1NWPA

Crystallographic study of azurin from pseudomonas putida
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
AECKVTVDSTDQMSFNTKDIAIDKSCKTFTVELTHSGSLPKNVMGHNLVISKEADMQPIATDGLSAGIDKQYLKDGDARVIAHTKVIGAGEKDSVTFDVSKLAAGEKYGFFCSFPGHISMMKGTVTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Crystallographic study of azurin from Pseudomonas putida.
pubmed doi rcsb
molecule tags Electron transport
total genus 36
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nwpA00
4BK5C 3IEAA 3S3BB 4AI7A 2DYSB 2IDSA 2YAEA 6PAZA 1JXFA 3CZUB 2YAQA 4Q89A 2IDUA 4WTQA 3FYEB 1SF3A 4N8UA 3S3DB 3PAZA 3X1EA 2BZ7A 2EINB 1NDTA 2XX1A 3X1GA 1E65A 3FPYA 3FSAA 1J5DA 2ZONA 1W6WA 4F7KA 2H3XC 3JTBA 2I7SA 2FNWA 1CYWA 2VMJA 1SF5A 2HRHA 2OJ1A 2PPDA 4K9JA 1NPJA 1ASOA 1GS8A 1PF3A 2YXWA 1L9OA 2HXAA 4A2GA 4HALA 2BWIA 1PZAA 4W9ZA 4YSQA 2PPAA 2IWEA 1M56B 3OM3B 2FQEA 4BXVA 3SBPA 3NT0A 1GS6X 3IE9A 1TEFA 1XB3A 2P80D 4DP9X 5TK4A 4GY4A 2ZOOA 1M9WA 5I6MA 1ID2A 1OCOB 3BQVA 4HZ1A 4DPBX 4FA7B 1ILSA 4YSRA 1BQRA 3NJGA 1GW0A 1TU2A 4CSPA 3UACA 2TSAA 5B1JC 4YSCA 1JVLA 4GP4B 4RH4A 1KBWA 3PAUA 3WIAA 5D4HA 3IN0A 2FQFA 2PCYA 3L45A 3NJNA 4HHGA 1KDJA 1NPNA 2J56A 3CVBA 3EH4B 1OV8A 3T6WA 1OCZB 1CURA 5F7AA 1MG3C 2BW4A 3FU8A 2EIKB 3WG7B 1KGYE 5B7FA 2BP0B 1WA1X 1XB6A 3CDZB 2JXMA 3WNJA 2OV0A 2HX8A 3FYIB 3FQ2A 4HHWA 3ABLB 2XV0A 3FSWA 1KCBA 4DPAX 1AANA 2DWTA 3ABMB 2UX7A 5FC9A 3S8GB 2QT6A 1E5YA 3FPXA 1BQ5A 2WO2B 1TEGA 3BVDB 1JXDA 4KNSA 1SDDA 2GB2A 1WA2X 2IDFA 3H56A 1KCWA 1XB8A 1CC3A 1ILUA 4AX3A 3TBCA 2Y1AA 2AZUA 4YSEA 1A65A 1PLCA 3HB3B 4YSOA 3TBBA 1A8ZA 3WKQA 4BWTA 4GP5B 4DP0X 1A4AA 2BP0A 2YXVA 1J5CA 4E9XA 1JXGA 3SQRA 4F2FA 2PP7A 3FU7A 1AZBA 4KO5A 4KO7A 5B1KA 3V9CA 1KV7A 5LDUA 5I5JA 1UATA 3QJVB 4KO6A 3FQ1A 1J9QA 2W88A 1CYXA 4G72B 2VN3A 3X1BA 2VSMB 1V10A 2IAAC 1QNIA 4HCIA 1ZIBA 1EZLA 1MZZA 2AANA 2I7OA 3WKPA 4X4KA 1L9RA 3X2QB 4BWWA 2HZHA 4NAJA 4PCYA 2YAHA 1JZIA 3CG8A 1WS8A 2FQGA 2YQBA 1AG0A 2EIJB 2FQDA 4A66A 1SFDA 2ZWNA 3MBWB 5AFAA 1ZV2A 2EILB 1ASPA 1OCCB 7PAZA 4A2DA 1NIFA 2VM3A 3PAVA 4P5RA 5F7BA 3UADA 1NICA 3UAAA 5B1BB 4G70B 2N0MA 1L9QA 3AW5A 2J5WA 2HRGA 3ZX1A 1X9UA 1JZJA 5B3SB 5AKRA 1AAJA 4YSSA 1OOWA 3ASNB 2BHFA 3AY2A 1SNRA 1PZCA 5E9NA 1N70A 5D4IA 3WI9A 2VW4A 2FT8A 2GHZA 3KW8A 2VW7A 1AOZA 3UABA 1CUOA 4G71B 1URIA 3X1NA 5I6NA 1T5KA 2XV3A 2XLLA 3QJRB 3T71A 2UXVA 4DP8X 5A7EA 1F56A 2OCCB 1BEXA 4A68A 3QJSB 3FSVA 1NTDA 1X9RA 5B7EA 2PPFA 4M4RB 2YAPA 3X1FA 2VW6A 1W8EA 4UANA 1IBYA 5TK2A 1OF0A 2LLNA 3PXLA 5IY5B 1N68A 3ZIYA 1L9TA 2CCWA 4A67A 1AS8A 3V9EA 2CBPA 1WA0X 4YVNA 1GSKA 2JFCA 4YVUA 1YLBB 2GI0A 2Q9OA 1IUZA 1SDDB 2AZAA 3AG4B 4E9SA 1JZFA 3FQYA 2DY2A 3FU9A 3QJUB 2MTAA 2CJ3A 2VSKB 3OMNB 1NIAA 1KYAA 1HFUA 2FT6A 4UF7C 3S3CB 3TASA 2P80A 3NJJA 1PLBA 2X87A 3CVCA 3FU7B 1PY0A 4NERA 4Q8BA 2XXFA 1SHWA 3NJFA 9PCYA 2AVFA 2VM4A 2BP8A 1I53A 2QDVA 3G5WA 2DWSA 1J9SA 3ABKB 4M3HA 3IBOA 3PLYA 3DTUB 1AS6A 1ET7A 4UAHA 1OE3A 5PAZA 2QPDB 2XWZA 4HIPA 4NB7A 3ASOB 4F2EA 2XYBA 1KDIA 1JZEA 2B3IA 4DP6X 2HX9A 1XMEB 2PLTA 4KOCA 4DP2X 1ET8A 1PCSA 1QLEB 4HCFA 1OE1A 3TA4D 3OMAB 1RZQA 1B3IA 3ABGA 2BW5A 2GBAA 3EH5B 2WO3B 3DIVA 2PCFA 4E9TA 1ZDQA 1PNDA 3AG2B 3ZDWA 3NSDA 2GC4C 5EHFA 1NIBA 5B1JA 3UAEA 2XUWA 2NRDA 1JVOA 2FJSA 1AZNA 1ET5A 1VLXA 2UXFA 5D4JA 5B7MA 1J9RA 2PPCA 2IDQA 2UXTA 5I26A 4JHUA 4AKPA 4YL4A 4BDVA 1FWXA 2FT7A 1AQ8A 3S8FB 2DV6A 4W1TA 1PNCA 4E9YA 5I28A 2UX6A 3QJTB 4GXFA 4BXSV 2IDTA 3EF4A 3OD3A 2JKWA 5I5IA 1A4CA 1TKWA 1MG2C 6PCYA 1A4BA 4A2HA 3NSCA 3QQXA 1GY1A 5PCYA 1KBVA 4FAAB 1NINA 4A2EA 3RYMA 5I5MA 4HAKA 8PAZA 3C75A 4GP8B 2BZCA 3WNIA 3FS9A 2IH8A 4TXVB 4GYBA 1AZUA 1R1CA 4AKOA 4CSZA 2GSMB 1BQKA 1ADWA 1BYOA 2H47C 1JOIA 2IH9A 1M57B 1IKOP 4YSTA 1IC0A 2PP8A 2UXGA 2BWDA 2XX0A 3GXUB 2R7EA 3ZBMA 1BXVA 2YAOA 1FFTB 4A2FA 3H4HA 1NWOA 3NSFA 4BWUA 1BXUA 3HEIB 2A3TA 3H4FA 3PCYA 1AS7A 3NYKA 1JZGA 1OCRB 3AZUA 1AACA 2CUAA 3NSYA 2RACA 4YSAA 2W8CA 3AG3B 3DKHA 4G7SB 5AZUA 1AR1B 2ZXWB 3FSZA 2J57A 3NJHA 1E30A 3QJQB 1IBZA 3NJIA 5B1AB 2IWKA 2FWLB 3IN2A 1RZPA 3QPKA 1GY2A 4AZUA 1AZCA 3OQRA 1V55B 2Y69B 1E5ZA 1HAUA 1OE2A 3KW7A 5I6LA 1E67A 3PPSA 3UGEA 1EHKB 3U25A 1NWPA 4JKNA 3AG1B 1GYCA 2BP8B 1ASQA 3OMIB 4DPCX 1AIZA 2FTAA 3EHBB 2DYRB 2HLEB 1ZPUA 1SFHA 4AKQA 2HX7A 4KO9A 1QHQA 4G7RB 3TU6A 1JERA 1PZBA 4ENZA 1J9TA 2CAKA 1FA4A 1BAWA 2YAFA 1ZDSA 5I6PA 3JT2A 3T6VA 2XU9A 3GYRA 1HAWA 1DZ0A 5I6OA 1SJMA 1JZHA 4ZK8A 2I85A 4G7QB 4L0PB 5ANHA 4E9WA 2BO0A 3N55A 4MFHA 1MDAA 2Q5BA 4P5SA 2QDWA 1AG6A 2J55A 4E9VA 4E9RA 3GDCA 1L9PA 1NZRA 1L9SA 7PCYA 3EH3B 3CVDA 2YAMA 4DP7X 4PAZA 3SBRA 3SBQA 1ZIAA 2E86A 2GIMA 1BYPA 2QPEB 4BDVB 1GR7A 1BXAA 1GS7A 1MZYA 1NIEA 2H5UA 3T9WA 3NP3A 2PP9A 4QKTA 1NIDA 4EF3A 2AFNA 4KNUA 1RKRA 2IWFA 2PPEA 4QLWA 1SHXA 1WS7A 1ETJA 3CDZA 4N4YB 3N2JA 1A3ZA 3ERXA 4KOBA 5I6KA 1AZRA 4DP5X 1V54B 3NJMA 3MX0B 3NJKA 1PAZA 1WAEA 2XVBA 4E9QA 4WKXA 4YSUA 1PMYA 2MRYA 2X88A 2GC7C 2XXGA 2WSDA 2R7EB 4YSPA 2B08A 4DP4X 2XV2A 4YSDA 3T6XA 1RCYA 1DYZA 1W6LA 2TSBA 1PLAA 2YARA 3D12B 2CALA 4DP1X 2EIMB 4KNTA 3FT0A 3NJLA 4HCGA 4JHVA 3NP4A 3T6ZA
chains in the Genus database with same CATH superfamily
