1O9ZA

F17-ag lectin domain from escherichia coli (ligand free)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
177
structure length
170
Chain Sequence
AVSFIGSTENDVGPSLGSYSRLPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSSRYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords F17-AG LECTIN DOMAIN
publication title The Fimbrial Adhesin F17-G of Enterotoxigenic Escherichia Coli Has an Immunoglobulin-Like Lectin Domain that Binds N-Acetylglucosamine
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 170
sequence length 177
ec nomenclature
pdb deposition date 2002-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1o9zA00
2BS71 1ZK5A 1O9VA 1O9ZA 3F64A 2BSCA 4K0OA 1O9WA 3FFOA 3F6JA 2BSBA 1OIOA 1ZPLA 2BS8A
chains in the Genus database with same CATH superfamily
4RRPG 1W0VA 2ZXAA 2WBJB 4NJ9L 2QDWA 3PIQA 4KRMB 3RX8A 3ULVH 4J3VA 1N3NA 2BC4A 4JG9A 4RWYL 1V5JA 2IFGA 3GNML 4MCZA 3VE0B 4E9TA 4NNPL 2IBGA 2VUYA 5F89A 1G7QA 5M7QA 1HWGB 5CLZA 3SD2A 2XQ0A 3K5SA 1R3JA 4WNSA 2G60H 1NSNL 2ZX9A 1VESA 1CFNA 1R5WB 1N5AA 4LSRL 2YD5A 4YWGH 5A2IH 2AVGA 1AQDB 1U6AH 3OV6A 4PP1C 3SIKA 2ATAA 5DJCB 3FTUA 3MXVL 5KJ4A 4L1SA 3UAFA 2J56A 1SLXA 3KGUA 3MRDA 3HLAA 4XHJD 3IGUA 2VRKA 4PGCB 3JV4A 3KYNA 5SWSE 3CC1A 1XDTT 3QA3A 2QGEA 3ABLB 1T0OA 4MNHB 5DRNB 4TF4A 5AZUA 2DLHA 3SDCD 2R4RL 4CGUB 1NL0L 2BJMH 3AY4A 4H44C 3S0PA 3QDMA 1XFPA 2CALA 4YGAB 2DI7A 3UGXA 2FHFA 2A9ML 4MJ2A 2YWZA 2YD8A 4JFZH 1HH6A 4XOBA 4M7JL 1BVKB 3FXIC 3U4KA 3FFCA 4F57H 5FHBL 1JZ6A 3VQ1C 1OTSD 3F7KA 4FFTA 4GRWF 1FCGA 5E56A 3MNWA 5BOJA 2NW3A 1AFVL 3WKNA 4WJG3 3B6SB 3U4EA 1D5BA 4KI1A 1NAMH 3O0LA 4IBWA 1U2CA 4HS6A 2A9NH 1PKQA 3QH3B 3T2PA 4D8OA 4R84A 4XPFL 4Z3IA 1IBBA 3MNMA 4UT6H 4V33A 1H9DA 3SY0B 2P4AB 3LN5B 1CE1H 1QSFA 4IGBA 3UO1H 1IM3D 4PJ9A 1AHWC 1B4LA 3BDBA 1MG2C 3O6FC 4GYBA 2F15A 5GRZA 2C3GA 3FB7A 3QWNA 1CXHA 3UTPE 5KAQF 1ZAGA 4I0PB 3FB8B 3GHBL 3EOBA 4M00A 2WWMD 4EN3C 5JOEA 3LV3A 3NFSL 2OX5A 4EZKA 5ID1B 2CIIA 2HLAA 1OWWA 2ZUUA 5IR1A 3CN4A 5AW5B 3V79C 3QUKA 1MHHB 2HB0A 4JN1L 2HRPL 1LE9B 2WY3B 4PJIE 5EO1A 4PI0A 4ABQA 2MOGA 5DURD 5KVGE 1QO3A 1GPOL 2ZXCA 1M1SA 2CJ3A 2H1PL 5BVJA 3TBCA 3MRGB 3ETBJ 4JPIA 1LXMA 1S78C 4GXVH 3X3FL 3R4RA 3C87A 5IIEB 1C5DA 1MI5A 1FPTL 3GKWL 4IM8A 4NENA 1B0RA 4W9LC 4DSYA 3A47A 5JA9A 4DP7X 3SKJL 4LL1A 4OQTL 3CQQA 4FC3E 4JKMA 4EIGB 3NT0A 1U3HC 3ARBB 1K8IA 3KVQA 4HK0B 5GPRA 1F3DJ 4WO4B 3LMJL 2AJSL 2CLRB 3QQXA 5HVGB 5IFJB 3FH5A 1D5MB 5C8JA 2WUCL 2QVIA 3JV0A 4MQ7B 1ZPUA 5DJ8B 3B83A 3UX9B 1H6EA 4QT5B 2L7QA 5I1GL 1OAXH 1XAKA 2NY4D 3NPSC 2EDHA 2XJKA 4UNVA 5JHDB 2ZCKH 3C08L 2DF3A 1IAIL 3QVAA 3SKOA 4K3DL 1ECZA 1IGJB 4NKIH 4ZYKB 2Z31D 1LJMA 5EO9B 1A3QA 3JVGC 4Z7WA 3VMOA 3VH8G 4H20L 1EHKB 2R1WB 3HC4H 1FHGA 4XBGB 4K2UH 4UV4L 4LU5H 1ZEAH 2MSPA 4NKOA 3U0PB 2OFQA 2ICCA 3FRPB 1TJHH 3LPWA 5IB1A 2Z0UA 4AIOA 5HPMB 1AQHA 4GRWH 3EYUL 2ED6A 5BVPH 3DBXB 2P80D 1FBIH 4QMEA 1HCYA 1JPGA 2BWQA 2IPKB 2X6CA 2O1AA 1W0VB 2IQAA 2ZKYA 2OP4L 3PIQB 3CH1B 2NSXA 2QELA 4Z7UF 3KBFA 1N3NB 2BC4B 4HBCH 4JN2A 4P46D 1ETZB 1A6UL 4HC1H 1JXFA 4MCZB 2LV4A 3MBWA 2IPUG 4IRZA 1Q0XL 3BVUA 2E47A 2EC8A 5F89B 1G7QB 3RVXD 1R3JB 2F7RA 1IGMH 3C2AH 1CFNB 2COQA 4LPXA 2B39A 5EO0A 4BFGA 1A4JA 4WF7A 5IB4B 1N18A 2VDLH 4LVNB 2R4SL 2NY3D 1P4UA 5FA3B 1R0AH 5CHNA 3WXWH 2FGWH 4ZW7A 1DDTA 4BFNA 5JW4Q 3HLAB 4X4XA 1BJMA 5C9JA 1V05A 2R1YA 1G6RL 4PY8J 1A1OB 4AI7A 4OI9A 5AUMA 1JF6A 1GSMA 3KYNB 3FT1A 2RBLA 4F5CA 1ONQA 4Y4KC 3QA3B 2PPFA 3HI6H 1X7SA 4DUVA 1EZUA 1ZLUK 4LNVA 4BCZA 4Y8AA 2WZ6A 3QDMB 1QNZH 2G30A 2XN9D 2AXGB 2FAUA 1HH6B 2AFNA 4EPSA 3MV7D 4X7DC 5EEXA 3H0TA 3APDA 1YNKL 2UWEF 3L54A 4W1TA 3FFCB 4YPGA 5F96L 4F8LA 5CJQL 5E2TL 1IGCH 5HHOE 3D3VE 3KL5A 1X4YA 4P05A 2F0CA 3ZTDC 1YO4A 4GXUN 5JW3H 3MNWB 1ZIBA 3ARZA 3NIDB 2NW3B 3VM5A 2ICWI 1T2QH 3IE9A 1F90H 2BHYA 3QQ3A 1RJZA 4YFLI 4C83A 2BIIA 1D5BB 1E4KC 2W60A 4HS6B 2CHNA 1OO2A 1BVOA 4QRAA 5B3JF 2WO4A 5BRZE 5KS9F 4X8CA 2YK1L 3PFUA 4LDEB 4C4UA 1J8HE 1E3ZA 1ML0A 1QSFB 1J88A 3O4OC 2DM7A 4IGBB 4PJBF 4PJ9B 3VA2C 1M6OA 2ICES 4HH9A 4PJXA 1CICA 2VB5A 4PRDB 1E50A 4WTQA 2H5UA 4GKLA 4YSPA 2FBOJ 3P9LA 3N1FC 3EOBB 5ICZA 2NDGA 3QRGH 1YEEL 4RESB 3SDAC 4DETA 4D9QD 1KENL 3NFNA 3LV3B 2OX5B 2X10A 4JO8A 2CIIB 3NA9H 5AOLA 2HLAB 2OMBA 5IR1B 2DQFA 1E30A 3U6RA 1RD6A 1CN4A 5EO1B 3RIFK 3HAEG 4UU9B 4YHMH 4BZ2L 3K0YA 4PMFA 2BSSB 2EE0A 4OI8A 1AXIB 3UZVA 5BVJB 2IGTA 1SDDA 2X2JA 1CFVL 4POZD 1ET8A 1H15A 2XPGB 2J5LB 4MA1B 1C5DB 1JN6A 1MI5B 1UD4A 4N0RA 3MGOA 3V0AC 5BQ7A 4NENB 1HHIB 1NCGA 5KJRL 5AZEH 2ZXEB 1NWPA 1O7DE 2BWIA 4FMFA 1N6QL 3EZJB 4LSSL 3MV8A 4OLVH 1K8IB 5ICYA 4JHVA 4XX5A 3BEWA 1JYNA 2CO7A 4Q6IA 4ETYA 4O02H 2ARJA 4OUUA 4FXGB 3CFEA 4WAFA 5DEGA 2EXWC 3APFA 3S36X 3SO5A 5CP7A 2X05A 1D9KA 1BOGA 1CR9L 2EYTA 3D06A 4AGQA 3SKOB 4QTHA 1KTRL 1J10A 1OP3H 1OSPL 2Z4TA 4DQAA 1WD9A 1EHAA 3RL2A 4Z7WB 3HG3A 4I8DA 1P2CA 4FTDA 3PJSB 4JDZA 1BAFH 5FYLL 1JWUA 4G6KH 4NKOB 5C08A 2HLFD 3WS3A 3IJSA 1MF2L 4GUOA 4X4ME 4FNRA 4YXHL 4APQB 4WW2C 2BP8A 4NERA 2E7BA 1KWKA 4PS7A 4EEEA 1KEGL 1NCWH 2YSSA 5F7HA 4X7CC 2Q1EA 1FGVH 4N0UA 2R56H 4JN2B 4ZS7H 3WI9A 4U1SA 