1NWPA

Crystallographic study of azurin from pseudomonas putida
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
b'AECKVTVDSTDQMSFNTKDIAIDKSCKTFTVELTHSGSLPKNVMGHNLVISKEADMQPIATDGLSAGIDKQYLKDGDARVIAHTKVIGAGEKDSVTFDVSKLAAGEKYGFFCSFPGHISMMKGTVTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Crystallographic study of azurin from Pseudomonas putida.
pubmed doi rcsb
molecule tags Electron transport
total genus 36
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nwpA00
2XXGA 4DP5X 2BW5A 4DP1X 1E67A 1EHKB 4G72B 3UAAA 1I53A 3AG3B 1SHXA 3NJLA 3X1BA 2CAKA 1OCCB 3FT0A 3FPYA 4CSPA 2WSDA 3NP4A 2CALA 1SHWA 1KYAA 2QPDB 3V9EA 1UATA 3AG2B 3WIAA 5TK4A 2OCCB 2UXGA 4YVNA 3FQ1A 1JZHA 1NIAA 2EINB 3ZDWA 3RYMA 3S3CB 1JXFA 1M56B 2YXWA 4KNSA 1GW0A 1AZUA 1DZ0A 2BWIA 2CCWA 4HCGA 3PAZA 2BP0B 1GY2A 2Y1AA 3S3DB 2PCFA 3FU7A 1AS7A 3SBPA 7PCYA 3NJNA 1WA2X 2EIKB 4YL4A 5I26A 4DP0X 2XU9A 2IH9A 4PCYA 1GS6X 3SQRA 1XB8A 1AAJA 4HIPA 1JXGA 1SF3A 1GS7A 2HRHA 1CYWA 4BDVA 1CUOA 2HLEB 2Q5BA 1WS7A 1OCOB 3HB3B 5D4JA 2PPCA 1CURA 4GXFA 3ASNB 3V9CA 4DP7X 2PPAA 1ASOA 5I6LA 2H3XC 1AZNA 2AFNA 2PP8A 1JZFA 2FNWA 1QHQA 3MBWB 4E9QA 1JVLA 2P80A 2I85A 4KO7A 3QJSB 1JOIA 4HHWA 1WS8A 2XX0A 3WNIA 2BO0A 1KBWA 4W1TA 1JZGA 1ET5A 6PCYA 2B08A 5I6MA 1W6WA 3AG1B 4E9WA 5I6KA 1FA4A 5F7BA 1IC0A 2VM3A 5I6OA 2R7EA 1SF5A 1R1CA 1SJMA 4HZ1A 4A66A 3WKQA 1AS6A 2DWSA 3MX0B 1J5CA 5B7EA 3NJJA 4NAJA 4UANA 1N68A 3FYEB 5EHFA 1J9RA 1KDIA 3CVCA 1MDAA 2UXTA 4G7RB 1J9SA 3NSFA 1XMEB 3SBRA 2XUWA 2XV3A 1AR1B 3ASOB 4WKXA 4P5RA 1OF0A 1SNRA 1AANA 4KO5A 1HAUA 3QJVB 4E9VA 3GDCA 4AKQA 3GXUB 3FQYA 1AG6A 1NIFA 1RCYA 3T6XA 1TKWA 1OV8A 4HALA 4HCFA 5I5MA 1NICA 2Q9OA 2Y69B 1OE3A 4UAHA 1QNIA 2FQDA 1NZRA 2GSMB 1RZQA 1OOWA 4Q8BA 2IDSA 4EF3A 2W88A 4K9JA 2FQGA 1L9SA 2QDWA 3DTUB 8PAZA 1HFUA 3TBBA 3WG7B 1YLBB 6PAZA 3T6VA 4G71B 3NJHA 3CDZA 2AZAA 3NP3A 3HEIB 1KCWA 2XYBA 2ZONA 2VW6A 3JT2A 1VLXA 2H5UA 3UGEA 5D4IA 3UACA 2ZWNA 4BXSV 1NPJA 4BWUA 1KCBA 2XV2A 1T5KA 2PP7A 4BXVA 4JHUA 1MG2C 4YSQA 1W6LA 3WNJA 1ADWA 4DP9X 1NPNA 1X9RA 2XV0A 3X1EA 2BW4A 3QJQB 5PCYA 1GYCA 3C75A 4Q89A 2I7SA 2IWEA 5B1KA 3AG4B 4KOCA 3ABKB 3QJTB 4HHGA 3T71A 1AG0A 2BP8B 4E9TA 2H47C 4FAAB 2EILB 1JERA 3TASA 3ZIYA 4CSZA 5ANHA 2DYRB 2GI0A 2YAHA 2OJ1A 5B1AB 2YAPA 2DV6A 2XX1A 2YARA 3DIVA 3FYIB 1OE2A 1A3ZA 1L9QA 7PAZA 2FT8A 4PAZA 3X1GA 2P80D 1A65A 2X88A 1FWXA 1WA1X 2IH8A 3AW5A 2HZHA 3UABA 1BEXA 4A2HA 2BP0A 1ASQA 3X1FA 3X1NA 3NJGA 5B7FA 4YSRA 2N0MA 2IWKA 1TEGA 2CBPA 2PP9A 4GP8B 4AI7A 3PCYA 1ILSA 3BVDB 4N8UA 4A67A 4KNTA 5F7AA 2VM4A 3S8GB 2VMJA 3NSYA 2J57A 3IN2A 1OCZB 4BWTA 4KNUA 4ZK8A 3QJRB 1J5DA 3T6ZA 1RKRA 5B1BB 3UADA 3IBOA 5LDUA 4UF7C 1RZPA 4E9SA 1F56A 1A8ZA 2IDUA 2HX7A 2W8CA 1PLBA 2FT6A 2ZXWB 5A7EA 1GSKA 3NJFA 1SDDB 5I5IA 1ZIBA 4YSEA 1ET8A 1PLCA 3KW8A 3PLYA 1AQ8A 5I6PA 4L0PB 1JXDA 5TK2A 1V54B 2DY2A 4KOBA 1JZEA 1MG3C 4G70B 1PCSA 2UXFA 1BQKA 5B1JC 5IY5B 1XB6A 4ENZA 1NWOA 4GP4B 2VN3A 2VW4A 3D12B 4F2FA 3IN0A 2A3TA 4YSDA 1ID2A 1N70A 4DPBX 2UX7A 3FSAA 3TU6A 4DP6X 1KV7A 1MZYA 2MTAA 4X4KA 3ERXA 5I6NA 2QDVA 1ET7A 4YSUA 2PCYA 4DPAX 3CVBA 2GBAA 3FS9A 3FPXA 3EF4A 3ZX1A 1ILUA 4YSSA 2YXVA 5B1JA 1L9OA 2XVBA 1MZZA 1PZAA 3FSZA 1PZBA 2AANA 4BWWA 3H56A 3FSWA 2B3IA 1AIZA 1NIDA 2WO3B 3IEAA 1B3IA 2OV0A 3OMNB 2YAOA 1OCRB 2J56A 2VW7A 3OMIB 2YAEA 3NT0A 2XWZA 1AZRA 2IDQA 3SBQA 4E9XA 1CYXA 2J55A 2QPEB 1NDTA 2I7OA 1GR7A 1CC3A 4HAKA 1AOZA 5AKRA 3T9WA 3CG8A 4MFHA 1SFDA 1A4BA 3CDZB 4P5SA 2EIJB 1SFHA 1X9UA 2IDTA 3TBCA 3DKHA 1L9TA 4AZUA 1BYOA 1IUZA 1E5ZA 1ZIAA 1BXAA 2QT6A 2FJSA 3H4FA 4E9YA 3KW7A 3QQXA 3NSDA 3T6WA 1ZV2A 3NYKA 4M3HA 1JVOA 1URIA 4QLWA 1J9QA 2GC7C 2FWLB 4A2FA 1W8EA 3OQRA 5I28A 3OMAB 1PNCA 2HRGA 3AZUA 4JKNA 1AZCA 1M57B 3CZUB 3FU7B 1ETJA 2CJ3A 3OM3B 5FC9A 2DYSB 3X2QB 4A68A 3S3BB 3WI9A 1NIEA 2VSMB 2VSKB 5AZUA 4NB7A 4DP8X 2LLNA 2PPFA 4F7KA 4KO9A 2BP8A 3ABMB 3IE9A 1BQRA 3G5WA 1JZJA 3H4HA 3CVDA 2YQBA 4BDVB 1E5YA 2MRYA 4YSTA 5I5JA 3NSCA 2UXVA 2WO2B 1J9TA 4TXVB 2DWTA 1HAWA 5B3SB 2FT7A 4W9ZA 5D4HA 1V10A 4QKTA 4NERA 1PAZA 3OD3A 3EH3B 3NJMA 1NINA 2IDFA 2TSBA 2GC4C 1ZDQA 1NWPA 1PY0A 1V55B 3AY2A 1KDJA 1WAEA 3WKPA 2JXMA 2XXFA 4A2EA 3UAEA 1PZCA 3ABGA 3GYRA 3FQ2A 1AACA 2R7EB 2IWFA 1BQ5A 2PLTA 2HX9A 2JKWA 2RACA 4E9RA 2BHFA 2FTAA 3QPKA 1GY1A 4GY4A 1FFTB 4GYBA 1TEFA 3N55A 4N4YB 4YSPA 1AZBA 3TA4D 3EHBB 2NRDA 1QLEB 1BYPA 2TSAA 2J5WA 4HCIA 1SDDA 2GIMA 2JFCA 3N2JA 1NIBA 4AX3A 1A4CA 4G7QB 1KGYE 1XB3A 1AS8A 2AZUA 2X87A 4KO6A 1PLAA 4A2DA 4YSOA 2EIMB 1L9PA 2FQEA 9PCYA 1BAWA 4F2EA 1PF3A 2IAAC 2PPEA 1GS8A 1WA0X 2UX6A 4YVUA 4A2GA 1M9WA 2CUAA 3S8FB 2YAFA 3PXLA 1ZDSA 2PPDA 1L9RA 2HX8A 1IBZA 1IKOP 4BK5C 1BXVA 1E30A 5E9NA 1JZIA 4AKPA 2AVFA 3FU9A 1BXUA 5AFAA 4DP2X 4AKOA 3U25A 1DYZA 1PMYA 2GHZA 4YSCA 4DPCX 2E86A 1EZLA 1KBVA 1NTDA 3L45A 2ZOOA 3FSVA 4WTQA 4YSAA 2XLLA 3ZBMA 1A4AA 1ZPUA 3EH5B 2YAQA 3NJIA 2BWDA 4JHVA 2GB2A 3BQVA 1OE1A 3EH4B 1E65A 4GP5B 1TU2A 1IBYA 3QJUB 4DP4X 2BZ7A 3ABLB 3PPSA 2FQFA 1ASPA 3FU8A 4FA7B 3NJKA 2HXAA 2YAMA 4G7SB 4M4RB 4RH4A 3PAUA 5B7MA 3PAVA 5PAZA 3JTBA 2BZCA 1PNDA
chains in the Genus database with same CATH superfamily