2BVUA 4I0PC 5EUOE 3S3BB 3FONB 4CVWA 3JXAA 1HHIB 1J0HA 4D9RD 1GRWA 1MPAH 3GHBH 3I9PA 4TULH 1EFQA 1GAFH 2J5LC 1OSPL 2OR9L 5FYJH 4PGBB 3MHZA 3RVWD 2YJLA 5EEYA 3WCYA 3ILPB 3N1FC 3EO1B 5F3HA 1NDTA 4PBXA 4LPUA 4PJIF 3VA2C 5CP3H 5DMGC 4F9LC 5D7HA 4QKXB 3ROOA 4JANA 3RWIB 2D2OA 3RPKA 4P46D 1SF5A 2HRHA 1MW2A 4YDJB 3S5LA 1F6AA 3BT0A 3TFBA 3BVWA 5CILL 3KGRA 5SWSD 3CH1A 4LSTL 3DHJA 1FZOB 3FB6B 4I0PD 3BWUF 4NGHH 1MVUB 2WJ7A 4YO0B 5TDPA 4YHIA 5CGYC 4NXKA 4JM2A 1SRDA 4OFKA 4LLDA 2XRAL 4ELKB 1ZSDA 2VDPL 1UM5L 2WXMA 4WWPA 4R2GD 4KKAC 2WINA 4FQIH 4AG4H 2R1XB 2OA9A 1W72A 5KS9A 3FCTA 1XB3A 4R83A 3TONA 3N04A 1JN6B 4XNUH 4BCXA 1UZ6F 4WI5A 1MHPH 1QSFE 1C1EL 2ESVD 4L4TA 1CFBA 1DJGA 3KYMA 3QZWA 5CHNB 4YSRA 2EYSA 2OSWA 5GSVB 5KW9L 1FYTE 2EDQA 1MFEH 2EVJA 3GMLB 5DJXA 4JZOB 4R0LC 4GP4B 3QUYB 2DQIL 3MLXH 5HYQB 2YZ1A 5E5LA 3CSYB 1XL4A 2BSSA 5CGYD 5DA4A 3WY3A 4LCCB 1YDPA 1QNZL 4UQ2B 1H6EA 4KKAD 5E6YA 3T3ME 3B34A 5BS0D 2EUVA 4FQHA 1OTTC 4Z7NE 5F96H 3SEPA 2FNBA 5JW4M 2BW4A 5GRUH 4H26A 1WHPA 4P23B 1EAJA 1TQBB 1WA1X 3S35L 4RAUA 1YEGL 3GD1C 2OV0A 2Q3ZA 3SGDI 4J12A 1AGEA 2H3NB 1MVFA 3VXRD 4JDTH 4ZFOL 1QO3A 4MJHA 4WJ5B 1L9NA 3B9AA 2AXJA 2NTSP 1JXJA 2I27N 3AWGA 1BREA 2GB2A 5BQ7A 1XB8A 2YD4A 4HT1L 2CDEA 3V6FA 5K9JL 1A65A 4XPGH 3MRRA 4TSCL 2GFBA 4HC1L 2O6EA 3RRQA 3BT2H 1G6RB 5DO8A 2E6JA 1I85C 3CFTA 4RGOH 3CXHJ 4JFEE 1X4ZA 3CZEA 5L8KB 5IROA 4UQCA 4NUMA 5I5JA 1UATA 1ZANL 3HG4A 4LOFA 1MJJA 3SCMD 1EHAA 4ZMZA 1HYRC 1F00I 4WWID 3SJVD 3A3YB 1VB9A 5HYJE 1LWRA 1NCBL 1S3KH 3QISA 4GFXA 3DO4A 3OKLA 3RUGF 3S3SA 3ZTNL 3KVDD 3WKPA 2WGNB 2Y7QA 4XB7A 3K6DA 1G1OA 4L3FA 4ZMQA 1KNOB 2HWZH 2XNAA 1N0XL 2D3JA 3EGSB 3QFGA 2OXHA 2DQGH 5JHMA 4Y5YC 4NRXA 4P2QB 2VXVH 3KLSA 3QCUL 4JRYA 5IQLA 1MFDH 2OYPA 4FYRA 2GTWB 3GJFB 2Y0SA 4A7VA 5FEBA 1CTNA 2A0LC 4OFYD 4PPTA 3RWGA 2CKBB 4P0DA 3NFNB 4IJTA 5AAWA 3IDNB 2QQQA 2MPAH 3O4LA 3ZK0A 1DBBH 3PJNA 3KLQA 1MFAH 2EDRA 3KCPB 2CUIA 3WEXB 5IW6B 2UY6B 2VMFA 3O9WC 2RR3A 4BIKA 4Y9GA 1RZIB 3EUUA 3X12B 2HRGA 3BD4A 4ONGL 3ZX1A 1NFDE 4TNVK 1D5BA 4XC1L 3SBWA 4XODA 3WD5H 1JGLL 1N9PA 3BUBA 5D8JL 4IIZA 4Z3EA 4Z0XB 1RV6X 3RG1C 4FG6C 1AOZA 3BYTA 3N43F 1W0VB 2CIKA 2DRUA 4H4NA 3KPRE 1Q1JL 2AJSL 4V11A 5BZDB 2WWNA 3CN0A 5HVHC 4FDWA 2JH2A 3BLPX 3QJRB 3T71A 2PWEA 3O2DL 4JHWH 5CN3A 5BOJA 3WIHH 1NUDA 1YY9D 1MDTA 3QDJD 3DI2B 3O9WD 1CGSL 4KHXH 2ZSWB 4OGAD 1OAUL 2ITEA 4W9GC 1RUQH 4UQBA 2DAVA 1BA9A 2E0PA 4IDJL 4AL8H 4FFWC 2ETWA 5EA0H 5CCHE 4JRWA 4RNRA 2BMKB 4FG6D 1MCIA 2FGZA 3ULUH 1U92A 5A3IC 4NNXB 1NOAA 1Z9OA 1CDHA 1NAKL 3VWKB 2NXYC 4Z8FH 4YDNA 5ETUA 3L3IA 2ZT9C 4HIHA 4M8QA 4R8WL 5IESL 2VRQA 3BDYH 5EOTB 2PXYC 3S5LG 3ZL4L 4R26L 1WIOA 4R96B 2ZWLT 2XA8L 4N87A 1CFNB 4YGAB 2BS8A 3GSQA 4LHUA 5TF1L 3QJUB 5J1SC 3IFPA 1I3UA 4PD4J 3VXUE 1I9RL 3MTRA 4NSKA 4K71C 2P80A 3NJJA 1J1PH 4GUQA 3QDGA 4FFWD 3C5XA 1R0AL 1RERA 1CGUA 2AXGB 2F53E 2OJZL 2V17H 2IXQA 2ZP9A 3RU8L 5A3ID 1RJCA 1Q94B 3OMZA 4G1EB 3AWFA 4IBLT 2N7SA 2NXYD 4ZFZA 5F9WC 4Y2OB 2WXIA 4AMXA 2A99A 4B6ZA 1UCTA 4PWHA 3IBOA 1GCFA 1U95B 4PG9A 1CGYA 2B8OT 4U6HA 2JJVA 3JYCA 2PXYD 2ZX8A 5E2VL 3SPVA 3EFFA 5AB0A 4GRLB 3PP4H 4L0YA 4WW2F 2PLTA 1UGKA 1DJHA 3KYKL 3DX6B 5A40E 4W4OC 3LKRA 2OPCA 1MSPA 2YGPA 4QXTA 2GBAA 4JPVL 5LUMA 2X6VA 3B2XA 4P04A 4A6YL 4HXBL 4FP8H 1A6VH 1LMIA 5IJCC 1I1FA 32C2B 4D8OA 1SEQH 5GS1A 2ATPA 3GFUA 4ZMYA 5JHLL 3P4OA 5ENWA 2BHZA 1LDSA 3ZKSD 2WNXA 3B7RL 3PWLB 1J9RA 3VH8B 2IDQA 3TCLB 3WFBH 5C3LD 1IO4C 1KMGA 4HPOL 3QJHA 5HP5A 1ZLVK 4OB5H 5ALCL 2BVOB 1ZVYA 4HUKB 2DN7A 4HIXL 5I15L 1QRNE 4FQ2L 3V4VA 3VGAB 2KYIA 4MD0B 3DNKA 2GSGA 3T04D 1I8AA 3EH1A 5PCYA 5MENE 2NOYA 1JF1B 2F7OA 3HS8A 1XQ4A 4QT5A 1D7DA 1U3NA 3C75A 5CLZA 2VE6B 3SKJL 5JQHC 2JB5L 2VWEC 4LSDA 4WV1C 2JI3A 4HOXA 4LEXH 1JZ6A 4ORGB 3KEHA 2LQRA 2IADB 3QR1A 3O11A 3QG7H 4U6YA 1CFSA 4GRWF 3WNOA 4XBEH 1YNTF 1CIDA 1KJ2L 4DKEL 1J05A 2XZCH 5CD5C 2R4SL 3FHQA 4GQ9L 4LCYA 3N1PC 5G4OA 3DX8B 4MA1C 4HLEA 5L7XH 3RIFF 5EIQA 5F7HA 2OBGA 5EPMB 3BDXA 1OCRB 2W07B 3ZL1A 2WM0A 1TR7A 4W6YB 4ZX5A 4HGMA 3POHA 4QXUL 4YOKA 4MS6A 3UX9B 1YYLH 1OPGH 2P5EB 2HFEA 1AMYA 4Z18A 4HETA 4A7GF 1UOKA 3OXSB 3S5ZA 1H9DA 1HJBC 3ZU8A 3AU1A 3WNNA 1PGRB 4DFIA 4B3EA 1Q9OB 3VXMD 5HI5C 3V8OA 4AIOA 5JW5A 5KVDH 4N90E 4DPCX 2MNUA 5CD5D 3KWVA 4UM9D 5GS2H 4F37F 1YMMB 3VI3E 5I1HH 2JTYA 3T2LA 4IBVA 2IPTH 2YK1H 4AKQA 2QSVA 3R4DA 4D9RE 4DO4A 1FL3B 4HJ1A 2VLJE 3QVAA 4PP1C 4DSYA 4YDLB 5IFHL 4OIAA 4RMRA 4ENZA 1B9ZA 1KN4L 1PVHA 2D9QB 4NKOA 4GINA 3N44F 5DMKB 3QFJA 1AY1H 1M3JA 1N5AB 4JRXD 4Z76A 1D5ZA 1HAWA 4TUUA 2A6IB 1NJ9A 1D7BA 1Z9PA 1OSEA 4HKJB 2BO0A 2NQCA 3E6FB 4OJAA 1E9QA 1PG7W 2ZUYA 5DD3L 4ELMB 5HI5D 1FGNL 3IDIB 1CICC 2IFFL 5C6TH 2HJLA 4NP4L 3F62A 2YPKB 1L9SA 4YNYB 3UDWA 7PCYA 3CZNA 3JQOB 4WZ9A 1OKEA 3QNXA 4NKDA 4ETQA 3TBTA 3TZVB 4HUVA 3HZVB 4PP1D 1KB5H 3FW6A 1U6AH 2H32A 2WN2A 2QPEB 3MNWA 2C9SA 3MA9H 1GS7A 2IFGA 3F00A 4LLMA 3RX5A 3ULVE 5GGTL 4P05A 3N06B 3LHPL 3QUMA 2ITDA 3CLFH 2ARWA 3G6JB 5TE7H 1J88A 3PQYA 2PMZA 3LZNA 1NIDA 4X7FC 4WI9A 1UJ3C 4MJID 1FAKT 1T5XA 3DO7A 3H42L 1CICD 2E7CA 2DQMA 5MEOB 4X9HA 2Y24A 1LQBC 