1O9ZA

F17-ag lectin domain from escherichia coli (ligand free)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
177
structure length
170
Chain Sequence
b'AVSFIGSTENDVGPSLGSYSRLPFVYDTRNKIGYQNANVWHISKGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTKYSRGTAMSGNSWENVFSGWCVGANTASTQGLSVRVTPVILKRNSSRYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17-AG LECTIN DOMAIN
molecule tags Lectin
source organism Escherichia coli
publication title The Fimbrial Adhesin F17-G of Enterotoxigenic Escherichia Coli Has an Immunoglobulin-Like Lectin Domain that Binds N-Acetylglucosamine
pubmed doi rcsb
total genus 45
structure length 170
sequence length 177
ec nomenclature
pdb deposition date 2002-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1o9zA00
1OIOA 1O9WA 1O9ZA 2BSCA 3F6JA 2BS8A 4K0OA 1ZPLA 2BS71 1O9VA 1ZK5A 3F64A 3FFOA 2BSBA
chains in the Genus database with same CATH superfamily
3IN2A 4YDIH 3RVVC 3GSQB 3OXRB 4JM2A 1HEZB 3KLLA 5E4EB 3ULVD 3T0EB 3MOAL 4GO9A 2X6MA 4HDIA 1QP1A 3W9DA 1DUYA 4MA7H 2BVOA 4FMVA 2Y25A 3B2UD 3HAEH 3U48A 4J4PA 2CLVB 4PJ5A 2COVD 2IPKA 3U2IA 3ZTJH 3EJSA 3KPOA 4H0LC 1GS6X 1HOCA 1KDIA 1AGEB 4AW7A 3T3MB 4HX1B 2DLGA 2ZPKL 2ZUXA 4Z3EA 1ZKAA 4ES9A 4NI3A 1R5WB 3ARZA 2OXGB 2VIRB 3L6FA 4PQXA 4HS3A 4BFIB 3GXDA 3GF8A 4HIHA 5DRZB 2Q3ZA 3ZXAC 1U8PB 2CJ3A 4N2OA 4F37F 3AU1A 3WIHA 5DK0B 3Q3GA 3RVUD 4P57B 4I0CC 5E99H 2K4AA 2OI9C 1GOGA 5K1VA 2E7BA 2DDQH 5ANME 3VYNA 2FCBA 4NN6B 4O4YH 3V7AG 3JTTB 1DQJA 3NGBB 1KLUA 3N2JA 1BBJA 4JRXB 1FNEB 3T8XB 5C92A 1FLTX 5CZKA 4KGJA 2BSRB 3D9AH 3MX0B 4N0CC 4PJIE 3VH8G 3BMWA 1CFTB 1RUPL 4C47A 3AT9A 3DI2B 2CA4A 4IU2B 1B2WL 3WNPA 2CO3A 3K8LA 2QSCL 1COBA 3CFDA 3KCWA 3DV6A 4NNPL 3EYQD 2LTQC 1VFAA 1T5WA 5E2UH 1QSVA 1BZ9A 3WU1A 3IXAB 3B9AA 1X9LA 5KJ4A 5IF0A 3C8DA 2FEDD 3EFDL 4Z0XB 2FH8A 1YNLH 3HRZC 3CDGA 1X5HA 4EZJA 4KBPA 3QJFB 4DO5A 4P04A 2VT0A 2WLLB 4Z3FA 2AJZB 4MZRA 3PDGA 4ZMTA 1SVCP 2NQDA 4NKIL 1GAFL 2B1OA 3DIFA 3PG2A 3IWVA 2NY3B 2XWJB 3QWNA 3O6FA 1AQMA 3H3PL 3FAXA 3P4NB 2EEXA 3MNWA 1JWMB 2CHWA 3QO0B 4D3CL 1T7WA 4FKKA 4XPHL 3UJIL 3U0TB 5AD0B 3ILEA 5E8EA 4FG6D 1V10A 3GJFK 5DK2B 4LLUB 3KJ4B 3WJMB 4AQZA 2OMXB 3V5KB 2FATH 3KEHA 1I8MB 3VXME 1CFSB 5FLVA 4NN7C 4OQTH 1B6UA 2VKWA 5DMYA 1BXXA 2OCJA 3MBED 2QZQA 4LB8A 3UEQA 2GCYB 4U2ZA 2YD3A 4OI9A 3FQTB 4JFXA 2NY3D 3HE6C 1A4JA 4JFWA 2WTOA 3CNKA 2VDOH 1CT8A 4MB3A 1ACCA 3CFNA 1GTNA 4B7IA 2VDQL 3MU3A 1FFNB 4UAOB 2VR9A 1EHKB 4LT7A 1IEBA 2GAZB 3UJTH 4XCNA 2DQHL 2H1PH 3NMEA 2PYEB 1X5FA 5HGHB 1B3IA 3D4GA 4ZUTA 4HIEB 3UBFA 4J8RB 1H6FA 4GW4B 4XXWC 3QJRB 5TH2B 3WNOA 1FNSL 4K3JH 5AZEL 3L3HA 1HE7A 5B3SB 1LO5B 1OM9A 3STZB 4LEBA 4ZG1A 1M42A 4YSTA 1ZHNB 5EOTB 2X2HA 3KVPA 5LNDA 1KIUA 3NPSC 4QXGL 2CIIA 3B7RL 4K94L 4WV1A 4G6ML 4FEMA 4LIQH 4POZC 3MCKA 3FTYA 5I6XB 4HJJH 4WU5B 1X5GA 4F3FA 3RL1B 3V4VL 1LE5B 2AS5M 4HIQA 4M7ZB 1S7SA 3QQ9D 2VDOB 5DUJA 4DEUA 5JHDB 2KLRA 3HMXA 4ALAH 5DQDL 3FC8A 2L7EA 1JNLL 5T5NF 3H9SE 4JVWA 3RL2A 5IHLB 3EOAB 3LPFA 1KJ2A 4ZW8A 1HH6B 3GXIA 4BKTC 1EEYA 3QQ9C 3RWJB 1OO2A 3QSKB 5SWSA 4NIYE 2J6EL 4W9DC 1JZIA 3VXNB 1U33A 5EEYA 4JO3H 3EJYD 1NGWB 3KPSA 3QH3B 3RYMA 2DKUA 5EIQA 3MRQB 1TYJA 3ATDA 3LN4A 3A6BH 3IJEB 4RBPH 4TUJA 5D7IF 3VFVB 4OIFA 5IMMA 2ISDA 5CGBA 3ZR5A 2VR7A 4TVSa 5MEQA 2J8UF 4GXUM 2H2PC 1L7TH 2W0FA 3VMNA 5D9SA 1EVUA 4M6OL 4UBDD 4NUJB 4OFYD 1S7QA 1YMHB 1RZFL 1MZYA 1MH5A 4Y16B 1L6XA 2R1YB 2D3NA 3VQ1C 2P5EB 2FO1A 4X6FB 1KEGH 1G6RH 3T08A 2ZOKA 3W0WA 3U6XA 1N8ZA 1QZNA 2BS8A 5FWQA 3E6HA 3M86A 4M43L 3HB3C 3ETTA 3L9RA 3RGVD 3MA7B 2RQEA 4JN1H 5C0CB 1TJGH 4QCIB 1XB3A 5DSCA 1U8KA 1UD4A 1JYNA 2BPBA 1GVIA 2Y7QB 3QUMH 3QRGL 3B5HA 5C3IA 4YHKL 5KVDL 5C0NC 4ORGB 5SV3A 4CBZA 2H32H 5IJKC 4RGNE 4BCXA 2BNQA 1LP9E 3ZL4H 5C7XL 4HJGA 1VEMA 3GDBA 5ENWA 3V5HA 5IHZA 2E4FA 4KJYB 4HS6A 2QPDB 1U2HA 2F19L 4AUYA 3CSGA 3GSRA 4M1DL 1CFBA 5L6YH 2W81C 4XO8A 5ADOH 4Q56A 1R5VA 3CVHL 4LLDA 1D5XA 4FJ6A 5IM7B 4NM8H 2BP8A 3FTSA 2OMTB 1LO4H 3BVTA 1BAFH 3BVVA 3SPJA 1IKOP 2MHAA 3F85A 3MLRH 4PW4A 3EYSL 3PL6B 4N86A 2WMPB 4OZFB 3TV3L 3REVA 2NUPA 3ZTJG 4WNJA 2VXSH 1IBZA 3D30A 2BLFA 3IBEA 3UO1L 4ELMA 1KIQA 4C4KT 2CDFB 1GCYA 2X9XA 1MFVA 3NJMA 5BW7C 2YOAA 2D03H 4YBLB 4ZFOL 4XNYH 5BUPA 1I3VA 4MSWA 3O6MH 1GYUA 2X4QB 1M05A 5HJDA 4NZTH 2EDTA 5CR8A 3V5DB 1S9WA 5FLUA 4WCYH 3FH5A 1S7VA 3LPGA 2F5AH 4L48A 1JXKA 1I85C 2ZX7A 4ODUA 4NUGL 2VW4A 4HA1A 4MB5A 5DMIH 4J3BA 2E3VA 4PJ7B 4HAGA 1RU9H 4M61B 4Z7UE 2AXJA 3HHSA 3UG5A 2IJ0C 1JPFB 1R3HA 2P8LA 1A14H 3FSOA 2EABA 3S3SA 4G7QB 1KPRB 3QXDB 5D93B 3VXRD 2C9UA 4KUZL 5AOJA 1P4UA 4WK4B 1BQSA 1PY4A 3UCRA 3V0EA 2G9HA 1CBVH 4LOVA 1IAOB 2V5SA 3OHMB 4NQSA 5E5MB 1FA4A 4U3CA 4YQXL 1HXKA 1X5KA 4MMZA 5IMLB 1OB0A 2D4FA 5J89A 1IBDA 3WFCL 1NWPA 1TJMA 4HX1A 3V0HA 2P7TB 2CDEA 4HKXA 5J6HB 5TK2A 1TLMA 2ICEB 2OP4H 1WWWX 4B3VA 3FFDA 5FKPA 3AREB 5D7LB 5LGHL 3TJHC 5TE4L 1IFRA 5AQ0A 3FT9A 2FTAA 2W0LA 3FONA 1FJ1A 1HL4A 2WBJC 4YQXH 3V10A 3ARXA 3SQOL 2IFFH 1CGTA 3HC3H 4M7LT 4BSVA 4AMKL 4QI3A 3MRNA 1E4KA 1PAMA 1WUZA 3QR1A 4H8UA 5C0FA 3KM2A 1SJEA 4L5FE 2R39A 4F9PA 1UWEL 1AFVH 4BQ6A 4JFFA 4X9YA 1J9TA 4PRNA 5EWIH 4KZEL 