3FH8A 3QWQB 3FBQA 4QI3A 4QXVA 5FOBA 1UM6L 5ISZD 2F6AA 4QGTA 3EDFA 1VAHA 4LLMB 2YZ8A 1IL1B 1FG9C 2OK0L 1KCUH 3NRPA 1KB9K 1IBBA 4TF4A 4ETQB 5LNDA 1HE7A 2EDRA 4I7ZC 4GO6B 4UQIM 1SYVB 5A2KH 1U8IA 1K9TA 1PKQA 1PPIA 4PJGE 4YDMA 4G8IB 2WVSA 3UYRH 4HAKA 2G9KA 4LOUD 5HHMB 3VX1A 1RK1A 2WPGA 3RI5F 1N0XH 3C2AL 5TE4H 4M3HA 2BSSB 5LG1A 4GUPB 1F0LA 3IDIA 3MOAL 5CN2A 1ODUA 1IBFA 2IBZY 4KK6C 4C4KO 2DQTH 3OQRA 5DHMC 3HCVB 4OH2A 3RWHA 3U4AA 2ZXGA 3K80A 5JIKA 3I50H 1M05B 2NCMA 4CL7A 1RHHB 4JNXA 1KV3A 1Q0EA 2VT0A 3EH4B 4OD2A 4X5RA 5FGRA 3TV3H 1KACB 1V8HA 2YD8A 1C1EH 5JO5B 3MTRA 2OS7A 1F4WH 4OFVA 2QPFA 3NFPB 4FAAB 4LCWD 1FZJB 3IFOA 1U2CA 1LWJA 4LCCB 1MFMA 3QQ9C 2OXGB 2VNCA 5INDB 4JPIA 5F9WC 5A2CA 4M00A 1GS8A 3WAKA 3OKDA 5DQDL 4OV5A 4PU2A 1HAUA 3NCWA 2VKWA 2P26A 2VLKA 1U21A 5IREA 2QKIC 4WEEA 3E1ZA 3IFPA 1I1FA 2ZCZA 1L5GA 2ZF8A 4BUGA 4F9PA 1DQKA 3MJGX 4X4XB 5LJYH 1SFHA 1SVZA 3LN5B 1UFUA 1L3NA 2Y06H 3TNNB 1M71B 4JFTA 3BPNC 2Z4TA 4HUMB 2H6PB 3GSNB 4X6FB 3CVIH 2NZ9C 4YNYB 3SPJA 4OIAA 1CI3M 3FRUA 3ZGIA 4OCRH 2B9BA 2O6FA 1PBYA 5EN2B 1M7DB 3UC2A 1XH2A 4HWNA 2Q2EB 4L5FH 5LKNA 1ACXA 3Q8CA 5G4NA 1I1AC 1L9OA 5J11B 2J55A 2H1PL 5E4EB 3RWJA 4N2BA 4GG6A 5I19L 4JS7A 5JHLA 5ICYB 1KELL 3LZLA 1Q1JH 4DP0X 4AMWA 1FFPB 2ZQKA 4FQXC 2FH6A 2C5DC 5EEXA 1NBQA 2QVKA 3VXUA 1ZSDA 3ZDXB 1OD7A 2AJUH 3PNRB 2WLLA 1GOHA 4GQ9L 3CZSA 1A8ZA 3NCJL 2XBTA 1E5BA 4GAGL 5CUSH 5I0DA 3NSCA 3ZDWA 1NZRA 3HPLB 2I32A 1MEXL 3LS4H 2VDQB 1QLEB 3QUXB 3R06B 4G7RB 1M7XA 1AMXA 2AJSL 1INEH 4JREC 1OK8A 3VFUA 3Q43A 4MA3A 2X4OA 4ODXB 1FA4A 1JDDA 1YAIA 4Z78B 4E9WA 4GI9A 4Z0BL 2VJ0A 1YYML 1RUAH 3MJ9L 3P9LB 4IQHA 4NBZB 4C83A 3BAXA 4ZNEE 2OZ4H 4MCYB 2ZX6A 3GSQB 3PQYE 3U6XA 4JKPL 1MFVA 1QSFA 3FU9A 3UIYA 2DJSA 3UEQA 2VLRE 4FFTA 3RTQB 3D18B 3IWVA 4U1KA 2WTPA 4N68A 4BZ2H 1XL6A 3Q2VA 4HEMA 4JFFD 3ZO9A 5I1JL 3S37L 2H26A 1EHXA 1BX2A 5AOKA 5ABAA 4M7LH 1Z6JT 1UXSA 3P73B 5HYQB 2E9JA 1A5FH 3MBEB 4BKLA 3HC4L 4XNDA 1LQBC 4PJAB 4GXFA 1AMYA 3DIFA 2D9QB 4PRNB 1O75A 4OF8A 1YNLH 4I0KA 1XBRA 4HPOH 5D93C 4FLHA 1CDHA 4HKZB 2XN1A 3BH9B 5E2TL 3KR3L 4NQUA 3NCFB 3T65A 1N0LA 4KJWC 2GTQA 1M2VA 4GRMA 5G5DB 3T2LA 5BV7H 5IY5B 1JZ3A 5I5JA 1EEZA 2IG2H 4MLIA 5CD3A 5E8EB 3NA4A 3ZN6A 3POCA 4I48B 2D7TH 2APVA 1EV2E 3T4AB 4YMPA 3MJ7A 2FO8A 5T5NF 4B60A 4BCXA 1EK3A 4I1PA 2N7BA 4CSZA 4LCVA 3TN0C 1PKOA 2GSIA 1J0KA 3ARBB 2HTLD 4U4IA 5DEZA 3S98A 3SPGA 1TYEB 5D7SH 4QHUB 3SOBL 2IPUG 1BAFH 3LRSA 1RP8A 1YEEH 3FU5A 1UWFA 1UADC 1TENA 2JXMA 2VDMB 1K2DB 3OGCB 4YS4A 3AROA 1IC5H 4D0DB 2APBA 3KS0H 4KI5C 4PJGB 5LAPA 3H4FA 1OP9A 1PZ5A 1F90H 4JHWH 5A2BA 1C8QA 4R7NB 2R29H 1A6WH 3HS0A 4OF6A 4ZUSB 3RVUD 1OGAB 3EYUH 2NTFB 3DSFL 3I6LE 3WJLC 2Y5TA 2YEVB 4HA1A 5HYSB 2Y2WA 3KZ8A 3PJSB 3RVVD 3ECUA 2DQCH 4Z3TA 1G7IA 2E86A 2FBJL 3E2HC 3GXFA 4JR9L 4NIKB 4PQXA 3CU1A 3QC6X 3QJHB 4XC3L 1OTSC 5LDSA 4LASL 2BIOA 5EO9A 3LKNA 2IEPA 3HR6A 3HLAB 1IC7H 4WJG3 1IKNC 2J43A 1EMTH 2G5BA 4WKZA 2Y4SA 2X40A 4HC1A 4CW1A 1SM3L 4WU7A 4IRSC 4Z7NE 4V33A 4JG1L 1P7QD 3EJZD 5I18L 1F56A 1KDJA 1KTBA 2XWBA 3FOLA 3NIFB 3GD1C 3ET9F 4PJ9C 5KN5B 2DV6A 4UDUB 5D1ZC 2WNGA 5ESQA 2UYLB 3BHBB 2DWEB 4O2CB 3APFA 3VDBA 3LQAH 1FNGA 3RVXD 1N59B 5B1KA 5I26A 2EDFA 2AI0L 5IG7A 1H3XA 3KGRA 3AU1A 2C7UB 4KXAA 2J8OA 4EN3B 5AVUB 1UCTA 1AKPA 3V52H 2QKSA 1SY6H 4LE8A 2X4UB 1KGIA 3WE6B 1GHFL 4J2QA 4D7PA 4YXHL 4ERSH 1YEJL 3P11L 3H7BB 5BQDA 3NJHA 1NPJA 2A38A 2YGPA 2M8XA 1JYXA 3KBHE 4LCUA 1L3WA 4CVZB 3QA3B 3ZO0A 3VFOA 2ZAIA 4BKTC 2KT6A 4KTGA 4GSRA 4JMXA 3N55A 5DDHA 5FC9A 5KZCD 2PABA 1ZANH 5D72L 2VLRD 1A4CA 2FLRT 5L2KB 3VYOA 1D9KC 1MLBB 2X4RB 5T1KB 5HI4D 4JAMA 4N8UA 2FH8A 1KN4L 1EJOL 3FQUB 4PRIB 4QRBA 4TLTA 4PRBA 4JRYD 4KZCA 3KPSE 4L9DA 1IJNA 1DBJL 2VW6A 4PLKC 3BVNA 4F8OA 4Q52A 3FB6A 4NOFA 3T8XB 2EZ0C 1W0WA 2JK5A 4FLQA 4KRPC 4NQCE 2A6KB 2NY7L 5KS9E 1R3JB 3IETB 1THAA 1JGVH 2I5YH 4PW3A 4MXWH 4TUJB 2Y36H 5BCAA 1J87A 2VXQA 3WTXA 4NUJB 4LHUB 1MREL 4DN4H 2CRIA 1DN0A 1NLBH 1P4UA 1N64H 4Y4HB 2Q8BL 5AWNH 1B2WH 3J07A 4LDLB 5IVXF 2RHEA 2VO8A 4IJ3B 12E8L 1M1XA 2O5XH 1XWVA 5KVDH 4N9GA 4HS6A 3HRZA 4NI6A 1HIMH 4K5PA 3ATEA 2J6EA 3F7LA 4FQIL 5IFJA 2IGTA 4IU2A 1QTSA 4L0ZA 1JBJA 3P3UA 4Y19D 4C4BA 3NJXA 4QNPF 2O4EA 1KZYA 3TPKA 4HGWA 1G9EA 1TMQA 2DJUA 3O6FD 4RGMC 2A77L 2OL3H 2MPAL 5SWSD 4DK3A 4FQCH 5DD5H 2LU7A 2Z8RA 