1NWPA

Crystallographic study of azurin from pseudomonas putida
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
AECKVTVDSTDQMSFNTKDIAIDKSCKTFTVELTHSGSLPKNVMGHNLVISKEADMQPIATDGLSAGIDKQYLKDGDARVIAHTKVIGAGEKDSVTFDVSKLAAGEKYGFFCSFPGHISMMKGTVTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic study of azurin from Pseudomonas putida.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords AZURIN
total genus 36
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nwpA00
3QJTB 1WS8A 3X1BA 1AS8A 4GXFA 5I6NA 4M4RB 5I6OA 4BXVA 3TU6A 4FA7B 3MBWB 3S3CB 2VW6A 2YXWA 3ZIYA 2PCFA 8PAZA 4AKOA 1L9SA 1KBWA 5I28A 1J5DA 3NJLA 2YXVA 2PCYA 1ETJA 1SF3A 1CUOA 1KCBA 1OV8A 4HCIA 1SFDA 1PLAA 4YSDA 5I5JA 2EIKB 2BP8B 3BVDB 1E30A 1BEXA 4HIPA 4YSRA 2IAAC 3NT0A 2PP7A 4BWWA 4YSSA 3FQ2A 1J5CA 3N55A 1AZCA 2HZHA 2DV6A 3QJUB 1QLEB 3WIAA 3ABGA 1JZGA 2XX1A 5I6KA 4YVUA 3WKPA 4A2EA 4KO7A 3V9CA 2GC7C 3WG7B 1AANA 4KO6A 3NJJA 1RKRA 2DWTA 4HCGA 1NIEA 2FWLB 1WA0X 4JHUA 4DP0X 2WO3B 4W1TA 1ASQA 3ERXA 2P80A 3ZBMA 1M57B 4HAKA 1EHKB 2BZCA 3FQ1A 3UACA 1X9UA 5TK2A 1KV7A 4DP5X 4E9XA 5B7FA 1J9RA 3C75A 1CURA 1XB3A 4DP9X 1BYOA 1OOWA 2I7SA 2MTAA 4ZK8A 3FPXA 1OE2A 2JXMA 1JVOA 3AG1B 3IE9A 4CSZA 2BP0A 4DP6X 3FPYA 2HRGA 1MG2C 2FQEA 2PPEA 3UAEA 4GP8B 1ZIAA 2IH8A 1T5KA 1NIDA 2R7EB 3KW8A 3NSCA 2AZUA 3TA4D 3S8FB 2CJ3A 4A2HA 2P80D 2PP8A 3S8GB 2OV0A 1E67A 3L45A 3NP3A 2UXTA 2UXGA 2B3IA 4A66A 2IWKA 4Q8BA 5PAZA 4KNSA 1PCSA 3X1NA 1HAWA 1PY0A 3AY2A 2XXGA 4MFHA 1JOIA 3UAAA 2DWSA 2BO0A 1TU2A 2QPEB 4G7QB 3ASNB 2UXVA 1IBYA 2IDUA 3EH4B 4E9QA 2VM3A 4HALA 3OD3A 4AKQA 1A8ZA 2BW4A 4HCFA 5B1JC 3T71A 1CC3A 4E9VA 4E9SA 3UABA 5I5MA 4TXVB 3X2QB 2HXAA 5F7AA 3FSZA 1ZIBA 4L0PB 2BZ7A 2XLLA 1AZRA 4GY4A 3WNJA 4P5SA 3AG2B 1A4CA 2H47C 2I7OA 4KOBA 4YSPA 4AX3A 3IEAA 1PMYA 1BXAA 1PNCA 4W9ZA 3QJQB 2GBAA 3GDCA 3EHBB 3ABKB 1KYAA 1SF5A 2PPDA 4YSAA 2QPDB 3DTUB 1BAWA 2DYSB 2DYRB 2BP8A 1WS7A 4ENZA 1ID2A 1GS7A 4YSOA 1L9QA 3FQYA 1SJMA 3V9EA 4E9WA 1AS6A 3OMNB 3WNIA 1IBZA 1KCWA 2RACA 1FWXA 4G7SB 2IH9A 2IDTA 3CDZB 1TKWA 4N4YB 4DP1X 1SNRA 1HFUA 1BQ5A 1N70A 1ASPA 4YL4A 5B1AB 1L9RA 2W8CA 4Q89A 1RZQA 3NJNA 3ABMB 3QJRB 2YAPA 3NYKA 4A2FA 1NPNA 1GY1A 1IUZA 3ZDWA 4A67A 3H4HA 3FT0A 1A65A 1DZ0A 2BWDA 1MZYA 1OE3A 2ZWNA 4NAJA 5TK4A 4A2DA 3HEIB 4YVNA 2YAFA 3EH3B 2XVBA 4KNUA 5B7EA 4BWUA 1ET7A 3NJFA 2AVFA 2B08A 3OMAB 4G72B 2OJ1A 1AZUA 1E5YA 1AR1B 1E65A 1A4BA 1OCOB 1AACA 2CALA 4WTQA 5E9NA 4A68A 2FTAA 2QT6A 2YAOA 2YQBA 1VLXA 2BW5A 2PPCA 4DP2X 2WSDA 4YSCA 1A3ZA 1J9SA 1UATA 1GS6X 1TEGA 4KOCA 3G5WA 1KGYE 1WAEA 1E5ZA 4NERA 5EHFA 1MDAA 2HX9A 2H5UA 3NJKA 5D4HA 3CVCA 5AFAA 2W88A 2ZONA 3SBRA 3U25A 5B1JA 4G7RB 1PNDA 2A3TA 2TSAA 2FJSA 1NPJA 1PZCA 2YAQA 4KNTA 2HX8A 6PCYA 1IKOP 2HLEB 1JVLA 1NTDA 3PPSA 5D4JA 1BQKA 1GY2A 3D12B 4AZUA 1RZPA 4GP5B 1ILUA 1ZDQA 1ILSA 3H56A 1V54B 1QHQA 9PCYA 3WKQA 2Q9OA 2FT8A 1ZDSA 1BXVA 3PXLA 1JERA 1OCZB 2CUAA 2PP9A 2HRHA 2VSKB 5IY5B 2VSMB 4PAZA 1L9TA 5I6PA 3DKHA 2H3XC 1AIZA 4JHVA 1YLBB 2FQFA 1DYZA 2ZXWB 1W6WA 2J55A 3NSDA 2UX7A 1N68A 2BHFA 1NZRA 1AOZA 2XV3A 2FQGA 1AQ8A 4E9YA 3AG4B 3QPKA 2E86A 4UANA 1OCCB 4DPBX 3PCYA 1WA1X 2J5WA 1BQRA 1A4AA 4HHWA 4BDVB 2FT7A 2TSBA 1AZBA 1GW0A 1JZEA 1NINA 1PAZA 2AZAA 2VM4A 3TBBA 2IWEA 3OMIB 3HB3B 4GYBA 2FNWA 4JKNA 4DP7X 4EF3A 3CVBA 2XU9A 3FSWA 4A2GA 3FYIB 4YSEA 3NJGA 2FQDA 2XV0A 2EIMB 2IDFA 2XV2A 3TBCA 1SHXA 5ANHA 3T9WA 4F2FA 3NSYA 3FU8A 5AKRA 1WA2X 5I26A 4UAHA 3NJMA 2GIMA 1I53A 1XMEB 3OM3B 4RH4A 5AZUA 1MZZA 2PPAA 2ZOOA 4YSQA 1XB8A 3H4FA 1ET5A 2EILB 3ZX1A 1JZIA 1IC0A 4F7KA 1HAUA 2IDSA 3QQXA 4KO5A 3ASOB 2CBPA 2XUWA 1M9WA 4G70B 4BXSV 3FS9A 1NWPA 5I6LA 2IDQA 3N2JA 4DPAX 5I6MA 3T6ZA 3X1GA 1ZPUA 4AKPA 2LLNA 1FFTB 3IN0A 1V55B 3NJHA 3S3DB 3MX0B 2DY2A 1SDDA 2QDVA 3T6XA 3KW7A 3ABLB 4E9TA 1OCRB 1SDDB 1R1CA 4QLWA 1EZLA 2XYBA 2J56A 2HX7A 2R7EA 5A7EA 5F7BA 3TASA 1ZV2A 2VW7A 1AAJA 3AW5A 2YARA 1RCYA 1NIFA 3FU7B 1AZNA 2AFNA 2VMJA 2J57A 2XWZA 3NP4A 2PPFA 5B1KA 1L9OA 2MRYA 3QJSB 2YAMA 4KO9A 4DP8X 4YSTA 5B1BB 3PAVA 2N0MA 3IN2A 4X4KA 5D4IA 4CSPA 3CZUB 7PCYA 2GHZA 3WI9A 3PAUA 2UXFA 4M3HA 3GYRA 2VN3A 2EIJB 1M56B 2X88A 4K9JA 3T6VA 1SFHA 2YAHA 3UGEA 1W6LA 4DPCX 3FU7A 1KBVA 3FYEB 2Q5BA 3FSAA 1CYWA 2GSMB 2EINB 1V10A 4BDVA 4BWTA 3RYMA 5LDUA 4HZ1A 2VW4A 2GC4C 3SQRA 1CYXA 1AG6A 2CAKA 4QKTA 1AG0A 3NSFA 1BYPA 2QDWA 5FC9A 3EH5B 1JZHA 4YSUA 3SBPA 1B3IA 1PF3A 1PLBA 2OCCB 3DIVA 3JT2A 3UADA 2UX6A 1GS8A 3BQVA 2NRDA 3GXUB 1X9RA 3CG8A 2WO2B 3FSVA 1L9PA 2BP0B 4FAAB 3CVDA 5B3SB 5I5IA 4PCYA 1NIAA 1ADWA 4P5RA 2BWIA 2XX0A 4N8UA 1PLCA 5B7MA 4UF7C 2YAEA 3S3BB 1URIA 1OE1A 1J9TA 1KDJA 1NDTA 2IWFA 3T6WA 1ASOA 2Y1AA 6PAZA 1AS7A 1SHWA 1GR7A 1NWOA 1QNIA 2FT6A 7PAZA 3EF4A 1JZFA 1PZAA 4AI7A 2GB2A 1JXFA 4WKXA 3CDZA 1W8EA 3AZUA 4F2EA 3JTBA 1NIBA 4NB7A 1TEFA 3PAZA 3IBOA 1GYCA 2GI0A 3OQRA 4E9RA 1F56A 1ET8A 1MG3C 2JFCA 2Y69B 2I85A 3QJVB 2CCWA 1XB6A 4G71B 5PCYA 4BK5C 4DP4X 3SBQA 1JXGA 1NICA 3X1FA 3PLYA 1OF0A 1JXDA 1JZJA 1BXUA 1J9QA 4GP4B 3AG3B 1GSKA 2PLTA 4HHGA 2JKWA 3FU9A 1FA4A 3X1EA 2X87A 3NJIA 1PZBA 2XXFA 1KDIA 2AANA
chains in the Genus database with same CATH superfamily