5JIKA 2BVQA 2VXVH 4FFWD 1W72H 3M1OA 5BQDA 1HHHA 4Q97A 4YHYC 1OGAA 3N1GC 3KPQB 1H0DB 4DFIA 5C6WH 5AAWA 5T5NF 3FCGA 5F8RC 1XH3B 5IHWA 1T6WA 2TRHA 1NGPH 4PJ5A 4EAEA 1JNHA 2H0PA 3ILDA 4YAQB 2H2PC 4YC2C 5GGTL 5EEUA 1SJEB 4MDIB 2N59A 4KHTL 2ZXEB 4KRPD 2XPGA 2BVPA 1BBDL 5D7LE 3QI9B 3FUIA 3K81A 2E46A 2QEJA 4HHAA 4B9YA 5C0RH 1UZ6E 1JZHA 4O00A 3NUKA 2MWCA 3GHPA 5A43C 2Y2WA 3LMJH 2EC8A 4BM7A 1RURH 2W81C 2NXYC 4Q7DA 4HUMB 4KQ4L 5GSRB 4KVCH 2CDFB 2CKBL 4U31A 5TE6H 5GS0L 4FQ1H 1GGCL 2KDYA 3B2PA 3HW7A 3WGVB 1D5BB 4N8VG 1I85A 2VC2L 3D4GA 5JIQA 2PW2B 5I16A 3BAJA 5ENWB 1JGLL 2ICCA 3VVWA 2APTA 1IAOB 4KUZL 5I66B 3TYGH 1RZGA 2VDRL 4L2LA 5MHSE 1FG2A 3N5AA 1WWBX 1KB9J 1AAJA 5FLVA 1O5PA 1UA6L 2VQ1A 5J06A 2I9TB 5B3JF 5F3FA 5JA8B 4Z18A 3OZLA 2IANB 5IFAL 4BDVA 1CUOA 2EIDA 1QFUH 4LE8A 4DQOL 4HC1A 3TZVA 4L3CB 2DQFB 1L0QA 2ZX9A 3EOAA 5DJCA 5EZPA 1WZ1H 3V6ZA 3VFGH 4LPCA 3KJ4C 4I3SL 5HGDB 5KTEL 2J8UB 4BZ1A 1A7RL 2GPZA 4M7ZB 4I3RH 1EO8H 4KO7A 1QUPA 3AC0A 3SQOL 2MCG1 1JZGA 2A99A 2B08A 2WNGA 3GSVA 3MFFB 3KJ6L 2WWNA 4N2LA 4WIQA 5GJTL 3V6FB 5F7BA 2DWEA 3HBPA 4UQIM 4N20A 3WJJA 4EI5A 4U7KA 3TL5A 4IBSA 4NYLA 4D9LH 2R23A 1ZSDB 2XA3A 2AJUL 5IB5B 3MLWL 3QQDA 2QGCA 1QSEA 1PFOA 4JRLA 3FYEB 3TA3C 2JJSA 1NMCB 1T0OA 1FH2A 1R5VA 4NUQA 2RD0A 5DEGA 4NPYA 2CM6A 5EV7A 1R47A 3T4AA 4Z3JA 5EN2A 3HZKA 3G6DH 1MCWW 3SSGA 5F1NB 1KPVB 5EBLB 2MKWA 1ZK5A 2FX7H 3PP3H 5D72H 4PBVC 5FWQA 1G6RB 1CTMA 3MYJB 1GTFA 3VFRA 4JB9H 4ZTOH 1JZ3A 2ZYHA 3VGAC 4Z7WF 3GDCA 2I5YH 2BOBB 3ULUD 1P4UA 3DC0A 4JQXA 4JG5A 2VJ0A 3D87B 2AQ2A 3LRKA 4HALA 4L3EA 4XNUL 4J39A 1KG0B 1XV8A 4P2AA 3UAJD 5I5MA 1GTNA 1PX4A 2KMWA 3DROA 1EEUA 3KGRA 4G3YL 4MAUH 1WC7A 2E76C 5JPMC 3QDAA 2H3KA 4RGMC 4GLRH 2X41A 4N5UA 1UOVA 3VXNA 2OMTB 1A7NH 2FQGA 1BPVA 2AQNA 4ODSL 2PYEE 4PM1A 2Y7SA 1L9SA 1M05A 3LPPA 3AQXA 3N6YA 3QPQC 1GPOL 1WCBA 4XP4H 5FHBL 4FNLL 1WE5A 2E3VA 3NP3A 5TF0A 3SGEH 1FLRH 3VRIB 5CEZH 3PY9A 2G4GA 1UXLA 1MHHB 2VRQA 4PRHE 1FO0H 2WLIA 1C16A 1KCBA 1T5KA 5BMFH 1HZLA 1TTRA 4G1MA 3D39E 5IQ7H 1MG2C 2Y9RT 4OFQA 3PHQA 4YSQA 2V2TB 4CBZA 4N2HA 3V10A 1WFMA 1GCFA 4EN3A 1O75A 2QKSA 2ALWA 3MBXL 4CADA 2ZKWA 4E9TA 1UWYA 3NESA 4FQCL 1WTLA 5LUMA 1WWWX 4LSVH 2XN9E 3QDJE 4MSWB 1BVLB 3P3TA 4MX7B 2GJ6E 5IBUG 3IJYB 2P44B 3S34H 2DYPB 2OL3H 3DIVA 1MWAB 2A9MH 3D3VE 4O4YL 7PAZA 3K5RA 4QXVA 1KLGA 3LN5B 3F84A 3SDCA 4UIMA 3MRPB 1CLVA 1WLHA 4Y4FA 3X1FA 4KJPD 3FU3A 1UWEH 1Y1DA 3PWUB 4P2RB 2ZWZA 3QVAA 4J2XA 4ZX3A 3ARDC 2KPNA 1YAZA 4WK0B 4ANUA 2NYKA 1NEUA 3FSOA 1A1MB 1XSJA 1HX0A 2VDMB 4GRMB 4LSPH 3T8XB 4PS4L 1A6WL 5CJQH 5KEZA 3PUUA 3DRTB 4DT2A 4ZK8A 3KS0H 5MEQB 1RKRA 3L9YA 1JHKH 1N7MH 3CFKA 3HHMA 4DVBB 1BQSA 1VSCA 3OKMB 4BQ8A 4ELMB 3NDZE 3BN9D 3GSNB 2Z34A 3QIWD 4J8RB 2P46B 4POUB 3VD2A 3GBNL 1A3RL 3DI2B 4J3VA 4DESA 3C6LC 2ADIA 1GMIA 1A0QL 1AQ8A 2VLRE 1IGYB 5D1ZI 5A7BA 1E5CA 2O4EA 2Z31C 3B8SA 4DGVH 2GBTA 3DX1A 4E0RB 2IXQA 3UBXG 4K71B 3T65A 3EG9A 1CI3M 1EX0A 3REVB 4UUJB 3N43B 2YJLA 2A3TA 1R34A 2FHBA 1NCDH 2F74A 3G6JB 4MMZB 4WHTA 3RL1B 2ARWA 2EKSB 1F0LA 4WTWA 1QD0A 5AW0B 5DZAA 1N6QL 1ZE3H 2VDOL 3ULUF 3WUWG 1NC2B 2NSXA 2Y0SA 4E9LA 1CQKA 3IFNH 1Z2KA 1CFSB 1ZHLB 3RWEA 4AGPA 1VPOH 3U30C 4F7TA 2BIHA 1NDMA 2FJFA 4PREA 1EAPA 1M7IB 1U8KA 1HU8A 1MHPL 3DSNA 2JQAA 2HTLD 4PP1C 1IVLA 3CSTA 4AYEC 3RG1C 1INEL 5I1IH 3VD3A 4PJAA 4NUMA 4FL4B 1AKJD 2Y72A 4PJ9A 2R29A 2CNYA 2EDQA 4DGUA 4R97B 2GITB 1PZBA 4EI0A 4ZPTA 4A37A 5T3XH 3L4XA 4AQAA 4J1UB 2IPUK 3CVHA 3ZE0B 4LZKA 1RU9H 3QS2A 1HIMH 1BVKA 4JFWA 4KKLC 4XAKD 4DERA 5GXBB 3EKCA 3V6OE 2VW7A 4RAUA 2BIQA 5CCJA 5I30L 4TNVK 5KS9A 5FLUA 2NY4C 4BBWA 2NY3D 1GR7A 3QJZA 5HDQL 3T0VA 4Y8AA 5TFSL 1AGFB 3V9FA 4HJ1A 3N50A 4M4RA 2IH3A 4UILH 5HYJD 3MV8A 4I13B 3S88L 3V4VL 2ZKHH 1J8HE 4EVNA 5DR5L 3L4ZA 3C5ZB 3CQQA 3RKPA 1JI1A 1E40A 1IC5L 3JZYA 1ZIAA 4IKIA 4UAOC 1YVLA 5IBUB 1U3HA 1I1AC 4JFVA 1R3KB 2CRMA 2AVGA 1JWUA 2R0KL 3D2UA 4TUKH 3T6WA 2F7IA 4CJ1A 5JHLH 3L17A 2QFPA 3U1SH 2Y1ZA 4O02H 2AXWA 3QXUA 3B9EA 3ME0B 3BXNA 4FA6A 1TITA 2X70A 5A40E 2VDQL 3ATAA 3H9SA 3R8QA 2NQDA 5FUCC 4UT6H 5FO9A 5J13C 1UB6B 1TT6A 4JKNA 4AVIA 3FU7B 2WIIB 3IPFA 4N87A 4ZTEA 1MLCB 2BH0A 4O2CB 1R19A 2W59A 4L8BA 4D0CA 2QR0B 3VI4E 1DBML 4NB7A 2COQA 1ITBB 4ZUWA 1KEGH 2B77A 4OCYH 3F7QA 5D7LD 1IC1A 4Y2DC 4TVUA 5E99H 5ACZB 2XICA 4J4PA 1IAKB 3GI9H 4DAGL 1NLDL 2HVBA 5CJXC 4D3CL 2GW5A 3WYRA 1WF5A 1S7WA 3VXRD 4PTTB 2CJTA 1NDGA 4HPHA 2EVHA 1BQLL 1NINA 5J5EA 5F1IA 2HP4A 2IDFA 5DQJA 3HPLA 5C0DB 3UBXB 2YD4A 4WCYL 3BKYL 3EGXA 5K39B 1NCIA 4NO0D 3RGVB 3FT4A 2QQKH 3WFCH 4XP6H 4FFZA 1IJ9A 5HI3C 1WV7T 2N1KA 4QHUA 2WNXA 3LHPL 4HCRA 3PQYA 3E3QE 1MFBL 5D1XB 4BH8B 3LZQA 3T0ED 4AQ8A 4FJ6A 5EC1B 4KFMA 3BYTA 5BVJA 4Z1PA 4HC1L 3QB7C 2FHCA 1A6UL 4HG4J 1GY1A 1MY7A 3G5YB 4N4YB 5LGHH 2NZ9C 3ZE0E 2ADJB 3O8XC 3NFNB 3BT0A 3EJYD 4JHZA 1UB5A 5BXFA 4BZ1L 3VDAA 2GIMA 4JANA 3N2JA 3NGBB 3NZ8B 3WY4A 4K3EL 2V0AA 1UCBL 2MMXA 3FONA 5EU5B 3FO0H 4RIRA 4PRIB 4U0RC 1HWHB 2WN3A 3OAWA 3MRLA 1E9QA 4JY4A 5TPWL 5AD0B 3O2DA 4A55A 3MRGB 3MLUL 1KIRB 3DHJA 2NLJA 3BHBB 3VFUB 4MCMA 3S8FB 4XNMA 4N1HB 3APNA 3GMMB 3D5OF 