2XXMB 4W70A 1P5UA 5I66A 3QARA 4A68A 2YHGA 2V5TA 5DZLA 4DTGH 4UTAL 1MCQA 1I9IH 2FBOJ 3CSFA 4X6DE 3LZQA 2NNXA 2AC0A 4KWUA 4OD1L 3UOAB 5IEHA 5DUBB 4YEFA 3U7YL 4A2LA 1TZHA 1FNFA 4FNUA 3NH7H 1J9RA 3OMZA 4MWFB 3SPVB 2X4OA 1JUFA 1ZTXE 4TQPA 3E80A 4LSTH 2FIKB 4KK5D 1D6VL 4F58H 5KYNA 5HYJD 3ZT5A 1TEYA 3I6GA 2B20A 1UGKA 1I82A 3TYGL 5ABAA 1OCWH 3G6DH 2ZX9A 1I9IL 3FT2B 5KSBB 1MFEL 4J5VA 5HDBF 5AL8A 1AZCA 2AJSH 2DMBA 4OFIA 2X6BA 5F0PB 4R4ND 4S2SA 5DF0A 5G55A 4NRYA 5D7KE 2I07B 2NW3B 1P1ZB 2QVFB 1FZMB 2BH0A 2YPKB 3QUXC 5I17B 2Y6TE 4FNSA 2JB5L 2NT0A 3VGBA 4C4UA 1PD1A 3BKMH 4JREB 3TH2T 1YMMA 3U46A 1LEIA 2OTUB 1BZOA 1WGOA 2ZAHA 4I2XA 1GH7A 4FKHA 4EI5C 3B2VH 1S3RA 1F41A 1UHVA 2A83A 5FAAA 1R4XA 1S9XB 5TF1H 1I8MA 4Z77A 2GEEA 4PBXA 3AG4B 1JGVL 1JL8A 1JHLL 1I85A 3OF6D 3IJYB 4Q0XH 1ITCA 1I7ZB 4XBEH 4DGYL 5F9OH 3FCUB 3QISA 4KDTC 1OTSC 4OF6A 4TOYH 1T1ZA 2NY3C 3T0BA 1HHKB 4DW2H 5TDNB 1E4JA 3CLEL 4ECNA 1SJXA 2NY6D 4X7DC 1D5RA 4NHCL 3FQXA 2QQLL 2EUXA 1AJ7L 2ZWYA 5EU6B 5I1KH 2FGWL 4H8HA 3HNSH 1C7SA 4A7TA 3O4LE 5BS0B 1M7IB 2FWSA 4L4VD 3NIGE 1N6UA 3JV5A 2VL5A 3FNKA 4LPXA 3HPJB 3HJ0A 5FYJE 4BKLA 3S3PA 4ZUTB 1J1PL 3WJLC 5E6ID 3KGRA 1PIFA 3NOIA 3ZTEA 2EIZB 2RALA 3BEWB 3KLAB 4JDZB 2Q6WA 5CILH 4BH8B 5ABZA 3UG3A 3CQPA 4AGOA 4KK9D 2RH0A 3HBQA 1FHGA 2EDFA 3HHMA 1E2WA 2YXVA 2WB1A 3NEOA 4OQTA 4X5PA 3D4ZA 3MLWL 1AHWC 1T0PB 2HVJA 4ZOBA 5CEZE 2AXGB 4J23A 5IW3A 3SKUD 3ZT6A 3TXAA 1E42A 4GSDH 3SZKC 3IDMB 2VMFA 1MCEA 4CMMB 3TO4D 3PU7A 3RTQD 1X6NA 5IVOA 1T21A 4NHUB 1EJ6A 1MJ8L 2A74B 4M48H 5KVEE 5GSVA 3PWNB 1YNTA 4RQQA 5J9PA 3BWAA 3QORC 1FRGL 2BOBA 2WZ5A 2EDRA 3Q05A 3GI9L 1KCKA 4JPWL 1CU4H 1HIMH 1N8OE 5ERWA 4GSDL 2Q8BL 1TZ8A 5CR1A 2FWUA 3L3DB 1NPUA 4CAGA 3UYPA 2DLTA 1K72A 4CU7A 1A5FL 1TOXA 2G2RB 2XV2A 1ZT1A 1ZEAH 3SYQA 5DC0A 3QXVA 1CG9A 2Z1KA 4NRZA 4U1JB 4AYID 4MQ7A 4LIQE 3HNVH 1O7SA 4XR8C 3HG5A 1KFAL 1YEEL 2EEBA 1QSED 3LN4B 3RBSA 4R2GC 1UZGA 4IDJH 3HBGA 1DUZB 3H9SA 1BLNB 2C9XA 5KANG 4EUPG 2BNRA 3ATAA 3ARBD 5EOCL 2WO2B 3MKKA 1E9PB 5LG6A 3PHQB 1WSST 1QSZA 4G9FE 5SWSE 1YMMD 4M6NL 1XAKA 4NRXB 3UROR 4ZSOB 3NA9L 1FCGA 3VGAB 3BUQA 1JVOA 3S36L 5H94B 1TG8A 1CXIA 4R2GD 4R7LA 4A7GA 1KB9J 1FFQA 1E4XL 4G7VH 1I8IB 1KY7A 2NTFB 4L3CA 4Q2ZB 1WIPA 4XP6H 3S35H 3W9EA 4EZMA 5FHAH 2BVEA 4JR9H 3MLUL 2FBJL 1SM3L 1NBYB 3OJDA 3LH2L 1SYSB 1USQA 4FYQA 2HAZA 3IE9A 2Z7YA 5E2VL 4R96B 1Q9WA 4FFVC 5DMKB 3EBGA 2WO3B 2WCSA 3MBXL 3ZE0F 2ZUTA 3CZSA 4ZAKA 1LL1A 4PRBA 3MXWL 4CC0A 5I1IL 5LO7A 5CZVH 1RY7B 2YPLA 4KKCD 4KKPA 4WHYG 4DCQB 4WWOA 1G9EA 5C0GB 4JFVA 5B4MC 3F12B 1M53A 4JR9L 3RTQC 2R23B 5KAQF 2V9TA 1WFMA 1GL4B 2YN5A 3W56A 2HVKA 3H54A 5FKAB 5AB2A 3MV9A 1A7QL 1TZAA 3QDAA 3ALPA 1TZOA 1EDHA 1PZSA 2BCKA 3ZTDC 1MCDA 3IDNB 4IMKA 2KL6A 2BNQE 4KK9C 4QOKB 1LP9A 2HJLB 3M1BA 1QR1B 2BERA 3RAJL 4QT5A 2GIYA 1ZTMA 3L5WA 1YA5A 1BZQK 3B7YA 4ONFH 2Q0ZX 4KTEL 5L7XH 1REIA 3TF4A 3BP6A 1XF2A 3KGUA 2XYCA 3WDJA 3GO1H 2VLJD 1AD9A 3T4AC 5T3XD 1KMGA 1JMZA 4C4BA 3WAKA 5L9DL 1ZT7A 4JFHD 1G9NL 1A14L 5MEPA 3BH9A 3NSCA 2F54D 4HKZA 5IROD 3O6LL 2YGQA 2FT8A 4JUSA 5CD5D 1ESOA 3MLZH 2UX7A 3QUXB 3TBSA 4KOBA 3IRCA 2IPKB 2Y7NA 1HSBB 1RIHL 2IH1A 1UYWL 3UG4A 4YXKH 3VFGH 4Y4FB 3AQYA 4PAZA 1UT2A 4OU3A 1OAKL 3AQDA 4S1DC 3I9IA 1JPFA 1R3HB 4KX7A 3X14B 1OGTA 3GMPA 4HEPA 4C56A 3OJ2C 2Q86B 2CUIA 2ZP0T 3DX6B 1KPRA 3QXDA 4NERA 4M9OA 4F1ZA 1CF8H 2JWYA 1GIGL 1QHQA 5LB1A 1A1NA 1C5BL 4QTIH 4RCAA 2OM5A 3BJLA 3F7YB 4ZUWA 1IC7H 1MCIA 5C9JB 1J0YA 2MQ0A 2JQMA 1QLEH 3PHOB 2NY6C 4Z7UA 3FU0A 5FM8A 2D4DA 2QMKA 3F7VB 5LNGA 4G6AD 4G5ZH 4XZ4A 2QLVB 4HKJB 1AZBA 1E4XI 3B34A 1UT9A 2X28A 4XMKL 1SLXA 3RDTD 5GZOC 3TL5A 4HCRL 2ENQA 3KBFA 1V54B 3P0VL 5J56B 4KZEH 2V5MA 1ZSDB 3TCLB 3ZDXB 3DYOA 3AY4A 2ORBL 4KK5C 5DMGC 5C09D 4YO0B 4IU3B 1YO4A 1S7XA 1G0DA 1G9ML 5I9QC 1Z5YD 3T0EC 3WKYA 3ZO0A 4Z7VA 4G5ZL 5JNYB 5I6XC 2XTJB 3ZYOA 2W0KA 3RA7L 5JHLH 2D9QB 7FABH 1OPGH 4JFFB 2FD6H 2J8UB 2UZXB 4JHAL 4AI7A 4HC1A 5B1JA 3RURA 5HGAA 1QRNE 2BMKA 4AXWB 4F57H 4LSQH 4O5LH 1WQVT 2APWA 4GRMA 5CZXD 3QORA 3QUGA 4JFYB 3VDAA 5KS9A 1MUJB 1QRNB 2WWMC 4N9GB 1XR9B 3QIUA 3KH3A 2V5YA 4R0LB 4QRRA 2QEJA 1SN0A 1IM3A 1EDYA 4N8CL 3RA7H 5JHLL 7FABL 2HMIC 2PWFA 4M7JL 1NGYA 4W9HC 4BEIA 3DETD 1VA9A 2P5EE 43CAA 4WU7B 1IMHC 4OZGE 3W5NA 4MD5A 4ELMF 4DVBB 5CD3A 1AQHA 5JHDD 3GQFA 2EIMB 5EIIB 1HEHC 3I6LE 2LLNA 1ODUA 3NAAL 2X4NA 3RJQB 2VLLA 3VWJB 1XSOA 2CNZA 3GTVA 5I8EA 4X6DA 2ZWNA 2OSXA 2VO8A 5BOPA 2R51A 3ZKSD 2CR0A 5LWYH 3QPXH 3INUL 2W9EH 3EH4B 5I17A 1UB5B 2LQRA 1BIIB 4PJ6A 2JJWA 2MTAA 2DTSA 1KGCD 1DZBA 5DRWA 2OTWA 3R18A 4TSBH 1FFTB 4BDVB 1HHJB 1Q8MA 7CGTA 2EILB 5E7BA 4YSDA 5KVGE 2NNRA 1A2YA 5DVKA 3GPEA 1FFNA 3WKQA 4BINA 2ZJSL 3EXLA 1XR8B 1WBZB 2XG4A 2IGTA 3IYLW 5LWYL 4UOJA 4LVNC 1U8HB 2FB4H 4OUUB 1AXTL 4UWQB 4LO9A 3WDIA 4FNRA 1JFHA 1XIWA 5GJTH 1JZ7A 3D0VA 5FDYA 1A6VL 3OKNA 5D1QA 3HAEB 1N2RB 2JKXA 1XSKA 1TQCC 4TS6A 5IZ7A 2WWNA 1ZHNA 5KZCD 2P9RA 1BX2A 2AQRA 1E5ZA 5E8PB 2AJZA 3ME0B 1RP8A 4XMTA 3KE0A 3OKDB 4GQZA 1LE9B 3OZ9L 3P2BA 2NXYC 2CQVA 3CHRA 3BKJH 1SN2A 3TBYA 1MIEL 3IFPA 3HG1A 4ACTA 1NLBL 3AS3A 2ZSVA 1ZE3H 4PJAE 2Q87A 2BW4A 3QWRA 5CJXC 4HHAB 1NM4A 2M8XA 4YBLC 