3HZVB

Crystal structure of s73-2 antibody in complex with antigen kdo(2.8)kdo(2.4)kdo
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
220
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLAFIRNKAKGYTTEYSSSVKGRFTISRDNSQSFLYLQMNTLRAEDSATYYCARDINPGSDGYYDALDYWGQGTSVTVSRAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S73-2 Fab (IgG1k) light chain
publication title Antibodies raised against chlamydial lipopolysaccharide antigens reveal convergence in germline gene usage and differential epitope recognition
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 220
sequence length 226
ec nomenclature
pdb deposition date 2009-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzvB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzvB01
4OB5L 4KU1A 3MV7A 5DRZB 4QRRA 4F7MB 1KFAH 3NN8B 4E42A 3R1GL 4X7TA 3U46B 4Q6IB 2GJ6B 2YRPA 1L6ZA 4S1QL 4X99B 1LK2A 3O0RL 4KROC 2EZ0C 3O9WC 3U48A 3QCVL 5ICYB 3TJHC 4ETQA 4MNGA 5DJ6B 4UBDD 1RU9L 3T0WA 4WW2B 4XZUA 3GSQB 1YEDB 5I1LA 2RR3A 4JG0H 4QYOA 3GM8A 3GJFK 1U6AL 4IOFC 2FEDD 1UG9A 2UWEE 2X1WL 4ZYKA 3T09A 5E70A 1A2YB 3S36X 3ROOA 1BMGA 4MA8L 5H8DA 4CVWA 3EDEA 2V17L 3VXNA 3SOBH 3QUYC 1D5ZB 1X3DA 2IG2L 3HG1D 1QVOA 1ZKAA 1A9EA 4WWKB 5JHDD 4PJGA 4F15B 5C0JB 4MAUL 3I6KB 4YR6B 4JHAL 1MWAH 1J8HA 1NCAL 4NO2B 4XNYL 2PTTA 5JW5A 3F58H 1ZHKB 4K3DH 2GFBB 3GM0A 3ULVE 3FOMA 4O2FB 4P9HL 1KACB 5KSBB 4NDMA 1FJ1A 4HS3B 2EDFA 2FBJL 3KJ4B 3HLAB 1P5VA 2E7MA 3G9VA 1HH6A 3R0NA 3QXTA 4PG9B 3L3IB 4OGXH 2XT1B 1D6VH 2XQBH 3BZFA 2EDYA 2DAVA 4LLVA 4NUJB 4OUUA 5IIEA 3SGEI 1IGTA 1ZHNB 3T0VA 3TV3H 3EJJX 3C60B 1AQDB 3LS5H 1YNKH 4I3RH 1HEZA 3TT3H 5IW3A 2YPKB 3HUJE 4JREC 5EU3B 5HDQH 4M7KL 5D5MF 4R3SA 3D25B 2YKLH 5C0DA 3UBXI 2E27L 3CVHH 4Z78A 5I74B 5CD3A 3MCLH 3QRGL 3MRJA 4JB9H 1C12A 3QDJE 3OPZH 3LEVH 2DWEA 4L3CA 3H9SE 4PJEA 3RGVA 4Z7WF 1B0GB 1I7TA 2MQ3A 3MGOB 4OV5A 3MLRH 3O3EA 1MCEA 3CFKA 3IFOA 5BVJA 4JPWH 4WCYL 3RAJL 4HZLA 4M4PA 4P5TC 2Q76A 1VFOA 1HXYB 5E6IC 1ORQA 1S7UA 3D69A 5EC1A 1HZHH 5IJKA 5IESH 1BQHB 2VABB 3QDMA 3VGHA 2HVJB 4WI7A 1P7QA 4BK5A 4EN3D 1YEGL 3ARPA 3BHBA 5EBLA 3LSOB 4MQ7B 3F5WA 2P48B 4JRYD 3VG0L 5HJ3B 4ENED 3MRFB 1JIBA 3LKQB 4IRJC 3SCMD 1YYLL 4JVPA 4F7EA 5FHAL 2WIIB 5D96B 3STZA 1MCJA 4DGVL 5IHBA 4Z8FL 1JK8B 1Z6JT 4Z7UA 2HFFB 4ZPTB 1L9NA 4JN2B 1XF5A 1UXSB 1S8DB 3OJDB 5HI4C 5EOCL 5DR5H 1KXTB 1MAMH 2ZZUT 1F13A 2FSEB 7CGTA 2XQYK 4YZFE 4KDTC 1BX2B 4XNUH 3RU8L 1L0YA 1NUGA 5MEPB 1D5XB 4P5MA 5LWYL 1OOAA 3KPPB 5T3XH 2GCYB 1HILB 2JIXB 3HMXH 4H8WH 1DFBH 5ANMB 5DVKA 3D3VD 5E4EB 4OFDA 5CBAA 4Q97A 1RZKC 3EFDL 3QCTL 5E1AB 4CN1A 1MREH 3HA0A 1RJYB 4WW2F 4X8XA 1H5BA 4P2QD 3FFCA 2XIDA 3MFFA 4L3EB 3VXSB 4BYHA 4Y2DA 4NHCL 5HI3C 1CLOL 4GKNB 4PBXA 4NWUH 3VH8A 1MCHA 2PO6A 3O11B 1FFRA 1MHEA 3RX8A 3VXUB 1TJGL 4J7RA 2J5LC 4K3GA 4KC3B 3MPCA 3CH8A 2FNBA 4LIQH 5MEOB 1F58L 1IAKB 4BQBA 1INEL 1PDKA 5HYFA 4XPAH 3QEUB 3KPSD 4EDXA 1JNLH 1HK6A 4ODTL 4CAGA 2FATH 4NT6A 2X4NB 4ALAL 4HH9B 1JGLH 3HPLA 4JY5L 4YEEA 3IFNL 4G6FB 2XZAL 1XCTA 2IPKB 3I9GH 4JFFA 2IALA 4MJIE 4P57B 5JDSA 5CD5D 4PJIF 1V7MH 4L8CA 4PRIE 5FGSA 3BO8A 1S7SA 1FLRL 3FOLB 3QQ4B 5EOCJ 1VFUA 1NMCC 3KHQA 3QT2A 5KSBF 3Q3GB 1DLHB 5DJDB 1NAML 1MCOL 3BAEH 4M5ZH 4KQ3H 2F8VA 2DL9A 4XHJC 1LO4H 2FHCA 1A6UL 4HKBA 4NQCB 4E41A 1MI5E 2QQKL 2ZOLB 1SEBB 4X4ME 5JR1H 4PRPB 4PRNA 3G04B 2QADD 2NX5D 4UV4H 1WWBX 4HJ0C 1XAUA 2B2XH 3PDDA 2V2TB 3OAYH 2YPLB 1R3JB 5DK3A 3BIKA 4KAQH 1ZT1A 5C0AD 5C0BB 1T1ZA 5D9SB 3WFEH 5EORH 5C0GB 1P6AB 3VDCA 2AEPL 4RRPA 1RUAL 5CGYC 3BDYL 43CAA 4HWNA 2M1KA 4R4FL 2FHBA 3ORJA 5D7LA 1RMFL 3UCRA 1IAIM 5KSUB 4QXWA 4X6FB 3IETA 3DX6A 5LAXB 4J8RB 4M9OA 1T0MB 4NQEE 3EIFA 1UWGL 5LCVL 3ZL4H 2AEWA 4KTDL 5IG7B 4B5EA 2DYPD 5HDOA 5HVFB 2HTLD 4M6OL 4F9PC 1QA9B 1D9KD 1K4CB 1A14H 4PJ5D 2ENSA 3WS3A 3GKZA 2AK1L 3T04D 2FJGA 1DLFH 4PLNC 2DQJH 4GQ9H 4EXKA 5IK3B 4GBXA 2X89D 2O5YH 5D1XA 1IT9H 1S5IH 4YHOH 3PXHA 1OTTD 2AJUH 3HRZB 1FORH 2BY0A 3U82B 3DGCR 1UB5B 4OF5A 5DLML 2LE9A 3IVKA 3OKKB 2XFXA 3FCTB 4U4BA 4L9DA 3O6FD 3QO0A 5EBWA 5AZ2H 3TH2T 5EO1B 5I19H 2VDML 3PP4H 2V5RA 1CWVA 5KVEL 5E9DA 2X4QB 4U6TA 4JDTL 2BSSA 2OR9H 3VI3F 3VRIB 1ED3A 1S7TB 2C26A 1A6AB 4OT1L 1MIML 5EZLA 4AEHL 1RK0A 2GW5A 2P45B 3MUJA 4MNQA 1TZGL 4NHUB 4ZUUB 5D7KE 1Q94A 4OQTH 1CQKA 2GTZB 4X5XB 