5BZXA 4IIQA 1TF4A 3BO8A 5KYWA 1J05B 1XL6A 5J56B 4A7GF 2FIKA 4BK5C 4FXKA 3L7FB 1ID5I 1U41A 1OAQL 2BC4B 3DMMA 4S1RH 4AL8C 5CZRA 3LIZA 2ZSWB 3ILQD 3UJTL 2GHZA 2HTKD 5E23A 4YSCA 4ZX4A 3CLEL 2J4WH 4PVBA 2E86A 5ECJE 3CBKB 5IB3A 3L45A 2YMXL 3CN4A 1A4AA 1O7SA 1JV2B 3O3EA 4KDTC 4UV7H 4UOJA 1ZPUA 2EXYC 2CQVA 3MNZB 4APXB 3BQVA 4Y5YA 4JRYA 1SN2A 3PWPB 2XACC 4JO4H 3HG1A 1BOGA 3RU8L 2Z91A 3ESNA 1EVUA 4Y9CA 4BHUI 4G9DA 1X7QB 1B6DA 3QI9D 3US1A 1RZ7H 2EDWA 2HVKA 1TQCC 4LL4A 1Z9LA 1SHSA 2H1PH 1RIHL 5C2BH 3BQUC 5HVFB 4NI6A 2DMBA 1IIIA 4LDCA 3R7QA 4N22A 2FCBA 2H0EA 2NNXA 3ZDXB 2B14A 4NPJA 1YPZA 3LKPB 4U1MB 2FJGA 3NJLA 1IKNC 3X1BA 2Q76A 3U4EB 5E6ZA 3VNYA 4PP2A 3EYOA 4X4ME 5CFAA 2WQ8A 1EMTH 1KN4H 4Y1SA 5TQ0L 2PYED 3IDGA 1NCTA 1XTLA 3KPPA 1A9EB 4G7YH 3L81A 1I8KB 5DRWA 2HKFL 2A9CA 3HA0A 3AADB 3S3CB 4ZYKA 3I9GL 3CFCH 4AIXA 1HH9A 4I18C 4ALAC 2EVJA 2BVTA 3DUSA 4G6ML 25C8H 1T1WB 2IAND 3BP5B 4I2XB 4PRHD 4GQ9H 3MOAL 4N6RA 4HCGA 2YXFA 2GJJA 2O6FA 4LVHB 4PTUA 3WIHA 5BUPA 2AEQL 1N5AA 4K5MA 1CGUA 3LZLA 3L6FB 2H26B 2JJTA 3FH8A 5EZIL 3NACL 1R24A 3OKOA 4OD1L 2WNWA 4HJGA 4GRLA 3I9IA 4H1LG 2FX8L 2B2XL 3BWAB 1DLFL 4XWGH 4N0FB 1XF3B 4LKXB 4IMKA 4MXVF 5AL0A 4XP1H 1OAUL 3L3GA 2IALA 3E1F1 5CCKH 2A74B 2CIKA 4MWFA 2W94A 1RZJL 3FQUB 2VERA 3DGCR 2V7HA 3F5WB 3EYUL 4XI5D 1KTLA 2GJ6D 3QIBB 1HZHL 1BM3H 3UZEC 1T1XB 2F1AA 2X3BA 3MRIA 2DDQH 1BYNA 1UM4H 3D3VD 3PGDB 5FUZL 4AC4A 1RVFL 4R96B 2WUCH 3I6SA 4TSAL 4DO4A 4G80B 4TLSA 5D5MA 1MHCA 5DRXB 4YNYB 4O2FA 4OJCA 4W4NA 3O6FA 2EYTA 4NPKA 2Y36H 5KJRL 3LRSB 3CX5K 1KWGA 1J0JA 2QZ5A 1T1YB 4X99A 4Y19E 3UPAA 3VFOB 3GSXB 4YEEA 1ZV5A 2LW3A 4F2MA 5I6MA 1W6WA 1TQBC 4KMTL 4Z7QB 4IKJA 4OCLC 4ZT1A 4P9HL 1JN6B 2W80C 2DQEH 4FQIH 3HS0B 1Q9LB 5DGQA 5GZOC 2HYMA 3LKNA 4AGMA 2F61A 4HYTB 3M8OH 5C6TL 2ARJQ 2WK2A 3RVUC 2QADB 4ZZFA 1UKQA 5HHVH 4NAJA 4UANA 3QXTA 2ZKYA 4X5PA 5IM7B 1V7NH 3W2DH 1KDIA 4ANXA 5KVDH 4LEOA 2BSRB 1FYTA 4IRJC 4R9HA 2VLRD 2UXTA 2X2HA 3VAEA 4ONFL 2GJZA 4HUWB 1KFGA 4QI3A 2BRRH 2AJZA 4FQHB 3RQ3A 4D9QE 5D1ZA 4U6YB 2B3RA 1JWSA 3O3BB 5EUOA 5A2CA 3HRZB 3PFQA 1HH6A 5KUKA 3WE1A 3FT2B 3GXDA 3OAZK 1EAQA 3LRGA 1TETL 3FFDA 5LCVA 2H3NA 4LLWA 2D3VA 3RWJA 5IOKA 5BZDA 3LSOB 2BM3A 3DX7B 1Y0LA 2F58H 3DUHA 2VTFA 4N0CD 1J1XH 4XPBH 1QBLL 2R9HC 2QV4A 2HJLA 3C87A 3LN4B 4WO4C 3BGAA 4CVXA 3EJJX 2WZ5A 3RL2B 1AGEB 2UY6A 4LARL 5H4ZA 1U8HB 5H37H 2DQIH 2R29L 2FO1A 4QRRA 4P57B 3WU1A 3RTQC 1U8CA 5CEXB 3MLTB 1P1ZB 3FK3A 4ZMYA 1ZTXH 5FO7B 3ULVD 3MN8A 1UJ3A 1NSNL 1QFWI 2DL9A 1QW8A 2WINB 3FTSA 3GSRB 4IKNA 4WV1C 2YRZA 4Z7IA 4HPOL 3LEXB 3CXFA 2CNZA 5C09B 2DYPD 2WMPB 3DUUB 3ORJA 4RZKA 1F02I 3WLBA 1T3FA 5D2NC 4A7VA 4J6RH 2J6EA 1IBDA 2J8UF 2BW4A 3BZ4B 4NP4H 4TVPE 4YR6A 3ULSA 1CE1L 3V4LA 1IFGA 3NIDE 4P0DA 3QJTB 4JM2C 5JXEC 2P5WB 3HPJB 1YNTB 4QNPE 3CVIH 1ONQB 3SOBL 3MDJA 1CFQA 5BRZA 4MS8C 4OLVL 1P5UA 2GI0A 2PCFB 3CK0L 4MS6A 1LO4L 1U3JA 5I1HL 5AOKA 5EIIB 3TH2T 5I0VA 2VLJA 2YARA 3JT0A 4Z5RA 2V2WA 5DK2A 1J1PH 4YC2B 2FX9H 2X88A 1L5GB 3MA7A 5FFLA 5IEKA 1F58H 3TURA 3U6RA 3WENA 1ASQA 5HYFA 4PY7A 3VU1A 2P42B 1RP9A 2WXOA 1PKQA 1U8QB 2IWKA 3P77A 4NM4H 3UZVB 2OJZH 2H9GB 4S1SH 4S0SD 2FO8A 2NXYB 4XX1G 5I0WA 3QRFM 1ZEAH 2VMJA 3Q8CA 2WJ7A 4XC3L 1FHGA 5I2IB 3O3AB 4OZFA 5E1HB 1ORQB 2BSED 4BEIA 5GGQH 3AAZA 5D7JA 3GKWH 5FW8A 3MFGB 1G7PA 1CG9A 4E9SA 1NGYB 1DEEA 2V3FA 5D8JH 1S8DA 3IGUA 3U82B 1YMMB 3WE6A 4LSDA 1KIPB 4UOW1 1VRSA 3F7VB 2OX5A 1SDDB 3MZGB 2CR0A 1NC2D 4JY5H 4XXWC 3PL6B 1OVZA 4IMLA 3L3OA 3MBWA 1G4RA 2JLLA 4KY1L 3TN0A 4GOSA 1KPUA 5GHWH 1F11B 3ARGC 3IRPX 1PQZB 3JYCA 4FFZL 3L2LA 2PTTB 1NWOA 3TCLB 3OHXC 2HN7A 3OLGA 5I1DA 4Y9GA 3KJ4B 1OL0A 2NX5E 2UX7A 2Z93B 2KPWA 5BRQA 2KLTA 3FN0L 1G7MA 1X4XA 1MFDH 4MD5B 1TCRB 4YDLB 1P6FA 3FO2A 4G43B 3KPSA 4RA0C 3BJLA 4XOAA 2BVOA 4TL4A 4TSCH 5CGYD 1QRNA 1G7HB 1QZNA 1YSOA 3H2WA 4X6EA 4J3OF 1VKXB 3QNYB 3BH8B 3CCHB 4AQ1C 3ARYA 2XKNA 3Q2CA 2A1WH 4UZSA 1FO0A 3WJMB 3VD0A 3DPBA 5DJYA 4GW4B 3STZA 2M2DA 2APXA 1ZA6A 3O2DL 3EO1A 3GMPB 4ZOEA 3C5ZD 3LQZA 5DJ2A 3TA3B 3ULVF 5DMJB 4NKIL 1G7IA 2ITDB 5FK9A 5AYUL 4XVUD 3IU3B 1KBPA 3FQWA 4UM8A 2VUKA 5BV7L 1MFNA 3IJHA 2YAEA 3QQ3A 4R7NA 4X7TA 5C0EA 2WBWB 4XP5L 4E36A 1ZT4B 1VJSA 2ID5A 2J55A 2PYFA 3MRDB 5JDSA 4W9EC 4A2LA 5E94B 3F7YB 1NFDE 2YZ1A 4R3SA 5ADPH 1BW8A 3WMPA 4GRWE 3QXWA 3S36X 1H5BC 4JPKL 5FM5O 5DZ9A 3VGAB 3HAEA 1IC7H 1OGPA 4EOWH 5C86A 2ICEB 4FYSA 5D93C 2CIIB 3IJEB 3SE4C 3WUZA 5KSBA 1G43A 4UMSA 1W0VA 2WO4A 5GGRY 5TDNA 3CU1A 5FYJL 3VXME 1T0MA 3A23A 5TD4A 4OLZH 4JJ5B 4LCUB 1QO3A 3BISA 5IUSA 2V5YA 4OV5A 1JXJA 1QYGL 5JPMB 2R0LL 3IJ7A 4N8PA 1AI1H 4OVUA 1Y7VA 1O6TA 2FWLB 4ELMF 1W8EA 4XP9L 1B4JL 3EADA 3HG5A 3ARRA 3BUTA 4BHUA 5E08H 5DI8B 1YEDA 1HINL 3EGSB 1KJ2L 4FCAA 4KFZC 3VI4F 5DC2A 4AT6A 4KRLB 3QZPA 1CLYL 2PPFA 5CJ8A 2WQUA 1ADQH 4UINH 3SKMB 1HL8A 3UTTB 5CIPA 3ZZQA 2CBOA 3G5WA 3OAYK 1UOLA 3N43F 3CFEB 3L2NA 1QQDA 5IVNA 3QEHA 1ETZB 3BDXA 3G6JF 4X6FA 5LBVA 3FB8A 4DCQB 3VSVA 3E9TA 1L7IH 3FC8A 1CD1A 5HGHB 4RMVA 1SN0A 4FC3E 1AGCA 4RZCA 5D1QA 1E50A 5DD6B 1ACYH 4QYOA 2PWGA 4GXUN 1KYUA 2CUHA 4JO1H 2GC4C 4OZGB 3KHOA 3GLZA 1BOYA 2WLLA 1RZFL 