4E42A 2V9RA 3R0NA 3IJYB 3MV8D 4ZO7A 3FRPB 4BFOA 4U7MA 1IGYB 2OL3H 1FNSL 1MLCA 2LOEA 3MX0B 1SOKA 3LB6C 4BQ9A 4G1MA 4GSRA 1N7ML 2JE8A 5BS0E 2V3EA 4JHAH 1I7UB 1OB1A 5ICUA 1DN0A 3R4RA 5G5DB 2PTTA 1LO2H 4MXWH 4PJEE 5LNGA 1AQMA 3MV7E 4WTWA 5EC2A 4ZTOL 1R5VA 3K5SA 1QSED 3PWNA 5B38B 2NW2A 2YARA 1BM3H 3V0WL 4AT6A 5EC1A 3G04B 2X12A 5KYXA 1TMQA 4L5FH 3V7AG 5IB4B 1A1NA 2CHXA 5IFJA 4N8VB 4F27A 4UU9A 2GCYA 3BVTA 3HHMA 5HPMA 3I6KB 2WOYA 1RZ7L 4MNHA 3UPRB 1BQHB 3VU2A 3G6DH 3LB6D 2G0LA 1MAKA 4PCKA 3FUFA 1F42A 4JFDB 3CUPA 2XZQL 3BGMB 1MUJA 3PAZA 4QNPF 5SWZE 4NI3A 2CQVA 2Y7MA 3X1EA 3ZE1B 3B9KD 1VKXB 2VITB 1I4FB 5T3ZL 2EINB 2HKFL 3BP7A 2HCZX 3DPDA 1TZGL 3V7MA 4JCMA 4GIPD 2V0AA 4F7KA 1ORQA 3NSJA 1X5LA 3DXAB 1EGJH 2LVCA 1J0IA 2MEJB 3QUHA 4UT9H 1YEFL 1JWUA 5FUZH 3SJVE 1GGCL 2OJ1A 3U4AA 1UVQB 2YGVA 1IC1A 1NBCA 5SX5H 5IFAH 2E7HA 4PJAA 5JIIA 1XR9A 4G6ML 3FB7A 4W9ZA 1RZ8A 4BFRA 2QADC 4AMKH 3L7EA 5I18L 1AFVH 2J88H 1LYQA 2NZ1A 4I0CC 3QDAA 5E8EB 5TFSL 3UJJH 3WNPA 4BXVA 4P2OC 1FH5L 4OFQA 3KPPA 3N42F 3QUXA 4L1SA 1X5MA 2AK4A 2QZQA 1XGQA 3TYGL 2X4SB 3WEAA 3VFOB 2F7PA 4DKTA 2FLMA 2OXGA 1BVNP 5BV7B 3ATAA 5F3BA 2CDGA 5H37H 4QO1A 3T2PA 5JQ6L 2O6FA 4Y19A 5JLZA 2TSAA 4PEEA 1ETZB 4C4BA 1G5GA 1SYVA 3A6OA 2XTJB 4LCIL 5D7JB 12E8L 5BRZD 5T1MA 5D1XE 3U2SB 1JMZA 4EOWH 3WIAA 1HSAB 1GJIA 4NQEB 2GITB 2XFGB 1Z5YD 3CWGA 3NJNA 5IHUH 5JYMA 2QADD 2OX5A 3K74B 4P2OD 1FYHB 2B59A 3BVVA 2K1MA 2VQ1B 2QV2A 3U6XA 1JRHL 5I19H 4JFZH 2EC8A 2P44B 2F54A 3HE6B 5MI0B 4NCDA 1NANI 2J8UB 2W91A 3LNFA 3W9EB 4PGEA 1HZLA 3NZSA 3QHFL 2YIHA 2ZOUA 4KK9C 4ODXB 4XMXA 3TOPA 1HXMB 2Z8VC 1N5YH 4OGYH 4Y4HA 4BA8A 3UG3A 3V4PL 2UX7A 4N6RB 5J9PA 3G5XB 5IKCA 1U3ZA 4RISL 1TEGA 2VB5A 1S9VA 1OGTB 4U1IA 5E8NB 1WO2A 3KWUA 1PZUB 2ZAIA 3HJ0A 3SY0A 2EYRB 3CFEB 3MRIB 1TJHH 1GZPA 1UOLA 4KGLA 4IRJB 4YSEA 4CSSA 3KVQA 4X4XB 3FTGB 1OY3B 2C9VA 4QXGL 2ADIB 3BCDA 5FYLD 1UTDA 5C2BL 4TOYL 4MJ4A 2FJUB 1AVAA 1K85A 4CL7A 2KC0A 4LMQE 1KV7A 5B1KA 3EJTA 2OTWB 4KK9D 5IP4A 3FSOA 1TETH 4G72B 4KDTC 1C16A 2OYLA 1USQA 2E5EA 2GAZB 2JIXA 4GKNA 1IEHA 1JHKL 1AD0B 5HHNA 4UZUA 3IMSA 5GGRA 2BY3A 3MLTB 4PRBA 2R1WA 5MHSE 5FUOL 1GTFA 3GEFA 4BEIA 3QXAA 4PCYA 2NSXA 3PWVA 4YFEA 4P4KA 5FECA 1WD9A 3RI5F 1MCOH 5ID1A 4O51B 3H1ZA 2ZWNA 4FD0A 1AR1C 1MVYA 4R90L 1PQZB 4TL5A 4ZUTB 3X13A 1S7XA 1DTUA 1CZ8H 2VR7A 5CJBA 3UMTA 4XPTH 2NNAA 1LK2A 2HFGH 3QRBA 3BP6A 1TTRA 4FG4A 4TPRH 3SGJA 3B5HA 1U8KB 4TSAH 4OM1H 1UA6H 1U8MA 2EEDA 3JSSA 4OLYL 4OSUL 1CI5A 3VWJA 3N85L 4CDGC 2AEQH 3JTSA 4JKPH 3MUHL 1L0YA 3RHWF 1FJ1A 3MRJB 4LCWD 4ZXBC 2VW4A 4MMXA 4Z7VE 1K8DB 5C0RH 1RVFH 4WO0A 5F0JB 3SKOA 4GRMB 1T1YB 3HJEA 3QQ3B 4M7ZB 4FZ8L 1AR1D 2WQXA 3DUSB 4RIRB 1VCBC 3GUTB 3KH3A 1ZS8B 4PTUA 2XLLA 4OM0L 1ZT7A 3IS1X 4S11A 1H3TA 3U1QA 1PIGA 3BAEL 3HHRB 3IFNL 1RIHL 1G7HB 1UCBL 2Y1ZA 1NTDA 3SO3B 4NQCB 4PBDA 5FA3A 2R2EB 1WUNT 2R27A 4ECNA 1OTUC 4UANA 3L3GA 2KMWA 3QDMB 5K39B 4ZXBD 4HEPA 3IB4A 2FGWL 1S7TA 5CILH 2PCPA 4FQQB 1OHQA 4AJVA 3AB0B 5BOPA 1DQLL 3TVMB 1J5OH 4YVNA 1GSKA 1UM5H 3A23A 1ZLUH 4AQ1C 5A2AA 3GSVA 2PYFA 1H8NA 4PJXF 3N41B 4TUJB 1BBDH 4ZDHB 3VFTB 4K55A 3F58H 4DQOL 1C1EH 2Y7NA 5DJ0A 3SE4C 1HFUA 2WY3B 1BVZA 4RQQB 4UF7C 3S3CB 3M8OL 1BECA 3UTSA 5KW9H 2FJHA 3CXFA 3DVNA 4V1DD 4EI5A 1ADQL 1KYDA 2XPGB 3OAYK 1RIVH 4Z1PA 1I8UA 5IBLC 1CLCA 5CD3A 5J0BA 1I9IL 3ABKB 4M3HA 3SDDB 5I1LB 1J0YA 4XVUC 3KDMB 1QNZH 1YUHA 4DHLA 1F4AA 3MQIA 1F4WL 1ODAA 4NKIH 4QRSA 5IM7B 4ODVL 2IWGA 2QR0A 1GCYA 4B50A 3D50A 3N0AA 3BP5A 3O6LL 3RWHA 4DP6X 2X6MA 1A4JA 1S5IL 2KH2B 4NQXA 2VKWA 1YEGH 4WKZA 4ZI8A 1M6OB 2VDQH 3QWOA 4YBLC 1A3LH 3DIVA 4P3DB 5GSRB 3VGHA 1IX2A 2X0VA 3QEQB 3IJSA 4MNGA 4KAQL 4XMWA 1NDGB 3QH3A 1SXNA 4IIQC 5IBLD 5E2UL 5CEZD 3P30L 4GSXA 3RNKA 1PKQE 4XVUD 5E5UB 1Z5HA 1A6ZB 4K9EC 1HSBB 4HT1H 3NIFF 5IMMB 4WI2A 5I26A 5K9QI 4YHOL 4HUNB 3A4EA 4R9HA 4AKPA 2FT7A 1RHFA 3RDJA 4E9YA 3QIBC 4GAYB 4HIIA 4ZMWA 4KVPA 1KWGA 1U8CA 2Q7NA 1SPDA 1ZANH 2Z6FA 3FN0H 1HHJB 3FRUB 3NZ8A 4LBEA 4WCYL 4LAJH 4MB4A 4IOSD 1OP4A 1LP9F 5FO9A 4F5CA 4BYHA 3ZUNC 3GSNH 3GXPA 1MN4A 1PIFA 2EXYC 2XWTA 2B5IB 3PV6B 3ZTNH 5E2WL 5C3IA 3VSVA 1SYSB 2WIIB 3BKJL 2IG2L 1KN2L 1U4EA 3NRPA 2XCMC 1JOIA 3MRNA 3KXFA 3QRGL 3PHQA 4G8IA 1N0XH 4B96A 1RHHB 1RSFA 2HTKC 5C0AA 3QCUH 1EMTL 2UXGA 3QIBD 4LHQB 2N7AA 3T1FB 4MJIE 5C0ND 3LXAA 3NTCL 1HXYB 1EDYA 3DWTA 3H4HA 4MNQD 2K8MA 5IVXE 4BFIB 1ZGLM 1LO0L 2WYTA 4BZ2A 4YX2L 2NW3B 3BLKA 3MV8E 4E0RA 2DLTA 4WNJA 4M7JL 3H4FA 3T0BA 4PWIA 2V5SA 2AKRA 2ZNXA 1FGVH 3PREA 4NZTL 4QRPA 5EORL 2ZXWB 3T4YB 3VRIB 1OP9A 4KK5D 3MCYA 3CCHA 4PG2C 4XC1H 2Y5QA 3TXAA 4OCMC 5H4YA 3QPKA 5D8JH 3KPTA 1L7IL 3UFIA 2AV1B 2HTKD 4MBRA 2KHAA 4U1JA 5CLTA 1A0QL 2R9HC 2VAAB 3P69A 1CT8A 4DEWA 3M1CA 1UACL 2AJSH 3H7BA 4QGYA 4PJBA 2B14A 4OQTL 3NDZE 2XWEA 4GT0A 5LGJA 4P9HL 3TBWB 1MFVA 4A37A 3O2DH 5HJBA 5FGBA 4KHTL 1HQ4B 2WP3O 3MUZ1 4G7RB 4RETB 3W1ZA 1CGSH 2Y3AA 4IRSB 3TU6A 4I18C 4RX4A 4LPVA 4CUCA 1NM9A 3MJ7B 1BAWA 2CMRH 2DF3A 4AE1A 4ZPTA 1RFDL 3KL0A 4IDJH 3EJQA 3WEMA 1P7KA 4HK0B 1T5WB 5BRPA 5CLWA 4G8FB 2E7DA 4WUUB 3LD8B 4MFHA 1DVYA 4OZ4B 3ARRA 4QY8B 4U4BA 4U6XB 2GJZA 4P4RA 