3WNNA 3L3DB 3S7GA 2MCPL 1LEIB 4X6EA 2FWLB 2X4QA 15C8H 3WNJA 4J2XA 2V8LA 2WBJA 5JA8B 2HKFH 4P9MH 4PJHA 1NFDA 3GHBL 3BI9X 4QRRE 4Y16A 5TK2A 3AS2A 3ZMEA 1VFOA 4OIFA 2G2RA 4E41D 3NZ8A 2TSAA 4N2KA 5ADPH 1J9CT 5TGBA 1RP9A 3DC0A 2A7BA 4KUZH 4YAQA 1WFIA 3SCMC 3ZDYF 5FKAA 4L4TA 3M1BA 3PRZA 3TZVC 1UXWA 3ZT5A 3E9TA 4FI8A 3EFFB 2VDLH 4LLYB 1AE6L 1NDGA 1RIVH 2E7HA 1RZ7L 3BVVA 4L1HA 1F41A 4PYHA 2FIKA 4TOYL 3ECWA 4GFXA 4AQEA 4OVUA 3QZWA 2NZ9D 3QK0A 4HW6A 1D6VH 5IQNA 1R75A 2QZQA 2LQRA 1YJDL 1KOAA 4HOWA 5FWRA 1FIGL 2RQEA 4MNGA 2ITEA 3QG6B 5DWUL 4ZTOH 3RIAK 5KSAA 1BYOA 1L7IH 4XE5B 3ZTEA 1D5MA 4OIIH 2WXKA 2XPGB 4PR5B 3MLVH 3NJJA 3OJDB 4Y4KD 1Q9LA 1JMXA 4GRWE 4HCIA 1TG8A 1Q0XH 3EOAA 2VKXA 5GRUL 4EDXA 2GHZA 3FB7A 3FTZA 2J1XA 1QLEH 3H3BC 4K5OA 5FLUA 3OHXA 1Z32X 3K6OA 3FYEB 5C0EA 1KCKA 3KJ6H 4NC2B 1U8HA 4U1HB 3MRQA 3K2UH 3ARDB 3DURA 4RSYA 2AK4D 5JW4R 2ETWA 5JZ7D 5E2VL 1UD5A 2R1WA 4WDIB 4EUPB 4K3EH 3BP5B 3L17A 5ERWA 1EFXB 1PCSA 1C16A 4YSAA 1E3ZA 3NPSC 1KIPA 3EJYC 4X6CB 1KBKA 3LDBB 2A74B 1OKEA 3PP3H 2DLFL 3VWJB 4CU8A 3K81A 3BZDA 2GJPA 3SDXB 4I18C 1Q9WA 4YXLH 3MRPB 3ROLB 5SWSB 4HU2A 1JXKA 5LBGA 5JHLH 1SXZA 2Q7YA 3I85A 3LH2H 3HCVA 3QQDB 1A9EB 1NWPA 3DRQB 3OR6B 4EAEA 4G1MA 2DOCA 5HGBB 1J9RA 2R9HD 1FG2B 3TH4T 5CIPH 5BO1L 4D94A 2PWEA 2AXGA 4Z0XA 2W60B 3T1WA 4AYFA 2QKIB 5TTRA 4AQAB 4UNTA 4AWJC 3CN2A 3OMNB 2UY7B 4JO1L 1QFPA 1OTTC 3CDZB 1U8JA 3BKYH 4HIHB 4QKXB 4AYEC 4Z7OE 2RTTA 1RZGB 3HZ3A 2WIIB 1KY7A 2X4SB 2YHGA 3V0VB 4W9HC 5BZZA 4XP1L 4TNGA 1JZ2A 2ADIB 3A4AA 1H6EA 1DVUA 1QHQA 4UU9A 5CJXC 3II1A 5DUBA 5DMKB 3T08A 1HHHB 1TEFA 1G0DA 1G5GA 5SWZA 3IGKA 4GO9A 2DYSB 3MBXL 5E2WL 3HE7B 1GGBH 3GZOA 5CJQL 1V7NL 4OCWL 3TBTB 3WNOA 1XF5B 4ELMA 3BP4A 3JWDL 2Z91B 4ZAKA 4IIQA 1E9QA 1EAJA 4OCNC 3EADA 4PJIA 4RIRA 2BRQA 3CZJA 3B2UC 4LU5H 3H2QA 4A2FA 1FV1A 2PYFA 4N0YL 4ZUWB 2GABA 5T1DL 2L3BA 4YL9A 4ZFZA 3RX9A 1MW1A 5HYJD 3MLYL 2J5LC 3GDBA 3TASA 3NZHL 3FO1A 4N6RB 4TNWF 5IB1B 1PAZA 4XHQA 3EJCA 3Q1SH 3KYMB 4ZW6A 4WFGD 2EVFA 2IXQB 3FB5B 1QEWB 4D8OA 4K94L 1E8ZA 5TDPB 2WO3B 5CZVL 4J4PA 1PS3A 3PE9A 3B8YA 1WCQA 4POZC 1FDLH 4QCIA 4NN7B 2VITA 5J0BA 3KEDA 1R3IL 2HWZL 2VZVA 5G2NA 3QUMA 1AR1D 2F8OA 5BS0D 3CHQA 3K5RA 2XWEA 3MV8B 2XTJE 4PJ5D 4YK4C 4JM2F 4WZ9A 4U1SA 3T3PB 3UTTA 5HP5A 4XPBH 1G7QA 3G5VA 4WWID 4R8WH 1KTRL 5FM5O 1VFMA 1KMGA 2V4LA 4E5XG 1EA9C 1P1ZA 1F4YH 2VOTA 3MACH 5DLMH 3SQOH 2BSBA 4X9HA 1NEUA 1IGYA 1MRCH 1T4WA 2XG5B 2ICEB 2YZ1A 4G8GA 1NCDL 4NKMA 5GRXG 5I8OL 5L0QB 2ERJB 4OZHA 1F5WA 5AW8B 5IGXH 3FT1A 5GRJL 3IFLL 3J27A 2IWFA 1QRNE 1JGLL 1AO7A 3ECBB 3MRLB 4RESB 3ESNA 3VFRB 3BMVA 4YDLB 1LE9B 5C08E 4PWFA 4OZGB 4MJJA 2ISDA 3NFSH 3QXVA 4BKLB 2J88H 5JOFA 5J89A 3JTSB 1J8SA 1QQDB 2A1WL 2OMVB 2Y7QA 5E9NA 4HKJA 3WE1A 3VXQA 4NBXB 1BZ7A 1IGTA 1M6OA 3EUUA 5FKPA 1UOLA 5BRQA 3U0WH 1KTLB 1A47A 2LHAA 2V37A 3C8HA 5LQBL 1SXNA 1J5OH 2G9HA 2VAJA 3FRPA 3GLAA 2V7NA 4ZSOB 5I6XB 2DKMA 1HH6A 4AQ8C 3L3HA 1GCFA 5JOPD 4AQZA 2NY3B 2AK4A 5CU9A 4WI9A 1JRHI 2IVFC 4ODHL 1CCZA 4EQ2A 2OXHB 3FUHA 4MA8L 4AMKL 3AQZA 3VQLA 2AJXH 2ICWA 2BIQA 3GBNL 5IP4A 1U3NA 4LEOA 5TE4L 1A7OH 4UM8A 2VC2B 3QO0A 4QF1A 3UGEA 1IEAA 1WWCA 3O3DA 4MDJA 3SSGA 1CQYA 3ARBA 1BVZA 2QHRH 4FC3E 1TTAA 3HR5B 4FEMA 3SDYH 5AALA 5B39B 1BREA 3H3KA 3VG9B 1LNUB 4H1LA 3LZPA 4PJAF 3L95B 3UZEA 4G80A 5CN1A 4YE4L 4JZNB 2HLAB 3CDCA 5FLVA 2EH7L 3B9EA 1OCZB 4HEPA 2PP7A 5D2LB 4K7PL 1LO3H 2DTML 2D4DA 4QRPA 3WEBA 1FNEA 4RWYH 5E7FA 4MZRA 1RIHH 1OB1A 3QNXA 4A6YA 1MJUH 3LCYA 3ZXAC 4L2YA 4ZFOB 2WY3B 3AXLB 1VZIA 1XGPA 3GSOA 2AK4E 4H0HB 2XIDA 2WUCL 4MBOA 4YUEL 2F5BL 5F7LB 2VDOH 4TNVK 2K6WA 4GKSB 3S6CA 1HEZB 1MVUB 1R3HB 5FX3A 4DPCX 3B6SB 1GXEA 2H6OA 2WYTA 4YGVA 4ZBJA 2XIBA 3DRTA 3G3LA 2YKLL 4IGBC 3ZKQD 1J10A 3B2MA 3ILQC 3PWPA 5C07A 3GSNA 3VNZA 3VRIB 3WKNA 3QNYB 1HEHC 2UXFA 4WLCA 4WCYL 3HAEA 4CW1B 1PY9A 2DQEH 2WKLA 3SKUD 1IAIL 4QRRB 2C1OB 1CFSA 1XB3A 1SMAA 2H2SC 3QORA 3VRJB 4BSWA 4M6NH 4WFED 3GJEB 3MO1A 4R5VA 4PTTA 5HJGA 3VD1A 4KHTL 5FCUL 1UEMA 2YRPA 3KJ4B 4M8UA 2EDXA 1UACL 5B22A 3VW3L 1EZSA 4NN6B 3D9AH 4TS6A 5CMAA 5C0NC 4NENA 3E6FA 2JIXA 4XPHL 3DOHA 4NYLB 1LO2H 2N0MA 2JKXA 2XN9E 1WFOA 4JDEA 4U31A 5B1JA 2CCWA 2AABH 2DDQL 3IFNH 1KYFA 4L5FL 2FK9A 2CM5A 3CV5A 3F83A 2L7EA 2O5ZH 1OT2A 5M94B 3V2AR 3DROA 1FNSL 4JFOB 3EYSL 4ELKA 2OMTB 5E94B 