2XXFA 4JAMB 4G6KH 5JW3H 1YA5A 1ZV9A 3DJ9A 2DJSA 2X0VA 3LD8C 1FN4B 3PWNA 4M6AA 3TESA 4NHCL 5CP3A 4PRID 2DPKA 2ZIDA 4TS6A 1AACA 4NGHL 2J6WA 4PJAE 4RRPG 3EZJB 2PR4H 2FTAA 4R8WL 5AW4B 5HHOE 3ZE0F 3ARDB 4E5XA 3N55A 3ML8A 4YIQA 5DQ9A 3VJ6B 3TEWA 3P0YH 1WSST 4XWOC 5IMMB 1GZHC 1JPST 1MEXH 1PX8A 4W81A 4HLZH 4KZEL 1S2EA 5E00A 2NNAB 3BH9B 1XB3A 4QHMB 5AVZB 4R83A 4M03A 3JXAA 1TSHA 4LRIC 1AIFB 4MTMA 1HYSD 3P3RA 4NEHB 4Z7UB 3VFTA 3EOTH 2DIBA 4LP4A 1UOKA 3V8CA 4K8RD 4Z0XA 3MODL 5J9PA 1N59A 1OP5K 3U7YH 5LAPA 3QR2A 3QCTH 3PWPD 3AQZA 4HU2A 1MXDA 1KXHA 5CD5D 2Z31B 2YD5A 1X5KA 1N6VA 4ZRGA 3SY0A 5KG9B 4W9FC 5KSUA 2VKWA 1E3ZA 2QPSA 3BPOC 2AEPH 2CLZB 1ZGLB 3B7UX 1NFIB 1GYUA 4RMQA 5JHLA 3BKML 3O4OC 1YEIL 3RJQB 4I48A 3T4YA 1KYFA 2ZWLT 4O02A 2X12A 2Y7MA 2ZX7A 3QC6X 1A2YA 1BFVH 3NJIA 5C7XL 3UO1L 1DE4B 2CLRA 3GIZH 4AVJA 4BFEA 5ESVA 1G7LB 1VDGA 3U30B 3GMLB 3ZDYB 2K9UA 1M1XB 2VR6A 2QVMA 4NN6C 2IQAB 3GRGA 4HH9B 1FVCA 1S46A 2EH8H 2DMGA 3J07A 4XNDA 4L2YA 4TTDD 1UTDA 3PAVA 3KWXA 5GIRB 3FCSB 2VXTL 3B9KA 2ZOTA 1FNFA 3CZLA 2OMUA 5LCVL 1CT8B 4ODXA 5LBSA 4PJFE 1IGCH 2QQNH 2VE6A 5TH2B 1FC2D 4D8PB 4PLJC 2DI7A 3T2NH 1Z9SB 5C0CA 1EV2E 4NQSA 1EDYA 2DD8L 3CDCA 5DD5H 4A6YL 1Q9KB 3THML 3X13A 3S36L 4PG2A 3M6DA 3FTGA 3LXAA 4IRSD 2A6DB 4U1LA 3REWA 2NY4B 1BZOA 2DWDB 3ZDWA 5CD3B 3PNWA 1N8ZA 2SODB 4N2DA 1OAJA 1Q9OA 2UUDK 4XVSL 3VFWB 2E27L 1EPFA 1DUYB 3VMPA 3T5WA 1LO2H 2YKLH 3SPVA 2ICWJ 2AABL 1QASA 2JB6A 5E2VL 1NBYA 2C3XA 3ZTNH 2C3VA 2Y1AA 3DYMA 3WD5L 5B8CB 2J6EL 1FIGH 5DT1H 1I1AB 3A5VA 3U1PA 2HKHH 3P1VA 3BRFA 1MNNA 4TVPD 3RZCC 1BZ7A 1GYWA 4GBXC 4AEHL 3OX8B 4NHUA 4WGKA 4UOW0 2BFGA 5F0PB 5GGRA 2Z4QA 4YDIH 5AB1A 5T1MB 3D25A 1A6ZA 5J13B 2CR3A 3WEXB 1H6TA 5IQLA 4FERA 3TJHD 4QTHB 1A6PA 2DQ6A 1W16A 4P3CH 4Y5VC 5L4JA 4PIBA 2FEDC 3X3FL 3U9PH 1DBBL 1ASOA 2VXQH 1FJ1B 1X4ZA 2MTPA 5CWSB 5I6LA 3QRBA 4IKKA 1UCTA 2QADD 4Y2DB 1AXTH 4HUVA 2YMTA 1ZWIA 2ZAHA 4J3OH 3QNZB 1LGVA 4M6OL 3ZTCC 3TFKD 3IPEA 2AK4B 4DHLA 4YQXH 4L1BA 2ZPKL 5GRVL 4KROC 1AC0A 1ACCA 4JPQA 4OCWL 5K1VA 3DGDA 5LB1A 3SDYL 4OI8A 3Q6GH 2MPAH 3MX0B 3P54A 5E8DL 1QHPA 2VQ4A 3ZZSA 4LCWA 5JW4Q 3DOSB 5FYJE 3J7HA 3STBA 1M1SA 4U6VH 1U8NB 2D3JA 3IKCB 1KENH 1MWAH 5HGAA 1UADC 4ZFOA 3FRUA 3IBEA 4Q52A 3ARBC 3ZDXF 3ZHLA 5CMAB 5I82A 3RWFA 3H3KA 4P8QA 2XUWA 3PJNA 3KLHD 1XGRA 2CG9X 1YPZE 2FWUA 3MA9L 4N2GA 3RWIA 5JXAH 5AB9A 1A1NB 2XFXB 3EDJA 1GIGL 2VDMH 3ASOB 3IM1A 2N7AA 3O8XB 4P5RA 2LU7A 2NX5D 4ZQTA 3UYRH 4I77L 1E4XL 2RQEA 3BSZL 1I3RB 1WYJA 4N6QA 1G9MC 4CC4A 4AM0B 2XRAL 4WFFD 3L9RB 4EQ2A 2HT2D 3T77A 2F19H 3T6XA 4U0RB 5J6HB 4M43L 4FFYH 5SWZA 1U3NA 3F05A 1U36A 5LAXA 3AT8A 2CMRL 2YSTA 1HXMA 3EBHA 4J27A 5DWPA 5C09D 4QHLA 1NM9A 4TQEL 2K6ZA 1D5ZA 1TQSA 2ORBL 4FHJA 3S0PA 5FW7A 3B2DC 1B0RA 1I85C 3Q2LA 2W0FA 3O6LH 2BWQA 3PRZA 2OK0H 5BW7C 2BIIA 5FA3A 3FTYA 4GEIA 1GAFH 3QRGH 4BA0A 2W38A 2R0ZL 4I0KA 2Z35B 3CDZA 4HEME 2AZAA 4Q6IA 2P5WD 1MCSA 4UIKH 5IROA 3APDA 2V33A 4DGYH 1E5BA 1U8MA 3TM6A 4M7LH 3GHEL 3KH3A 1QLFA 4RBPH 4XMWA 5ADOH 1G7JB 1PX3A 3WDJA 4IHBA 4PWEA 5KYYA 3TZVC 4LGSB 4LCIL 1WAAA 4MJ5A 2H2PD 4XCNB 2HUEA 3U48A 1UJTA 5DJ6B 3UYPB 1RUKH 3CC5B 1KV3A 1UVQB 3C75A 5D5ME 2R2BA 5CR8A 4M1DL 2QGBA 1TQCB 5E6IA 4JO2H 1NEZA 5C6PB 3ZUCA 3KBFA 1F6AA 1VFAA 4JFQB 5I9QC 3V4PH 2NXYD 4GG8A 3VXMD 5I0YA 4XPHL 1EERB 1INQA 2X4TA 5KYXB 4Z7QF 4NLAA 2X2UA 2FJHB 4R5XA 3K6NA 2DV6A 1TVDA 4F2ME 4Y1AB 5F9JA 4FA8A 4H88H 5MENE 5KYWB 1EDHA 3S8WA 1TYRA 3WJJC 2BNRE 3BD3A 2BNQA 3N40F 4LB8A 4PB0H 4ZDHB 3RWGB 1S9XA 1M2VB 3I2CH 1PG7X 3BZ5A 1JPTH 2CBPA 4ICWA 2YPLB 4NJAH 3KVQA 3H3BC 5DURB 3GXMA 3TBYB 3QO0B 3MTRA 1KOAA 2E7DA 5E1AB 4I18B 4H8WL 2HLAB 4GKLA 1KJMA 3ETTA 1BDYA 1JZ6A 4JFHE 4QOKE 4RDBA 4DWHA 3VW3H 2KQMA 3C2AH 2R15A 1CGXA 5I71C 4KZ0A 2ZKMX 3LPGA 3GF8A 1NGWB 1AMXA 3CE1A 4KDVA 4UQ9A 5A7EA 2NW2A 4PD4K 3TPKA 3MUZ1 3ARTA 5IHLB 3II3A 5IFHL 1ET8A 2ADGA 4YWGL 4J23A 4MB4A 5ES4B 1YEKH 4M6NH 1A6VL 1Q1PA 5DVNA 4MA3A 3VG9B 5SWQA 1YY8A 4JQXC 4I87A 3W9EB 3FQXA 1S9WA 3ZL4L 4YEFA 3MV9A 4UQAA 2I07A 2X53A 4WUUE 1BP3B 4Y2OA 4ZMXA 1PZ3A 4Z77A 1NPUA 4KU1A 3L95A 5EOCJ 3CFDB 1KCKA 4QGTA 1J0HA 4C57C 5K9OA 3P4NB 4TQHA 1MLBB 1WGOA 2OMYB 5HHOD 1U8PB 4MQ7A 4YDKH 4F5CE 2EVGA 3ZTJG 3TA3D 1MVYA 3TX4A 4FTVB 1BAFL 5E8EA 3T1FB 1RUMH 5I6NA 3SCMC 1P5VB 1TQBB 3UMNA 3W0WA 1VF5C 4FFVC 1KGIA 1OARH 2X4UA 4PW3A 1YDPB 3KLLA 4UM9A 3FPXA 4EIGB 5FKAB 4HQQL 5CXPA 1SYVB 2F53B 4K0OA 4WY7L 5D55A 4KKBC 4WU7A 4TLUA 2UWEE 1PZAA 1TKWB 1H15B 2D3NA 4NC1E 4U1IB 4EN3C 3JV0A 1YNTF 1F4YH 3G6AA 4BZ2H 1S9VB 4UOQA 5KN5A 3H7BA 3GQFA 1B3IA 2K7PA 2XPZA 4OLYL 2XWZA 3K6SB 2CO7B 1XXFC 1F45A 4LRNH 5BQ7A 2QPEB 4TRPH 4NQCE 2UZXB 2JV6A 3L3HA 5AKRA 4GKNA 1BMGA 1M71B 4WWID 1X9UA 4F91B 2IDTA 1CLOH 1OCWH 3RIFF 5A2LH 3U46B 4XNXH 1MFEH 5C08B 3QPQD 1E6JL 1A6AA 1IUZA 1MJ7H 2X6MA 4KMLB 4UV4H 4Y4FC 4P59H 4ZO8A 1PKQE 3CUPA 2F7OA 1QRKA 3WOVA 2BS8A 1SN5A 3UTTD 1H6EA 1RK1A 2NW3A 5TF1L 3DDGA 3CQFA 2DRUA 1JVKA 3VB8A 1GW6A 3D0LB 5E8NB 4JN1H 4XB7A 1WDAA 4AENB 2ODIA 3RVTC 1BD2A 4JFOB 1FZKA 4V1DA 4WO4B 1OSPL 5C07E 3V5DB 5LBSL 3E8VA 4X80L 1T89A 4UQ3A 4U7SA 2DAVA 1S9YA 4GMSL 4G8IA 