4HUWB 1Z5LA 1KLGA 5F71A 1IEAB 4P5TA 5H94A 2ORBL 4HEPG 3ZHKA 3EH2A 3F84A 2Y5TA 5E4EB 1DQVA 3C60A 3ZL4H 3ZTJH 4JO3H 2EADA 2XA8H 4JFFA 4Y9BA 2XTSA 1A3QA 1SJVA 4GAGH 1J8KA 1KCKA 1SN2A 3U4EB 5DEGA 3KHQA 5EBLB 1I9RH 4L9DA 3P3YA 1BAFL 1IGJB 1FNEB 1MZYA 1VJSA 2CPUA 4OU3A 3ILQC 4S2SB 4BE6A 3ALWA 1MJ7H 1R0AH 2B2XH 3RU8H 2OJZH 1T0NA 1KIQB 1NCCL 3QSKB 1HILB 2IF7A 2ARJA 4PJFA 4PTTB 4UT6A 3ULSA 3UOAB 3N1QC 2CO1A 5ACZB 4NAMA 3T4AB 3IDJA 4PYGA 4F8LA 1EJFA 2BDNL 4G80A 4XB8A 4ZMTA 4JFQB 3GSXA 3KYKH 2NY1B 2NY6C 3IXTB 1PAZA 3ZQXA 4PRHE 3QORA 1BV8A 4N2HA 2F19L 5G2NA 4JPVH 1JHLL 3ILQD 4A04A 5FYLH 4A38A 2VR9A 4HF5L 3T6XA 4HXBH 2COVD 4MAYC 3GS0A 3RWJB 4KBPA 1UG9A 3HG1D 1PLAA 3V5HA 4FLOA 4U1LA 5GRWA 5HGDB 4YHML 4N2EA 4IHOA 1TJGH 1YECL 1WSST 2P8LB 2I9TB 5IHZB 1FZJA 1KBPA 1PCXA 3QZPA 2PYED 1DO6A 3V5DA 4Q89A 5ALCH 3W9DB 2NY6D 4FXKA 1WG3A 5IW1A 2MSPA 2XXCB 5I15H 3TA3B 1XIWB 2WTRA 1ZT1B 2RCSL 3FT3A 3ML8A 1JFQL 4J27A 2BSTA 4XP5L 4O2FB 3GBDA 1BP3B 5C97A 1QD0A 4G9FD 3RWCA 1KTLB 2AV7B 3IF1B 1HCFX 1G7JB 1MF2H 2EYTA 2QVFB 1XGPB 4MAYD 4QHUA 3QULA 1SJEB 3QWQB 2ZONA 5B8CB 3VG9B 2BY2A 4WFED 4YZFE 4NJAH 4OD1H 2ERJC 4ZFQA 3UG5A 5HD8C 3OKKB 2YA1A 4MD4B 4OCRL 4NLAA 3ULVL 3C5ZC 3A67L 5DMIL 4M7KL 1PZAA 1R3KB 2YMOA 4BKSC 2V8MA 3REVB 3SBPA 4DKEH 2OYKA 7FABL 4BHUI 3DX0A 2WWMC 4IGBA 1SMAA 2BOCA 4OZIE 4JVWA 3CSFA 4FA7B 2CXGA 1ILSA 3P4NA 4KMTL 4OLXL 3ROLB 5KUKA 1VACB 5IB2A 4BKLA 1GMIA 4X6CE 2H45A 4L8DB 2BNUB 5HD8D 3PL6C 2ZOLA 2E7MA 2G2RB 5AW1B 5B1JC 1O9VA 2QTEA 1RZFL 3C5ZD 2TAAA 3C8DA 3DPBA 2YKKA 3FCSB 2A9NH 3L45A 1FIEA 4OD2B 3FTZA 5LAXB 1Q9WB 1OK8A 4M7LT 3OZ9H 3ZRCC 1ZHLA 3OHXB 5C0GB 5DEZA 5HDBB 3EOYG 5KSBB 5HGAA 2WWMD 3QUZC 4WO4C 1IBFA 2XXMB 1KGJA 1IAIM 3I50L 2V7NA 2ENJA 3MBEB 2DWEA 4LKCA 1K6QH 5GSVA 4W70A 3GMLA 1FVDB 4JZOA 5IQOA 4ZPVB 4AYSA 3FQ2A 4BSVA 5IFHH 1WFMA 3PL6D 3WELA 5HYQA 2G9KA 5GIRB 5LWYL 1KCUL 5HVWA 5JPMA 2XBDA 3VCLB 2O61B 5I1DB 4ONFL 1I8IA 1JP5A 3BKCH 2OMUB 1SDDA 4LVOC 3UTQB 2FLBT 5DD3H 1ICTA 5AVRB 2C9RA 2P7TA 3L2NA 5DHVH 2H0JA 1OAQH 3O41A 2IFFH 1F4YH 3BWAB 4XNQA 5KSUB 4JFOA 4WO4D 2W65A 1BSIA 3QUZD 3D33A 1NEZB 4PBVC 2CCVA 4MGXA 2PP7A 2XWJB 3FU7A 3J8F7 4Y8DC 2H3NA 1TT6A 5IF0B 1E90A 1IJ9A 2AI0H 5KVFH 5EDXA 3PABA 2DIAA 4JE4B 4CVZB 4KJYB 4Y5XB 3F7LA 2AQPA 2IPKB 4CMMB 2JKRM 5CCJA 2VN3A 5EU5B 2ZXEB 4IBSA 1QNIA 5GGTH 2BVQB 3MNVB 5SWQA 3IVKB 3LHPH 2GVYA 5A2FA 2X1WL 5D72H 4N28A 1FAIL 4V2CB 1UYWL 5FFLA 1DVSA 4O5LL 4UI2A 4R97B 1NGXB 5CMAA 5D93B 1PZDA 1D6VL 1G7QA 3FO2A 3ZYOA 2WSPA 1B6UA 3HC0A 3PHOA 4XX1E 1AG0A 1I82A 5ID0A 5FLUA 1TZHB 5ILTL 4P48A 4XCYA 2DTSA 2Q86B 5CEZH 5F2FA 5T5FL 4A2DA 2FD6L 3WKYA 1NIFA 4CBZA 1DSYA 2WLIB 3P4LA 1PEWA 1DQML 3QC6X 1I1AA 4FFYA 5C08D 4WFGE 4CVXB 4XXWA 4JJ5B 3VFRB 4NCC1 2WWKO 4JDEB 5FGRA 4OUOA 5AZEL 1CTMA 1K3ZA 2J12B 1F1AA 5JW4R 4HS8H 4ZTOH 4W9FC 3EGSA 5L4JA 3L3OA 2ALWA 4FNSA 1UOVA 4P2QA 1PLGL 4WIQA 3WXVL 4WHYG 1QWUA 1LO4L 3AITA 1TLKA 3SD2A 4OV6F 5ICYA 5T1LD 5JPNB 5LVEA 4P9HC 3IDNA 3DX7B 1YQVL 1PG7X 1RZ7H 1BBJB 4XNYH 2MCPL 1KLUA 3U1SL 3WEXA 5HHOA 2YN3A 2CD0A 2UY6A 2O5XL 1K8IA 4QUOA 1NFAA 3NACH 4HUXA 1RZIA 2XZQH 5ISZD 3ILDA 2BHYA 5T3ZH 4XOBA 3WJLA 2B77A 4E41A 1SQ2N 2HKFH 1Q0YH 4A55A 2B20A 1T22B 4KZEL 4I9WD 2V33A 2DM2A 2FZ3A 5AOKA 3OJ2C 4EJ1C 7CGTA 1JZ8A 4LOEA 4S10A 3S9DB 1SUHA 1YEFH 2ESVB 1L9TA 1ZT4A 2BNRE 1AGFB 1QBBA 4AJWA 2CBPA 2OMBA 1SEBA 1E42A 3FQXB 4CC1A 5IVZA 5TFSH 4OJYA 1UD4A 2OZNA 5BQDA 5KZCB 3Q01A 2AXHA 1G9NC 2ZSWA 1U0QA 3W39B 3NH7H 2B0SL 2J6EA 3NA4A 4FL4B 3ZT7A 3VFPB 4F15B 1RK1A 3TYGH 1ITCA 3C2SA 1UASA 1KB5B 3L95B 1KIPA 4NT6A 3EBIA 4MNQE 2AJVL 2OMTB 3WL9A 3BUTA 3IKCB 2UZPA 5I75C 5JQ6H 1PY0A 5AKSA 3I02B 1JV2B 4L1TA 1S7SA 2NY0B 2VN6A 4G43A 4NUPA 12E8H 4PJ5B 4J6IA 3IU4L 3OG4B 4F7PB 5TGBB 5J3HC 4UOJA 1PY9A 1JFHA 3L4UA 4NHCL 3K0WA 5F7NC 5HDQL 3VNZA 1TQSA 1FNAA 1CJYA 3LJ3A 4MRCA 1XD0A 3GSUA 1DLHB 1MRDH 2ZAHA 3GMNA 1GTNA 4GXUN 2AJZB 3PXHA 2VXUL 3BH8B 5C07D 2OL3B 1EFXD 2FX9H 3RGHA 3GIVB 3P3SA 1B3IA 3QHFH 3A6BH 4MD5B 3HUJA 5I16B 3LEVL 3RKDC 1O6VA 5F8RC 4NJ9L 4J7RA 1DDTA 1S7WA 4Q2ZA 4Y2OA 4XZUB 1EZVX 1NAMA 3IDYC 3IBEA 5T1DL 5J3HD 2QSTA 2ZPKL 1YO4A 2ZQKA 3ZL2A 4PV8A 4NNPH 1ET5A 3ZRSA 4GRLA 5GS3A 3D3VA 2KZ1B 2Q2EB 4JHUA 4GMSL 3GSRB 2VLKE 5DTFB 1A7RH 4QXGH 5C0IB 5CZXC 4G7YH 5C2BH 4TOYH 2KPWA 3ESVF 1Q8MA 4PJ7F 5T1KB 1TOXA 1R3IL 1FCCA 4XNZC 2IMNA 5FCUL 3JTTA 1U93B 5DQDH 6PCYA 3EXLA 3RKDD 1VFUA 2W60A 1A4BA 4WI6A 1MFBL 1UKTA 3AU0A 2Y9RT 1BMZA 4JM4L 2AQNA 2FX7L 1UEMA 1MHHB 2ZKYA 1JHKH 4ZTPH 4BGLA 4LLQB 3MJ8B 4J4PA 3FS9A 1E9OB 4XT1C 3VH8A 4UYQA 1R4XA 4MCYA 3T77A 1BQLH 4CSZA 1BYOA 2DLGA 2EO1A 4MMZA 4F1ZA 1M4KA 3G9AB 3CMGA 1MNNA 1PDKA 5A16B 3P40A 4QHMB 2HG0A 5E2TH 1OGAD 3RURA 4AH2A 4UOQA 3EXJA 5E9DD 5J7CC 5EZOL 5CZXD 3S96B 1WT5C 2YS4A 3CN2A 5EMYA 2XX0A 2CLVA 2YAOA 3HI5H 3CJJA 4R90H 3CZSA 1SHMA 2DYPD 2EVFA 2DZEA 3Q6FB 3MREB 1HE7A 3WDIA 4AK1A 4WWKC 4PWFA 3IMVA 3LN9A 4ZD3L 3C8KB 4Y5YB 2VDRL 3HEIB 3AROA 4BJLA 1TQVA 2A3TA 4RFNB 3BW9B 1Q9LB 4ISVB 1NCNA 2NUTB 3HI1A 5CNHA 5AKTA 3BAWA 4I48B 1ZGLP 3K46A 5BO1L 4GQQA 3A4DA 1OQXA 3OGCB 4ORGA 4JRFA 4OLYH 4FNPA 2GSIB 