2K6ZA 1MHCB 2IADA 5F9WB 3MBWB 5GGVL 2CJUH 2H1XA 3TGXA 2G3NA 5HJGA 1CICD 1XL6A 4WI3A 1G1YA 3GHPA 5E95B 1QFUL 4JKLA 4YHYC 3NCJH 1WAAE 5EO0B 1L7TL 1OGPA 2FTAA 3C60A 4WWKA 2N1KA 5D5ME 5MEQB 3L5JA 3HRZA 3SDYH 4PN6A 2Y9RT 4FXKB 2J88L 4PB0L 3MUY1 5CHNB 4S11A 2XZQH 1FP5A 3LZRA 4JVWA 5C9JB 1QFWM 2BVTA 4FL4C 2R1YB 5ELIA 2OTPA 3BW9B 5AUMB 3V0VB 4G71B 2J73A 1KBPA 1KG0A 1ONQB 1MJ8L 5K9JH 2Y7SA 2YLKA 4UYQA 5D2NA 5DZVA 3OAUH 3CN2A 1KCRL 1MCJA 3L2MA 1AXTH 3K1DA 4QXUL 1JZIA 2H2PC 4AXWA 1WAEA 5GZNC 1I1FA 1YEKL 2DOCA 3TNNA 1LNUB 1P6FA 1G4RA 2R29L 2J72A 5CZKA 3ZE1B 4FZ8L 4XODA 3IU3A 2P52A 2E86A 3H0TB 2CZNA 4YPGB 2B0SL 5GS0D 2DKUA 2FBRA 3KLAA 4MA8H 1SHXA 3CQFA 3PAZA 3V4PH 1RULH 3WELA 1UB6A 4M9PA 2FYYB 3QG7H 2PP9A 4HG4J 5CEZD 3QQ3B 1RJZB 5B4MD 5TQ2L 4C83B 3NCBB 4QJ5B 5C6WH 1HHJA 1T1WA 1YZZA 1CDYA 2OSYA 3QCUL 1IGYA 3FQ1A 4PGZA 3Q0HA 4PSRA 1D9KD 2OYMA 4TVPD 5C7XH 2OR9L 3EO9H 3RILA 4K8RC 3N06B 5TE4L 5EBLA 5DVOA 3QR1A 1BVNT 5BCAA 3FCGA 1II4E 5DLMH 1M3JA 4E5XG 1UM5L 4HH9B 5KYWB 5CN3A 2BP0A 3GK8H 3DRQA 1OCOB 4PRPB 5CZVL 5DJDA 4FHKA 5ICZB 3DVNA 4WW2F 2ZPKL 4DP5X 2FX8L 1ZT1A 3NFNB 3WFDL 4PJIF 3EGDB 4JFVA 3QDJD 3EDJA 3NJFA 1I1CA 4I3SH 1VEMA 2DQFB 1DBMH 3U6RB 3IMTA 1EIBA 1M7DA 2KZBA 3I74A 4NZ8A 1IVLA 5AKSA 2FUTA 1SDDB 4MAYC 5FUOH 2PXYB 3O8XA 1H15B 5EB9A 1ZLDA 2LU4A 3B4NA 2CJSA 3QXWA 2OSWA 1BF5A 3MGOB 1JGUL 4MDJA 2J1WA 2F18A 3X3GL 4H8VA 4OBRA 1I85C 1PS3A 4E9WA 5KZCD 4PWFA 4WVRA 3MV8B 3BN9D 4WWKD 5ICYB 1EK3A 3TA4D 4LDLB 3OKOA 3N1PC 3BEWB 4EZLA 1IEBA 3IJYB 1WHOA 3NQKA 5IF0A 5DJAA 3V6BR 2ARJB 3PUUA 4OUUB 3PJLA 3TV3L 4PJDF 3IBOA 3QI9B 2XZCH 5E4IA 1GY1A 1WFTA 5BV7L 4W9ZA 4WU7A 1G94A 4Z7VF 3ESPA 4QTHB 4EVNA 1GC1L 3GSNH 3PWVA 5A1AA 3F2LA 3FUNA 1L9QA 5DUJA 5I1KH 2XV3A 3RL2B 2GB2A 2AABL 3WTUA 1P2CB 4YLBA 4JPWH 2VLKE 3VXUB 3C6LC 1EJOL 1JWUB 5C08B 2DQEL 1JGLL 1J5HA 1MDAA 3WS3B 1KYOJ 5E94A 2EDXA 4ANWA 3IJSB 1GA2A 2FEEL 3DX2A 4XVJH 5F0JB 5I19H 4QTIH 2ZWNA 4RGMB 1CLCA 4D0CA 4G2AA 2YQ2A 4XP5L 2MKLC 4X8XA 2KDYA 2YSSB 3MO1B 3HG1A 4JREC 4N0UB 1INEL 2EH8L 2DTML 4DP0X 4N0CD 4U1SB 2IADB 3KGRA 3PP3K 4EUPG 2IBZX 5FYKL 3MRMA 3EYOA 2ESVE 2NYYD 3ISYA 2VR7A 3DGDA 3K6SA 4K71C 4QOKA 1U8IB 3M17B 5KVDE 4FLRA 3VMNA 2H3KA 4CBZA 1ZGLM 4K4KA 2PCFA 3C60B 3V4UL 3HRZB 2VDMH 4M5ZL 5IBLD 1HH9A 2B3RA 3W37A 4PD4J 2R0WL 4N2HA 3CUPA 4G6JL 3K46A 3ILEA 5A2CA 5BUPA 3BMVA 2W95A 4CMHB 4K5LA 3MDJA 1RSFA 1JYXA 2BDNH 3IRZA 2F5BH 4HC1A 4FLQA 2I5YH 2WO3B 3MZTA 3UABA 3O8XD 2FHBA 4FQHA 1LK3H 2ZNXA 4HHWA 3QJQB 2Y6SD 5CZRA 5C3TA 1I1FB 3SY6A 1TQSA 2HA1A 3KPRE 5ALBH 2PPDA 1JK9A 1Q1JH 3IU3B 4GBXD 3AT0A 4KRPC 2IH1A 3ZDYB 4ZX3A 3AUWB 3E1ZA 2VJXA 3KLAB 1P4BH 5IVOA 5A3ID 4PTTB 1LO2L 3CDFA 2YD0A 5CUSH 3S35X 1KXHA 3WN5A 1OW0A 4PLKC 5AL0A 1UASA 4B9KC 3OG4B 2Z8WC 1F2XK 4I77L 3CFMA 3ZTJH 1OF0A 5JIDA 1IGYB 5JYMA 1FO0L 4DKEH 3QYNA 5GSVA 5EBLB 3T0XA 3BUQA 2TRYA 2XZAL 5I8KH 1HZKA 4EDXB 3EJSA 3HMXA 4P2QA 4GS7C 4PUBL 2BP0B 4PJ5D 1JHKL 1FZKA 1WIOA 2YD3A 1UVQA 3DRQB 3GI9H 4LPWA 5SV3A 5DJDB 2UY7A 4R90H 5BPPA 4YDLB 4JZJA 5CJOH 5EZPA 1G0XA 2LU3A 1JNNH 2WXLA 4OFDA 3BKJL 4EBQH 3UC2A 2Z93B 2BFVH 4X8JA 4FABH 3PPSA 2COVD 2RIKA 4XO8A 3W2DH 4I18A 4K8RH 1M53A 2DYPA 4PM1A 1P6WA 4U31A 4XC1H 1CF8H 2V7NA 3MX0B 3O0RL 3PDGA 3HG1D 1W16A 3NJGA 4IW4C 3WY1A 3KWVA 4YC2C 5EU6A 5LAPA 4DO5A 5JIIA 5EZIH 3Q8EA 4FX5A 3RZCC 1J0ZA 4FNQA 3LEXA 3EH5B 5AOIA 3WFHA 2X89D 5D7SH 3T3MB 4XMPL 5GZOA 4J3BA 1EDHA 4GXUM 4N2KA 2YPLD 4G1MA 5DUBB 1N7MH 5IHUL 1OPGL 3QHZL 2X4SA 4FFZL 5DJAB 4L2YA 2MHAA 5J1TC 3FHEA 3K8LA 1AMXA 1YECL 5E8PA 3PHAA 3RX9A 5JPMB 1RERA 4WU7B 2WBKA 1UJ3B 4I4WB 2Q0ZX 4EVNB 4IBVA 1RXLA 4ZFOL 3PWVB 3RGVA 6FABH 4RMUA 3G7TA 3JZYA 4HIJA 3TJEH 4XCCH 2JMRA 1Q0YL 3E6HA 1D2OA 1SXNA 1CUOA 3II1A 5DJ6B 4LEXL 4NJ9H 5ITBH 2KYIA 5E94B 1BVLA 4LIQE 4KXZH 4C56E 3PWNA 1GRWA 3QIBA 3WBDA 3LZLA 2Y1ZA 4RWYH 3GNMH 4A38A 4CN1A 4NNPH 1BX2A 4M9OA 4YSEA 3OWEA 5I2IA 2K1MA 5HD8D 5A2AA 1ZSHA 4LSRH 2ENYA 1A6AA 2FX9L 3DOHA 1CD9B 2HXAA 2XV6B 1IV8A 3A5VA 3ASWA 3EYOB 4LVHB 4WTZA 5D5MF 5FV2A 3K6SB 2EDOA 4QOKB 3TCLA 5JW4R 2PO6A 2WVVB 3BVDB 4KTDH 4GRWB 1QP1A 1A4KB 2X4QA 4XH2A 4NSKA 5T8IA 3K7UA 3LD8B 3UPRB 3WAJA 4GFTB 1RUPL 4MGXA 5TE7L 3TA3C 3CUPB 2BMKB 1NL0H 4U6HA 5J9PA 3DO4A 3SN6N 4JY4A 1KC5L 3MBED 1NFDE 2A9MH 1FFOA 2AXHA 2Q3XA 4FJYA 4U1MA 5E23A 4PCSA 4AMXA 4M7JH 3STLB 5FHBH 3UEQA 4AKQA 3AB0C 2Z6FA 3ZIYA 4Z7QE 3WNLA 4Y16D 4AK2A 4OF8A 1OGSA 4KHTL 1AFVH 1JK9B 2HUHA 2PP7A 1M42A 1NCAL 4J3OC 2AKRA 3T3PF 2G75A 4TL4A 5CXPA 4GO8A 3SDXF 3OKNA 3FONB 1MCKA 1RZGA 4XPFH 4ELMA 3TC9A 2CXKA 3OJVC 1NFIA 5KSBA 4PJHE 5EPMA 1KBGL 3TBVA 2IDFA 4FI6A 2XHNA 3EW3B 4HUNB 2X12A 1EBPA 3GHBH 4U3CA 2O5XL 3MKGA 5GSVB 4AM0Q 3LDBC 4NQDE 3VJ6B 3NIFF 4P2QB 3NFSH 4NZUH 4EOWL 1P7QA 1FZKB 1UD5A 1UVQB 2UY7B 1G84A 2XLLA 4DK6A 1X5AA 4JN1H 2HRPH 1UHVA 4JZJB 4I0KA 3GRGA 5DEZA 3BGAA 4ZMVA 1GPOH 3ARFA 1UXMA 2H1PH 2VJ8A 3CHSA 1A6PA 4KJPC 4OCNC 1VACB 4X8JB 5T1MA 3OVUB 3X3FH 5IJVA 2DM2A 1I8UA 4OZFA 4I18B 1BSIA 1UEMA 4BSVA 1FPTH 2DYPB 2ZAGA 3GKWH 2AMGA 3N50A 2V7NB 1DQDL 2DD8L 4O9HL 4W9EC 3RIAK 2PWEA 2C9UA 4MQXD 3SKJH 3OQ3B 4OQTH 1REIA 5KVFE 5I30L 4MYWB 5K33A 5FLUA 