2BLFA 1DANU 3IJ9A 1DUZB 2M8XA 4MMYA 3T4AB 1CTMA 4J1UA 2DJ4A 2EP6A 3PWUA 4ZX5A 1MI5E 4HIJA 5ID1B 5A16B 4J23A 4AQEA 2VRKA 4Y2NA 4NSKA 3ZIYA 2PCFA 5DJAB 6FABL 1IJNA 3U6XS 1J0YA 2OMWB 3EO1A 2O61B 1D5BA 5BRZE 1T7XA 4FNLL 3ARGC 3HUJA 4BSVA 5B3JE 5GRVL 5J3HD 5DUML 4OFDA 1M2VA 4F57L 1PX3A 4JM4L 4X8XA 5HGBB 1XL6A 1TDQA 3MLSH 3QS2A 4N25A 1KG0A 3ELQA 4LDOB 4PTUB 3AWEA 4G11A 3M1CA 4YFDB 1PD1A 2ZYIA 5HI3D 2N3JA 4CMHC 2KQMA 4X9IA 4LGPB 1YEJH 5LDSA 1E28A 3UG4A 5FXCH 4UIMA 2V7NA 4C83B 1MH5A 4G3YH 4JPVH 4TF4A 2BCKB 3FZUD 4B9YA 2OL3A 4Z7OF 4NP4H 3PNRB 3QJHA 1PSKH 2FWLB 5E7FA 3MROA 3RLSA 3D4GA 4X9FA 4F1SA 3IGUA 1ASQA 2A74B 5LGHH 3U4BL 5ISZD 3SEPA 4MJ4A 4E9XA 3KAAA 2AQRA 4OB5H 4RRPM 1CLVA 3W2DL 3DWTA 1DANT 3FPXA 1HIMH 3IE9A 5CJXA 3RWGA 3CVHH 4X99B 2BJMH 1UZ8B 3VDCA 1ZY9A 5GRYA 3KS0H 1ZHLB 1JYWA 3HZMB 3UAJC 1A6VL 2I07A 3CPUA 3W0WB 5JIQA 4B9FA 1GGCH 3H6JA 3WN5B 4PY7B 4N2GA 3NVQA 2WZ5A 1G7QA 4U1GC 1H3WM 4PJDE 3C60B 4S1RH 4XO3A 2UXTA 3NESA 1MCPL 3EHBC 1XF2B 1HXYA 4IHOA 3FO1B 3MFGB 4KUZL 2JCCA 3IMSA 3IMUA 3Q1EA 1WUZA 4WO0A 4ZSOE 2FX8L 4UV7H 1W2KT 5D1QA 4Y2LA 4AUJA 4HIQA 2PW1A 3LXAA 2BSCA 2F53B 2BFVH 3W81A 2QPSA 1EEZB 4DNLA 1RZGB 1T1ZA 4OI7A 5AVUB 3ECBB 4TOYH 2X6BA 4S1SL 3RB7A 3N0PB 4ZX4A 1X7QB 4UT9L 3ABZA 3L13A 3MXVH 5ISZA 1QO3A 3TBVA 1KTKE 3VWJD 3OQ3B 1SXCA 3QEQA 1K8IA 1IBDA 3VWKC 1II4E 3HI6H 3WNKA 4AL8L 5IK3B 2R0ZL 2NY4B 3S4SB 4WEBL 1KBKA 1LDPH 2HVKA 1U8OA 5ADPL 3MUGB 3ARSA 4AW7A 2WKGA 3V4VL 1I1AC 3WEBA 4G8FB 5KVGH 4Z7UB 4WIQA 1N5AA 4OCRL 1WH0A 4ZFOL 5I82A 4KK8C 3BD3A 1Z3RA 2XLLA 1MREH 5HYJA 1OB1A 4YK4B 3V2AR 2C3XA 3MRGB 2F58L 1FNSL 1RJZA 4MJID 2QADB 1A6UH 1EQWA 3TIDA 4OCXL 3NIDF 1LILA 5DD6A 3VTAA 3N3EA 3IEAA 3GEWB 3VQMA 4K5OA 4W9IC 3C08H 4N2AA 3U1SL 4QXUL 2X41A 3T65B 3H9SD 2ALWA 2EXYD 2B1OA 2RFXA 5E5LA 4JRXA 3MLXH 2Y7SA 1GS7A 3QDJE 4UU9A 5DGRA 5F7MC 3EO1B 4J27A 2O61A 1AQDA 1K6QL 2CKNA 1A5FL 5J9PA 4N4YB 3CH8A 1Q1PA 2PCFB 4TN9A 5DJAA 1N70A 2FJFB 3QDGE 1XGRA 5ITBL 1PKQB 1SYSA 4PJIA 5KJRL 4MAZA 4PVNA 4UM8B 4Y9FA 3NJNA 4J1UB 3ZDWA 1OKEA 1DUZA 1JZ4A 1ZJAA 5L2KA 2V2TA 3FFDB 2OW7A 3K4ZA 2MNWA 2D7PA 4NI3A 1OE3A 3A4EA 3ARYA 5I0ZA 1YEFH 3O4OC 1IVLA 4RBPK 1NCWH 3KPMB 5IWLC 2NY3B 1Z9NA 3LEYL 3PHSA 1CXEA 2OJ1A 2XVLA 4JZOA 3D50A 4W81A 5DJ6B 3AUVA 4PB0L 4TUKH 1L4IA 3MAWA 4XMKH 3QJZA 1CMOA 5AW0B 4A68A 5DZJA 1DSFL 5JTWA 4LHUA 1BFVH 2X1OA 3O2DL 1HS6A 2J8UE 3OTTA 1MNUL 2JJSC 3GHEH 3BCDA 4XP1L 3EGSB 2XXMB 2DL2A 3F7VB 1AH1A 2AEOA 2IVFC 2HJFA 2HRLA 4PHZA 4XBEH 4BE6A 1AGBB 2QHRL 3CFUA 2PXYA 2OMVA 3BUBA 3MACL 4O51A 4J3BA 3CVCA 1QBAA 4X4ME 4HC1A 4ZJ9A 1H8NA 1GTNA 1YNTB 4LRIC 2E8YA 4X4XB 4UT7H 2Y7MA 5D1XD 1NUFA 2A3TA 5C97A 3OZ9H 1MSPA 2YAQA 2ESVD 3B1TA 4XOCA 3VDAA 3K6OA 4X5WA 3P0VL 4WSGA 1J7VR 4EI6A 3ZDXE 1E9QB 1I3UA 1PKQA 4LT7A 2VLME 3D69B 3Q9QA 3D0VA 4UYPA 4NQEA 1L9TA 4ZS7H 1DVSA 2J1KA 4RMBA 1DJIA 4R7NA 5EF1A 3BZ4A 1NGZA 1OHZA 2AITA 2ZYRA 5EA0H 4DCQA 1N6VA 4WGVB 4X8JB 1KBGL 2E7DA 4ZUVB 3KXFB 3KYNB 2JJTC 4FQCL 4PWGA 2ZT9C 5AOIA 3ULUC 2EADA 4Z5RB 2CO7A 4P3DA 3FQNB 2D7QA 2ZUSA 3EG9A 4NQCD 4XP4L 1ZT1B 3F7QA 5DS1A 3UTZA 1QUNB 3QWRD 1HSBA 3EDEA 5CS7A 2YPLB 3A24A 4P5MB 1PZ5A 1U8MA 4WI5A 5DD5H 4N8CL 4HZAA 5IQ9A 4YXLH 5IKCA 1NINA 4YMPA 3EOTL 1SJVA 4ES9A 4MMZB 3WIIL 2ORBH 2P3YA 2NTFA 2ZE0A 3FQXA 2B1AL 3IRCA 4J3TA 4OF7A 1RD6A 5LNGA 2XU9A 2A77H 3FTYA 4GRLB 5EO0A 3B9KA 1GL4B 4AW4A 2IDFA 3F01A 4QCIB 2ITDA 3NIGF 3F58H 3JWOL 5KVMC 5D96C 1IRAY 5E2WH 3BEWA 4UAHA 2MKLC 2BSSB 3MU3A 3ZDXF 3OM3B 3IDYC 3QORB 2QQQA 3FFOA 4PJAB 4EI5A 3LEVH 2HVKB 4D94A 1XB8A 5F3BA 1D5XA 1NDGB 5DHVH 4HT1H 2ZG3A 4F7KA 3P9WB 3QQXA 2AQPA 1TJXA 1TU2B 5EC2A 4XGZB 1CICA 4WFFD 1QP1A 5SWZB 1QO3B 4XC3L 5ISZB 1AJ7H 3KYKH 4GXVH 3S34H 2OZNA 1UD8A 3TO4A 3HE7C 3FFCD 4NCDA 3KEHA 1RZGA 1T1ZB 1YPZA 5FW7A 3VXMD 3VWJA 2F8IA 4XB8A 5L2JB 4EDXB 1Z7JA 4ODSH 1TVDA 1S7XA 1AZVA 4M7KL 5EU7E 2QDVA 2VXUH 4AG4L 1EHLH 3BDBA 4JL2A 3EXJA 4TTDD 2XT1B 3V6ZA 2DI8A 3HPJA 4B9KC 4LSSL 4WHDA 2H1XA 3PWPE 2K45A 2YSSA 5DUBB 5IMOB 1I8MB 1QA9A 2M26A 3GLAA 1JHLL 4DK3A 4Y5VA 6CGTA 3V6OE 5EOCL 4O2EA 4QXGL 3F62A 5DJXB 2CRZA 2D7OA 2YAMA 4PM1A 1A3LH 5C2BH 5EBLB 3STBA 4U3XA 1OXYA 1UUNA 2C9RA 1U3HB 2WYTA 3WDIA 3SGEH 4F9PA 3FUFA 4F8TA 2BX5A 2CWRA 5EBLA 5AD0B 2P46B 1USZA 2L3BA 5BO1L 3V4PA 2VR8A 2BS9A 3PAUA 4AGQA 3W1ZA 1PIGA 5TF1H 1MN4A 5LB1A 4XBPA 3INUL 2XPZA 4H0IA 2WXLA 3UGEA 2ARJB 4DPCX 4D9QD 1NMBH 1KBVA 5FPIA 4QHLA 5ILTH 4XAWH 3V10A 4JPIB 2MSPA 3BC9A 1VFBA 3N43F 3THMH 4G6FD 4JW3A 4BZYA 1Y07A 1DQJA 3TZVA 1S3KL 4FQIL 3SQRA 5C7XH 1SUHA 3LH2L 4JHWL 5FM5M 2P26A 3WMQA 4BSJA 1IM9B 3U9UA 4AQ1B 4FG6C 3CQFA 4X5RA 1VGEL 2A4ZA 1QLFB 5BQ7B 1HEJC 1BFSA 2HJKA 1DBBL 2AQSA 2OX5A 2WO2B 5KUMA 1L9PA 3EJZD 3QPQD 5EC2B 1J11A 5J57B 4P5RA 4YDKH 3VXUB 1CFNA 3ULUL 2OULB 1J9TA 2UWEE 5F1IB 2F74B 2OMWA 2PTTB 5A7BA 4MCMA 2Y1AA 1RSYA 2BSSA 2YQ3A 4H40A 4WV1B 3FQWB 5AALA 1CD9B 3S5ZA 2IG2H 2ITDB 4XOAA 4YDZA 2ZSVA 3I9AA 5E99H 2VL4A 4MJIA 4P9HL 3MJ6A 3Q6FB 5T5NF 5TE7H 3ZR5A 1BPVA 3WUWG 1T21A 1EANA 4F2EA 3AAZB 4DJMA 3T3PF 1CIDA 5BOJA 3T77B 2J4WL 3OQRA 4H44C 1NLDL 4OKDA 4JRXD 