3N85H 1IAKB 1OEZW 2XTLA 3EDEA 4F80A 3MGOB 2APFA 2PW1A 1XCTA 3DETC 5CFAA 3SE8H 2V2XA 1BIHA 3GUFA 5KANI 4NDMB 5TQ2H 1QQDB 4FZ8H 4QRUA 5F7DA 4OCWL 3EHBB 5I0DA 4WNSA 3PWPA 4IK6A 4UMSA 4WWKD 3R7QA 5LKNA 4OM0H 4KUCF 2NZ9C 3E2HC 4KZDH 3THML 1KCRL 2X3BA 3VYOA 3BOVA 5EU6D 4CILA 3BAEH 3P73B 4S0TD 3IFNH 2E9WA 4KVCL 3UG4A 2BNQB 2BSED 1JF6A 2AAAA 5J13B 1E4KA 4KMLB 5IUCA 2P5WE 5E6RB 1FDLL 4OZGA 4JDZB 4Y1AD 1N19A 2GTZB 4G9FE 1A66A 2AMUA 3WN5B 2JK5B 1E9PA 3DETD 3BEWB 4J28A 1DBMH 4PJGE 5C0CD 1WC7A 1DQLH 4YXKH 1UJTA 5FW8A 1MFUA 4HFUH 1XD1A 4DH2A 4UAOB 2W9EL 4U3SB 5D7IA 3HPJB 1EEQA 3SDXE 5M7QA 5EF3A 2NZ9D 3MRHB 2YRBA 4U1NA 2CIIA 4L3EA 1ZLDA 2EDMA 4DQOH 1TTUA 2JKXA 1C5CL 1RY7B 5IB1A 3F7RA 2FJGA 1CXKA 1GGUA 3M8OH 1YEKL 5F89A 2Z1PA 3BAKA 2WXKA 4NBZB 5HSFA 4LCUA 4WW2C 1HEJC 4GMTH 5EBGA 1WFOA 2E59A 5CJ5A 5I1IH 4JLRA 4ELMA 2UZYA 3WSQH 3IDIA 4XNXH 4AENB 2A6JA 2YPKA 1QEWB 1I9IH 1JD9A 1P53A 1BFOA 3HAEA 2CO4A 2NXZB 1W9XA 3QQ4A 1WTGT 2XBTA 2DQ6A 1RZGB 4ODVH 5CEYB 5CIPA 5DZLA 4KOBA 2FJFB 4DP5X 1IKNC 5F9WB 4UV4L 1ROCA 2P24A 3AQYA 3MODL 4ODUA 3C2AH 4KPHL 5HGHA 2UWEB 1T7WA 1DLFL 3G6JA 3ZE1F 1P9MC 5DURD 3OXRB 1BQSA 2ZX7A 1IM3D 2X1QA 1RCYA 4X6DE 4EN3C 1SLVA 2D7NA 2FBRA 3CH8A 1FC2D 5MEOA 3F5WB 4PJCB 1Q9KB 2RBLA 4Z7UE 1CGXA 3GSOA 4I77L 3N0PB 4G8GD 3O6FB 3T09A 1J5HA 3AQXA 4PGCB 5ITFB 3SDYH 4HYTB 1RURH 2EKJA 2MHAA 2Z31C 4LVNB 4YHOH 4L29A 1SJHB 3D0VB 5I0WA 2IDUA 2W0FB 4PJDB 3GK8L 1I7UA 2XDHA 1AXSB 2BS9A 1QFWM 1VZHA 3CXHK 1Y6MR 3FYEB 3LVTA 5G5DA 4I2XB 4AQOA 2HKAA 3AWEA 4BGDA 3WO4C 5LBSA 5FM4A 4EN3D 1Z66A 1J0JA 35C8L 5TE6L 3RQ3A 3ZE2B 5IB4A 4AY0A 1RPQA 4XWGH 4YPGA 3D34A 3O3BB 3VQMA 4TVUA 5DUBA 2VXQL 1KN2H 2YC1A 1E3FA 3D39B 4N3UA 2W5PA 1HEHC 1NPUA 2FO8A 1SN0A 5GGQL 4FNTA 1LO3L 3L4VA 2Z31D 5E6IC 1KOAA 1CYGA 1TF4A 4LF3A 4F2MA 1UM4L 3VH8G 1EMTH 3P9MB 1ZWIA 5DQ9B 3GJEB 2R2BB 2VDPB 1FRGL 1I4FA 4GQRA 2AJ3B 1L5GB 1LO0H 2QQLL 1DCLA 4UINH 3BIBX 2J8UF 4JO1H 2KDYA 1ND0B 4M7JH 3H9SA 3DV6A 3IFOB 3DXAA 5BVJB 1K4CA 4O4YH 5ICXB 5C86A 2XWBB 3LH9A 2FR4B 4CSPA 4UM9B 2YXFA 2XI9A 5DD6B 5C92A 2DB8A 5C08E 2EEBA 2QJDA 1LO5A 2KPNA 1U3HC 3N40P 4LIQE 5E6ID 4HUUA 1L7IH 3ARQA 4B3VA 3FUEA 1TFHA 2CGRL 1FG2B 4GI6A 4Y5VC 3OB0H 4H5SB 1A0QH 2XN9B 3BUDA 2ZX6A 3DYPA 5KS9E 2ITCB 1EZVY 4JRXB 1RJLA 2C3VB 3MOAL 1A64A 3BFQG 4TNWF 1NGPL 2VSDA 4YMPA 4H25A 4XMLL 2VDNH 4P9HH 5EBWB 1LEKA 4AGQA 1WAPA 3LKSA 4L4TE 3PWJA 4KHTH 5FA4B 4C56D 3WNJA 4WSKA 5AVWB 3U2SA 3ABLB 1JK9B 3PUCA 1JYWA 1AGBA 1C8QA 3D25B 1RFDH 2V9TA 4ZFOB 4LL4A 1J48A 4YJZL 1Z2KA 3QEHB 1INEL 1WA2X 1KCWA 3SYCA 3UL4A 5D6CA 2R29A 2VQ1A 4AX3A 3KLKA 3MKGA 5KANG 4FI7A 3UBXB 3BO8B 2Y6SC 4UOZA 5L0QC 1MCJA 1A4AA 3CLEL 5F1IA 2H9GB 1SY6H 2RALA 1H0DB 4PJ8A 4PJIE 2AVGA 1A7QH 1FNHA 1JXGA 1J1XH 2X09A 3UH8A 5L2KB 2A6KA 4KO5A 5C09D 1PG7H 2KQMA 1N6QL 4OR1A 4P06A 3VFUB 5LDUA 3ARFC 5JIDA 4J2XA 3TEYA 2XQBL 5JHDD 1HHHA 3LMJH 4N6RA 4PD4K 1A5FL 4ZYKB 5HDRA 2Z64C 3FFCD 5K9OB 3X1BA 3CK0L 1BAFH 1CK0H 1G9NH 2IAAC 4HZLA 5CSBA 2A74A 1BQUA 5IG7B 3ZMNA 1XVSA 1NC4B 5DS8A 3HC3H 1UXMA 3GSNB 2E74C 3HG5A 1NCCH 3HMXH 5HYSB 2KLRA 1XMWA 4A7TA 2JELL 1CDCA 4Z5RB 4NAJA 2YAHA 3G5VA 1AO7B 2Y6SD 2D9CA 3C6EA 3ARPA 5GXBB 3NBNA 1C7TA 3L2LA 3QWRA 2F08A 3O45A 2GK2A 4ODHL 2OTWA 4UQDA 3LIZA 1MI5A 4ZUVA 1Y1UA 1UJ3B 2NY2C 5EZLA 5L8JB 3ARFD 3U0PA 3HAEG 3BUPA 3PAVA 1M6UA 5MEPB 3UAAA 3L3HB 2SEBB 5D2NB 4ZODA 4N2IA 4DEPB 2PR4L 5C07E 2J73A 3RTQC 2APTA 5FGCB 1YA5A 2YEZB 4DK5A 1SLWA 1JZJA 1GC1C 3ARBC 1KBBA 1IFHL 3W0WD 3INOA 4YR6A 5IK3A 1AHKA 2Y7LA 1CD9B 4K3EL 2A4CA 2AQ2A 1YECH 3UIZA 2H26A 3EZJB 4QGTA 4PJ9B 1TU2B 2O1AA 4POUB 5D7LD 3MXWH 2LAAA 4Z3JA 1LWJA 3I3DA 4PRPB 4M8VA 3LQAC 5E03A 1ZY9A 2NY2D 3LEXA 4RMVA 4F9PC 3U36A 5JDSA 2XV3A 1H5BB 1SXCA 3HS0A 3O4LE 2IANA 3JV0A 4QHLA 2OCCB 2RCSH 3KPSA 3N41F 1P5UA 4IMKA 4TTDC 4F8QA 2VZSA 3ISRA 4XP5H 3QA3B 3RTQD 5I1KL 1TNNA 3AREC 5E1AB 1P4BH 3C9NA 4HOZA 3HFML 2XFXA 1EWHA 3EDDA 3ARBD 5BPPA 2BOBB 2O5YL 2VW6A 3EBGA 5I82A 1OXYA 3PXLA 3B7TA 3RZCA 1JPGB 2WVTA 4OCRH 1BWMA 4OGXL 5GRYA 2CCWA 4A67A 2BP3A 2Y5EA 5C0EA 3VXNA 2E6QA 3A67H 4P2RD 5DMIH 2R0KL 1WZ1L 3GUTA 4OF5A 1LGVA 3CQFA 3D69B 1BEYL 1I3VA 4PRIB 2IALB 3QIWA 1HOCB 3NIDB 4FYQA 1OGAE 4TTDD 7FABH 1EEZA 2OZ4A 1P4UA 5KYYA 4LL9A 3ARED 1F02I 1TVHA 4HS3B 4N2MA 2QADB 4YHYC 3WFHA 3MA7B 4PVMA 2FB4L 4KXBA 4NENB 5FYKU 4Y16C 5K39A 4KMTH 1HH9A 1WTLA 2HFFA 5E2JA 4AVKA 3BAYA 2Z7YA 5JNYA 5SV3A 2E46A 5C9KA 3MV9B 1RZFH 1GH7A 1XF1A 5LN4A 1TQCC 1BVNT 3GRGA 5DZJA 1IFGA 2WQUA 4YHLL 1A7BA 3T2OA 3BIAX 4ZDHA 1IC7L 4R5TA 5FKPA 1OE3A 4V33A 1EEYB 1UD5A 1NSNL 4I89A 2EDKA 1JZEA 4KI5E 2HX9A 4QXWA 1JRHI 3DIFB 4XP6H 1TPXB 4YGVB 3FK3A 4HJTA 2X70B 4TQHA 4K94C 2K45A 1V5JA 4Y16D 2FBJL 1XZWA 2N56A 3QDGE 4JGUA 2VQTA 1NDMB 1PNDA 4PR5B 3FTXA 2D03H 4PH8A 4QRRB 3N91A 4A6YB 3LSOB 1GIGL 4NUJB 2OP4L 3ZGHA 2YHGA 3EDKA 1XO8A 3D85D 4MDJA 4ONFH 4JB9H 1WBXB 3JWNG 3WJJC 2HG5B 4OGZA 1U58A 3OGOE 4JR9L 3PXJA 4YFLF 3L3DB 3VFMB 3VFVB 4K5OA 4TUOB 3D4GA 3BUQA 2FO1A 1IE4A 4KWUA 4Y2DC 3E3QC 4TF4A 1MCWW 3HE7B 5C0DB 1JNLL 2D7MA 4YBHA 1KGIA 5F88A 1MJ8L 2CLRA 2CCLA 4JFPB 4WEBL 3ZYJA 4XP4L 4HXAH 