4D7PA 4KOCA 5F44A 5EU6B 5HHPB 2R59A 3LMJH 2AJSH 3OJDA 2DW5A 3VFSA 3TPUA 2O6CA 4PH8A 43CAA 2WUCH 2Z3FA 3LEXB 2OI9C 4FNPA 3RPIA 1LQSR 4JFQB 2WIIB 2F54A 3ARGD 3JTSA 3CHOA 3MODL 3FUHA 1M05A 5H94A 2PO6D 1MW0A 2B08A 5I1GH 2JJTC 3BRGC 4MD0A 4G1MB 4JO2L 3D4YA 4K5PA 4P5TC 3C08H 1IAIH 2X4SB 5IGXL 3KVPA 4KPHL 2MHAB 3KLHD 2NQ3A 3OG6B 3UROR 1JWSB 4IDJL 5AAMC 5E8PB 3VACA 3GFUA 2VQ4A 2DKSA 4JEGB 2P47B 3OF6D 1NC2D 3V4VL 3K2MC 4ZMWA 3N1MC 3VRLE 2ENSA 4H20H 4HCRL 2DIAA 3PL6C 4UV4H 5D7LE 1X5FA 3RGVB 2DB8A 3SE9L 1KIRB 3EYUH 3G9AB 3T0WA 2JKLA 5GGTL 3WJJA 4JFFE 1QAWA 2CSPA 4XVTL 4YIQA 1HHHB 2JCWA 2OP4H 4GG6E 4P04A 5K59F 1P1ZA 3GS7A 2E7HA 3F7PC 3QIWB 3PWNB 3QIBB 3TO4A 2YBGA 1J8RA 4X6FA 1SNRA 4RFNB 1A6UH 4ETQA 1Q0XH 5IHLB 2QPDB 2YFOA 5I2IB 1ZA6A 4QHKI 4FAAB 1TQBB 2J57A 5IHWA 1A6AB 2IOMA 2R4SH 3LEYL 4N28A 1JV5A 2N7SA 1CTOA 1YUHA 2X4OB 3S2CA 3PWPA 3BUYA 1SUHA 1DQQA 4NKMA 1G6RH 1NIBA 3CXHK 3QWRA 3ZE0F 3K91A 3HZMA 2X4QB 2X44D 4XH2B 2B9AA 1FL3B 5I74C 3UGEA 3W9EB 3FDWA 5HPOA 1CDBA 1E4XI 4IMKA 4PLJC 3DI3B 5J9PB 4U6HB 1BYPA 2VLMD 4Y0GA 1FFOB 3B7YA 1IFHL 3UTTA 5IVXE 4Y4HA 4JM2C 1YNKH 2XRAL 5F96H 4XN9A 5CJQH 5E2TH 2X1PA 1WUZA 3ZT5A 4PJAF 2XWZA 2BOCA 3GRBA 1USQA 2L4OA 2VWEE 2WQRA 1CGXA 2AKRB 2F54D 2WWNA 5FGBC 5C9KA 2G75B 2VL5A 3B2UD 1TJGL 3OKNB 1RZGB 4ELMB 1NFIB 1AGDA 5JORB 5KSBB 1RZJL 5EPMB 1BXUA 2EINB 4P48A 4JFYA 3X2QB 1MFEL 1P4LB 4JRXE 3GRWA 4GAJL 3RE0A 3TEYA 2EIZA 4PJ8C 3NSDA 1IKFL 4KZ0A 1D7CA 1YEEH 1PY0A 2P5EE 4DPCX 2JTDA 1KENH 1MWAA 1LK2A 3NCWA 1TQUA 3ZE2E 3AXLA 3B7TA 1P7QB 1ZVYA 2UZXB 4KGLA 4OFPA 1HSBA 2QBWA 2IMMA 5HGBA 4LLQA 3V4PB 2YD9A 5FUCE 4BA0A 2H6PA 3WENA 4OF0A 4BZ2H 1IAMA 3FT4A 2OV0A 3ARFB 5FR3A 2V33A 2W0FA 1GYAA 5T1MB 5DS8A 1CFVH 4YHLL 5IJVB 5BV7C 4P06A 1KGUA 4TUJA 1R5VB 4OZFB 4BSVB 5KJRH 2P28B 2FWOA 4N2FA 4OIIL 5I9QB 5D6CA 4RZKA 1DVQA 4ICWA 4Z7VA 3AG3B 3WJLC 1N6QH 4LSSH 3RTQA 5DK0A 4JPQA 5DZJA 2DQHL 3EJTA 4GXFA 4RIRA 3VFSB 2DPKA 43CAB 4BH7A 3TJHD 3RPIB 1CYXA 3AITA 3PWPD 3JTSB 2DMHA 1M05B 1W6LA 2GBTA 2VKWA 4H7VA 4KDVA 4LLUB 1CR9H 3KPSE 1TNMA 1OVZA 1OSPH 4D3CL 3KWTA 4UOZA 4PRIA 4HJTA 5I6PA 4YDJA 2JKTM 2VSCA 1SYSA 2CBTA 1SF5A 4G7YL 4Y4HD 4AVJA 4EI6B 5E0FA 1MCDA 3D8MA 4X6DF 1NCBL 5FYLH 5LGYA 4JQXC 2NY2B 3D85A 1AOZA 3IDMA 5LQBL 5KBDA 5IJCC 4BKLB 4Y5YC 5D1QC 4FNLL 2ERJC 2VXQA 2P5PA 3UAAA 4YXHH 8FABA 3P69A 5AB2A 1HSAA 1E6OL 4PGBA 1KEGH 4UTAA 5B38G 3KJ4B 5IW3A 1FYTE 1DBJL 2DJSA 3HFML 3KLLA 3BWUC 1UG9A 1K6QL 4R7VA 2C3WA 3TO4B 2FL5A 1NGYA 4X6FB 5TTRA 1OL0A 2FIKB 3FCBA 4OGZA 2X3BA 5GGVH 2HSIA 1F41A 1ZA6B 5ESQA 1QFUH 5C0BA 3ZGHA 1YY8B 3EJYC 2E7DA 1L7TH 3DK0A 1MEXL 2D03L 1A8JH 2BCMA 3QEGL 1RZ8A 2OJZL 1JV5B 1V3LA 2J88H 4N8PA 4PB0H 4M7ZC 1YUHB 2UX6A 2JV6A 4TLKA 2X6MA 3CWGA 3IMRA 3DHJA 1NWOA 1WGVA 2BHFA 3PDOB 2XPYA 4HIIA 1TVDA 4N24A 3Q5TA 1VENA 1MJ8H 2EDRA 1M9WA 3E1F1 5FYKU 2HMID 1KCRH 1JERA 5HYEA 4IRJC 2IANA 2IWKA 4QXUH 3VD5A 1OF2A 4E9QA 1NDGA 5MENE 1YEKH 5FO7B 1HQ4B 2R29H 4QRTA 3UTTB 5H37A 1QRNE 3FO1A 3H85A 2Y2YA 2B0SH 4CGTA 1I3GH 3NCMA 4FOMA 5B1KA 1MRDL 2QPUA 2EVGA 2ISDA 2WGNB 2BOCB 2QPFA 2ZCZA 1FH5L 5B1JA 2I60L 2VDMB 1CDIA 5TQ2H 3R7RA 1A7RL 2JELL 4YEEA 3QCUH 3WGVB 4H40A 2D3LA 2YQ3A 4AQ1C 2OR9H 4FERA 5TE4H 1MCHA 2ENJA 2GQHA 3U2IA 2L7UA 3RP1A 5I0XA 3B34A 4ODXB 2EIZB 5CZVH 3IFLL 5EIIA 3FO2A 3FUKA 1MELA 4RMSA 2C9SA 3LIZL 2CNYA 3BIBX 2ZPKH 2K7QA 3D85D 2FX8H 1LMKA 1MWAB 2MTAA 3WFDH 1LK2B 5I75B 3AXLB 1CD1A 2ORBL 3OGCB 3BWUF 1HSBB 3OXRB 5HGBB 1RZIB 4KK5C 4NDMA 5F3HA 5JQ6L 3TZVA 1EAPB 2IWEA 4Z7IA 1U8QB 1NUNB 1H6TA 2H6PB 1KCSL 1RIHL 1DUZA 1EVTC 4HOZA 3FT4B 2VDNB 5E6IC 1FGNL 2FECI 2W0FB 1TTUA 5DS8B 1DP0A 1HIML 4UCFA 4ICXA 4AW4A 4F58L 4EJ1C 1JGUH 2FWOB 3ARDA 3Q5YA 5D6CB 5D7IE 3TIDB 3X3GH 4Z7VB 4AC4A 5IKCB 5JOPD 5J56B 1RHHA 2XWXA 2Y7QB 5DZNA 4WEBL 5C0BD 3RTQB 3O9WA 1K4DB 2P3YA 4LOFA 4RRPM 1JRHI 3BUPA 4W6YB 4OZHA 4PEEA 4NZJA 5F7BA 4RIRB 3UC0L 4BH7B 4X9YA 3W56A 3ZXAC 1Z3GL 1KYAA 2OMXB 3SE6A 2X87A 3E8UL 3V0IA 3ECBB 4ZO7A 3PP4L 2XCMC 1DSYA 7PCYA 3X11A 5BV7H 5CCGE 3UP1A 1ETA1 2AQNA 4JW3A 5DS2A 4POUB 3ECVA 1GC1H 1IBHA 1OP9A 1NBVL 4HZLA 1NICA 5I1CL 1GR7A 1KWGA 4PRIB 1V3KA 4YDJB 1MW2A 3I9PA 2XXCB 4A2MA 5EEZA 2AABH 4MDIB 1CCZA 4KC3B 1EJOH 1NDTA 5EEWA 2DQEH 1JGLH 1R34A 3ECWA 1GCFA 4GG6F 2R8SH 8FABB 5DMJB 4X83A 4Y19E 5FUCC 4PGBB 1Q1PA 2GIMA 1LP9F 3EYQC 3UBXI 1GXEA 5IQ9A 1INEH 2EH8H 4WV1A 2DTMH 2FL5B 3VX0A 4MAYB 4HS8L 3H9SB 5DHVH 5FYKH 3WHE1 3ZT7A 2WTOA 3G5ZA 3OKMA 4NRYA 4H26A 2P8PB 3V4UH 1QKZL 2YC1B 3DX7A 4GB9A 1RZ8B 4MCMA 4UILL 4TSBH 1ZDSA 2NY6C 4EN3A 4BK5A 1MY7A 2R0WH 2WQ8A 1BMWA 4AITA 2RB8A 4B96A 3VO0A 2QSVA 4IEFA 2X5PA 1WTGT 2A6DA 4HIIB 1UD3A 2GJ6B 5J3HC 1CT8A 1KNOB 2BIOA 1TITA 5IVXF 2A4EA 2GAZA 2HRGA 1L6ZA 2IANB 1ACCA 1OF2B 1NDGB 1KIUA 1SMDA 1NCCH 1AQKL 3CMOL 3FF8A 2WLKA 4QRTB 2ZXBA 4LDCA 3FO1B 1U33A 3QO1B 4ODHL 4X5LA 1KIQA 4L8SA 4W9HC 4XB8A 3O9WD 3U7AA 1QSVA 3G5YA 4KMLB 2B1OA 2F08A 1LO2H 2ZKWA 1G6RA 4TQIA 4DGYL 4NHUB 3OMIB 5DDHB 2VQUA 4V1DD 3VD3A 1KB5A 1TIUA 4I77H 4DPBX 2FLRT 2XFGB 4D9RD 4UUJA 3NFPA 1AZNA 2HN7A 1MJUL 1H3VA 1A1NA 1FO0H 1P9MA 2JJWA 3CFKA 1R3HA 2VR5A 1XSIA 1JHLL 2XZAH 4WJKB 