4AH2B 4HZLA 4JO1H 1IKFL 1SPDA 2WIMA 4Q9CA 5AZEH 1BJ8A 5EOQL 1Q0EA 5JOPE 1CFSA 5A2KH 2V8MA 1AZZC 1CGWA 4GEJA 3PWJB 3RPIA 2WNXA 1GMIA 1C08A 1Q1PA 2LVCA 4UTBA 5I9QB 2GCYA 1NC2B 3FTWA 3ISWA 3FQTA 2R0LL 4RGND 4ZZKA 4LU5L 4QIRA 5I30H 1DQDL 1H8LA 2A0LC 5CCJA 2E4TA 1DVUA 3P11H 3T65A 1UXMA 2XV0A 4NP4H 5TE7H 2OX5A 4IOIA 4Z0BL 1KB5H 5C0BB 3D34A 4U3HA 1BYPA 2V2WA 3DVNA 4X6BA 2NUTA 2X1PA 2Q76A 2ZUSA 3IGLA 1PD0A 1W72B 5F97E 1YN6A 3DJ9A 4HIHB 5DRZA 3AABA 1MEXH 1ZD6A 4X6FA 4W4OA 1BWWA 4JFZH 2YIHA 3MNDA 3OB8A 4NPYA 3GMOB 3WV0A 2HX8A 4L29B 1XGPB 1WO2A 3FBQA 3H9SB 4DOHB 3RTQA 5SV4A 5HJ3A 4QHLB 3RWEA 3S48A 1AGDA 4W6XB 4TKWA 3TO2B 4PLNC 5C6PB 1R3KB 2CR3A 2VRAA 2HFFB 3FU9A 1CGSL 4L8BB 2XA8L 4WK2B 4ZOEA 3MRDB 2VDKH 4JFZL 2DOCA 4KC3B 1QVOB 3LS5H 3K6NA 2RB8A 4H20H 1ZSHA 3EOAA 4KKLD 5FGSA 1EZUA 5DRNA 3D6GA 4RWYH 1FWXA 3V4VH 5D55A 4OZIE 4FNLH 2EH7H 3BAYA 4U6TA 3WHXA 4DETA 3VJ6B 1A1OA 4YBQC 3WENA 4MASA 3MLTA 4JZNB 5MHSE 4HXBH 2Y5TB 1KTDB 1FFRA 2AERT 4L1LA 5FYJL 3ZN6A 1J5OL 5AKRA 1FNSH 3OKLA 4K3JL 3CDGB 1L9RA 3V0DA 3C6LD 3PRZA 3BGFC 3BSZA 1PGRB 2UZYA 3GMNA 3KR3H 3SYPA 1TPXC 1KCSL 1R1CA 2BK8A 3SBWC 2AV7B 3MCLL 3O45A 4JRYB 1CU4L 3JWDL 4OTXH 1YDPB 1UFUA 1FYTE 4HGKC 1QD0A 3FOMA 3HHRB 3QEHA 4OZFA 3ARPA 3WFDL 4Q9RL 2ZQKA 3FCBA 4X4KA 5SWZE 5HSFA 4XNXL 4XPGH 2E7LC 3HEIB 5BRZE 2CPUA 3QP3A 1F11A 1LWJA 2A74C 5IBLC 2MOGA 3IM1A 1UH4A 4P46A 3VA2C 1KLFA 3ZUNC 3NFPA 1DBBL 3GXNA 5EUOB 5DJ6A 3WCYA 1KNOA 1G9NH 1VZHA 5DSCB 1WIOA 1ZLVK 4G80A 1SXSA 1CGUA 5EBGA 4HD5A 4JY6B 3VXMA 2LU7A 1GKEA 1TTBA 2EACA 4XP5H 1PG7H 4P5TC 1P4BH 4MLIA 1MHCA 4TPRH 3VU1A 2OZ4A 4ZK8A 2X4TB 3CPUA 2DD8L 2R7EA 7TAAA 4AIZA 5ENWB 4HMCA 2XWXA 2Z91A 2I69A 3KYKH 1FVDA 4XNYL 2XIDA 5FUCC 4AJWA 2MQGA 4X9HA 3ARWA 1BJ1J 3PJNA 4UM9A 5TDOA 2BVTA 1UWGL 3D2UB 3GBMH 3QIBB 1JJUA 2V7HA 4BCYA 4FG2A 3VRLE 5I1AB 2RJMA 1I3RB 3QYMA 1FHNA 1SVBA 3X14A 5I23A 4W6WB 3GHPA 3VW3L 3KWUA 2QL1A 2OKMA 3SBPA 1I8LC 3DX6A 4I48A 4PS4L 1QRKA 3LN5A 5K33A 1E3FA 4UNIA 1I8AA 3IDYC 2XOTA 1KTLA 5T3XL 1BOGA 1HILA 4LCIH 1SOKA 1A1NB 2WGNB 4IU2A 4HPHA 2XG5B 1KIQB 2EIBA 1MJJA 2AI0L 3HZ3A 3M17A 4LSVL 4NC2B 2VN4A 4V1DD 4DNLA 4D7PA 4IKKA 4DOHE 4ICXA 4POUB 1CD0A 3HE6D 4EVNB 5ID0B 2FJHA 1ZHBA 3WE6A 1BZ9B 5IEKA 1WT5C 2AABL 5JTWA 1OB1B 3ROOB 2VNCA 3HBZA 3IETA 1W6LA 4Z8FH 3GUFA 4PJBB 5EO9A 4JG0H 4MNQE 1LDSA 3QXAA 1NMAL 4G8IB 2CRZA 2J88L 1Z32X 4P8QA 1TR7A 3O2VL 5I0DA 2A73A 1Y0LA 5E94B 1LK3L 1PYWB 1EO8L 3GM8A 3S96A 2ETWA 1IB5A 1OOAA 1UCBH 2Q3XA 1H5BA 4HC1L 3L3JB 4RGNB 5EBLB 2DWDB 3UDWC 5EU3A 1UM5L 1JMXA 1MIML 2QV2A 1T6WA 3HE6B 4NSKB 1KDJA 3WKMH 1RZFH 1L7IH 5GZNC 4AV5A 3ZGIA 1ONQA 2EEFA 4AYEC 2MIZA 3ZTNH 4IM8A 2Z8VC 3KPSE 3S4SG 4EJ1C 1KEGL 2VZVA 4YLCA 1PX4A 3UTPE 3WGUB 2WY3B 4GQRA 1EJ8A 1BBDH 5C3TA 4HCRA 1UOVA 1CL7H 4XPBH 2IDUA 2Y0SA 4HGWB 5G4NA 3QDMD 1LO3H 3WKPA 1HU8A 2ENSA 4D0DA 3NFNB 3SKNB 2DM3A 2VDQB 4GRLD 2ZP9A 3HR5A 5EZOH 3MFFB 4XXWA 4DP8X 4QWWC 4WRLA 4WI8A 1BBDL 1BQRA 5EIIA 5JW4N 1S46A 2XPZA 2AKRB 4MMXB 1RPQA 2WP3T 1ADQA 2EAEA 4DSYA 1G7HB 4AQ1B 2DQGH 3K6DA 4N0CD 4G83A 4DGUA 1SN5A 4IRSC 4PJFB 4HJGB 5IHZB 2APBA 2ZWLT 3EOYG 2GSIA 4AQEA 4L37A 1GTFA 1T0MB 1HHKA 2GQHA 2MOQA 4HV8B 4LRIA 1M71A 3IJSA 2JI1A 2R4RL 3A0OA 3MPCA 2VQUA 2JB5H 4QDGA 1J9SA 3P2TA 3V0VB 4OJEH 4YZFE 2YEVB 2YQ2A 1S7TA 5EZLA 3LKSA 3MRCA 3DOIA 4ZO6A 2PUQT 1E50A 5ACZB 1EANA 5H8DA 3VTMA 4Z78A 3LQAL 4QHKI 2X4PB 2O72A 1QLRA 5DRXB 1RKRA 1AYRA 1QYGL 3GKZA 3LTVA 5BO0D 3G5YB 4MZIA 3TONA 5L6YL 3E8UH 1D5MB 4XCCL 4PIRF 4D0BB 1BX2B 2YN3A 3HW7A 4FMFA 3DX3A 4L0PB 4LHUA 4RESB 4NO0A 2F5BL 1CGYA 4IBUA 5D2LE 4WCYL 3H8NA 2V37A 4XXDA 3FF8A 1P84K 4OR1A 4L9LB 1RSYA 3DXAD 3WEBA 1PZ5A 2VISB 4M8RA 5F1IB 4HUWA 1FN4B 3H9ZA 3ZLQC 1DUYB 2J12B 5JDSB 4F5CA 5D1QE 5LCVL 1MOEA 4UT9A 1SXNA 1ED3A 3DOSA 3TBWA 5CZXC 1MAJA 1UVQB 3HRPA 4MX7A 4XX1E 4ZMPA 1A7PL 4PJBE 4PJ7A 3ZE2E 3NDZE 3NRPA 5FO9A 3UTTE 1MCSA 1U3JA 1S5HB 2GTWA 2PWHA 4NP9A 4Y5VA 1JZ2A 3CDYA 4UIMA 4H8VA 5TDNA 1QHOA 2CRYA 3S37X 3CX2A 1NC2D 1KXTA 3MRRA 3R1GL 5LXGH 4PJAA 2CO7A 5AENA 4QXUH 1YEGL 5CIPA 4F7KA 4MD4B 2IBZY 3F2LA 2F8OA 5LGHH 5C0CA 1UH2A 2DLHA 4KO9A 3L4WA 4EUPB 5BO1L 4ZTPH 1B4RA 4I1NB 4DW2L 3UABA 4I9XA 4AOFA 1OLLA 1Z66A 2OV0A 4N8VA 3CXHK 3GBEA 3H2PA 2Z0UA 4QRQA 4X2UA 3Q6GL 4EI0A 1CBVL 3QK0A 5KSBE 2NXZD 5B21A 3IXTB 5JXEA 2BVPA 1F90H 3P0YH 1QPPA 2GJRA 4BZ1A 4M00A 3B2VL 4H1LH 5TF1L 3Q06A 1NPJA 4KXDA 5AW3B 3I3EA 4MHHI 1BQHG 4I18C 1T5WB 5DJ0A 3RHWK 2B9BA 1YG9A 4G59C 4AM0B 2IQ9L 5EC2B 3RTQB 1NJ9A 3KPRB 1AXSB 3LQAC 4PGCA 1BYNA 5KJRL 2DTML 1OTTC 4BZ1H 3VFOA 2HT3D 4F7MB 4HXAL 4PJCB 2AHIA 4X4ZA 3NCMA 3RIAF 2DQCH 3D06A 1MVFA 1XXDC 4GP5B 5E56A 2YUWA 3X13B 5JW4M 3L7EB 2APVA 1RFDH 3PF2A 5E95B 5I1EL 3G5XB 4KFMA 3X3GH 2CDGB 4KVCL 4P2OA 3BSZH 4LL1A 4ZQKA 1R47A 3OL2A 1Q72L 1SEBB 3VJ6A 2ZXDA 2EXYD 1OWRM 4A6YB 1V3KA 4NQVB 2DEYX 2H9GA 1JWMA 3P3TA 1H5BC 2HVKB 3LNIA 3QO0A 4MQ7B 4P07A 3RZCB 3TV3H 4DN4L 3LKRA 3UPAA 4YZFF 2F0CA 5DK2A 3ZKXB 4WDIA 3UJTL 5D7JD 1CQYA 4JGJA 4WHTB 2MQCA 4Z0BH 1P4IH 4PD4J 3WO3B 5HHOD 5DURD 2ZSWA 2OQJB 3PJSB 4Q4EA 3TPUA 4PGEA 3FQNA 4PCKA 4HCIA 4UDTB 2Q7AA 4WWKB 4Y5YC 1DBAL 4OFDA 4G1MA 4I18B 4PP2B 