1NWPA

Crystallographic study of azurin from pseudomonas putida
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
AECKVTVDSTDQMSFNTKDIAIDKSCKTFTVELTHSGSLPKNVMGHNLVISKEADMQPIATDGLSAGIDKQYLKDGDARVIAHTKVIGAGEKDSVTFDVSKLAAGEKYGFFCSFPGHISMMKGTVTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords AZURIN
publication title Crystallographic study of azurin from Pseudomonas putida.
pubmed doi rcsb
total genus 36
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nwpA00
4G7SB 1L9OA 4GP8B 3NP3A 4NERA 3SQRA 1BAWA 4GP5B 5B1JC 4YSSA 1UATA 2AFNA 4ENZA 5IY5B 1AZBA 2B3IA 1E30A 1MG3C 3OMAB 2EIKB 1KCBA 3FSVA 6PAZA 3FYEB 1E67A 1JZFA 1E5ZA 2VSKB 1AIZA 3FS9A 2PPCA 1OV8A 2IDQA 1NWPA 3AY2A 3H4FA 2YARA 5LDUA 1JZJA 1SFDA 2J55A 3NJMA 2UXGA 4HALA 1ADWA 1KYAA 3NJHA 2FJSA 1JVLA 1BYPA 1NDTA 1TU2A 1JZEA 2FT8A 1JZGA 1RZQA 4YL4A 1SF5A 2H3XC 4DP7X 2IWEA 1SFHA 3FT0A 4EF3A 3CDZA 4BWUA 1KCWA 3FU7B 1A3ZA 2PP8A 2J56A 2VM3A 4E9YA 2DV6A 1GY2A 1TKWA 2GIMA 1MZYA 1OCZB 3EF4A 4MFHA 5B1KA 3S8FB 1NPJA 1NIEA 2BP8A 4X4KA 2P80A 1KDIA 2BWDA 1AZRA 1AG0A 4BK5C 3OM3B 4Q8BA 2FQFA 2FT6A 2BZ7A 5B1BB 3WKQA 4AKOA 1BXVA 3QJQB 2ZONA 1BYOA 1X9RA 3N55A 9PCYA 4KOCA 2R7EA 1BQ5A 2YAHA 2DYRB 3D12B 1GR7A 4DP2X 1ASQA 2HRHA 3NT0A 3S3BB 1OCOB 2BO0A 1QHQA 3CVDA 4GP4B 4QLWA 1ZDSA 3NSFA 5D4IA 2B08A 3NJLA 1GSKA 4YSQA 1PMYA 3V9EA 1L9QA 1NPNA 2XXGA 3CVCA 4YSCA 2W8CA 1BQRA 3UACA 4P5RA 1GS7A 4GXFA 1AZUA 3H4HA 3PLYA 4HAKA 2ZWNA 4DPBX 2VW4A 1IKOP 1AANA 2WO3B 2W88A 4A66A 2WO2B 3X1GA 5F7AA 3T9WA 2FWLB 3WKPA 4BWWA 1L9SA 1XB3A 3CDZB 1AACA 2VW7A 3PAZA 4HCIA 5B7FA 1JXFA 2IH8A 1DZ0A 2J5WA 3FSWA 3UAAA 4E9TA 2BP8B 5I6LA 2VM4A 3FQ2A 3QJTB 2P80D 3OQRA 3PCYA 4E9XA 3S8GB 2GSMB 2CAKA 2HZHA 2IAAC 1PY0A 3NJGA 3QJVB 4CSPA 2R7EB 2XUWA 2CCWA 1JOIA 2EINB 3SBQA 4KO9A 2Q9OA 1WA0X 1AAJA 1JERA 1L9RA 3CG8A 1F56A 3MBWB 3NSYA 4UANA 5D4JA 4A2EA 1N70A 4JKNA 1W6WA 2XV0A 3X1FA 2YAFA 3N2JA 2EIJB 5B3SB 1RCYA 1OCCB 1PLBA 2XVBA 1AS6A 1QLEB 3ERXA 1ZIAA 2GC7C 3BVDB 1IUZA 1BQKA 4JHVA 1L9PA 4BDVA 1J9SA 2Y1AA 1GS8A 3QQXA 1FWXA 4UF7C 2QPDB 1MZZA 2J57A 1FA4A 5I28A 2ZXWB 2JFCA 2XU9A 2YAPA 3IN2A 1WS8A 2PPFA 1N68A 2NRDA 1WA1X 4HCFA 1OF0A 1ILUA 2UXFA 4M4RB 4KO5A 3UABA 2I7OA 3EH5B 4G72B 3NJNA 4AX3A 1RKRA 2E86A 3C75A 1GYCA 1ZIBA 4G7QB 1J9QA 3T6WA 2BWIA 1NTDA 2MTAA 2UX6A 2BP0A 3ABLB 5F7BA 2N0MA 3JT2A 2A3TA 3FQYA 1A4CA 1J9RA 2YAEA 1SF3A 2IH9A 3SBRA 1OCRB 1OE1A 1ASPA 3ZIYA 4KNSA 3TBCA 4BXSV 3DKHA 2Q5BA 4GY4A 3V9CA 4E9QA 1CURA 4HHWA 4YSAA 4DP6X 1FFTB 2FQEA 4G7RB 3G5WA 1WS7A 2YXWA 1A65A 1PLAA 3L45A 1A4BA 4L0PB 3NJJA 5AZUA 4PAZA 2JKWA 5PCYA 1J9TA 3PAUA 4A2DA 1PNCA 1WAEA 4BDVB 2TSBA 4DP8X 2Y69B 1NIDA 3PPSA 4E9RA 3U25A 5I6PA 5I6OA 4M3HA 3AG3B 3UAEA 4WKXA 2UXVA 3FU8A 2PPDA 3JTBA 3RYMA 1GW0A 5ANHA 3HEIB 2IWFA 2AZAA 1M56B 2IDTA 1NINA 3WNIA 2EILB 4E9VA 3AG4B 1XB8A 1IC0A 7PAZA 1NIAA 1NICA 3ABMB 2FQDA 4WTQA 4AKQA 4A2GA 3H56A 4NAJA 1ETJA 3ZBMA 4YSRA 3X1EA 2PPEA 3FSZA 5I6NA 1GS6X 4YSEA 2CALA 2GHZA 1J5CA 3T6VA 1PNDA 3KW7A 2FT7A 3WNJA 2PLTA 3ZDWA 4KO6A 4A2HA 2BP0B 1ILSA 4YSPA 1AG6A 3PXLA 4HHGA 1BXAA 2IWKA 1IBYA 1T5KA 2TSAA 1V55B 2IDFA 2QDVA 4G71B 4W9ZA 3NJIA 4KOBA 2QDWA 2YAMA 1NIFA 1SHXA 3X1BA 1ZPUA 5AFAA 4E9WA 1NIBA 2XV2A 2IDUA 5D4HA 1OE3A 4RH4A 1A4AA 3AG1B 3X1NA 3EH4B 4HZ1A 4NB7A 3GXUB 3ZX1A 3NYKA 3OD3A 4UAHA 1ET7A 2X88A 2XXFA 4DP4X 1CC3A 1HAWA 1IBZA 1V54B 4YSOA 1AQ8A 2WSDA 2FNWA 1VLXA 3FQ1A 1TEGA 2JXMA 1DYZA 3S3CB 5EHFA 1I53A 2LLNA 4W1TA 3NJKA 2GB2A 1ET8A 7PCYA 1W8EA 4A68A 1XB6A 2CJ3A 1AS8A 1PCSA 1X9UA 1W6LA 3T6ZA 2XWZA 5B1AB 2DY2A 1AZCA 4A67A 1KBVA 2X87A 3HB3B 2XLLA 1KGYE 1ET5A 3MX0B 4AKPA 2GC4C 3IE9A 1A8ZA 1MDAA 1M9WA 2PCFA 3ASNB 2EIMB 2PP9A 2QPEB 3GYRA 4DPCX 4DP1X 4DP0X 2I7SA 3FPYA 1KV7A 4BXVA 2AZUA 3BQVA 4TXVB 2GBAA 1KDJA 3ABKB 4YSTA 3UADA 4DP5X 2BHFA 2MRYA 5A7EA 1E65A 2IDSA 3AG2B 1ZV2A 4KNUA 4DPAX 1AS7A 5I5IA 1CYWA 3IN0A 4PCYA 2BW5A 1PLCA 2XV3A 1YLBB 2FQGA 3TA4D 1WA2X 2VMJA 3PAVA 4YSDA 3TU6A 3FSAA 3FPXA 3ASOB 2UX7A 1XMEB 1BXUA 2XX1A 6PCYA 2FTAA 1ZDQA 1J5DA 4QKTA 5AKRA 2HLEB 3WG7B 2QT6A 2OJ1A 2BW4A 1PZCA 4F2EA 2RACA 1BEXA 3IBOA 3QJSB 4G70B 3EH3B 3TBBA 2UXTA 1R1CA 2BZCA 2DYSB 1ID2A 2OCCB 2YAQA 4N4YB 1MG2C 2H47C 2VN3A 4YSUA 5I6MA 2HRGA 1CYXA 2DWSA 1HFUA 1M57B 1NZRA 4K9JA 2HX7A 1B3IA 5I6KA 1AR1B 4FAAB 2HX8A 1KBWA 3FYIB 4E9SA 4A2FA 4YVNA 3OMNB 4YVUA 8PAZA 2CUAA 4HCGA 3DIVA 1SDDA 4HIPA 5PAZA 3KW8A 4Q89A 1JVOA 4FA7B 2VSMB 2HX9A 2XX0A 2VW6A 5B7MA 5E9NA 5I26A 2OV0A 4JHUA 5I5JA 4F7KA 4N8UA 2YAOA 1JXGA 2YXVA 2PPAA 1URIA 2CBPA 3OMIB 1ASOA 1V10A 1JZIA 3S3DB 1L9TA 1NWOA 1PZBA 3T6XA 3NSCA 1AZNA 5TK2A 3QPKA 1AOZA 1EHKB 2HXAA 5B1JA 3AW5A 1OOWA 4AZUA 2DWTA 3NSDA 3QJRB 3CVBA 3CZUB 1EZLA 1HAUA 4CSZA 3IEAA 3AZUA 3FU9A 1OE2A 3NP4A 2GI0A 1PAZA 3X2QB 5B7EA 4F2FA 4BWTA 3NJFA 1QNIA 1SNRA 4AI7A 5I5MA 1E5YA 3SBPA 5FC9A 4KO7A 3FU7A 4KNTA 3T71A 1JXDA 2H5UA 2YQBA 3ABGA 3WI9A 3WIAA 3TASA 2PCYA 1SHWA 1RZPA 5TK4A 2AVFA 2PP7A 1GY1A 3QJUB 4GYBA 1JZHA 1PZAA 3UGEA 3GDCA 2AANA 3EHBB 1CUOA 2XYBA 1PF3A 2ZOOA 4ZK8A 4DP9X 2I85A 3DTUB 1SDDB 1TEFA 4P5SA 1SJMA
chains in the Genus database with same CATH superfamily