2WZ6A 4KKCD 4OF8A 1PZ5B 5G5DB 3OLEA 5GGUA 5HHXL 4NPYA 1KYDA 2WNXA 3SY0A 5FYJL 3T0WA 2IALB 5L6YL 3R7RA 3MODL 5JHDB 1N0LB 4PSRA 5I8KL 1NICA 1EEUA 35C8L 1GMIA 1QSVA 3FXIC 3NN8B 3VMPA 3ULUD 1OF0A 4HFUH 3QI9D 1WAAA 4YPGA 3AXHA 4R7NB 4GP4B 5FLUA 5IOPA 3ARWA 1ITBB 1QOKA 2W0LA 2JKWA 3EW3B 4XNMA 1YZZA 2DYPB 1LWRA 3FU5A 5E9DD 1UB6B 5FHBH 3DGCR 4YFEA 4XMZA 2Y4SA 4U33A 1ZLUK 4EQ3A 3GK8L 4GAYA 5CJ8A 3C2SA 4JM0A 3G5ZB 1J12A 2N4IA 4LRNH 4NI6A 2GABA 4Z18A 4NBZB 5DRWA 8PAZA 2F74A 3SGJA 5I1AA 3W9EA 2ZXEB 5DHXB 1IKFL 1KFAH 3FTGB 5JPMA 5EF0A 1D9KA 3NCJH 5MP6H 2LQRA 1N4XL 4PJXB 3WMSA 3C5ZA 1TLKA 4Y7MA 3ZO0A 1DBMH 3MRFA 3U9UB 1FSKB 4NZDA 4M48H 4MAUH 4WI2A 3QZOA 5HHOA 3KLHC 3TX4A 3N44B 4BZ1H 1BQLH 3RX9A 4HIPA 3MR9A 1PCXA 4AIZB 3U4AA 4X6EB 1Z0MA 5GGRY 3N55A 2FUQA 5C0NC 3VGDA 2B8OT 1R0AH 4FJYA 3NCMA 3D05A 4IKNA 4J3OH 1QBMH 3TP4A 5TGBB 3PU7A 5LNDA 5AZEH 4XN2A 1AGFB 3SE8H 1DQTA 4ZO9A 3BKYL 2CO6B 3VFSA 4XXCC 5J5EA 2IGLA 4NZRL 1UWFA 4DZ8B 2P4AB 4C57C 2VXVH 1BZ7B 4HEME 1HH9B 2X4SA 3NABL 5IHLB 4OCYL 2QV4A 3U82B 1WZKA 3WJJC 3CSFA 5GQBA 4WY7L 4XVUD 1NEZG 1CXHA 4N8VB 5TK2A 3RIAK 4NYLB 2DLHA 2GTQA 1MI5D 1LO3L 2DJSA 3BQUA 4DQOL 1KELH 1P7QD 3DXAD 4PJEB 4NJ9L 1ZA3A 3D39B 4RWYL 4BFGA 1FNGA 2J20A 2I5YH 2R1XB 3IMBA 2YK1H 1E2WA 2RFXB 3IU3B 2LGNA 5HI5D 4OM0L 3T65A 3NBNA 3DTDA 2X44D 3K91A 5CEZE 1Y7VA 1TQBB 4A2HA 4FCHA 3T8MA 3D25A 1RFDH 3EDFA 3HS8A 3CMOH 3H8NA 1KXQE 3VI4F 1AO7A 1P5UB 4PCSA 4MXQC 2GFBA 3ZL4H 3MFFB 4ZMZA 3C6LD 3HN3A 2IWKA 2B5IC 5B4MC 4JQIL 3SE3A 3VXSB 1SEQH 3ATDA 5HYJB 1PCSA 4GG8A 3X1NA 3ZE0E 5ICYA 1YEEL 3ZTJH 3EDKA 3P4LA 4QRFA 4WJG3 4PVBA 4IDLA 3X3FH 4D9RE 1EFXD 1QBLL 2YHGA 1L7IL 4FNTA 1J9CT 1NAML 2FBJL 2PWGA 5DSCB 1FNEA 5D7KD 2K78A 3AS3A 4GSUA 1IGMH 4R8WL 1IKNC 4Z7WA 4F80A 2O6FA 4URKA 5JW4M 2X3AA 4G1MB 8CGTA 2F1BA 4OZ4B 4Z7OE 4PRHD 2RBLA 4M6OL 4P3CL 1Q72H 2YR3A 1RZ8B 1H3XA 3L4WA 2A4EA 2AMGA 3B9KB 4JR9H 1PEZA 4NZFA 1Q9WB 2FZ3B 1A6TB 4JFYB 4DGVH 4OLWH 1B88A 2XG4A 3GXNA 4IRSB 1MVUB 3LSOB 4LSPL 4OT1H 4P06A 4MCYB 2VN5A 5JIKA 4CW1B 3NG5A 4KY1H 2HFEA 1H0DB 2ZKHL 3CLFL 1YO4A 1IBGH 1XVSA 1M7IB 4KRPC 3CFTA 3JTTB 3PYCA 1E4XH 1JGDB 3UTZB 1HWHB 1HU8A 3RVUC 4NZTH 3GJFK 2WTRB 3VSVA 3L7EB 1A3RH 4WWKB 4NGHL 3AUWB 3F7YB 4NQCE 5EIQA 1QSFB 3V5HB 4ZI8A 2CA4A 5BS0B 3MRKB 3VI3B 5HDRA 1ZHLA 1XXFC 3PGFH 5CD3B 4LPYA 3M45A 1HEZB 1MQ8A 4LSVH 2PYEB 5HPMB 3LB6C 4JE0A 3DO7B 3WKYA 2OM5A 1YDPB 4G7SB 2FIRT 4ZG1A 3O6FB 3OAUL 1Q8MA 3CFQA 1LD9A 4FFZL 3FW6A 1CDGA 4AEEA 5BVJB 1U8PA 2V7HA 1JSYA 2WQ8A 2QQKH 4LLQA 5CLWA 1NPNA 2H26B 2H1LM 4PJ8C 4LSTH 1F58L 2WBJB 4Z6AT 2IBBA 1DZ0A 1IV8A 4TSBL 5EU5B 3NDZE 3F7KA 4RNRB 2G5RA 3OKKB 3N50A 4KNUA 2R23B 5F7WC 3OMAB 4YUEL 3RBSA 1BVOA 1QFWH 2Q7YB 4KXZH 4UIMB 3WDJA 1JPGA 4LCYB 1ADQL 3UTTD 2C9VA 1JUFB 5GIRB 1IEAB 1FL5A 5JHLL 4KU1A 1Q0XH 2BW5A 2IPUK 4PJ5D 2WVTA 3LJ3A 4J6RL 5D7JB 1BXXA 5KSBA 1UATA 4LHUB 1WAAE 1ODAA 1A4KA 2P45B 2YZ1A 3BE1L 4TSCH 3W0WD 1OTUC 3PG2A 1GHFL 4DSYA 3LPFA 1CU4L 3H55A 4KKAD 4KJQD 1MF2L 4RA3A 2CNYA 1HX0A 3H54A 3AT9A 3HMXH 2IGFL 3NZ8B 5ANME 1D5BB 3U0TB 4BSWB 2AKRA 2V0AA 1EH9A 1DFBH 5FDWB 4WWNA 4H8WH 5H37H 1ZXQA 2NW3B 1IGJA 1NPJA 4NC0B 3BXNB 3WIHA 5ID1A 1NCUA 4HJTA 2R2BB 3QCUL 4HKBB 1IKNA 1XGRB 3ZKND 1YQVH 1LWJA 9PCYA 3B2UD 5HY9A 4WO4D 4ZOBA 5ESVB 3BHBA 2AEQH 5I0YA 4YHKH 1IM3D 1HYSD 1NMCB 3DK0A 3G5YA 5IIEB 2DKSA 2IH3A 1AQHA 3D08A 4TUOA 3SQOH 2P49B 2QQLL 2B77A 1GAFL 3BISA 3T6QC 1IE4A 3ES6B 1AR1C 5JIMA 3L5IA 3UZQA 2W9EL 4KKBD 5L7XL 2G75B 5C71A 2DQGL 4OIIL 1TVBA 2DMCA 2AC0A 1Z9LA 1WA1X 3FRPG 4LCWD 5DO2C 1FZMB 2LW3A 3TWCH 3D3VD 3KPSE 3MHZA 3DVNB 4N8VG 4QTIL 3HB3B 1JGIA 3EFOB 2E3VA 3OJDB 5HI4C 1VCAA 4U6HB 4LASL 5KBMA 2XIIA 3BZEA 4Z7QF 4N9GB 1EEQA 1N5AB 3LZOA 1LHZA 1FH2A 4GRMA 1FG9C 4XN4A 3EYSL 4JDVA 3HS9A 2BXZA 3QCVH 4PIRF 3U2SB 4JQIA 3I2CL 3PL6D 2DJUA 5T3XL 4QRRD 5IK3A 2VJ8A 5H94B 2ZOOA 4AH2A 5LWYH 2R2HA 4JN2B 4XN1A 5MENA 3VW3H 3TBVB 4P2RD 4P23B 4O2FA 4W9GC 3MUJA 4X9HA 4UZGA 2Q8BL 4GKNA 1UJ3C 1C7SA 2CR6A 4HWUA 3F3HA 4P4KB 1OK8A 3V4VB 1SXSA 4WNQB 4OR1A 3FMGL 5LG1A 1B6DA 2FJGB 3HBPA 4JY5L 5D5MF 1VSCA 5LCVA 4BBWA 5T3XD 3S3DB 3C60A 1SDDA 3KXFE 2N7SA 4LSUL 4N1HB 4X5XA 3WNLA 4A2LA 4LCWB 4PY7A 4M7ZB 4QLWA 2K3HA 1A66A 4HK0B 1KWKA 5KS9E 4MD0B 2RR3A 3GIVB 2R0WL 2XN9D 3IETB 3IU4H 1I9EA 4DKEL 5L88H 1AZNA 1Y6NR 2QQNL 4F2MB 3I6SA 1YNTF 3UZVA 3FCSA 3W3BA 2PCPB 3HE6B 3SZ6A 4UDTB 1UTDA 4KDTC 3SGJC 4PGEB 1FP5A 3Q3GB 4NKDA 4NNYA 1E4XI 1D5MA 2Q20A 1YEDB 2CGRH 5MEND 1TO4A 4NQQA 4R97B 1TTGA 3AJ7A 3VFPB 1FH5L 5KVFH 1CN4A 3ISRA 4ETQA 4Y88A 2UXFA 5JO5A 4AZ8A 2X38A 4B53A 4P23D 2A9AA 5C0DB 2X88A 4K9JA 5LN8A 1SFHA 4AY0A 4Z3IA 4ISVA 4G5ZL 3EOYG 1YNKH 4XC1H 1ZA6B 5DRNA 1DDHB 4M8UA 3N41B 3IMWA 3QRFM 1HHHB 5ICXB 4QRQA 2A6DA 3QUYA 5HI3C 3SGDH 4ZW8A 4CKVX 5LGYA 1JTTA 4O58H 2NUPB 3L2LA 5HYIA 1A6ZA 3FTWA 4FULA 4WI0A 2F6AA 5GRUH 1YYLL 1K5WA 3ECQA 1XGPA 2I60H 1B3IA 4UOW0 4FLQA 5HHMB 3ZU8A 3KXFD 2YMXL 4MA1B 4XVJL 1YJDC 1JGVL 3AWFA 3BQVA 4QRPA 5F6IC 3CG8A 3NIFF 4FQXD 5HGDB 3RVTC 3IAQA 2QSTA 3GSNA 2JKLA 3E1ZA 3I02B 12E8H 2VQ1A 2K8QA 2EEDA 4LLDB 1X6NA 4ZTOL 1XR8B 4PGCB 1SN5A 2XPGB 