4CVZA 3RFZA 3W37A 3SCMB 1HINH 3VFUB 4DAGH 2M26A 1WO2A 3GUTB 5JHBA 4OZFG 3UBGA 2K9UA 1CICA 2ZE0A 4FFYH 2WKOA 1SQ2N 2AJUL 4LSRH 3WJLA 4AGPA 1U30A 5CILH 2V9TA 3FU3A 1I1CA 1MY5A 4GQZA 4OUUA 4FYSA 2PNDA 4S0SD 4XHJC 4OCSL 4N0FA 4XMKL 5MEOB 3D39B 4L8CA 1U93B 3CMOH 3DJZA 4ZXBA 3CLEH 4ICXA 4Z0BH 5FECB 3FQXA 5IK3A 5JDSB 4NJ9H 2ZJSL 2CWRA 2CIIB 3WY2A 4I9XA 2OI9C 3GJFH 1I3UA 3OKYA 2NSMA 4XVTL 1TZHB 3VJ6A 1G6RL 4NRXA 2E4TA 4ODBD 2IBGA 3FT3B 2DQ6A 1NGQH 4GAYB 1KYDA 1JS4A 2I7OA 2IALB 2VB5A 1MCPH 3O2VH 3VD9A 2FWOA 2BMKA 1IIIA 4OB5L 2D3NA 1YMMD 4FMVA 1MIMH 4B97A 2C3HA 4FERA 4JPVH 3VWKA 3SBRA 4XZUA 4F7EB 3D0VB 4HJJL 5HHXL 2OMZA 1NAMB 4KY2A 4UOQA 3ZDZE 1RZKC 1XH3A 2DLIA 5ISZA 3O3AA 3EH5B 3V9CA 2ZX5A 3KW8A 2XG4B 5KYYA 3MMEA 1RJLB 1ZT1B 2FCBA 2ENQA 1YNLL 4PGBA 1FO0A 1OM3H 2VISB 1C5CL 4WHTA 3ILEA 3VD2A 1XGZA 3D30A 2XVKA 1D7FA 1MG3C 2AQPA 2IH1B 4YHPA 3SYOA 1IGJB 3DK0A 2UVEA 2C7FA 4JANA 2IAMD 3VXRE 4PRPA 1TQBB 1WS8A 1IBHA 1T5XB 1CT8A 2XX1A 3UDWA 2ZOLB 5I1CH 3HKZA 4OLYH 1BJ1H 2CNZA 4NQCD 3C5ZD 1NANI 1NDTA 2JIXD 3MGTA 4DOHE 4YHLH 2Z93B 3K6NA 3WEOA 4NQVB 5EDSA 2CQVA 4UQ3A 4AUYA 3NZ8B 4QTFA 4YHNB 2QGBA 1QRND 2NR6D 2QSQA 1AVAA 2XWDA 1RVFH 4DP9X 4Y4FA 5HGAA 1DJYA 5IHZB 4MNGE 4N4YB 3RGVA 3TS8A 2NW2B 4I2XA 1DQTA 2WZ6A 3FTVA 3QJVB 2CRMA 4HSCX 4TM9A 4PJEB 1PQZB 3ZL1A 2DYPA 4K73A 1QBBA 3IXTB 5E6ZA 5G4MA 4DN3L 1JPSH 1IFGA 2NNRA 1FSKC 4XX5A 5JNYA 3CZEA 5HVWA 4MQ7A 2PR9A 3NP4A 1XR9B 5T1JA 1NOAA 4X7CC 5C0ND 1L6XA 3GEWB 3V55A 3IRPX 4X5PA 5CCKL 3S35H 1KCUL 1USZA 3K0YA 3GSWA 3MYJA 2JCCB 1QLRA 4UM9A 4ZUUA 1UB6A 2XVLA 3BSZH 2ENPA 1KLGA 4V1DA 2H2SD 5DD6A 4WNQA 3W9DB 1KLUB 1FLRL 3CQPA 4IGBD 1ZSHA 1LYQA 4NKIH 3RDTA 4FG4A 2FECI 4XVJH 5IHWA 4KJPD 2BXYA 4LKXB 1Q8MA 1JZJA 3U2SB 3FULA 4M7ZB 4MDIB 5F7DB 4UOJA 2QZ5A 1HHGA 4JRXE 3TBSA 1NBVL 3H0TB 1X6NA 3P77A 2W1NA 3ABKB 3G5ZB 3MV8E 4Z7NF 3GT6A 3I6LD 3LNDA 3Q05A 4YEFA 3CXDL 3WIIH 4HLEA 1I4FB 3RPIA 3FT0A 2B3IA 1NC2D 3OKEA 3WFHA 1CXFA 2Y7MA 4UV7L 4MJ4A 1JD7A 3QIBD 2COQA 3NH7L 5MENE 2V2XA 1D6EA 5EULV 4HEME 3IMRA 4DUWA 3FKUS 3G5XA 3VCLA 4NB7A 4P48A 1PZDA 3D2UB 5GS1C 3NVQA 2R4SH 3V4VL 4MA7H 5H37A 1TQVA 3HUJA 3MJ8B 3RWDA 3RFRA 4Z7AA 5KSUB 3C5JA 5IW6A 2VLJD 2XWJB 3N9GH 5GGTL 3P0VL 5D8JH 2CJUL 3UAEA 2EILB 3NTCL 2ZNWA 3QDGB 4F7MB 4MCYA 5E4AA 3EBHA 1JPGA 1GSMA 3L08A 4NN6C 4LHUA 2NY0D 1I1YB 1TF4A 1UGKA 2GCYB 1HDMA 5ABZA 1JL8A 4R7LA 1DSFL 2EXWD 3W38A 1JK8A 1OCCB 3W81A 4AC2A 4MS8C 4BFIB 5AD0A 5I5RA 1TUPA 3VXTB 2BSTA 2Z8VC 5I2IA 2Y36L 4Y5VC 2D7QA 2HAZA 1VEPA 2R0KH 4UBDC 1QHPA 4FNLH 2F15A 1YPZA 1MCSA 1RZKH 1S7TA 4HQQH 1D5RA 4OQ1A 5D4HA 1NEZB 4X8CA 5LBVA 5EG6C 3EBIA 3AG2B 1V10A 4JGNA 4M1DL 1MCWW 1NBYB 2YMOA 3K4AA 3WFZA 2VLLA 1VCBC 4NPYB 4Z7VA 1HHHA 1ZLWH 4HKBB 3ERXA 5CJBA 4PP2B 2IPUK 5F1NA 2CLZB 5TE6H 1J8HB 1HSAB 3MCKB 1K4CA 3F58H 1AQKH 3TCTA 3H9HB 1II4E 2WJ5A 4YWGL 5GJSL 1FC2D 4FKKA 3GSVB 3JVFC 4GRLA 4XOEA 4Y1SA 4OQTL 1WJ3A 1KXTB 5EZJB 1JV2A 2EXTA 4IKJA 3LEVH 3T3MB 4EN2A 4FQLL 1IKFH 4J5VA 2H3KA 4O5LH 3IJEA 4FQCL 5DD5L 1DO6A 4NBYB 2GSIB 4HVBA 3PL6C 3UERA 3V0DA 1LDPH 1A7NH 5EU7E 1NM4A 5D2NC 1ZTMA 2MEJB 1AZCA 4PVMA 1L7TL 5D7KE 5E9DA 5FHAL 3NCEB 3PP4L 1EZVX 2P5PA 1BYNA 1UYWH 4KY1L 1NC2B 2P8LA 5ACZA 3QJUB 1NUFA 1U91A 2H5UA 3Q2LA 1NJ9B 2NY5L 4QO1B 4ZMTA 5DZNA 1KJMB 2L7JA 2ITCB 2Q6WB 4DGYH 4M9PA 3RU8H 5E9DD 5IMMA 3RUGF 1IQDB 1MHCB 1PNCA 4M43L 5DJ0A 1NMAH 1OPGH 4Y4KA 4OD1H 1WFJA 3R1GH 1IT9L 4ZO9A 3STZA 1QVOB 3W5MA 4MTMA 3NCBB 1K5WA 4C4UA 1YMME 3ZRSA 3LNGA 4MGXA 1JSYA 1AZNA 3GLZA 4LSQL 3C9NB 3S96B 4MJHA 1AQDB 2YA2A 2QT6A 1QA9B 2ATAA 5DJDB 4X6DE 4Y5XB 4K0OA 5C0EB 4QXUL 2D31A 4BD4A 3NEXA 4JCLA 5B7MA 2JQAA 3BYYA 4S1QL 2GITB 3RVTC 4OIIL 3K6FA 2ZUTA 1AKJB 4IOSA 2F8XC 4DPRA 3ZSTA 3CX5K 1ODAA 2XV0A 3JV6A 4AH2B 1DZ0A 4HUXA 3US0A 2BIHA 2P45B 4OJFH 1ORSA 2FQEA 3UROR 3T6QC 1MW2A 1CGWA 3ULVD 4N8PA 2YMXH 2V6HA 4ENED 3RDTD 3NJVA 5F1IA 2P9RA 2XXGA 3JVGA 1UKQA 4QT5B 3NN8B 5DURD 1MW0A 5D96C 3SOBH 4W9KC 1CVRA 2B4CH 2C4XA 4O4YH 5IJVA 3ROLA 2XJKA 3O81A 3IJ7A 4FJ6A 3MNZB 2YQ3A 5F3HA 4IEFA 3OTTA 1PLAA 3TN0B 3VXPB 3L4YA 2AERT 3EFDH 3BRGC 4GKZB 3DDGA 5C07D 3QDMA 3LXCA 3O8XA 2WBWB 2XUWA 3GGWB 1OP4A 3Q44A 4P3DA 5C0CB 2AVGA 4BKSC 4EOWL 3QHFL 2XZAL 5EUKA 4F5CA 4UIKL 4Y2DD 3EXLA 3EG9A 5IT2L 5KVGH 4FNUA 4AYFB 1CFQA 2PXYA 1XSKA 5F0JB 2HT2C 