5GGUA 1UQSB 3VXOB 1V3KA 4DN4L 2AC0A 2Y2TA 1OVZA 3V0DA 3UO8B 4MDIB 3SQRA 2XIDA 1WBZA 2HT2D 4GP5B 5ESAB 3UL4A 4G9FE 2CRMA 3MYJB 4KMLB 1IAMA 1BQUA 4V1DE 4YK4C 5EZLA 5DSCA 4Z8FH 2WXKA 3IDGB 3TJHC 1DVFA 4IKKA 1N7ML 5L8LB 2R23A 1A1MA 3SE9L 15C8L 12E8H 1H6TA 1IBFA 5HGDB 3FAXA 3D48R 4KZCA 1MHEB 1OAQH 2F1BA 4P9HC 1DANU 2GIYA 2IVFC 2WCSA 2CWRA 2AVGA 1I1CA 4LPWA 4OUOA 2NY0D 1YEJL 1U95B 1BPVA 2UXGA 3UYOD 4A39A 5DD3L 2A77H 1KTLB 2LOEA 3GZKA 3QUKB 4N8PA 5J3HD 3VWKC 3M8OH 5E95B 1BD2A 4TSAH 2WMPB 4D9RD 3VCLA 4K8RD 3ULVD 1FAIH 5DU7A 3U36A 4LLVB 3EJZD 4Q52A 1Q8MA 1HZHH 5DRZA 4IOFC 5BOZG 4BFBD 2AKRB 2NYYD 2A4CA 2H9GB 5JOFB 3ARED 1U2YA 5IQNA 5C0FB 2EDTA 5BQDA 4NSKA 2F5AH 4YLBA 5CKAA 2BMKA 3FQNB 3KGTA 3UYRH 4OM1L 5I15L 2C7UA 2BWDA 4ZTPH 4BA0A 1DN0A 2QPUA 2V33A 5IHUL 4XI5D 3T2PA 1AXSA 1MVUB 1UG9A 1YCSA 4HK0A 4NQTA 4QXGL 3WUWG 4EI5C 1FPTL 2CR0A 3V4PA 2B77A 3S5LA 3CIAA 2FIKA 3PXHA 5EIIG 3PQYE 1YNTB 4PJHE 2YUVA 4WTZG 5INDB 3VXUD 4KHXH 4XN5A 1BZ7A 5DFAA 2M26A 4QLWA 5D55A 2EEXA 1KFAL 1D7FA 3W82A 2NR6A 2O5YH 3NJLA 3WIFB 5A2BA 3IJHB 4YSQA 3F7LA 4HLZH 2DQCH 4P49A 1G43A 1Z3RA 1Y18B 3QEGH 1O9WA 1OL0A 1FYTB 2I69A 2D7TL 4LIQL 4P5RA 5T3XL 3BUQA 2WYZA 3ENEA 4GXFA 4IBZA 5KTEL 1VSCA 3V79C 3UZEC 5KSAA 5CJXC 4P3DA 1C5DA 3P77B 4LEXH 4Y0GA 3SPCA 5FA3B 1SLVA 4FQHA 1PJ9A 3FQTA 3GKZA 3GC3A 3I9PA 4FTDA 1K5NA 5FYKD 4B60A 3OZLA 4M93B 2J73A 3D85D 4JKMA 1A6ZB 4AZ8B 3JTTA 2DI8A 2DYPA 3HAEB 1CIDA 1K5WA 4MD5B 3CN0A 4HHAA 2NPLX 4HS8H 1ZHLB 4P46C 4OGQC 5J8OA 3RFZB 3UDWA 5I1JH 3CXDH 1WITA 1TTCA 4RDBA 4FZ8H 2FD6L 4P2QD 3C6LD 4HJUA 4RLDA 4XPTL 4WI8A 1QBML 3MOAH 1JK8B 4X8GA 2VAAA 5IROC 3DX7A 2ESVA 4OLXH 4HPYL 2Q9OA 1QPPA 3FUJA 3LRGA 2E6QA 4HUWB 1JHTB 4JZJC 1IZKA 1HXYA 1WVZA 5D4JA 4YX2H 4Z7OB 4LCVA 4JKNA 3PWPD 4BEIA 1DJSA 3TWYA 2C9PA 5B3SB 2IADB 4XPAH 5HYIA 4BUGA 2ZQKA 3LNDA 2AK4D 5I23A 1ZIAA 3FTZA 1NFAA 1PPIA 2W07B 5C70A 3AU1B 2V9UA 3QUZC 1ECZA 2PYEE 4XNYH 3TZVA 1R3HB 5AZ2L 2HLFC 4P5MA 3ESNA 2A99A 4H0GA 1LYQA 5CCGE 2B1AH 4OLYL 3IDXL 3Q48A 3GNML 3OKMA 1BIIB 1CZ8H 5T1LB 1MNUH 4GINA 4HUNB 2NRDA 4GQ9H 3ULUH 2XN9E 3QCVH 2H26B 2VDQB 4JEGB 3X12B 4UT6L 5IFHL 4OAWB 3RBGA 1LP9B 3RE0A 4QTIL 3QISA 5J13B 1G7HB 3GUFA 1J9QA 2BOCA 3FF8A 3M6DA 3QZWA 1U58B 3D25A 3O3DA 4OGXL 4KJWC 3RB5A 4KUCD 3DARA 2EJ1A 1JNJA 3HG1B 4JHAH 3FN3A 3TP4A 1YEDB 3ILPB 2DB8A 3QIBC 5DJDA 2IH9A 3OQ3B 5BS0D 1ASPA 1KJMB 1U8KA 4IK6A 4WK4B 4L1LA 1KIRA 5JPMC 2QQKH 4OVVA 5E00B 5EU3B 2X42A 3TBVB 2RH0A 5EORL 3ZKND 4PRPD 5HI5D 4NLAA 2ZXCA 4OD2A 4PLJC 4BKTC 4ZS7L 3MNVB 3IXAA 1MY7A 1WFNA 3RWDA 2Z7UA 4WNQB 3LNGA 4HS3B 5K9QG 3L5IA 4KI5C 5D7LB 3PJSA 5AZUA 3KPRB 4LRNH 3DDFA 4WU5B 5IB3B 4K0OA 5GGQL 1QVOA 1D6VH 3C08H 1WCBA 2KBGA 4MA8L 4JVUA 3OKNA 4CMHB 1HILB 3F8UB 3P9WB 3TXAA 5C3TA 4IKJA 3FB8B 3KG5A 5JIIA 4K3EL 1M1XA 3RNQA 3ZE2F 2IDTA 2YSSB 4YDIH 1KTRL 5A2IH 3BPLB 3ARDA 2XCMC 3H9SB 1XGTA 3D2UD 2PW2B 1GMIA 4NQED 4YFEA 3H56A 3OKOA 3F01A 4FQQA 3T0ED 3F7YB 2N56A 3FMGL 1JZ6A 2MHAA 3ZBMA 4NQDD 3FBKA 1DQJA 2DJSA 4LHUA 4NN5B 4AH2B 5I6NA 4QT5A 1J05B 3IU4L 1PNDA 2ZX7A 4LVOB 2F7IA 2YUXA 2OP4L 4OZ4B 1CGTA 2VZTA 4JO3L 3MX0A 3RTQB 3WTSA 4FLHA 3WN5A 4DK6A 5JHDD 1HHKB 3GZQA 1LLAA 4Y4HB 5GXBB 5JHMA 5F9JB 3CH1A 4OSUH 5KWYC 3ARTA 3MCLH 4POZC 3IYLW 4AITA 4GO8A 1AVAA 4GQRA 4N28A 1NIFA 3AWFA 1PSKL 3ARPA 4YL9A 3QXDB 3HS0A 3O81A 1MCRA 4GO9A 2YBRB 5D1ZD 1V7ML 5HHMB 5BJTB 4GG6B 3O6FB 3BEVB 1A4AA 1E0OB 5J11B 5FB8A 5ETUB 5HYQB 1ZK9A 3MACH 4FRWA 1ET7A 2ZUVA 3IETA 2JV6A 2V2XB 5CWSA 3CBKB 2Z4QB 3RA7H 5JLZA 3DMMA 5DLML 4Y4FB 1HL4A 2BNRB 2YD7A 4PJDF 4ZUTA 2DI9A 1ZLUK 3RZCB 4CC0A 4AEFA 2ZIDA 1Q0EA 2H1PH 3DI3B 3EJTA 4OJFL 4M6ML 5DEFB 4D2NA 5GGRA 1T6BX 3OSKA 1BLNA 1T1XB 1J8HA 3QFDB 3LKQA 1DYZA 2HVJB 4Y8DC 3V0JA 3FF7A 3I84A 4EDWL 3ESMA 4ZUUB 5GRJH 4CDGC 4U0RB 1X4YA 2CIIA 2R69L 5K9KB 2R2HB 2BH0A 1E27B 4Z3HA 2MCMA 3BIKA 4J3OF 2F2HA 2NY4D 4A67A 4GIOA 3JVGA 4XCEB 2P26A 2N0KA 4FJYA 1OF2B 4X7TB 2Z31C 4AIXA 1SBSL 2WXHA 3B2VL 2PCFA 4DGVH 5I18L 3Q44A 5JXAH 2I7SA 1VACB 4X7CC 5FUCE 4M8QB 1VZHA 5D93C 1QPKA 3O4LE 4NI3A 1GIGH 3FHAA 3KPSA 3QW9A 4X6FB 3VFRA 4C4KO 4C4KT 4I87A 1CDYA 3HC3L 3R4RA 4KTGA 5CUSH 4O2FA 4JM2B 4JZNA 2X0WA 2Y07L 3F65A 2OCFD 3BLBA 2A6DB 4U1HB 4XXCA 2WXQA 4XBMA 4AQ1A 4NJ9H 1HESA 4YSDA 4F20A 5DC9B 3QZMA 2APFA 4EIGB 5LBSL 2UX7A 2HRLA 3L3KA 1ZLVK 4G6MH 3OB0K 4NWTH 1M7IA 2BSSA 4MKTA 5GGTH 4A38A 2VLJD 3P4OA 5H4ZA 2ITDA 3BIBX 5DVPA 5GS1C 3D18B 3K0WA 5F1IB 2FO4B 3S88H 3L95A 1R3KB 5JIDA 2NW2B 4X9BA 3QE5A 1IM9D 3KH4A 2XICA 4BBWA 5DO2C 5MERA 2AJVH 2W9LA 5ES4B 2QGEA 3BUIA 3CU7A 5F6IB 4K2UL 4YQXL 4L5FL 4AM0B 3Q05A 1MRFH 3FH8A 1XIWA 3U48A 1AGFA 1KXHA 1MJUL 1UXLA 1JWMA 5EV7A 3AY4C 3ZE0F 1EZVX 3GXIA 1U8QB 3RU8H 2AQTA 3QP3A 1YEKL 5E7FA 2W59A 1EVUA 2EEFA 1ZGLA 4U3SB 3V6BR 2YC1B 2X3CA 4HH8A 5AB2A 5E6IB 4EO5A 5BZWB 2MMXA 4AL8L 1INQB 3KMDA 2CRYA 3LEYL 2Z8VC 1L5GB 3VJ6B 5I73B 1A6VL 3W5MA 4XP1H 5I5JA 5AVZB 4BUQA 1Q0XH 1A0QL 4KPHL 4NBXB 1JXGA 2OLDA 4OM0H 3WHXA 3LZRA 4C4BA 2CR6A 1C5BL 2YUZA 4F5CE 2XG5A 4JUTA 4Q9BA 2BSCA 3QR1A 1X7QB 1FZJB 1L9TA 2EDHA 3DHUA 5AUMB 5I5RA 3OHXB 