2EYRA 4XBEL 1Z9OA 4PUBH 4JB9H 1JHKH 1G1KA 4PW3A 1OCWL 3QDGD 3V7AE 5EIIB 4JE0A 5BJTA 5IQLA 3SBPA 1PZUB 4ACTA 4ZW5A 3GEWB 5K69A 3AQZA 3BKJH 4N2AA 4FYQA 3LQAL 1CD1B 1EA9C 3EJQA 1MFAL 3QJUB 1EEYA 5F3HB 5GGUB 3TZVB 2XWTA 4N85A 4BZ1A 2FO8A 1BVZA 1YYLL 1YEFL 3CE1A 1V8HA 1DUZB 1OGAA 3O0RH 3MXWH 2KT6A 3RIKA 2B1AL 2VIRA 5GISH 1RP9A 4IU2A 1JJUA 2AK4E 2I9LA 4UM8A 3MJWA 2XN9E 1S9WA 3VFNA 1S7VA 1RHHB 3MV7E 2KERA 4XMPH 3TONA 4Z23A 2CMRL 3H56A 3FCTA 1F86A 3L4ZA 4N8VA 3ZL1A 2Y7OA 1BQ5A 2E75C 1T20A 5IHUH 1OPGH 4YK4B 3QHZH 4KX8A 4FFZH 4EN3D 4HS3B 1LYQA 2TSAA 4X42A 1DUYA 1N59A 1UOVA 2Q7YB 1OOAA 1YECH 3VFOA 4BZ2A 2VQTA 5EUOE 5EOCJ 3LB6C 2JLLA 1IJ9A 4HAKA 3BRFA 3LRSB 4AX3A 1WC7A 2EO1A 1S7XA 4NI6A 4AIXA 5L8KB 4HZLB 5ACZB 3MTRA 1NEUA 2AZAA 5K5YA 3KJ6L 5GGSA 4GS7B 1Q0YH 4JMNA 2CLZA 5IZ7A 5C0AA 1EJFA 3VX1A 1J05B 3F7LA 3FTWA 1QR1A 1QWNA 1PPIA 5AVWB 4M1CD 5E5MB 2E9BA 4HWZA 5DFWH 4B9FA 2O4EA 3H42L 1FH2A 3ARBD 5D7KE 2D3VA 2VLRD 3U30C 1O5PA 3G08B 5F70A 4ZPTB 2MKWA 5AOZA 5IQ9B 4B60A 4WV1B 5DC4B 4JL2A 2FX9H 4YC2B 3GTTA 3SPHA 3L5IA 5HGDB 4F2FA 3RZCB 4UQAA 5CILH 2G9KA 3ZTNL 4NRYB 5EHFA 3ECUA 4H26B 3HG5A 5DO2D 2FWLB 3T2LA 5IROC 2WTPA 1A3ZA 3MAWA 5DMGD 2F74B 1RIVH 5D1XA 2GYSA 3DXAA 5HYFA 1RUPH 2IWFA 5TE7H 3T3PB 1VERA 3F6LA 5DT1L 3DDFA 1NMBL 4IEFB 1KZQA 2UUDH 1KC5H 1VCAA 4LE8A 3W0WB 3M45A 3R4DA 2A6DB 3RFZA 1IC0A 1RZJC 3SPGA 1OGAD 1WRFA 2BNQE 4XMZA 4JJHA 2HH0L 4DOHE 4AOFA 3QFJE 1QQDB 4W4NA 3TESA 2GAZB 1E90A 4G80A 4P2OD 3GC3A 4YDNA 3F83A 1KIUB 4XN5A 1OP3K 3RVVD 4KHTH 4N0YL 1MQKL 4NHCL 1NCAH 4TYUA 5JQIB 1T7VA 3D51A 1GHFL 1KIQB 4L8SB 3SE3A 5I1IL 5CSBA 4LHJB 3SO3C 3SE4A 1VFMA 1JZJA 1AZZC 1G6RB 3AWGA 3HOGA 1CLVA 1W72L 1U8CA 2Y3AA 1KBGH 1E4WL 3BXNB 4XMTA 5IMOB 1R3KB 5JNYA 2V8LA 4NUPA 1KB5B 2ZP9A 4R6UA 3DLQR 4UUJB 5AD0A 1P6AB 3NFPB 4MZIA 3T6WA 3U82B 3WDHA 3U0TA 2ITCA 3OHMB 1R3HB 3M1OA 4N2IA 3ML8A 2XDHA 3WGUB 5E4EC 3VFRA 4YNYA 4EOWH 3STZA 3NDZE 5C09E 3HZ3A 1EXGA 3T2OA 5BJTB 3CHXA 1ZANL 4JRFA 3HBZA 2K45A 3IMVA 4OFYD 5A7BA 3CSPA 5AWNH 1QBLH 2Q3AA 4NM4L 2A74C 1AKPA 5I16A 2FX7L 2YGPA 1DN2A 1EEYB 2XWTB 2IC2A 3FU0A 1DQLL 5BQDA 2Z35B 3BPOC 4O9HH 2OSLB 4UTBL 1DQDH 2DD8H 3HZKA 1XGQA 3P3TA 2JCCA 3B3IB 4JY5L 5I30H 4Y5XA 1TR7A 4FFYA 2Y3NA 3SJVE 3HBQA 5EOQL 1A9VA 3U4BL 1HVXA 2SEBA 5DWPA 2HAZA 2DEYX 2A4CA 1IJNA 3BAYA 4NAMA 2EO7A 3X17A 1FNGB 2BNUA 4PV8A 1S9WB 3MODH 3VFNB 4M5YL 2JVUA 1HCFX 4N8VB 4JO2H 1T20B 4AZ8A 1NMCB 4NUQA 2HT3C 3BOVA 3RKPA 5IGXH 1TQTA 3DXAD 4LSVL 4KPHH 5EZLA 1C08A 3TASA 4S2SA 1N59B 4ABUA 4ZMTA 4IDJH 1FORL 1AGCB 1X5GA 4IOSA 3VFOB 3CZEA 1W91A 5T3XD 3V4VH 2EDKA 5IOKA 1QFPA 4HCRH 4QIRA 3CZSA 4IBSA 4TVPE 4U7KA 4GIAA 1WC7B 1S7XB 3F7YA 3A4FA 1TTRA 3LDBB 3SE9H 5GGSB 2YD7A 1AD0A 4JL1A 1BFSA 1UADC 1B4RA 5GGTH 5AW3B 5C0AB 1SOQA 1UB5A 1TUPA 3PQYA 4XVTH 2BNRD 1QR1B 3V55A 4A6YL 1VKXA 2CBPA 1OALA 4PG2A 3GYRA 1KACB 1I8IA 5C0IB 4HWZB 4F8QA 3QDJE 3T6VA 3ZE0B 4F9LC 5JYLA 4LF3A 5F9JA 4WK4B 4JM0A 1T3FA 3MRRA 2OL3A 5DJYA 2IOIA 3L3OC 3O3EA 5B22A 4YXLL 3EKCA 4QF1B 5FGCB 1E4XL 4FHJA 4DGIL 1VFBA 3GB7A 5IG7A 5D2LA 1KULA 3LEYH 5BUAA 2CRZA 4W6XB 3UBXG 4B9YA 4XXWA 5K9OA 4JPKL 4GIPD 4Z3EA 3K81A 3RKDC 1UYWL 3H8NA 4RDQF 4HEME 3SE8L 1T0MA 4TUKL 2IALA 2O6EA 5D1XB 5T5FL 4TNWF 1CGSL 4XTRD 3MJ9A 4JMXA 3B43A 4Z3HA 4GG8A 4KXDA 3RFZB 1IFHH 4R96B 1AR2A 1G7LB 2F8XC 2XRAH 4P59L 1HNGA 2E6QA 2ZG3A 3P77B 3UAJD 3ZOAA 3PL6B 4G80B 3RUGF 1NOFA 1S5IL 1OAQL 1PG7L 4DZBA 1RY7B 2H2SC 2JE8A 5I1EL 3UXFA 1BF2A 3B37A 4M93B 4GSUA 4J3XA 4XOEA 3RGHA 1J0HA 3WNNA 1TENA 2VLLA 3FC8A 2DJ4A 1GY2A 4LO9A 1TJGH 2JJSC 1KPUA 5E6YA 2J8UF 1I53A 1WITA 4FHBD 4MASA 4TRPL 2X2UA 3CZUB 4NQSB 1RZJH 2NZ9C 4RMWA 1ZCRA 1MFEH 4IOSD 4N9OB 1R6VA 5ANMA 3RVTC 4GAJH 2B59A 1BFOB 2C9PA 2WWKT 1YY9D 3V9FA 1CGYA 1IKFH 2Y06L 3U0TB 4JRYD 4PY7A 4X98A 1ZTXE 1TMQA 2R2HA 4HIQA 5CBAA 4J27A 1E28A 2OXHA 5EUKA 3VI4F 2NZIA 3VFRB 4YNYB 1KCWA 3STZB 2ZOUA 3NZSA 4ES9A 2YGOA 4OJDH 3PQYD 5MHSD 4H8UA 5KUMA 3ZL2A 5JO5A 5DZLA 3EJPA 3SPJA 3K72B 1U21A 4YHLH 3UTQA 2ITFA 2A77H 4PBDA 4M29A 5HGGS 5C0FB 4KI5D 4EKJA 2WLIA 1A2YA 3KPMA 4OIIH 3WEXA 1QSEA 3HZKB 1XGQB 3F85A 2JCCB 1B9KA 4AQAA 4P2CG 4IIQA 2DDQL 1HHGA 1KXVA 3CDZA 1WQVT 1X5HA 5FF6A 3VRJB 3DDGA 1I7UB 3KH4A 2SEBB 3BPLC 1BZ7A 5IFAL 4PJEF 5KBMA 2VM4A 4PV8B 3DMMD 3QJZA 4X6DB 4TTGA 1KYFA 4TNEA 3L4WA 3REVB 3S7GA 4D94A 3ZX1A 1F6AB 1GOFA 4B97A 3VFGL 4AZ8B 3KVDD 1QLFA 2ZAHA 5EZLB 2XNAA 3Q6FB 4J4PC 1C08B 4XVSL 4S2SB 5I5JA 1URZA 2JKWA 4FNSA 4PS8A 5C07B 3S5LG 2OCFD 1QR4A 4MA3A 4G7YH 4U1IA 3KS0H 2IFFL 3E0GA 4BGLA 4OFVA 2V9QA 3DTDA 1NCBH 3SBQA 5LQBH 4G9FE 1INQA 4HG4K 4CC1A 3G9VA 3NP3A 3BFWA 5LBVA 4PJ7A 1AHKA 2FO4A 1AD0B 1NZRA 4FNLH 1BWMA 4J6RL 4GEIA 5D7HA 3RBSA 1UB5B 1E6OH 4WFFD 4QNPE 5KW9L 5LBGA 3QNYA 5JMRA 3HFMH 1DBJH 1VKXB 1K6QH 3VI3F 5MEOA 2XJLA 1I8IB 2A2QT 1YCSA 2GHZA 4KNUA 4LF3B 4LCWA 5F9JB 2GI7A 3D05A 3DECA 5T1JA 4LSTL 1A9BA 1E8YA 5A2KH 2WCPA 2EVFA 2WYZA 1MEXH 1VFBB 3GB7B 2R9HD 5D2LB 2D03H 2VDKL 1F97A 3QEGH 2CRMA 2OJZH 3S88L 1OGTB 5F88A 2WBWB 5K9OB 2A73A 4HMCA 2A4ZA 3MV9D 1WZLA 4UBDD 1AXSB 1T0MB 2VW4A 3F8UB 3H55A 1QATA 4TTDC 5TF0A 5I0VA 2IALB 3VVWA 4LRIA 5FXCH 