1LVEA 2BY3A 4KKBD 2P47B 1QSFE 3LB6C 1TPXB 4MRCA 2YMTA 1XF4A 2A0LC 1T7ZA 1B0GB 3QIWD 4N2FA 4GYBA 1NIAA 3EHBD 3W2DH 3CPLA 5L8JB 4KKPA 3U36B 4ES9A 1LO5B 1OF2A 3MRMA 1CLOH 1YLBB 3QIBA 4AK2A 1SN5A 4LSPL 2QL1A 4JG0L 1A6ZA 5DUBB 1PNDA 3QPQD 1MI5D 1DUYB 5DQJA 3GMNB 3VFTA 3UG4A 4GUOA 2BSEA 3MLTA 1OE2A 2QV2A 1DVFC 2OSYA 2X12A 3UOAB 3VXRB 4TULL 5GS0L 5CKGA 2EEAA 1SY6L 2Z7WA 4NRZB 3BGMA 4MHHG 3DPBA 2CA3A 3H1ZA 4IBLT 4N2DA 5DQ9A 1T20B 4PGEA 4ZMYA 4XVOA 4QTIL 3X3GH 4PJFA 3JZYA 2X1WL 1SEQL 1CWVA 2PMZA 3JYBA 4L1LA 4TVUA 4EIZC 3PXJA 3RTQC 5DRWA 4NC1C 3QDJE 1N12A 5AOIA 3U9UA 2EDLA 5A6IA 3AT9A 3U9WA 2BRRH 4M4PA 4PJ8C 5FO2A 4V11A 3QR2A 4S0HA 1KJVB 2AXFB 4PJHB 4AVHA 4PWEA 5AYQA 3D6GA 3D4GA 3DX8A 5KVEE 3QJTB 3S5ZA 1ULVA 4HJ0D 3MLYH 4KJQD 5KG9B 5AVYB 2DWDA 2Z92B 4G1EA 3T8VA 3M1OA 3L1EA 4RBPH 4XODA 3DVNB 3PL6D 2L0DA 5AZ2L 1OP3H 1EHLL 3RIAF 1MJ7H 3QUZD 1XD1A 1QUNA 4OFYA 3G6AA 1A1MB 5DHYB 4ZW7A 1KCVL 3BWUC 1M53A 3EH3B 4BWWA 1IGFH 2OI9B 2FB4L 4Q8BA 4WEUD 3QWRD 1G9ML 4YSTA 5K59E 1SYVA 3SDCD 5C9KA 5CIPA 2N56A 5AWNL 4FJYA 3UTTD 1IGIL 2BNUB 4GP5B 1BV8A 2DIBA 4DVRH 2KLTA 1UWGL 3GTVA 5EBMA 4JM4H 4ZXBB 4FL4C 5KSBE 4RMBA 1HH9B 2Z1KA 4H8WC 4DGIL 2BSSA 3CFNA 4PG2C 3SHSA 3H55A 2IF7A 1BFOB 3MXVL 3RE0A 3SQOL 5I0VA 1ZV9A 3TIEB 2ATPB 4R4FL 5IROC 1C5DA 3E3QE 3KCWA 1J7VR 3CHSA 1P7KB 2PO6B 1H8SA 2Y7SA 5DJ8A 3OKLB 1GOGA 4FXKB 4WGKA 4ZOBA 3VACA 1CXHA 3CHXA 4DKFL 2IQAA 1DJHA 3PGCB 1VF5C 3VXMB 5ICUA 3A67L 1ZT7A 3GSUB 2XQBH 4Q2ZB 2PR4L 4HWEL 1CTNA 2ZX9A 2IH8A 1S7RB 1MFCH 2O93L 1TQTA 4KQ3H 3GK8H 3C5ZB 1WFMA 1WZKA 4NDMA 3QPQC 4D3CL 2J25A 4M8QA 4P4RB 4PPTA 2OXGA 5INDA 2MNUA 3EJJX 3ILPB 5AB9A 2OSLB 1BVLA 4L3EB 1XHHA 3M46A 5E1QA 3K6SB 5EU5B 3ARGD 5J3HD 5IM7A 4ODHH 3MOQA 4G6FB 1O6TA 2YRZA 4UTBL 1MNUH 4KKBC 3RURA 5HGHB 3RB5A 5J1AB 4H8PA 4HUKB 1D5IH 2DQTL 3QEUA 1D6VL 4E41B 1ETB1 3EH2A 5AB2A 5I9QB 1UC6A 3IGAA 3ARUA 1AQMA 1E0OB 2R59A 1HILB 1T89C 2YUZA 2NW2A 1L7IL 1WFUA 1NCTA 1BVNT 1MCRA 4MX7A 1HJCA 3WFCL 1MDTA 3ZZSA 2CDFB 5HHOB 3NGBC 3DJ9A 2D03L 2HJKA 3FU8A 4PS4H 2VDOB 4N8VB 4G6JL 4YHKH 1RIHL 2Z65C 5K1NA 1DQJB 3DXAD 3PIQA 4A2DA 2XN9A 3P4MA 3SJVA 2CAKA 4LPCA 3CQQA 4PV8B 3D48R 3ARDD 1U8QA 5D1XE 1FZOA 4OSUH 1A3LL 1NFIA 3I6KB 2FT7A 4B9CA 1CN4A 3OZLA 4TNWK 4DNLA 1OAQH 3ASOB 3BN3B 3DMMB 5GIRA 5KJ7E 1A3ZA 1UD3A 5EEYA 5IB5A 3O0LA 4HIIA 1EH9A 2ZCLL 1RQ5A 1YEKL 2EIJB 4C56D 5KWYC 5FYKE 3KLHC 3V6OC 5ITFB 4L3CB 5BOJA 2J3SA 3PWPE 3OKOB 4W4OA 3GLEA 5HI3D 4MB5A 5GHWL 5B1BB 3ZTJH 1F6AA 3AREA 1BVOA 1XF3B 2WVVA 4ZK8A 2ZPKH 2FEJA 4BRVA 4JFZL 4N6RA 3ZZ1A 4HXAH 1SEBB 3C8KA 3QNZB 1CICB 3X2QB 3NG5A 5BO1H 5IKCA 2YPLA 3D07A 3T4YB 1BEXA 1K3IA 4DUVA 4NJAH 4Z7UB 4YXKL 1G4RA 4WKXA 3MOBH 4X50A 2AKRB 5E6IB 1MSPA 4WI8A 5F6HI 4JDTL 4ZNEA 2UUDH 4NUPA 4IOIB 2WHVA 3CUPB 5MEOA 3KYAA 4YPGA 2FLMA 4S1SL 3BP7A 3OG4B 5C0IA 1J86A 1ZS8B 4N3TA 1JWMB 2YUWA 5ETUB 2EE2A 3P4NA 3Q6GL 4LVOC 4XP1H 4AUUA 1B0WA 4TVPE 3SJVD 4F20A 2A6IB 1Z9SA 3ARSA 2BOBA 3FFDB 2FWUA 5B1CA 2DMCA 3RTLA 3SGDI 4BFOA 2OTUB 1YYLH 5EZLA 3MTXA 3H6JA 2NY4D 5J6HB 1M05A 2JKSA 4IDJL 4YO0A 1WP6A 1I1AB 3MBXH 4HETA 2R15A 3T09A 3BZ4B 3HE6C 2QLVB 3NABL 2LGNA 3GWJA 4KX8A 4PJ7B 5C6TH 3D18A 4FQXB 3FPYA 1ITBB 1T22B 4PVBA 4KAQH 4TLSA 5H2BA 3STLA 4HS3A 4PJDB 1XGYH 5LN4A 4P5MA 4Q6YA 1YPZF 5J6GB 4Y16C 1RSFA 2BXZA 1NBCA 5FYKD 4K3DH 3TCLB 3T0AA 2PYED 2QADD 2QV4A 3FCSB 3OJMB 1HXMA 2WYIA 1MCKA 3Q1SL 4LLQB 4YZFE 1INQA 2WTRB 2ZOKB 1KN2L 1QWNA 4ODVH 4P23D 4R90H 4UTCA 4ALAL 2XI9A 5EO0A 1CDJA 1X5FA 1WWWX 1YVLA 4X6BB 3OXSB 4JGMA 3SKNB 1PU0A 4OLWL 4M1CD 2FVNA 4BE5A 2VLMD 1F6FB 3KW7A 5T1LD 4WW2C 5JQIB 2IFFL 5DEFB 3LPGA 4N28A 3CH8A 3O3BA 4PIBA 1MRFL 5E5MB 2ARJB 1UJ3B 3IK2A 2QTVA 4X8JA 2ZF9A 2X09A 1A4AA 4HCRH 1J5DA 2R7EB 3CBKB 4WV1A 1EZLA 5JPNB 4BFGA 3QG7L 3BE1H 1JCVA 1M7DA 2YXWA 3ESVF 4JRWA 5A16B 1YDPB 5TF1L 5JHDA 1B4RA 3SDAC 3PUCA 3OV6A 2WXFA 2R4RL 3WUWA 1S9WB 3MACL 2H0JA 1F6LL 3X1EA 3KVDD 2VSMB 3HZKA 3VFNB 5D7SL 1MJ8L 3H85A 1NCDH 4BA8A 2AQRA 4HC1H 5IBLD 5JHMA 3GBEA 3WY1A 5D2NA 4FKHA 3SDXF 3MV7E 4MD0B 5FUZL 3SKOA 5IWLA 5F71A 2NSQA 2YGQA 1RIUL 5ECJE 4EN3A 1F90L 2VLKD 1OGAA 2OTWB 3ETBF 3DLQR 4R0LC 2P8MA 4GUCA 1IQDA 4YL4A 5DJYA 4MNHB 1ZLSL 3C60A 1VFBA 2GT9B 2W0LA 3CN1A 3FBKA 3GKWH 5TH2B 2ARWA 3LQZA 4KRLB 3EOYG 2XZQH 3KLAB 1UD2A 3NCCB 3W82A 2Q2LA 