2P8LA 3DTXB 1MJUL 3RTQB 1C1EH 1PD0A 4OCXL 1HE7A 1XGTA 2AMUA 5FM5M 2VL5B 4OLWL 5DHXB 5HSFA 3NZHH 2XC8A 1FL6A 3K6DA 1KT2B 4XBPB 1O7DC 1KB3A 4WV1B 2BP8A 4KKNA 4XNQB 3VYOA 1LHZA 1RSFA 5I5RA 1HWGB 4PUBL 5HHNB 4TUOA 4LSRH 4AK1A 2CHNA 3MV7E 5D2NB 5DDHB 5E2JA 4PJ8A 4DEPC 5T1KA 3CZFA 4FOMA 3HE6C 1D5XA 3QUMB 2GJPA 1AQKL 2P52A 4W9ZA 1DVFA 4P48A 5HHMB 4NERA 1SOXA 2G9HB 5CINH 4JM2B 1A7QH 4GIAA 2KZKA 4D7BA 4XB3A 4Z0BL 1D5MB 3ARDD 4V2CB 3BCFA 4ORGB 2IBZY 4CVZA 3VWKC 3KPSE 1QFWL 2YUWA 1PG7L 5GGUA 5KSVB 4RX4A 3ZQWA 3UAEA 1T2XA 1PZCA 5L0QC 3ZW3A 2NY5C 3X12A 4M6MH 1AFVL 2FATL 2APFA 2XTJE 1D9KB 1OTTC 4WNSA 3RUGB 1QWUA 1G9NH 3MUGA 5E4AA 1CDYA 4M3JA 3VE0A 2WKOF 4PJ9C 3QPKA 4R5VA 2NZIA 5F97E 1VZHA 4GYBA 1BZ9A 5IP4A 3C6LD 1IBGH 1P2CA 4HFUH 1FUNA 1OSEA 1YN6A 2Z31D 5H2BA 5L2JA 4KTYA 2PCPA 4C83A 4FQXC 4P5TA 2X87A 4OM0L 4KO6A 2DLTA 1L9PA 1KIUB 5DHMC 1PF3A 3LNHA 5EPMA 4RSVA 5ESAB 1UM6L 4U6XB 2BS71 2X6VA 2CUAA 2F54E 1JGEB 3V5KB 4Z95H 3K4AA 2PPDA 4QRQB 3UDWA 4MCZA 4U3HA 4LFHG 3SPJA 1QATA 5B39B 2QTVA 4R6UA 3S96A 4GXUM 4YPJA 3HBGA 4YHKH 3VI3A 2CU9A 5E9NA 4OFYD 4L4TA 3ARGB 3OF6A 5IBLC 3OR7A 4PP1D 1FFOB 1SOSA 3OHXB 2HVJB 4POZC 4ZFOL 3UEQA 4BFJA 5EA0L 5IVXB 3WY2A 3BPNC 3ZBMA 2X10A 3QEQE 3TIEA 3U9UB 3B56A 3Q8FA 1T20A 3KE0A 1ZVYA 4GIOA 4FMFA 5BS0E 3SE9H 3QJUB 4TTGA 1QTYT 2JKXA 3L3KB 1WD8A 1PZ2A 3B3IB 4NZRL 1BFSA 1MUJB 4GKZA 3PP4L 5AZ2H 4KKLD 3V5HB 1U95A 3JTTA 3GSUB 3MRHB 4KRMB 4QJ4B 3WELA 2ICES 4KXCA 1EAJA 4FRWA 2CKBB 3KAAA 1RLWA 5K1JA 1KMGA 2NY4D 4LLVA 3L3JA 3M1CA 3V6BR 2VZUA 2OMWB 4X8JB 4YLCA 4NRXB 1F3DJ 2GTWB 4J4PC 4L8DA 4PEEA 2JKTM 4HK0A 4GEJA 5HHME 4UU9B 1DBAL 1PZSA 4QYAA 3RX9A 4XB8A 3APCA 1MCKA 4OZGF 1WBXB 2V2XB 1WUZA 1I1AD 4I89A 4IU2A 1J1OL 4ZTPL 5TK4A 1T21B 3OGCA 4H0LC 4ZFZA 4PJIA 2C3GA 2NMSA 4CVUA 4JL1A 4P04A 1PYWB 2PW1B 2Z9TA 3PIQB 4I5BA 2R69H 4G6JH 1MHEA 3KGSA 2GUOA 4IW4C 4KI5C 2VAJA 3FB7B 1N0XL 4PJEA 2CCWA 1JGDA 1JK9B 5IWLC 1JGVL 5DTFB 3TT3L 5D93B 4BFKA 1XH0A 2NR6A 4JDEB 1X5XA 2LAAA 5I18H 4MAYA 1QR1B 2P4AB 4Y0GA 2MQGA 4PJGB 1FVEA 3NJNA 1X3DA 4DN3L 4HWZA 3W11D 4L29A 1LP9E 3MNDA 4Y2DD 2E9JA 2L7JA 2LVEA 4G1EA 2YPVA 1ZANL 2WUBL 5FYKH 1TZHB 3ET9F 2PXYC 5ID0A 1MJ8H 1RZKH 4XN8A 4Z7UF 3OKEA 1T7XA 1H3PL 5FDYA 2MCAA 5FB8B 2DQGL 1QFOA 5E9DE 2FZ3A 3AREC 3BP4A 5D4JA 2HB0A 1FE8H 3D0VA 3ASNB 3O4LB 4OCRH 4LLMA 2H32B 1PVHA 4IIQC 4HKJB 4JFEB 1IM3A 3DOHA 4FXGA 5E2WL 3L3DB 4YHLL 5I17A 3QJSB 5I1EL 4H25A 4QRBA 4TULL 2Q20A 3FO9B 2CHDA 2R1WA 5F88A 3CHPA 4LLQA 4IHOB 4O5LH 3OC5A 1KCSH 1KGUA 2B15A 2LLGA 6PCYA 1N4XH 4KAQL 5FS5A 4JFFB 1Q90A 4M8QA 4GAJL 4QOKD 1G5GA 2TRYA 4X9IA 3UL4A 1SF5A 1UEYA 3HI1A 1E3XA 2NZ9D 3MUY1 2H41A 4Y5YC 3NEXA 3O8XD 4ZUTB 1L7TL 2DWSA 4XCFH 5BCAA 5B7EA 4G6FB 5L6YH 4GW1A 2FJUB 5CSZB 1JZ5A 3JYBA 2B9BA 4G6AC 4OJAA 3VSUA 1IE4A 4CA4A 3B83A 5TE4H 3OXSA 5FX3A 4X4YB 4OM1L 1T2QH 3QDMB 1JZ4A 3QH3B 5GRXG 3M88A 4HV8A 1XMEB 5I8KL 3EZ8A 3IMUA 5I8OL 1YEWA 3A4DA 1QLEL 4JO3L 3KZ8A 2B5IB 3BIKA 1Q72L 5EWIH 2FB4L 4ISVB 5HHQB 1SNRA 2D31A 2XIDA 2X3CA 2K78A 4YBLC 4WTZA 3BI9X 5CZVL 5C3LD 4Y89A 3QUHA 5FCUL 1S7RB 3FQYA 3VYPA 1UACL 2A0LC 1YJDL 4OF0A 3S4SA 4HWEH 4C56A 1I1YA 4HCFA 5EZJA 1NICA 4WUKL 2EQDA 1HVXA 4HMDA 2A9DA 1E28B 5L2KA 1MIEH 3FBQA 2EXYD 4K94C 1H9VA 1ML0A 4AW7A 3TBWA 5KSAA 1AHMA 3QUZC 4K3HA 3NCEB 3SBWA 4L0YA 2L7UA 3WFBH 3ZT6A 2KC0A 1YC7A 2OCFD 3IETA 5L9DH 5SV3A 1SUHA 8PAZA 5ECGA 4BFIA 4XZUB 4GRLC 3P4MA 3BPOB 3F7KA 3QPXL 1CLZH 3VQMA 5IV2A 2CCVA 3BQUD 1F4AA 1LEKB 4IMKC 4WEBH 5E2TH 3SDXB 5GS2H 1NMAH 4ODHH 3QG7L 1DQDL 4JLRB 4OQTA 1QSZA 1RZ8A 4AMKH 2ZWNA 1VACA 1VEPA 4NO5B 4LEBA 3QORB 4TNGA 4HX1A 4Y1AD 3EFFB 4L18A 3ARWA 1DR9A 2ZXQA 5D7SH 2LLLA 4UTAL 1RZIA 2VITA 1TZIB 1D7CA 1G9ML 4Q89A 1PGRB 4PVMA 1KB5H 2N56A 5FGCB 3P73A 1GGBL 1FHNA 1EH9A 4I4WB 4RMSA 2YPLD 5CZKA 1W0WA 3QIUA 3VXQA 32C2B 4LLYA 4Y4HA 3BZFB 2BERA 2Z7WA 1UA3A 3SKJL 1D6VL 3A4AA 4IGBA 2WXQA 3QUKB 3BEWA 3MLSH 2W07A 4HBCH 4HIHB 4JX0A 1O6SB 2APBA 2IH8A 4UDTA 5CLTA 3TLRA 2BP0A 1LK3H 3BE1H 4GLRI 4XBGB 3ZN6A 4FXLA 2ZOKA 4PRPB 4LCWE 1IFHL 4DTGH 4ZMOA 1E2VA 3T0DA 2OZ4A 1AHWA 1T4KA 1J7VR 3HMXH 2OQJB 3GJFB 3EUUA 3HI6L 4JFYB 4JM4H 4LSSL 4LAJH 3Q1SH 5E4EC 4M7JL 3U4AA 1JTTA 3LZFL 4MDJB 1N3NA 1DUZA 3H9HA 4GT0A 2HFGL 4CKVX 3NFPB 1C7TA 5FA4A 4PB9L 5DUPH 4D0DB 1BIIB 5LO7A 3CSYA 1Y6KR 4EE2A 5HYQA 3W81A 2MEJB 4QXWA 3RZCB 3KPRB 4GBXB 4LIQL 5F9AC 1XIWA 1FAIL 3TNMA 4ZO7A 2DTSA 3D85B 2FR4A 1MCLA 2GFBB 4PYGA 4RMWA 2WANA 4YX2L 1GC1L 4FMKA 2W9EL 3DTDA 3KS0J 3MRMB 2CD0A 1A5FH 3I9AA 3WIFA 3MLPA 1ACZA 2E9WA 3WSQH 3ZOAA 1XB6A 3ATDA 3QG6A 2VW4A 4Y5VB 4B3EA 4NC0B 5GZOD 4YSDA 2NYYC 5D2LA 1ID2A 4H20L 3BZDA 2G0LA 4H26B 5IR1B 1B4LA 1CN4A 3OTTA 5EO9A 2VABA 4AVKA 3PYCA 3R19A 3RVUD 1YEHH 1KV7A 2OYMA 5ACLA 3WS3A 3K71A 2B7DT 4D94A 4IRJD 3V0FA 1SLWA 2IBZX 2HRPL 4YSUA 4W68A 1UJ3C 4AYFA 2O93L 1YUHA 4KROB 4WRLA 7CGTA 5IMOB 1ZGLP 1JNLH 2VDPB 4RDQG 3OSVA 5HYSA 5D96B 2BDNH 3CVBA 2GBAA 2VUYA 3EYFB 4XNYH 1U3YA 5EU7C 2EE2A 3NCJH 3AVEA 1U58A 3O6KH 1WAAE 2P9RA 2QSQA 5ETUB 5IW6B 3U2SB 2P7TA 1WZMA 3UTZA 1CGYA 4MJIA 2WVVB 3FSWA 5C08D 1MREH 4TF4A 3MLRH 2Y07L 5E95B 1NCCH 