4LGPB 1G7JA 1F11A 1QBLL 5IB5A 5C0EA 1BOGB 1CXEA 3I3EA 3RIFK 3V6FB 1EX0A 4JFWA 1KIPA 3DGCR 1CFBA 1CG9B 9CGTA 2DL2A 5C7ZA 1H3PH 1IEHA 1OTUC 5FGRA 5EN2B 3QEQA 2ZAGA 4FQJL 3A6BH 3GBLA 1LO4L 3FU9A 4FXGC 3RWGB 1KCRL 1YRKA 3QZOA 3CFTA 4LSPH 3A4AA 3UYPA 4O4YL 1QNIA 4Y9FA 2HTLD 3E6FA 4UQCA 1E5YA 1XH1A 3FCTA 3FONA 4Z3GA 4O51A 4XO9A 3MV7D 2XWDA 3PWVB 5AW7B 3F2LA 3ETTA 2OXGB 3KPNA 4X6DB 2OTWB 5LNEA 3SOBL 4N2HA 4LNRB 1OM3L 5EU6D 4WWNA 2XDHA 4LPUA 1YSOA 4YDZA 1MVYA 4AYSA 1HC1A 4PB9H 1I3GH 5D5ME 3P9LA 3AT9A 1DSYA 1QRNB 4FNPA 2M1KA 2JKSA 2XVGA 4NERA 3FFDA 1BAWA 1J1XH 5K1VA 3C6EA 1F45A 4M7LL 4PVLA 5JMRA 4KXAA 3B9KD 2PW1B 4ZPVA 1H8NA 1N64H 3HRZA 2ZKXA 1JRHI 5F7NC 4G8IA 1E67A 4S1QL 4NQCB 2VSKB 5TQ0L 3FS9A 4OZGF 5LVEA 1OV8A 1QG3A 4G80A 5F9WC 3RKPA 1JCKA 5B4MD 5FKPB 1L6XA 3BESR 2YARA 4XWOC 3HI6L 5GGSA 5JHLL 5LDUA 5AL8A 5DGQA 2COVD 2OL3L 1G9EA 5MENB 1I8LC 1IAIL 3B8YA 3N42F 5C07A 3BDYL 5HPOA 4G7YL 1GGBL 1N3NB 4FFWD 5IF0A 2WWNA 1QFPA 3KYKL 2H3XC 4WZ9A 2VITA 1OM9A 4DP7X 3FT0A 4EF3A 2B5IB 4HU8A 5BVPL 2AQQA 3B5GA 2AJUL 3RKDC 5IHZB 4GKNA 5A2FA 1BM3H 2J56A 4Q6IB 3SSGA 4E9YA 3BRGC 2K8QA 3RILA 5CHNA 1VDGA 2XFXA 2PWHA 3VFTB 4L3ED 1SLXA 3EF4A 1XGPB 3O6KL 5A2KH 2EUXA 2JCCF 1DQML 1ETZB 3QUYA 2VLMD 4KK9C 1JK9A 3DPBA 3K8LA 4UU9A 4WDIB 5EBWB 4F37F 1BF8A 4GLRI 3EO9H 1AR2A 4LSRH 5I0ZA 1BXVA 5GGUB 3KVPA 1CL7I 3QG6A 2F15A 4QHLA 3VG9C 1SQ2N 3B37A 1T20A 1WBZB 1OWWA 2WV3A 3S4SA 1GR7A 2GY7B 4DP2X 3B34A 4KROB 1LEGA 4YHLH 4R97B 5EZLB 3OL2A 5DSCB 4OCMC 5HP5A 3BPLC 4D3CL 1O5DT 3JZ7A 1IL1B 3TV3H 4F7MA 4EUPH 1DVFB 4BHUI 2R23B 1A1MB 1ZDSA 2XWEA 3OLDA 4PJ9A 1IIKA 5IJDC 1G4MA 1PZDA 3MZTA 1PMYA 2NDFA 2YO3A 4OFYD 4RQQA 4XN7A 1AHKA 5AVWB 1NPNA 1TF4A 1H3UA 4OV5B 3SGJC 1GS7A 1P5UC 3LEXA 3RNKA 3UTTD 5LGJA 2OK0H 1QFUH 2X4TA 2XZCL 1XXFC 2C3VA 1MJJA 3C9NA 1DLHA 3ZHNA 1EEYA 1BD2B 5A16A 1N5YH 2H1LM 3VCLB 2WO2B 3GSOA 4XB3A 3OXRA 1HKLL 2NXYD 4AGLA 2DQUL 1HHJA 2WOBA 1FGNL 1IC1A 4RZCA 4YDMA 4B9GA 5IWLC 1PEWA 4BZYA 2YPLD 5DRZB 4AGQA 1ECYA 1F58L 4LGRB 5DYFA 3FSWA 5D96C 3HE6D 1HIML 1GZQA 1MVFA 4I77L 4NSKB 4R8WH 5DHXB 4LBEA 5F7MC 2V8LA 5J11C 5HHVL 3WFCH 2C7UB 1F42A 1DN0B 4Y1SA 2DDQL 4B50A 4BFOA 2EXTA 1AXSB 2EZ0C 4HK0B 5DHDA 4I7ZC 2EYSA 2B59A 3NIGE 4CAGA 3V4PB 2A6JA 3S5LB 2FIKB 3IAGC 2EINB 4LCWD 5E24E 4P9HL 5SX4I 2OKMA 5T3XD 4DETA 1BZ7B 3SE3A 3DJRA 1SXNA 3CJJA 2ATPA 2D0HA 4P2OA 2X2IA 1S7VA 1X5HA 2CR3A 2EIJB 3NIFB 1NCUA 1G9NL 1NAKL 4CN4A 3BVDB 3VW3L 2HT4C 5IK3A 1K4DA 5HI3C 4TLTA 5KS9E 5LWYL 5JIPA 2HA1A 2ICCA 1II4E 4IMKC 4XR8C 2Y22A 3CX2A 5KSAB 4P3DB 1C5DB 1Q9KA 2O5ZL 4JFZH 5I28A 4ZJ9A 4QNPF 4FQHB 3IN2A 2ZCHH 3FQTB 2VWEE 4E68A 2EADA 4LCIH 1K5NB 2F53A 3H6AA 3CFJA 1GYUA 4M7ZB 4XVUC 5IQMA 3EH5B 5DURB 2E46A 3JTTB 5EBLA 2DYPB 4AYDC 2W9DH 4RFNB 4HHAB 2YS4A 3ABZA 3O6ML 4BCZA 3MLUL 4X4XA 4TVSa 3GPSA 4B9IA 2ED8A 3C2AH 1UC6A 4PS3A 4PJIF 2G4EA 1THCA 2ERJB 5T3ZH 3IKCA 3FCUB 3U7AA 1BDYA 1NMBH 4BYHA 2HJFA 2VAJA 5F1OB 3G9AB 4NWUH 2R4SL 1GVIA 2VAAB 2PCPA 5D1XC 3LB6D 3MRLA 3DX7B 2ESVB 4N68A 4XH2A 4KZDL 2E7HA 4OCSH 4K5LA 5DEZA 4L2LA 4XO3A 1J0IA 1HXYB 2JKXA 4L9DA 3KJ4B 3BAWA 4OLVL 1RUMH 4PN6A 3SQOL 2DMGA 3WIHL 4WY7H 2SODB 1KTDA 1AE6H 5ELIA 4QO1A 3DO3A 1V7NL 2VDMB 3JYBA 1YEFL 5PCYA 1KGCE 4G11A 4A2DA 5TE7H 3KLKA 3TZVB 4BH8B 5FV2A 1B2WH 1DJHA 1KPVA 4H1LH 4XWGL 4PWHA 4OCWH 2GJJA 1UT9A 1FL5A 3OKMB 4ODVL 4MHHG 5B22A 3ZZQA 5D1QD 1ZXKA 2XETA 2KPWA 3SE4A 4TVPL 3MUJA 1RP8A 4YAQA 3ZU8A 1PY4A 4LFHG 4RETB 4KXCA 2KUTA 5DZJA 3O3EA 2YKLL 1GPOL 2BOCB 3MKGA 3I85A 5H94A 3WNJA 3QZWB 2JI2A 3D25B 3DX8A 3EJCA 3BT2L 3O3DB 1GYAA 4HJSA 5I75C 3OLEA 1ILSA 2M83A 4QRBA 3L3DA 5FLUA 3BD4A 1W15A 5J12B 3OB8A 4LOUD 1KGIA 3RY6C 1TTAA 4OZHE 2AJXH 5DJDB 4UTAL 4GQZA 1E8ZA 4QOKD 2QDVA 2V6HA 4G71B 1U8KB 4HV8A 4U2ZA 3TCLA 1SHXA 1KIRB 2AABL 2F8VA 2ZUQC 4ZI8A 1BOYA 1LWRA 2EH8L 4OD2B 2VDPB 3BAJA 3IXAB 4KAQH 4J3OC 4RH4A 3CLWA 3RWDB 3S9DB 1MFNA 4Z7VA 4H8PA 2Q8BL 2F7RA 3PJSB 3UCRA 3UO1L 1X5KA 3D6GA 1GGIL 3NYKA 5AW6B 4HH9A 1U3JA 1Q90A 1WCBB 5DHVA 3OKNB 2WXIA 3UAJC 3I74A 3MFFA 1S5HA 4KGJA 1UTDA 4JE4B 4KTEL 4M1CC 1M1XB 4XAWH 3QEQE 4PD4J 1DFXA 5EHFA 3FT1A 4ZFQA 3L3GA 3ARDB 5C1MB 1C7SA 1YY8A 5C0ND 3IAPA 2XNAA 1NM9A 1XGTB 4PRAA 1ET8A 1MWAA 4YIQA 2R2EA 3EDJA 3OKOB 4FQQB 4LSSL 2EDNA 4JRXA 2MHAB 4YE0A 1AS8A 1PCSA 1DQJB 4LHUB 4LU5L 4NGHH 3ARGA 5KJRH 4FA6A 2CGRH 4QT5B 4HGMA 4NZJA 1CICC 5LBGA 4OD3L 1ET5A 3MX0B 3UJJL 4TSCH 3S3SA 4XNZB 1A8ZA 4O5LH 3E6HA 3WN5B 4MNGA 4DPCX 2VM9A 1FC2D 3C60A 3CH1B 5F96L 2YK1H 5SWZA 2CRIA 1SUHA 1S3RA 2OR7A 4ADIA 4UQDA 2XIIA 3SEPA 3UADA 4DP5X 3RHWF 5HXMA 2J12B 3WJJC 2NXZB 4XGZA 4CU7A 4TULH 3IPFA 4HGWA 3HFMH 3VSTA 4F58H 4W6WB 3LPGA 3HS0B 4FOMA 3CVIL 1R3LA 2DMBA 2QHLA 3L3OC 4XTRC 1CMOA 4PCYA 2BW5A 1PX4A 2CKBH 4JRYE 3BVUA 4Q6IC 1R19A 4CC4C 5FB8B 2PUQT 5TF1L 3LNEA 4FNLH 4WQOA 2QKSA 3ASOB 3IETB 5EOTA 5CWSB 5JLZB 3DMMB 3DSFH 6PCYA 4O58L 1RIUH 4LPTA 4ZUTB 3WY1A 1U6AL 3BJ91 4O9HH 4AW7A 1IFHL 4QXVA 1UA7A 3NSXA 2F0CA 2PWGA 3OGCA 2VMFA 5GGRB 1BLNB 2YLHA 1J8HB 3LKQB 2VC2L 5FLVA 1P1ZA 1JPTH 4N4YB 3FUMA 5A2JH 4XPBH 3F7QA 5TGBA 2CIIB 1BBDL 4QRRD 5F9DC 1AZVA 3MMEA 