3UIZA 3EGXB 3IT8D 3QBTB 4JPKL 1KUMA 4GIAA 4ADGA 1UT9A 4GI6A 1WA1X 2G3MA 3L3IA 3PWUB 3GXMA 2R2CA 2B7DT 3AACA 4HJUA 1EMTL 3DUSA 1WZLA 1J5OL 1VGEL 1C7TA 4Y5XA 5E8DH 5BMFH 4Y8DC 4QPEA 1BQUA 4B9ZA 4DEPC 2WO2B 2NY2C 2UX6A 4U6YA 5F1KC 4HHWA 3CNKA 5DC9B 1T83A 5FYJH 3TO2B 2NPLX 1ZHKB 3BHBA 3UAJC 1KDIA 3RUGE 3A23A 2H26B 5HHNA 3V6ZB 5DSCB 1JZ7A 5DJCB 3BO8B 1U8PA 4M7LT 2APFA 5IMLB 4Q4EA 5LGKA 3MFFB 4LVOB 3UBXA 4ZMWA 3MV7B 2KKQA 3IDMA 1JK9B 2EYTB 4FQHA 4DEWA 5ID0B 4DKTA 4IHOB 4N0UA 1WVZA 1DDTA 1MQKH 4LVHC 4U1IA 2FJHB 5IBLC 3HE7C 3P11H 2DM3A 5ICZB 1D5ZB 4W6YB 2QDWA 1XVSA 2EKJA 3ULSA 1BPVA 1MCOL 1JNHA 3TBCA 4A2EA 2ICWI 4JB9L 4KDWA 1XXDC 4L1DA 2OCCB 3HRZB 3BQUC 5DO2D 5ESAB 5BS0E 3MJ7B 1DYZA 1JUFB 4WI3A 4I3RH 1Y6MR 3VVWA 4YSCA 4ZPTB 1JK8B 1K8IB 1CFQB 2PXYB 4X98B 5DFVD 5T3XD 3LZQA 5EU7C 2KQMA 3LYRA 4AENB 3IDIB 1J1PH 2KZ1B 4N26A 4P2OC 1BMWA 2XVGA 2F58L 3NCXA 3WL9A 4G8GE 2VLJB 3N1MC 4XPGH 2AS5M 2DL2A 1NGPL 3VG0L 2CPCA 4JY5L 3MRMB 1TCRB 4H7VA 3SKJL 5HHPB 4AIEA 3IS1X 4DK5A 2DRUA 4AJ0A 1A7PH 1BD2D 4IMLB 4P2RA 5CJXA 3WHXA 1FO0L 4XNBA 1LO2L 1HKFA 1J1XL 4XXWA 4MAUL 3VI3A 2AABL 2M2DA 2KC0A 2ZT9C 3GFUA 4M3JA 2CK0H 3ARRA 1WG3A 3SN6N 3LZNA 1CYXA 3O9WB 1HKLH 1N4XH 4Q56A 5KVDL 5CBAB 3K8LA 3QUMH 4WWKB 3IF1B 1IGML 2VTFA 3F58L 5KJRH 4EZJA 3U9UB 3ARYA 3N40F 4OGYH 4LSRL 1BXAA 4WTWA 4FADA 4WW2F 4NXKA 1CT8B 4ODTH 4HIEA 5CILL 3H42L 4NNPL 4M48H 3MGTB 1H3UA 1E7VA 3KDMB 4YJZL 4HHAB 2WBJB 2QMKA 5IVXE 4MYWB 15C8L 3IS0X 1NC2A 2HT3D 2GBUA 3JWOL 1IRAY 2LLGA 4JY4A 1Z9NA 3FO2B 4I18A 2E4FA 4OZFH 3RZCB 2PPDA 1T1ZB 2VO5A 2UV3A 3RGVB 4AC4A 2VL5A 5DJ0B 4PJCE 3TJEH 4Y4KB 4JFDA 1BZ9B 3DVFA 5GRVK 1CFTA 1Q9KA 3N1GC 4XPFL 3ARVA 3BH8A 4PLNC 4PY8J 4CKQA 1DUZA 3SE8H 4W93A 1VZHA 3TA3C 1EGJH 4FXLA 1VA9A 4PRAA 5DZAA 4TSAH 1F02I 2KERA 3U4EB 3C09B 1FSKB 4UUJA 2BS71 3Q8EA 5C07E 2PW2A 2YC1A 4NZ8A 1EEQA 2A74A 3OZKA 3NK3A 2BVPB 2D31B 4RZCB 3FN9A 2FX9L 2JJUA 1EXUA 2NUPA 3QZPA 2EO1A 1H8LA 2LFEA 3LKRA 2IPTL 2XXCB 2JK5B 4Y9CA 3UTZB 4KROC 3IAPA 3SGJA 9CGTA 2YD9A 1UM5H 3G08B 5D4QA 1AXTH 3VVVA 1BMGA 4AEIL 3V9FA 1Q0XL 1ROCA 4QT5A 2X3AA 3BGFB 3IDGB 2AJVH 1ZWIA 4P9HC 3QXAB 1RUPL 2BOCB 3B7SA 2W07A 3MRQB 1BAWA 3H0TA 1S7RA 1FYTB 3D51A 5ITBL 3GTTA 5HYJB 5GSVA 3INOA 2H9GB 4KUCD 1SF3A 1C12A 1OAXH 2F19H 5EZIL 2ZYIA 4R96A 5C0BE 2ZXQA 2X0VA 1JZ5A 4O4YL 1KYOK 3ZKMD 5KS9F 3VXSB 2ZCHL 5CLYA 1KFGA 4NQCA 1Z3GL 2KUTA 3CE1A 1KBPA 3JWOC 4JFPB 4ONGH 1YC7A 5BXFB 3DTUB 3S3SA 4H4NA 1IAOB 2QSCL 1KF9B 3D2UA 2WTOA 3F05A 4LLUA 3QE5A 4A55A 2X87A 4KFZC 3NQIA 1RCYA 3L2LA 3FQNA 5I16A 2O1AA 3AQXA 1LEIA 1HHKB 4N25A 2VN6A 2JJSC 2Z7ZA 4HUVB 3CPLB 3T2OA 1KG0B 4LHUG 3EOBB 3L7EA 1OSZA 3Q7JA 4DETA 5K33A 5TGBB 5DQJB 1I85C 2EVIA 1DVXA 4N2LA 1C08A 5AD0B 2J73A 1V05A 5I8KH 4OLVL 1V3LA 3N41B 3PV6B 4JL2A 2X6BA 3J8F7 5D1XC 4L4TB 2FATH 4OLXL 3B8SA 1GY2A 1VB9A 4JKLA 5BS0B 5C92A 2K6YA 3UACA 4PJFB 4G8EB 4JZOA 1NCNA 3ELQA 4KZDH 3VGGA 4QR7A 3I75B 1MCDA 2V5MA 3LZFL 3REVA 3P2BA 2R27A 2Y07L 4ZUSA 5AL0A 2BIMA 1WT5C 3O6FA 3V0WH 5I15H 1HOEA 4TSBL 1N7MH 1X7SA 2X2JA 2YS4A 1JZHA 4O02A 4F80A 3QDJA 4JCMA 3T0EA 4FYRA 5C0FB 3OJ2C 4LGPB 4MNGB 5EO9B 2BZ7A 4I5BB 1E43A 2F68X 3TBYA 1LO0H 4ZAKB 2OMBA 1N6QL 1GCYA 4ES8A 1HQRA 4XP6L 2E7DA 3CG8A 5KG9A 4GG8B 1I9JL 4ONHA 1IC4H 2N3JA 3CVHA 1PFCA 1XF3A 2WVVB 1CURA 2ZICA 4Q6KA 3MJ6A 1IKOP 3BAKA 1RMFH 2EQDA 3WY3A 5MP6H 4AM0A 1A1MA 4E9RA 3BAYA 4QXWA 1EEYB 2VRAA 5DK0A 4R97B 4OZGA 5JOFB 1H6TA 5F6HJ 5B7FA 4EF3A 4H8HA 4ODWA 4DP6X 1QQDA 1REIA 5CSZA 2JH2A 2BNUA 2WSDA 4WF7A 1P7QB 5E9AA 5EUOA 3DO7B 3KPNA 1DE4A 4A7VA 3TF4A 3TEYA 1R0AL 1B2YA 3MLXL 3EFOA 1KGCD 5FM5M 1E5ZA 4PRDB 3O6FC 2FB4H 1LP9E 4MWFA 4BZ1L 5C86A 4HDIA 2GFBA 4X9FA 4OUOA 5KTEH 1E4XI 3KEHA 1L4IA 3GO1L 4I0PB 3WUZA 5F93C 1RZJL 1XO8A 4UIMB 4Z77B 4LBEA 3GPEA 4HAGA 2CO2A 1Q1PA 3EDEA 3QI9C 4JCWA 2QQLL 3OKLA 4HG4K 5AB0A 3AB0C 1NGWA 3F5WB 2R39A 2WQWA 3IRCA 2UWEF 3ROOA 2FX8L 4H20L 1PLBA 3GSUA 3V8CA 3CCHB 3GHEL 3BPLB 4JFDE 5HDBB 1JXJA 4BDVA 1AHMA 1QFWM 3L95A 1ORSB 3NAAH 2GJ6D 2EINB 4XMLH 2E56A 3PHQA 5EF0A 4KMLB 5E23A 2HLFD 4GRWF 4G9FE 2A1WH 1QPPA 5IW1A 2QSVA 4JPWH 4NUJA 2XZCH 1QO3A 2DM7A 3X11A 2DI7A 3A4FA 2NQDA 1THCA 1EXGA 5E24E 3EO9H 3GK8L 3IDXL 5CD5C 1XAKA 4W4NA 5HVGB 4IRJD 2UXTA 4HP5A 3B6SA 2N7AA 4XOCA 2AK4B 3DECA 1D9KD 4YGVB 4P46B 1AAJA 3QEUB 