5MERB 3EBAA 3QFJD 4MYWB 2BOCB 1J8RA 3ZKXB 4XN7A 1K5NB 3MNMA 1MJ7L 4MKTA 4JHBA 4OCSL 1GZPB 1HHJA 1KCRL 1NCBH 2FT6A 2IAMB 2IADB 5KYNA 1BM3H 4AVIA 3VRJB 7PAZA 3L5XH 3CFDA 3LOWA 3PGDA 2YUXA 3IFLL 3OXRB 4AC4A 4XRCA 4KKRA 3LX9A 2FEDD 5FK9B 2RCSH 3JTBA 4NB7A 4DGUA 4U1MB 5JW4Q 3EYFA 3QUMH 4BKTC 4GW5B 2NY5L 2O6DA 2UZPA 1TJIH 4JEGB 2MPAH 4XPBL 1GGTA 2QELA 2P5EA 2DQJH 3WCYA 1AKJD 2I85A 4DT2A 3HBZA 4HSAC 3MLPA 1NFIB 3NTCL 4NQDA 3TZVC 4A6YL 2Z34A 1P4BH 1YY9D 2K4AA 4FMKA 3OKNA 3PLYA 2I69A 4K4KA 4KQ3L 1OGSA 1TZGL 2CKBB 4JO4L 3RGVA 2AXHA 3I9GL 4K23L 4KJPC 4KKLC 1OPGH 4X6DB 2B2XL 1E4WL 5CILL 2XHNA 2AMUA 1DVFA 1SEBB 3BFOA 2OQJA 1OAQH 3IDIB 2ADIB 3B5TA 2UWEB 5GHWH 4BXVA 4DKAA 4LDLB 4I3SL 1MIEH 5AWNL 4YFLI 4AEHL 1IIKA 2AGJH 5C0BE 4QYOA 2IH1B 2BC4A 5DK3A 4M00A 4IM8A 1XGTA 1I7ZA 2BWQA 2MCAA 1T20B 3AITA 1SFDA 1GPOL 1GIGL 1UB5A 4DVRL 4ODBD 5IMMA 5HD8C 3JYBA 4JANB 1G9NH 1E7UA 4EVNB 4BINA 3TO4D 2YQGA 4CVWA 1MFDL 2KS0A 2UV3A 3EUDA 1B4LA 4YSSA 1P5VA 2FWSA 3SDXE 4KWUA 1KXVC 2DTML 2DV6A 2W0KA 3LNHA 3KDMA 1CZ8H 4WUKH 4PD4J 4QXVA 3N9GH 5C07E 2WK2A 4Z3JA 3L9YA 1F4XH 3P77B 5IB5A 1FUNA 2H45A 1U58A 5HYEA 3KG5A 4RZCB 2PR9A 5FUCE 4AJ0A 4FXKA 5C7ZA 2H32A 5AAMA 3HRZC 3IVKB 4HWEL 4XN5A 4Z95H 3AU1B 1QHPA 1SN0A 2FEJA 3D3VB 1M57B 3D39D 3QHFL 3TJEH 1I1AB 4L0YA 4PS4L 3E0GA 3QC5X 5CZVH 5D72H 1SN2A 3BJLA 5CINH 4DP9X 1BYOA 3BO8B 4K8RL 4OF3A 1OAXH 4DGIH 1W0YT 3P4MB 2XKUA 1KB9J 1XR8A 4PGCA 2X4NA 1OE2A 3GNMH 2DF3A 2R1YA 3LNEA 4P4RB 3WFEH 4QYAA 4YXHH 1Q1JH 4YK4C 5DFVC 3V4LA 3UAEA 2WAQA 4QGTA 1J88A 1NBYB 3FQ4A 4LOFA 4LSDA 5ISZE 3NJXA 3CFIC 3RU8L 2PW2B 4OGZA 2Y7LA 4FZ8H 4G9FE 4RDQF 5CCJA 3SGDI 1U2YA 3R06B 5EFIA 4KK9D 4OCWL 4LLUB 1DN2A 2O5NA 4NFBA 3ZZSA 1YMHB 2B3IA 1N6QH 1U41A 3QAQA 5DC0A 4AC2A 4LL1A 2CJSA 1ZVYA 2ITCB 4XWOC 2J1WA 4JG1H 3PGCB 1RZIB 4NBXB 3LXUX 1RZKL 2ZG1A 1WBXA 3HHSB 2CR3A 4YDIL 1JWUA 3ZR6A 2EDQA 5LGJB 2FGWL 4KVNH 1RZ7L 3KLKA 3V0VB 1E90A 1I7UA 2HRPH 4GFTB 2Q6WA 3RTQB 4M7LL 5B3NA 2J5LC 5DVPA 2W9DH 4L8SB 3WKMH 1MIMH 2EH8L 1SXNA 1BWWA 3HPLB 1C1EH 1ZRUA 1M7DB 1AO7D 3T5WA 4K3DL 2BW4A 5DFWH 3IJHA 1TVHB 3RGHA 4FEIA 4NC1E 2WVUA 2AJXH 4BUQA 1NGWB 3ATEA 3IWUA 1X5AA 4PJIF 4M5YL 1D6VH 4FYRA 3X2QB 1FAIL 2ATKB 4ANUA 1EK3A 3B37A 3I3DA 5I1JL 2R8SL 3T1FA 1G9MC 4I2XA 2CJUL 1S7UA 3BSZH 5IB2A 3VJ6B 2C3WA 3RFZC 3N42B 3RUGF 4DK5A 4X83A 1KJ3L 5I8OH 3QQDB 1C5BH 1YQ2A 4AVJA 3QORD 3T3PE 3RWJA 1NOFA 3A47A 2D3JA 2KDGA 3QJQB 2GBAA 4IOFD 4R2GC 5IMLA 4YSAA 5FB8B 3U36B 2WGNB 4FD0A 3O6LH 5FUZH 2VMFA 2BP8A 2HLAA 3OAZH 5IWLA 3TV3L 3OKMA 4QKXB 2DM2A 1NC2B 3ARGD 2VXQL 4MQXD 4L3CA 3IF1A 3K6DA 4RLDA 4DP1X 2WZ0A 4JPWL 2H2PD 1KN2H 3O9WD 5D93C 3E2HC 1YEGH 3NAAL 1WBZA 2YRZA 4IBQA 1S7RB 3QJRB 3FH8A 1TPXB 5ALCH 1NOAA 2NXZB 4MS8D 1IC4H 4YHYC 2NNAB 4DKTA 2WHVA 5I30H 5KSAC 3C6SA 4KFMA 4ORGB 4PRHE 1P53A 2IFFL 4ERSL 1CXIA 2R2CA 3AREB 3Q9PA 1U8JB 5GRJH 4Z3HA 2EH7L 3KNBB 2IPUG 2YBRB 3D34A 1XGUB 5FGSA 4LSQH 2YPVA 4ONOA 1XTMA 3NSJA 3AU0A 1EAPA 3QISA 3VQLA 4MJ5A 2HWZH 1TJGL 3NH7L 4CVUA 5IHBA 1HSAA 1E5AA 2AEWA 4I48A 4BIKA 4G6MH 2MNJB 1LEKB 3VXRA 1O6SB 3O4LA 1KGYE 3VFGL 4LOEA 2W81C 4YBQC 5K39A 1ETZB 3ZHFA 5E6SB 5L8JB 4N0CD 2W07B 4DEPC 1JPSL 3G5YB 1HINH 1OW0A 2WUCL 4WKZA 5IIEA 1TJHL 2W88A 4ZUSB 4RSYA 3V8OA 4XZUB 1KCSL 4JFED 3U25A 2NY6C 2ZZUT 2C9QA 4KTEH 1S3RA 3E7JA 3WIHH 3N5AA 3QDGA 1PZCA 5CBAB 3G7TA 3T3MF 1XBRA 2ZCHL 1JVLA 1HVXA 2MTPA 2GSGA 3OJMB 1CL7L 1ILUA 4L4VA 3QWRA 1FZOA 2WQAA 3MCKB 3Q8FA 4Y4FD 2VITA 3FO2A 2DQTH 1CGWA 1T0OA 2X6VA 3LV3A 3Q8EA 4BSWA 2A6IA 3C8KA 3QPQC 4QPEA 4GSRA 4S0SD 5AVYB 3DKHA 4NDMB 4WFGE 4ZYKB 1KN4L 5D7SL 2VYRE 4ILDA 2HFGH 1HWGB 1P7QA 1PTZA 1AXTL 1LMIA 2XZCL 3DX2A 1W6WA 2WC7A 4HJJH 4KDWA 4NO0A 5IROA 3NSDA 3U83A 2P7TB 3P9MB 4L1SA 4U6XA 2V2XA 3ULVE 3IFPA 1I31A 4JKKA 2FQGA 3DC0A 3VX1A 3IFOA 1PSKL 2WQSA 5EU6E 3PCYA 5KVDH 3FB6A 4WTXA 3QZWA 3QDHA 3QEGL 5TFSH 3MV9A 4NFDA 3UAJA 4L3FA 1PAZA 5F6HI 2LU3A 3OMIB 2OR9H 5IHHA 4NQVB 4TUUA 2H3NA 5B8CB 2YWYA 1T1WB 3QDGD 3EH1A 2I27N 4OB5L 3WFDH 1E50A 1OOAA 5E8PB 1JPFA 3KGSA 2EIMB 4NZ8A 3RJDA 3TBCA 3C6LC 4DO6A 4MDJB 3CVHL 2BRRH 5J1TC 4JG0L 1KMGA 5JHDD 3SQBA 1C08A 4NN6C 4FOMA 1A6VH 1MRCH 1I4FB 3GMOA 5IW6B 1A14L 1OZUA 3WXVH 3US9A 1T4WA 1CFTB 2IDSA 5F1KC 3TEUA 3ZZQA 1RUKH 1F11B 2HMID 4NS0A 4HZLA 5I74C 4OLUL 32C2B 4KUZH 3ISYA 4Z7VA 3PF2A 5C0EB 4OLVH 2R1WA 3INOA 3LQAL 5DD3H 4QRSA 1OM9A 1CLOL 1LO4L 4IRZA 5HYJD 3L7EA 4WJ5B 5BVPH 3NRFA 2QJDA 2KH2B 4PGZA 4ZMVA 4ELME 2VDMH 3B2VL 1BMGA 4GMSL 3BCFA 4S1DD 4UT9H 3VRLF 5KS9B 3JTTA 3OC8A 1NPUA 3QUHA 2XYBA 3BP4A 4F27A 3EYVB 3ZDZF 2HFEB 1XGYH 4G1EA 4JFSA 5EU6D 1VESA 1AAJA 3MLRH 1ZHNB 3N6YA 1D2PA 4JREC 3ARGA 5MEQA 1RIHL 5AVTB 3O8XD 3NP4A 4BFRA 1EO5A 5BCAA 1ANUA 5B1KA 1BQHB 4P59H 1D5RA 4U1JB 4X8GA 1MY5A 4H8VA 4Z7IA 1INEL 1T0MB 1XIWA 4W6YB 4X4KA 3EGXB 4XVOA 1JF5A 5EUKB 2N56A 1LE9B 1SJHB 3S6CA 1NGPH 3WFCH 1C16B 1I9JH 2FHCA 4Z0BH 4J8RB 3BT2L 1QI3A 1FL6A 1AXSA 5GRVK 1I3RA 3IFNH 2BS71 3TPKA 4ZFGH 3TCLB 2L04A 5MEQB 3MNWA 1OAKL 2PYFA 4U2YA 4OVUA 3RFRA 3FU7A 3ZRFC 1MFEH 4HV8B 3JZYA 4ONGH 5CWSB 2WY3B 3GC3A 4O9HH 3BP5A 2GSMB 1T7ZA 4OZGF 5MHSD 