1RIHH 4I13B 5EPMA 4M6OH 4H20H 2ZX8A 3BIKB 2HX7A 5GHWL 2ZP0T 3MFGB 5E1AA 4D7BA 1X5LA 1OAZL 4HUKB 3QJXA 4GBXD 1L6ZA 1U3HA 4YVUA 2YRLA 3UJTL 2PCFB 2A73A 2I32A 2AXGA 1A7QL 5FW7A 4HOWA 3KZ8A 1ZTXL 1UXMA 2YHGA 1CBVH 1MAML 3SE9H 1SBBA 2Y6SC 4BRJA 5ADPH 3MLWH 3KPSB 3VFRB 4TRPH 7FABL 4WWKC 1RHFA 2R4RL 5E6SB 2FRGP 5EDXA 4O2FB 4JZNB 4FFYA 4MJIA 2PPAA 1ZJAA 4H8HA 1N9PA 4KKAD 2PTVA 1R3JB 3WIIL 4AQ1B 2EAEA 2K78A 3C5XA 2IQ9L 1IGYA 2CCLA 3CK0L 3D50A 5DD0L 1DO5A 3U4BH 1AKJD 4LRIC 4IGBD 3L3KB 5GRUL 1M7IB 2BSSB 3P4OB 3IVKA 3JWOH 2ITDB 3OAWA 4XMKL 4FNTA 5F7YC 3S34H 4IOSA 1XQ4A 5IM7A 4PREA 5DS8A 4F15C 1RZ7H 5HHXL 3SJVE 3KXFE 3UPCA 4IRJC 3L95B 2QSCH 3QI9D 3FUDA 3NTCH 4MZRA 4ZRGA 4PJXF 2AEQL 1XGZA 5MERB 4KX8A 4WW2F 1J0ZA 2HJKA 3QO0A 3VVWA 3VQ2C 1G1CA 1XIWB 5EOQL 2E8ZA 1AGFB 1HI6A 2NR6C 2I07A 1TJIH 2ENPA 1DQDL 1JWMB 3QQNA 1YG9A 4LDOB 4QXGH 2AVFA 1S46A 4FZEL 4DN3L 2V3EA 3WDJA 2XY2A 3E9TA 2DWEA 1ZGLB 2VKXA 4DP9X 1XD1A 1JCVA 5IUSA 5GGVY 2E7CA 1H3VA 1FE8L 4HS6A 1KFAH 2CPUA 1NFDA 2KDYA 1OCWL 4U2YA 2K6ZA 1JFHA 4IDLA 4YSSA 4N2MA 3MUY1 5FGBA 1AZBA 3WHXB 1CU4L 2DQDL 3DBXA 1CFSA 1QX1A 4M7ZC 4W81A 1KCBA 1KB9K 2ZOWA 4MQSB 3GRWA 4HWZB 4KRPC 3NG5A 1EO5A 4OLZL 2ETWA 3QDJD 1G7JB 1F11B 3T0DA 2FUQA 5C0EB 4BSWA 1D5RA 1RZGA 4F8PA 4NT6A 1KIPB 3UDWC 3FU3A 5C0RH 4NUPA 5KANI 4DTGL 5LGYA 4OQTH 4ELMF 4PJGF 4WNJA 1TQCB 3QEQB 2PO6A 4K15A 2VR4A 2GY5A 2CO4A 2NY5L 4J8RA 1JV2A 1U93A 2XRAH 3U82B 2C9XA 4S1SL 1F5WA 3TA3A 3UYPB 5CFAA 2YOAA 4XP5H 1TYEB 3E6FB 5DD5L 3FCTB 3FONB 1EEUA 3FQUA 4O51B 1RLWA 4GUOA 1HEHC 3FL7A 25C8H 3KJ4C 5HSFA 1IM3A 2NY1D 4ENEC 4Z7WE 1F3JA 3QZNA 5GS0L 3KPNB 3Q43A 4LQFL 2IV8A 1RUAH 3LXUX 3LKOA 3MJGX 3LAFA 3U7WL 1ROCA 3IJEA 3VB9A 1AG0A 1N67A 3OM3B 2AEWA 4PW9A 2VDNB 5D7EA 1XF2A 3P9LB 4G3YH 4QRQA 5DMYA 4P57A 5AVYB 1X9RA 2FH6A 3K2KA 4NO5A 4TN9A 1AR1D 1NAMA 3FFDB 2XWXA 3WOVA 4HJ0D 2NY3C 4UOJA 3LMJL 1OAKH 3WHE0 5TH2A 4DKTA 4HD5A 5CIPA 4FG6D 3UG5A 4ZPVB 3VWJC 1C7TA 5KSBE 3NCFB 4MCZA 3HRZB 3PV7A 4N26A 4XXWC 3L1FA 1S7XA 4XP9L 4G8IB 3JV4A 4UUJA 1OARH 1A3LL 3TEZA 2IBBA 2CNZA 4OLYH 4B9KC 1GSKA 4YC2C 3WTWA 5C0AD 4G80B 2VDLB 1AHWC 3TTYA 4FL4B 5GGSB 4P07A 1V05A 3VX0A 4JCMA 3KLSA 2IAMA 5ITBL 2XHNA 4EI0A 2HTKC 2P5WE 2QQNL 4NQVA 5C07B 5J12C 3KL5A 5AVTB 3BOVA 4NCC1 4DPBX 2GIXA 4DF9A 3RX7A 2WO3B 2JB6A 1NC4A 3BXNA 4Z7UF 2VITB 3E1ZA 4K7PY 1WTLA 1KN4H 3L3HA 3MA9H 4WTXA 3QG7L 4GKNB 1VFOA 3C5ZA 2IH8A 5CHNB 2XFXB 1NBCA 4M5ZH 2VR8A 3D9AH 3QUMH 1NBZA 4Y2DD 1HT6A 2IPUG 4BD4A 3PYCA 1GMEA 3SDDA 3O8XA 3OVUB 5FFGA 1NGWA 1EDHA 3QUYB 4UU9B 1JK9B 3DPBB 4APQC 2WXNA 1IC5H 4N86A 5IW3A 2L0DA 5I2IA 1T2QH 2AP2A 2H7WA 3QG6B 4OJDH 4QHLB 1T20B 1UGNA 5CJ8A 3S4SB 1NL0H 5J89A 5C3IA 1LEGB 5BRZA 4UZUA 1E40A 1Q0YL 1F4XH 3BN9C 2GQHA 4PJ9B 4AV5A 4YHIA 1A4KA 1Z32X 4BGLA 1J0HA 3SKNA 1PLBA 4HUCA 2ZOUA 4U3CA 2YQ3A 2YWYA 1H15A 4L8SA 4RQQB 5GPRA 5KYNA 3BUPA 3ZUCA 1ZHNA 3Q3GA 1N2RA 4LCUA 5AQ0A 2VR7A 3PL6D 1LMKA 3VD0A 5SWSD 5IB4A 3LEXB 4XCNA 3RNKB 5GRYA 5LGJB 3W0WE 1WAAF 2X4TB 4XP6L 4TOYH 5D71L 2C3VB 1MJJB 1KTJA 1DLHB 2B16A 1QSFE 2ZYIA 1EEYB 3C9NB 3DLQR 5DYOA 2V2TA 5DJ6A 5A16B 3G6AA 3GJFA 3GSOB 4JFDE 2ZOLA 3OXRB 5H2BA 5JOEA 1M7XA 2IPKA 1HHJB 1NUNB 2EYRA 4RZCB 4XMLH 5DJ0A 4H25A 4I0PA 1T0MA 3TJHD 5C7XH 5I8EA 2NW3A 2YLKA 4C4UA 1JGUH 1BVKA 2NQCA 4Z3EA 1KYUA 5CM1A 3DX4A 2JIXA 1GZQB 4E41E 5EUOA 4LBEB 4JN1H 2F18A 3U2SB 1TSHA 2O26U 4JFED 5DMGC 1TDQA 3WY3A 1RIVL 4Z3JA 5L2KA 2X41A 1DR9A 2DWDA 4JANA 4I3GA 4QJ3B 5CZRA 4ZUWA 4MD0A 3ZDXF 2UX6A 1HCYA 2QVMA 5KVGH 2EYSB 2B59B 2J21A 4BFKA 1FAKT 2A6JB 3FKUS 1SF3A 1S9VA 5GZNC 1MCCA 3TBCA 3DKHA 4PJEE 4Z78A 1VFMA 4HOMA 2ATPB 4P2OB 1S7VB 3SYOA 3NZ8A 3AB0C 3H2PA 4FQXD 2OSYA 5AKTA 2CSPA 2Q8AL 4IBUA 1A5FL 1ZA3A 5BV7C 1TPXB 1WZAA 5IK3B 1K4DB 3CSPA 4LO9A 3PPSA 4EDWH 1LMIA 3BWUF 1T03L 2WNKA 1UCBH 1X4ZA 4JQXC 1Q9KB 2VLRD 2ZPKH 5C09E 2ATAA 3RYMA 4JDVA 1YNTF 5A40E 1NINA 4XNUH 2F53B 4LSTH 3WNIA 1CPUA 3CFJB 3GI9H 4JKPL 2X6BA 4HLJA 4WTQA 5EBLB 2IBZX 2IQAA 1QP1A 3T1WA 3FQXA 1NANH 3BPNC 4DKEL 1XMWA 1GJIA 3KEDA 3QWNA 2FLMA 4X4XB 2XOTA 4AV0A 4NO0A 5LGHH 3P11H 4U7MA 5IBTH 1N6QH 1LO2L 5DC2A 4UTBA 2XKNA 3K6SA 2Z1PA 2VLKD 3PRZA 3JZYA 3IKCB 1A6UH 3VH8G 5DJ8A 1THAA 2HJFB 4OW6A 5F1KC 1KTCA 1SRDA 1BXAA 1OGAE 4APXA 2PCPB 3MRLB 2XZAH 3F7KA 1V55B 4XH2B 1PBYA 1HE7A 43CAA 1QFOA 4DK5A 4MLIA 1RMFL 1A6WH 1G1YA 3V4VL 2XZZA 1PG7H 3KR3H 2IOMA 1UWGL 3DETC 1KTDB 4DZ8A 1FFRA 1XIWC 4QO1B 5LUMA 3QNZA 3QUXC 2BSED 2ZUSA 4TVPD 2YXFA 4NBZB 3WFBL 2X88A 3WNOA 4F57L 5CF3A 5EDSA 4U6VH 5DUML 5INCA 4ATWA 1D9KC 1IAKB 1KPVB 4NN7C 2D3VA 1FL5B 2ZUWA 5FHBH 1DQVA 2QHRL 1WISA 2WSDA 2HKHL 1T7WA 1BF5A 3L9EA 4FHJA 3U2JA 5IROD 5K33A 3OKKA 3RDTA 2C4FU 1A6PA 4GW1A 4ODSL 1Q94A 5F0MB 1MHCA 4CVXA 3TF4A 4AGPA 4YAQB 1S7QA 4OZIA 4FLSA 1WZMA 1E5UI 2FNBA 1TCRA 5FM5M 2EIBA 3VXRE 4AL8H 3O3EB 3PNWA 4FMFA 2NNCA 4IKLA 5FHAL 4P23D 1MRDH 4X9FA 5H94B 1UXSA 1PW3A 3DX6A 3QUZD 5DVMA 3DX8B 4PRHD 4J3BA 5T33H 5I30L 3IPEA 1MDAA 3K3QA 4MAYC 3VXUA 5D2NE 3L3DB 2DQEH 1OAUL 4HQQH 2HFFA 2RFXA 2TRYA 2BSDA 4HV8B 1ZV9A 4YZFE 1ANUA 2VZUA 2BNQA 3TCLB 1MQ8A 4JM0A 1E65A 4DPAX 2EDEA 4AK1A 