4Q2ZA 1GW0A 1G7MA 1F0LA 2YXFA 3V6FA 3VCLA 4F7MA 4GG8B 3O3UN 5A2FA 2I27N 2ZD0A 2BK8A 3V6OA 2QSTA 5AB1A 2QMJA 2VXTL 1CG9B 1OPOA 2BS9A 4Y1AD 4MQSB 4Y9FA 3NG5A 5DHVB 4LKCB 5T5NG 1MRDH 4NS0A 4J3TA 4QHMA 3B7RL 4HIHB 1B6DA 2EABA 3BJLA 1PG7W 3M6DA 4Y5YB 4ZTOL 4OV5A 1FH5H 2DLFL 3E2HC 1RIUL 3QXDA 4IOIA 3FZUD 2FLMA 2I60H 3BSZA 2VLLB 1A7RH 2JELH 3LQAC 1KPUB 3MLWL 1I8LC 5E7FA 1S2EA 2K4AA 1FZMA 3DKHA 4M4PA 4Q9CA 1F11A 1ZE3C 3ENEA 4Z8FH 2XWBB 1EXUA 4X6CF 2VO5A 1KJVA 2F58L 4KJWC 3NCFB 1KYOK 3IFLH 4AW7A 3L5WB 3PGFL 2FECL 3LIZH 3TO2A 2A6JB 3R06A 5JW4N 3E38A 2A1WL 2DLEA 4PY7B 4X98B 3V0HA 2R2HB 1ZV9A 5AVUB 2E9JA 5DD0L 5CBAB 1E28B 2OXHB 5EUKB 2YXMA 1SBSL 2BW5A 2ORBH 1ES0B 4XO5A 5JQ6H 3SCMA 3I9AA 4P2RD 5IWLC 1JRHL 1KCSH 1RIHH 4PWJA 1BPVA 1QW8A 5SX4I 5FOBA 3FCUB 4FQQA 3S3BB 1TFPA 1FGNH 3UTQB 4S1QL 2WQXA 1ADQL 1HIMH 4X5RA 2WLIB 2ED8A 2ZX7A 5HP5A 2I25N 4OCMC 4F58H 3KPMB 3WEXB 1QSEB 4UOJA 3TBSA 5DD5L 4N2NA 3B2MA 1HHGB 3CDZB 4O2EB 1PDKA 4WEBH 4KZEL 4PD4K 2NDFA 1G9NL 1FCCA 1MFBL 2IDTA 3DPBB 4MNGE 4UOW0 1BZ7B 2ICEA 2F53D 3TFKD 4EQ2A 3UC0H 3P3UA 3WFZA 5HYSG 3GWJA 1CF1A 3NCYS 1Z3GH 3E8UH 4FD0A 2Q3ZA 3PP4H 2EDEA 1CURA 3D48R 4NQCD 4HEPA 1V3JA 3T08A 3RDTD 1QLFB 4LEOA 1S6NA 2XNAB 1UXWB 3N44B 4GT7A 3EBAA 5I1CH 2UV3A 2IAMA 4U1HB 4U1IB 4OLUL 1H3GA 2LVCA 3QSKB 5KN5B 3I6GA 4G6ML 4DVBA 4C47A 2QZ5A 2AV1A 3P4MB 1E4HA 4TV3A 4PJ7B 5DRWB 3ZYZA 2FO4B 4NX0A 2ADIA 3I50L 1U8LB 3HR5A 2D0GA 4AYSA 4TUUA 5MI0B 3TVMC 5IMMB 1Q0EA 3QNYB 2X9ZA 4L3EB 4JVPA 3LKPA 5MEOB 4N3TA 4TLTA 2OMVA 1FG2A 4JUSA 4LCWB 4HS8H 5TE6L 4IBZA 3C8KB 2QQLL 4AYID 1M4KA 1OM9A 4JDVA 2J1YA 5CS7A 4ZFOB 1NFKA 3KPQB 4GIOA 2PYED 1G9ML 3CBJB 4QCIA 4QAWA 1D6VL 3KMDA 4HKBA 1NGWA 4UILH 2C1OB 3L08A 1ND0A 4P4KA 2DL9A 5AVZB 5GGTA 5F88B 3UDWA 2GK0B 4W9CC 3V52H 4HCFA 2YARA 2X4UA 3MRBA 3V8CA 1VADB 3LPGA 4CN6A 3LTVA 4OGXL 4Y7MA 4Q2ZB 1G7MB 3P11L 4MMZA 3V6FB 1CGWA 3VCLB 4F7MB 3CMOH 2R69L 1AQKH 2NUTA 5LCVA 3PJNA 2J6EA 2NTFA 3P0YL 3B8YA 5T1LD 2WB7A 5HYJA 4ODHH 3QPXL 3TJPA 4WK0B 1NC4A 5JW5A 4GOSA 1CI5A 4B9JA 3DIDA 3WU1A 4QHMB 4WLCA 5F7KC 1JPSL 3JT2A 1QFHA 2EDJA 4MJ6A 1SOKA 1QVOA 3ZKQD 4OV5B 1DVFC 1U8KA 2OW6A 1YEGL 2AJVH 4JFHE 3QXDB 2RFXA 4I0CC 4IOIB 1GKEA 5L88L 1E6JL 4FQPA 3UJJL 2Q86B 4WEEA 5K9QG 1MJUH 1F11B 2GCYA 3NRFA 2F1BA 4E9RA 3ETTA 3L17A 2YPVA 1EXUB 1JHLH 1QEWA 1AANA 1F6FB 3D39A 4H0LC 4XBEH 3SDDC 5EFIA 4YLQT 4DEUA 1KJVB 2EEAA 3T0EE 2J1ZA 5AAWA 1H3XA 3SOTA 1OCWH 4M3KB 3WD5L 3FRPG 4F93B 4K23L 4QRSA 1NGZB 3TO2B 2YQGA 3R06B 1EZVY 5DUML 5CU5A 4L0ZA 3O6FA 4AL8L 2XWRA 3GSQA 3PCYA 3KAAA 4JK0D 3LQAH 3OLEA 1MFAH 3MNVA 2GITA 3AG4B 3QNXA 3SCMB 5K1JA 1R75A 1ZE3H 4I2XA 1YYLH 1YEFH 1A6VL 1T5WB 5FOBB 2PWDA 4FQQB 4AIZB 2B1AH 3J2PA 5ESVB 1N68A 1BM7A 1HNFA 4TN9A 4KK8D 4DTGL 1BEXA 1U92B 4KV5F 3WDJA 3JTBA 3DURA 2VLME 2XXMB 1FUNA 3TBSB 2APTA 1KXQA 4FQIL 2VSDA 2CRIA 1WEJH 2CMRH 1QUPA 5EZJA 4FYTA 4Q0XH 3RWDA 2ICEB 2JI3A 1E5CA 3GMRA 4HW6A 1UWXK 3BISA 3CC5A 3W11C 4F7CA 1KTDA 2IGFL 5G2NA 1PAMA 4E42A 4NT6B 2QEJA 1YQVL 3AWFA 3QEHA 4OCWL 5FDWB 1ZHKA 2X1XR 2W80C 3ESUF 2C9AA 3QUML 4QHKJ 2LVEA 3ATAA 3BGFC 2FSDA 2IAMB 1CK0L 1FWXA 1IARB 4JHAH 3KJ6H 2HT4C 1FC1A 1QA9A 1RZKL 4JKPL 3ZPDA 2R83A 2EE9A 5KYUA 5H4YA 5HYJD 1ZK9A 4XAWL 8CGTA 5E2UL 3I6GB 5JXEC 1Q9LB 3EO1A 2AV1B 3PRZA 4HOMA 2VR6A 1MCSA 2K8MA 4QRUA 4OTXL 2FVNA 5G5DB 3QK0A 3H42H 4FEIA 4U33A 5GGSY 1SN5A 1ZHBA 4GO9A 4K7PL 3NESA 5AKTA 1ZGLA 2LW3A 3LKPB 2DBLL 3ZKMC 2OS7A 3D39D 1MXGA 1FAIL 3BH9B 3Q8BA 4DO4A 4NXKA 2XG4A 3KR3L 2X4RA 2DRUA 3IAQA 3ZTNH 4L0YA 4JDVB 1K9TA 3K4DA 4QCIB 2N7BA 4HPYL 2Y69B 3RUGA 1U4FA 2C9QA 4OZIF 5C6TH 5I73C 5C71A 1NGWB 4P4KB 3SSGA 1ND0B 3O6FD 1TKWA 4BSJA 5JIQA 2W07A 3QUYC 3EDEA 5DSCA 4MXQD 3TN0A 5DT1H 2YUVA 1NMBH 5L8LB 2X4UB 1J5CA 2BX5A 4MNQA 3MRBB 5AKVA 1SN0A 1VF5C 5DFAA 2HH0H 2YMTA 2YUWA 4LQFL 4G43A 4OZGE 1PX4A 2KPWA 5HI3D 1LWHA 5SWZE 4ZNEE 1CVSC 1IX2A 2K3HA 3ZVVA 4CVZB 4M02A 3AUVA 5JOFA 2NUTB 4NWTL 1QRKA 3TU6A 4N0YH 1MQKH 3GMPA 5F0PB 4Y4KA 4NHCH 3HB3D 4NRXA 3ZDZF 4E41A 1GHFH 1CTNA 1NC4B 3K74B 5JW5B 1GSKA 3PLYA 5I1IH 1S78D 3QUZA 4ZSOA 1KFAL 1ASOA 1BIHA 3C5ZA 5GGVY 3VI4A 4UNUA 4MJ6B 5CD5C 3A22A 3S5YA 1QVOB 4WU5A 3VRIA 1XH1A 1W72H 2NXZC 1CLYL 2NW2A 1E4WH 3QORC 4ATWA 3LAFA 3VXRA 2VKXA 3ZSSA 1U3HD 3AVEA 5HI4C 3GZQA 1KTCA 3SBWC 2GCYB 3BEVA 3DROA 1JD9A 1QEWB 3N40P 4Y1TA 2E5EA 5EFIB 4W9KC 1V27A 5FO9A 4GQPH 1G7HA 3L48A 2Q8AH 5J12B 4W4OC 1A65A 4WUUE 3FOMB 1H5BC 1ZANH 4QRSB 4YDVA 2YGQA 9PCYA 1HJBC 2NNXA 1FA4A 3H9HB 3WG7B 2WLMA 3FUDA 2PW2B 2X0VA 2Q6WB 1BIIB 2J1XA 3QZWA 3GSQB 1I8MB 2DQGL 4NM4H 2YBRA 3MNVB 2FX7H 4DCQA 2C3VA 3QNXB 3U2JA 3QYMA 1P5VA 2CG9X 3QUXA 4NJAL 3BRDA 1DQLH 2VR4A 3R18A 2FEJA 4FQXA 3VG9B 4I2XB 3TT1L 4UTBH 5J6SA 3D2UD 5IB5A 3N55A 4JY5H 5SX5H 4E9YA 3UTSA 3PREA 2BVYA 4FTVD 5JHMA 5DD1H 4DNLA 4XP4L 4U1GC 3LQZB 4H1LH 3U4BH 4ANUA 1A0QL 3WXVL 5FPIA 1Z6JT 3FQTA 5SWSA 3DURB 3DX9B 3M86A 1AACA 1WZKA 1OTTC 3C8DA 4M5YH 2BRRL 3L4TA 4ERSH 1W9XA 4ZK8A 1U8MA 1B88A 3SOBL 5EZJB 3RWDB 1F58L 4BXVA 2LLLA 4XNDA 4XZUA 2KL6A 4EI5A 3GSUB 4LSVH 1HKFA 3CC5B 4JM4L 5E03A 4F7CB 1KTDB 3C75A 1FORH 1ODAA 1GMIA 4BFJA 2CU9A 1BD2D 