1GGBH 4HIJB 5E5RB 4P9HL 4HBCH 1Y6KR 4M61A 2BRRH 3CN4A 4OLYH 5I6KA 1A02N 1EK3A 2FR4A 5J06A 4JFDB 4PYGA 2NY2B 3RZCD 4QTHA 4FXKA 4Z7QF 3R8BB 2JK5B 3LH8A 3IMBA 4F15C 5M7QA 1G7PB 1TIUA 3MR9A 3CE1A 2CHNA 1BQLL 3OHXC 3VRIA 2A77H 1HYRC 4KROC 1JK8B 4X4YB 3FUNA 4NJAH 2QELA 2G5RA 1ETA1 1T6VN 4UZUA 5FUZH 3C6LA 4EIGB 3C75A 1CBJA 4JZOA 2Q86A 5D8JL 4PRBB 2AJVL 4AEHL 3RUGE 3BUYB 1MN4A 2XN9B 1QFUL 3TBTA 4K94C 4XC3L 1NDGB 5GS0C 1M7IA 2XKSA 4IRSD 4F3FB 2VR4A 2OCCB 4JO2L 3CVIH 4RMSA 1ZXQA 3MRIA 1TENA 1W0YT 1UM4H 1CYGA 3ZHNA 5LBGA 2EEAA 1BM3L 1DEEA 3S2AA 2B1HH 2W0PA 3B9KD 4BXVA 1SJEB 3KHQA 2FWOA 2HX7A 3PJLA 5IB4B 1X5LA 4AQOA 1E9OB 5C8JB 1G87A 4QWWD 2Z4QA 1L7TL 4F8TA 4PJAF 3HTLX 5F3HA 4V2BA 3WO4B 3FQWB 5KSAD 3P9WB 3LRKA 3CVIL 1T04A 5DEGA 5DS8A 1MG3C 3MQIA 5GRWA 3QYNA 3OHXB 3TIDB 4TVPD 2D8KA 3O2VH 2JKSA 4N24A 4QTIL 5ANMB 4JO3L 3WG7B 3HI1A 1F4HA 3H55A 1PG7X 2LLLA 4KZDL 1GGIH 4FKEA 4FL4B 1JD7A 3B7TA 3NA4A 2GTZB 2HUHA 4OSUL 1NIBA 2B5IB 4UM8B 4TUUA 3DIVA 5J12B 5CM1A 1WBXB 1UZ6E 5FOBA 5GGVL 2P5ED 3D8MA 3T3ME 1HI6B 1GYCA 4UTAA 2ZXEB 3EDFA 4IDJL 2QVTA 3RBGA 1P4BL 3TO4A 4GT0A 4CKVX 1XR9A 3QIUB 4N8PA 6PAZA 3MHZA 3W0WB 2F19H 4KMQA 4FABH 3RDTA 2OS7A 3LQZA 3VVWA 5JQ6L 4N0FA 3MA7A 5KANI 4N5EC 1BQKA 3PQYE 2X0WA 4NO5A 4OCSH 5GGVH 1NWOA 1LEIB 2B4CL 3SGDH 5KUKA 2QKIA 5EF2A 3GBML 3BUPA 1A4KB 1A22B 1FIGH 1S9YA 5BXFA 4H26A 2BNRE 2AXFA 4Z7WB 1C5CH 1LHZA 3LDBB 4M62L 1SJHA 4YHKH 3WXVH 1L5GB 4CJ0A 5KVDH 3WMQA 4MXQD 2Z35A 2ESVE 5J3HC 5AAWC 4UAOC 5L4JA 2BHFA 5LBSH 3MNVB 4I0PB 3Q6FA 1JZ8A 3RVTD 4LSPL 4XVTL 5KYWB 2W9DH 1YPZE 1PZBA 3BI9X 3QDJD 5SWQA 3KXFD 4UQAA 2AKRA 5K59E 1JTTA 1NBVL 1JRHL 3EH3B 4N0UB 1E2ZA 4K23H 2YA0A 1O9WA 4R5VA 4LXFA 1O7DE 3TWCL 1CDBA 1DO6A 3PGFL 4CSZA 4H44C 4HISA 3HB3B 2PO6C 3SKJL 3CWGA 1J0KA 4HIIA 5HGAB 4GXUN 2ZNWA 4CVZA 1FH2A 3MROB 3EO1B 4GRMB 4ABWA 3WSQH 3B83A 4TL4A 3CQFA 4P5TD 3PGDB 4BFRA 4P9MH 4N9GA 3V79C 3BRGC 4HF5L 3PXHA 4H88L 3HE7D 2QKIC 5BV7C 3D39A 2CJUL 1F02I 2BCKB 4N85A 2JVUA 2HX9A 4ZFOA 2WUCL 3MV9E 4V33A 4HPYL 3O3BB 5ECJE 5CEXA 4S0HA 2VQ1A 3X12A 4PV1C 3G9AB 3CSBA 4EQ3A 4M5YL 4PHZA 4HJEA 3IBOA 5FOJA 5TK4A 3UGEA 2PPAA 4HVBA 3CSTA 1WG3A 1YJDH 3FB8A 4UV4L 1WZLA 2P8PA 1F6LL 3JV6A 3PWLB 4PJIA 4FYTA 2X05A 2WXJA 2RFXB 1OAYL 5IROA 1E27B 2BZ7A 3LPOA 4JO5A 3WS6A 5MEOB 2CGRL 3G04A 1TSRA 1HIML 5KVMC 3EOTH 5KYXB 3VXUB 1CZ8H 4WZ9A 5AW8B 2F53A 3VUAA 2E7LA 5IV2B 1DN2A 3GSNB 4BFEA 2OX5B 4IOIB 4XNQB 3APDA 5FO9B 3A67H 1FFOA 2XXGA 1S5HA 2GTWB 2CBMA 3U9UB 3J07A 4Y1AD 3RJDA 1W72A 1XSIA 3WIFB 1FAIH 4KMTH 4IKNA 3WAJA 5EMYA 3U7YH 5FCUH 3SY6A 1FC2D 4Y4HA 2PF6A 1LLAA 3S8GB 1F1AA 1HZKA 4L29A 1ZPLA 4N1HB 3FUIA 3P69A 3BP7B 3MBWA 2CXGA 4N0UE 1WISA 1DQTA 2D0HA 2J4WL 4JY5H 3EFOA 3W9EB 3VXRE 1KB5L 1JNHB 2W65B 3L13A 3T1FB 2N0MA 1AGCB 1KUMA 2ZSVB 4HYTB 5CF3A 3ZYZA 2CPCA 1KBGH 4HHWA 1WAPA 5MHSD 4P2RA 3QDGE 3ZBMA 3FTUA 4U6VH 2Z31B 3MACL 3KPLA 2V9RA 1NAKL 1CXFA 4XBMA 1VADA 2TRHA 4XCFH 3X1NA 5HYJB 1TU2B 4LPYA 2OYPA 4GMTH 2JTYA 2EZ0C 1AIFA 5GS1C 2FB4L 4KRPD 2VGLM 4N1CA 3UMNA 4YHYC 3PWUB 4M1GH 2VDRB 1I7RA 4PB9L 5D7SL 5KVEH 4NBYB 3SE8H 3CCHA 3ESPA 3ZE0E 3MRJA 1LD9A 4OZFG 1JGVH 3IN0A 3TV8A 3VFWB 4ZW3A 3I3DA 2UWEB 3C9NB 5F9OL 1MUJA 1QRNA 4UOW1 4UQ2A 1PZUB 1QR1A 1TQBC 1KJ2L 3ELAT 3BE1H 1J05A 1FRGH 1K6QL 2FD6L 5C0BD 2CO6A 2W59A 4Z7OE 2YMOA 3O3DA 4YNYA 2Z8WC 3L5XH 5I74C 3MRLB 4M6MH 5FPIA 4IBWA 3STLA 3KW7A 3RP1A 4QRRE 1MWOA 2QHLA 4XAKE 2YD0A 3NVQA 1CI3M 4B9ZA 3VXSA 1XHHA 6FABL 2DWXA 2IDTA 1A21A 1FFPB 2NXYD 5IOPA 1BF5A 4ODVL 2NY6B 3VX1A 4ZMLA 1BW8A 3DX7B 2GJ6B 1U8IA 3EGSB 4J3VA 4BUGA 3TT3H 3Q6GH 1A64A 5HTSA 3U1SH 2H41A 2Q3AA 2UZIH 4PJ7F 2WYZA 3FQXB 3TNMA 4J1UA 5EFIB 2XU9A 3QWOB 4F27A 2C7FA 5EG6C 1NAMB 1IE4A 2BZCA 2FGWH 1QPXA 1S7UB 3TYFA 5JIDA 1OT2A 1XF5A 3AWEA 3Q0HA 1BSIA 4U1SB 3MJ6A 5I6OA 2XIBA 3HPJA 3QEGL 4FCHA 3IGKA 1M57B 3D0LB 1FE8L 1U9KA 2R8SH 3LEXA 1RZ8B 2J56A 3BQUA 4KAQL 3IFNH 2CU9A 3ILQD 3QUZC 4KNQA 2WQAA 4ONHB 3VG9B 2E9IA 2VB5A 1RVFL 5ID1B 3K2KA 2WBWB 3GMNB 4L18A 4FTVB 4TPRL 1CVSC 3SDAB 2VSMB 2QGCA 4FDWA 4X99A 3DX8B 1ZS2A 5I71B 3D5OF 3BDBA 5FW7A 3SY0A 4OCRL 5D2LB 4OZFH 5B8CA 4R0LC 4KITB 1YNTF 3HG1D 2XVKA 5AOZA 1NDTA 3QCUL 1KBKA 3IDIB 3QDME 1X4ZA 4B7LA 5A2BA 4R7VA 3EFFA 1MRCL 4Z7VB 1E7VA 2ZF9A 2WD0A 2DEWX 4OH2A 2V8LA 4UMSA 1IM9B 2X2IA 1GGIL 4RWHA 5EOCJ 1XD0A 2OMZB 1YN7B 3OR6B 3RUGA 2NCMA 3QXUA 4PG9B 4MJIB 4M3KB 4TUKL 4WI4A 5GZNA 3QA3B 5CEZL 3KPSD 4TLTA 4PRPB 1JZEA 1PQZA 3Q44A 2YARA 4HPOL 3C12A 4MYWB 5I1JL 3S34L 3HZMA 4UAHA 2NR6C 2ZKWA 2W1NA 4LSVH 2V17L 3EYOA 1LEKB 2OAAA 1O7DC 4HCGA 3I02A 4JFOA 3IGAB 1T89A 4ISVA 1TMCB 4IKIA 1V3JA 2MCAA 4AGQA 4XP5L 1RQ5A 1WBXA 4YWGL 5FOBB 2MTPA 3HE7C 4CNIA 2E5EA 5IFHL 2Q76B 4XC1L 4NBXB 2FQEA 2DLIA 3K0YA 5HYIA 1KYAA 4HSQA 2FL5B 5CLXA 4KO5A 4W9KC 1WEJL 3P3RA 1FBIL 5H94A 4FXTA 4Y2NA 3WHE0 3CMGA 1T1YA 1UCBL 1WA1X 2MH4A 4IS6B 4QKXB 1MHEB 2V4LA 4XCYA 4LEXH 5A2AA 5JORA 2YJQA 3L95A 3MFFA 3NPZB 2TRYA 1AOZA 1UJ3B 3NG5A 1LQSR 2UXGA 2E74C 3L1EA 3J8F7 5GISL 2FX7H 1IQDA 5H35A 1XZ0B 1A7OH 3HBPA 5AVXB 4NEHB 1WFTA 3ULVL 2DIAA 1SJHB 3QULA 2XZAL 4G1EB 3VFNB 4JE0A 1DVYA 4HALA 4ZOCA 3V7MA 2EVFA 2OMWA 