3CV5A 5KANI 1GKEA 3QWNA 3ARBB 4OZHE 2VH5H 2KZBA 2F6AA 4HS8H 4L5FH 2BVQB 2XBDA 5CN3A 3CFBA 1HHHB 1I9RL 4JE4B 1OGAB 3INOA 4M48L 3V4PA 2AMGA 1UT9A 4FG0A 1BJ1H 4PJ5B 5C9JB 1JNHB 3RIAF 1NKGA 1EO7A 1XCQA 3CGTA 1OP9A 1EANA 2BVPB 2BNQE 5BVPL 3RTQD 4ZNCD 2WOYA 3B5GA 3C8KA 5BS0D 3HVDA 3HC0A 3H2PA 2WGNB 4S11A 3P3UA 1ZLWH 3NSDA 3R1GH 1KCUL 2R4RL 1EZUA 4L23A 4PGJA 1UA7A 3MCKA 4FQ2H 2IGFL 3TO2B 2DKSA 1J9QA 3NA9L 4M5SA 3VMNA 2YD9A 4JFXA 5D7JC 4LESA 3IKKA 2Y6SC 2NUTA 1FZOA 5KBLA 1M57B 1A3LL 1MI5A 2CJ3A 2DYSB 1ZMYA 2E0PA 4WK2B 5HHMD 5MERB 3FQTA 1RZGB 3OVUB 3WI9A 4JM2D 5JXED 5AZUA 3P2TA 4HMCA 1L4IA 3GTNA 1ZLSH 4F20A 3BVNA 4QDGA 3ZE2B 3KBPA 4MS8D 3DXAA 3PS6A 2HG5A 2VUOA 1HSAB 3TN0C 1TZGL 3OAUH 5F1OB 4N68A 4BDVB 1L3WA 1MNUL 2CPCA 3MV9E 2LFEA 4JHWH 4YSTA 3ESMA 4F7CA 5B4MC 2Y3NA 5EULV 5C7ZA 2EXSA 2WO2B 4YDJA 4R26H 3TZVB 3V6ZB 1CDUA 1XF4A 3T3PE 3FHQA 4NZUL 1R3IL 4WDIB 3VDCA 4M5YH 1HQRA 1JMXA 5DMIH 1I9IL 3WKML 4IRZA 2XZZA 5I9QB 5IHUL 3AY2A 2B16A 2W91A 1EJ6A 3BH4A 1JHLH 3JVGC 4EZLA 1C5BH 1NANI 2YPVL 3W0WE 2P24A 5BO0D 3A6BL 2XZCL 5IMKA 3PGCB 2BMKA 5GSVA 3VD1A 1ZGLM 1O7VA 4X98B 2GI7A 3KYKH 1MCCA 4NZDA 5DJDA 3DJTA 3K6OA 3ILPB 3M7FB 5E9DD 5IGXL 3WDIA 3QFJA 1YRKA 1CK0L 3QQDB 3UTQB 1NJ9A 3QQ4A 1QSEB 1A9BA 2W60A 1TTUA 1CB4A 2W65A 4L4VE 4PS3A 2JFCA 4M7KL 1R5VB 3ARGD 4Z9KB 1DCLA 3S6CA 2AQTA 1ZS2A 3QJOA 3T4AB 2V9QA 5EN2B 1URZA 1A7PL 5I71B 4EIBA 4LLDA 4LPVA 4P4RB 2YAFA 3PXLA 1H3WM 2XWBB 4WFHE 5B38G 2NUPB 2YHGA 3DARA 5FXCH 2VDNL 3CMOL 2ICWB 2W9DH 4ODTL 1RERA 4FGMA 4Z7AA 1CLCA 4LOUC 5TGBA 4JE0A 1AO7A 3V8OA 2V6HA 3QFDA 4RMUA 4L3EB 1RL1A 1KTCA 4N24A 1DSFH 3SE3A 3VG0H 3IFLH 3BAKA 1WC7B 1EFXA 4CMMA 4ANVA 1X44A 3DIFA 4YE4L 1OT1A 1I82A 2QQQA 5LKNA 4XVJH 1TTCA 1KCVH 2X6UA 2ZNWA 3VXNB 4NUGH 3V4UL 1R3HA 4QLRA 4OJDH 4N0YL 1JD7A 4QO1A 4HISA 1WCBB 2FQFA 2B0SH 1EHAA 3SCMB 5SV4A 2GYSA 1HNFA 4XPAH 4QRPA 3PAUA 2WLIB 1C16B 5JHDA 5AKVA 4RRPM 3IXTA 1I8MA 3BAYA 1E67A 1EHKB 3HE7A 4G1MB 1GKOA 3BAIA 3PHQB 3O2WH 4I8DA 4Q0XH 1G9HA 3MCLL 4JM2F 4EN3B 1NCWL 1HDMA 2CAKA 1F8TL 1WK0A 3MOBH 4NQEE 3A67H 4LIQE 5B1CA 4CADB 3LZNA 4S1QH 2DBJA 5D1QC 5MP6H 1Y1UA 2NY0C 2QPDB 5F7DB 4BJLA 1AP2A 4BQBA 3RB7A 4R4NC 1I7RB 1ZE3C 5D7IA 3W5NA 3WTWA 2E8ZA 3BMWA 4WHYG 1CFVH 2E75C 3FULA 1JXFA 4WZ9A 3DETC 1OW0A 2CDEA 3OJVC 1XVSA 2VRKA 1JS4A 5AVUB 3E80A 3RUGF 1O0VA 4OQTL 2R39A 4UIMB 5JIMA 1R5WA 3CH8A 2O1AA 2X1PA 4OZ4A 4Y4FB 1JDAA 4WWKC 4LCCC 3O4LD 3KLKA 2BX5A 3LAFA 2IDCA 3RPBA 3MXVH 4P4KC 4YL4A 3MRQB 1GS6X 5I19H 1Q0YL 4WI4A 1N19A 2B1AL 1YEEL 4NZFA 1O9WA 5DHYA 1Z3GH 2A77L 4LFHD 4WFGD 1B4TA 4HF5L 3TVMA 3BAEH 4U49A 2FEJA 2WVUA 1X5MA 4QR7A 2F8IA 1OCOB 2JJWA 3VFSA 2G0KA 2EACA 1MCBA 1SHMA 4XO8A 3ISRA 4ZUUB 2QSTA 3MRJA 1SEBA 3FUNA 4ZXBC 3FRPG 2B9AA 1PW3A 4D7PA 1MIMH 1JZFA 4E9QA 3OSKA 3IS0X 4G9FA 3H3PL 4L4TE 2JIXB 2QZQA 4JY6A 3UC0L 3MLZL 3DVFA 3WNIA 2IXQB 5LGJA 1FBIH 2AI0H 3EG9B 5IVXF 4F7MA 2OSLA 5B38B 3Q0HA 1EBAA 3HE6B 5DVLA 3ROOA 3KWWA 3QDMD 5I6KA 4XN7A 4TYUA 2O5XL 3M45A 4JPIA 3ARFA 4JRXE 2AJXH 2O61A 2X4RA 2ZXGA 3T2LA 5DEZA 4XWOD 2VIRA 1IE5A 4FKEA 3VWKB 1XO8A 4F7TB 2BSBA 4XPGH 1DQVA 1XEUA 5DUML 4DEWA 3Q5OA 1NDMB 2V9RA 5C8JA 2FJFB 1AYOA 4PREB 1KZYA 5L0QB 1EAPB 1U8KB 1CR9L 2BY1A 3DSNB 1ND0A 3H1ZA 1PSKL 3B9KC 3WY3A 4DK5A 4G7RB 1OHQA 2EKJA 1QI4A 4UT9H 4DO5A 5FYLL 3SBRA 4PJ9B 1VZGA 2JB5H 1IGFH 3MGAA 5A2BA 3IE4A 2BVUA 3BT2H 4ZPTB 4AQAB 3CVHB 1BVKB 1JWMA 3LRHA 3QC5X 4PG2C 1AJ7L 4L48A 2B4CH 2R1YB 4FQXB 1RI8A 4RAUB 4A04A 1JF1A 1LWJA 1WH0A 5ICZA 3MJ8A 5K9JH 3HC3L 2Q8AH 3SD5A 2VR3A 5KS9B 2ZX5A 5E03A 2Y5QA 1PBYA 3AM8C 3HHSA 2E7CA 1GMEA 3B2VH 2IH3B 2WB1A 3MV8B 4OH2A 1R0AH 1QSFB 4PJEE 4EUPG 4FNSA 4MZIA 1FDLH 5C9KA 2ZUSA 5CILH 4AUYA 4PJGF 4RGNE 5EORH 4GUOA 3D33A 1CICA 1XD1A 5TDOB 5DF0A 4HIJA 1TVBA 2FECI 5C0AE 4LCYA 3QBTB 1CU4H 2VM9A 1JWUB 3D2UB 4FLOA 3S5LA 2DQCH 2NY1C 5HPMA 3BW9A 5T3ZD 1F13A 2J2ZA 1RFDH 3LEYH 1MAML 3Q2VA 2F5AH 3BXNB 1F4WL 2E56A 5H4YA 2X70B 5I75C 3H9SB 2A6KA 4PLJD 3JV5A 2C9VA 5FO9B 3T09A 4FZ8L 2MOVA 3VXOB 1V5JA 1BLNA 1CL7I 3LPWA 3LS4H 4GSDL 2HKAA 2P5EA 1IC4H 3OLEA 1LLAA 1MQKH 1TVHA 3MJ6A 4FNTA 4L8BB 4D0CB 4UQBA 2QPUA 2NT1A 4ZUWB 2K6WA 3QCUH 2EUVA 3MLXH 3MC0A 4N90E 1OEZW 4PRPD 1BF2A 2MSPA 1JJUA 2H47C 4X5WA 1REIA 4MA8H 1D6EA 1CE6A 4QXTB 2AJ3A 4Y2NA 4ZNEA 2BP3A 2VDKL 4RWYL 1P84J 1MWOA 1K8IA 3MACL 5B1AB 3L4TA 3FRPB 4W4OA 2ZJSL 4PAZA 2R0WL 3N06B 2NSQA 2DLHA 3NIGB 4L05A 4NCC1 4UB0H 4XPFH 4A2HA 3HPLB 1OOAA 5DHVB 3RZCD 3GGWA 3KPRD 4MB3A 4AMWA 4GBXD 3ZMEA 5F9OL 3FT4B 5A2JH 3EFOA 5DUBA 4OT1H 4D9RD 3R4RA 3D85D 1F6FB 4QXUL 3OR6A 3TNNA 3VMOA 5ANMA 4PRDA 3I6LE 3OHMB 3PQYB 5F89A 5HJ3A 1HI6A 4U3SA 3U7WL 3FTZA 4Y4KD 3WHXA 4PVNA 5EFIA 3UADA 1L6ZA 3VWJC 1T83C 5BVJB 4ZOAA 4DSYA 3IAGC 2ZX8A 1F56A 2FEDD 4PJ7B 1TJIL 2HX7A 2VZTA 3NDYE 4ZSOA 3W1ZA 2X09A 1N67A 3LQAH 1YNLH 4Z7NB 4FG6C 3SDDA 3SDAA 4AW4A 4IBUA 5BXFB 2ED7A 3N3EA 3QZWA 3QUXA 4JANB 5EEXA 4FQJH 4HOMA 1KGWA 5I6PA 4GW5B 3BUIA 4CC4C 1MFMA 4HOZA 3FONB 2DY2A 4KOBA 4NXKA 4RIRB 2BCMA 3CJJA 3MRLB 1E9QB 1C08A 4JY4B 35C8H 4KROD 4PWHA 3VQ1C 1KACB 3FCUB 1H9DA 2NLJB 2CO6A 1FV1B 1JF6A 4M1GL 4OIIH 