1O7DC 5DJAB 1Q4NX 1JXFA 3Q9QA 4APQB 2VR9A 4AMKH 1I7ZB 3B3IA 4IIQB 4G7YL 1DBMH 3SE4C 4M7KL 4GY4A 1J48A 3R1GL 1JMZA 2WQVA 4NQDB 4FABL 4D9LH 3PWVB 3APMA 1QR1A 2CXKA 1JG9A 4DK6A 4F2EA 2W59A 2G30A 4XBEH 3KG5A 3VFNA 3QFJD 2VXQL 32C2A 4OCMC 1DQJA 4UAHA 2WLZA 4JBSA 2HP4A 1GKOA 2GG1A 2W92A 3SBWA 3QJXA 5DHVH 5D70H 2OTWA 1W80A 5AUMA 4XGZA 4M6OH 1W72A 2E76C 2EKSA 1TZIB 4GSUA 1YY9C 2CUIA 3V7MA 4ZZKA 2PCPA 1KXQE 5LB1A 3W0WE 2ADFH 2EADA 4IKLA 2EH8H 1Y0LB 1UXWB 3HB3D 5B21A 3ULUE 5C0RL 2YKLH 2C9SA 2VERA 2CZNA 4OSUL 2XCMC 3BZFA 4ZXBD 2OSWA 4ZS6D 5FGCE 4IRJA 4GRWB 4XMPL 1O7DE 2KBGA 1IKNA 2ICEA 1E28A 3WDJA 4UNVA 5CEXB 3ULUL 5K9OB 4X83A 2ZCLH 1SJXA 3DOSB 3Q2WA 4FXKC 2K3HA 2OMXA 4OTXL 1T03L 1G5AA 5HDBF 2OW6A 3MV7D 2E27H 2CHDA 4UQAA 3G04B 5CINH 2A3TA 1DDHB 5HJ3A 3VFRA 2FSEB 4XPHH 5E00B 4PJFE 5EC1B 3AC0A 3HZMB 4J8RB 2FQGA 3MV7A 4KI1A 2PCXA 1IAMA 3A6CL 4L4VE 4YDKL 5EORL 3TONA 2A9MH 1F4XL 3VXQB 1UXLA 1IFHL 2VSDA 4G3YH 2HPTA 2ZX7A 4Z7OB 2BZCA 2V7HB 3GXTA 4CN6A 1IMHC 3DARA 1CMOA 4A04A 3UJIH 1L0XA 3VWKB 3OHXB 2XC8A 3P4NB 1FLTX 2K70A 2WUBH 1FNSH 3VSQA 4KMTL 3FT2A 2WYHA 5K9KA 2A6IA 3HFMH 1YN6A 2HFGH 4NO2A 1MHPL 3RNQB 1GA2A 3DURB 2I26N 4XN7A 3RILA 4D7BA 3V4PA 4CRPA 3WS3A 2VQUA 3AWGA 3PXLA 4GXUM 1I1AA 1ZXQA 4LESA 3MN8A 5EBMB 4EMZA 1RJCA 3D7PA 3CZGA 3K4DA 4HUUB 3SD2A 3MAWA 5JDSA 5FECA 2L8AA 5B39A 2Z0BA 3KPSB 3SQBB 4LLWA 5CEZH 1GAFH 3WKMH 2MRYA 3UXFA 2HSIA 4NRXB 3V4LA 1A9EA 1BYPA 4RSVA 2G4EA 4RFEB 1F8TL 4G5ZH 3LV3B 4XO5A 3SY0A 3L3OB 4LSVH 4UDTA 1U6AH 3BIAX 4KPHH 4UQ2A 4IMLA 1TPXC 3KXFD 5J06A 1KTCA 1TQUA 2CMRH 1P2CB 4GKSA 1KGJA 5CJOH 5HHXH 1SN2A 2OJEA 3OKNB 1S9VB 1FRGH 3D39E 3BOVA 5FGBA 2N0KA 3DI3B 3ZHNA 4PB9H 2EXWC 3IDUA 4GRLD 1KBGL 2Q86B 4C56A 3O4LD 1DL7L 4TVPD 1XDTT 3VXUE 2N1KA 3BIBX 4JO5A 1KN2H 2UZYB 3BEWB 1RK7A 1YN7A 4CJ0A 3ZKXB 5LCVH 1A7RH 3KPOA 1OVZA 1TQWA 4BSWB 3JV5A 3DKHA 2VDRL 1TEGA 5HDBE 3RKDC 3QZMA 3LIZL 3M6DA 1H3WM 3CGTA 4ZUUB 4OGAC 2DQDL 3NSJA 4AYBA 3AB0B 4DVRL 1Q94B 3ZL4L 4NYLA 4NZTL 1WZMA 3EKCA 4XXCA 4FQXD 3LIUA 1L0PA 4W9GC 1QW8A 5EO1B 5FM8A 5C8JA 3RDTB 4X2UA 4PJIB 5AZEL 3ULVH 1RULH 3I9GL 2YPLE 4XNYL 5I9QC 3IMBA 3NK4A 4W9FC 2IPKB 5DRNB 4FMKA 4ZUTA 4CADA 3BYTA 4NNYB 4YQXL 4RFNB 1M7IB 1U3HD 4XN5A 3FFCA 3G5ZA 4MNQA 5D1XB 2XQYK 4EI5C 1I9RH 4PUBH 1I3GH 3ALWA 4NT6A 4DN3H 2CO3A 4DKFH 1CS6A 3P30L 4WUUE 4JZJA 4PRHE 3EJSA 3VXUB 2DQHL 2BO0A 1ZSDB 2V2XB 4HWEH 1QZNA 4K15A 4MRBA 1WC7B 5D7JD 3D39A 4JFED 2X1QA 2EC8A 1F4AA 3QARA 5DD0H 2OFQA 3BPCB 4XCCH 1PG7H 3QUXA 2VXSL 4IMKC 1KLGB 4V1DB 2C9QA 1M3JA 4U1SB 4DP2X 1A6TB 2PLTA 1UFGA 3B7YA 4X9GA 4QLWA 2AEWA 3DHMA 2FQFA 1YY8A 3FZUD 3NEEA 4ZI8A 3JV4B 4H88H 3BKCL 1ZLDA 1OANA 1V55B 1MNUL 4LDOB 2ZWZA 3FSVA 2JJVA 4M3KB 4BK4A 1O5DT 1MWAL 3OVUB 1FFTB 2ESVB 3MC0A 1FPTH 1KBVA 4P9HL 4AEHH 3QNZA 2QPDB 4X0KA 5KYUB 4G9FB 3WFBH 4U3HA 5IFHH 4JDZB 4FD0A 2VERN 4BWUA 2CGRL 4PYGA 1HK6A 4TMPA 4LCWA 1D6EB 4FHBD 3NH7H 5F70A 2CJTA 2VLLB 2OMYB 5C0JA 3KJ4C 2BW4A 1KTLA 1KB5B 4LLUB 1X4XA 4F57H 1KJ3H 1ZLUK 3KE0A 3ZZLA 1KWKA 3FDWA 3SDCA 4GMTL 2I07A 3H9SD 4ZTPL 4JFFA 2QSTA 1NFKA 3CFUA 1KG0A 4AOFA 1ZLVH 1B90A 2FNBA 5DQDH 4WJ5A 3ZR5A 2P24A 4YHNA 5DZVA 2R56H 4BQBA 1WGVA 3QI9B 3BDYH 1AC0A 4JO8A 1K6QH 2GCYA 1JF1A 1TQBC 1J0IA 4OQTA 1LP9B 1E6OH 5FYLH 4MDJB 5HHOE 5K93A 1YJDC 3BPOC 2AGJL 4AI7A 1CBVL 4BFEA 3VXTA 1TYRA 3HE6A 4JY5H 1PZSA 1IEBA 4PGCA 3VSTA 1X6LA 2F7IA 4ZDHA 3AW5A 3BKMH 3FONA 1J18A 4RMTA 3WTTA 4PJDF 4ZS7H 3KPMB 5LGYA 1WWAX 3QUKB 3FQYA 4PJAE 4YHIB 5JW3H 5LGJB 4NC1E 1NCAL 5IVXB 3HG5A 2XKSA 4F2MA 2P46B 2DIAA 4U3CA 2RR3A 4JQIL 4NJAL 2VMDA 1JTOA 4EZMA 1ZJBA 2X3CA 3CH1A 3T0EC 3IGFA 3L5IA 4FQ1H 5D1QE 3AG3B 2I7SA 4G8FA 1GW6A 2X7LA 1Q1JL 1E8XA 3H9YA 4LB8A 4M8RA 3K72B 4S1SH 2CO4A 1CD1B 1PYWA 1AS8A 3D8MA 5EBLA 5JXED 3MJWA 4KFMA 3U6XS 2BVOB 4Z7QB 2GI0A 2R0WH 3NCJH 3LNHA 4MCMA 4EI6A 2YA0A 3PPEA 4PD4J 1SHWA 5CSBA 2WGNB 3RWFB 1KYUA 2FEEL 4X9YA 1JFHA 1N0XL 5J11C 1JWUA 3JWOH 2WWMD 2EIZA 1NCIA 3NA9L 2DIJA 4HMEA 4Q58C 4WO4C 4PBXA 2WW8A 4JO4H 4RISL 1CXKA 2H6PA 3NABH 4YH6A 1BBDH 4I8DA 3UEZA 1VPOH 1UYWL 3DV4B 2UWEA 4KY1H 3TESA 2XPZA 1UZ6F 1BF2A 2CU9A 4GP4B 2GEEA 1DCLA 1DE4B 2NY5H 1GGCH 1C5BL 2XXFA 5IEHB 5DK2A 2NUPB 1NAML 5D7IB 3VGAB 5A6MA 2CUAA 4BEIA 5IJVB 5LGHL 1T7WA 2OMTA 2QELA 3QAQA 1ZTXH 3QDJD 4PJCF 3MREA 1G4MA 4TUOA 