1J7VR 1WAAA 2Q20A 3A6BH 5JIHA 4E0RB 4NBZB 1N59A 2N7AA 3BRGC 4NZUH 3O3DB 5J06A 4JLRA 3PHOA 4QRQB 5DSCA 3JV6A 2NY5H 3RZCD 3LCYA 2QTEA 4YGVB 1W72A 1IGIL 1N5YL 1MRFL 3GMRA 3MJ7A 1TFHA 1S5HB 1E4XH 5C2UB 4PJCA 1DE4A 2H26B 2HWZH 4FABH 1CR9H 1CXLA 1CL7H 2VITB 3PGDA 1IAOA 4YDVA 2JB6B 3ULVD 2DQDL 2OP4L 4LLYA 3TBYB 4A6YA 1E4WL 3P40A 5KVGL 2PF6A 4EUPB 1QBLL 5F9JB 4R8WH 4PB9L 4YJZL 2EKSB 5HYQA 4U1NB 3RVTD 1S9YA 1XGRB 3ZYIA 1B0RA 5F9OH 3VFTB 1F6AA 3EO1B 3QIBD 3BZDA 2V7HA 4HMEA 4Z9KB 4BH7B 2QSQA 2C3HA 5CWSB 4NZTH 3G5XA 4GG8A 4LVOB 1GAFH 2VDNH 1HOCA 3P0VH 1A1MB 3ZHLA 3WFBH 1LO5B 3OG6B 3B9KD 3VWJC 4AL8L 1IJ9A 1J05A 1PG7L 4D8PA 3W9DB 1NLBH 3MGAA 2JJTC 3QDJD 4JZOA 1ORSA 4ONFL 1NUDA 4YDKH 3OXRB 3ABZA 5F8RC 1FNGB 5EFIA 5I1KL 4YHLL 1WITA 1RJLB 1L0QA 1NFIB 3IFPB 1RJCA 4ZAKA 1B6DA 2AJXH 1P7HL 4DZBA 5TE4H 3T3PE 5EO0B 4HXBL 4PRHE 3VH8G 3O8XA 3U7YL 1K3IA 3TA3A 4R97B 1SVCP 1DUZB 5FB8B 3PIQA 4Y4KB 4YLQT 4FS0A 2DQFA 5GGQH 4ODWA 4JY4B 2AJ3A 4U1GB 4YX2H 3L3OA 1N0LA 3K3QA 3BESR 1YEHL 5ADOH 1LDSA 5T3XE 3ZKSD 2X70A 4Z7OF 4F33B 3BRFA 3C6LB 1JWUB 4LASH 2QLVB 3PWPE 2IAMA 2V2WA 5E8DL 5HBBA 1M71A 3VGEA 4R2GB 1Y18B 3QDAA 2AERT 2AXGA 2Y25A 3O2DL 1I9JL 1EFXB 2OL3B 1Q9LB 1YEKL 3L7FA 2OTWA 4LSPL 4LKCA 2ATKB 4PJBE 3QA3B 1IC5H 3P4LA 4D0DB 2YSSB 1IEBB 3GSRA 1IGYA 3KPRA 3TH3T 4AYFA 2ESVB 1ZT7A 1J18A 2R9HC 1U0QA 3CXDL 1ZS8B 2ICWA 1WEJH 3DI2B 2PUQT 5C8JA 5IBUB 2HJFB 3UTTB 2VH5L 4XWGH 32C2B 3ULUL 2D0GA 2HMIC 3UYRL 3JTSA 3GSWB 1SJEB 4KMQA 4XPHH 3BE1H 5E7FA 4JKPH 3FAXA 4G43A 5SX5H 5GRUL 4OCWH 1S7VA 4RGMB 3FO0L 2CUHA 1KELL 2OZ4A 3FFDB 1FE8H 5JPMA 4RRPG 4LHQB 4H1LH 3VFVA 2KKQA 4ZFFA 5INCA 1LE9A 4MJ6A 5EU7C 3NZ8A 3FQWA 1C7SA 2E8YA 5IHLB 3JWNC 4OZGE 1MQKL 5FGCB 1VPOL 2DMBA 4HPOL 4JM2A 5E56A 2IADA 1A6TB 1W8OA 2C4FT 1GGIH 3QUZD 3BQUC 4MJID 3RWCA 3NACH 1CQYA 1F4YL 4PRID 1ZSDA 4RNRA 4XP6H 5DQJB 3C2AL 1WSST 3TNNB 3MV8E 3K4ZA 4P2OB 3EYUL 4Y16C 3T65A 2E7HA 2OK0L 3X13A 1MI5D 3MGTA 4TTDD 5CJOH 1RZJC 5DFWH 2WAHA 3GI9H 2BVOA 3LN4B 5HXMA 1JGUL 5ESAB 3PXJA 4JFZH 3V5DA 1YPZB 3VMNA 1OD7A 4QKXB 3OMZA 1J86A 2A73B 2UYLA 1NFDB 4OB5H 1AR1C 5C71A 3CDGA 4JY6A 3GMNA 5SWQA 1YMHB 5EO9B 4ZUTB 4HUVA 4QRPE 2W59A 1KPRA 2VL5A 5H94B 2DI8A 1F45A 3R1GH 2ADJA 3BH8B 4WJ5A 4MXVF 4S1QH 5J3HD 3O0RH 5IB3B 1DQDL 1KPUB 3BYTA 2O5ZL 3S37X 3KDMA 3QCVH 3KWWB 2BVQA 3BW9A 4NQED 2FO4B 1RU9H 1IC1A 2QSVA 3ARGD 3T4AB 1K8IB 3GHEL 4XWOD 4OAWA 1U6AH 4TUJB 3U4EB 5I1EL 2YK1L 3RWHA 5B3NA 3O9WB 3WL9B 1NMBL 3MNWB 3MCG1 3X11A 1A7NL 1EVUA 2VLRB 3PQYE 2QBWA 3RL2B 1TVBB 2C3VB 4MA8H 1HHKB 1X5KA 3ZYOA 1CG9B 2V17H 2EC8A 5JMOC 1BFOB 3PGCA 2IG2H 5JORB 3ARBC 1B0WA 3MRBA 1BZ9A 1TDQA 4GH7B 4QNPE 5DEGB 4KKLC 5C07A 3WJJA 2P5EE 3RVXD 4FFZL 1IZKA 2L4OA 3SDDC 4MAUH 4PY8I 3GK8L 1G9NL 4JHAH 1NCAH 3QI9C 3JWDC 5IB5B 1NCNA 3QUYB 5E6IA 1AD9A 5C08B 5C0CA 4XNYH 1OGAA 1T89A 3C9NA 3DXAA 3IDIB 3WLBA 1G7HB 1L9MA 1WVZA 3RWJB 2E6PA 3QWRA 1BBDL 1JZ8A 5D7KD 4P9HH 4NQXB 4GLRI 4U1HA 4GO6B 2FBJH 3IU3B 3AB0B 3G5ZB 2GK2A 3KPLB 1VFBA 1XIWC 1ND0A 4MA3B 4XPTL 1FFPB 5DD0L 1QYGL 2MSPA 5GS3A 3UO1L 1PLGL 2Y5TA 1F6FB 5D2LA 1CXFA 2VLKA 3X12B 2D0FA 4M7KH 2EDXA 3CZFB 3NA9H 3U83A 4CN6A 2E27H 4WVRA 4KDTA 4KJYA 3QRGH 2DWDA 3SQOL 2W0PA 4G8GB 5E2JA 3N1MC 2J8OA 1MOEA 2X4TB 3OKNA 4EIGB 3CFJB 5ILTL 4JREB 3IJYB 4WU7A 4WCYH 5BOZG 3NPSC 3RAJH 1AGCA 4S2SA 1FVDA 3DPBA 3V52L 3IDGB 4X5WA 3OKLB 3SDCD 5ICZB 2XWBB 3RVVC 2ADIA 1AQKL 1KXVC 1P7KB 4MX7B 5DC0A 4I1NB 1MLBA 4PJ8C 1YEGH 2X44D 2AS5M 5K9QG 4MXQC 3BEVA 2DLIA 4P5TB 1RZGB 3SKOA 3VG0H 2P5WB 1G7PA 1YYLH 3LV3A 5CHNB 5FHAH 1VHPA 4FQHA 1F3JA 2VLME 5SWSA 3F12A 4DGVH 4Z8FH 5BCAA 5H37H 5JUEL 4R7DB 3B8YA 2VAJA 1CFSB 1FV1A 4KRPB 4V2BA 5GGRY 3ARFB 3RIFF 2VJXA 4IRJB 4PV8B 3GI8L 4Y5XC 1T21B 5EOCH 5FV2A 3LMJL 5F89A 1NFDF 2QQLL 1C16A 4OQ1A 4JDVA 4ZFZA 5I8KL 5CKAA 1GZQB 3GB7A 1PEZA 4U1IA 3RU8H 5LWYH 4JO2L 4BKLA 2GSGA 4HH8A 2EDNA 2B5IC 5HI5C 3WUZA 3F7YB 3CSYB 3MBEC 5E8OB 4R4NC 1WV7T 1J9CT 3EFDH 2EC9T 3QCTH 5T3XD 2VQ1A 2P8LA 5DJXA 1PKQB 4WFGE 2NW3A 4L8DB 5EC2B 4NKMA 3L3KA 3PWPD 4NHCH 1CLOH 2X4RB 2D4FA 3MRGA 5FDYA 4IMKA 1JPTL 1NGZA 4W6XB 2KDGA 4MJ2A 1FBIL 1TJGH 3MYJA 3R06B 3WS6C 4QO1A 2J6EL 3N0PB 2ITCA 2DJUA 1F58H 2R39A 1AFVL 4ZQKB 1INEH 2NTFB 3FZUD 5J13C 1WK0A 4G9DA 4JZNB 2PN5A 3WYRA 4ODTH 1AXSB 4Z0XA 4RBPH 4ALAH 4JY5H 5IV2A 3IFNH 