1CLOL 4HG4K 4BSJA 4OJDH 3V6FB 1WAAE 1ZLSL 2ZUYA 5CZVL 5FYJH 4CKQA 4LGRB 3OD3A 3DK2A 2WXOA 1N2RA 2V0AA 4JRXD 3GO1L 2PTUA 4NO3A 3PQYA 4A7QA 3BZEB 4YJZL 5JW3H 4PRIB 3MLTB 1KB3A 3N1FC 3QC5X 4ODXA 4DESA 3QUHA 2YFNA 2IH3B 3U1QA 4C59B 3V0VA 3AU0A 2Y5TA 2JNZA 4TNWF 2LU3A 4GW1B 5CINH 2QTVA 2QSVA 3D3VD 4K7PY 3SDDA 3QZBA 1N64H 3GJFB 1JXDA 2Q8BH 1QLRB 5DRXA 5IROC 4P4KA 1RZJC 1AS7A 5ALCL 4IMLB 4ZNEA 1AD0B 1XFPA 1EO8H 2YZ1A 5I15H 2BSDA 3F84A 1WFIA 1KCVH 1ROCA 2KUTA 2HRPH 1QI5A 4XP4H 4BH7A 3LAFA 4FA6A 1DBKH 3II2A 2HJKB 1BPVA 3NIDF 3T2OA 1YEKL 4GXFA 1MWAL 3QNZA 4LCYB 1AQKH 4NQCD 2OBGA 1ZT7B 2Z92A 1H8SA 1A9EA 3ML8A 4ZAKC 3VTAA 2IOIA 3SCMB 3LEVH 2VXUH 4YSQA 3VDBA 1HC1A 1BM7A 1INQA 5IB2B 1MNNA 2EADA 2VQ1B 1U95A 3H42H 4AZ8A 1SDDB 5HI4D 5EV7A 3EJQA 1MFBH 4ZD3L 5L0QB 2YAFA 1FZOB 4PGDA 2FBRA 4FFZA 4M8VA 2FEDC 4M7KL 4MQXD 4UQBA 5I30L 4NWTH 1YZZA 3ZHFA 2ZAIA 4M5ZL 3FUKA 4G7VL 2V7NB 4PJIB 3UIZA 4TTDC 3BW9B 3GGWA 5BVJB 3AFLA 4OGYH 5CIPH 1PU0A 2J5LB 1FZJB 5DJZB 43C9B 3E38A 1H6UA 3AROA 5CEYB 2BVOB 4RMUA 2F1BA 4FA8A 3SPGA 5TDOB 1F4XL 2B15A 3KPOB 2BVUA 4MD4A 2V7HB 1VGKB 1NCWL 4Z6AT 4JQXC 3LYRA 3L4TA 4PGZA 4YMPA 3NZHL 2J71A 4HSAC 4N8UA 5BQ7B 4FQHB 4YSPA 2K8QA 1LO2H 2E7HA 3GMMB 3RY4A 2UVFA 3LY6A 4UT9H 4I85A 1JGEB 4L5FH 3AU1B 4YHOL 1ZSDA 4ZODA 3TCLA 5A7EA 3QWQB 5L88L 2AF2A 2OZ4H 2ARJA 5IFJB 1FV1B 1J9CT 5HHQA 1QVOA 4OIIL 2WWKT 4WJ5B 2F53E 5G5DA 4TRPL 4OI7A 2BY1A 5DRNB 2WGXA 5DJ0B 1DQJB 2VWEE 3FTZA 3EFOB 1BVKA 1SQMA 4I5BA 5FUOL 3WEOA 3PUCA 5CLWA 3X3FL 1E6JH 2VISA 4LOEA 4NUPA 3IETB 1T7XA 1VEOA 4EKXA 3MUHL 3L3OB 1IFHL 1YHPA 4I2XE 1H6TA 5C3LD 5I1HH 2F53D 1M1XA 2HKAA 4G6FD 4MB1A 1V8HA 4JO4H 3QORB 4JFYA 4XMPL 2FJGA 3FUJA 2ZONA 3QHTC 1U0QA 4ODSL 3O8XA 4MNQA 4YHIB 3W39B 1OKEA 3F62A 5LNEA 3AVEA 4RFNC 4ZW7A 5DR5H 3RRQA 1R3JA 1C16A 2BIOA 1DR9A 2JXMA 3HC4H 4GRWH 4ODHL 3TA3D 3VXRA 2J1YA 2WIIA 3VI4B 4MD5B 5CD3B 1EHLL 1G6VK 4QXTA 5EDXA 1MW2A 5DT1H 1A6TB 4YL9A 4Z5RB 1G5AA 5AALA 5EC1B 1ZE3C 4AGPA 1QHPA 2JI3A 2XIIA 3FCTB 4JFPB 3F83A 5DFTA 3QUKA 3U36B 2FUTA 3EGDA 1WC7B 3IGUA 3KPPA 4JVPA 2VLKE 3K72B 5E4EC 2MFNA 1OHZA 3TURA 3FQUB 3BAWA 4K5MA 3ILPA 1DQIA 3ZO9A 4D3CH 3U25A 4DGIH 1EQWA 3H9YA 1R33A 2AJYH 3VGAC 2X4TA 2CALA 4BDVA 5CP7A 4GP4B 5J11B 2KQNA 2NT1A 5F7WC 5DD0L 3WJMA 1Q9KB 3QZMA 1N12A 1X6LA 4XP1H 5TTRA 4WV1C 4FP8H 3U2JA 2NLJB 4XVJH 4WFGD 3CFKB 3KDMB 1TFPA 5GIRA 4WSKA 2CLZA 2P24A 4H1LB 4RFEA 1EH9A 1KELH 3FTVA 1MW0A 5DVMA 3C60D 4F7TA 1QW8A 2D7TL 4DP0X 1U92B 5DJYA 4XO5A 4J3OG 4QXUL 4FI6A 4FXLA 3EH5B 4UZSA 4BFFA 4J3XA 3DECA 4IOSD 2J6WA 2CDGA 1S7TB 2Y06L 2E6PA 3NIFB 5D70H 5EZLB 4WHDA 3BT2H 4WEEA 5T5NG 5DC9B 2CCLA 5C6TL 1KTRL 1JNJA 1E0OB 1NZRA 2XN2A 2X4RB 5J7CC 4EDWL 1QNIA 3DGCR 2XLLA 3FFCE 3VU2A 4JW3A 2D7TH 4P23C 1TKWB 4UT7L 3LRSB 4L3AA 4OAWA 5IEKB 4L8SC 4TVPE 2ZIDA 2HTLD 4RISL 3TVMD 2GKIA 3HS8A 4NQDB 4MDIB 1XH0A 2PCXA 5JUEL 5C0AE 1OF2A 5ITFA 5FB8A 5IBTL 1PTZA 3QNXA 3QXAB 2XX1A 4G9FA 3VSQA 4D9LH 3BYYA 4L4TA 2LVEA 5GGRB 1T4KB 4Y4FD 5D2LA 4MS8C 4OCXL 5F3BA 1VFMA 2BY3A 4OFQA 5BZDA 1XGUA 3EFFB 1YY9C 3VFMB 3NZ8A 4AC2A 3FSZA 1R46A 2OL3A 2CJTA 3ARGC 1IAKB 1EEZA 2QR0B 1T3FA 4BQBA 1T6BX 3MR9B 4Z3GA 2OYLA 4U3SB 4J2XA 1KC5L 4PG9A 3GMRA 4LGPB 5JXED 4P59H 2VLKB 3DHJA 1RZJH 3IDXL 4PJ8B 1QA9A 2VUKA 32C2B 4OIBA 4XC1H 5H2BA 4UQEA 1T5XB 3QDMA 3VM7A 3AXHA 3H9SD 5GRXG 3T0XA 1CR9H 3OKOB 3RDTB 4KOCA 2EH7L 2QADB 4LEOA 2AEQH 3TBTB 2O5YL 2FYVA 2VL4A 4NAQA 4FTVD 3QT2A 4UQ9A 2X4UA 3NTCH 5DQ9B 1RZGB 2NX5B 5DS2A 3RI5F 5LGJB 4JDVA 4N6QA 2Z93A 4OSUH 1SYVB 3VCLB 4WSGA 1X5XA 2OPCA 4JL2A 4HD9A 4MMZC 5DLMH 5K9JH 3VAEA 1FDLL 1CGSH 1GGYA 3WMSA 3T6ZA 1ZJAA 2H6UA 1N8ZB 4ZMOA 5F7YC 3Q9PA 4PRHA 2E75C 4M43H 5FYKH 2H1PL 2DWEA 2ZKYA 1DLFH 3FUMA 5FGCB 4YHZL 4YSEA 3LH9A 2VW6A 1FNHA 1OF0A 2PN5A 2I9TA 1KTJA 3LKNB 4H2AA 3RNQB 4BUHA 3O4LB 2VDPH 4GMSL 3VFSA 2A77L 1T04B 3FQRB 5DEGB 3OAYK 2B4CC 1TCRB 1GGCH 3LB6D 1TTGA 2V3FA 4PJCA 3UZEA 1VFUA 4DFHA 2JQZA 3NIDE 1X5AA 3QULB 3U4AA 1MCLA 3MNZB 4Z78B 4NKDB 3OAZK 3K2UH 3WFBH 5I8KH 2BSEA 4M1CD 4EIUA 4GRLC 1RURH 2AEWA 2APTA 4ZFFB 1MWAB 1U8LB 1GY1A 3CHPA 3FKUS 4OV6F 1WICA 1XIWD 3M1CA 5KN5A 2R83A 2WYIA 4JFUA 3MCG1 5F1OB 1DQDH 2VWEC 4DP1X 4PB0H 3S0PA 1QFWH 2YUVA 4DHLA 5EEUA 3BGMB 4GW1A 5IJVB 5I1GL 1MRFL 1A66A 1DBKL 3E8UL 3NFPB 3BGAA 4CRPA 1Z5LB 1EVTC 4NZUH 4HIXH 3ECBA 2P52A 5HGDA 2OQJA 4HMDA 4Y4HC 4FI7A 3H3BC 4V1DB 1R75A 4GG6F 3QS2A 3DOSB 4G1MB 1N70A 3MGOB 4I18A 3TBWB 3L9YA 4I3RL 5C09A 4PJXE 1HZHL 5BXFB 5B7MA 1BFOA 4FQ1H 2R29A 3EO0B 1MFBL 3R0MA 2G5BB 4QRTA 3U4BH 5C0RH 3GS0A 3IMUA 4QTHB 4KXZI 1PLAA 5DJXA 4NPKA 4Y5VB 3S3JA 5PAZA 1MDAA 1ZHLA 3GZPA 1LDPH 2RFXA 4HDIB 1G4MA 3QJTB 2C9QA 5KBMA 2AQSA 2PTTB 2ICES 3AMLA 3ARYA 5INCB 3O3AB 1EGJA 1A7OL 2RACA 4A1RA 2A6IA 4LPVA 4XC3H 3WNNA 1HOCB 1HYSD 1J8SA 2DQHH 2PYEE 3C5XA 1WFJA 4JN1L 3V4PL 4FYSA 3WUWB 2NNAA 1I1FA 1UEYA 5GGSY 4N26A 1HT6A 5DJDA 4O58L 4J3SA 1AY1H 4QPEA 2PW1A 3PXJA 2O5XH 5EORH 1AXIB 1VACA 2FSDA 1QUNA 3MROA 1M7DB 5DMJB 3NRFA 2PXYC 4AGLA 4MVBC 3GJEB 1MCFA 4GUOA 4K55A 3QRFM 2RQ8A 1CO1A 1IGMH 2ZKHL 3WY2A 1L9OA 2FJHB 3NACL 3U7AA 4QTFA 2JV6A 5EC2A 4Z3TA 2W5PA 5C8JA 3ROOA 5FWRA 2C4FU 