3CCHB 5JNYB 4XCCL 5CJQL 4BDVA 5CCKL 2QMJA 5LDUA 1XCWA 2DEXX 3N44F 1A7RL 3IJ7A 2BOBB 2HH0L 5CP3A 3B7YA 1AG0A 3QIWA 1K6QH 1BYPA 1SY6A 3DMMB 4WJ5A 1A7BA 4LNRA 5JIHA 2NYYD 1UM5L 3NIGE 3MLUL 4NLAA 1A9EB 5KJRH 2FB4H 5J13B 1YJDL 4L2LA 32C2A 2X4TA 4F5CE 3WY2A 1D7CA 4G42A 1T2QH 4QAMB 1UFGA 3GBNL 5EEXA 3O8XB 5D2LF 2X70A 4PJBA 2DLFH 1RJYA 2WBJD 4I7ZC 4TULH 3GINA 4WW2B 5DRZB 3VD9A 2XCMC 4MXWL 1RIVL 3WTXA 1LE5B 1W72B 3RVUD 4YZWA 3BGFC 3DPDA 3UTSB 3D4YA 2YC1A 4X8CA 5JHAA 2F08A 1AP2B 3GSQB 2CO3A 4MBOA 2PXYD 1XH0A 5JQHC 2CRIA 3GKWL 5GSRA 1E5UI 3UO8B 3DURA 1JZFA 2OTUA 4CC4C 1KY6A 2GB2A 4O5LL 4OD3H 3WTYA 5D1XA 1KEML 2A5UA 4NQVA 3GLEA 3QRBA 5DWPA 4DKFL 4H4NA 3Q13A 3P2BA 5K33A 1MJJB 4XBEL 4XB3A 1BLNA 2JQMA 4K94C 3U0PA 1FF5A 3MA9H 4NKMA 3BSGA 3QJVB 2AF2A 5DHYB 4PJ8D 4H25A 3ZT6A 1R75A 4DERA 3MRLB 4U1LA 2Y2YA 4QRUB 3WDHA 1X9QA 4FDWA 3FUEA 1VACB 3IK2A 2ZWLT 1P7QB 3UBXB 4CVXB 4AT6B 3TF7C 3FU9A 4JDTH 2DDQH 3SKMA 4LLVA 4FQPA 2SEBA 1RK1B 1TCRA 4F9PC 3DRQA 4K5NA 4R96A 1UM4H 2F54D 1H15B 3UZEC 3WS6C 2CK2A 5I6NA 1KJ2L 3FO0H 4M4RB 4W9KC 2I9TB 4F37K 1K85A 1G6RB 2AJ3A 4PG9B 4IBVA 5FECA 3MBWB 4XH2B 1KIUB 2VW6A 5TE4H 4RDBA 1XSIA 1BX2A 4PJFE 5C0CA 1XF5A 2P44B 1QLEH 2UUDK 4UQ3A 5KOVC 3QHZL 4PRPE 1HNFA 3CN4A 5KVEL 4MD5A 1DE4A 3OLDA 4MCZB 2BDNL 4PLOB 1CICD 2K6ZA 3TM6A 2F7QA 5IOPB 3O2VH 4F3FA 2V17H 1TQBC 2X3BA 3WUWB 3QI9A 2YRPA 2C9AA 3ECUA 4FXGC 4ORZC 3LRGA 2W60B 1R24A 2CXGA 3NZSA 4IMLB 1DN0A 1R3KA 2CHZA 4M8VA 3K8KA 2D03H 3MV8B 2YEQA 5JHDA 4I48B 3IDMB 5FO7A 4BKSC 4F8OA 1IGTA 4I77L 3MRMA 3B8SA 1VEPA 1G0DA 1VDGA 2X4RA 4XR8C 5C6TL 2BVYA 5ES4B 2ZOKB 5BXFB 4BKLB 1UGKA 4P5TD 4DUVA 2K70A 3AQXA 4ZUWA 2DWTA 3Q6FA 1WA0X 2BNUB 1I1RA 1TJMA 4JFFD 5A2CA 5L4MA 3DIFA 4LCVA 4W1TA 3ZBMA 3T4YA 2AQ1A 4HAKA 2ZYSA 5DUPH 3QNXB 3Q0HA 3JUYA 5I6XC 3CK0L 1CD0A 5J11B 2I9LA 3B9KC 2DBLH 2BVTA 3QPXL 2ZUQB 2PTTA 4IOSD 3VUAA 3HFML 3TXAA 4JFWA 3B7SA 3ILQC 1U8IB 3MN8A 1OOWA 4U49A 2EACA 4M7KH 3AFLA 3FAWA 3HAEB 4M29A 3NQIA 2FO1A 2LFGA 4UMSA 1MG2C 3DARA 5SWSE 3VB8A 1FGNL 3FL7A 1WTGT 5BQ7A 5EF2A 4HF5H 5FB8A 4AQ1A 3RWDB 1QRNA 3IKCB 4K7PY 2QV2A 3BGMB 4C4KT 1JV2B 5EULV 1HJBC 4N26A 3QIWD 4Q0XH 5CEYA 1QFUH 1JGUL 1W72L 4Y19E 5JDJA 1WZMA 4NOBA 3DPBB 1KXTA 4J4PD 5PAZA 5C08B 3BAXA 1EJ6A 1DLHB 5KOMC 4YE0A 2ARJA 4MNGA 4LFHG 2ADYA 5CSGA 5JQ6H 2HN7B 3B3IB 4QHUA 1FGVL 3B2MA 2R0KH 4MGXA 3ZDYB 5KBLA 5T33L 1CE6B 4P2QE 1JZ7A 4IK6A 5FGBC 3INUH 4GUPB 3MBEC 3ISWA 4XCFL 2UY6A 5IHUH 2AW2A 1T1XA 3DVFA 4OD2A 1HK6A 1M7DA 4EXPX 2AXFA 1A25A 4XWGH 2CHXA 4HS6B 1FDLL 3GZPA 3O3BB 4L8SA 1KTDB 2B20A 4PV1C 3RY5A 5IJKA 3EZ8A 4I9WD 4JAMA 4NM4H 3KJ6L 1OTSC 5EOTB 3QUZD 2JV6A 2NQCA 3Q2NA 3K8MA 3C6LA 4GQZA 2J6EL 4CNIA 2WLKA 4L0PB 2Z65C 2GJRA 3DVGA 5AKSA 3PGCA 4LVHC 2VXTL 2J8OA 2LLLA 5EU6A 4MJ2A 4JFVA 4IBWA 2BHUA 5L9DL 1DBBH 2RD0A 3SDDC 4AMWA 3IDXL 1P1VA 3N85H 5FO2A 4A2MA 3FCTB 1F41A 3MLYH 3GMPA 3OR7B 4PYHA 2I7OA 2EIBA 4V1DB 1PMYA 4N0UB 2G2PA 3K46A 1RP9A 4MB4A 4UT6H 3TC9A 5L2JA 1WZAA 3RI5F 1DEEA 3NZHL 4HD5A 2KBGA 3HNTH 5A2AA 3TO4B 3CZSA 2AK4B 3VMNA 5T3ZE 1YN7A 4M9OA 1TETL 3TBSA 4YDJA 3GSRB 4XMPL 5I71C 4HGMA 2RACA 1KCWA 1CGSL 5INDB 2HKFH 2IDTA 4KJYB 4ONFL 2DWEA 4IKIA 5JPNC 3HBGA 1CJYA 4BFIB 4EXKA 3QFGA 5FA3A 5TPWL 2NY3D 3QORA 1FLTX 1L9RA 2BMKB 2X28A 1HQRA 4D0DA 3BZFA 2YAPA 3NYKA 4M03A 2VLJE 1MRDL 2XKSA 3BIKB 3NFSH 2H41A 4JFEA 2APBA 1CFQB 4QWWD 4M43H 1SBBA 2YAFA 3FQXB 2NX5A 2EDDA 2L7QA 1CQKA 5IB5B 2B08A 4XNZB 4G72B 1K2DA 5TJWK 1JYVA 1E65A 3H3KA 4JZJA 3BAYA 1IEHA 3A0OA 4YE4L 3BPLB 1HHKA 1NANH 1MFAL 3B56A 3LZPA 3CFEA 2YPLA 5KSVA 5HHOD 3BP6A 3C5SA 4NHCH 3RE0A 1KJ2B 3EG9B 4GXUM 2AEIT 3CVHB 5DMIH 3VB9A 4OZIF 3EYUH 1CE1H 1I8LC 5T3XE 3W37A 5HDWA 2OSLA 2QKSA 2VISA 3KBFA 4DCQB 5M7QA 2V9RA 3LMJL 3GK8H 2OMYB 4NO0D 1KWGA 1TYRA 5IROD 2WXMA 5GGRB 3RY6A 4DAGL 2B39A 4XPTH 1EJOH 1N59A 3D0VB 4FQ1H 4ODHL 3X11A 4ZNEE 2CDGB 3MUZ1 2G3ZA 4PJCF 4AQ8A 1ZHBA 4R2GD 3PPSA 1NBVL 1JHTA 4D3CL 5JW5A 1GY2A 5E94B 1SM3L 3QGVA 4GAAA 3F2LA 4CDHA 4GQRA 4QMEA 1PZ2A 4ZX6A 2VE6A 5KSAA 3AROA 2N0KA 2OJEB 2VDMB 1Y18A 4M48L 3EOAA 4NCC1 1MW3A 4PI0A 1U92A 5DFVD 4AYSA 1T03H 3A67L 5ADOL 2CUAA 5D71L 3Q5YA 2VLJD 4Z7QE 2EC9U 1CO1A 3QA3A 4GAJH 1UD3A 5BZWB 4P8QA 1F3JA 3SOBH 2YPLD 3I50L 3BUDA 4P5TC 2YFOA 4E5XG 5F72S 2B4CH 2WPGA 1SRDA 3TO2A 2FO4B 1T5XA 3GMLB 3OJVC 4KVCH 4BFOA 3SKOB 1AOZA 1KGJA 1VJSA 2BP3A 5MHSE 1OK0A 2WIIA 3N40F 1BFOB 2WQXA 4AEIH 4JO2H 3S2AA 4QRRA 3OZKA 1VZIA 4J4PA 2P5EB 4FQ2H 2PWFA 4NO2B 2FD6H 2EDWA 1CGTA 5CJXC 2AZAA 4A7GA 3TBBA 4IJ3B 5KZCD 1BQHG 4OM1L 1ZLVK 5FLVA 2QLYA 3FHAA 4U1MA 1XF3A 3RHWF 3UJJH 4DP7X 1OLZA 5HVHC 5J8OA 3NGBB 5LQBH 3M88A 3ECWA 1KELL 2XV0A 1WPCA 2DD8H 3CVIH 1MCIA 1ZE3H 4F2FA 2O5YL 1L5GB 4JFEE 1WA2X 1VADA 4UMGA 1I53A 3HC3L 3LKPB 4R6UA 1E4KA 2GG1A 2VLJA 4APXA 1MVFA 1WC7A 1PQZA 3A6BL 4NENA 2V37A 1U93A 2EILB 3SODB 1VERA 3ASOB 4Z23A 3SE4A 3CMGA 4PR5B 4X7CC 3MRJB 5BO0D 4CJ0A 1UT2A 4R3SB 3APFA 2PKDA 3DSNA 5E5RB 4MMXC 5KYUB 4PJHE 5HHQB 1GGBH 1R3JA 4TVPD 2N59A 2VDPH 2X9YA 3PP4L 4RFNC 1SYVB 1JNNL 2ZSWA 3LRSA 2BERA 1S7TB 4E9TA 3DGDA 1MCNA 3MA7B 2AK4E 4DZBB 2Z1PA 3HG1A 3N04A 