3L9RB 2DM2A 1CGTA 2XZAH 1GZPB 1JNHB 4Z7QF 5JW3L 1DJSA 4WI2A 2LVCA 5F6HJ 2FR4B 4BK4A 5F3BB 3C6SB 4P23B 1MLCB 4TUKL 3M1BA 4XCCL 3U0TB 4MJ4A 3MRCB 3O3BB 1FLRH 4YWGL 4S1RL 4AZ8A 4DEPC 1Q8MA 5BXFB 1NAMH 1MCOH 3HE7A 1NSNH 4XAKD 1DN0B 3CFBA 1L7IL 2B1HL 1A6UH 3BSZL 4RAHA 2QQKH 5KANI 3X17A 1OF2B 2VUOA 4MD0B 1O0VA 1RUPL 3TLRA 3QUKB 1DEEB 1BLNB 5IBLC 1R5VA 2DB8A 2K3TA 5DYOB 2MQCA 2PW1A 1X6LA 4O51A 2IH3A 4DWHA 2CQVA 5DFVD 3O3AB 4XBGA 5KAQG 4Z6AT 5J11B 2AEPH 3ECBA 2ZWLT 1LD9A 1RUAH 3KPOA 4PY7B 3BDYH 5GSRB 3CC5A 3MV8D 4R4FH 2H32A 4YHNA 1RMFH 4TNVK 3OXSA 1ZT4B 1KCSL 3CVIL 2DM4A 1RFDL 4PLKD 1WFOA 3HC0B 2E5EA 3MRDA 1UWGH 2A6IB 5LCVH 4GRLB 2BNRA 4KTDH 2HFTA 4FXKB 5IWLC 5C0FB 2P8PB 4M6OH 1UYWL 2DBJA 3FN0L 3ROLB 1LO3L 1PYWB 3TN0C 4MCZB 4XVTL 4FQIL 2GITA 5DMGC 3L3JB 4HG4J 3NFNB 4K8RL 2W91A 2DKMA 1F02I 3P4OA 1H8SA 4HBCL 1FNEB 4QRPD 3IDMB 4MDJB 3MLPA 1YA5A 3VI3E 2I24N 5DLMH 2GT9B 2ZSWA 4NQDD 3C5ZC 3DNKA 2EEBA 5KS9A 2VDMH 2R2EA 1VGKA 5DJCB 1U92B 5I76B 2FJHA 5KVEH 4NIKB 4C83A 1KJ3L 3B43A 2DMKA 4K9EL 2GJZA 2R69L 4JDTH 4POUB 4PG2A 2ITDB 4TN9A 4F37K 1ZAGA 5ANME 1JN6A 5C70A 3WCYA 1CF8L 3OKYA 4XXCA 4OT1H 1MIMH 1AIFB 4AEHH 1TZGH 2QSTA 5DMJB 4JGMA 3PQYD 3TZVD 1ZVYA 3QFDB 1DQJA 4L3EE 3VXSE 1S9KC 4M61A 2WBJC 4D9LL 4FQXA 3NFPA 3FT2B 3GHBH 4FG6D 3BISA 2E3VA 5L0QB 3STLB 1I8IA 4YAQB 1F4HA 5FO8B 2XZZA 1IGIH 1N5YH 4ELKB 1MRFH 4OCXL 5I1GL 1R24A 3MJ6A 5GRXG 1R3KA 1QLRA 3OAYK 4BELD 5K9OA 1RUKL 4X80L 2NY3C 3HE6A 1ZGLP 4J3XA 4DKFL 1OQOA 4Y7MA 3O6ML 1WFTA 2I07A 3MLVL 3KPQA 2DQDH 5E7BA 2OP4H 2AJYL 3ME0A 1E4WH 3KJ6L 4G6KL 2RBLA 5KVGH 1QBLH 4PB9H 1OAKL 4ZSOB 4MB5A 2YD2A 1NDMB 4HIEB 2CPCA 4P2YA 5FXCH 2VWEE 4LLUB 1SYSB 2AI0L 5ID1A 1SJHA 1KIPA 4ZDHA 4HIJB 1DBAL 4N0FB 5FM5O 4Y4HD 4P4RA 2HP4A 3QIUA 1DQLL 3DI3B 4NQCE 4OFYA 4QHUB 4AIOA 4PRPE 4V1DB 4XCNB 2IBZX 3FONA 4U6VL 2JELL 2VDKL 2VMFA 2H45A 4AL8H 3FO2A 5AD0A 1PG7H 4ZXBA 2OSLB 1BZQK 4UBDC 2EEAA 1S78D 2YPLE 4ONFH 5JTWA 2VXVL 2X4PA 5IBTL 3QH3A 1T6VN 5C0BE 1CDJA 1XGQB 2O5XL 5I1KH 5GGSB 4YHLH 2FEDC 3GBNL 5J6HB 4V2CB 4OZ4B 3VWJB 5GS0L 4MQXD 1I1FB 3UPCA 2GAZB 1U8OA 2GSIB 1A7RL 1ZA6B 4LCYA 1XR8A 1GOFA 3VU2A 4JKWA 4CJ1A 1CCZA 4NNYB 4JAMA 3JWOL 4X6CB 3BPNC 3U7WL 3V8OA 4HXBH 1ZHLB 2CIKB 3U7YH 5EUKB 4Z7OE 4GS7B 3QDGA 1J0ZA 5KVFL 3L95B 5GIRB 3FT3B 1CFQB 1HXMA 2OXHA 4Y19A 3T4YB 1A22B 1MJJA 2ZSVB 3N1GC 1YEHH 2OJEB 4OM1L 3S96B 2VLMD 2XG5A 4U1SA 4CNIB 3NABL 1YEJL 1BVKB 4NNXA 4WUUA 4HK0B 5E8DH 1I9IL 4F3FB 1CXHA 3FQRB 4JQVA 1J0YA 1RI8A 5TQ2L 1I7UA 1F8TL 3QEQA 3GMMB 5F3HA 5DMKB 3O2DH 1I9JH 2ATPA 3MOQA 1YEKH 3ZE2F 1L7TL 3AS0A 3DO7B 4LSPH 4GMTL 1WBYB 3B2UD 3W5NA 1BGXL 1CE6B 4HDIA 4ZUVA 1BF2A 3HR5A 1G9MH 2AAVA 3VFMB 3CXDH 3DYOA 4LEOB 4WHYG 4G9FA 4PGEB 3A0OA 4YIQA 2VH5H 2AXFB 1U3YA 3NBNA 3ULUH 4WFGD 3UYRH 3DX9A 4JFOB 4XX1E 1JI2A 1MAJA 5EU4A 1VKXA 4KHXL 3HZYA 4HPYL 4WWKD 3FO9B 5GRUH 4OF6A 3D39A 3CMGA 3HAEH 4JFPB 4XMKL 2FECI 3AS3A 3FO0H 3UMTA 1A4JA 1KELH 3PG2A 4LLAA 5IM7A 4JZJB 3BVNB 5IROA 1NANI 1VDGA 5I0DA 1M05A 1IQDB 1OCWL 8CGTA 3K8KA 4HHAB 5D7IB 5TE6L 5BQ7B 1BD2B 1QRNB 4JCLA 1I8LA 1QBML 3BGMB 1MQKH 4EN3C 1A6PA 1VPOH 4HPOH 3HZVB 1VFMA 3MV7B 3TT1L 3KPMB 3K80A 4E42B 4ENEC 4X7TB 3SCMC 2F58L 1F4YH 2Z92B 5EU6E 1LK2B 3F8UB 3GNML 4XI5D 3CDFA 1UB6A 5HVWA 4YC2C 2EE9A 2DQEL 1P4IL 3C2AH 3S5LG 4MLSA 4YK4B 3EYUH 5ESVA 1BVLA 5J1SC 2OK0H 5A1AA 3T3MF 1UWEL 1U8QB 4PP2A 1X6NA 4GG6A 4GFTB 1S9VA 1EHLL 2BVPA 1YNTA 3PF2A 5GGVY 3KPTA 3QEHA 4L9LC 4ODUA 1HIMH 1X44A 1H9VA 3QI9A 1M7DB 1OAUL 4QGYA 3VXNB 1JGUH 2Z8WC 4CADB 2OJZL 5E8EA 4J3VA 4MDIA 3V6BR 1QVOB 2FYYA 3W0WB 1OWWA 2FX9L 3WD5L 4U1JB 4LPCA 4LCWB 1VERA 5DJAA 3MODL 1KG0A 2PW2A 3D2UD 1J8HB 5DD3L 3Q1SL 5DJYA 1QSEB 5GXBB 4Z7VB 3TM6A 1UQSB 3V7MA 1DQDH 1TTFA 5IB2A 3VXMA 3B9EA 2O5ZH 1UWXK 4L1HA 3QXAB 1T1XA 3FOMB 3RTQA 3GHEH 4MS8C 1TVDA 3K7UA 4WNQB 2PYFB 3IF1A 2F74A 1CIDA 5I1EH 5SX5K 2YK1H 2ARJB 4WW1A 1NMBH 3GSUA 1A7NH 4K3HA 4K7PX 3OV6A 1AGFA 1I8MA 4XCEA 4AEFA 3WNKA 4LLVB 4LSQL 5A2KH 5CIPB 4RAVB 3KYKL 3LD8C 1HEZB 4JJHA 4JO1L 1GHFL 1ZA3B 4YFLF 5CD5C 5LXGL 4FFZH 4PGZA 4XNMA 5C92A 5D2NA 3GK8H 2Z4QA 5IF0A 1G9NH 1MCCA 5C0DB 5HYSA 3ZDXF 4Z78B 1KCKA 2ESVE 1C12B 3ARBB 3CIQA 2OR8A 2DWEB 4L3CB 1M6OB 2E9IA 2V9QA 4MQTB 5BVJB 1BBDH 3UTTE 4HZLB 2QADC 1DEDA 3V4PL 3T0EB 3CXHJ 3L5WA 4L3ED 5SWZA 3VXSD 