1OIOA 1RIVL 3CZKA 3MJ7B 2BSRA 3MX0A 3CZEA 1FC1A 4WI9A 3V0FA 3ZDZE 2EXYC 3DK0A 3O3BA 4P23A 5A16A 2XZCH 2X38A 4XO9A 3U1PA 1KGYE 4Z7QE 1UM4L 3EHBB 1A0QH 3DO3A 5T3XE 3RDJA 1J1OH 5E9DE 3WL9B 2Z31A 2VXTL 1LK3H 2YKKA 2CJUH 3OHXA 2G9KA 3KYNA 4M7LH 4XMPH 2EYRA 3EJZC 5I2IA 3KWXA 3ZK0A 2HTLC 4PY8I 1MFAL 3ETSA 1CE6A 1DP0A 3P9MB 4JL1A 1SEBA 4OLXH 4NAMA 4I5BB 1X9RA 4NN5B 5ADPL 3ROLB 4YH6A 5AAPA 4MS6A 3W5MA 3X3GL 2UZPA 4HWBA 4WUKH 1EFXA 4EI5A 2A3TA 2AEOA 2ITDA 3D18A 2HFTA 2D03L 5DJCB 4A2GA 1F2QA 3P4LA 2XQ0A 2F58H 4TSAH 4AEIL 4GBXC 1ECZA 2A9ML 3EH2A 1G1OA 1MNUL 3BJ91 1KN4L 3VWKB 5IT2L 6TAAA 2H0EA 4QY8A 1WS7A 5DHYB 1DVXA 1U93A 2FEJA 2LAAA 2QDWA 5FR3A 5GRUL 3CZFB 1JHKL 3NQIA 3MUY1 4L3ED 2V5RA 5LAPA 1YRKA 4WO0A 1Q4NX 4NC0B 1CFQB 1F8TL 5E6IB 4BD4A 3PFQA 4KV5E 4ZW5A 3HG1E 4QF1B 4IBSA 4FG4A 4HEMA 3PPEA 3BE1L 4HH9A 4CC4C 5H37G 2BFVL 2E9GA 7PAZA 1AKJB 2CBOA 2H47C 4JFQB 1JHKH 4XHQA 3A6CL 5HDLA 3QIWC 1F13A 2VQTA 2ATPA 1MPAL 2XN9A 1QPKA 3GHBH 4XCNB 1N6VA 5ACZA 3ELQA 4YHLL 2J2ZB 2ZYIA 3GLEA 4ZPTA 1NMBH 1AH1A 1FYTB 1JZHA 1NC4B 1N18A 4LCCA 2FWOB 4L05A 1HKLL 1ZHKB 2LU5A 3C9NA 4HC1H 3GSVB 4XXCA 5CBAA 2VDNH 4HUCA 4P3WA 3O0LA 4NOBA 1CCZA 4RDQF 3DX8A 3BISA 3Q1EA 4FQXA 4AT6A 3TNNB 4YFEA 2UYLB 3H7BB 1Y07A 2XTLA 1AYOA 3V6OC 2UUDH 2WNGA 3BP4B 4PJDF 3HPLB 4S11A 1JV5B 1OQOA 2W80C 3CU7A 4U1MB 5EO0B 3M45A 4OAWB 3UPRA 4G7RB 4YK4C 2IANB 1G5GA 4RGNC 2XJLA 4IMKC 3RL2B 3SOBL 4LVOC 4OKVB 2F9BT 4EEEA 3QNXB 5EN2B 2IBBA 2BZDA 3E2HB 4J2QA 1BZ7A 1DYZA 4QHNB 5IMOB 5D93C 2XWRA 2C3HA 3VQ2C 5JIPA 1BF2A 3G04B 1EZSA 1J1XL 1E67A 1NGWA 4MJ6B 3CDZB 2UWEF 5D5ME 1BG9A 3PAZA 1GPOH 2N7AA 4FYRA 2IQ9H 2Z8RA 3EDJA 4QHPA 2IDCA 3D08A 1BFVH 4FFYL 4ZTOH 5C0DB 2WOYA 5C0AA 1R6VA 4GKSB 4MGXA 4U3SA 1A6UH 1U8OA 5JOFB 3FSWA 1N5YL 1BZEA 2C9PA 3FU3A 4V11A 2ICEC 3AS2A 3QJHA 2BNUA 4YVUA 4GW4A 5IKCB 1ZEAL 1IKNA 4OLZH 1JDDA 2KLSA 4AG4L 1LNUA 1BEXA 1H6EA 3VMPA 2WKGA 4UU9A 1FDLH 1L5GA 3S8WA 4UQCA 5FDWA 1K4DA 3V6OA 4MQXC 3GMQA 1T1YB 4ZQTA 4RX4D 4Y9EA 2X1WL 4RETB 4M62H 4N1EA 2X41A 3WXVL 2W07A 2D7MA 4LHUG 3AY2A 4H7VA 4LZKA 4N2CA 5BRZA 3N0AA 3UTTB 1QYGH 3MACH 3R8QA 5E2TL 3CZNA 1D5BB 2FJSA 4XCCH 4E5XB 3IDIA 1S7SB 4JO2H 3VXQB 2DM2A 2HFEB 3I84A 4J3TA 4LGSB 2YAOA 4NCDA 4NKMA 4HQQH 4NM8L 1DN0A 2IADA 2WB7A 4ENEC 3HKZA 1KV7A 1I1CA 3MOAH 5C2BH 4FLOA 2DJ4A 5ALBL 5DJAA 5F6HI 5I0XA 1PX3A 2OMZA 4K23L 5J1AA 4Q2ZA 1R19A 5CHNB 1JZFA 4NI6A 4DPRA 2H8PA 3B9EA 3FHQA 5SX4H 1G43A 5IM7A 4FGMA 3QCTL 4K2UL 4U0RC 1V5JA 4D8OA 4R96A 3K8MA 1ES0A 1DJGA 4U1LA 1PL3A 1JP5A 3MNZA 2WXMA 2K78A 3BPCB 2WSDA 5E4OA 2E47A 3IGAA 5B3JF 5KVGL 3DGGB 3SPHA 5D6DC 5C0EB 4IQHA 1QKZL 3TT1L 1XB6A 1NIEA 2ICCA 4H88H 1FUNA 4AX3A 4P4RB 4P46D 2GT9B 2GK0A 2XBZA 4J4PC 4Y16D 4ZUVB 2XQYK 3Q2LA 4ZJ9A 4APXB 5DEZA 5B39B 3C6EA 4LHQB 4LF3A 3BD3A 4GG8A 2HPTA 4AYMC 3T0WA 5HGBA 5IJVA 2CLRB 2GPZA 5EHFA 4PJCE 1DVFD 1INEL 3LZRA 3QIWD 4NJ9H 3SCMA 3L95B 5HY9A 1K6QH 2XN1A 2YD1A 3EZJB 3MCYA 5EF3A 4H8QA 1Q1JL 1DEDA 3HMXH 4NNXB 4Y2DA 3R7QA 5JQ6H 3CBRA 3OXSB 3V4UL 2DMGA 4NT6A 2N1KA 4KTEH 3O0RH 5D7LD 5AW6B 3VXSE 5TF0A 5L7XL 3L3GB 3QJSB 4IRJA 1VZGA 3X2QB 1HOEA 1Z9OA 4DP6X 1MSPA 2W8CA 4NQQA 4OF5A 1ZLEA 1UENA 4IRSB 4J1UB 2ZAGA 5D8JH 3DUSB 4KAQH 2BIHA 3BD4A 9CGTA 3OVUB 3MRBB 2K6ZA 5DK0A 3Q3GB 4FLSA 3N40P 5IGXL 3BCFA 2YJLA 4L3EA 4DKEH 2QQLH 3QBTB 5E5MA 3Q5TA 4EIBA 3VFUA 4WTWA 3ZL1A 3PCYA 3SGDI 1XGTB 4QHKJ 1IC4L 3PDOA 3RTLA 3OR7A 1LO4L 2BWDA 3DROB 4PJXA 4QXVA 4LFHD 5LHDA 5DXWA 4EN2A 3D87B 1RUKH 5KTEL 1R34A 2P7TA 3EYSH 4PI2A 1HXYA 4UT6A 3V6ZA 4XB8A 5F7MC 3N43B 5FKPB 1BOYA 4X4MA 3BAEL 3LH2H 3OAZH 1IEAB 3I6KB 4DK5A 5HHOE 5DS8B 3CFDB 1KGJA 3IKKA 5B38B 1ZGLB 1UURA 2ERJB 12E8H 3ARDC 5CU9A 3MRNB 4GUCA 1BQHA 3ALXA 4FA7B 5FX3A 2ENPA 3GXPA 3F6IA 4Z7UB 3C6LC 3FB5B 1RUKL 1G9HA 1WFUA 2FQDA 1D6EB 3GINA 5JO5B 3ZPDA 4URKA 2MNUA 4BK4A 4RFOH 1IM9A 1DQLL 5GS3A 1JNNL 4NQXA 5CP3A 1TVBA 3WKNA 4ODUB 4HJ0C 3RB7A 2P5WB 3OWRA 4PJCF 3V4VB 4CADB 1DFXA 3MO1B 3G6DL 4PRID 5EEVA 4KKLC 1VESA 3CDFA 1X5MA 2YXWA 3GKWL 2PWEA 1IAMA 1Y1DA 3QUZD 3ILQC 1JUFB 2CE6A 3IRZA 4O9HH 1QLFA 3SSGA 3K74B 4CC4A 5BVJA 4JFOB 4KO6A 3WO4C 4HK3N 3SKOB 5C71A 1RP9A 5FV2A 4A7GF 1B90A 1XTMA 4U4IA 1CGXA 2DAVA 1YLBB 1EV2E 2C9VA 3QVAA 1EJOH 2NDGA 2X5PA 2DB8A 4K94H 3GLAA 3SKMA 5JHBA 5E9DA 4UNTA 4N0YL 3RHWF 4EAEA 2V17H 1CICC 4HLEA 3QZWB 3CLWA 3V0WH 2N01B 4OM0H 1MWAH 4P49A 5B4MD 2A4ZA 1QFUH 4XMXA 1CLZH 4TSCL 4PRDB 3SDAD 4OGQC 2H6PB 2YBGA 3QPKA 5JORB 3FFDB 5KOMC 4EQ2A 4M02A 1M9SA 4WWPA 4DVBA 1PKOA 2YSSB 3DMMB 3ZKNC 5KBPA 4W68A 2RMNA 2ITCB 2F8IA 4XXCC 2ZP8A 1EHLH 1XZ0A 4AUUA 4FJYA 2NW2A 4QO1A 1I3UA 4Z7IA 4A2DA 2GBAA 5D1ZD 3V0WL 2NLJA 1TETH 5GGTL 1NQBA 1GIGH 3JT0A 4M5ZH 4IBQA 2DQIL 1MLBA 5GRVK 4WSJA 1MW1A 3O3EA 1EFXD 3HS0B 1GZPB 2P45B 3HG0A 4KHTL 2WLIA 1G6RA 2Q1EA 4NO3B 1DQMH 1JERA 5HJGA 3EO1A 3ISRA 4PJ7E 1DL7L 1SLUA 1UKQA 5DURB 3ARBA 2IH3A 2BDNH 1FNGA 3NN8A 1IQWH 2VE6A 1NH6A 3JWNH 2G60H 5BS0A 3TH3T 2XDHA 2MOVA 4RGOL 3IFNL 1PIGA 3FB6B 4WU5A 2PPFA 3DIFB 2NQCA 3ABLB 2IWKA 2HRPL 3NCJL 3O81A 3D4YA 4WNQB 4QHUB 1EAJA 2L7JA 2HSIA 4QXTB 4AYSA 1FIEA 1TZIA 5CSZB 4LCCB 3S5LG 2VXVH 3LMJL 5D5MF 3OAUL 4Y7OC 2X9YA 