4ZO6A 2BK8A 4BQCA 1RUQL 2Z8SA 2W5PA 2XWJA 4NX0A 1S7UA 2FJFA 3IBEA 3M17B 5GS0D 1DHKA 1P6FA 5E2JA 3MRNA 3TYGL 4JX0A 4LSQH 4PJFF 3MJ9A 2XRAH 4E42B 4QHNB 2JJWA 3IDGA 3ARQA 4DJMA 1U41A 2GVYA 5CXPA 2QDVA 1I1YA 4OLWH 3KR3H 1H15B 1YECH 1DQVA 2QQKL 3CK0H 5HYFA 5IJDC 1ETA1 1HEJC 3OMAB 4XH2B 3R4RA 1E2WA 5JPMB 3ME0A 1ZHKA 4AH2A 4HK0B 4ABWA 3QYMA 1XCTA 4WNJA 4YFEA 3ARTA 4Z78A 4QHMA 5IMLA 4ANKA 3HZYB 1S7XB 5T3ZE 2GI7A 2QPUA 4YC2B 2JKLA 5CAYB 1KV7A 1A0QH 2RCSH 3VQMA 3Q13A 1AO7E 2BJMH 4FCHA 2AQ1A 3UG3A 3ML9A 3WMPA 4NAQA 4OZIA 3JYCA 5K9JH 3ARFD 3B9KD 2Y1VA 3ABMB 1JXGA 5I19H 4L4VB 3HMXL 1KELH 2J1WA 3EOBA 3L7EB 2VISA 3L3KB 4WJKB 4ZW5A 2AANA 3GRWA 4PS3A 2IQ9L 4XBPA 2NOYA 2COVD 3SGKC 3MXWL 4ODUA 5KUKA 1PY0A 1GIGL 1R24A 1BG9A 1PDKB 1CLZL 2B0SH 2EIDA 1LK3H 4RVBA 4XC3H 1BVKB 3FT4B 2CDGA 1UA7A 1IARB 3D3VB 4LASH 4L8SC 1WBZA 4WTZG 5ILTH 4HJGB 5GPRA 1B0IA 4KK8D 3U36A 4OCXL 1WAEA 1H3TA 4MJIA 4X42A 3S5LB 1M6UA 1XSJA 1UCBL 1YYMH 3BGAA 3IDNA 5H8DA 5F21B 2XT1B 3CAFA 3A47A 3LTVA 5SX4I 2OR9H 5I1DA 1X5IA 3BD3A 3GBDA 3F62A 1RZPA 4P5SA 1D7BA 3R0NA 4FQJH 3EYFA 1QRNB 3MRIB 1OCOB 5AZUA 4KROD 5D55A 3D08A 5D7LE 4DVBA 3KCPA 4FG0A 5JIIA 1T66C 2XWTA 3I50L 4JRYA 3A0OA 1P6WA 4WFFD 4WFHE 1SOKA 3NDYE 4WWPA 1YMMA 5CEXA 5KS9A 4IBSA 3TA3A 4ALAC 1ZLWK 2P80A 5DURB 3OWRA 1ZDSA 5SWZE 3PJSA 2NRDA 2Y0SA 2LVCA 1LO0L 3BQUA 1AKJA 3LDBC 5F3BA 4HYTB 1E6JL 2ADJA 3QFJA 5B38G 2W8CA 3TA3D 3TP4A 4ZO7A 1MRDH 2VABA 4J8RA 3RKDD 1EUTA 4WO4D 5CSZB 5DGRA 3S88H 1Y6KR 2AXJA 4KVNL 5DJ6B 4LVNB 4WUUB 2V7HA 1J1PL 5GGTA 3KWVA 5MP6L 2Z92A 3EFOB 2JNZA 3ARED 5TD4A 1AZRA 4NKOA 4PBVC 4Q9RL 4Q6IA 1XGUA 2V8MA 3R18A 1H8OA 1T4KB 4NHUA 4AEEA 5ESQB 3N44B 5KBPA 1CICD 3GB7B 3P77B 4KZ0A 4HUNB 3RQ3A 4IDLA 3QEGL 4LARH 4NDMB 4P49A 4S1RL 1PEZA 3EHBB 1IQWL 3BD5A 4M8QB 4X4KA 1R0AH 2WAQA 1R1CA 4P3CL 5IQ9A 2R51A 1VGKA 2D73A 5D2LE 3MNDA 3ARFB 3B9KB 1HYRC 3F5WA 1I1RA 3IEAA 2WMPB 4MAUH 4Y9BA 3T0ED 4DN4L 1QWUA 2HH0H 2B15A 2QADC 3MRJB 2NNAA 4NFBA 5IM7B 3FB8B 3MA7A 3TIDA 2LTQB 3BZ5A 1R17A 4R7VA 4UT9H 1U8KB 1HKLL 1WDAA 3JWNC 4MB4A 5I6XC 5C6PB 2CDEA 2OMUA 12E8H 2VN5A 3FQ2A 2YN5A 3TIEA 2VW4A 1A6UL 3VI4A 3BRDA 1C5DB 2BH0A 1UOVA 3I02A 3NRFA 1I31A 1JNNL 1P4BL 5L2KA 3HE6D 3LSOB 3MV9D 3JSSA 4EQ3A 5JW5B 4EIGB 3C60C 1A7QL 5BVJA 5DTFA 2PTTB 4HFWA 5DS8B 4PRBB 3LRMA 2OL3L 1CDIA 1I9IL 1INEL 1JHKH 4AQAA 4YIQB 5D9SB 3VXRA 3VFGH 3SYAA 4K9EC 3UPCA 3Q2NA 3P1VA 2PW1A 3NJIA 3GHBH 5DJZB 3IKKA 4APQA 5E1AA 4YR6B 3O8XC 1RUKL 4PHXA 2R0ZH 1ETZA 3LPWA 2XN9B 3P4MB 3U7WH 2ZP0T 2VDKH 2CKNA 4GEIA 1QSVA 2V9QA 1DN0B 3L54A 4WV1C 4XB3A 5ISZE 4XCYA 1K8DB 1W72L 2AQNA 5BZWA 2CHXA 5HGHA 1CF8L 4ZO8A 2OULB 3PJNA 1SMDA 3NJGA 4G5AA 4D0BB 4M7KH 1LEGA 3OKMB 3FUNA 2DW5A 4Y1AA 3IJHB 1KXTA 3TBVA 4GSXA 2VH5L 3IGAB 3W1ZA 1F1DA 5IWLC 1BECA 3K71B 7PAZA 3CFJB 4XGZB 4NOBA 5D7EA 5GGQL 3LRHA 4G1EB 3T2PA 2ZAGA 4Y9EA 1YJDH 3KMDA 4CADB 3HHSA 1EJOH 4K71B 3SDDA 1S78C 3NP3A 2J6WA 4X4ZA 1DBJH 2ERJC 1A4BA 3FZUC 4Y19A 5EOCJ 3HAEG 2N01B 5MERA 1WLHA 4N2AA 4O02H 1BLNA 2JKTM 4YHKL 3WTSA 1XGQB 3SQRA 5F7HA 3WHE1 5I5MA 3BSGA 4PY7A 2J56A 1A4JA 1U4FA 2QJDA 3LQMA 1EO5A 3LKOB 3UC0L 5GGUA 3O45B 4E5XB 2VITB 4TQIA 3SBPA 1ZS8A 1HXKA 1NGZA 5A2AA 2BP8B 3PAZA 2ODHA 1VCAA 3DMMA 5DMGC 5GIRB 1ZHNB 3O41A 5C0RH 3T0EB 4QYAA 1TNMA 1G7PA 5FA3A 2WN3A 4F33B 3LPPA 4YBQD 5EUOE 2WZPA 4CMHC 3TBYB 3HC0B 1AR1B 1A6VH 3GS0A 5INCB 2XZZA 2DKUA 2DS4A 1T03H 4HF5L 1ND0B 4YO0B 1AGBB 1F6AB 3MCLL 2IBBA 2BX5A 5EF1A 3MKKA 3TZVD 4OF5A 1OAKL 1YUKB 1BEYL 4CGUB 1EVUA 5JHLL 4NQXB 4B0MM 1HCYA 5DK0B 4XVSL 4Z7NB 3CN3A 3CC5A 4WWKC 2WOBA 4P07A 3GM0A 4Z7WE 4I4WB 3SPVA 25C8L 2A74C 1OAYL 2OMYA 3DMMC 3OD3A 1JPTH 3U4BL 3HG3A 4DSYA 5IR1A 2OR7A 3MRCA 5AVSB 5CBEB 3KPSA 3WNPA 4KUZL 3QEQA 3U46A 4U3SB 3Q6GH 4I1NB 4KZDL 3VXPA 5AW9B 2AI0H 4UYPA 3HBZA 3I84A 4GKZA 1VENA 5E5RB 2ID5A 3SY0B 2WCSA 4AXWA 1P7BA 5E5LA 1GYCA 4LCYB 4LEOB 4OKVA 3FOMA 3BZ4A 3HI6L 4L8BB 3ZE2F 1TYJA 4F3FB 1AGDA 3FTUA 3KLSA 5AVQB 4P2RD 3QO1A 4ATTA 2J8HA 2X9YA 4YDNA 1GGBL 5CJQH 4QAWA 3PPSA 4XI5C 1IM3B 1VIWA 2DF3A 4X4MA 3PHQB 1G43A 4LLVB 4A1RA 4J3UA 1JN6B 3LH8A 3MRRA 4EZLA 5J6GA 2VM3A 2VYRE 3RIFK 4JG9A 1M9SA 4KKAD 3GLDA 1BFVH 5IJBC 3KPOB 3MLVL 3S3CB 2PP8A 4K3DL 1CE6B 1OB1B 5CJOL 4A6YB 1U8QB 5KUMA 2W91A 4N0YH 5T1DH 4NCC1 3AXLA 3KL0A 4WSJA 5F88A 5KYWA 3NUKA 