1KIRB 4N90E 4OD1L 4U1KA 4LARL 1YUHB 3MCKA 4BH8B 4XPTH 1NCTA 1MFAL 1P7QB 1R5WA 4RISL 4WV1A 2QR0B 5DD0H 1QYGH 4HAFA 4MZ3A 2OCFD 4PREA 4RWYL 3UO1H 3F5WB 1VGEL 1PLGH 2PXYA 3ZKQD 4WY7L 1FIEA 4Y5XA 2Z35A 1XIWB 4YFLI 4F7EB 5L9DL 1I7ZA 3STZB 3MQIA 3OB8A 4H20L 5FGCE 4LSTL 1W0YT 3GMQB 4QXGL 4RX4D 3P3YA 3L6FB 3SQOH 4G6FD 1ACYL 3MJ8A 2HTLC 1MVUA 5BZDB 1D9KC 5ILTH 1XF5B 4YQXL 3B9VA 5D7IF 1CICB 5CEXB 3W9EB 4KUZL 5F97E 5TFSL 3MBEA 3SO3B 1PJ9A 2VXQL 4N0RA 5GZOD 3EYFA 1N0XL 3HI1A 3V52H 3WIFA 1ULVA 1INQA 4XRCA 1GGYA 1YQVL 3L5IA 1OTTC 1JV5B 4CU6A 5JOEA 4K2UL 4DTGL 1AQKH 1EEYA 4RA0C 3A67L 4NQCD 1JTTA 2ID5A 4L8SC 4X9IA 3HZKB 5LGHL 2FIRT 3MMEA 3O6FC 5CBAB 4NO0A 1NFKA 1NBZB 2N1KA 4RIRA 3WS6A 1ZMYA 3QG7L 4JHWL 4PJDA 4TVPL 3FFCB 1H15A 2FZ3A 1YPZE 2YPLD 3JV5A 5BRZE 1RK1A 1ZWIB 2VDOL 5ITFB 5C0BD 3PWVB 4OLZL 3PJSA 4YDIL 2PO6B 5HSFA 5JUEH 2BSRA 2A9ML 4N1EA 2DQHL 4OCYL 3LMJH 4ONOA 1A8JH 3GIVA 3PNWA 4M48L 2QQLH 1AY1L 3Q5YA 1I8KB 4WI5A 4CMHB 5I8KH 3TWCL 1AE6L 4NT6B 3RZCC 3JV4A 3HPLB 4JO2H 5DRXA 3V0VB 1YN6A 4RQQB 2YR3A 5DQDL 2X40A 4Z7VF 1XCTB 4JFFB 3ILQD 4HUWB 2IALB 1W72L 1RJZB 5JDSB 4HQQL 2VLRE 4EI6B 5CP7A 1CDBA 5K93A 4IJ3B 1CFTA 1OAYL 1AJ7L 3ULVC 1CD1A 1H3GA 1KV3A 1JPTH 4NN5C 2DL2A 3ULUE 1FBIH 3RVTC 4A6YL 4E41B 4HKBB 3D0VA 5CSZA 1ETZA 4OI7A 1T1YA 2J6EH 4U2ZA 1T3FB 3QIBC 1HHIA 2P4AB 4MMXC 1TNNA 3V6OA 1AFVH 5AYQA 4ZS7L 1DL7L 4RWHA 1OAQL 3BIKB 4JDZA 3T77A 5FECA 4HUNB 5IWLA 5JW3H 5GGUA 2EYTA 4RGOL 4TUKH 1FAIL 2MHAA 3HHRB 3QXDA 3UDWC 4XCCH 5D7LB 5I15L 2CDEB 4YWGH 4S1RH 2NLJA 2H8PA 3QPXL 3IETB 4C54A 4KXZH 4OFPA 4ZNEA 1U8JA 2VDQL 4M62L 1I3GL 3OAZK 1L7IH 2MJWA 2B1HH 4L5FL 3BSZH 3EOTL 4K07A 4DW2L 3C5ZA 4WHDA 1U3ZA 4FN0A 1RUPH 2R0KL 4IRZL 3WN5C 4KDWA 4DEPB 1HKLL 4G8GE 4GBXB 3RL1A 5D1XB 1WC7A 3O45A 1A6WL 3LN5A 3G6JA 1E0OB 5FO7B 1JE6A 2WP3T 4YO0A 4YDJA 3IVKB 2NR6D 1JL8A 2W0LA 3QO0B 5EBWB 5EU6D 1L6XA 5BZWA 4D3CL 2HN7B 2Q8BL 3N1PC 3W81A 3UPRB 3H6JA 5ECJE 1JPGB 2UY6A 4Z5RA 5E9DB 2FL5A 2BSSB 5CILL 1KCSH 3CVIH 4OLYL 1RFDH 4M8QB 3S4SB 1C7TA 2BDNL 1PBYA 4MNQB 4N8CL 3V7AE 5BV7L 1DBML 2P5WE 1Q94B 2ED7A 1UYWH 3FN0H 5HYSG 1JGVL 5JHLL 1LO3H 4XVTH 4FQIH 2F9BT 4K8RH 5CMAB 5DC9B 3RDTC 4P3DA 4QTIL 3FRPA 4JLRB 3UZQA 2RHEA 5DSCB 4Y4FA 4PJXB 4MAYA 4HBCH 4HKJB 4YHZL 3GMRB 3MJ7B 1YY9C 4NRZB 2YC1B 3QNYB 4NCC2 4CMMA 4WU5A 2YHGA 4RBPK 5LQBL 1IAOB 1MFNA 4YDVB 3MR9B 1IGML 5CS7A 1KJ3H 5EUOE 4K9EH 1CVRA 1OL0A 2R69H 5ISZE 2VZOA 4LLYB 4A6YB 5IVNA 2YN5A 1CF8H 4N68A 5AEAA 5HYQB 4M1DL 2EE2A 2JK5A 2OZ4L 3AY4C 2MPAH 1S9YB 4X6DA 2CLZA 3VFPA 1PKQE 2IFFL 2G2RA 1AGEA 1TMCB 3GJEA 2V7HB 3TVMA 3GJFB 4UQ3A 3O2VL 4D9LH 1HSBB 4X6EB 1AGBA 2VE6A 5J12B 1MAKA 3G5XB 2YBRA 4DCQA 3QUZC 1EFXD 4OF0A 2QHRL 2W65B 4OCXH 2FD6L 4R7NB 4NN7B 4QOKA 5I1GH 1EEQA 3FKUS 3E2HB 5MENA 4K7FA 3NFSL 2WBJB 4D8PB 3CMOL 1RUKH 4X80H 1T7VA 2ESVD 2PCPA 4JZOB 1AXTL 1ORSB 3H42L 4IBLT 4DKFH 1QLFA 2V6HA 5E8NA 5IW6A 3VGBA 3O6MH 5EFIB 3MLVH 5JHDA 4FQQB 1HE7A 1D5BA 2AJYH 3UTTD 3WSQL 4TTDC 4NRXB 3KJ6H 3DUSB 4G6KH 4KI5E 3TO2B 1X5IA 1XGUB 2D03L 1OAKH 4YXHL 4QTHB 4N90D 3WUWB 2ICWJ 1A47A 4HUKB 1DDHB 3UTQA 3CZJA 3AGVA 1CI5A 4TQEL 2AI0H 2RCSL 4MMZC 5D1QA 3TF7C 1QEWB 2VIRA 3L7EB 4JE4B 1UEMA 1HDMA 2JLLA 2J8UB 2DM7A 2DQFB 4Q0XL 1RUQL 4H26B 1DQLH 3L3OB 2UVEA 4XP9L 1Z5LA 3RQ3A 1NEUA 1OW0A 5J3HC 1B90A 4U6VH 2JELH 3TYFB 1U93A 2VDKH 1ZGLB 1FRGH 3QJHB 3FN3A 2X70B 4LSSL 2WWMD 5D7JD 4YHPA 5SV4A 4MA7L 2IAMB 3ARGC 3GMOB 2VXVH 3O2WL 4ONGL 4AENA 5IBTH 3GSNA 4LNVA 5INDA 4XWOC 2O5XH 1LEGB 2D2OA 2BCKA 3GBNH 3AREA 3BPOB 4MD5A 2EXYD 1KENL 5GS0H 2P7TB 4MNHA 4ERSL 2B39A 3L7FB 4DQOL 5J56B 1MRCL 2OTWB 4LVNB 1A3LL 2X2YA 1A7RH 2VL4A 4LKCB 4NQSA 5HPMB 5JLZA 3GSRB 1IGYB 3KPRB 4PB0L 3REVB 3SDXA 3JWOH 3DVGA 2DIAA 1ZT7B 3U7WH 1JMZA 4HV8A 3RVXC 1LILA 4S11A 5KVFH 1DANT 1T0NA 1EA9C 5E95B 4B7IA 4HJGA 5BRZD 4OM1H 2ZUYA 3HG1B 2R1XA 4G3YL 4OLEA 5CJ5A 3BH9A 3NABH 4G43B 2EEDA 2ZNWA 3D85A 3ZE2E 1YEJH 3U6RA 1QZ1A 2NXYB 4MA1B 3H7BA 2V7NA 4TYUA 1I9IH 4JRYA 4OD2A 5TQ2H 4S0TD 1F8TH 4ZFFB 3SCMA 5INCB 1LE9B 4UT9L 3NZ8B 4RMUA 3PV6B 3FQWB 4PYGA 1L7TH 1JYNA 4PJXF 2OS7A 4TPRL 4GMTH 5ADPL 3U7AA 1BGXH 4JM2B 5T5NF 1IQWL 3A6OA 4RMQA 1QFWI 4NC2B 3QQ9C 4LGPB 3U36A 2VLRD 3IRPX 1KB5A 2LTQC 2BSTB 2YS4A 12E8L 1ZSDB 2L7UA 4RNRB 1OVZA 4LDEB 1MH5A 4G6AD 3B9DA 5A2LH 4LCCA 5FK9A 