4UM9D 4E42B 4YAQA 1HILB 1FFQA 4GKNB 1WBYA 2YUXA 2F7IA 1ZHKB 2OMNA 2NXYC 2OK0L 2ROYA 4MXWL 4DP6X 1W15A 3QARA 3T0EC 1QA9B 1E4JA 1N19A 5E4EB 1HDMA 1S7RA 5A7EA 5JW4M 4Y4KD 1A7PL 5KYUB 3ZYJA 2VDQL 4CU6A 4JKWA 1K3IA 3D2TA 3C5ZD 3EO1B 3HVNA 2OYPA 4FNTA 4QRUB 4J8RB 3MC0A 1BBJA 1BXAA 3T4AC 3P9MA 3GMQA 1RVFL 2V5MA 3WUZA 2YA1A 1ZHBB 3QIUB 1MCWM 3UJIL 4Y5VC 3P4OA 3C5SA 4YXLH 1U3ZA 1ZGLB 2P8LA 3II3A 1E4XH 1QLEB 3QC6X 2E0PA 1YMHB 2AXFA 4ODTL 5ISZD 4A2EA 4QRRA 4TVUA 1D6EA 1IC5L 3BUBA 2XG4B 3I6KB 3P73B 2X4RB 4JPKH 3U46A 5E9DE 4G59C 3JWNG 1WFMA 1UYWH 1NANI 3UZQA 5GS3A 3VXSE 3RUGB 5EG6C 3SE8H 1WE5A 4JKKA 2UZIL 4NQTA 4TUKH 3ULUE 1GYVA 5T5FH 2W07B 3MVSA 4YHKL 4GW4A 4JZNA 4Z0BL 1CGSH 2VLJA 3TN0B 5E51A 4ZUSA 1CFTA 3SDAD 4MNQB 1XV8A 1EAJA 4LOUC 1Z9NA 5DRZA 4G43B 1HWWA 1YUKB 3SGJC 1IB5A 5E2WL 3WHXA 1XF5A 4L1LA 1TSHA 3QO0A 4HWBL 1S5IH 1T66D 3IKKA 1OAQH 1PG7H 4X6CA 5IVZA 3WOVA 4KROB 4PTUA 5JOFB 4PCTA 5EBGA 4ZQKB 5I1EH 1HAWA 5C0GA 3LPPA 2EE6A 1OCCB 2IBBA 4NRXB 1F02I 4E41B 2CE6A 4QXVA 1G43A 3DTXA 3QQ9C 3QUZB 4ZSOB 5C70A 1ZJBA 3VI4B 2XQYA 4IHBA 1EO8H 3D52A 4TRPH 2XBZA 4WU5B 2X2IA 3VRIB 3VXTA 5I24A 4BUGA 3EOAB 2NW2B 5JQHC 4UQCA 3VXRB 3B2XA 4QHUB 3IGKA 3L3OB 5AG9A 2QDVA 2Y06H 5DMYA 3BEVB 3F05A 4X6BA 3VQ2C 4PJCF 4IK7A 2VR3A 1AGEB 5FO9B 3MOAL 1G7HB 2ID5A 1XGRA 1AMYA 3DO3A 4JFEB 1G9NC 4WDIB 3KL0A 1UC6A 4YDVB 3IF1A 5GJTL 2L7JA 3WO4C 1T83C 4KDTC 1A7OL 1JL8A 4KY1L 3UTPD 3BO8A 2WN3A 2YBRB 1EAOA 4DCQB 2C3VB 4C8XA 1RMFL 3QUXB 4FQCL 3N9GL 1MCEA 4FQXB 1ACZA 1BQRA 2YA0A 2PF6A 2JQAA 5TDNA 1R9FA 2CGRL 3UTSB 5IOPA 4CADA 3KBHE 2JFCA 3OHXA 5IFAH 2X9XA 35C8L 4TL5A 2YKLL 4CKVX 4AKPA 3D34A 3OPZL 2D7NA 1DQTA 4PJFA 4AIEA 3VWJA 3LS4L 5J5EA 4KUCD 1U8MB 3IDYC 5JA8B 3QEQD 3QS3A 4EI5B 4XVSH 4CN4A 3QBTB 3T6QC 3RJQB 1CFSA 3SYOA 1VLXA 4ISVB 4OVVA 4MYPA 1NCHA 3FTYA 4YZWA 2IFFH 3VI3B 1U3YA 2MEJB 1WBYB 3GMLA 5IK3B 1X3DA 1QI5A 4A7UA 5A2BA 5JHAA 2AJZA 5KANG 4DAGL 4S0TD 3RFRA 1HDMB 4DWHA 4ANVA 4J6RH 4MXVE 3IFPA 5BRZA 3QDGE 1EJ6A 1JFHA 4N2CA 3L7EA 2DH2A 2Q8BL 5E8NA 1J8HA 2VXVL 3K2IA 5KW9H 1P84K 5HGHA 5F1SA 3PWLA 2H2PD 1HYSC 3D5OF 2EVHA 2PR9A 1XB6A 1IC7L 1N9PA 1J5IA 4WHTA 2EIMB 1C16B 2JKRM 2XWEA 4OM0L 4ESKA 3P9MB 3GMQB 1U58B 1WG3A 2QL1A 1EO5A 3P4OB 4LSTH 3C5SB 4E68A 2P8LB 2XA3A 1SPDA 3B9VA 2ZE0A 1JGVL 4PGJA 1DQIA 5PAZA 1TXKA 3S37X 2BHZA 5FFLA 2R39A 2JK5A 3VD9A 1CXIA 2VDKH 1D5XA 3WS6A 4QRRB 1A14H 1Z0MA 1D6EB 1ZTMA 4LFHD 1CGVA 5HDLA 1JUFB 1IT9L 1BM3L 3U46B 3UMNA 1T22A 3BPNB 1XF4B 2B16A 3UZQB 4BCXA 1DYZA 2IDCA 3FW6A 2KPNA 5I15L 3MRFA 4GW4B 1T4KA 2VLJB 4OZGF 3NMEA 4R97C 3AG1B 2EADA 5AOMA 1UWFA 4ZUSB 3CFJA 3GTVA 1NOLA 2VXTH 2J44A 2XWJB 1KLUB 4J8QA 2QKSA 3AFLA 4OM1L 5DRZB 3UYRL 5BOPA 5E6UB 3WNIA 5G4MA 3GLAA 3QO0B 4X6CB 4DW2L 4ZW3A 3SGKC 1JGIA 2E7MA 4PTUB 4ZTOH 1DVTA 5C0GB 1MLCB 3NJJA 4KX7A 1RIUH 3NABL 4IK6A 4X50A 4AL8C 4FMVA 1R33A 3X13A 3MLWH 3DTXB 2EQDA 4BWTA 5C97A 1YG9A 3RWCA 4B9PA 3ECQA 2J20A 4QRPB 1T7WA 4IRZL 3VXTB 1AZVA 5LDUA 2KZ1B 3MLZL 5DHYB 4R2GB 5JHLL 2EDQA 4JFDD 5HHOD 3D3VD 3WY4A 1D7BA 4PJ6A 2VLRE 5K93A 3FUJA 2X6VA 2HFEA 3KM2A 3PGFH 4X4MA 1ZLWK 1AZCA 3MRPA 2WANA 1CQKA 2A1WH 3EUUA 4IJ3C 5I6MA 1PZSA 4P23A 3LOWA 4B3VA 1SBSH 3V2AR 3BQUC 4HD9A 1XGRB 5JHDE 2IMNA 1I1AA 3TYGL 3LYRA 5DC2A 5GGRA 3KLSA 4UQBA 3IF1B 3BIKA 1Q94B 2XI9A 1JRHH 4AEHL 3S34L 3ULUC 3HHSA 2DLGA 3BO8B 5HHXL 5FM5M 3QJHA 3BWAA 1WAAA 4S1QH 1ADQH 3C6LD 4K9JA 3FTVA 1TVHB 2IH3B 1N26A 4PW4A 4HJJL 5DD5H 4DKFL 2EACA 2UUDK 2KC0A 4KZEH 2EIEA 3B9EA 5IOPB 1RZKC 4CADB 1L9MA 2W0LA 1G9NH 3MTXA 1MFBH 2QJDA 2R0KL 3OHXB 4HETA 3Q8FA 4YHOL 3KEDA 3IDNA 2D4DA 3CPLB 1N0LB 3B2PA 4FFWC 4YDMA 4PJFB 1KJ2A 3VWJB 3QUGA 5IJKA 3BVNB 1Q8MA 3QJTB 4OW6A 1PGRB 2WXRA 4H13C 2G3ZA 2E9IA 3QXUA 4NPYA 1IBZA 5LN4A 3VXOA 4BFOA 1CFSB 4R7DA 3X1FA 2V9TA 4XN2A 3INOA 5B8CA 4L48A 3MRJA 2YQBA 4OLUH 3GMLB 2RD0A 1YAZA 2KQMA 1PYWB 2OJ1A 5KAQG 2AJZB 3C12A 1X5MA 3FQRA 4HHAA 1F4YL 4XMXA 5FUZH 3I50H 1UXLA 5KSAA 4WNJA 2GSIA 3IFPB 5BRZB 1IC4L 3ZR6A 3L7EB 1J8HB 4IRSC 1FL5A 1T7ZA 2EP6A 3QDME 1BQLL 3PWLB 3RY6C 2VCOA 4BINA 3KM1A 3QQ4A 3HS0C 4KRPD 2Y5EA 1IGIL 5TE6H 2WXJA 5L8JB 3Q2NA 5B3NA 2QQLH 5GS0L 2RJMA 2WXFA 1VAHA 1G9MH 2CDEA 1D6VH 2QADC 1D5XB 4M03A 2WBJC 4JRLA 1QABA 3AT9A 2AJXL 4RAHA 5DJ2A 3C6EA 3EHBB 5DJ0A 4MJIB 5DWUL 4ZX6A 5CEZL 1T22B 1GJWA 4WWNA 4B53A 4A6YA 3PE9A 4HZ1A 4HWNA 2F1AA 2OA9A 4W6WB 1HZHL 4OGXH 1QW9A 4QYOB 3MRFB 4BH8A 1T4KB 1CXFA 3P11H 3V6ZA 5C0RL 4QR7A 2R69H 3CFJB 3P0YH 1ID5I 2OAAA 1AE6L 3QPXH 5D4JA 2Q2LA 1RZFL 1JPSH 2IXQB 1K8DA 3VWKA 4FI7A 3ARWA 1YEGH 3RRQA 5DJZA 3UZEA 3UAEA 1E6JH 2VR8A 3UJJH 3MFFB 5DFVD 2CUIA 3BCDA 3GKZA 4B50A 3Q3GA 4JANA 3IS1X 1MI5E 3MSPA 5JIPA 3ELQA 4R26L 1AAJA 3U79A 1JDCA 5I6OA 5LO7A 2VLKA 3EFFA 4MQTB 1KCLA 1XSKA 4MRBA 2D2CC 2FT6A 4APXA 2X4NA 3PG2A 2CWRA 1JF1A 1F42A 1BJ1H 3CLFL 3W81A 3QQDA 3WD5H 1HXMA 3MRPB 2DWYA 5DUMH 5L0QB 2HVBA 3DIVA 4AL8H 3EJUA 4P23B 2BXYA 4YSOA 1ZY9A 4F3FB 3GM0A 3OAYH 1I1AB 4U6XB 5CSZA 1HL4A 5E1QA 4TS6A 3U1SL 4KVCL 3N40F 5E9AA 1A6VH 5F7EL 2ESVA 4LMQI 4RRPA 4QHPA 4M6AA 4HOXA 4I0PC 5HI5C 1SYVA 3BWAB 2FIRT 4DTGH 3MBXL 2W81C 4RAVA 2ADFL 2Y6TE 4ZO6A 3HRPA 