2DIEA 4IIQB 4P3DA 3VXSA 3BO8B 1NEPA 3TU6A 4HUXA 4QRTA 3EOBA 3FB6A 4I1NB 4PWFA 5AENA 1AKPA 4XNZC 3K2UH 5BV7B 3QWRD 3WUWA 4PV8A 3SDXF 3A6CL 1G7QA 4NZTH 4A7QA 2QVFB 3ARBD 5IROC 4MJ4A 4EUPB 2V8MA 3QWQB 2YWYA 4JFDE 4K73A 2PCYA 5HJDA 3O6MH 5IB3B 1CBVL 4DUVA 1ZT1B 4X6DE 2XBTA 1E7UA 4P23C 4XC1H 3KL5A 1HWWA 2XN2A 3R4DA 4OGYH 4R2GD 3RPKA 1JG9A 5D70H 1E3FA 4Y5YB 4JRYB 5DHDA 2XN0A 5G2NA 1E6OL 3CZNA 2YD7A 4NXSA 3FSZA 3HG1B 2Z91B 2HFEA 3V52H 3UP1A 3W5MA 3CH1A 1VGKA 1XBDA 2Q86A 3GZKA 2DWYA 3NRQA 2WB7A 3GMNA 3I50L 3OMNB 4L1DA 2VMEA 4XN4A 3EO9L 1OCRB 4XT1C 3UG3A 1AXIB 2YBRA 3E6FA 3IFPA 2IDQA 3R06A 1D2OA 4CN4A 1BBJA 3RGHA 3M17B 3E2HC 2FJGB 2Q76B 4NO3A 3ZKMC 5TE6L 4F9LA 1CIUA 1SFHA 3NIGE 4CMHC 2VAAA 3ILEA 2C7UA 4YBLB 2X7LA 1TFHA 2MFNA 3Q06A 1Z32X 3GBMH 3UG5A 3KPPB 3QHTC 4IEFA 1WBZA 4YDNA 2CA4A 2RH0A 2IC2A 2OR9L 4ZYKB 5JA9A 1I1CA 4QJ3B 2AC0A 5KWYC 5HVHB 1NGXA 3LPFA 1IAIH 1Z0MA 3G7TA 3RIKA 3ZSTA 4ZMWA 4NQVB 1WITA 5HDRA 3ZL2A 3EXJA 1N5AB 4ELDA 3AZUA 4LF3B 3NRPA 5H35B 1WZ1L 4PJXB 3VFGL 1R24B 3OKOB 3PDDA 1PJ9A 3I75A 3QE5A 4M02A 4F1ZA 4HJGB 4GRLB 2LT9A 5I0ZA 2ZF8A 4U3CA 3RBSA 3ECWA 3RHWF 3BUDA 4I3RL 4IKLA 4NQUA 2AQSA 3L3GB 1SQ2N 3IE9A 3WGUB 5GS1A 3H4HA 1BBDH 3WO4C 4I85A 4AVHA 3TT1H 4YFDB 2V7HB 3BGFC 4KKZA 2MRYA 5FYLE 1KTLB 3WN5C 5AQ0A 1C7SA 5H94A 3L4VA 5D2LE 3RB5A 3A21A 2ADFL 1V10A 2GK2A 1MHCB 3K5SA 3LCYA 4KQ4H 2OSWA 4O2FB 2CKBH 2Q8BL 1G1KA 1R3JB 3JWOH 4JDTH 8FABA 5KBDA 2TSBA 1QSED 5D7KE 2VC2H 2WZPD 5DJ0A 1PY0A 4RFOL 4X99B 2VR8A 4Z8FL 1OF2A 3D09A 5D6CA 4KUZH 1EO5A 2LE9A 1D7DA 2DBLL 2VDRH 5IHZB 1KXQE 3B8YA 3SKOA 3NA4A 3PABB 4X9BA 3UPRB 3G6DL 5KVFL 5IFAH 4MA7H 4DQOH 5CCHE 3TA4D 3OQ3B 1ZPLA 5C0IB 3CQPA 1GRWA 2WNKA 3CDYA 4P99A 1UWGL 4I3SH 3PUCA 1FYTB 5FM4A 2I5YL 4Q6KA 1A7RH 3RIFK 5MEOA 1ITCA 4MD4A 4G5AA 1W72B 1ZXKA 1OXYA 2GJZB 1UHVA 4MAUL 3FOLA 4ZOCA 1JUFB 4OZIE 3QISA 5DO8A 4P2QA 5IFJA 3DX4A 3SQOH 1DANU 4MYPA 5F7YC 4NJ9L 4HUUB 3DRQA 2RALA 3T3MB 5EUOB 1DCEA 3M7OA 1IGTA 3KJ6H 1A7NL 4PR5A 2J1XA 4JRXD 5GJTH 3SODB 2X1QA 2PUQT 3FFDB 2VNCA 1T0PB 1U4EA 3RWJB 3SCMD 4F7EA 2AVFA 2DICA 1YYLL 2AJUH 5BZDB 3L7EB 3MLWH 2BY0A 4DP2X 3VXUA 1VAHA 4FFVD 3TJEL 1DYZA 5KYNA 5CEZL 1Y0LB 5DC9B 2KQNA 1TSRA 5AW8B 2BLFA 3Q9PA 3QS3A 2IG2L 2IBGA 4JQVC 5BMFL 1ED3A 4KKBD 2RHEA 5IQ7L 4PV9A 4EN3D 2I26N 2VDLL 3HG0A 4QRRB 1UXMA 5FGBA 4AH2A 1U8CB 2EE0A 3LNGA 3ZE2F 3U0PA 2CUIA 1YY9C 1XWVA 4TQPA 5HI5C 3OJDB 3TWYA 2BHZA 5IT2L 4QHNA 3ZKXC 1UJ3B 1MW1A 2KLRA 4BZYA 4TVSa 2WXKA 5C0GA 1S78C 1T03H 2G4EA 1EHLL 1DFBL 4NWTL 3DJRA 1WWAX 4PLOB 2WY3B 3WLBB 2W5PA 1T3FB 3S34L 3IYLW 1SXSA 4PJ8C 2J5LC 1G84A 5DWUL 2NY6C 1OCCB 4YR6B 2F7QA 4Y4FD 5DXWA 5HD8D 3ULSB 2A6IA 3ZYOA 4AEFA 4CSPA 4N3UA 1UYWL 2ZKXA 1P4BL 1E42A 4ENEC 2Y22A 5AWNL 1CFQB 5CP7A 5BRZB 3HUJA 2E6PA 3Q2NA 2AJVH 1P5UB 2UXGA 4ODSH 5EBGA 2YZ8A 5C0AD 4DOHB 1MCFA 4DZBB 1J5IA 1F4XL 1GSMA 1GPOH 1LO0L 4LSPL 3MGTB 4HKZA 5CJQL 3RVTD 1ZAGA 3RY6A 1I9JH 3FUKA 5BPPA 2MNJB 3MA7B 2DN7A 1QPPA 4PY7B 4OV6F 4M3KB 4IU3B 3APMA 2ALAA 1MPAL 5DS8A 5AUMB 2X4OB 3BWZA 4DP0X 2VWEE 1FL5A 4FN0A 2YK1L 4N90D 4PCYA 3WMSA 3K2KA 2JIXD 1IGIL 1GS7A 1DBJL 1P7KB 4OZFB 4P5TC 3UC2A 4B9PA 3BP6A 3U2JA 2KZWA 1K5NB 4FQCH 3AAZB 1ZSHA 5D7JB 1EGJA 4XHJC 2RA1A 4OUOA 1G7PB 1CG9B 3HE6D 2JCCA 3NABH 1HHKA 2MNWA 4HJIA 1DEEB 4Q9CA 3MZTA 1S8DB 1NCDL 4FX5A 5C0BB 2EXWC 3G9AB 4X0NA 4F57L 2AXGB 4NQDA 4EDXA 3CFUA 4GNKB 5JOFB 3VWKD 2KUTA 4ZX6A 1AZNA 4IMLB 3MBWB 3IFNL 3TN0B 3VU2A 4GI8A 1VPOL 1KPUB 3IFOB 3K2MC 2Y2TA 2XX0A 4W1TA 4BV1A 4GKSA 5I1LB 2Z7ZA 1DN2A 3CWGA 2HN7B 4WFED 1OTTD 3CXHJ 2WAQA 5I1IL 4PS4H 2RCSL 4PJ9D 1G7MB 1VHPA 2HRLA 1MJJA 3A47A 3CDFA 4ZS6C 3AWGA 3I3DA 3NFSL 5BOPA 2IBBA 5ESQA 5T5NG 4UNTA 3IPBA 5ICXA 1MCOL 3CPUA 1H6FA 3RVWC 4IJ3C 1A25A 1KNOB 3NJJA 4LQ1A 4JPWH 2BVOB 5EZLA 1QRNB 4F9PC 3AS3A 4E5XG 4FQXD 3KM2A 1BSIA 3QIWA 4R4FH 3H42L 1A3RH 3WFEL 4BFGA 4K5LA 5EU7E 1H8LA 3CBRA 1CDCA 1FO0B 4OB5L 2Z7YA 2XOTA 2EH7H 5DJYB 3PHOA 3STZB 4YHIB 1ZA6B 1O5DT 3EO1B 1QSFD 4FDWA 4UILL 3RI5K 5J6GA 1UWXH 4L9DA 3GJFH 3LQZB 4MCNA 4LPYA 5DJ2B 4ABUA 1JK8A 5ICUA 5CGMA 1WFJA 1S5HA 3FFCE 4B9CA 1X5YA 3FQWB 5IBLD 3IJHB 2RQ8A 3QQ3B 4R7NB 4X7TB 3D2UD 1N6QH 4XN9A 4POZD 1OTUC 2EUXA 5JDSB 4M1CC 4IBZA 3WS6C 3SKNA 4R3SB 3H9SD 3WIIL 4TKWA 2OL3B 1MHPH 4WU5A 4NT6A 4UT6L 3HAEB 3ZE1E 4G8GA 3PNRB 5KSBB 1INEH 5TDNB 3KCPA 3QO1A 3FDWA 1LJMA 4L8CA 1AKJA 2KKQA 2N7SA 4BSWB 1CFTA 3ZL1A 1QO3B 3MHZA 4OV5B 3IRZA 3F58L 4MRCA 1WD9A 3D1MC 2ZONA 1FYHB 4KJYA 1F86A 1IGJA 3I02B 2H5UA 4J4PD 1U6AL 1KPRA 4BWUA 2XV2A 4L9LA 3CZKA 2FGWL 2Z7UA 2IJ0C 4JCLA 5KVFE 3VGFA 1ES0A 2HT3C 3DLQR 3WCYA 1YEDB 4A7GA 3BPLB 1ADWA 5I30H 3CD4A 5EG6C 1KB9K 2X4QA 4AT6B 5HDQH 3UTPD 5TFSH 4PY8J 5PCYA 3FOMA 4OI9A 4MJ6A 1T04B 4RCAA 3UBGA 3S88H 3V0EA 3V4VH 5HYJA 2VDPH 3BRDA 5CIPB 3LPOA 5DR5H 3DHPA 1U93A 3GSQA 3OPZL 3TASA 3VFNB 4QHKI 1IC5H 1JZ7A 1QQDB 3NCBB 5GPRA 3FFOA 3QEHB 4GJTB 3L3IA 4GT7A 3NQKA 3PQYD 4KI5D 1VGEH 3F7RA 4X6FB 3FB8B 3FYIB 2R0KH 1OAKH 1CD1B 2YRBA 2CPUA 2D7PA 1GGYA 4LHUA 1AGCB 4RZCB 5D1QB 4M7ZC 2NY0B 5IKCA 4HJEA 3ALXA 4QYOB 1EWHA 2VDQH 5KJ4A 4HAGA 5E4OA 4AI7A 2WLLB 4J6IA 