5ETUA 4JEGB 3BPLC 2NNAA 4R0LC 4KHXH 4HPYH 3ULUD 2VERN 3FL7A 3EYOB 4XMKH 3GMLA 1SM3L 1FNLA 3MGTB 5CCKL 4K94L 4NZDA 3QZWA 3C87A 1OCWH 3I6LE 2ICES 3IJSA 3SDCC 1RZKL 4N0UA 3R0MA 3V5DB 2BNUA 5TE6H 1DZBA 4NCDA 3ARQA 3TBVA 2H6PA 1QBMH 1CXEA 4JY6B 4DVBA 3GMNB 3TT1H 2BZDA 1FLTX 3OKEA 2OQJA 5GGTA 4ZSOE 2E6QA 4L4VE 1QFHA 2F58H 4M7ZB 3DYPA 5GS1A 3RGHA 3GNMH 5BS0B 2D31A 3P2TA 3ZE0E 1KC5L 2J8HA 2DQEH 3FRPG 1P4IH 2BVQB 4Q7DA 3NVQA 5T1KD 5HGHA 3WV0A 2X05A 4JFDE 3IAGC 2XY2A 1UWEH 4PJAA 3ZDYE 5I2IA 2AKRA 5FFLA 1EHLH 3BOVA 1XGPB 4YC2B 4ZUWA 4HLJA 4APQB 2J8UF 4I4WB 1TZIA 3S97C 2Q7YA 1OAUH 1M4KA 2BVTA 3NPZB 4OLVL 4PJHB 5DFTA 2BSED 5TJWK 1UJ3A 2OJZH 1TITA 4JN1L 1RV6X 3B5GA 4M7LT 1AHWC 3SE8L 5I8EA 2F8XC 3NCYS 2FX9H 3WD5H 1VA9A 4DUWA 3MODH 2VDPL 4I9WD 4H8WC 5DD3H 5GGRB 3S3JA 3Q1SH 2AK4A 2EIZA 5IKCB 1AD9B 3QQ3A 4DFIA 1BPVA 1OGAB 4X6CE 2N56A 3F6IA 3WLBB 4NQUA 2VAAA 4NYLB 4PJ9B 3KYNA 1LEKB 2P5WD 2VC2L 2EE3A 3BI9X 1KLGA 4U1HB 3RNKB 2X4OB 4M6ML 3FZUC 5ESQB 1VFBB 1FHGA 3RA7L 1A6ZA 3EJZC 1ND0B 3B3IB 2B0SL 3IJHA 4KRPD 3ARFD 3DX8A 4LSQH 5IVXA 5IMKB 3KYKH 4OBSA 4CDHA 1QSFE 4JO1H 1GHFH 4AG4L 3S98A 5F96L 3KPSB 5LXGH 4MSWB 5DJZB 2VLKB 4DJMA 3DGGA 2CIIB 2VXUL 4A2LA 4EVNB 4UNUA 3PUCA 5F7KC 4XTRD 4HLZG 5T5FL 5ISZD 4N0YL 5JO5B 3WDJA 1PY4A 3LKSA 3LD8B 5GZND 5HGBB 3MLXL 1BJ1J 1QR1A 2ADFL 4WU7B 4L8SA 4QF1B 4NKIL 5I1AA 4Y5YC 1AGCB 3V4PH 4S2SB 2W9LA 3OF6D 5C9JB 4OD1H 4LARH 3FTGA 4B0MM 4WTZA 5DVOA 2ADIB 1MFAH 1BFVL 4RISH 3DROA 4LHUA 3TO4D 5DFVC 2QADB 3BD4A 4RWYH 4DN4L 5HHPA 1VGEH 5JNYA 4M7JL 5F9WC 1X5LA 4WY7H 4F2MB 3GUTA 5JQHC 3TJEL 1TNMA 3QR2A 1X5GA 4U0RC 3LV3B 5D7IE 1G7JB 1QRNE 4PLKC 2PETA 4FQHB 1AKJA 5L9DH 3F12B 4H20H 4ZD3L 4PJFF 4LSTH 1R3LA 2NY2D 4QXGH 5TGBA 4UTAL 3MV7E 4QRRE 5KVDL 3L3GB 1ACYH 3I50L 4GKZA 4KI5D 2QKIA 1WIPA 4UOW0 4YQXH 1EJ6A 4P23D 2IGFL 3U30B 1H0DA 1LNUA 4KUZH 3UJIL 5TFSH 2C4XA 4NFBA 1BIHA 1EHXA 2DS4A 5F89B 2VXQH 5AG8A 5AAMA 2YEZA 4LVEA 1C16B 5EOTA 4DZ8A 4I0PD 1KPVB 1T1WB 4EOWL 1N0XH 3T2NL 4JDVB 4ZFZB 3GB7B 3BEWB 3EFFA 1N8ZB 1YQVH 3LKPA 4K2UH 4BKLB 1D9KB 2GSGB 4PGDB 5MHSE 4PJ5B 4DTGH 4HX1A 4YPJA 3A67H 1UC6A 1G0DA 3ARDA 2HAZA 3LKOB 3E6HA 4NP4L 1JZ6A 5LGHH 4NKOA 4AIZA 2XZCL 2VQ1B 2P8LB 3QG7H 4JHWH 4JQXA 1QNZL 4TVPH 3VE0B 1JTOA 2RAMA 2V5SA 3HMWL 3N1QC 4XBPA 2E7CA 1JF1A 3MRGB 3MLUL 1EO8L 2VDOH 5JIKA 3VMPA 4YDIH 4OLZH 3RWDB 1C08A 1Z3GL 4PJGE 3LPGA 1JZ3A 2A9MH 1OTSD 4OLUL 3MYJB 4HKXA 2DQHH 4JVWA 3TZVC 1MCLA 3WNMA 1J8HE 3VXRA 4OCYH 4PTTA 2AXHA 2ITCB 4CVXA 2F53B 3KXFB 4Z7VE 3VFNA 5CJBA 1BM3L 4M48H 1AY1H 4FG6C 3H9SA 4H88L 1FC2D 4G9DB 4XMLL 3TWCH 1AE6H 4GRLD 4NSKB 4UZGA 4Z0XB 1YN7A 1U3HA 2G9HB 4GLRH 1T22A 5IFAL 5DQDH 2X41A 4AM0B 2OX5A 3DTXB 5LJYH 3QZWG 1W72H 1FZMB 4YPGA 1N3NA 4HQQH 4WHTA 1WZMA 3VGAB 4JJ5B 1OAYH 1AJ7H 4L1DA 5CGTA 2RB8A 3HFML 3AU1B 4Z0BL 3C5JA 1OWRM 3RWFB 4AIXA 4ESKA 3SKNA 3ARVA 4A6YH 3PV7A 4KK5D 1K9TA 4XPBH 2X09A 3N85L 3QSKB 1MEXL 5IMOB 2DKSA 1KTRL 3EOBA 3OAUL 4PJEE 4Y4HC 4ZS7H 5DTFB 2EDDA 1DL7H 4NN5B 1OAQH 2PW1B 1T5XA 3TCLA 4O51B 4P46D 2NW2B 1M7XA 2LFGA 4M43L 2PYEA 4DGIL 1XGYL 1G6RB 3T0EE 1LD9B 4RGOH 1FAIH 1S78C 2H32B 3L5HA 3S35X 5I15H 3HUJB 5GPRA 3RDTA 3QPXH 4D9QE 4OZIA 5A40E 1O7SA 1CDCA 3PDOA 3B9KB 4J2XA 2UZIL 1NL0L 4QRSB 2VDQH 4MQXC 2CKBB 5DDHA 3J7HA 4M62H 5F44A 1I3GH 5ELIA 4LOUD 3QXUA 4L5FH 4I5BA 3I6LD 1WICA 3EOTH 1KGCD 5F7YC 4WI9A 1SYVA 4DW2H 1RIUL 1P9MA 5I75B 3ZKND 4Z76B 2R0KH 4IRZH 1EXUA 5LVEA 2C7UB 1OARL 3FB5B 1HKLH 2ZUWA 3HTLX 3P4OB 1A6WH 1PX4A 1XF3A 3PP3H 5L2JA 4M1CD 1HYRC 1RUML 1CYGA 4JPIA 3UTSA 4L4VD 4CBPA 5D70L 2ZSWB 1CD9B 1A0QL 4MB4A 4R4BA 3BN3B 4D3CH 2Q8BH 1J0KA 4GRMB 3T1WA 1VADB 5K59F 3QNXA 2FJHB 4IIQC 5D6CB 4C83B 3IKCA 2GJZB 5CILH 2NZ9D 4JFDD 4OLYH 2K9UA 4G8FA 4U7KA 3RBGA 3GBML 2BDNH 4D0CA 2LQRA 3OJ2C 2WP3O 1OSZB 4N8CH 5BV7H 4LRIA 4PRIA 1DBMH 3MNVA 1QFUL 4G80A 4YGAB 5GSVB 1JGVH 5JHLH 3FFCE 4Y0GA 2LU7A 1DQJB 3MACL 4WEUD 4M61B 3BZ4B 3GZKA 4XP4L 2H3NA 3NFPB 3ZYJA 4QTIH 2NY1B 5MERA 3QWOB 4GW5A 1I8IB 2JJUA 3PABB 2FH6A 3DSFL 2EDKA 3ZKXC 2XNAA 1CLYL 4K8RD 2NY7L 4YHZH 1R24B 1R3KB 5EULV 4IHOB 4QT5A 4QXTB 3ILPA 3E8UL 1RZJL 2YZ8A 4ZO6A 3QO1B 5LQBH 6FABH 4WTZG 4WWKC 5JOFA 5C0EB 2P24A 1G7MB 4U6XA 4F15C 1U95B 2I07B 4HG4K 1IGMH 4LHUG 3RHWK 2AQ1A 2JF1A 4JFFE 2HRLA 4M1DH 3JVGA 1HSAA 2OZ4H 3K4AA 3P9WB 2UWEF 