3D48R 1KTBA 5C0CE 1QWHA 1O6TA 2CO1A 1FI8C 3ULUH 4R7XA 4WHYH 5FB8B 1MCOH 4ICWA 4RGOH 3F7QA 4OQ1A 3TNNA 5E8DH 5C08D 4L4VE 4N25A 4IOFD 1A9EB 1DJYA 1IKNC 3WTUA 3RGVA 3NCWA 1U8MB 1A4JB 1WAAF 3QORD 1YMMB 3UAJD 5EO0A 1NBZB 4UV7H 3RX8A 2F53B 1SXCA 2PW2B 4BFJA 3HNVL 1MREH 4Z77B 3UP6A 4E36A 4PRPE 4ZFGL 3D7PA 4LQFL 4KRPB 1T3FB 5E4IA 4AW4A 3FTGA 4FERA 4MAYD 15C8H 4PJ5E 5EN2A 2W0FB 3H2WA 1NC2A 4LSPH 4XVTH 4Z7OB 3BW9A 3GGWB 3MV9D 3VWKC 1YQVH 2YOCA 1CDUA 4F7TB 4NRZB 4U1JA 3ZHLA 3D52A 3RVXD 3T8VA 1TXKA 5EOTA 1ZLDA 1DQQB 2VOTA 1RHHB 3IDJB 4OFVA 3WN5C 1Z5HA 2C9RA 3ZKQD 3I6SA 5E6IC 1ZRUA 2GSGB 5JLZB 1NM9A 1JZJA 1ETJA 1U8CB 2LOEA 1U8OB 3PAYA 4L1SA 1FNEA 2X10A 3RX9A 2AFNA 3ZZQA 4CSPA 3MLYL 2A1WL 4WW1A 2DQDH 4XBEL 3LVEA 1HJCA 5FYKE 1JGEA 3FPXA 4WENB 1Y6NR 2VITA 3F7KA 1XH1A 2HMID 3DO7A 5L8LB 2WWMD 3MTXA 5TQ2H 5I75B 1EZVX 2DWTA 2AXGA 1E3ZA 1FG2B 3R7RA 5IQ7L 4EDWH 4Y5YB 3GSRB 3GSNL 1EEUA 2AZUA 2R29L 2XZAH 3N44B 4G8GD 3MRKB 5AKVA 4ETYA 2WKLA 2XWTB 3T3PE 2NPLX 1R5VB 3QR2A 3FHAA 3VRJA 3ARGB 4LLMA 1IBHA 5HP5A 5EZIL 1QMUA 4JG1H 4E9VA 2M2DA 3OB0H 5EUOE 1LD9B 1CLYH 4KXCA 5GGUA 2UUDK 3TVMC 5BS0D 3SE9H 4XVUC 4FG0A 1WWBX 1FL6B 2HG5A 2YPLB 4YHIA 1AGFA 5EU6D 2VRKA 5E23A 1RK1B 1WLHA 3IGFA 3CUPA 5BRQA 1LMIA 3UYPB 4E9TA 4JZNA 6CGTA 4IRJC 3RDTC 5AYQA 3P4NA 1TVHA 2VDRH 4DFIA 2IIJA 2EICA 4KQ4L 2B1AH 4M4RB 5B7EA 4LLUA 2ILLA 1A9BB 2XUWA 4ODWA 1GC1C 3FUEA 5F6HJ 1EMTL 3R06B 3SDYH 5IOPB 4JZJA 4WO4C 4PJ5B 3VGFA 4R90L 8CGTA 2GT9A 4APXA 4LCWB 3WFEL 2G3ZA 1A3RH 4UNVA 2XVLA 1XT5A 2VSCA 2B1AL 4Z1PA 2G0KA 4GP8B 3R4RA 2EDYA 1PF3A 4QRSB 4Z18A 2IOMA 4GPVA 2J8HA 2PETA 3E3QE 4IBTA 5KEZA 3T8MA 3AREC 5F1NB 4P5MA 4HU2A 5HGHA 1PMYA 1DHKA 5LN4A 5T33H 4FZEL 5FV1L 4MJJA 5TH2A 4LRNH 5KVFL 2WZPD 1TJIL 4X7FC 3GYRA 4GRLB 2YD9A 5E2WH 3WIHH 2AEPL 1BBJB 1YC8A 4TLUA 5DJYB 4IRSA 4XCFL 2AVFA 3RKDD 2X2YA 3KYKL 5ALBH 4CW1A 3GSXA 3PAVA 4ZX3A 1I53A 4K9JA 4WUUD 1AP2A 3FW6A 2DJSA 5J4MA 1SRDA 3S34H 3P0VH 4JG9A 3NTCL 1IAIM 1PZAA 1JPEA 3O9WD 1JD9A 5L2JB 2QADC 2D7OA 3QFJB 4PJHE 3DROA 3CBJB 4PJXB 2L8AA 5BVPH 5C0FB 5E6RB 3QIWA 2M83A 4HKJA 3OC5A 1KCRL 3ECBB 1IC5L 3NZSA 1KBBA 1J5CA 1QKZH 3TT1H 1A5FH 1AKJD 2ZD0A 4LHJB 3E6FB 2FYYA 4ONFL 5DUMH 4AQ8C 3QQ3B 1FF5A 1IEAA 1OLZA 4X6CF 3BP5B 4WWNA 3L17A 2WLLA 2DWYA 5F3BB 1ET5A 1SXAA 3W39A 2LFGA 2ESVA 4LCCC 1JGDB 2C34A 4XPTL 3D85A 4EZLA 4OTXL 4LPUA 5FW6A 2EH8L 2FNBA 2QPEB 5F0MB 3GS7A 3O6FB 5D2NA 2WIIB 4HS8L 4OJFH 2DLEA 2BX5A 1RURL 1XO8A 2IGFL 3BD5A 1TQSA 1OM3H 1FSKB 1RIVH 3FT2A 2B59B 2VMJA 1KCLA 1S7QB 4XNMA 5I1KL 4LEEA 4TLKA 4RMQA 1N3NB 3LZNA 1M3JA 3MRPB 1OQXA 3K6SA 2DWDA 3D33A 4MCYA 1KT2B 2WXQA 2DYPD 2YAEA 4XPTH 4TNFA 2AJ3A 3LXAA 3T2NH 1UA6L 5FK9A 4NSKA 1ANUA 2YPKA 1OCZB 5E1AB 3VWKA 1TQVA 3HC2A 3ENEA 2ZOLB 5B22A 3ILPB 3VXMD 2FBJH 2IQAB 3KNBA 1OM3L 1IC7L 5AZUA 3DI3B 3WELA 4RMTA 5DA0B 2EDNA 4JPVL 1JGLL 2H3XC 2UWEE 4NZRL 3GTTA 7PCYA 4DAGL 2K4WA 1L9NA 3IDUA 4YDZA 2HLFD 5A2JH 1V7MH 5ICZA 5HI4C 3NJVA 1OAKH 2Q2EB 4PD4K 2VC2B 5I16B 1NCGA 3WLWD 3VGDA 2QSTA 1P5UB 1IZJA 2J8UE 5I66B 1ET8A 2VLRA 4JPKL 2G2PA 4WNSA 1XDTT 1SLWA 1JYVA 1P7KB 1HHIA 3PUUA 4WKZB 1G9NC 4DGVL 3CIQA 2VMEA 3VI3E 4RRPM 2XFXA 2C4FT 2BDNL 2EDLA 5F44A 5LLIC 3GJFA 3FN0L 2H3NA 3KM1A 3PV6A 4MB4A 1X7TA 4LPWA 3RGVC 5IREA 1BDYA 3Q1SH 1Y6MR 2P8MA 2IOOA 3MRMB 4AYDC 4U3XA 3UTQB 2JELL 3BN3B 1DDHB 4QHMA 1G6RB 4GQ9H 3VD5A 3KYOB 1I9RH 3THMH 3OC8A 3UCQA 1RULH 4UTBH 3ZYJA 2XVBA 5E8PA 3GSVA 3WE1A 4H8PA 4OLXL 1BXVA 1HX0A 1TJHH 5TJWK 1D2OA 3SZ6A 3H7LA 2VJXA 4GJTB 4P2OC 5I26A 4G9FB 1ODAA 1JWUB 3FB6A 1G9MH 3TVMB 4ELME 3GIVB 4XNXH 4XPGL 4YDIL 3PP4H 4ABQA 3HG1B 2VR8A 1UA3A 1YEHH 5EWIL 3W37A 3MV8E 5IBTH 2PP7A 1XGUB 5CSZA 4RQQB 1J8HD 1XBDA 4D0BA 4CGUB 4HJ0D 4PYHA 2IPTH 1IT9H 1VGEH 4NQED 2QR0A 5K1NA 2MCMA 2C8NA 3MV8B 4OD1H 1MNUH 1VPOH 3G5VB 4QEGA 3VFPA 1PJWA 1UB6A 3V0IA 4B5EA 5JZ7C 1Z9NA 1H15B 4G8FA 4LQFH 2W9EL 4U05A 4KRNA 2BSSB 2N7SA 3NJLA 4ACPA 1H3PL 3S4SB 3FQ2A 2OMBA 4ZXBA 2HCZX 2H7WA 4U1NB 1MQKH 1CG9B 1MF2L 4JFQA 2J21A 3B6SA 4OT1L 2NZIA 5D71L 3OV6A 3QDMB 5LJYH 2EVIA 1NBZA 4IK7A 3L5HA 1X4YA 2YLHA 4HULB 1FLRL 2VERA 4GO6B 4HT1L 4YGVB 5FO2A 1A2YB 3EBHA 3B3BA 2DYPA 3MBEB 3QIBC 1N5AB 3L3KB 3QJOA 3S5YA 1AY1L 2AJUH 2BP5M 2Y6SC 1BA9A 5AYUL 5DQ9A 1SHMA 2VL5B 2CDEB 2JKLA 2SEBA 5EU7C 1K3IA 4LLWB 4RGMC 3ZHKA 1HHHB 5AW5B 5IMKB 5JYLA 1P7QD 1B2YA 3MLYH 1IU1A 2VH5L 4CGTA 5GRUH 1OAQL 4OCYL 4PJAB 1FV1A 1W0WB 3MMEB 4N3UA 4AV4A 1FLRH 4HT1H 2DQGL 1LGVA 5CINL 3L7FA 4Y0GA 3WS3A 2FRGP 1I8IA 2GJJA 2HVJB 2H26A 3KEDA 3M1OA 1II4E 3RNQA 1I9JL 4NZDA 2BWQA 3IDMA 4LOUD 5MP6H 4PWEA 4CVXB 4J4PD 4P46C 4HOZA 1NAMH 4PS3A 5D1XD 5D7JB 2J5LC 4N8VB 4CBPA 3KLHC 1O0VA 3MNMA 3RZWA 3P9LA 1IIIA 2D3VA 3ZSSA 5E08H 3HNTL 3IXTA 5DMKA 2ARJQ 1T1WB 5F3FA 2FHCA 2GFBB 5JXAL 4WY7L 4YPGA 3TTYA 4IIQA 4MAYA 2Y1YA 4TQEH 4A39A 3VXSD 1MWAA 2J88H 1C16B 2ZWSA 4Y5YA 5FUCE 3T09A 1WF5A 5I0YA 1T7ZA 3NSYA 4ELMB 1KZQA 2KDGA 3ZQ9A 3HI6H 2E0PA 3DIDA 1JFQL 2NY5H 3LSOB 5BUAA 3ZE2F 1T22B 3EG9B 4B27A 3MV9B 2ZG3A 3VGHA 1J86A 2TAAA 4KI1A 4Y16C 1MFNA 1ETB1 2WWOA 4XVJL 5K9KA 3EXJA 2BS71 5JHAA 4GSQA 4ZFGH 3QPXL 4MAUL 4P5KA 1E5CA 1MCRA 4W9GC 1G7JA 2YC1B 