4TTGA 3UJIL 5L6YL 3ZKXC 3V7AE 3RYMA 4B9CA 3VE0A 3S4SB 3B6SB 3ARDB 5I8OH 2IH8A 1FAIH 3PWUA 1UYWH 3ARTA 2J1WA 3I6GA 1DVXA 4G7VL 1D6VH 2LFEA 1UXWA 1U36A 4JFXA 4XC3L 4CN6A 2YD0A 4HSQA 1M7IB 4EDWH 1IIIA 4A63A 3HCVA 2GW5A 2HN7B 5DC0A 4H8WC 5ILTH 3OLIA 4BH7B 4YC2B 4C54A 3FRUA 3OWRA 2P45B 1E8ZA 5IBUB 1XGTB 1P5VB 2YPLD 4RGNE 1GGTA 1BXXA 4PWGA 1KJ2B 1UURA 3WNLA 4LCWB 4PRNB 3POCA 1RSYA 4LLWB 2CWRA 1BXUA 1DQMH 2EQDA 5GZOC 5EO1A 1EHLL 3PCYA 2B1OA 1TZ8A 1CGVA 1ZHNA 5MERB 1OP3H 1AR1B 4FQXB 2W8CA 4G7SB 1YVLA 5AZEH 1FYTA 1OWRM 1U8OB 3OKYA 4UMGA 5I66B 1IBZA 4L48A 3CFMA 3V5KB 4WI0B 1GOFA 3BZ4B 4HV8B 4UTAL 1DJIA 3WXVH 2Y69B 3RWDA 3T1FA 2BZDA 1E5AA 1YN7A 2QPUA 2YMXL 5AW6B 4EO5A 1I7ZB 2EC9T 4ANVA 2DOCA 3H2WA 4ZSOB 1YQVH 4P5KB 1ED3B 4F57L 4U1GB 4G8GE 3L9RA 2X4UB 3IU3A 4MCZA 1AXTL 2R2CA 3U1SH 5GZOD 2O5XH 4L8SB 1KPRA 3MOBL 3OKMB 4IEFA 4HBCH 2GYSA 4MSWA 3BPCB 1DBJL 2QKIB 3GM0A 5T5NF 4KZEH 2YRLA 3OLGA 3DX2A 1BPVA 2ARJQ 1RULH 3BQUC 2D8KA 1SLUA 3JV6A 1T7XA 1E27B 4GRWH 4F1SA 1JV5A 1JZHA 2XYCA 3EBHA 3H8NA 3IGAA 3TBVB 1JG9A 3U9UA 4MB1A 4N0RA 5INCA 1BLNB 2ZICA 4MJ5A 3APCA 2ZX5A 2B15A 4YHPB 1QFOA 4LDCA 5BMFL 3UYRL 4H20H 2PO6A 3MJ7A 5FW7A 4JG5A 4Y4KA 4GO6B 1ZIAA 4FQCL 5IOKA 1U30A 2VLRD 4J3SA 2VJ0A 2X3CA 2VL4A 4NUGL 3T0EB 1U8NA 4U2ZA 2X4TB 2AJVH 4NOBA 1QZNA 4WUUA 4U05A 5LXGL 3SZ6A 2E47A 1P7QA 3Q9PA 3O0RH 1S2EA 3C6LB 1E2VA 5IJKA 4HUWA 2NX5B 3MRGB 2YD8A 4NNYB 5D5MB 1OT4A 2NY7H 2LE9A 4BH8B 1LEGA 4H44C 1TSHA 2IWFA 3GGWB 1WS7A 3NCJH 5C2UB 4NUQA 3IMRA 4KTDH 3M45A 1MY5A 2VXUH 5KJ4A 4X7DC 4MA8H 1A3RL 2ZP0T 2Y07H 4ZUUA 3AMLA 5DUJA 1D5MA 4PWJA 2JKLA 1E4XI 2IAMA 5J1TC 1EERB 1TQWA 3DOHA 2F74B 1I8LA 2MOVA 3DIDA 5DJDA 5T8IA 3V0VA 2ZZUT 3QAZB 4X83A 1ECZA 1QAWA 3MYJB 2IOIA 4DP1X 4HKBB 2ZPKH 4YBLB 4EAEA 3EYQC 3Q13A 3K6OA 2VIRB 4XRCA 3ESOA 3ULUF 2P8PA 3K6SA 2YAEA 1NL0L 2LW3A 2WQRA 3BZDA 2CM6A 1MW3A 1T1XB 4APQC 3CDFA 4L9LB 4Z7AA 1QI3A 4N8UA 4H40A 3PIQA 4BZ1H 3HPLB 5FCUH 1ZK5A 2BZ7A 2ZXDA 1KPUB 3X1GA 4KY1H 1WRFA 4JM4H 3P3RA 2FX7H 3FSAA 4P9ML 3GLAA 1F3DH 2C3WA 1J5DA 3LPGA 8FABA 4MWFB 1KXVC 1S7QB 2W80C 1XSIA 5IHZA 1BD2B 1CL7H 5CBEB 1HDMB 1Q0XL 4R7DB 2VMJA 4URTB 5JW3L 3JWDL 1OTSC 2W0PA 5A2CA 1W0WB 1ASOA 1PF3A 1J8RA 2YXWA 4MTMA 3W9DA 1MWAL 2X4QB 4Q6IC 5EZOH 2KKQA 3Q3GA 3OKOA 2WLZA 3CIAA 4APQD 4WU5A 5HDBF 2WK2A 5DHXB 1FC1A 2W9DL 3NEOA 1KTLA 3CFBA 5KSBF 1G7JA 1NMBL 4M6OL 4UUJA 2Y22A 1SJEA 4ZD3H 3VXUA 3NCYS 2VDRH 1C12B 2OJEB 4DPBX 5CWSB 3UPCA 1KIUA 4FQPA 1OALA 4RVBA 5DUML 4QJ4B 4NYLA 4OCXL 5BO1H 4EZKA 4LASL 4APXB 1HI6B 4L8BA 2BY0A 4NRYA 1OTSD 4X0KB 1R3KA 1AMXA 5A2BA 4RDBA 1BVLB 2XQYG 3ZKNC 1JZDC 3O3EA 3REVA 5DMYA 3TYFB 4GG8B 1GC1H 2HJFB 1M7DB 3KS0H 1IQWL 4QRTB 3FAWA 4W9DC 5EO9B 1YY8A 4MA3A 3G08A 3QPXH 3ATFA 4GAJL 5GGUA 3BJLA 2VOTA 1AQKH 4OCWH 3VD0A 1BJ1H 3MUGA 4PY8J 3EDJA 5JTWA 4KQ3H 5ERWA 1PL3A 2JKJA 4JS7A 5D7LE 2DIEA 1VACA 3THMH 1KCRH 1L0PA 4WU7B 3TIEA 3ZPDA 3LQAH 3OVUB 5EUOB 1AHWC 1O7SA 2IV8A 3IAGC 2WBXA 4HHWA 3WIFA 4XPFL 3EJRA 4Y4FB 4AC4A 3ABMB 5JOPE 3MROA 3EW3B 2E7LA 3FCSA 4M8UA 4ZFGH 1FDLH 3FKUS 3O8XC 3P3TA 4OD2A 4WW1B 4DKAA 1BX2A 1NCWL 3DMMB 2Y72A 3ZKND 2B16A 1QACA 3BMVA 4H8QA 3V6ZA 3FQNA 4PW4A 2ZXQA 4LSUL 2Y1AA 2DICA 4QNPE 1YYML 4M5ZL 5DFVC 4KI1A 5GZNC 1WHOA 2IOOA 1RJZA 2MQ3A 3UROR 4P2RE 3FT2B 3IPFA 3OAZH 2ENPA 4KRMB 5DMJB 5F1OB 4LARL 1VA9A 4GUPB 4DUWA 3CHPA 1DN2A 2C1OB 5LQBL 3FU6A 2J1YA 1C5CH 3LXBA 5EU3B 5FK9B 1IU1A 3FAXA 2O61A 4JDVB 4QDGA 3MRMA 4ZS6D 3U7YH 1G0XA 3NG5A 3O8XD 2H2PC 5I71B 5AVZB 5KBDA 1R3LB 1E2WA 1QSFB 1HNFA 1N3NB 5C0BD 3U46B 4CC0A 1D2OA 2HZHA 4CW1B 3DO3A 1Y7VA 5GZND 3DI3B 1PEZA 3TT1L 4PU2A 1E3ZA 2OTPA 1RIUL 1WWBX 4PW9A 4PYHA 4P49A 1KJVA 2C7UA 3L1GA 5B1CA 2F1EA 2IPKA 4IMLB 2OW6A 4KPHH 5F7BA 4Y88A 2APWA 1W72L 4IOFC 1N59A 2QVKA 3OSVA 4X7SL 5E94B 1DLFH 5B1BB 5TH2B 4AM0B 2N0MA 1XSJA 3WLWC 3LZRA 4RWYH 5DD5H 4K94H 2AEWA 1UXLA 4U6VL 1FL5A 2A77L 2FYYA 3MRLB 2ZCHL 4ZW3A 2CK0H 1B2WL 1D5XB 2C9AA 1NLDL 1X44A 4GAFB 4I77H 1NGQL 4B53A 5T3XE 1ES0B 1EVTC 2Z92A 4XBPB 1Z9SB 3SDAA 1URIA 2Y3NA 1B4RA 3X1NA 4A7QA 1ZA3B 3VI3A 4ZX4A 1O6SB 1OLLA 1XCWA 4JPWL 3CZFB 4XMUA 4JJ5A 3VFRA 3QUYC 4IOFD 3OJMB 4A68A 2X6AA 4XP1L 4B9ZA 4LCCC 4ADJA 3KM2A 3L3JB 3WLWD 3CFKA 1V3LA 2I5YL 5BZWB 4L4VB 1DEEB 1Z32X 4GKSB 35C8H 5TE6H 4D7BA 1XBDA 5TK2A 5FM8A 5JPNA 3CHRA 1ZVNA 1LLAA 2VGLM 4WEUD 3LTVA 4P23C 1TQBC 3P11L 1L6ZA 3TO2B 3DHPA 3PPEA 1LO3H 1NBVL 3QCVL 4LQ1A 2VXSL 5KSVA 4HWBH 2WCSA 1X7QB 1MCKA 2MQGA 1O0VA 4P46A 1IGCH 2HVKA 5SWSA 4YXHL 3FO0H 4I0PA 1FRGH 3AG4B 3QUYD 5E8OB 3B3IA 3VG0L 1NBZA 4JZNA 1JGUL 4Q9QL 5DJCA 3D2UB 4KJQC 4H8WH 2QQLH 2WBJB 5IEKA 4HJIA 1DSFL 3QXDB 1NIAA 2HJKB 1KWKA 2FT6A 2OMYB 3L9YA 2X87A 3GIZL 2ESVA 3LRSB 1HWWA 5G4MA 1I3RA 3VB8A 1F13A 4P23D 3ELQA 2EH7L 4F9LA 4HVBA 3FQXA 2CUHA 5GGSB 5B4MC 4NZRL 3QIUB 1URLA 2CGRH 2AK1L 4WGKA 1HZHH 3KPMA 3VXSE 1NFDB 6CGTA 5JYLA 3EYFA 3WTUA 1Q4NX 1MY7A 3H6AA 1XMEB 1KB5A 3L95A 1PBYA 4ODTL 5BS0A 3FMGH 3MRQB 1UA3A 4QLRA 3NQIA 5E8PB 3RAJL 3KPRB 3I02A 2LTQC 1F18A 5HHVL 1D7CA 5I8CA 1FFNB 1L4IA 2CUMA 1AH1A 3RNQA 1EXUA 3VXRA 2P4AB 1EUUA 5B4MD 4OCSL 4R0LA 3SZKC 1INEH 