3FB7A 2IFFH 2SEBB 1Y0LA 4U7SA 5ID1B 3DX7A 3EO0B 4ZDHB 3O2VH 1S9XA 5DEFB 2GUOA 4P4RB 4UU9B 4I2XA 1I85C 1KBGL 3KJ4C 3LN9A 1F11A 1QSFD 4E41E 3PWNB 2QHRH 4PBVC 2FD6H 4OI8A 2Z8SA 3FO2B 4EQ2A 3NFSH 4ZXBB 1T7YA 3KVQA 4DKEL 3CMOH 5CUSL 4HWEL 3LEXA 3DV4A 1AXTH 3SPVA 3H42H 2R1YB 4GUPA 3QUZB 5D6DC 1QHPA 4X4XB 3P0GB 4MWFA 3ULVF 3BPCA 2LAGB 3WSQH 4HULB 4DK3A 4Q9RL 5I74C 3QFJA 1PZ5B 2D03H 4P4KA 4YXHH 3C8HA 5IFJA 5CLWA 4N9GA 4LCYB 5D7LE 4HSQA 1R5IA 3JV0A 4S1SL 4BZYA 4F7PA 4TQEH 3DRQA 2RCSH 5MEQB 1MI5B 4PYHA 4DAGL 3LHPL 4M6AA 1K8DA 1I1AD 4Q0XH 1RUQH 2HFGL 3N1FC 1QFWM 3HUJF 1MJJB 4XP9H 5F8QC 2CD0A 1N5AB 4FOMA 1QRND 1WWAX 5I66B 1T4KB 2WLYA 4AH2B 3B8SA 4LSSH 2Q86A 5HGAA 2YD1A 2K1MA 1NCWL 3MV7D 4MA7H 4QRRD 4GRWB 3VD7A 2EIBA 3C5SA 3INUL 4QRUA 3O2WH 4ONGH 2AQ2A 2HJKB 3QIWB 2I27N 1HKFA 4TVPE 4GW1A 1KENH 2ATPB 4ERSH 8FABA 3VI4E 3SGDH 3ZT7A 4DQOH 1MRCH 2ARJQ 1A3LH 2I26N 5E9DE 3OQ3B 4ZFGL 4PB0H 5MHSD 4ZUVB 5GS0D 3HR5B 3BKYL 4R0LA 1SMOA 2R2HA 4MNQE 2NCMA 5EPMB 5HY9B 1WAAE 5HHXL 4D94A 4NQVA 2W92A 3MUGA 3IXTA 1UZ8A 3CGTA 1OPGL 3C2SA 1LDPL 3WFCH 3L3HB 1U8PA 3UC0L 4G3YH 1VKXB 5A2FA 3Q5TA 1Q9KB 5E5MB 1B9ZA 4HS8L 3D39B 4PJXE 1OP3K 3WFDL 1U8IA 1A4JB 4G42A 3EYVA 1J8HD 1PQZA 5IM7B 5DRNA 4O2CA 2OI9C 1DSFL 4PJCE 2EYRA 1MCKA 1M05B 4UT9H 1MWAB 4N8VA 3ZTNL 4P9HC 4FZEL 3GGWB 3WJLC 1B4JL 4YZFF 5TF1L 1ZHBA 3TPUA 4TPRH 5ADPH 2JKXA 1HCFX 4RMWA 1IQWH 4KVCL 2I5YL 1WBXA 4U3CA 3MX0A 4P2RB 3MLSL 1G7IA 4JFYA 5DRWA 4JANA 4PV9B 3REWA 5T33L 12E8H 1T66D 5AZEL 1R3HA 5DD1L 2V2XA 4PRHA 4JFQA 1R6VA 4O02L 1EMTL 1BVLB 1BAFL 4RGNB 2B20A 4PS4L 1AHWA 2AV1A 3I75A 2EC9U 4MJ5A 4PP2B 4GG6B 1SM3H 4M9PA 1S9VB 4OZHA 2VWEC 4K94H 5CCKH 2BVPB 1YNTB 3OKDB 5SX4I 5GZOC 3QEHB 3HC3L 2HG5B 1BFSA 1MHHA 3WKNA 1F3DJ 3RGVD 2IPUK 3CVHB 1NGYA 4MDIB 5CINL 2EH7L 2YMXL 5DHVA 4ONHA 3EHBD 3HZMB 3DUHA 1EAPA 5DJAB 1IM3A 2PW2B 3D18A 2X7LA 4HZAA 2Q8AL 2JCCA 2EDWA 4KHTL 3ULSA 1DBKL 5HHNA 2P8MB 1MCDA 1P7QD 1KC5H 3OSKA 4D9QD 4Z7NE 1X5ZA 3MUZ1 1JGDA 1T1XB 4YBQD 3RTQB 3NAAL 3OHXA 1A7QL 1NJ9A 4N5ED 1LP9A 2Z91A 4W4OC 2F74B 3FQTA 4UUJA 4RZCA 3AAZB 1NH6A 3GSUB 5ID0B 1I8MB 4XCEB 4BFGA 1BJ1H 1X4XA 4OLVH 3ARXA 4P3WA 5JZ7C 2D7NA 2BK8A 4JN1H 4J4PC 2ZUSA 3ILQC 3SKJL 1AGDA 2R0LL 3VXPA 3X3GL 1WBZB 3SE8H 1BOYA 5BW7C 1HHHB 4XNMB 2Z4QB 1CZ8L 2VDPH 5GQBA 3T1FB 3KPRE 3QG6B 1QFWL 2H1PL 5C0RL 1K2DA 4UIMA 3TBWA 5KSAA 3BWAA 1N4XL 4QEGA 1YQ2A 4X8JA 3KYMA 1X5HA 2FIKB 3M07A 3SKMB 3V2AR 2VC2H 4WI6A 1T7WA 3FFCD 5CZVL 3L5WB 5FHBL 3TESA 2GQHA 2YD8A 3HG1E 4M6MH 4YXLL 1LGVA 5F1IA 1WT5A 3RA7H 1EBPA 2OYPA 2PO6D 1ES0A 4YNYA 3QJFA 3HNTL 2B0SH 3FRUA 4BSWA 1R5WB 4WV1B 1PGRB 1T20A 2PXYB 5DHYB 1UZ6E 1KIQA 3IAPA 3WEXA 4R26L 4LSUL 4AG4H 3IDXL 5F96H 3CU1A 4MQSB 2ENYA 2VXUH 2BERA 4NOBA 4RFOL 4MZ2A 3RI5K 4ISVA 3NCJL 4HCRA 2Z31A 1CT8A 5F9DC 5T5FH 3ARZA 4N0YH 5JQ6L 1LE5A 4JFFD 1NEZB 1IEHA 5IJVB 3G5VB 3MJ8B 1MVUB 3MLXH 3I3BA 2VDRL 2PTUA 4MB3A 4NKIH 4UIKL 4WHYH 3BP7B 3EYFB 4L8BB 3HI1B 3WIFB 1J8KA 1HWGB 4ODXA 5E6YA 3SY0B 3MV9A 4E41D 1BFVH 4OKVA 1ZVSB 2NR6C 2DQGL 4DN4H 3LPFA 4JFEA 2VO5A 4NO0B 4M7JH 4RIRB 3RKPA 3UBXA 3TJEH 3DOSA 2FZ3B 1NBYA 2DJ4A 4NM8L 3MRHA 4LVOC 4ZD3H 5JDJA 3CDYA 2XYCA 3OGCA 4G8EA 3CXHK 4LFHG 3PJSB 2H32H 4UTAH 2P5EA 5CP3A 5KVDH 4S10A 1UKSA 2CDGA 3MV8B 3L3DA 3PL6A 4PR5B 4J3UA 1CGUA 2IGFH 4XP5L 4OI9A 2W0FB 5D7LD 5F7MC 5BS0E 2UY7A 4QHMB 4EOWH 3T2NH 2IBBA 4M6NL 4Q2ZA 4UNVA 4ODSL 1YECL 5DUBA 1YN6B 2YD4A 3I02A 3FT4A 5E6ZA 3QBTB 3VD9A 2ADGB 2BOBB 4NP4H 4LCUA 5FO9A 1R3IL 1MCBA 4N8VG 2XZCH 1NCUA 2OTPA 3AM8C 5D5MA 4D0BA 4GBXD 4R97C 1S9WB 1QNZH 3ARSA 3K2UL 5D1XD 5E08L 4PJHE 4RMVA 4K3EL 3HMWH 4NC1E 5C7XL 4LU5L 4U1GC 5B38B 3P77A 4HEME 3G5YB 3MLUH 1EO8H 1XCQA 4B41A 4NQDB 4L29B 2DKUA 4FXLA 1X9QA 1Z3GH 4Z7WA 4TVPD 2VZSA 4LLMA 5CSZB 4OLUH 2ERJB 4LNRA 1T1YB 3C6LC 4K71B 4C4KT 3MRNA 2C1OA 5E9DD 1OGAE 4YDLB 1BM3H 1FIGL 4FMFA 4R2GC 1J1XL 5JXEA 4XCFL 3T3PF 4H88H 1FG2B 4JDZB 4XMLH 3T77B 4MNQD 5DK2A 4XPGL 1G7QB 4WFEE 5C6WH 5IFAH 1AP2A 1MRDL 3MA7A 5GGUB 2R1WA 1REIA 1RURL 3BXNB 5TDOB 1DVFA 4OIIL 4LLWB 3HR6A 2XICA 3QXDB 2D9QB 4BUHA 4CU7A 5IVZA 2OLDA 3QUXA 4EI5A 2H8PB 4TNVF 4FQ1L 3HFMH 3U9PL 1H8OA 1ZE3C 4Z0BH 1CDUA 4QGTA 2VDLL 5D2LE 2HJLA 2HT2D 2Q6WA 3O4LA 4ORGB 2VLKE 1RIHL 5B4MD 2IC2A 2I60L 2IQ9L 3N85H 1MEXH 4XVJL 3ARRA 4PBWD 2GEEA 4QRTB 