2O5ZH 3VCLB 3MBXH 4BELD 1RUML 1FZKB 2HX7A 3PV6B 1BA9A 1F1DA 4CN6A 1OB0A 4NM8L 3U4EB 1CDYA 4OV5A 2CM5A 5C0DA 4UOW1 4F91B 1UWEL 2B0SH 3IJEA 1M71B 2F15A 4G43B 4YHLL 4E0RB 1D7BA 4RRPG 4GNKB 4W9DC 3QEHB 1JZ5A 2N0MA 2OSYA 2WVVB 4G8FA 4M6NH 1AMYA 4B9CA 3QG6A 3SCMB 4M1CD 1P7KB 3MRNA 2EIEA 3S5YA 4NZUL 4UOZA 7PCYA 1MAJA 4U6YA 1CLYH 3WI9A 1QX1A 1WIUA 2NY3C 1E5CA 4HJIA 1EMTH 3RAJL 3TT3H 2AJVH 3IT8D 3U9PL 1URZA 2ZXQA 5E1GA 4F1ZA 4L8CB 3PV7A 2VXSL 4P2QA 4JCWA 5IESH 3EADA 4G8GD 4J4PC 2X4UB 4LDEB 2GKIA 3ZTEA 3FU6A 1WICA 4RAVA 1B0GB 4JFXB 5D1QB 2PTVA 1Z5LB 2NMSA 4IIQC 3P3UA 1MAKA 1G94A 1K4CA 3WO4B 4EZMA 5FV1L 4LVNC 3DHJA 1IAMA 4C56A 5JOPE 1AHWC 1CYXA 3QUXA 3O45A 2VCOA 3D5OF 4NPKA 3LZLA 3V52H 4IKKA 3RWHB 3UTSD 4B5EA 1JTOA 4EEEA 4Z76B 2IANE 3ARPA 3BAKA 3HE7D 3II1A 1ZT7A 3L1OH 4NQCB 4X6DE 3GIZH 5CEZD 5CZXC 2FEEL 1DQMH 1AXIB 3B7RL 3FCBA 4TQ8A 3FUJA 4P23A 1QLRA 2YAEA 2BY1A 4ZW3A 1DBJH 2XWJA 3WL9A 4WEBH 3TH3T 1N12A 4Y4HA 1AS7A 1ZGLA 3U7AA 3U2SA 5T1KA 4OFIA 2NCEA 4PRID 1VCBC 3HNVL 4NKIL 1WEJH 3HI5L 4Y1SA 1GA2A 2X2UA 3EJCA 3MGOB 2L4OA 4OAWA 5BPPA 2GJZA 1IGIH 1W8EA 2UZIL 3KJ4C 4HUNB 3SJVD 1EUTA 4XAKD 1DL7H 1YC8A 2BCKA 3NACH 2F58H 2ZWYA 4XCYB 4M7LT 3AQZA 4OFYD 2R4SH 1MF2H 4I0PC 5EO9B 5IOKA 1XEDA 5K1NA 3RGVC 4DQAA 4GW1A 4L29A 5I0VA 3NPSC 3ETTA 4HIIA 4JZJC 3FFCB 4HW6A 2NY7H 2JIXD 4UT6A 1BF8A 2CQVA 3WV0A 5BOPA 4YHNB 3V0HA 1BWMA 1GSKA 3T0VA 2A99A 3QCUH 4K3JL 5FYKU 5D6CB 2X4UA 2WN2A 5AL0A 1I3GH 4LGSB 3UBXG 1G7IB 4GAGH 4M1GH 2B59B 3ESVF 3PHOA 5T3ZL 4Q14A 1TSRA 3IDYB 3QORC 1FO0A 4ZUTA 2DPKA 3CDFA 5KYYA 4YAQB 1T0NB 4U6YB 5KJ4A 3BPOC 3EO9H 1VA9A 5E2VH 3WXWH 5FA4B 2DQDH 4MD4B 2X9ZA 1NGXA 1LQSR 3QG6B 4OZFB 1L9NA 4X6CE 3OMZA 1U3NA 3HKFA 1IAOA 2BIIA 1DBAL 2EDKA 3LEYH 4YHPA 5F7LB 3UC2A 1MY7A 5DJ2B 3WIFB 1I9RL 3AY4A 4TUKL 5EU7C 4XMKL 1NEZB 1ZSDB 3WFHA 4B6ZA 2CO2A 5K9KA 1F13A 1B0WA 3L95B 1UXWB 3GRWH 5DTFB 2GT9B 5IVXF 5C0FB 4CC1A 3V5DB 4C58B 1X4ZA 2XG5A 5BOZG 5C0RH 2CDEB 1FIGH 4EI0A 1GKOA 2F8OA 1QMUA 5D7IB 3PIQA 1H9DA 5KJ7E 3KS0J 3ZHLA 3VFMA 1SYVA 1JUFA 3TV8A 2YKLH 5EU4A 1R3JB 4ZFZA 4K5LA 2E27H 2XX1A 3I2CH 2P8PA 3ME0B 4NUJA 5E00B 2NSMA 3DSNB 1SBSH 3BZDA 1AD0B 2IC2A 3OKKA 3TBTB 2Z93A 4HLJA 2PO6C 4LL9A 4RNRA 3LQZA 3VW3L 5EIIB 3MKKA 3EDJA 4XXWC 3S35X 4HCRL 4L4TE 4OGAC 1MCRA 1ODUA 4MX7A 1RQ5A 3GI9L 5TH2A 3ZOAA 2X7LA 2PUQT 2APSA 5H37G 4FMFA 3F83A 1OSEA 1U8PB 2V7HB 3OC5A 3O81A 4XXDB 2M2DA 3VXTB 4APXB 1G9NC 5BW7A 3X3GL 3UEZA 3SDDD 4I5BB 2WZAA 1FFQA 4HPOH 4TMPA 3UXFA 5DEFB 4ZS7L 5E6UB 2OCJA 3O6MH 1K72A 4HA1A 4JO3L 1CLZL 3V0EA 3L8QA 5C0JB 4PJ9B 1KT2A 2ZNWA 1JPTH 4WO4C 3PY9A 1DTUA 1ZV5A 3D39E 3PQYA 5AKVA 1F1AA 4ELMB 2ZX5A 1T5KA 4ELKB 3LS5H 3MRKA 3FT3A 2FE0A 1ZEAL 4FFYA 5HYSG 3S8FB 3L4VA 5DJYB 5L88L 2GTZB 2OV0A 2YMOA 5TF0A 3HC4L 1BAFH 4AQ1C 2E75C 2BNQB 4MYPA 3VI3F 3KWWA 4DOHE 4HXBL 4OGXL 2QGBA 4Q8BA 1NFDA 1VGKB 1S2EA 2A73A 1U95B 2WQRA 3WE6A 1YNLL 5C0GA 3CDGB 3HI1B 4QHMA 4XNUL 4M4PA 1JV5A 4FQXA 1BEYL 1MLCA 2BO0A 2F53E 1EJFA 5D9SB 2CPUA 1IBFA 1PAMA 1PW3A 2Q0ZX 3EJRA 5C0ND 1A47A 4U2ZA 3QBTB 3MUHL 4E42B 1HOCA 4XT1C 1JFHA 2V5MA 1MUJB 4XHJC 4XNXL 1HXKA 3OD3A 4M7JL 5CN3A 4AKQA 1A8ZA 2DYPD 3OXSA 4UTBA 2VLRE 5FF6A 4Y4KC 2UYLB 3OV6A 3Q2LA 5D5MA 4F7EA 4HKZA 1JHTB 5JW5B 3D2TA 3NIDB 3X13A 1CFSB 4KNQA 1GZQA 4QI3A 4TXVB 5EB9A 2QEJA 4LHUG 1H6FA 1EAOA 2D0HA 2VR3A 3KLSA 4ZAKD 1TENA 1S78C 3UX9B 3S88L 3AXLA 1A6AA 1L6PA 4UQ9A 2Z31D 5EC1A 3VG9C 1T04A 4PTTA 1L6ZA 1QASA 3IJ8A 4PHXA 3HZKA 2EXWC 1BGXL 2JI1A 2CLZA 3MJ9H 1AD9B 3PPEA 3RDJA 3LS4H 3NIGB 4GLRH 1NLBL 1CFBA 1EVUA 1H3TA 4OLYL 4ZPTB 5IQMA 4NHUB 2LAGB 1UCBH 3GDCA 1U8LB 1A1MA 2PPDA 4EQ2A 3R4RA 4ES8A 3F6LA 4WK0B 5CO1A 2CBOA 2R1XA 3SJVA 4QXGH 4I9XA 2QSCL 1F02I 4Z7VE 1U8KB 4LEXH 5IVXB 4NQDD 2Y9RT 3V5KA 2NX5B 3R0NA 1G7HB 1BBJA 1UYWL 2KLTA 3B5GA 3CDZB 3QUYD 4ODVL 4PRNB 2A9DA 2FSEA 4N8VA 5B1AB 3UZEA 1YEKH 1AR2A 1YHPA 1LO5B 3ABMB 3KH3A 3O0LA 4F7CB 4A2FA 5HYSA 1GY1A 4WHYG 4TNEA 4FQLH 5F0LB 3FT0A 4HH9B 4QRBA 4ZUUB 3LNFA 2P8LA 4BFIA 2JIXA 2K8MA 4NZJA 4K3GA 4YVNA 2KZBA 1UOWA 1ADQA 4P0DA 1USQA 4FADA 4NNPL 2EDEA 4J3OF 2GK2A 4JFPA 3BPNB 5JYLA 1BF2A 4WTQA 3GS4A 4PG2A 3DXAB 3QFJA 5E8DL 1R3HB 4AMKL 3QIUD 2YQBA 2ADFL 4X6EA 4G2AA 4FYTA 4TNWF 2KZWA 4EN3C 3BUYA 3QDMD 5KN5B 5K9JL 1WAEA 1E5ZA 2C9PA 1XWVA 5EHFA 1KIQB 3HOGA 4WUUE 5T1MA 5IUCA 2ICWJ 4EUPB 3CHSA 3LKRB 1NGQH 4L05A 3VD2A 4LF3B 4GSDL 5HDBE 5TDNB 1C12A 2E9WA 2WYHA 1BPLB 2AGJL 4N1CA 4XBMA 2EKJA 2ZG2A 3QUGA 4QNPE 4P9MH 2UZXB 4NNXB 2J88H 2ATPB 3ROOA 1VRSA 2YOCA 2PWHA 4TQHA 3WTWA 2Y0SA 1OP3K 5I15H 5EWIL 3EGDA 3U0WL 4JUSA 3RZCD 1XZWA 5DD0L 3QJOA 2EIZA 2F5AL 1LP9F 2X0UA 1NBZB 4N86A 2VSKB 1J1OL 1UWGH 2WAHA 3KM2A 1EEYB 5KBNC 4U1SA 2OK0L 4TL4A 4GSQA 4QEGA 4PMFA 4ZFOA 3MV01 4J8QA 4KK8D 2VERA 1LO2L 3Q01A 4E5XB 1KXTB 4LB8A 5CGMA 1IC5H 4OW6A 4ICWA 2K0RA 3S5LB 2MCMA 4X0NA 5F7EL 2XWBB 5I16A 4LBEA 2XN9E 1A4AA 4FNUA 5ABZA 1C5DA 5FO8B 1JK8A 4WFGD 1UURA 2OL3L 3DIDA 5AVRB 1C5CL 4PJEF 1B0RA 1QRNB 3CN2A 1WUNT 3ARRA 3HZYA 3IKCA 3N0AA 4MAYB 5JUEL 3V0JA 4L4VD 4AENB 1UASA 3NOIA 3ESOA 4KMQA 3AAZA 4JDZA 3CVBA 3UIZA 4AE1A 4BZ1A 1JK9A 3FSWA 3OGOE 