2WY3B 2B1OA 1CR9L 2Y36L 3GBNL 3HJEA 4Z7VB 1TQVA 1XXDC 5I1HH 3FPXA 2IWGA 1KENH 4HH9B 3WSQL 5E2VL 4XCFH 5L88L 2B8OT 3WUWA 1PZUB 4JFDB 2OZNA 1S5HB 3MFFB 4BQBA 1BM7A 1W80A 3QHFH 5EIIA 4WTZA 1BEXA 3QIBD 4WENB 1LVEA 4G1EA 5D7KD 2YD2A 2DYSB 3L3GB 4KH2A 1YY8B 2XNAB 4G1MA 1NCTA 4PRAB 1UD5A 1MWAB 4YIQB 5I6MA 2R2EB 1CYXA 4WIQA 1L9NA 1XHHA 1D7BA 2ZCKH 4JRXB 3LH2L 1UB6A 5J1TC 3C6LA 1J5IA 5GGRY 1VJSA 1DDHA 2FB4H 3ARGB 3MBXL 3NPSB 3RGHA 3ARVA 2FSEA 3OWEA 5LJYH 3JV6A 3D0AA 1FL6A 2ZKHH 4FL4C 1RP9A 3E6HB 5DEGA 1OZTG 4MNGB 4BV1A 3R1GH 4HIPA 4DUWA 4JGMA 2A4EA 3TBTA 2HG0A 3GDBA 4Q89A 3PWPA 2XX0A 4PJEB 5SWZB 5ACZA 5E1IA 4PHZA 3BFWA 1FUNA 3NBNA 1E6OH 1F6FB 3REWA 3V2AR 1W0VA 4MQ7A 4G7VL 3ISRA 2AK4A 3ECBA 4NCC2 4XGZB 4HGWB 4OLWH 4ZAKC 3HI6H 4MJ4A 4NCDA 2DKMA 5FWRA 4WW2C 1V10A 2CZNA 1R3LB 4WUUE 2CBQA 5I1LA 1M2VA 4YHZH 3DX2A 1IQWL 2YQGA 4OIIH 2J1KA 2LR4A 1NSNL 5L4JA 3AW5A 2IG2L 4YLQT 4CGUB 5HYJD 3NSDA 3WKYA 3WFZA 3LSOA 2FX7L 3L5WA 4PJHF 3V0AC 3VFVA 1J8KA 3SYCA 2DWYA 3AQDA 3LRSA 1KIUA 1BFVL 3OGCB 3BE1L 1XF3A 4B95C 3BSZH 5KYWA 2Y6TE 3VSQA 4XMTA 1PVHA 4G6JL 2YR3A 1ZHKB 1JZ2A 1P1ZB 3Q5OA 2CHZA 4ZFGL 3TCXA 5B8CC 1EK3A 4K94C 5TGBB 1DQMH 2GG1A 1ETB1 2Q1EA 3MMEB 2WQXA 3MV8D 4FYSA 5EPMB 4KO7A 1Q1PA 4E36A 3IMTA 1KELL 5AALA 2H5UA 1BMWA 1OGTA 2PCYA 1CDBA 3DO4A 5E1AB 4ZOCA 1VA9A 4G6AC 4PCSA 1U3HB 1N10A 1QEWA 3KS0J 5KVEL 4EUPG 3L08A 4G82A 2A73B 2AXGB 4OY9A 1TO4A 4TYUA 3KJ6L 3DTUB 2F8OA 4FTVA 2K6WA 4QTHA 5D7JA 3N1FC 3K4AA 1NUDA 1D5XA 2E9WA 3JBG7 3O6LH 4YBHA 4CADA 1ZAGA 3FQRA 4HSQA 3VXSA 4MJIB 4PS7A 5KVFL 1XAKA 1BMGA 1XZWA 4R4BB 4XNXH 4W9EC 5BRZE 4M7JL 1XT5A 1IGYB 3K5RA 4JY5H 5IVZA 2ENQA 2XZCH 4LL4A 1XL4A 3ALWA 3N1GC 4KHTL 3V4UL 1X5JA 3CPUA 2X28A 2RQ8A 1DLFL 4UAOC 1UFGA 2YPVH 3I3BA 1FGNH 3IVKB 4M48L 5C6WH 5HJ3A 2NSXA 3D2UA 1F8TH 5IM7B 4PREB 5DS8B 1NOFA 1OP4A 2J1YA 2G60H 4F8OA 3T0EA 4QHKJ 4Z6AT 2PR4L 1P9MC 1MHPH 4NQDA 2VZOA 2UWEA 35C8L 5C08A 3QGVA 4S11A 3MXVH 4FMVA 3UTPE 3GD1C 3LDBB 3CDZA 4KKRA 4AGNA 3VXQA 3GS4A 3QO0B 3X13A 3WO4B 4WHDA 5KVDH 5JHDA 1HI6B 1NLBH 1OT1A 2I07B 1C12A 2H2PD 5FS5A 3TIDA 2KQMA 1CFVH 3HMWH 1NPJA 2AJYL 4R5VA 1UEYA 4IBQA 2W9EH 2DWEB 2OSXA 3ATAA 3GSUA 4UT7L 2FQFA 2BNUA 3Q9QA 4N2LA 3BUYA 5FYJL 1RUQH 1J12A 2D3NA 3E8VA 4HS6B 3VGDA 1JIBA 3MJWA 2JKIS 1NFDB 1LO0L 5I76A 5L7XH 1P7QD 1DL7H 1BQ5A 4M1DL 3RP1A 3UC0H 2F54A 1SEBA 2WOYA 3D12B 3HE7C 3QAZC 1G9NH 5CJQH 2IGFL 3EBIA 4YE4L 4AEHL 4NNPH 1JV5A 4AGMA 1DQLH 2F8IA 1ZLSH 2YRBA 3DBXB 1CFSB 1F86A 4GP4B 3ZMNA 3SKJL 4X6CA 1EBAA 3ZDYE 1KPRA 1OANA 1DO6A 3WXVL 4P0DA 1G94A 4BSWB 1RZGB 1D2PA 3H54A 1FFNA 4NT6B 1MQKH 1K6QH 3MPCA 5IQ7L 1ZE3C 3CVCA 3F3HA 3O4OC 2YD1A 5JW4Q 5GS0D 3TH4T 2PO6B 3H4HA 2R0ZH 4JFPA 2R29H 2WANA 5C0BE 3TX4A 3LH8A 4J8RB 2AQ3A 1JV2B 1L7TH 5I6XB 3MU3A 1U93B 2QFPA 5JQIB 2WQRA 1JSYA 3R19A 2A4ZA 4FEIA 3TA3B 1TZIA 4OBRA 3RUGA 3WLBA 1KG0A 5IVXE 4DUXA 1CK0L 3FQUB 1E4KA 4I3RH 5EEUA 5FW8A 2ZAIA 4N90E 4N2DA 1IM3B 4MRBA 5AYQA 1F3JB 2X6MA 4MJ6A 3ME0A 3VXNA 3AAZA 5IREA 5A6IA 4I0KA 4BK8A 3LKOB 3CFCL 1M3JA 3ARBC 3FQ2A 1RZ8A 5J6GA 1O6VA 3IJEB 1EZUA 1OSPL 1RHHA 4ZW7A 3EOBA 4QRQB 5AL0A 1LWJA 1T5XA 2YFOA 1UVQA 4P57B 4NO5B 2J4WH 1NAMB 3QYMA 5GS2H 2XUWA 2CCWA 1QA9A 2E7BA 5G5DA 2NX5A 4WUUB 5TH2B 2XTSA 4BE6A 5CIPB 4GXVL 5JOPE 1M4KA 3OGOE 1BQLL 4MCZB 2VN5A 4MS6A 4FX5A 4D0CA 4MJHA 1S7XB 4NDMA 3D51A 1QWNA 2VLJA 3JV4B 3PF2A 4UUJB 3V6OA 2WD0A 1LEIA 2DWXA 1G0XA 3OZ9H 4S0SD 5AOIA 4PJ8C 3O2DH 3IJ8A 5EOCL 4J39A 5AKVA 1IM9A 1OKEA 1HYRC 2IAMB 3QHTC 4KJQD 4BDVA 3ARSA 4TVPH 4CRPA 3T0XA 5T5NG 1FWXA 4NQVB 4D9RE 4GSUA 2WZPA 2EABA 2WLIA 2JFCA 1AXTH 3I02A 2JB6B 1NC4B 2YKLH 1J87A 1X5MA 3BXNB 4BSVA 3L3HB 3WFEH 4ABVA 1RQ5A 3NQIA 3C5ZB 4H88L 1QYGL 3H9YA 5E2TH 5L9DL 4BQ8A 4D8PA 3NZUA 1KPUA 1RKRA 2ITCA 4PJAA 3MJ9A 2CMRL 3SDDB 3O8XB 1TTFA 4XWOD 1NGWB 1GJUA 2E5EA 32C2A 2BWIA 3QEUA 2G0KA 1KEMH 5JW4R 4JR9L 3ECWA 4PEEA 4RGNC 3WELA 3BWUC 5I2IB 2E7LA 4HPOH 4TSBL 3W56A 4AG4L 3CD4A 1UT2A 3G5ZA 3S36H 3G3LA 2AI0H 4WO4C 1HEZA 1SZNA 5BRZB 2N7BA 3UO1H 3IMSA 4I88A 1DCLA 1JRHH 2XTJB 4GS7C 4JHZA 3CQFA 1VZGA 3BAKA 3FUHA 1CURA 5JNYA 3ZYOA 1KCUL 4KKCC 4YHIB 1A4KB 4FJ6A 2P43B 3DXAD 3O3UN 3SKNB 3ZYZA 1A4BA 2Q0ZX 2HMID 1H15B 3F7RA 3JTSA 4L8SB 3O9WC 5D7LD 3KPRD 3MA7A 2GCYA 1N19A 1ZHNB 1N2RB 3Q3GB 1DVXA 4GXUM 4KK9D 4LCUB 4CUCA 2F5BL 1URZA 5IB4B 4XCNB 5I6PA 1S8DA 3QIWC 4F37K 4JPKH 3UAEA 3K8KA 2ED9A 2E6PA 5IMLA 5D6CA 3C60C 5J7CC 5DYOB 2V2TB 5FYKE 5DJ6B 3KHOA 1O9ZA 2EXWC 3G6AB 5ISZD 3GJFB 5H2BB 2ZOLB 1CD1A 2IPKB 5DJ0B 2EYRB 5I71C 2G75A 4UILH 4OD3H 4NZTH 4H25B 4I0PB 2J43A 1T0MB 3H9SD 5I0XA 3ABMB 5I8EB 2NW3B 4AVKA 4NZFA 1BVKB 1AQHA 1MJ7H 2JIXB 4PGDA 1DJWA 5EUOB 5F7UA 2ZWLT 1GS6X 4S2SA 4P2QE 3DJSA 3KLQA 5L2KB 3TTSA 4ZUWB 2DWDB 1UUNA 4JANB 4X9HA 3RTQD 3B9KA 1CL7H 4MD0B 1YYCA 4Y4HD 1LL1A 4M5SA 2XQYK 5KBLA 1D7DA 4JLRA 4YJZL 1VB9A 1KLFA 2JJUA 5HVWA 5E4IA 1JNLL 1W16A 2QGCA 1S9VB 4DAGH 2P28B 1PJWA 1YNLH 2F9BT 2A2QT 2V8MA 3PWPE 4Z78B 4MXQC 3WV0A 3PY9A 3BRFA 1KT2A 1MREL 3P30L 2AK4E 3NZ8B 3AM8C 4FFZL 4LBAA 5HHMD 1OE3A 3AS0A 2ADIA 2HP4A 4YXKH 2HFEA 2M2DA 2EE6A 4N3TA 4NB7A 3S36X 4MA1B 