4PJBF 1WC7B 3O45B 3OAUH 4WI3A 1ZEAL 3G6JB 4Q6IA 1FFQA 2NY4B 4KI1A 1KLUB 2GJ6A 4YDJB 4YO0B 4CU8A 4X99A 2VZ1A 4M43H 3OBAA 4DGIH 1Z0NA 1XGYH 3AMLA 5TDNA 5BZWB 1T5WB 3BP4B 5ICYA 4MLIA 5K9JL 2YUWA 2WWMC 2CLVA 3S7GA 4WW2A 1TVHA 5JPNB 3GSQA 2FL5B 4OCMC 3CH1A 5IB1B 3OZ9L 3ZT6A 5AWNL 2EXYC 2UZIH 4F37F 1NL0H 3GSNL 1Z9SA 5T1LB 1RAMA 1D5ZA 5GRVK 1RIUH 5L7XL 1FO0A 2A38A 5FYLL 4WWKA 4OZGF 1TXKA 1OARH 4QHLA 1IEAA 3VXTB 3I6KA 1J0HA 2KBGA 4YR6A 4I77L 3Q48A 4POZD 1RUMH 4NO2A 5D70H 3KAAA 1A0QH 4KMTL 4CMMB 4WU5B 3RIAK 3SBWC 4PJIA 1ZHKA 3O8XD 4Z77B 2GFBA 3S8WA 2X4SB 3TA3D 2FX8L 5B3JF 2FJFB 3OR7A 1RZFL 2XY1A 4HT1L 1FP5A 5KSBA 5AG9A 3GBMH 4GRWH 1WGOA 1S7XB 2DRUA 2YD7A 3MRMB 5FGBA 2JK5B 3NH7L 5D1ZA 3IDYC 4PG9A 1QFUH 3LS4L 1N2RA 2VQUA 1PKOA 3VFPB 1T0PB 4NRYA 4NUJA 4IIQB 4PFEA 1AGEB 2QV2A 4F8TA 3GJEB 3MACH 3PDGA 2IAMD 3K74B 3TVMB 5E1HB 4UQ3B 4ZOCA 1RPQA 2YUZA 3C60A 4XP4H 5HHMB 4GAFB 5B39B 2YBRB 2YPKA 3HCVA 5D6DA 4DCQB 5HGDB 5EU3A 3DSFH 2XKUA 3N50A 4C56B 1CLYH 4U2YA 1FZOB 2NY7H 4WIQA 1UM6L 4QOKB 1G9MC 3M45A 2F53E 3KXFE 5GJSL 4G6AC 5MENB 4K7FB 1W0VA 1KB5L 3QWQB 3KPRD 4Q9CA 3E8UH 1RZJH 2PCPB 4GKSA 1JZ5A 1B0GA 1QLFB 3MGOA 5E8NB 4E5XB 3ISWA 5EZIL 5IW6B 3ULUC 3ZKXB 4HMCA 4LCIL 1FYTB 1JUFA 4B53A 5FAAA 1HXYA 2I9LB 3PHQB 3UBXG 1U36A 5LGKA 3P9LB 5IFHL 4R90L 2VABA 1D5MA 2HVJA 1LMKA 1FNAA 5B8CB 5D1QB 2NXYD 3UTOA 2A77L 3GFUA 3LSOA 4MQ7A 3U79A 2VIRB 1TZHA 4J1UB 5I6XC 1HDMB 1T7XA 2XKNA 3LKQA 2VN7A 4QNPF 1G84A 3AB0C 2JJSA 2WIIA 3RUGB 3T08A 4U1MA 5GGTL 1W8NA 5TDPB 1F90L 4HUUB 1U93B 4H1LB 3SDAA 3VCLB 1JK8A 2G75B 4JM2D 4DKEH 2HFFA 5CUSH 4HWEH 3PP3K 4YHPB 1BOGA 2B8OT 2KZ1B 4JN2A 3ZTJG 4AENB 1UXSA 1A7OL 3OJDA 3GSNB 2BCKB 4I18B 4LAQL 1FNSL 2FSEA 4MNHB 4WHCA 4Q9RH 2A6JB 1BX2A 5IGXL 1T83A 1D5XA 3U2SB 1F00I 5JLZB 2VR5A 2JIXA 5FDWB 2MCPL 4S1SH 1IC7L 2WWKO 3OX8B 2YWZA 3SDXB 3VMOA 4DAGH 1HHJB 2BNRE 1NGWB 1A9BB 3LHPH 4HV8B 4RSVA 4ZFOB 4BA8A 5E1AA 3RWIA 4YHML 4JFXA 4OUOA 4W70A 1RJYA 1X4ZA 2HFGH 3W11D 4PRAB 3RJDA 3U4BL 1NKRA 2P49B 4GKNA 6CGTA 3O11A 3WJLA 3VXUA 1RHFA 2Y36L 1NCWH 3H3PL 2ICCA 3H7BB 3INUH 1K6QL 5IW1B 3D2UB 1WJ3A 3B83A 3UP1A 4OBRA 4ELMB 1IAKA 1E4XI 5BS0D 3QEUA 4QY8B 5KS9E 25C8L 2WSKA 2X4NA 1WWWX 4HH9A 3FQXB 4RX4A 4KRPC 3ARFC 4ZFGH 3AFLA 2IPKA 3EYQD 3BKYH 4UDTA 2UZXB 4TSAH 2W60A 4P57A 5I16B 2CRMA 2HKFL 1IGFL 4RFEA 1JNJA 1WLHA 3U36B 3QQ4A 4PGJA 1NC4A 4APQD 5HHXH 3V5KB 1F3DH 4XTRC 1DR9A 1MH5B 1OPGH 1DLHA 4FTVA 1LDPH 4RMTA 4XGZB 1FYHB 1JPST 4LCCB 5FK9B 5ETUB 3UC0H 5GZNC 1HI6B 1N64L 1WISA 4HS8H 2ZOLA 1EFQA 1SEBA 4PRPA 4YBLB 5F7DA 3WFDH 1ZV5A 3G04A 1E4KC 4HJJL 1DSFH 5E6ID 1UFUA 1Q9OB 2V2TA 1OGAD 3IJSB 4AEIL 4N0UB 1R3JA 3DXAD 3ZTNH 1VCAA 1CDHA 4FZEH 5FKAB 1KCUL 1B4JH 2X9XA 5TF1H 3TBVB 5KJRL 4PJ9D 4JRXA 3QWRD 1KB9K 5C0GA 5E2VL 3TO4C 1PSKL 5JA9A 4WFED 4ZO7A 4KVCH 3TIDA 2I5YH 4DVBB 5L8JB 2OI9B 5CJXC 3OKEB 3MLSH 4W4OA 5EBMB 3NZHL 1FG9C 3QULB 2F15A 4CRPA 2APVA 5T33H 1P84J 2CSPA 4X6FA 5AZEH 5EZJB 2D31B 2NY2C 1T0MA 1UVQA 1SQ2N 5DD1H 2C5DC 4O02H 5D71L 5ENWA 5F70A 5IG7A 5HGHB 1EMTH 4KI5C 1QA9A 3GIZL 1BAFH 4J4PA 1JGEA 1MHPL 4P23C 4PS4H 2VLKD 4PJAB 5I2IB 4L4TA 2AKRB 3VWKB 3AS2A 1HHGA 3TEUA 1FL3B 2V5YA 3HC3H 5IK3A 2HH0L 4HWBA 3TCXA 5L8KB 2ICEB 3CCHA 1TZIB 3HRZA 4BSVB 1GL4B 1UJ3B 1UB5A 3RUGF 1FDLL 1GH7A 5CINH 3OKKA 5CBEB 2J4WL 3JTTB 5I8EB 2EH7H 2YMXH 5IMLA 2A0LD 1CBVL 4ZTOL 3PWLB 1LO2L 2Q8AH 2XZQL 4KJQD 4KHTH 4M5YL 2EIZB 5EDXA 1DBKH 1CDIA 3VRIA 1S7TA 4LDOB 4F8QA 1A6AA 4LEXL 1A1NB 2VAAB 4NHUA 3WE6B 3QDGE 4GXVL 5J11C 3KYNB 2EIDA 1OTSC 3AC0A 2GTZA 3NAAH 1BFTA 1A7QH 2BJML 3C8KB 4FFWD 5BVPL 4Y19E 4X7CC 4E0RA 1KLGB 1MFEH 3LY6A 2PKDA 1OAXL 3TBTA 4WI4A 1KUMA 1U8MA 4GRLC 1VEMA 3IJHB 4GRWE 1MJ7L 5D93C 3CUPA 4Y5VC 3U1SL 3DX8B 4P99A 1S5HA 4O2EA 3SKJH 2R0LH 1JTPA 3QEQE 3X3GH 2H26A 5C09A 2FEEL 1EK3A 4KFZC 1TQBC 5GRWA 1CZ8H 1FFNB 4XAWL 3UAJD 4QCIB 4ELMF 5C0RH 1QFWH 2H1PH 5DQ9A 1GGCL 4EUPA 1N4XH 2EKSA 1JYWA 1EZVX 4U1NA 1VESA 3OKOA 4KK5C 1FH5L 4O58L 3VFTA 3DECA 3B9AA 5CZVH 3ARTA 3VD5A 5FHBH 2R4SL 1U8NB 4YXLH 2XA8L 3FTGB 4LPUA 3QHZL 5AYUL 4OIBA 3BIAX 3D39E 3HNTH 1WIOA 1KN2L 4P46C 3MROB 4LHUB 1KOAA 1LO5A 4PJ7B 2F53D 3KXFD 2X9YA 5EOQL 4R26H 3IDXH 5C2BL 3OXRA 4U1LB 1XF2A 5E00A 5L0QC 4RFOH 1AKJB 4CVZB 3NCJH 2GI7A 3P73B 1Z9OA 4PLJD 1PW3A 1RJLA 1SJXA 3FMGL 5TGBB 1NFIA 1GPOL 