2H32B 1KPUB 5I1HH 3HHMA 4ORZC 4PB9L 5C97A 4ODVL 5JQ6H 1X7QB 3VXME 4K3HA 2NY7H 2CGYA 2UY6B 3OMZA 5D4IA 3RIFF 1WEJH 2ZOTA 1UWEL 4CC1A 5IJCC 4NQEA 1BA9A 5DWPA 4ZMQA 4URTB 3DX9A 3KPRA 3O2DL 2GTZB 5EF2A 2ICWJ 3RVWD 2YPVA 2DY2A 3DX7B 5MENB 4MSWA 1T3FB 1AS6A 1MREH 3TYFB 4PGEB 1P5UC 2HWZH 1CDCA 1BXXA 1N64L 3BN9C 3ULVF 4ZX5A 2KZWA 5FA4B 2R2HB 4YSQA 3F7QA 2R2BB 2H0PA 3WUWB 4B27A 3QYCA 1W8NA 2PYEA 4BV1A 4R4BB 4XVUD 2J12B 5IKCB 4PJ8D 5JUEL 1W9XA 1A1NA 1TDQA 1OZUA 3KYNA 4NRYB 1UD8A 4H20H 3GRWH 4KBPA 3U79A 2YPKA 1S9XA 4U1GB 2P8MB 5HDOA 1CXEA 5HHQA 2JJTC 4P4KD 3IU4L 3ARZA 2DD8H 1R5IA 2DTSA 3N40P 2BSRB 1RJYB 4XPTH 3P30H 3GSRA 4UWQB 2HKFL 3L6FA 5L8KB 3GHPA 4Y5VA 2X4OB 1QEWA 4KDTA 3QP3A 2BOBB 1VKXA 2XZCL 3BPLC 3D34A 3E8UL 5DEJA 4XRCB 3TT3H 1CG9A 4QHNA 2UZXA 1GL4B 3LJ3A 1YY9D 4DZBB 5JLZA 3FT9A 1JZDC 5KVFH 5DRZA 1GZHC 2CIKB 5JORB 2DEWX 1ZCRA 2LU3A 2OMXB 4XAWL 4QNPE 5BO0D 4XH2A 4G83A 1N19A 3G04A 5E6RB 5FF6A 3OC8A 3F6LA 1CXIA 3TH3T 2VXVL 4PP1C 5EC1A 3HZMA 3SYQA 2X28A 4IBVA 3HPJB 4LPUA 3W56A 5D71L 5I1IH 2XG5A 4G8GB 5ICXA 3P9MA 4QOKA 1X9RA 5BQ7A 2NQ3A 5T1LB 3KBPA 4OBRA 5DEGB 1N2RA 3O6MH 4MMYA 4ZYKB 2XQYA 2D9CA 2VLRA 2W80C 5A7BA 4ZTOL 2EDNA 3HVNA 1T0NB 5LNEA 5I24A 2CGRH 1MCJA 1X5JA 4ORGB 5D70L 5KYXB 2EH7H 1Z5HA 2DEYX 2XKUA 4NQED 5BV7C 3EO1A 5K5YA 1EHNA 1F4WL 3U6RA 5KYYB 1HI6B 3O9WA 1SPDA 4PM1A 4RWYL 1L9QA 1NGYA 2ADYA 2FO4B 3HA0A 4F57L 5JW4Q 3FHEA 4EN3C 4HG4J 4ZTPH 3RDTC 1LL1A 1PDKA 2IV9A 2VDOL 4WSGA 5JPNA 3RA7L 3F7YA 3WGUB 4F9LC 3D2UD 4UZUA 1FE8L 4R7XA 2F61A 4HOZA 4FFZL 4H44C 1SHSA 3K2MC 5KSBF 1D2OA 2YEQA 4I13B 5GZOD 1X9UA 4QTHB 2EP6A 1JDCA 3S5LA 4URKA 5FV1L 5IQ7L 1TCRA 4XPGL 4RFEA 4YZWA 1E6OL 5LGJA 1KGXA 3L3OA 4R7NA 4N8CL 2NXZC 3SKJH 4BSJA 4JW3A 1T1ZA 3CDFA 2YSSB 3QFJE 5IHZA 1BZDA 2YA1A 1A7PL 3CH1B 1CDYA 3VU1A 3PWJA 4XO4A 1TZGL 2VSCA 4P4KC 1PTZA 5TH2A 3ZE0B 4H1LH 3A6CH 4YDKH 4H25B 1Q9KB 2L7QA 2Y25A 5HDLA 3CFDA 1DJZA 2DAVA 2AMGA 2BHYA 5HJBA 1SXSA 4WKZB 1KXHA 3QEHB 1ACZA 2XTJD 3HI5L 5D7HA 5I6PA 2WUBL 3H9SB 3THML 3X12B 3DUSB 3AG1B 3EJTA 4HIXL 4F8LA 5AKVA 5T5FL 4JREB 4AL8C 4LRNL 1H5BB 8CGTA 5IMOA 1TMCB 2X10A 4M4RB 4MMZC 3ZY7A 4OGYL 4AQ1C 5B8CC 5JXEA 2W65A 5D1QB 3BN9D 2JKIS 3US1A 4ODTL 4FFYL 2D0FA 3QCTL 1DJXA 1GMIA 4J3TA 4GAFB 1Z0MA 2AZAA 3MDJA 3QHTC 3QUZC 4GXUN 4I18B 5B3JE 5EBGA 1XX9C 2QQQA 5CEZL 3AXHA 3DGGA 2VDQH 4FQHB 5ID0A 3WIFB 5DK2B 4LKXA 4A7TA 5I8EB 4K7PY 4RISH 4ZUTB 4P46C 1AGFB 1S7VA 2RBLA 4LQFH 1FORL 4YHMH 3NFNB 4KKLC 4Z7VF 1G6RH 1A3RL 1ZPUA 3SPHA 1I9EA 4TPRL 4Z7UA 4B9KC 2AQQA 5I30H 2WNWA 5JMOC 3WEXB 4DH2A 3LKQB 3U4EA 5BZDB 3S37H 3VWKC 3CUPA 1DJSA 2WQAA 3JV0A 4MMZA 4NQCB 4LL4A 2C9VA 1H15A 2Y6SC 3UZVA 1CTMA 3VXNA 1XZ0A 1I8LC 2ZUSA 3CD4A 2NX5D 1YUHB 3PP3K 2GJZB 3HNTH 4PJ7E 4RAUA 3EBAA 3VSVA 2OMNA 2OMUB 4AENA 3L7FB 1MCNA 1U2HA 2A6KA 1C5CH 1UVQA 4R7DB 4JKMA 4ZZFA 1YY8B 4P23A 1TFPA 1W0VB 3D3VD 1JCKA 1RHFA 1DCEA 2DQEL 4BQ8A 3D69A 5KANI 5BV7B 2K0RA 2AJVL 5FYLD 5DUJA 2X6UA 1D5XB 1MOEA 4NZTH 5EEUA 3S3PA 3K7UA 4JRXB 1QACA 5GSVB 2DMBA 2JTYA 1KCSL 4D9RD 5I6LA 2DQIH 3L3KA 2XFGB 2W95A 1OK0A 1AP2B 2PWDA 4QRPE 1OCRB 5J9PA 2WXPA 1JI2A 4JZOB 4B41A 4W9ZA 1NBYA 1PVHA 5F7MC 4U4BA 2WLKA 1FN4A 2F7OA 1Z3GH 1QAWA 5JIQA 1MFAL 2VR7A 4YFLF 2P7TB 4U2ZA 2WTRA 2ZOKA 4G2AA 5DC0A 2QSCH 1OOWA 5F1NB 5FUCE 2R29L 3QJSB 2BFGA 3D85B 4G7VL 2MCG1 3O9WC 2FHBA 1RJLA 1ZT1A 3MV01 2IQ9H 3U2JA 3QUHA 4GAJL 3OPUA 4ABUA 1T21A 2G2RB 4EJ1C 4F8QA 4X99A 3P40A 4ZQKB 2FUTA 1WGOA 2BP0B 3HOGA 1WAPA 3RJDA 5CCKH 2R7EA 3H9ZA 4Y2LA 1C08B 3CMOL 3NJKA 3CDGB 4TNVF 2ZCKL 2CKBH 4UZSA 1QFWL 2VRQA 4OZGF 1W8OA 3BIKA 2DQFA 3N85H 1FPTL 4GW4B 3CVHH 3IPFA 1WZAA 5E2UH 4W81A 3X14A 3LQAL 1MCPL 3O2VL 3IAGC 2RJMA 1U92B 2VN7A 4AJYV 4DGUA 1ZTXE 4G42A 3MV9E 3UG5A 5KW9H 2XPYA 5C09B 1Y18B 1G6RB 4YE4H 4QD2E 2DLGA 3VD4A 4OZIF 5CP7B 3ESPA 2VW7A 3ALPA 3CSFA 3SDAD 1R33A 4UV7H 1F1GA 3L9BA 3N1FC 2WQUA 4GAAA 4OBSA 1DBAH 4GXVL 2Y1AA 2AEQL 3NSFA 5SV3A 3HHRB 1ZOXA 4GMTH 3MZTA 4WTXA 3L3GA 3U1QA 2JJTA 5AYUH 4ZMPA 1ZANL 2EVJA 4APXA 2HG5B 4U7MA 4Y0GA 4NQSB 2WNXA 2ZXWB 2IDSA 1U58A 3N2JA 1QLRB 2J2ZA 1KXVC 3MGOB 4HV8B 3V6FA 1AQHA 4JPQA 4YDIH 3VXOA 4DTGH 2A73A 5E8PB 2WLYA 1UKTA 1RZ8B 4KVNH 2OJ1A 3VD5A 1KB3A 2KZKA 1TJHL 4IJTA 4E41E 4QIRA 2FBRA 4UM9D 4CDHA 2AGJH 1NH6A 2DI8A 2ZSWA 3EXJA 4WHDA 3U1SL 3VRLE