2WBJD 5ISZB 2NNCA 1CIDA 1WC7A 3ULAB 4R5TA 1DANU 4EIZC 3FCSA 3E7JA 5T1DL 3NCFB 1N7MH 4P0DA 3K72A 1RUQH 1F8TH 3N9GH 1S9KC 5EU7E 1IGCL 5F8RC 5DQJB 1TTUA 1DZ0A 2VDPB 4PEEA 4I2XB 3PYCA 4OLWL 3ZGHA 2OR9H 3ARFB 5EUOA 4NPYB 4XMKH 3SDXA 4OV5A 3TJPA 1YEIL 4G7YL 4HLZG 3OMIB 2E9BA 1NOAA 2Z8SA 3M07A 4UDTA 1Q0YH 1E8WA 2VDMH 3FCGA 3DMMC 3LXBA 1YCSA 4ENED 4W9JC 3O11A 3VD1A 4H1LG 4IRJB 1FL5A 1KELL 1GOHA 5BRZD 2EDMA 5KVFH 5T33L 5F9AC 5K9JL 4AJ0A 4JFDA 2HPOA 1WBYA 3U9WA 2AMUA 2CAKA 2QQKL 3DUSA 5DJAB 1KV3A 3NQKA 5A6MA 4Y4KD 1A6WH 1NLBH 3QAZC 3II3A 4G6MH 5F1NA 4I3SH 5I1CH 3VD9A 3OF6A 5FFOA 3DSNB 3BOVA 4LOFA 4N22A 4P06A 1VDGA 2YPLD 1Y7VA 3GJEA 3CN1A 3QEUA 4KRLB 3RUGF 5JW5B 5GZND 1XGTA 2VDLH 5DU7A 5ITBH 5KBNC 1MCBA 3C6LB 2HZHA 5B38G 2FH6A 3BZ4B 2L3BA 1KFGA 1VF5C 3L81A 2APXA 4RIRA 3RWHB 4FQ2L 1E9QA 1QRND 4OY9A 4DP4X 3JYCA 1ZOXA 3MI6A 1KJMA 5B1JC 4I3SL 3S5LB 5I1CL 5HYJE 4MJ5B 3P1VA 4LSSH 2DKMA 5CNHA 1FGNH 3QG7L 2EE2A 2AGJL 1ZA6A 4YSUA 5DT1L 1PZ3A 5FYLD 5GQBA 4ZI8A 4OCXH 5B1AB 1NIFA 1AD9B 2R0KL 3PWNA 3B2UC 3HR6A 4JM2D 4LKCB 5AUMA 3HUJE 2C1PB 1E9OA 2ZUVA 3D12B 3UEZA 3KL3A 5C08B 5HY9B 1X7QA 3IMWA 1JZGA 2JKNA 4AXWA 4LLAA 1OP9A 4LSSL 2ITDB 1BZ7B 3D18B 1ULVA 4NYLB 4XCEB 1EA9C 3MAWA 2Y07H 1NFKA 1I3GL 1B9ZA 2X6UA 3AS0A 4YDKH 4PCYA 5F96L 4PJHA 4JPIA 1OP5H 1WAAA 1QLFB 4XPAH 4XOEA 2ZYHA 1FVDB 1F3RB 2OXHB 4R5XA 5D2NB 1XMWA 4ELKB 2A9MH 4HCFA 2VDMB 1JNNH 2X4NB 3T5WA 3EYUH 4E0RB 5TPWL 3HB3D 3BQUD 4JHWL 5IWLA 1MZZA 5DYOA 4U1KB 5BO1H 3K6SB 3QZWA 1JHLH 1I7ZA 3FO0L 3VW3H 5FK9B 1SF5A 4J3OH 3V6ZB 2MPAL 3HR5B 2HB0A 3OBAA 2EDKA 1HK6A 1Q9OB 2N56A 4TVUA 1KJ3L 4B96A 2QKIB 5B38A 1ZGLA 5IVXF 1SBSH 5DHXB 4RAUA 5DQDH 3SQBB 3I2CL 3VRLF 2EC8A 1JPTL 4WAFA 3HLKA 4OIAA 2A9NH 4XN9A 1T7VA 1VCBC 3T0VA 3VM5A 5ICZB 4BWWA 3GHEH 1S3KH 2WLHA 3DX4A 1BMWA 1T0MA 4F2FA 2YPVH 3FRPB 4RNRA 4C4KO 1DBMH 3OKNB 2Y6SD 1UC6A 4XTRD 4LK4A 4AM0Q 1LYQA 3QIBD 3AGVA 5FHBH 5JOPD 1DE4A 1AIZA 5E2VH 1NUDA 1HDMA 4QOKD 4ERSH 4XPFH 4BFKA 1QLEL 1UM5H 2GVYA 3EJZD 1S2EA 5GRJL 2GBVA 5KZCB 2MWCA 3N5AA 4F7EB 2A9NL 4A67A 5IQ9A 1X5ZA 3P30H 3QIUD 1EZLA 3GC3A 3MLVL 4L0ZA 2BCMA 2CNYA 4N5UA 1OOWA 2EXWD 3KVDD 5LGYA 3QHFL 4Q4IA 1UADC 3PP4L 3ULUE 4E9YA 4PG2C 5HHMB 4KTDL 3F00A 4GBXD 2HJFA 5CEZD 3UERA 3BQVA 4CN4A 4XNZB 2WVTA 3NGBC 1PSKL 4YHNA 4JLRB 4U1GB 4OKVA 3L3IB 2W95A 4K9EH 4JQIH 4I1PA 3TVMA 3SYAA 1J5DA 1QATA 4LDOB 4R7NA 3IJ7A 3QQNA 3NJHA 1NFAA 3U6XS 2O6CA 3L1FA 3X1GA 3OLGA 3UTOA 3BEVB 3H1ZA 4F80A 1E6OH 3HN5A 4MJ6A 3CDZA 4C54A 1AS8A 1HHJA 5LXGL 2Y24A 1U41A 4YOKA 2DI8A 4KU1A 3M88A 1KB5A 3V8CA 4PS4H 2XHNA 1BG1A 3O3UN 1TQTA 5F7DB 4N9OB 2NY4D 3EADA 2WC7A 4MCZA 4NQEB 1JSYA 4HJSA 3WY3A 4L37B 3FMGH 4DQOL 4U1IB 2D7NA 3ZIYA 3O3EB 4MXVF 4M7LL 4UI2A 2GJ6D 4C56E 3NIGB 4KVPA 3LKOA 1XGQA 3IU3B 5ECGA 1W72L 5CIPB 5D1QD 2PXYD 2NXYB 3MCLH 3QCVH 2PNDA 4BWTA 4ZX6A 5GS1B 2X3CA 3LZOA 2WZAA 5J5EA 1PY0A 3T1WA 4FG6C 1GC1H 1KY6A 5D96B 2RTTA 4MLSA 4G6KL 1OCOB 4U1HB 5C0IA 1FAIL 1NFDE 2WNKA 2BIMA 2OW6A 3BUBA 2RBLA 1QFHA 3DUUA 1HYSC 1L0PA 3DJSA 1L3NA 2BHYA 1W8OA 1FP5A 2UVEA 4D8PA 1XCQA 3P4OB 3T77B 2PYED 4X4ME 3WIIH 3IU4H 2GC7C 2ZUWA 3UZVB 4BELD 2HFGL 3HZYA 3T2QA 4J3OD 3P9MA 2MCPL 1XSJA 4PBDA 4X7SL 1WFOA 5HI5D 3WHXB 5I1DB 4G8AC 4AKPA 5HPOA 2R0ZL 1JPSL 3FZUD 3ARGA 4LLMB 1QFWM 4F7MA 1U36A 1ZA3B 2UXVA 3T65B 1J9QA 4DN4H 1XF4B 4HF5H 3OX8A 2VLJE 3X13A 2GFBA 2JKWA 4PJ9C 4LASH 4XMLH 4PM1A 1BGXH 2QJDA 3QJVB 5D6CB 5ESAB 3QCTH 3VSTA 2G60L 3EDKA 2DQEL 4YPJA 1LDPL 2Y2WA 4OD2B 4KI5C 4GRWE 2O6DA 3O9WB 1HTYA 4K5NA 5E1GA 4PJ9D 4PB9H 5D7SH 5EPMA 1TVHB 3K1DA 5EU5A 5T1DH 5DZAA 2WXGA 4Y9CA 4APQC 2P49B 3ML9A 2NMSA 3CCHB 3QEQD 1AHKA 1GZHC 2QTEA 3NIDB 4Z23A 2W92A 1I7UB 3GRBA 2EKSB 1X9QA 4ZYKB 4OZGA 1YUKB 5T3XH 3RGBA 4Q97A 1GPOL 3BZFA 5ISZA 1S7RA 1U6AH 4G80B 2I32A 1VB9A 2X87A 3TBSB 3FFCA 5IB5A 2VKXA 3L5XL 4F8LA 3E0GA 3KPTA 1ZGLM 5BV7H 1XEDA 1MW3A 5FGCE 2HWZL 3HVDA 1I7TA 3LB6C 4OVVA 1ZVSB 4HLJA 4JUTA 3ATEA 3BWUC 3CC5B 4TLSA 4C56B 5E70A 1KBPA 4N4YB 1ZLUK 4L23A 3ARRA 1CD1A 1WK0A 4Z8FL 5D4IA 1IGTA 2GC4C 4S0SD 3GBLA 4WI7A 1EHNA 2IG2L 3HI5H 1OGAB 4Z3HA 1ZAGA 5CP3H 3MRKA 3P0GB 4V1DE 5D1ZC 3PNWB 1PJ9A 2VLME 1AXSA 4WUUE 4H5SB 3NDYE 1WFNA 5ESQB 3DETC 4AVHA 3PHOA 5FF6B 3SOTA 2XSKA 3VFOB 4LLYA 1NC4A 3ECWA 2VUYA 3CSPA 4KTYA 2RCSH 3CN2A 4Z7NB 2IALB 4ADIA 4G8EA 3HS0C 4MNQD 3G5XA 4ZX5A 1R9FA 3KPQA 3QRLA 5JIKA 2NY4C 1LO0H 4UNUA 1T2QL 3DPBA 4BA0A 4M8UA 4HWZB 4Z7NE 2CO4A 4R7DB 2YGVA 1KBGL 2Z7WA 1EGJH 2EUWA 2BSCA 1MVUB 1UWFA 1ZMYA 1GRWA 1HINL 1JV5A 1MFCL 1KLFB 3IMRA 4M4RA 1NKRA 1AI1L 4HHAA 4EVNA 4CU6A 4FZEH 4MFHA 5IB4A 2BSTB 2QLYA 3DX1A 4JFDE 1MJUH 2CKNA 3I9GH 4S1RL 5T3ZH 1Z1WA 3AXIA 1IFGA 3VE0B 1GHFH 2PPDA 3UTPD 3H4FA 1RLWA 3EW3B 5E8OA 2HN7A 1RMFL 2BIIA 2JMRA 3EJRA 4OFPA 5KVFE 3EHBD 4IBLT 4O5LL 3ARGD 4OCRH 5DHEA 2A73B 1JCVA 2WZ0A 3NEXA 1H3XA 2VZUA 2Q7NA 2R4SL 2N3JA 5HHXH 2DQUH 3HCVA 2VXVL 5EU3B 4TQ8A 3VI4E 4G6AC 3EJUA 4L4VA 5D7IB 1CLYL 2PW2A 3UGUA 3IF1A 5F96H 3L5JA 2DBLL 3I50L 1CTMA 5C0BA 1TYRA 4OFYA 3VG9C 3EOTL 1U3HB 1E7UA 1XCTB 2PCFB 2OW7A 5DHVB 2ED8A 4XNDA 3V8OA 3JWNG 2VDLB 4PRPA 3ULSA 3BMVA 3ARDD 4QAMB 5I8EB 1I8UA 2I25N 2PCPB 4Z76A