3LKSA 3B2VL 4ODUB 1WFJA 3CDCA 4FQIH 3FSVA 5GQBA 1V10A 3IRPX 4XHJC 3QNZA 4F7TA 4WFHE 2NY5L 3IDNB 4FFVC 4I1PA 4PJGF 2VC2L 4BFIA 2VRAA 3ULUH 2D9QB 2IGFH 3I85A 4H5SA 1XBRA 1I3UA 1YQVH 4OCWH 3KPRA 4LPYA 3FUEA 4G8GD 5E8OA 3QUMH 4YZFF 4M7LL 4AQ8A 4K15A 3A6OA 3HMWH 4R7DB 3LKOA 1CK0H 4JKPH 5DQDH 2JJTA 3SDDB 1ZLEA 1RZKH 4E2OA 3HBGA 4EZJA 2WUBL 5B8CB 2ZKMX 1CQYA 4J3WA 2BVQB 2EEFA 3ARRA 5CFAA 4H1LB 4XAWH 3MYZA 2JLPA 3GGWA 5INDB 1AGBA 5E2UH 3TA3D 4WHYH 1JOIA 1OLZA 1H8NA 1NCTA 3MUUA 1O7VA 2DIBA 3FQRB 2W88A 5KSAB 4OTXH 2GSIB 2YD1A 4P3DB 2H32A 1JWMA 1BECA 1NOAA 4LBEA 1T80A 2EECA 2P9RA 4UAOB 4LLDA 4OZIB 1T1YA 1FL5B 4K7PH 1J9TA 5J6HA 4A2DA 2F6AA 3BUDA 3QQ4B 4KVPA 3ZE1E 5F7MC 2DBLH 3WTWA 1KV3A 2KS0A 3DI2B 4J3OD 4XPAL 3KWWB 1A7NL 2VLKD 2WWMC 1FAIH 1BQSA 5K9KB 4KI5E 3EO0B 3GPSA 2DBJA 5HDBB 4HPYH 4L5FE 4ZFGL 3VB9A 1YNTA 1MWOA 4DN4L 4ZMZA 3WFEL 3MCKA 2E4FA 5HYIA 5DJ2B 4YOKA 5DJ0B 1IBGL 3ZDZB 3S48A 4A6YB 1Y6MR 4PVNA 2MCMA 3SGDI 5IQNA 2ADJA 2VDOB 2AJUL 5JMOC 2YOAA 1SQ2N 4LQFH 1RFDL 3F7VB 4BH8B 4PRPE 2YAEA 5J11B 4R3SA 3V6ZB 3EJZC 5GRJH 4LHUD 4NWTH 3JWNE 4TNWK 2RQEA 5FFGA 4F2EA 5BZDA 4B9IA 1SZNA 3RHWF 32C2A 4KJPD 1PIGA 4B9GA 3IDIA 4PJCA 2ITDA 1KFAH 1MVFA 4G6FB 1MFCL 2AERT 1K8DB 4BELD 3VWKB 4Z95H 5HHMB 1CLYH 2XN1A 5DJZB 2E4TA 3LPFA 3AY4C 2PR4H 2WNKA 3AJ7A 4JANB 1HINL 1BF8A 1PEZA 4R5VA 4ODVL 4P99A 3T09A 5D1ZA 3EFFB 2I69A 2Y4SA 1WA1X 3M88A 5E5LA 2X4NB 3MV8E 1LEKA 4APXB 1JF1B 5IMKA 3SBRA 4P5TD 1QPPA 1RCYA 3RWGA 4YEFA 4R5XA 2QQKL 5CP3A 43C9A 3T0VA 3T1WA 3AQYA 1AQMA 3VH8A 1VB9A 2DQGH 3FQ4A 1QBAA 2BM3A 4WO0A 4ZXBA 1UCBL 2QKIA 4XN1A 4NJAH 4EIBA 5CSZB 2G2RA 4BKSC 4IGBC 3TT1H 4PJ9C 3AG2B 1J9RA 1E3XA 2X70B 2YAMA 3KHQA 1WDAA 2CNZA 4YBQD 4KJQC 5AAPA 3K6OA 4XP4H 4NNYA 1UKSA 3VXUE 1A0QH 1KCUL 3ML9A 3WXVH 5C08E 2J2ZA 1D7FA 1R47A 4OKVB 3Q1EA 1QFOA 4RAVB 3VXQA 4GI8A 1UZ6F 2ALAA 2WKOA 3J7HA 3LKSB 4ZUWA 2BRRH 4LVOB 1S9YA 5DHDA 3BLKA 3SOBH 4F7TB 3MLYH 4PG9A 4KO6A 3Q06A 1NFDA 2EH7L 4Q89A 2X1WL 1SMOA 4N0UE 3P3SA 4JM4H 4G8FA 4BFIB 4LL4A 1T1ZB 4H8WL 1KLGA 1HCZA 2VTFA 2OMZB 1PNDA 3KEHA 2J71A 1PU0A 3OMZA 4OZ4B 1EGJA 2J5LC 4MA1C 3II2A 3KPRB 3IB4A 3T65A 4HUVB 2YAOA 2OK0H 4AE0A 1JNJA 3COOA 3GUFA 2ILLA 3LKOB 4MXWH 1AI1L 4U7MA 1XCTB 4UQIM 2Y22A 1YEHH 3EBIA 3CSFA 4ORGA 2XETA 3IWVA 2BZCA 4JQVA 1YRKA 4RX4D 5DQJA 1DDHA 1XGPA 1XO8A 4OF3A 4PLJD 3GGWB 3L6FA 1AGBB 4PBVC 1RK0B 4PJHA 5TDPA 2VDQH 5DMIL 5L2KA 4F8PA 3L3JB 2XTJB 3ULVE 3ZKNC 3R0MA 3MLPA 4NO0D 3HCVA 5AVTB 4JM2D 2APVA 2H32B 2D4FA 5I17B 1RVFH 1LL1A 2W9EL 4GO6B 3UJIH 2HG0A 1T1YB 4NQDA 5DYOA 2MNUA 1LDPH 3MACL 4PCKA 4MZRA 2WPGA 1AP2A 5J6HB 4TQHA 1MN4A 2WXHA 4E9LA 3TIEB 2VZ1A 2VZTA 3BSHA 4UQ9A 5EU7E 3ZDYE 4ODTH 3QGVA 5D1ZD 3NIDF 4U1GB 5FV1L 2R2EA 4WGVB 2H41A 1IC5H 3LNHA 1UFGA 2VN5A 4C56D 3GMMA 12E8L 1YNTB 4PRHB 4WWOA 1W6WA 3MCKB 2F53E 4HP5A 4YHKH 3IVKA 4FG6C 4Z0BH 2PCPB 1MJ7L 2Y36L 4XHQA 1OAJA 4PJ8D 3CXHJ 4J12A 5F97E 4POZC 2ADJB 4QY8B 2AEWA 4LK4A 1OB1B 5F2FA 4CDGC 5G55A 2BS71 3ZTJG 3FQWA 5E2WH 3O3BA 4R3SB 3HAEA 1E2VA 4HWBH 4EXKA 4N9GA 1QYGL 1PLGL 5AW8B 2G3MA 1J5OL 1JYWA 2NY0B 1IM9A 5BZDB 1E9PA 2YRBA 32C2B 2VDKB 5DU7A 2XG5A 1JZGA 5ITFA 2GKIA 3IDIB 2ITDB 4PJCB 4DEWA 3VSTA 5AW0B 5LXGL 4YSUA 1JVKA 3DUUA 2VAAA 3FT3A 3QAQA 3FSOA 4NQEB 5CU9A 4PVBA 3BZEA 4LFHG 4JG1L 5D7LA 3TV8A 2C4FU 2HLEB 2Z7WA 2BLFA 1F3JA 1IAOA 3TL5A 1KLFA 4JFFA 4ZUTB 3T3ME 3ILPB 1LEKB 3QUHA 2HLFC 4ZS6C 2F7PA 3MOAH 4X4ZA 4HOWA 2R51A 5KSUB 1YNLH 1AYOA 1XD1A 5TK2A 1NAKL 3GXMA 2PCYA 3RWGB 5GJTH 2VMJA 3BAIA 1B0WA 3AADB 4JQIA 1LM8V 4C57C 1JGDA 43C9B 4KXBA 4PW9A 3VH8B 1A7OH 4KY1H 4AKOA 4BV1A 1QZNA 4XI5D 2RACA 4ZXBB 2QKIB 4LPCA 2WXKA 1RMFH 4FQCH 2AQ2A 3N9GH 5FYKD 4Z7WF 2XKNA 1GYCA 4NQDD 3VFVA 2DWSA 3NGBC 2ZJSL 3P9WB 5D1QD 1S9XB 1CICC 2CGRH 2X4PA 1YJDL 3OC8A 4AMKL 2P43B 4NNYB 4G8AC 2EDNA 4X7TA 5DK3A 2J2ZB 1OT2A 35C8H 3P30L 4HGWA 2YKLH 1TTAA 3O3AA 3VXQB 1DJSA 4ZUWB 3LS4H 1S9YB 3B8SA 3VGEA 4JZOA 1ACXA 4PG9B 4M62L 1NFDB 3NACH 5F8RC 4G5AA 3QQNA 3G5XA 3VTTA 2AEIT 4G8FB 1KY7A 3EJYD 1KLGB 2WNWA 4X9HA 1RJLA 4GRLA 5DZPA 5J1AA 2AJ3A 2EXYC 4I1RA 1USZA 1FNHA 2CO6B 3T65B 4HF5H 4QOKE 5AVYB 3TCTA 1XTMA 4OLZL 4Z77A 3B1UA 3ARTA 3MMEA 4DAGH 4GRWE 2QQQA 4ORGB 2Y7MA 3F84A 1WO2A 4NN6B 5DQJB 3UFIA 1DDHB 1T0PB 1XGPB 5B39B 4Q6IC 5J06A 2I9TA 2W38A 5ECGA 4OGQC 2VXVH 4LKXB 2Q8BH 4DO6A 1MHEB 3GM8A 4IRJD 5B4MC 2ATPA 5L2KB 4JRXA 1IC7H 1BFVL 3RWHA 3IJEA 4OM0H 2AJYL 4A66A 3S3JA 4E9VA 2BIMA 2P5EA 4N20A 2A38A 2W9DL 1ROWA 3FB5B 1FV1A 1FQ9C 5D7LD 5DYOB 1TLKA 3UH8A 4MHHI 1AO7B 3HN5A 4WW1A 2I32A 1JGVH 5L4JA 5AOKA 2O72A 3PAUA 5IQ7L 1H19A 1U8HA 2HJKA 4JFFD 4CC4A 4N26A 4FCHA 2R2EB 4JFOB 1SDAB 1KGCE 1IT9H 1BM3H 3IYLW 2ROXA 1AJ7L 1OAUH 4NQQA 1AS7A 3ZHDA 3NEOA 4PGEB 2YLHA 4E5XA 3GMMB 3EYSL 4RGMC 4ATTA 3VM7A 3N85L 1IE5A 3DTUB 1A6ZA 5I15H 3WE6A 4PJXF 5DVLA 3AGWA 1JPFA 4K3JL 4N6QA 3WIIL 5FM4A 4DFHA 3NA4A 5TH2A 2AVFA 4S0HA 4F1ZA 1M7IA 1DBBL 4OM1H 3UYRH 2OJEA 3FQWB 3B9KA 3QWOA 3L3KA 5BO0D 3O3BB 2N0KA 3DUHA 3HAEB 1L9OA 3ZIMA 4DW2H 4N9GB 3BN9C 3C60C 5BUGA 1JCKA 4HFWA 3HRZC 1MIML 2FZ3A 3NCCB 1WT5A 4TULL 1IM9B 3KPSA 1E9PB 5E6ID 2HRHA 2XG5B 3ZUCA 5ITFB 