5JHAA 2PXYD 2FL5B 5CEZE 2YLKA 3TH3T 5E2UL 5IJKA 3SGDI 1DBMH 5SX5H 3PWNB 3EJSA 4DNLA 1UGKA 5FKPA 5EEYA 3SEPA 5JUEL 4P06A 3ARED 4JG9A 2F08A 2YGQA 5D7LA 4WWKB 1PD1A 5KBMA 4LCCB 3JV4B 5GRJL 1CPUA 4E5XB 3HZMA 5BOJA 4YIQB 4DAGH 1NLDH 1MCPL 2CUMA 2LU3A 3MCG1 4D3CH 1E9PA 3I3EA 2WXRA 2R1XA 4ODBD 4YO0A 2GCYB 4HS6A 1AXSA 5KS9F 5E00B 3BJ91 5AB2A 3JBG7 2GABA 1BQLH 1JXDA 1NKOA 2WXJA 4S1RL 3GMRA 3OB0K 1QOKA 1JZEA 2CCLA 1BJMA 1NGZB 4WCYH 2ZCKL 3BKYH 3MV01 1BQKA 1FRGL 3MKKA 4N2BA 5F7FA 2EC9U 2BCKA 1DLHA 2VERN 4S0TD 2XDHA 2EE9A 2R83A 2VN3A 4NO0A 2OMZA 5J9PB 5DSCB 4YE0A 1N59B 5DQDL 3LHPH 3FSAA 4JRYD 1MFBH 3STLA 1NAML 1MZYA 4MCYB 1E2WA 1F97A 1SMDA 2MTAA 4G6AD 4MMXA 3B6SA 5CEYB 3AXIA 3BCDA 3L8QA 4HC1H 4LT7A 3T8VA 4IIZA 1A6UH 1ZVSA 5K59E 4PRNA 2K4WA 2H1PL 1TO4A 4DPAX 3T4YB 5HHPA 4I48B 2ZTBA 4O02B 4BZ1H 3GZOA 1HYRC 1A2YB 1UCBH 3HNVL 4FNQA 43C9A 4JVUA 4BFOA 2W92A 1F1GA 2P5EE 1PS3A 4OKVA 4PJDB 2C1PA 5ESVB 3KBEA 4KC3B 2AANA 5TPWH 5I1KH 3C6EA 3MLUH 5FDWA 1YYML 4XNAA 1EMTL 4GAGH 4XMXA 3HFMH 1BQHA 3QW9A 2A0LD 3D7PA 3B9KB 1P7BA 1S5IL 2Q7YA 4ZNEE 1X9QA 4ODXB 2WTRA 3NN8A 4X0KB 4J3OC 2VE6B 3JV6A 1R75A 2H1XA 2K8QA 4Z7VE 4JZJA 1OAQH 3WFHA 1SYSA 3QUZD 4Z6AT 1AOZA 2BIPA 3NIGF 4XVOA 1JPSH 4GQ9L 4U1NA 1DJZA 9CGTA 3HS8A 4JPSA 2XIIA 3CLEH 2PF6A 2ZXDA 2WQVA 3GMQA 4HSCX 3L5WB 1HHGB 1BYOA 2YMXH 3Q3GB 4GRLD 4AEIL 1TQVA 5KVEL 3FTGB 4L4JA 4GG6E 2QT6A 3CIQA 1HCVA 4R7DA 4U1LB 3REWB 3T0XA 1N8OE 4KI5F 1N8ZB 1BVOA 1ZV2A 2X1XR 3SPCA 3RU8H 1BMZA 2NDGA 5CCKL 1M53A 2NXZD 3IF1A 3W57A 2DQUL 4B9KC 1UT2A 4TUJA 5ILTL 3TGXA 3QI9A 2AEIT 4PJ7F 3AACA 3RTLA 3SPVB 4E41E 1UUNA 5M7QA 3OMAB 4DK3A 2JB6B 2HRGA 4Z7NF 1SEQH 2H4EA 2C3VB 4U1HB 3ULUL 1ETJA 3B7YA 4ZSOE 4GSXA 3UBXI 2WUCL 3BD4A 1BZ7B 4JRWA 2NY1B 4YL9A 3MRRA 2C3WA 5HVGB 4JZOB 2Y36L 4KO9A 1JZDC 1F2QA 2EEDA 3SHSA 2Z4QB 5HYIA 5I75B 1TYJA 5INDB 1A22B 1QBBA 2G75A 3CVDA 1SMOA 5ENWA 1IMHC 2XA8L 1YUKB 1BWMA 3D25B 1A6ZB 1UQSA 1MRCH 2PYEA 2UXVA 2HKFH 4KXAA 1EA9C 3C08H 2WVSA 3ZT7A 5B3SB 3I9GH 5ABZA 2DQEL 1KC5L 2FECL 3ZHDA 2GHWB 3DV4A 4G6MH 3J2PA 3NJMA 4FYTA 3GHBL 3SYAA 2IANA 3M8OL 4PRHA 5LNEA 4HUVB 2AEQH 2R56L 4AMXA 5B3JE 5LQBL 5E5LA 3WXVH 4L3CA 4XE5B 2DQFA 5EZIH 1RPKA 3D39A 3B9AA 4FQLL 1FYTD 1TNMA 5KVDL 3W2DL 4OD1H 3ARPA 2RFXA 5EBMA 4BKLA 2B2XH 2J8UA 2G5RA 4MNHA 5FECA 4J3WA 4DQAA 5JO5A 1OAUH 4PJCE 2Y25A 1ZLEA 4TMPA 5DS2A 2HPTA 4JCMA 1RZJH 4XCEA 3SQBB 3EYUH 5DJ8A 1HZHH 1SRDA 2XN9A 3QDJA 3MFFA 3IJSA 2GJ6A 5JTWA 2CXKA 1THAA 5HGAB 2FBJL 5FUZH 4ZFOB 1NM4A 4YXKL 3FRUB 3V6FA 1MF2L 3D3VA 1L9NA 3KYMB 4M5TA 4TSAH 1LE9A 3RIAK 1A4CA 5E6RB 1R4XA 1DJGA 1KCRH 1ZSDA 1C8QA 2QHRH 4NWUL 3VWJB 4A2DA 4NKMA 1CMOA 2IAAC 1XGRB 1GS8A 5FHAL 2F58L 1MCWM 1J1XL 3QZNA 1V3KA 3HNTL 2OTPA 3QSKB 5GRVK 1J87A 4FEMA 3FBKA 5DGRA 4QRRD 2AAVA 5IIEB 1KJVA 2DQIL 4W9DC 4P9HH 3ESPA 4D0BA 4J3UA 2G60L 3NTCL 4PSRA 4X8CA 5CHNA 5DFVC 3T77B 1KPVA 1HNYA 5EBLA 5SWZB 1ZTXL 5H37G 2J72A 5LAXB 3V95A 1HXMB 1EHNA 4QHLB 1N12A 1KBVA 5GZND 2ZOOA 2ZP0T 4FZEL 1TOXA 4PJXF 1B0RB 2AJSL 2W0FB 5AAMC 3SGJA 2VLRA 5HGBA 2WXNA 4XNZB 5FA3B 4Z7WE 4TUUA 4DP4X 3L4UA 1IVTA 4OI7A 3MAWA 2YD3A 4Q6IB 4MZRA 1EXUA 3JWNE 4ADJA 3CVIL 5B7MA 3V7AG 3GT6A 1JNNL 2OMTA 5GGTA 1QLFB 4P23B 3T2PA 5C2UB 2E8YA 4TOYL 5KYYB 1QMUA 1FVDA 4MJ5B 3GPEA 4BFNA 3FH5A 5L7XH 4FG4A 1N10A 3DO3A 1JGUH 5ID1A 3D0AA 2XWTB 1HC1A 1QACA 2AGJH 2FX9L 2R2BB 4N8VA 4R90H 1F58L 3IMRA 5GRZA 3HI5L 2UVFA 4TSBH 4C59B 4FFTA 5E6IB 1XR8A 1NEZB 3L5HA 4FF9A 1F6AB 4OIAA 3FF7A 4LARH 4DUWA 1FSKC 2R29H 1INQB 2E59A 2X4TB 5A6LA 2NTFA 3E2HB 4P2OC 1ZEAL 4X6BA 1DVTA 5F9JB 3NCCB 4ES8A 3CTTA 5D7JD 2DM3A 4CMHB 3CVHH 2Y6SD 2CJUH 4WWOA 1NOAA 3BZEB 5INCA 15C8L 4HPOH 5C0BD 1HE8A 3JTSA 5D8JL 3V6OA 3AS1A 4MSWA 1S9XB 1Z3RA 2OTUB 4MX7A 2X0WA 1T5WA 3SBPA 5HDBB 5EU3A 1YZZA 2DYPA 3RGVC 5FO2A 3GM8A 4NM8L 1CF8H 1SM3H 4Z3IA 1AE6L 3TN0D 3U7AA 5E56A 1JCVA 1CE1H 1RULH 5D1XC 1B0WA 1J8HA 5B4MD 5I0DA 2J21A 4HG4K 1VB9A 1X5GA 3SOBH 2J8HA 3X14A 3T6QC 3T0WA 5EUOF 4NN5B 1HQ4A 4HJJL 4L37B 4GRMA 1B2WH 1AGBB 1LO4H 3LXCA 2IQ9L 5I1HH 1KF9B 3L1EA 2NNCA 3QXVA 2NW2B 4JUSA 3LYRA 4DP7X 1IL1A 1MFDL 4LEXL 1BVNP 2ADGB 1OAYL 2PP8A 3GSOA 3RILA 4MA3B 1QRND 1YY8B 2IFFL 3ZKNC 5SWQB 3FQXB 4JHBA 3MJ9A 3OKMA 1KBWA 3GSNA 5JIHA 4EBQL 5KJ7E 2I07B 3BLKA 3SE3C 5CEZD 1JTOA 2FBOJ 1LQSR 1MCIA 4Y2OB 2A9AA 4FNPA 5HTSA 1CD9B 4HGWB 3AY4A 1ZLUH 2A1WL 3L95B 3VI4A 4Z77B 2XY1A 1IGYA 5TDPA 4IOFD 4XC3H 4CDGC 2V5SA 1B0GA 1R1CA 4HZ1A 4A66A 2XZQH 2QSCL 4E0RA 2K6YA 4MQ7B 3K4ZA 5KVEE 5IB4A 4WW2C 1MY5A 2EDKA 2PCXA 5FOJA 3G6JA 3DV6A 1JSYA 2YD0A 2E7LA 2X4UB 1SZNA 3CDGA 4UM9B 1J11A 1B4RA 5DD1H 1CFSA 4KY1H 3AABA 3MVSA 4MQTB 2WBJA 4P49A 4EIZC 4WU7B 7TAAA 3ALPA 3A24A 2HT4C 4I1PA 2XWDA 2YEVB 3O9WC 4FFZH 1WVZA 1M7IA 4B0MB 3G6AB 4QTFA 3LZPA 1DL7L 4EOWL 3H7BB 4HCRH 4LOUD 3QDGE 5K33A 3QJVB 3FN0H 1FNSH 5BQ7B 5IQ9B 4JNXA 1CGVA 2GITA 2C9XA 4GKNB 2RGSA 5GS3A 2WQRA 4PJBB 4JS7A 3SGKA 3VFMB 5HHXL 3UTSE 2EEFA 4H44C 1A6AB 1G9NC 3CUPB 4X42A 4LL9A 3U6XA 2VLLB 3O2DH 2YSSA 5KVDE 1RK1B 1ADQL 2NW3B 3BKCL 2NZ1A 4OIBA 5IB2A 3C5ZA 2P5PA 4NKIH 5AYUH 3QJFA 3K0YA 1U8IA 4ODUB 1BD2B 4V1DB