1ZA3B 4TLKA 5B39A 3QYCA 3MBEC 3VTMA 1BXXA 2DBJA 1EGJH 3NFSH 4ANUA 1HSBA 4EXKA 1HINL 4Y4FD 3RZCD 5DD6A 3LNFA 1BAGA 3CMOH 4JDVB 43C9A 3AUWB 1UYWH 2ZUUA 5FCUL 4PWKA 3MLZH 3A67H 3ZO9A 3KEHA 3AJ7A 2NCMA 4NKIL 1K9TA 4LSVL 4GSQA 2VXQL 3EDEA 5EU5A 5KZCD 3DO7A 3H3PH 2IQAB 4KKPA 4YPGA 4B3VA 2IALA 3FQXB 4AMKL 1A7QH 3G6JE 5E23A 3TCTA 1XAUA 5IEHB 5J0BA 2A38A 2VMEA 1XFPA 1ZLDA 4NO0B 4X4ME 1KCSL 1QHOA 2R83A 2XKNB 3K6SB 2EP6A 4OF3A 5HI3D 7FABH 5HJGA 1PKOA 5F1SA 2IGLA 3OAYH 5DJ8B 4PRNA 2PP9A 2MSPA 2X6UA 3LQZA 5BS0E 5FIEA 3ZO0A 4APXB 3SDCC 3WIIH 1IKFL 2WKOF 5SX4H 1UZ6E 4M6NH 5CBAA 3CVHH 1CDIA 3ESUF 43CAB 1GCFA 5BV7L 4PRPE 1HNYA 2JKNA 4KTDH 4XVUD 3H9HA 5KBNC 3WTVA 2OJZL 3LS4L 4DZ8B 5D5MF 3QNZB 3N1PC 1M6UA 3TGXA 4YUEL 3FSAA 3CSGA 4A55A 3EOYG 1LO3L 2YA2A 3MNZA 4QI3A 3L4TA 5INCB 2ZWSA 1F4WH 3H3BC 2HT3C 4X5PA 4XMPL 3WGVB 1ZDQA 3QRBA 3FB7A 3QC6X 4I9WD 4JPIB 4PJFA 5AKRA 2KC0A 3CFNA 5CBEA 2ZX6A 3BKCH 4G83A 5D8JL 1CVRA 1KFGA 5A3ID 5D1XD 2BM3A 1TJHH 3HE6A 3MHZA 4X8JA 5EEXA 3OKKB 3RDTB 3T2NH 4A2LA 1FNAA 4NQEE 4GW1B 1Q94B 1MHCB 3NIDE 3SHSA 2B0SL 2DTML 4CVXB 1WDAA 1MLBA 1EA9C 1FNSL 1S7QB 4F7CA 4H2AA 4QHUA 4OZIB 3TBWA 3MRPA 4ZO7A 3KDPB 1TCRB 4PS8A 1NZRA 2DM3A 2K3TA 4L1DA 2WXOA 2Y2WA 1PEZA 4QRPA 1G7IA 1DJZA 1KBWA 5DT1H 2NZ9C 3Q6GH 1UXSB 3GHBH 1I1FA 3DX6B 4TL5A 5I17A 5EULV 4LCWA 5JPNA 5BUAA 1QFWH 3VXUB 2OYPA 2K7PA 3NK4A 4OCLC 1SGKA 5DK3A 4NUMA 5F7DA 3S35L 3T3PB 2VW6A 2HFFB 2NNFA 2RFXB 5E9NA 2WWMC 3TV8A 3Q8EA 4J3OG 5DQDH 3ZDZB 2GITA 2BNQB 3ARZA 4MWFA 5AZEH 1E8YA 5JR1H 3I50L 1ASOA 4DTGH 1CTOA 4NC1C 4YLCA 1MW2A 2D7OA 5IHWA 3T6XA 1JHKL 2PKDA 3M7FB 4YMPA 1KCVL 3BCDA 5EU7E 4V2CB 2HXAA 5B1JA 3UJIH 2OA9A 2R2BA 2V7HA 3EYSL 3WUWB 3RAJH 3K6FA 3TPUA 1C8QA 5EIIB 4JUSA 3AZUA 4LP5A 4G1EB 5B7EA 5JDJA 1NGXA 4LQFH 3VXMD 5C0JA 2P44B 4FP8L 2X4SA 2MPAH 1IGFH 1UB6B 1CFMA 3C6LB 3LZNA 2CXKA 4J3OD 1DDHB 4B0MM 4GEIA 1KCKA 2X2HA 4HDIA 1V3JA 2PYFA 2Z35A 4QAMB 1W0WA 2FSEB 2PP7A 3JV6B 3HAEH 1FL6B 4HCRL 2QMKA 2Z34A 4X7SL 3QA3A 2AANA 5DEGB 3GBML 3PDOA 3UAJD 2DLFL 1HVXA 1CLZL 1QRND 4G7SB 4X5RA 3TBTB 4EZJA 4DQOL 3PWPB 5ACZB 2MQGA 1JZ8A 4M1CD 1LM8V 1YEEH 1GYWA 3REWB 4IRZA 2WLKA 1FVEA 1W0VB 4UNUA 4MQ7B 3VFGL 2AK4B 1NFIA 2TAAA 3ECBB 1B90A 3DX3A 5FEBA 1RERA 3WS6C 1KB5H 4DGIL 2VDRB 4YS4A 5I1LB 4N5EC 1M2VB 4OUUA 5DJCA 4XVJL 2VDNL 3S8WA 5LXGL 1IEBA 1CDGA 3UGXA 1Q72L 1CICD 1NWPA 1UOKA 3V6OE 4LOEA 4G6KL 1VGEH 4M6AA 1RZFL 3EKCA 2AHIA 3NIGF 3O8XC 3CLEH 3LSOB 3VFVB 4QF1B 5E5LA 3QFJA 4NKQB 2CBMA 5MEND 4LP8A 2IFGA 1KIUB 5F71A 1XF3B 1A9EA 5KYWB 2E27L 5JW3H 1NCIA 3TN0C 3NSJA 3GUTA 1JWSA 4IK7A 3OKDA 1RZQA 4RMWA 3S2CA 1JZ3A 3QRFM 3L3IA 2J71A 4GFTB 2XTJC 1XTLA 5CZXC 3WXWL 4XTRD 3BKMH 2PP8A 3A6OA 3T77A 5KS9F 3UBXG 2VDQH 4Z7QB 1J0KA 1OGTB 3HNSH 1MNNA 1F00I 2I60L 1DZBA 4HUVA 1L9MA 1QEWB 4QOKA 4XX5A 4X5WA 3IMWA 4PJAE 1PIGA 4ZMPA 1L6PA 1E6JL 1DANT 1Q9LA 1XVSA 2ZWZA 3D39E 4U1JA 3S97C 5KN5A 4FTVB 1R4XA 4ANXA 2X9ZA 2DQIL 4QTHB 1N0LA 5EO1A 5DMKA 2LAAA 4ZFOL 3VXPA 4UV4H 5D7JB 1NCWH 4KOCA 2O6CA 3L4YA 1D5XB 4OLUH 1IGCH 3N44F 4O2CB 2ROXA 1AI1L 4WKZA 3V6ZA 4CADB 3FQRB 4KROD 2WUCL 3MLYL 3SGDH 1TTBA 3JWDL 2AERT 1OCOB 1NLDL 1DVFD 2WLNA 4JFTA 4ACPA 5IVZB 1JDDA 2JWYA 4MDJB 4XP6H 5GRVL 5D71H 5CSBA 2NY6C 1A7PL 5DR5L 1NKRA 4NFCA 1KIQA 2QTEA 5CEZL 3UZQA 3EYUH 1G1OA 3L5JA 3OJDA 4K94L 5HJ3B 1JF1A 2F6AA 3D2UB 1OW0A 4HBCH 3UG3A 1HOCA 3T0EB 3PLYA 2Y6SD 3UOAB 4NQDB 4UIKH 1BD2D 1AANA 4P9ML 2UWEB 2R0WH 5C08B 1BVZA 3MV7E 4LEOA 1N6UA 1WSST 2IOIA 3D1MC 3FNKA 2E74C 3CDZB 3H0TA 4ONFH 1RIVH 4S0TD 5FYJD 3VXQB 4C47A 3X13B 3PGFL 5JHDB 4BQCA 5EU6E 1C12B 4KX7A 5BVJA 1AY1H 1PFCA 3ELAT 3TIDB 3BEWA 4E2OA 5FV1L 2CQVA 4R2GB 4LQ1A 3GSUB 2EVIA 3LZLA 3VNZA 3KM1A 2OTPA 2OMNA 2Q86A 1EAOA 1PD6A 2DJ4A 3BUYB 3X11A 1UOVA 2QSQA 4CN1A 4WV1C 4IRJD 5I76B 1BQSA 2F54B 1SEBB 2XKSA 4NM8L 1QNZH 3IJSA 3WJLA 3MRIA 3QAQA 4ZX6A 5IQLA 1JV5B 1JERA 1MIEH 4Z95H 2DJUA 2AQRA 1AO7D 4N1HB 1QSEA 3L4WA 1W6WA 5CCKL 4KKBC 1B0WA 1YMMD 2NR6D 1KPRB 2P49B 3PXJA 1TVBA 3L8QA 2APWA 4OGYL 5JUEH 1FFNB 4X9IA 3FZUD 4OZHF 2APVA 3NESA 5J6SA 2EUWA 2C9VA 4ES9A 4JFPB 4QRRA 1MZZA 2LLGA 3LJ3A 4M5TA 3CU1A 4ODHL 3U7YL 3F84A 4Y5VA 2ZXWB 4HA1A 4LARL 4EPSA 4F9PC 2EDMA 5KVEE 5D9SA 2PPFA 4ZFZA 1TZIB 1GXEA 2J20A 3RUGB 4XZ4A 3WLBB 5TF0A 5ID0A 1KG0B 4ZX4A 1L4IA 2A6KA 1ILUA 3K2UL 3AROA 4OTXH 1PLGL 2I7OA 4L3EE 4YZWA 3V95A 3MNDA 3MLXL 1WFTA 2DYPD 4MJ6B 3ME0B 4ORZC 3VXNB 3AAZB 1RSYA 2EH7L 5K59E 2XWBA 2VLME 3EJYC 2ED6A 3P02A 5LBSA 1RZ8B 5FUCC 5J6GB 2FHBA 3T6WA 1F3RB 1SXAA 3B2XA 1RHHB 4ISVA 3EOBB 1KEGL 3VD5A 1T5XB 4HIJA 2VOTA 3TT1H 4H7VA 3UTSA 3QCTL 3V7AG 3FQYA 1WK0A 4PJ7E 3HZKA 1YPZE 1QA9B 3HI5H 1M42A 2E76C 3LEVL 3NZSA 5G5DB 2NX5B 3RVUC 3VRJA 2ESVD 1IFRA 2FZ3A 1RU9H 3O2WL 4IGBA 3E2HB 4N0YH 1AH1A 4D0CB 2OMVA 3BAEL 4L1SA 3U0TA 4ENED 3APDA 3LQMA 4NDMB 2VLJB 5ECJE 3ECQA 1ACYL 1NH6A 1LEIB 5EIQA 4ZMXA 1EXGA 2BOBA 1G9HA 4AUJA 2RIKA 2BFVL 2CGZA 2UZYA 1RJCA 2BFGA 1FDLH 5FO7A 3UTTE 3RIAK 2JKWA 1U3NA 1IM9B 2EDWA 4BDVB 1Z9PA 2L7UA 4N8VG 4E9RA 2F8XC 2WVVB 1C5CH 2BY0A 4NOFA 3RDJA 3NH7L 2B3RA 3TH3T 2QJDA 4AMXA 2WLIB 1J1OL 1HZKA 1Z9LA 