4DKAA 2BY1A 4Q6YA 5C7ZA 3RI5F 3QAZB 5T1KD 3DUUB 2VAAB 1Q9OA 3FT3B 4WFGE 2PTTA 4IRZH 4NO5A 5DVKA 5CBEB 3BZEB 4H0GA 3MLZH 5JHLH 4ZAKA 3LQMA 3R1GL 5D2NC 3WFCL 1Z5YD 5EU6E 4PB9L 4OF6A 3LX9A 1BBDL 5SX4H 4ALAL 4AGPA 1UM4L 3HE7B 1MPAL 5JUEL 1XX9C 1KLFB 4OJFH 4Q6KA 1E9OA 3DBSA 4PS3A 4NC0B 2EXSA 1ETB1 3A67L 2DY2A 1SLVA 4L9LA 2JXMB 3FT9A 3DO7A 4OV6F 3TYGH 3H2PA 4NZDA 1KSRA 2NY1B 4R7NA 4FA8A 4AEHH 1JGDB 3EADA 3S34H 1TZHA 4Q4EA 2DQUL 4XBPA 1IO4C 2V17L 4KTYA 2FT8A 1KF9B 4JRXD 1E3FA 3B9AA 5C2UB 5HHXH 4MJHA 4Z7UE 5F9OL 2B9BA 4XCNA 4CDHA 5C0JA 3ISRA 4XMVA 4Y2DB 4RGNC 3V8OA 2P5ED 3I3DA 3SQBA 4HJJH 4DKFH 3RPKA 4OH2A 1J9CT 3ERXA 4K9EL 3VXMB 1RV6X 2QGCA 1IFRA 3KWXA 4XVUC 1G4MA 2R0KH 4X7TB 4YHOH 2BINA 4YDLC 5EN2B 5D7JA 4HGWB 4L5FH 5CZXC 5IBLC 4POYA 1XTLA 2CXGA 3D9AL 3EYQD 5KTEL 1PTZA 1ZLSL 4EUPA 3UYOD 3ZZLA 4HUXB 2D31A 4DESA 2DQDL 4NFDA 3BAKA 1FVCA 3ORJA 2DQCL 4QUOA 1XCWA 3HFFA 3P2DA 4Y1SA 3JSSA 5EN3A 4UZGA 2MPAL 3L7FA 1JIBA 1QRNA 3AS0A 3G5XB 2X40A 5F71A 1XF3A 3MNZB 3TOPA 3GRWL 3O8XC 2BS8A 4M6MH 1RJLB 4GRLB 1SFHA 5J1AB 4NFCA 5DGRA 2AJ3B 4OD2A 4IBYA 2D73A 1B6UA 2NY6D 4LQ1A 4BFKA 1R1CA 1MWAL 2UWEE 1IIKA 3HPLA 3UIYA 4AY0A 4RBPH 1EFXA 4RSVA 4Z77B 1THCA 3MMEB 2GTWA 3RJDA 1IE4A 2YMOA 1F4YH 4PI2A 1BQUA 4GP4B 1Z5LB 3FU7A 4WJ5B 1IC4H 3TBYB 2I9TB 4W81A 1MW3A 3DA0A 1U91A 1AR1B 2VL4A 1BQLH 2XV2A 3MRHA 1WHPA 5B3JE 2APSA 2FQGA 2JKSA 3G6DL 2WC7A 3Q9QA 3RWHB 4ES8A 5IB3B 4BM7A 1IGIH 4ZAKD 3L4VA 4L8BA 1VJSA 5GS0H 4OCLC 4YSCA 4YE4L 2DWDA 4WW1B 3VGGA 5CJBA 2B2XL 4DKTA 4LAJH 2YUZA 3GXIA 3WKML 3HC0A 4CC0A 5SX5K 2EEBA 4JDTL 2AJXH 5CEZH 2YEZA 1FYTD 4G7SB 1E65A 5DWUH 4XE0A 1MXDA 5I1DA 5JIKA 4ONFL 3L5HA 4E5XB 4LHQB 3SDCA 2D8KA 2P5WB 1KBBA 1BWWA 1HZHH 1BZOA 1A6ZB 2H8PA 5D7IA 3WE6B 3OMAB 4DGUA 4HVBA 1NBYA 2E6PA 5TDOB 4LVEA 1CO1A 4HWUA 1G0YR 5TH2B 2X2YA 4N1HB 3R8BB 2WOYA 3NZUA 1AE6H 1KEML 3O4LB 3QWOB 1SN2A 3B9KB 4F2MB 3L3KB 1RZFH 1AZBA 3IGAA 4J39A 4AQEA 1UA6L 5FCUH 3MV01 2VXQL 2V2WA 1Q90A 4HFWB 4J3OG 2Y7LA 1TZIA 4UQ2A 4N6RB 2XYBA 3KPSB 3LD8C 1L0XA 5IHHA 4UTAL 1JYVA 3U1PA 4XZ4A 1I9RL 1XF1A 4I5BB 2QTEA 1IM3A 3CFDA 1TU2A 5MEND 1Q9OB 4R26H 2PTTB 4NO5B 4PVMA 3EYVA 3VW3L 1XVSA 3M1BA 4NOFA 1JNHB 2YGVA 2M8XA 3T3MF 3CN1A 3CLFH 2BVEA 3CJJA 3CHPA 5IW6B 4HMDA 4MVBC 1XZ0A 2WLZA 3JXAA 4UDUB 3BGMA 5ICXB 4JDEA 2B5IC 5F1KC 1WH0A 3DX4A 2CHZA 1S7WA 3LB6D 3DO7B 3GDCA 2O5ZL 3EBHA 5AB0A 1V7NL 4LHUG 2X88A 3IETB 4KH2A 3WN5C 4MJ5A 4XC3L 3U1SH 4KVCH 2DQMA 2NUPA 1AKJD 3DOSB 5LAXA 5BS0B 5JPNA 5L4FA 1J9SA 3MYJA 3EOTL 4XBPB 5I66A 2HTKC 5I8OL 4PJGB 5HD8C 1CE6B 4DP4X 2FSEB 4K73A 4P0DA 4F24A 4XCNB 4L05A 3WY2A 4R0LA 3MBXH 1RJCA 4PHZA 2ADFH 3SQBB 4CVXA 4XCEB 3OSKA 1FNFA 4Z6AT 3B2VH 4NUJA 2GJPA 2YEQA 4DN3L 1AQ8A 4OLEA 2CCVA 3I75B 2VM3A 1ICTA 1A6WH 2NY5H 3BDYL 4JZJC 1HKLL 3HNSL 5D7JB 1HN1A 3AREA 2JIXD 4AYFA 1A8ZA 2FQFA 1JGEA 3KH3A 2IEPA 2VC2H 3JQOB 3TEUA 1WSST 4EUPB 3VB8A 5HYQB 4FJ6A 2Z31A 4KDWA 3MLVL 2DEWX 2WQWA 1FVCB 5CEYA 2G0KA 2GABA 3CFNA 4I18C 2D7QA 1X7QA 4YO0A 3L7FB 1QRNB 2XTSA 2Z8SA 4F8NA 4M7KL 1XF3B 3CZKA 4QRFA 2C3HA 1PD1A 4MB3A 5DRXA 2WUBH 5IROD 2G5BA 1A3LL 3I3BA 4OD2B 2ED9A 3MFGB 2K8QA 1R3LA 2P80A 1PQZA 3E7JA 1HE7A 3HPLB 4XNYL 1EFXB 5GZOC 1HX0A 2GTWB 4DERA 1KB3A 4GLRH 2N56A 4MCYA 5AVSB 3ZO9A 1C8PA 2J8OA 4KKPA 3KPPB 3FU7B 5CF3A 4JG5A 1DTUA 2UXGA 4P46A 3ZSTA 3N41B 1C7TA 1SBBA 3UTTE 3CD4A 1FYHB 3H7LA 3ESMA 4XPAH 1A7NH 3BLPX 5C0DA 4S1DD 3RGVC 3VGDA 5CJXA 4U2ZA 1T21B 4UDTB 1DLFL 4HYTB 1G9HA 1NFAA 3HC0B 3VGBA 4M6OL 3PXJA 4Y19D 4DN4H 5KYYB 3WFEH 4M6NL 2IF7A 1IBGH 2VZSA 2EDDA 5I1DB 3QIWC 3QIBC 2VDQB 1RPKA 4XB7A 1IEAA 4NNXA 3BCFA 4M1DL 2BFGA 4RFNC 4G7VL 2AK4A 2J8HA 3LZQA 5FYJL 3SDCB 3ZMEA 5JR1H 2AJUH 3QHTC 3E3QC 3EUDA 3S4SG 2XN9A 4OLXL 1RFDH 2NX5D 1CGTA 2L8AA 4XXDA 3QEQE 4P3WA 2B20A 3QZPA 3MV7A 2UZYB 2BZ7A 4OCRH 4X9FA 1TQBC 1U0QA 1GZHC 1H6UA 2ZOKA 4ENZA 2DZEA 4JO1L 2VAJA 1KGXA 4L4TD 1YLBB 4FA6A 3OJ2C 2PO6C 4AQEB 2DWTA 1ET5A 5I1HL 1HQRA 4EO5A 1MFCH 3HZYA 1SJXA 3OB0H 2V2WB 1XR9A 4UNTA 3OXSA 3ARED 4XMLL 4FLOA 4ILDA 3AU0A 3KLHC 1MIEL 5EBMB 4PJDE 2CGZA 1IM3B 1HINH 2FGZA 4ODVH 4Z7VE 4P8QA 3EFOA 3EYVB 3M1BB 2QHRL 4Y4FA 2JJSA 1YJDC 3VD4A 3P3RA 4RGOL 1UT9A 2QFRA 4G3YL 4P9HL 3MROB 2QQKH 1XZ0B 4OLWL 1LEGA 3BGMB 5ESAA 4LEEA 1ZV2A 1F6LL 1BG9A 3S9DB 5DURB 2DEXX 1S7WB 1UCBH 4JHBA 2X6AA 2W59A 3T4YA 4HDIA 5D6DA 5AW7B 3K3QA 2NUPB 3S5ZA 1DLHA 4PRIE 2GC7C 5E99L 3MYJB 4B7IA 4LGPB 5JHLA 1E5ZA 1SJHA 4GMTL 4MSWA 3CHRA 4LAQH 2UY6A 4NP9A 3WKYA 1KCUH 1XEDA 4R0LB 5IHZA 2PABA 2OW7A 1N5AB 4CVXB 1DANU 4HUMB 3OX8A 1BREA 2OMYA 3MRDB 4TPRL 1NPUA 1OKEA 4YBHA 2WTRA 2HPTA 1ETJA 2EH7H 4Z7NF 4MS8C 1EEZA 3WTSA 1QHPA 1LO3H 2NY4B 3JV4B 4AYFB 1JGEB 1LEIA 1FJ1A 3ARFC 1KB5L 3ZHNA 3DJTA 2RHEA 4H8WH 2AK4D 2Z31B 3H9SE 5CEYB 3N42B 1L9SA 4JG0H 5I9QC 5D93B 1X7QB 3HMXH 4XWGL 3FT2A 3M7OA 5CO1A 3O3DA 2OKMA 1AI1H 3V0EA 4LMQE 4JFDE 2ODIA 2VABA 2Z9TA 2G5BB 3OKDA 4PP2A 3DX0A 2I85A 2BVUA 1VEOA 4AYEC 1R3LB 4I3RH 1ZVSA 5DMIH 2D0FA 4Q52A 3JBG7 3GXFA 4G7RB 4OB5L 3U4EB 1DJZA 2GJ6E 2YAFA 1Z2KA 2PKDA 4AK1A 2X53A 1PCSA 5E70A 1PKQB 4BZ1L 1NANH 3HE6A 1T03L 1PW3A 4P46B 4YBLB 3MACH 4P5MA 1KPVA 2Z65C