1JVOA 5DXWA 5TPWL 2LU7A 1KXTB 4N2BA 3F7QA 4OUUB 1A1OB 5I8EA 3M7FB 3KG5A 3NIGB 3HNTL 4JPQA 4M1DH 5A7BA 2RAMA 4MD5A 3UGXA 5FUCE 1XEUA 4XAKD 4HWEH 1CPUA 3JT0A 4C47A 2BHUA 3VMPA 1N6QH 2R4RL 3DOSA 1P6WA 2Z91B 3GXDA 1VGKA 2Z35A 3BEVA 3HR6A 1FN4B 4MXQC 3UTTD 3GMMA 5SX4I 3RVVC 2XG4B 1U91A 5E0QA 3OQ3B 2A9CA 4M48H 3SCMA 2YRZA 2BZCA 2VERA 3W38A 5E1HB 3SJVA 2VLRE 4PJXE 1OIOA 1BQKA 1WJ3A 1D5RA 4G5ZL 1H8LA 3UIYA 5BNXD 2RHEA 1A2YB 3F12B 1KF9B 3BSGA 2IQ9L 4UDUA 1LNUB 3WS3A 1WBZA 5I30L 2H2SC 4E68A 2GJ6B 4Q9RL 2EUZA 4JPIB 2WMPB 2QTVA 5BZXA 1M71A 3ETBJ 1I85A 2QLYA 4MXQD 5FWRA 2FIRT 2L8AA 4LLQA 5DVKA 3VWKC 2G3NA 3MJ8A 3Q5YA 4OFYA 3RVVD 3WFEL 4G9DB 4M5TA 3QZNA 2PNDA 4I4WB 2PR4H 1Y07A 1YCSA 4N2FA 4L1BA 2YEVB 4HQQL 1EGJA 2J7LA 1CVSC 3H3PL 5A16A 1WCBB 1ZVHA 1IFHH 3TBSA 1KCSH 3VRLE 5J1AB 1VDGA 1QFWL 3KXFE 1V55B 1F1DA 5CINH 2ZUSA 3ES6A 5C0AE 1F2QA 4JM0A 5I73C 4HLZH 2VZUA 2EIZA 3BMWA 1I8MA 3Q6FA 3MREA 5EU4B 3WXWL 3C6SA 5D1QC 3UAFA 3B9VA 4Y5YA 1HXKA 4OVUA 4D0DA 5FF6B 1M7UA 2WZ5A 2Q76B 3VWKD 4ICWA 2XVKA 3E9TA 4C4KO 1X4XA 4Z23A 2XIIA 5ITBL 5H37A 4HU8A 2CO6A 5ABAA 3SE9L 4D0CB 1JERA 1IBBA 4QRPE 4RDQF 4OJEH 3HFMH 3RL1B 4LMQI 3HHSA 3O2VL 3P9WB 3QDJA 4N1EA 1A02N 3O9WA 3H9HA 3UTZB 1QRNB 2EABA 1NBYA 3FU5A 3SYOA 5IMOA 4P99A 2DIJA 4MX7A 5INDA 1RUKH 2J2ZA 1AI1H 5AYUL 1QQDA 4CNIB 4G6FB 5MENB 1GPOH 3I9GH 3PYCA 2EICA 3OKNB 2R51A 1WZ1H 2PW2B 5D1QD 3K71A 4PJBE 4QOKB 5DGQA 4Z78B 5MEQB 1INDL 1XCQA 1U8JB 3P73A 3UYPB 3D4CA 3ECWA 1LE5A 3RL2B 1IVLA 1BZ9B 3V79C 4H1LH 2L7QA 4RLDA 2XKNB 1UZGA 3QQ9C 1GHFL 3A0OA 1QKZL 4FTVB 5KVEE 1BYPA 4EIUA 2UWEF 4PB0H 2FB4H 1XZ0B 1RUMH 3V4VL 3P1VA 1QLFA 2GBTA 2JK5A 4PVNA 1OAJA 2G4GA 4DN3L 2GK0B 1T83C 1EFXB 3OLEA 4AQAA 4WHTB 2VR8A 3TT3L 5E99L 1CB4A 3DA0A 1S7UA 4YHLH 2DTMH 2EDNA 5MP6L 2NYZA 4E5XB 5I75B 3NQKA 1DE4B 2DMGA 4J23A 1QA9A 3GM8A 4B9JA 1NSNH 4J3TA 1XHHA 2PXYA 1HU8A 3D5OF 1DQJB 3KGTA 4PJDF 5EOCH 3W5MA 2O72A 2MRYA 3D87B 2OMXA 4JY6B 3T0AA 2WSDA 2FBJH 2Z4TA 4AEIL 2YUXA 4OJFL 2X4OB 2R0ZL 2VLLA 1F58H 3FQUB 3DGGB 3KWWA 4KC3B 3NN8A 4LGPB 4X6FA 1A6AB 2OP4H 2W0LA 4PJFE 4XCEB 2BIMA 1G7MB 3FT0A 2VLJB 5CEYA 2FJFA 1TITA 5EZIL 2WB1A 2V2TA 3TH4T 4JR9H 1NCHA 2DYSB 2IDSA 3UZQB 2QHRH 1JL8A 5DJAB 5EU7C 3CC5A 3HRPA 3MRKA 1QFUL 4OKVB 3TNNB 3RPBA 4BSWB 1JNLH 4ZOEA 1MJ8H 1ZKAA 1KJMB 5GISH 1R5WA 1NKRA 4W4OA 4ES9A 4YQXL 2DH2A 1E65A 4QF1A 4PJCA 5J6GA 2ITFA 1M53A 1T6WA 4MZIA 4MQTB 5IVOA 2FNWA 5EN3A 5I17B 4G7VH 5J12B 4ZW7A 3RVTC 4MKMA 4XC3H 4K7PL 3D0VA 3CHXA 5D7SL 4O2EA 3KR3L 3GXMA 1FL6B 1EQWA 4YDKL 1BOGA 1BW8A 2YGQA 4LKXB 3IRZA 3K1DA 4ZUWA 3ZTCC 3BLBA 4JL2A 1BGXL 1QUPA 1N8ZB 2UVEA 2VTFA 3QNZA 2P5ED 3SKNB 4K7FA 5IROC 5F7MC 3M88A 3BD3A 2YRPA 4Z7OF 1EHLH 2CHNA 4HWZB 4O00A 3MMEB 4QHNB 1MH5B 1UH2A 1QPKA 4LEOB 1YMMD 4I87A 2QGCA 4FA8A 1MELA 3O6KL 3RVTD 3H0TB 5EU6B 2HKHL 2WYZA 4M6NL 2HH0L 3TZVC 4AEHH 1G1CA 3QUML 4WV1A 1CBJA 4PJEB 1KDJA 3O2WL 3WAJA 4R84A 5CJQH 2YMXH 1OV8A 3L9EA 4J6RL 5AZ2H 4NC1E 4Y1AB 5IROD 4F57H 1VFMA 1I8KA 1ND0A 5I24A 3FU8A 5AW8B 3VXMA 1L0QA 1T21A 2XN2A 3WG7B 3LAFA 3MOBH 3TO4B 4LZKA 2NTFB 1QLRB 3HIZA 3CDZB 4UM9A 1T04B 3AACA 2APBA 5I5RA 4N0FA 3OR7B 3U7AA 2NY4B 3S36L 5FDYA 4I8DA 3ZZ1A 4HS6B 4XPAL 4NO0B 2DWTA 4KUCD 1R46A 2K7QA 3SBWC 1F3JA 1AJ7L 3E2HB 3CTTA 1IGFH 5J6SA 5H37G 2DLEA 3TZVD 1PKQA 4TLUA 4FG0A 4TVPE 5K33A 1CTOA 5EBMA 4A7SA 4JRXA 5IWLC 1IL1B 1AGCB 1T7YA 5DRZA 4X8XA 5ANMB 2VR3A 2ENYA 4DZBB 3CPLB 3F01A 4K23H 4XNMB 2FWOB 3QXVA 3V9CA 3QFDB 1NCTA 3QJVB 4DGYL 4TQ8A 2W88A 4FQCH 4BFNA 1QBLH 4KKLC 5F7YC 4OGQC 1JPFA 1BJMA 5GS0L 1UH3A 1FFPA 5LXGH 3K5RA 1A6TB 2CH8A 3CN1A 1TCRB 4KUZH 1OAKL 2CBMA 3H55A 5DK2A 1SM3L 3F65A 3FOMB 2F68X 1N67A 1IM3B 1W91A 2J44A 4WW2B 4KKPA 2BOLA 4MJIA 4I7ZC 3MBWB 1A14L 2PTUA 2EILB 1CICA 2OCFD 5D1XB 3TP4A 2WLMA 4AIZA 2EDEA 3FUKA 4MMYB 2ZOKA 2F15A 4OLZH 1A3RH 3MV8A 2MPVA 4ZTEA 2YBRA 4KKLD 3C5JB 1X5IA 2LU4A 2CLZA 3G5ZB 3GLZA 3GSNA 1VADB 1BYNA 1WP6A 3KLAB 1ZHBB 3OKEB 1PD0A 5HGBA 4FNQA 5EFIA 4X6EA 1HINL 5B3SB 1Y0LA 1WWCA 3AS3A 3GBNH 4K15A 5DLMH 4YSSA 4JFDD 1C5BH 2VL5B 3VFGL 3I75B 2DEXX 3AQZA 2AJXL 2ICWJ 1QSEA 3RX7A 3TL5A 5KYNA 3GJFH 5H8DA 1V27A 2BIPA 3RIAK 1JPEA 3OJVC 1UJ3A 2JI2A 3BVXA 3MLWH 1JI2A 1ONQA 5BV7C 5IHHA 3TJEL 2I07A 5B21A 1A47A 4IOIB 1NL0H 1ZS2A 4OLWH 2C1PA 3D7PA 1SBSL 4EQ2A 2V7HA 4POYA 2XTJC 5D7JC 4HJUA 1L7TL 2V3DA 3PG2A 4KZ0A 3NIDF 3KWTA 2EVHA 4HAFA 1CXFA 1R33A 3HC4L 3TX4A 4W81A 1K4DB 1FPTH 3DRQA 4G3YL 4P9MH 5ALBH 1OW0C 1NOLA 3B9KA 4CKQA 4K5NA 1HQRB 1ZPLA 4P2QE 1KXQA 4JKMA 3HE6C 5MI0C 1Q0XH 4MZRA 3DUUA 3TV3L 2ZYRA 4YXLL 1YNTB 4H2CA 5DJ8B 3ARWA 2YO3A 2GUYA 3GMOB 3LH2H 4PMFA 4NKMB 2FSDA 1MWAH 4UQ3A 3UTPD 4QRFA 5KVGL 5FM5O 1IUZA 1XEDA 1T0MB 2CR3A 2E9JA 2XTJD 5D7JD 5HDLA 5HHOE 4ZMPA 2HUHA 5E1AA 4HDIB 1NFIA 5KSAB 4NQED 4M6OH 2VH5L 2MTAA 1DQQB 1HWHB 1HEZB 1OL0A 2BOBA 2IGTA 2JTDA 4I85A 4E41E 4F7CB 3LN4B 3IE4A 1MCRA 4IRJC 4XMPH 3H85A 3UO1L 4OCXH 5DK0B 2Q1EA 4PLNC 1RQ5A 4PV9B 3RA7L 3HE6D 3GTNA 4GOSA 2VM4A 4OF3A 3LDBB 4HWUA 1Q72L 5EO0A 2ZWSA 4X5RA 4AEFA 2N01B 2C7FA 4ILDA 4C56B 2ZOTA 2F58L 4PP2B 1ET7A 4UAHA 4FTDA 5E1IA 5HJDA 4JGJA 5BRZA 