4PJFE 3F62A 4OD1H 3I02B 2IWFA 1XV8A 4QXUH 4BSVB 2YPLE 3KLDA 3VWJD 5DC0A 4HIXL 5C2BL 3PS6A 3HNTL 4XO8A 2JB5H 5FOJA 4D8PB 5IKCA 1KPUB 4IDJH 5K69A 3OJVC 5SX5H 4JO8A 2MCPL 2ITCB 4PJAB 3VGAC 1E5AA 2FL5A 4R7LA 1R3IL 5FGCB 1WRFA 5IMKA 32C2B 4WSKA 3QEUB 4F33A 2HFGH 4I48A 3BJLA 1CLOL 1EMTL 2QPSA 5I24A 2HTKD 2ZWYA 3ZSTA 3BKJH 5D7SH 3G5ZB 3K46A 5CGYC 4AK2A 3RRQA 1HEZB 4JPWL 1FCCA 1IC7H 4KOBA 2DICA 2DQTL 2OR9L 4AEIL 1FP5A 1KJ3H 4NPKA 3X1BA 5HVHB 5CILL 2WLLA 3MO1A 4M1GL 4HAFA 1IGIL 3V0GA 2X09A 1N8OE 1DBML 2L04A 1EAPA 1PZ2A 1CGVA 3EH4B 3JTSB 4QRFA 4E0RA 3Q1SH 3MA7B 2GCYB 4CDHA 3NFNA 3EJRA 4IIQA 4XE5B 3BDBA 4L4TE 3AACA 3BKYL 1S8DB 4YDNA 4FI7A 5IBUG 4ANKA 1JZDC 1IBHA 5IMLB 5D6CB 3GK8L 3MV7B 3W81A 4XPFH 1T7VA 1FGVL 3QDMA 1CD1B 4PRID 2WTOA 2G75B 3BAXA 3ARDD 3DNKA 3GGWA 2K9FB 1YYLL 2IFFL 2Q7YA 3BN9D 1BEYH 4IJ3B 4RMTA 5EC2A 4Q58C 3ZKXB 4Z7NB 1IE5A 4PGDB 2ZP9A 4YO0A 1DQKA 3Q2LA 4LHUD 1UJ3A 2DY2A 1UM6L 4NLHA 1JPEA 1OT2A 2I5YL 3FXIC 4S2SB 4XX1E 5E6YA 1GHFL 5GGVH 3OAYK 4WI0A 2PXYC 1G7QA 3FO0H 1E5BA 1SOKA 2IPTH 4ADJA 3B9KB 5HHOE 4MNQD 3ZT7A 2CE6A 4FYQA 4ONHA 4JLRB 1KLFB 2ZYRA 1M2OA 3NAAH 5EA0H 4YHML 3ZN6A 1I4FA 1MDTA 1UWYA 2BHFA 4N0CC 2Z8RA 2NXZD 5E9DE 1KT2B 3F85A 4A6YL 4HJEA 2XBDA 3STBA 1G84A 3VDCA 2ADIB 1RZKH 4X50A 1BFVH 1U8OA 4ALAC 5C0CA 2HFEB 2C8NA 5DRNA 5B39B 1YY9C 4FQCH 4KVCL 3RPBA 2DW5A 3IFNL 3TU6A 2NY2B 2JJTC 5DMGD 2E56A 4X2UA 2V5SA 1HSBB 3QCUH 1ZT7A 3DMMD 5HDLA 3HC4H 3IXTA 3ESVF 5D1QE 5DD6B 2LTQB 3MRQA 4PD4K 43C9B 1JTTA 3QJSB 2WQUA 1QTPA 1J8HD 4L3EB 5GZND 1A1NA 1YN7A 3FCSA 4K5OA 1H5BC 1JGDA 4PS4L 5EU5B 3OC8A 5I1GL 1MIMH 4AQEA 3DO7B 1J88A 4YPGB 4K3GA 3HMXH 2IALB 1RLBA 4QPEA 3KJ6H 1DEDA 2YMXL 4OCNC 5AW2B 3SDAA 2HLAA 3RL1A 5LQBL 1GW6A 5EU4A 4Q9QH 1C08A 1HNFA 4OB5L 8PAZA 5L0QC 2CHWA 3GI8L 4PRNB 2BY1A 5PAZA 3LQZB 4ONOA 1OQXA 2DD8L 4UOQA 4QOKE 5DWUH 1OP3H 4XVOA 1Z9OA 2EE3A 2OI9C 2WW8A 2ALAA 1X7SA 2KDGA 1O5PA 2K0RA 4Z7WF 1AD0A 3VFWA 3KPSD 1V3MA 3ZRFC 2ZG3A 3KBHE 1TOXA 3IFPA 1YNKL 1UB5A 3ILEA 3H9HB 4HC1H 1WBYA 5I1KH 3GIZH 3INOA 3PL6A 2WNXA 3GXFA 4RAHA 2XC8A 3IMRA 1R5VA 3N85L 4XNQA 2H0EA 3MNZB 3QWRD 5IOPA 4RBPH 4KVPA 2J72A 4XNAA 3FB7B 5K9JL 4PJFB 3NCYS 4XXDA 3VACA 4FFYL 3CZUB 5CBEB 1WYJA 3X3FH 5ICUA 4FCHA 4K7PH 5KSBF 3UTZA 2BX5A 3SBWC 3HE6B 3BGFC 4X8JB 2Z7YA 4XMWA 2ZT9C 4X5XA 1P0SE 3NJFA 2PN5A 1MLBB 5ITFA 1CF8L 4JFEA 4QHUB 2HWZL 4OFQA 3TBWB 4NEHB 3MRPB 1E4HA 1QATA 1T6VN 1QASA 3T71A 3V8CA 2VKWA 3HNVL 3ALXA 4Q9RL 1XIWD 4CC1A 1GC1C 3E8UL 1VFBA 3KAAA 4QRPB 1SHWA 2CO1A 3VWKA 2DJMA 3GMNA 1I1FB 3INUH 5I17B 5JPNB 4LCWB 3R8QA 4WEBH 3IGFA 2B1HL 3MODL 1F4YH 1PF3A 1T21A 3FRPG 3B9VA 4C54A 2P52A 4NIKB 4I18A 5F7DB 4ACTA 3VG0H 3NP3A 3WDHA 3S3PA 3WXVH 3ZTJG 1JI2A 2GITB 1MEXL 3V4PH 1G9MC 3F05A 4HYTB 1E4KC 3TOPA 1ZVYA 2EIKB 1E43A 3FYEB 3ZZSA 2LU3A 4OT1L 2P5EA 4JDTL 5FPIA 3QDHA 3NJXA 4ZTOH 4EI5A 1XCQA 3H4FA 2A1WH 1I1AC 4KKZA 3TBSA 1DBAH 2G5RA 1T2JA 2R2BB 3LKNB 2VMCA 3O0LA 2W95A 2AXHA 2V7HB 4AIOA 1SFDA 3APMA 3K80A 1MN4A 1KY6A 1SMOA 4KFMA 1IBBA 3OHMB 3TPUB 1JN6A 4P5TA 5B38G 4N87A 3GRWL 1N12A 5E8DH 1NGXB 2BIQA 4FNQA 5KW9H 3IF1A 5C0JB 4N24A 2Q2LA 2IWEA 4OCRH 2VDKL 3AADB 3O3AA 2GAZA 5JIKA 2X4SB 3E2HC 1N59A 5DK2A 4N2KA 1OP9A 1DVZA 6FABH 4H26A 5GJTH 4HDIB 3UZEA 2PYFB 2Z35B 2GK2A 4YEFA 3AABA 1LDSA 1W0WB 1ADQH 3FH5A 4GAGL 1MF2L 3PUUA 3BSHA 2KZKA 4PUBH 3KS0H 5GJSL 4BK5C 1I8AA 5ADOL 4Q8BA 3PDOB 2JKTM 4R26H 4F2ME 4HEME 2BDNH 2FEEL 2VXUH 4AKOA 3N06B 4JJOA 4CMMA 4OFDA 4MVBC 3S7GA 5C71A 5I0YA 2R7EA 5I1IH 2B4CC 4BFJA 2YD6A 1FVEB 2DYRB 4ELDA 5DWPA 4HOZA 1NFIB 4P46A 2BSEA 2FUTA 3OSVA 3KPMA 5EOCH 2BO0A 2H1XA 4OUUB 2YGNA 5AB0A 3MUGA 4OU3A 1RFDL 1IEBB 3TJEL 1ZANL 2FR4A 1FFPA 4L5FE 1UENA 2W60A 3CZKA 3H55A 1EHLH 4LZKA 5I1EH 2JKJA 3OKEA 3VH8A 2A0LC 1CGWA 2GJZA 4JZJA 5CU9A 2VDMH 2B2XL 3QFJB 3KM2A 3VFPA 4PJEF 1A9EB 5C07D 4QUOA 3PV6A 2CO2A 1ZA6A 2Z65C 3MUUA 5GGTA 3GUTB 1JWSB 2AEPH 3OKDB 3L3IB 3K2IA 1L7IL 2DZEA 3TVMC 2VO8A 1VPOH 3QUZA 4FG4A 2L4OA 5LN8A 3T77B 2JELL 3IDYB 3WNLA 1R6VA 4L2YA 5DDHA 4ZX5A 4HUVB 2I9TA 1PU0A 3HS9A 2DQJH 1FRGL 2G9HA 5IHBA 3SPVA 1HH9A 2J2ZA 4QOKB 2K8MA 2BRRH 4X5WB 2XJLA 4BZ1H 4MB4A 2YFNA 2NNAA 4AIEA 1Q9LB 4LNVA 5KN5B 3D3VA 4QRSA 5EO1B 4Z0BL 1N0LB 2CAKA 1Z5HA 3BP5A 2A9MH 5D7IE 3VXPB 5DMKB 4FNSA 5K9OA 3TESA 2IGTA 3IS1X 5E5MA 4A7UA 4NIYE 1JL8A 3UPRA 1OSZA 4WKZB 3V6ZB 5CEZD 2AXFA 4WGKA 2EECA 4EEEA 4DW2H 3QDJE 1FF5A 4PWFA 3L2MA 3QO1A 2XV0A 3X1FA 4A7QA 1A14L 4PJ9D 4H8WL 1JDAA 1RCYA 4BINA 1P4IH 4G6AD 1KIQB 1MOEA 3RVTC 5JW5A 3QIBA 1RVFH 1DSFH 2VDPH 3T4AC 4FN0A 4Y4KC 3UZQB 4TPRH 2VQ1A 3OJDB 1J9SA 1KF9B 1JF1B 5FKAA 5IZ7A 5JPMA 4ADGA 5JHAA 1HOCB 1T83C 3LS5L 4LASH 5AENA 4L3FA 2WVTA 4KKLD 5FFLA 2DQGH 2DQHL 4JPVH 3KLLA 3PHQA 2X6AA 3LN5A 4JRFA 3TT3H 3V52H 4LEOB 1WA1X 3MNWA 5F7WC 3H0TB 4K9EL 1Z3GL 1MCQA 1U42A 5JMOC 1CLYL 3MLVH 5BVJB 3WS3A 5CSGA 5TDNA 4QMEA 3BEWB 1A7RL 2AJSH 3MLRH 3C75A 3O2VL 3WFDH 1NPUA 1DCEA 3SPHA 4F7EA 2BVQA 1GC1H 2Q86B 1U2CA 1TYRA 3X11B 2ADFL 2DKUA 3P4NA 4LSUL 2CUMA 4LCCC 1J9RA 3BH8A 3ARFC 3IJSB 4NKDA 3MRIB 1H19A 1I1RA 3GXMA 1QRKA 2VDOL 4RRPM 3VGFA 5IFAH 1EUUA 1BBJA 