4KROB 4OLEA 3NJGA 1XIWD 3GBLA 3S3JA 3U9WA 2LTQC 1T5WA 5F2FA 3WY4A 5TQ0H 4CN4A 4Z78B 5C9JB 5MENE 4HJEA 2XV2A 4TKWA 4J6IA 3RL2A 1XT5A 3QQ3B 2F1AA 4YXHL 1JDAA 4PRHA 5I26A 2VLKE 5K59F 4KV5F 1EUUA 4FG4A 4YSQA 3VFUA 2RJMA 5GS0L 1CFNB 4PJCE 5D4QA 3H42H 3ESPA 5IFJB 4PJ5B 1CGUA 1KC5H 3A21A 3UO1L 1KGCE 4EOWL 1TXKA 5DK0B 3QXDA 3QNZB 3N2JA 4NLHA 2AABH 1QLFA 5I19L 4KRNA 3AGVA 3LZRA 4HMDA 4W6WB 4XMLH 1FFOA 4MAYA 3KPNB 2ZOKA 2XN1A 1NCTA 5FYKH 1A1OB 1UEMA 3UC0L 4UZUA 3CX5J 3ZRSA 4X4YB 4HX1B 1EJ8A 4P5KB 1DQJB 1RLWA 3CZLA 2XWBA 5FX3A 3SPGA 2V2WB 1CFVH 1BVKA 1DN0B 3MPCA 4FFWC 4RIRB 4YIQA 1DBKL 4X2UA 4LCWE 2HSIA 1RCYA 4Y19B 4BZ2H 4NRZB 1BZDA 2XFXB 3L9RB 4IRJA 2R4RH 2EEAA 1V5JA 3FU0A 4NUQA 4HC1L 1BQUA 3QUZB 5F9OH 2RH0A 3WJMB 2OA9A 4OGYL 4PJ8B 3IDUA 1PLGH 3MSPA 1QKZH 3L5JA 5DFAA 3MRBA 3LB6D 1IAIH 3GYRA 3AQDA 1AMXA 1CFMA 3CH1B 2XZQH 1V8HA 4PP1D 5IGXH 5KYWB 2ED6A 6FABH 5TD4A 1JE6A 1WYJA 2YSSB 4KY2A 3BDXA 4FQJL 2QR0B 4WUUA 4LF3A 5D7JC 4HJUA 4I4WA 4EBQL 2OMUA 3MI6A 4G82A 4WI8A 4MHHG 5DWUH 3HPJB 4L9DA 5GS1C 2EZ0C 3LKSB 4KHXH 4EUPA 3CN3A 3VH8G 1KIQA 3RYMA 4JN1L 1V7ML 3DSFH 4YFLF 3FUIA 2GC4C 2EXWD 5EPMA 4P2AA 5GRXG 2I26N 4NO3A 4RGMC 3U6RB 3GSNL 2CPCA 2J25A 5A6LA 1RJLB 1GS8A 2YO3A 3D4ZA 3NAAH 2NRDA 3QFJB 3QIBC 3ZE0F 1BVNT 3K6SA 2C9UA 4ZNCD 4FLSA 1KF9B 4IHBA 2QSVA 1TZIA 2C1PB 2VJ0A 1CICB 4OV6F 1ADWA 1OARH 4MLSA 1P1ZB 4TNGA 4XN8A 4QRTA 4U7KA 3CXDH 5DHVB 1YEHH 4TTGA 2QFPA 1EXHA 1JL8A 4EI5B 1CI5A 4JDEB 1ORSA 4ZMWA 1ASOA 3W57A 4LSQL 3BP7B 1J87A 2VDNH 3EJUA 5EBWB 3WKNA 5J6HB 4KZCA 1KYUA 1XZ0A 3BLKA 4YZFF 5TQ2H 4AI7A 1OW0C 4J3OD 4PRNA 5C3TA 1HHGA 1URLA 4LSPH 3GHBH 3LKQB 4L3EA 4IBTA 4PBDA 4APQA 2A6JB 3V9FA 1T2JA 2ADGB 1RL1A 1ZS8B 4CILA 4J2XA 3CLFH 3QZWG 5HJ3B 4NQED 3S4SG 3V0WH 3HBQA 1FORH 3FOMB 2Z92B 4DETA 3FB5B 5DR5L 2HJLA 3QEUA 4FNPA 3SKJH 3UYRL 1IGYB 2CHWA 1XX9C 4ADIA 1GKEA 2LU4A 1OM3L 3X12A 1GGCL 4OQTA 1QR4A 5C07D 4JBSA 4MNQE 3L4TA 4GUCA 1OD7A 5C9KA 3MTXA 5D2NE 5EORH 3VGFA 3ZT5A 2IFGA 2AQQA 1MFBH 3G5VA 1CL7H 3ULVH 5DS8B 5CWSA 4JRLA 2NY0C 4R7DB 2PYFB 2AANA 2YUZA 4TPRH 1XH1A 4DW2H 4HISA 2ENPA 2Y22A 4FJ6A 4EI5D 2C3GA 1DQQA 1TQCC 1CFSA 2QQKL 5CIPB 3GM0A 1KIRA 1OTUD 3ARFB 4P57B 2FYVA 3WS3A 1AIFA 4ZW5A 3US1A 3ZGIA 3MRCB 4RMSA 1C16A 4DO4A 1HOCB 2G9HB 2R83A 5BRQA 1A2YB 1QACA 2H6PA 2VABA 1N7MH 1IMHC 1XF4A 2Y7QB 2VL5B 3BX7C 2YXVA 1F2QA 2OTWB 4YDVB 3BAJA 1AGBA 5DF0A 3BSHA 4Y1AA 2AI0L 5FM4A 4QHMB 3RBGA 3EGSA 3V0IA 1G4MA 1X5GA 1IAII 4G7VH 1KPVB 3AXIA 2X0WA 2XYCA 4HH8A 3DK2A 3FRUA 4JJ5B 3P02A 4G7YH 3RIFF 1WDAA 2JJWA 2A0LD 3SGKC 2NXYB 2I25N 4ZW7A 2F8XC 1QLEB 4XPFL 3CZGA 5EZOH 3TN0A 4AYDC 3WIAA 3MXWL 3C09C 1LO0H 1JS4A 2EDLA 2P24B 2CU9A 2LR4A 5AW5B 3JWNE 4PG2C 4Y5YB 3QEQD 1P6AB 3MCG1 1MWAA 5DT1L 4H0GA 4JHUA 1DJWA 1H8OA 1UXLA 3MGTA 4MSWA 5IQNA 4NN7C 4JFDB 2OR7A 1EHKB 4PJIB 2OJZH 1WG3A 3VXTA 4XXDA 3X14B 3GSWB 1IC7L 4Y1AD 1MQKH 4QJ5B 1C8PA 1SJEB 2QQLH 2WLJA 2FLBT 3FPYA 2K3TA 1S9XA 3SO3C 3TIEB 4YS4A 5CCGE 3T04D 3G6JE 5CP3H 2W92A 3V0GA 5BJTA 4KZDH 2EDRA 1U8CB 3L81A 1TYJA 5EH1A 1ROCA 4G8GA 2AV1B 5EU4B 1DSWA 2GJ6A 4X9GA 1T1YB 5C0IA 5ITFB 1B3JA 5F7DB 3NFPB 3ZYOA 4A66A 3UP6A 1YG9A 2BSRA 5E4EC 5FYJE 4AGLA 4C56D 4HK3J 1OP5K 3SPVB 4O02B 4F7PA 4G6JL 5IJVA 2VLRD 3CU1A 1ZTXL 1FVEA 2OI9B 3MCLL 3AY2A 1FBIH 2XACC 4I88A 2OP4H 3D52A 4N0RA 4N9OB 3LY6A 1CG9B 3O3DB 2QPEB 1I85A 3ZKXC 2D31A 3EYSH 1G0YR 4ZXBA 1IBYA 2GEQA 3TBYB 1IIIA 4DEWA 2VM3A 3S48A 2DBJA 2CLRB 4PEEA 4FE9A 1TQSA 2VITB 3VI4E 4PREB 4YQXL 3CFCL 4E9VA 4JY4B 5JHBA 4FKKA 2KL6A 1G1CA 4XNZC 1S9YA 3DTXA 4PRIA 4ZXBC 2HXAA 5KZCB 4YGVB 2FIKB 1ACYL 1VPOL 4XZUA 3ECBA 3H9ZA 3TYGL 2FH8A 2H6OA 2BZ7A 5D1ZB 2LVEA 2JF1A 1KIPA 3WNJA 2HMIC 1HI6B 3R1GL 4YHNA 3RIFK 1AGCA 1E2VA 2QVMA 3K71B 3PRZA 3R19A 4P5SA 5K39B 4S0TD 1T2QL 4PS3A 1LEKA 4N2IA 5IM7A 4YN3A 2KPNA 3O2WL 5D70L 1N6UA 2LE9A 2EE6A 3RWIA 2I07B 3W0WA 3JVGC 3O9WB 3LVTA 2NQ3A 4WWID 3S36H 5LVEA 4L3ED 4PV8A 2FATL 1CTOA 4OFQA 1IQWH 3ATBA 4PIBA 1YYCA 2WJ5A 1XGUA 4Y5XA 2D7TH 2V3DA 5EN2B 2AQTA 4NWTH 4F93B 1OAYL 5FCUH 1NGYB 1ASPA 1HKLL 2D9QB 3K2IA 4YXKH 5DEZA 1U8HB 4P46C 3P3RA 4GSXA 3WEXB 5AW6B 4HG4K 1VEOA 3BDYH 3NK4A 5C0BA 2YXMA 1CDUA 1GW6A 4A2DA 4OD1H 4S10A 5IQ7L 5IBTH 1L3NA 2AQ2A 3V4UL 3UAFA 2XTLA 5F3FA 3W9DB 2IOOA 1M9SA 5LXGH 1YN6A 1CD8A 3GD1C 3QIBD 2PO6A 1O7DE 4J3OG 4LRIA 5CKGA 4BH7A 5E9NA 4E36A 2VM9A 5IHZB 4Z76A 2LABA 2ICWA 2VMCA 2QT6A 4MA8L 4RFOH 5C8JB 2B9BA 1I1YA 1VLXA 1ZHKB 3QAZC 2WSDA 2DDQL 2NUTB 4Y9GA 3MJ8B 3DO4A 1R5VA 3F64A 3DV4A 1ZPLA 4HIXH 5BZDB 3SDAB 4B3VA 1K4CB 1D5ZB 1K8DA 3RTQD 1GMEA 3B3BA 1U9KA 4RFEB 1F18A 2K6YA 5E5MA 2BNRB 2M1KA 4AWJC 3HA0A 3RA7L 3WEOA 1EBPA 5LAXB 3ARDD 2NSXA 4L8CA 5IFHL 3KYMA 3PABA 1OAZH 4CMMA 1WFNA 3DX9B 2AVGA 4O4YH 4ALAH 4FFVD 1NJ9B 1YY8B 1JMXA 1NAMA 4PGBB 3O2VL 3QDAA 1P6WA 4WHTA 3L5XL 5LO7A 2CIKA 1ILSA 4QY8B 2C1OA 4GLRI 5F89A 2FYYA 3JWNH 3AWGA 1ZJBA 2JJVA 2YD9A 5E6ID 4A7UA 3RKDC 4WTZG 4JLRA 5CBEA 1W0VA 4IDJH 3HJEA 3PDDA 4PAZA 1F97A 1AIZA 4E2OA 2NY5H 2OMZA 3CZFB 3P3TA 4XPAL 1XQ4A 2IQAB 1T2XA 2IO5A 1I7TB 2WSKA 5DK2A 2IQ9L 3IGAA 5BV7H 1FFNA 3DX7B 4YZFE 4BFJA 3H9HA 2ITCA 