3CBRA 1IQWH 3IXAA 3NAAL 1YZZA 5HHXL 3WOVA 1KCVL 1KDIA 3L7FA 1U3HB 4YAQA 5GRJL 3V0EA 3QZMA 2EEFA 4UQ9A 4P2OA 5T3XL 2X4NA 3P0VL 4Z7WF 2R69A 4Y5VB 3TA4D 3K3QA 4YDVB 4P8QA 1ZEAL 1RUAH 4JO2L 5DHYB 4IRJD 2P8MA 3FH5A 3EH5B 4HJGB 1CR9L 2QLVB 3Q8FA 5D9SA 3CFCH 4XPFH 3LRHA 5E7FA 4L0ZA 1A21A 2AQTA 3FT4A 3U0TB 5EHFA 5C09B 2MOGA 4W9KC 1NCWH 1NIBA 2OI9B 4GS7B 4JKLA 3UAEA 4GG6A 4YWGL 4FGMA 2CA4A 4LSUH 4NQDB 3KD4A 4WY7L 4AXWB 2UXTA 1RL1A 4M43H 4BDVA 5HXMA 1QRKA 2DV6A 5F6HJ 4D3CL 2R56L 2KLSA 2VMEA 4J1UB 3DC0A 4IU2A 1FZKB 4Y2LA 2IDTA 5I5IA 3G5YA 1A4CA 5LQBH 1WZMA 3U4KA 5DJYA 1KTKE 2QMJA 4M61A 4ZZFA 5L0QB 3KHOA 4TV3A 1CG9A 4M7ZC 8PAZA 1FVCB 3BRGC 3QQDA 2QQNL 5IBTH 3PFQA 3ZQ9A 1YEIL 2GSMB 2WLLB 5ESQB 2X7LA 4LNVA 2DQCL 4PRDB 3D3VE 1U8QB 43C9B 2D2CC 2HPOA 4GNKB 1M57B 5C0DA 1CQYA 1UT9A 3NA9L 1RIUH 2V2WA 1DBAL 3W0WB 1WLHA 2HT4D 2WXRA 3DVGA 5D2LB 1BCIA 3L3KB 3CBKB 3FQTB 3BDBA 3D9AL 5F8QC 5I0XA 3NSFA 3SODB 3B6SA 4YK4B 3S36X 1C08A 1W72H 2H0FA 3AB0C 2D3NA 2VDRB 4GQZA 4X7SH 1FNGA 4ETYA 2RACA 4X6CA 1I7RB 2VDLL 4KDTA 3UBGA 4PY8I 2RIKA 3US1A 3T0VA 3MRBB 4DVBA 1JUFB 2FWLB 2A77H 2ZCLL 1RZPA 1IGIL 2ZCHH 1OT1A 1CQKA 1V3KA 1KT2B 5FHAH 4KK8C 1NLDH 5IOPA 2B9AA 4OLUL 1CF1A 4NQCD 1BVKB 2VN7A 1E67A 4B7IA 3JZ7A 1E2ZA 1EHKB 3KYNB 5FAAA 1N0LB 1GYCA 4LCWA 2MCMA 4S1RL 3QDMD 2DDQL 1YJDC 2Y1VA 4NO5A 4JPWH 4YDIL 5I1JH 2HT2C 3ETTA 1KGCD 1T1WB 3BZEA 1S9XA 5CO1A 1S8DA 4HHAB 1F5WA 3CGTA 4LRIC 3SDDC 3TVMD 4CGTA 1PZBA 5DD0H 3MXVL 3WEBA 3E6HB 4ZUSB 2ZCZA 3T2NL 3V52L 2VDOL 1ZAGA 5JIHA 1DZ0A 1CXHA 4KK8D 4LDOB 3RFZB 2PCFB 4CN1A 3VXOA 3ARZA 2O5ZL 1ED3A 1WEJH 4FXTA 2X9YA 3VGFA 5D5MF 3SE3C 1K2DA 2X4UA 4ABQA 4ZXBA 2BSRB 2H0PA 2H1PL 3EH3B 1YN6A 3VG0H 1AGDB 2NY5C 3C09C 1JGUH 4Q9QH 5GS0C 3SDDD 3SBQA 5CFHA 3F7VA 3SGDH 4M8RA 1AOHA 4TLKA 2E3VA 1DSFH 4IKLA 1T0PB 1MXGA 5A6LA 1BXAA 5JQIB 1CFTA 3PDOB 2ICEB 4K07A 3BFWA 3GIZH 3KYOB 5SX5K 5L4MA 3TBVA 5E23A 3B2PA 2EH8L 3IPBA 3EO0A 5EZJB 5DHVA 1BLNA 3EOAA 4NRZB 4V1DA 1UWGL 3S98A 1XSKA 3MRCB 2D3LA 2AK1H 1MCNA 4RAHA 3QEQD 1B6DA 1ETJA 5D7IE 3RDTB 4PRAA 4NQVB 1LQSR 1J11A 4DETA 4OCYL 1AZRA 5FKAB 4JY4A 1TQCB 4AQ1A 4FKKA 4L3EE 4ODTH 3VXTA 5FO8A 4U0RB 4U2YA 3ZTJG 1XTMA 3B2UC 3GKWL 4FS0A 2LV4A 2EC9U 4LRNL 5D6DC 4ZAKC 5DJ2A 1U8PB 1QP1A 4IW4C 4BZ2L 3MRGA 3NESA 4QYOA 3SE4A 5K59F 4ELME 2X28A 4X98A 1FP5A 1W6LA 1PSKH 2TSBA 4OD3L 4UM8B 4R7NB 2DM7A 2E9BA 4LSSL 3UAJC 5CZVL 3DV4A 1SN5A 4RFEA 3NP4A 1WD8A 2D7TH 3ESNA 4XMKL 4LFHD 4JQIH 1XF2B 2R2HB 1EBPA 5LNEA 5HGGS 2ADJB 4YH6A 4TN9A 1XF3A 3OAYH 2ZCKL 1KIRB 2GEEA 3HNTH 3V9FA 4B0MM 2NQ3A 5DZAA 3E1F1 1JF5A 4AV0A 2F74A 1LDPL 3B2UD 2E9IA 3GSWB 1H8SA 3V4UL 4ZAKD 3G6JE 5DRXB 2XICA 3BSZA 2UYLA 4F7TA 1CLZH 2FSEA 2I9LA 4Y2DB 2B1HH 3GZKA 5CP7A 1W6WA 3ZDZE 2AXFB 2H3XC 4EIGB 4IOSA 1WBYA 3TNMA 4WWOA 4EQ3A 4X99B 1TIUA 3Q8CA 5KVEL 3UAJD 4M5SA 3ZKXB 1Z3GL 4IIQA 1MCEA 3KJ6H 3AXLB 1L9OA 1I3GL 4FZEL 1UENA 4IRSC 5AWNH 3VI4B 1U8LB 2IQ9H 3P02A 1HOEA 2VC2L 4LLVA 3LKNB 5I30H 1QUNB 3VMOA 3NFPA 1MCCA 3K72B 3PE9A 3VW3L 3HLAB 3SOBL 4DP9X 3AUVA 3QIBA 4XBGB 5IIEA 3LD8C 5EB9A 3BQVA 4ZMVA 4MNQA 5JUEL 3PFUA 3ARGB 1KPVB 1X7SA 5EUOF 1BQRA 4WHDA 3F64A 5E8DL 3H3PH 5E4EC 3QZBA 1CU4H 5FHBL 2X10A 5AB1A 2ATKA 5DVNA 2P48B 2JJUA 3GBLA 4IRSD 5ESVA 2RD0A 5FO7A 2ZUTA 2PKDA 3LQZA 4UYPA 1RPKA 1TJXA 3WXWH 3ZE1E 3T6WA 1SVBA 3LEYH 2AEOA 5I8KL 2G5BA 4UT6L 2OJEA 4K7PY 4MCNA 3S2AA 2R0WL 3OAUL 2XBZA 2EIKB 1KGYE 5DT1L 1ZTXL 3UPAA 1BIIB 3WY4A 4D9LL 5BV7H 1XAKA 4PW3A 1GZQB 4APXA 4BK8A 2GUOA 3KPLA 1D6EB 3DXAE 4NZ8A 1CD1B 5FGSA 2ADGB 3IJ9A 3SE9H 1DVFB 3RGVB 1DUZB 1BVLA 3NABL 4NO3B 3FPXA 1UXSB 4Y89A 2OQJA 3MCLH 2HJFA 2NY1C 4PG2A 5HHPB 5AYUH 4MMXC 3HR5A 1ILUA 3TBCA 4YHNB 1MAML 5IMLA 1S7RA 3ILEA 3TBBA 2AERT 4AVHA 2BC4A 3DROB 3PGFL 3BQUB 1W8NA 1JNNH 3N50A 1INDH 3BZFA 5J6HA 3GI8L 3FQRB 3WMSA 3HLKA 4X8JB 1MCFA 4OVVA 5JW4Q 3B5TA 3UTPE 2MNWA 1J9QA 4GJTB 1CFVL 5TDNB 1CDGA 3JWNE 2WLKA 1FHNA 3EFOB 1DVZA 5GGVY 5HJ3A 1IZJA 2DQEL 3V4VH 2X4RB 2GI7A 4I18A 4DN3H 2NY1D 4RMWA 4Z7NF 4X4KA 3US9A 1F3RB 4HJJL 3TA3C 5D1ZI 1T3FB 3JWOL 4XCCL 1OGPA 1IAII 1NMAL 3M7OA 5E99H 5F0MB 1WS8A 2ZUQB 1GSMA 2TRYA 1A9EB 5AVXB 3QHTC 5IQ7L 2J8UE 4LSQL 5FYKL 2FQDA 4U1SA 4GB9A 2BIIA 2NDGA 1HL8A 4HJ0C 1TDQA 3MLSL 3S0PA 2ODHA 3ECBB 4ZOBA 5F7WC 2IH1B 5AD0A 5B8CC 4XX1G 1KTDB 4BD4A 4D9QE 3DTDA 2B4CL 3A22A 3QUKA 1X6NA 3ULUC 2X44D 4ZQKA 5F9DC 2DWYA 3H6JA 2JB6A 5ECGA 4GW5B 2DQDL 4OJFH 5KOVC 2NYYC 3V4LA 4KKQA 1EAPA 1RI8A 2W0KA 2O93L 2J5WA 3RPIB 2ODIA 1ZVSA 2AP2A 4HD9A 3NIFB 1XIWD 4XVJL 3TA3D 4EI5C 5ICZB 4R7VA 2IO5A 3RJOA 2VZTA 5F7KC 5D4IA 4ZS7L 1AKJB 2FT8A 3HG1A 2DMBA 5LNDA 4HJ0D 1CBVH 1AE6H 1EEUA 2IGFH 1FV1A 1VPOL 4TVPL 2BVPB 1MI5E 2DM4A 1IV8A 3DBXB 1QFUH 3GMRA 4GSQA 3AM8C 2PYEA 2UXVA 4DP8X 3ULUD 1F56A 1BEXA 3WHXA 1XGRA 2Q7YA 1SXBA 4PIRF 4M62L 4AQEA 3ECUA 2I26N 3KNBA 4GEJA 4KJWC 2NYYD 4DCQA 1UM6L 2K6ZA 4FADA 3OHXC 3C08L 3S3PA 2UZIH 4EI5D 2VR6A 5C0FB 4ANWA 2AJYH 4D0BA 4G9FA 3UCRA 4PREA 4MAYA 2NQDA 5IY5B 5EEVA 4ERSL 3MBEC 5FR3A 3S7GA 4DKFH 1E28A 2NSQA 3BH9B 4H13C 1DVUA 1HCVA 1XXFC 5D7SH 1O6SA 1MKFA 1RK0A 1AQDB 1PFOA 4YDKH 4FQLH 4G2AA