1OALA 1PG7W 2HKFL 5KYYB 1QSEB 3WMPA 5HYJA 1MRCL 4KGLA 5FO8A 1MJ8L 3P0VL 3WTYA 5C0AE 5HGHA 4G9DA 1WS7A 4GUPA 4NZUH 2JLPA 1A65A 1DE4A 1TVBB 1XWVA 1G9MH 2XQBL 4DUVA 2AV1A 2FWUA 4K3DL 4N8CL 4PAZA 3MRMA 5FYLH 3PAUA 4YXLH 1SM3L 4KQ3L 4XCYA 2TSBA 3T8XA 3MOBH 1JGLL 4YZFF 4PY7A 4QRRB 3UBGA 3MV8A 1YMHA 3HI1A 3SKMA 4Z18A 2NZIA 4Y5VB 2X10A 4M7KL 5D9SB 1FN4A 4ZFZB 3J8F7 3DROA 4B9YA 5KVMC 2EILB 5ID0B 3PP4H 1U8JA 2A6KB 5LHDA 1NIAA 5L8JB 5SX5K 3QS3A 3V5DA 1UA6L 4JDEA 4OCXH 1S7RA 3X1EA 2XWBB 1IKFH 2H8PA 2VJ8A 1NCBH 2CK0H 3BVNA 3QQ3A 3RVWC 1H6EA 5K9QI 4ISVB 1T1WA 5I8CA 3L1OH 5IMMA 5L6YL 3E1F1 4HIJB 3BAIA 1MCBA 3UTSB 3FTVA 4FABH 1OEZW 2XWRA 1WZ1H 3HZKB 2IANA 3C09C 5EH1A 3V7MA 5KAQF 3HG5A 3VRJB 2A74C 3CLFL 3VI3A 4PV1C 5FOBA 3BP6A 2FZ3B 3FTXA 2MKWA 4MJ5A 2QDWA 4IGBB 2Z31A 3EO0A 2HCZX 3CC1A 2CNYA 2OMVB 3LIZA 2HG5A 3QH3B 4PM1A 3GQFA 4UTBL 4FEMA 3U0TB 1EERB 4XMPH 2MNWA 1FNGA 4XHJD 2IDUA 4UT9L 4M62L 4MKMA 2UZYB 5FO7B 5SWSE 4EUPA 3H7BA 5HDBB 5TDOA 4GKSA 2XA8H 3L5XL 4HWEL 3WL9A 1JYNA 5F0PB 5FUOH 4JG0L 1YECL 1U8PA 5I0VA 4IIZA 5I8OH 3A23A 4ILDA 1IBGL 2JXMA 4U1KA 2X89A 2J5LB 2X2JA 2LLNA 3CE1A 4X80L 2GBUA 4OGAC 5CXPA 3N0PB 1XB6A 5C6TL 5IKCB 5FYKU 3ZK0A 5GS1A 3KYNA 3SPIA 2FL5B 2HH0L 4WUKL 1E7UA 1JGIA 1P7QA 1ZKAA 5IMKB 4ANWA 4F33B 2HN7A 1KXQA 4I48B 1B4JH 2FBRA 4NRXA 2NLJA 2BCKA 5IIEA 4Y2LA 2KL6A 3DX9A 3QQDA 5FM8A 4GXUN 3K6OA 2EIMB 2EE2A 2FATL 2R8SL 4HIHA 4PMFA 5ANMA 3ZE1B 2H4EA 1KV7A 3QPQC 2AK1L 1W8NA 4QXWA 1X44A 1RUPH 2R9HD 3OBAA 4TXVB 3AY4A 5AG8A 3RPIB 2WLLB 4AGOA 3MO1B 2GJ6D 2ZSWA 4M61A 3EYSH 1NGPL 4FF9A 4DVBA 3W3BA 1EAPB 5IW6A 5TQ2L 1A3RL 1YLBB 3TA4D 3PAVA 4R7VA 4E0RB 1UM4H 3V4LA 3NFNB 4AQOA 4DOHB 4CGTA 4IIQB 3M45A 3A6CH 2VSCA 1J1PH 4NN6B 2VLRE 4GUCA 4RGND 3GXPA 4Y19E 5L2JA 3C8DA 2NY1B 1D6EA 1IGJA 1CXKA 1KTKE 2J8UE 3MCKA 3HAEG 1F2QA 3QDMB 3EH3B 4HK3J 5FX3A 1KYOJ 1SMDA 2ENYA 2Z7WA 3PHAA 2BZCA 3GGWB 4ZW6A 4IBTA 2VN3A 2Q7YB 2E9IA 1BCIA 5EC2B 4EI6A 1CDUA 1B6DA 4JRXD 4IBSA 1OLLA 4YO0B 5IQOA 5BXFA 2D31A 3CX5J 4AXWA 1UJ3B 3ARGD 1HN1A 1EXUA 2WB1A 5HJBA 1YHPA 2VLKE 4R9HA 5SV4A 4FXGA 3VNYA 2HX8A 4WI0B 1NOAA 4E9SA 1G7QB 3VE0A 4X0NA 1DUYA 1OP3K 3V8OA 3QULA 2ZNWA 1TETL 1FIGL 4ONHB 1TENA 3C60D 2NUTA 5MI0C 5DGRA 2OAAA 3SDXE 2EXWD 2Z0UA 5SWZD 5LXGH 1I4FB 1BFTA 1JNNH 5FW6A 3D4GA 4Y7OC 1RZFH 5AOJA 2A5UA 1T22A 3NPZB 4ODTL 1WF5A 3S3DB 2MPVA 4TVPE 5C0CB 1U8OB 3EOTL 1AZNA 4RBPK 5DRNB 4LEBA 2ZUXA 4TS6A 5AW0B 1EHKB 1PZ3A 3MV9D 4AZUA 1ZT7B 2UY7A 2VDLH 2WCGA 2XG4A 3LQAL 3IXTB 4L4VA 4PR5A 2OMUB 2VDRL 3MRQB 1HQRA 2DH2A 2VISA 3IK2A 1QKZH 5AYUL 1A1NB 1YN7B 3FCSB 5F88A 4LDCA 3ZDYF 1JGDB 2IBGA 4BWTA 4Y5XA 4YBQD 2QLYA 3EHBC 4AQEB 2C3GA 5ILTH 2UYLA 3SBPA 2DLHA 4R90H 2XZQH 1Z9NA 4ELKA 3SDAB 2HLAB 3RL1B 3WIAA 3FU0A 3GSWA 4PWGA 4JCLA 1W2KT 4PRHE 3B7TA 4S1RH 3D4CA 5KUMA 5EU4B 2NUPA 1AI1H 1C08B 4K23H 4ELME 3DYPA 1XD0A 4RESB 4CA4A 1EAQA 1I3VA 1OW0C 4HUUA 5I82A 5ERWA 5IVXF 3ZOAA 1L9OA 4XO4A 5AOZA 3DXAA 4ALAL 1T89C 5I74C 3VFWB 2RCSL 3ATFA 5EWIH 1RJYA 1A7PH 4GRLA 5AW9B 4U3HA 4ENZA 2YD4A 3IFPB 4TLUA 1UB5B 4Q6YA 3WKML 5E0FA 1WBYB 3PL6B 3P3TA 3SODB 2AGJL 1Q1JH 1DHKA 1MCOL 1YYML 2FX8H 1R5VB 2QADC 1MPAH 4W9LC 3UXFA 2CLRA 2PPCA 1IEAB 5IQ9A 3MCG1 1Q9OA 3NRFA 4JHWL 1CE1L 4QEGA 4F9LC 5IOPB 4LAQH 5ISZA 2JH2A 4YK4B 1AJ7L 3M46A 4QD2E 1E50A 4Q2ZA 4XXDB 3SYPA 1G4RA 5E2JA 4IOSD 1U4FA 3SDCD 3UTZB 3DUHA 4AWJC 2C9SA 4GAJH 1RXLA 1JZEA 2CU9A 1IC4H 5D2LE 4Y9BA 4FMKA 4X5XB 4F27A 1SF5A 1HJCA 5L4MA 4QDGA 4DGYH 5ITFB 5GSRB 4OF0A 4JFEB 3X3GH 1KCWA 4HFUL 3ASWA 1P5UA 3SGJA 1NBVH 4XBPA 3MCYA 3OR6B 4AYMC 1VFBB 3VWKB 1I75A 3GMNB 4NXSA 2Y7SA 2QFRA 4PJCE 3RJDA 2DIJA 5HBBA 4PI2A 1BJMA 2DOCA 4N0UA 4ZS6C 4IQHA 1T21B 5IWLA 4X6BA 3CSTA 2FEDC 2WBXA 1MCKA 4I18B 1I3RA 1N18A 1FI8C 1DVQA 3QDGA 1IIIA 3GHEH 2YAHA 4U1SA 4X98A 1S6NA 5F70A 2PNDA 4ZNEE 4M3JA 3S3BB 3RVXC 3FCGA 4UBDC 2ILLA 1Z5YD 3C12A 3QNFA 5FUZL 2B08A 2P5EB 3P0YH 4XVSL 2YGVA 5CP7A 4EI5B 4YHOL 1XCQB 3TBSB 3IGKA 4JFQA 3UACA 3P73A 4ZW5A 2PO6D 1QSZA 2Y06L 5BMFH 1JN6B 4P5TB 4UDUA 2OZ4H 2J1ZA 4JKKA 1C8PA 1RZJC 2VW4A 2WWMD 1CXIA 1KJ2L 2W88A 4A66A 1WGVA 1ZTXE 3TA3D 1HQ4A 3IF1B 4QRAA 1RULH 4BWWA 3O3AB 2GAZB 4DEPC 3V4VA 1AACA 2WIIA 1N59B 5DK2B 4NHCL 1IM3D 4H26B 4IMKA 5DO8A 5F21B 4GSXA 2QMJA 1A2YA 3GZPA 5AAPA 1MCDA 1TYJA 4TUKH 3UTQA 3FO9A 1FZOA 2E59A 1NCAH 1JPSL 1WAAE 2ITFA 1A7OL 3NQKA 4JRLA 1U21A 5AW1B 4DIXA 3MLTA 3EJUA 1S7TA 4CMMB 1CD8A 2IAAC 1NEUA 3QHZL 4DKFH 2R7EB 2YD5A 2ZJSH 1CB4A 4HT1H 3QUHA 1B4TA 4P46B 4EOWL 2CBOA 2GBVA 4ZZFA 3LCYA 3KPMB 5E2WH 1VCBC 4HBQA 2J5LC 3DGGA 5TFSH 1WFJA 4MMZC 3NSYA 5IHHA 2YEQA 3MUGB 4XC1L 4HJJL 1I9IH 2RTTA 4H5SA 1B88A 1U33A 1I85A 2FR4B 1FFPB 2XVBA 2W60B 4XNMA 5D1XA 3FN9A 3Q8AA 3NZHH 3VH8B 3OKEB 4GIAA 4UQ3A 3ZKSD 2GJZB 4I9XA 3AVEA 4JZJB 3KCWA 4PYHA 1VFUA 2IAMD 1IMHC 2FVNA 4S1DD 3VFPB 1U91A 3LZFL 3NABL 1QI3A 4KK8C 3PV6B 1ZA6B 3IRPX 4HF5H 2MCPH 5F8QC 1U3ZA 2F08A 3LRHA 2D2OA 5IJKC 1X6NA 4L37A 2XXCB 3ZKMC 4K3JL 1S9WA 3KE0A 1OF0A 3QUZB 4HXBL 3VDBA 3JVFC 4N5ED 1MFEH 5C9KA 2A7BA 3C5ZD 2P4AB 3HPLA 4BKLB 4D0DA 5BO0D 4W93A 3T3MB 4N5UA 5E7BA 1TIUA 3UP1A 1JF5A 1I9EA