5GGQL 2XA3A 3LPOA 1AQ8A 4A6YH 4XAWL 3L3GA 1OCWH 2YRLA 2JKNA 1GTFA 4JNXA 5TDPA 2YPVH 4DPBX 5FUOL 1EAQA 1SXZA 3UL4A 3UJTL 1E3FA 1EWHA 4FKEA 3LH2H 4R7XA 5I1HL 4K23H 3LN4A 3BVUA 3KPSB 3GSVB 4IBLT 4HJGB 5AB1A 4A2GA 3IXTB 3QJFA 2VLLB 2BIPA 4P4RA 2NY5C 4IU3A 3AS0A 3ZGHA 2NQDA 3MRPA 4FA6A 2OW6A 1WC7B 2P5WB 4A7VA 1OY3B 1B2WH 4YX2L 4PBXA 2NY2D 3F5WA 3MNVA 1J8HA 1WCBB 1I1AA 2EEXA 3LIZL 4KPHL 4ODWB 1R33A 1OAUH 5F1NA 3UEQA 2AK1L 2KUTA 2FL5A 3J27A 2CO1A 3RUGA 5D1QE 2AEPH 4FXKB 4PJFB 1B0IA 1R3IL 4PY8J 3T6ZA 4AKPA 4B41A 4WU5B 1GCYA 3SYAA 2Q10A 3DUUB 2VT0A 4PJDA 3CX2A 4UOQA 3N1FC 1Y6KR 3NCEB 1UXSA 3MX0B 4KGLA 3W39A 2OTPA 1OGTA 5I2IB 4D8PB 2CBTA 3T6XA 3OAYH 2R29H 3ABLB 1LQBC 1T7YA 1EZLA 3W11C 3EUUA 4AL8H 3FTZA 3VXMB 4YHIA 1MHHB 2R0ZH 2VW7A 3GMLA 5I24A 4GQ9L 4GO8A 3SDCA 4KHTH 4JFZL 4AQZA 5E08L 1FDLH 1PYWB 4EZJA 3SD5A 5JZ7C 3V4VH 3LN5A 2AFNA 5IJDC 3KPSD 2PPFA 4Z95L 3QZMA 4HS8H 4QXWA 1PY4A 5BZWA 3WLBB 3E2HB 2ZTBA 1T3FA 2EICA 4HKJA 4ZODA 3VFTB 1AC6A 5CHNA 4LKCA 2NXZC 3EOAB 4YHYB 3MJ9A 1I1AD 1Y18B 5CZVL 8FABB 2Q8AL 4ONHB 5SX4H 3BW9A 4XCNA 3R0MA 2A2QT 3LNGA 2PR4L 2WWMD 3KJ4B 3VX0A 5SX5H 3Q2CA 5CZKA 2EIJB 3BH8B 3Q6GH 5DZAA 4JHAL 3T0EE 5AUMA 5DMKB 3U6XA 2UZYA 1Z9SA 4HJGA 1J10A 4QTFA 4AL8C 5KUKA 4YNYB 3SB3A 3DNKA 1JGEB 3MUY1 5MP6L 4J12A 2AP2A 5J0BA 1WQVT 3MLXL 3NPSB 2IBGA 3H7BA 1EIBA 4FQQB 3T2LA 1EFQA 2X89A 3OBAA 3H53A 1N6QL 3D07A 4LHUD 1TZHA 2G4GA 3MOAH 4NQDB 4YSUA 3SBPA 3EO0A 3F00A 3OLGA 4OF6A 5ITBH 2EE0A 1KB5L 5TPWH 4G9DA 1G7PB 4TLSA 2Y3AA 4ZD3L 1X5XA 1A64A 4FAAB 5E0QA 3DX3A 1C7TA 4YHZL 3K2UL 3PJNA 3ZLQC 4GI6A 4LMQI 5I1KH 1M1XA 4FHJA 3T4AC 2NZ9C 1AHKA 3S3BB 2OCFD 2X2JA 1W91A 4JLRB 4P2CG 4U1KB 2BVQA 4XPGH 3LHPH 2WW8A 2YUWA 1E9PA 3NABH 5F44A 3X17A 4PGBA 1T6VN 5CSZA 1RULH 2X4OB 4PJ7F 1NCCL 4JFFB 3TT1H 1R3LB 3K74B 4CMMB 5AENA 4HU2A 1EGJL 5INDA 4MNQA 4ZAKB 1CXKA 1P0SE 1DFXA 3MNZA 3BWSA 4JE4B 4N20A 4TQPA 1CD1A 5DURB 5KYXA 3GXPA 1G7PA 2GAZB 2MPVA 1LP9E 4DAGH 2J8UB 2ZP0T 4N28A 4MS8C 1JD7A 4WU7B 3EO0B 4TNWK 2W9LA 4CMHB 3PFQA 4B9ZA 5J1SC 4DP4X 4ZQKB 1N8ZB 4FQQA 1J86A 1FCCA 3CMOL 2ZUYA 3AGWA 4F92B 1TZOA 3TEXA 4F57H 4G8EB 1JXJA 1PZBA 2V5YA 3C6LB 4HXAL 2UZYB 1PZUB 3A67H 1WS8A 4BEIA 3BH8A 3K0WA 2YIHA 3DOHA 1DUYA 3PS6A 3TU6A 2NXZD 3BQUD 3VRIA 4N2LA 4ERSH 3UPRA 2P47B 3VE0A 1K3ZA 1L9SA 4JPKL 1JDDA 2CSPA 1SQ2N 3K72B 3NJLA 3WNPA 1NCDH 4R5XA 2E4TA 4AQ8C 4KZEH 4G8IB 2HN7A 3B3IA 4QHUB 5EZIL 2AHIA 4MNGB 5AW3B 3EOBB 3WAJA 3U4BH 3VFRA 4RISL 4WW1B 25C8L 1MHHA 3EOTH 3VXMA 1NH6A 3DPBA 1A1NB 1SOXA 43CAA 4IBYA 4ZSOB 1RK0A 3WEMA 1RUPH 2W65A 3SE9H 3VXUD 4JL1A 5KBDA 4QOKA 1I8LA 1AZCA 2DD8L 1E4XL 1S9WB 1E43A 2QTEA 3CVIL 3JV0A 4R9HA 4A04A 4U6TA 5CLXA 1ZMYA 2DJMA 4YWGH 4BV1A 3HC3H 3BAEH 4Y9EA 4GKZB 4WU5A 4A2EA 5IF0B 1SDAB 1FYTB 2Y5EA 5IHWA 2VQUA 3FTVA 1AFVL 2MNUA 5I5RA 2BVPB 3NK3A 3PGFL 1D5IH 1AQKH 2K7QA 2ZCHH 3DTXB 3HG1D 4KX9A 2VIRB 2MEJB 2VKWA 4JN2A 4KKZA 5MENB 5D8JL 2FX8H 4UV7L 2P8MB 4Y4FB 4UINL 2C9SA 1XB3A 5I76A 2K7PA 4UUJB 4RGOH 4M1CC 2DWDA 4RMQA 3I6GA 1ZANH 4IS6A 2XJKA 1JNNH 1XBDA 4NJAL 3P11L 3DUSA 5F3HA 4N2NA 1DVTA 1Y6MR 3C2AH 4HJJL 3I75A 4Y16B 3TVMA 1HC1A 1BHGA 1RJCA 4TSBH 1FC2D 1RUMH 4LLMA 2W59A 3KW8A 1NFKA 3WFZA 3BPCB 1PS3A 3DOSB 5EN3A 3DVNA 3AT8A 4UTBL 4F7PB 5CF3A 2WB1A 1KPRA 4QT5A 5GISL 2VQTA 3KLAB 3L45A 1CF1A 5EOCH 2UXGA 4X6BA 4LESA 1UA6H 1MFCL 1UT9A 1LEIB 4B50A 5BMFH 1AO7E 4KXCA 5CUSL 5E2TL 5JLZA 2FHBA 3K6NA 3O8XC 3VQ1C 5IEHB 3BVVA 3SDDA 5BRZA 2DWSA 3O3EA 4TUOB 2O1AA 1GHFH 1I9IL 1FN4A 3HR5A 2F9BT 1SJEA 2VDKH 1DLFL 2AXWA 2VLKA 4LCCA 4XVSL 3GBML 2IGFH 3P4NB 4JG0H 4LPCA 3HAEG 4PWHA 3UTPE 3WJJA 3LD8C 2WINB 3QE5A 4IGBA 2X4PB 5TDOA 4XE5B 2B7DT 4QY8A 2Z91B 3U30C 5B1JC 4PG9A 5F96H 2L7JA 4AK1A 1RPUA 3O4OB 4HS3B 3THML 1UH2A 2QPUA 3QWOA 1MLBA 2G4EA 2BVPA 2NW3A 4XXCA 3SHSA 3TNNB 4TLUA 2GITB 4G6KH 3FT1A 3SKMB 1CLOH 1LO4H 2FX7H 4FQXC 4AGPA 1VGEH 4X6DF 4AT6A 3IRZA 2MHAA 3ATAA 2W65B 3T2PA 3AG2B 3OKYA 2WD0A 4MWFB 4AITA 3KMDA 4OUUB 1WK0A 2WLNA 3C5ZC 4PWKA 4BH8A 5I1LB 4ANWA 3CTTA 4K9EC 3RGVD 1DQLH 2J3SA 4PV9A 3G5XB 1SF5A 5F9WB 1I1YB 1ZHKA 3O0RH 4X80H 2H9GB 4OZIB 4PQXA 1BLNB 1XF1A 1QRKA 1ID2A 4GQQA 4XCEB 5D1XE 1FQ9C 1D6EA 3KEDA 1T6WA 1HJCA 1SJMA 1Z5HA 3P1VA 5HXMA 2R23A 3ZQXA 3W5NA 3WNIA 5EO1B 5TE7L 4EN2A 5D1XB 2IH9A 4V2BA 5L4FA 3VRIB 3FQUB 3L48A 1TF4A 1LTXA 2IOMA 1NGPL 2Z7ZA 3DURB 1I9JL 5C0BB 3F12A 2DWXA 1YRKA 3L3JB 3WEXA 3ZDXB 3BAWA 4DTGL 5GGVH 4ZTPL 3PWPD 3NACL 4WI9A 3FN0H 3GJFA 5C09E 5IFAH 5EG6C 2DMHA 3AMKA 3CUPA 4XX1E 1IM3A 3OGCA 4UDUB 5L0QB 2DQHH 3ULAB 2H1PL 3M8OH 5K69A 3Q2VA 1Z9PA 4KRMB 1F6LL 3K5RA 2VZOA 2AVFA 3EYOA 4H26A 4ZMTA 3QYMA 4HFWB 2YD0A 4U0RB 5DS8A 4KROD 1F90H 1LMKA 2IXQB 4POZD 2NY7L 1DJZA 1HZHH 4OIAA 3G04B 3JT0A 3K1KC 3CLWA 2XPYA 3D18A 5K9OA 2FTAA 1B6UA 4HU8A 1J1PH 1JFQL 1RVFL 1J9SA 4ELDA 1N2RB 4QHNB 2XWTA 3X12B 3U1QA 1J05A 3SPJA 4M1GL 3VFOA 4HOXA 5JORA 3GUTB 4C59B 1JGDA 2HTKC 1TQVA 3VVVA 1KTBA 4MMZC 4P2OD 4I18B 3CCHA 3NJKA 3GBNH 4HWBH 4WI7A 4GRLC 4ADJA 5HJ3A 5AFAA 1RZFH 3AY4C 2CA3A 2QFRA 4X4ZA 3LZFH 3LKQA 5JOPD 2XRAL 4ODTL 5FGRA 3H0TA 4LGRB 3VGEA 2FJSA 2CHDA 1EXUA 2NW2A