7FABL 5JQ6H 4GKZB 4P2RE 5GRJL 2QKIB 4LOUC 3TH4T 3MRKB 1FVCB 2VDRH 1ODAA 2VSCA 3TGXA 1H0DB 4WUKL 1FZKB 3E1F1 2HVKB 3VJ6B 3IGAB 4UIKH 5EO0A 2YEZB 5EOTB 3ZKNC 4DZ8B 5F88A 5J57B 3AM8A 3JUYA 3Q2CA 1DUZA 4X7DC 5FB8A 3WBDA 4Y4KA 3HE7D 1QHOA 4KKCD 4RGNE 2ZG2A 3A6CL 4M1CC 1II4E 3ARDB 3LKRB 5A16B 4GG6E 1NAMB 3U0PB 4UOW1 2DQGH 2OM5A 4F33A 2ZG3A 4AIZB 4F9LA 3C6LA 5J6GB 3T0XA 1N6UA 4NPYA 4XVSL 4NM8H 2NZ9C 4IS6A 1BP3B 1C08B 1QLEL 1YEIL 2A6DA 2OL3A 5EU6B 3MSPA 3QXWA 4LGSB 4JO3L 1EGJA 1S7QA 4HKXB 3IB4A 1SEQL 4M1GL 1BREA 4YHKL 3QA3A 4XP5H 1W0WB 4CVXB 4D0DA 3VFNB 5GISL 2ESVA 3VXME 1ZS8A 4M6NH 5FYJU 5HHOA 2BNRD 2A83A 1U3HB 1YY8B 3MBXL 4ODSH 2HJFA 4K8RC 1YECH 32C2A 2EDTA 1KIUA 4HIHA 2Z9TA 3FQNB 2CJUL 3FB6A 3AUVA 3IKKA 5EWIL 5FA3A 3SGKA 4NOFA 1P2CB 3GSWA 3UJTL 1BWMA 2VR4A 4LPWA 1P4LA 4OGZA 4YPGB 1R3IH 1CS6A 4OGYL 3K2UH 4GS7C 5E08H 4K3EH 4I48B 4ZTPL 4NZRL 5C7XH 3NIFE 4LU5H 5KZCB 5HTSA 3WIHA 2H9GB 1IL1A 4J12A 4HFUL 2ZUQC 5D2NE 4XP1H 2E7LC 4AJ0A 2DQUL 4O4YL 3CX2A 3PWJA 1UM5L 4I3GA 1FSKC 5DC4B 1FIGH 2VLJB 2XKSA 4OJFL 4RAUB 1A6TA 1J1XH 2L7JA 4XPFL 3ZKMD 4R96A 5C6PB 2PYEB 4XPGH 1C1EL 4TSBL 1MRDH 5EU5A 5DQJA 1RURH 1J10A 3TNNA 4P2OA 1IAIL 4OIIH 1JYVA 3DMMA 4FQXD 5DWUH 2NY1D 1E28A 4I13B 3Q5OA 1FCGA 4HKZB 2A74A 1DANU 4FQ1H 3U9PH 5HVHB 4O5LL 4MCYA 1QSVA 3DRTA 2AEIT 1BF8A 2VDLH 4F7TB 1EHAA 2D7QA 2NY6D 2ARWA 1RIHH 3HE6D 5ESAA 4LIQE 2Y7QA 2I60H 1MPAL 2IQ9H 3DVNA 4HC1A 4XVJH 2A73A 1NFDA 1EXUB 4PJ7F 4FMKA 5EO9A 1I1AC 4JZJC 1GIGL 1ZEAH 1DN2A 5L2JB 2XN9A 4HLZH 3BH8A 5TF0A 2AV7B 2BOCB 3BGFC 1G6VK 1DP0A 4NUGL 5IB3A 1IFHL 3KWWA 5K9JH 1IMHC 1BWWA 4XAKE 3D87B 3T4AA 1K8IA 3MNZA 2Y23A 3ET9F 1JRHI 1JHTA 3QIUD 4OFYD 5I1HL 1I3VA 3OZ9H 1A1OB 3U4EA 5E4IA 1SBBA 5BOPA 5IEKB 1AC6A 3O9WA 3WL9A 4UTBH 2A1WL 3GSNH 3IFLL 2QQQA 3MNVB 1IZJA 2C3VA 3IDNB 1ZLWH 4KUCD 4ZXBD 5D7JB 1HHKA 4YK4C 2XQBL 3KHOA 3MV01 1CG9A 1BFOA 5L88L 5JORA 3S36L 5GS0C 5L7XH 3STBA 4P5KB 4EUPG 5DEGA 5FYLH 4YBHA 2J1KA 1BIIB 1E27A 2MWCA 5B3JE 4I77H 5I17B 3JWOC 4GSDL 5IB5A 3QUYA 1WQVT 5C08A 3ILPB 4U49A 3RWGA 3V6ZA 5FOJA 4KK8D 1EUUA 4KMTH 3IDIA 1YC7A 4AT6B 1G7HA 5JOFB 4AQOA 2FX8H 3QDGD 1FZJA 2XI9A 3LRSA 1RZFH 4HT1H 2P1YA 2ZCKL 1DUYA 4Y19D 5BRZB 3DBXB 5F7NC 3NH7H 2F5BL 3LS4H 4MA3A 4OCRL 1FFPA 3VXQA 2QJDA 3DX7B 4WUUD 3BP6B 3RX5A 1S9XB 3NTCL 4NQDE 3QIWD 4JGUA 4I2XB 3QEQD 5DGQA 1RZIA 3IDYB 3O6LL 3CZFA 4PGCA 2RFXB 4ZUSB 3SE9L 1MUJB 1T66C 3M17B 1UM6H 4HGKC 2DI9A 5GJSH 1F6LL 3V6OE 1I9RL 4G8GA 1KB5H 3THML 3LEXB 1FGNL 2X4TA 4PPTA 3U0WL 3L1OL 1QUNA 5EZIH 2IBZY 5HD8D 3OKMA 2R15A 4LCIH 4MWFB 4LSRL 3BGAA 4LPTA 3O41A 3QFJB 2LAAA 2EXWD 3IDGA 3MLTB 5ICZA 2Z93A 5IFHH 3RGVC 4R90H 1R5IB 3BP5A 1U9KA 3D39D 4JPVL 2A77H 2Z8VC 4P5TA 4NBXB 4F58L 3EHBC 1EBAA 1OD9A 2IF7A 2C3GA 5LG1A 3T0EC 3HAEB 1CGWA 1O7VA 3RWEB 3GRWA 4GAYB 5GGTH 4IRSB 1F90H 1X5AA 4HXAL 2R4RL 3MLYL 1JNNL 4Q6YA 4R7DA 5I6XB 4XCYA 1CFSA 4YBQC 5J7CC 3C5SB 3G6JE 4IRJA 1UGNA 4P2RD 1A7OH 1A7PL 3G08A 4TSCL 3HS0B 1S3KL 1CGSL 4LAQH 2CMRL 4GW1B 1IGJB 1ITBB 1FNSH 8FABB 2YA1A 1GZQA 5IGXH 3MUHL 5T1KB 3KYOA 3LKNA 3MZGB 3RZWA 4ODBD 3RY4A 1SY6A 2MCPH 4RGND 1IC7H 5ITBL 1CICC 4PD4K 3F7YA 3CSYA 3FQUB 4HF5L 5E8OA 3SO3C 3HKFA 1RSFA 1XGTA 4YHMH 5F1KC 3EDDA 5DJ8B 1EUTA 4F80A 1PKQA 4HBQA 2BY2A 3IXTB 5EC2A 3QI9D 3U4BH 2X4UA 2X4RA 4WEMB 4M5ZL 1N6VA 4NFCA 1U8PB 3QISA 4QHKJ 5C1MB 1U8HB 3O6KL 4BFIB 5IT2L 1MFBL 4CVUA 2Y36H 3BZEB 4CN4A 3H3PH 3R06A 1J12A 1K6QH 4UT6L 2BHZA 5CGMA 1PQZB 4O2CB 4YE4L 3DV6A 5J89A 2NTFA 3E3QE 2IH1A 1VFAB 3QUMA 1JI1A 1T7ZA 3LQAC 4N8VB 3VXMD 25C8H 4JZNA 5K9KA 2PO6C 1AXSA 5FUCE 1F5WA 1ZHBB 3TPUB 4OF3A 3RTQD 1HQRB 3ARYA 1GZPA 1JNHA 4JHZA 1ZK9A 2R56L 5AUMA 5F3BA 1G7IB 2FB4L 2HKFH 1IGFH 4X6DE 4LAJH 5EN2B 2ED9A 3LIZL 3O3BA 1E4JA 4JANB 4NN6B 4CMHC 2O93L 3QXVA 1R3HB 4HIXL 2CRIA 3Q6FB 2V2XB 2ZPKL 1V3KA 1BBJB 1YPZF 5HHME 1DN0A 2NMSA 4HCRL 2FLBT 3CX5J 4DGYL 1N64H 2IJ0C 2AV1B 1OF2A 4C56E 4MD0A 9CGTA 4QOKE 3V5HB 3EKCA 4OZHB 4IJ3C 2YUVA 5MENE 4HJJH 3QNZB 5EUOB 1DEEA 1BLNA 5ISZB 3WFHB 1IC4L 1MHHB 4AEIH 5JW4Q 1BQSA 1FORL 3EOAB 2RQ8A 5DYOA 4C55A 3G6AA 5ACLA 4IEFB 4TTGA 1KCUH 1NGYB 2MCG1 5KJRH 1FYTE 4KZEL 5E2VH 1PSKH 3O3AA 1AD0B 5I18L 2BNQB 4PY7A 5KANG 5DJ0B 5GSRA 2CLRB 5SWZD 3D18B 3NZHH 2F5AL 2JCCB 5I8CA 3ULSB 5HHNB 1FC1A 2HFEA 1ZT4A 2R2BA 3DUUB 4KJWD 4HGMA 1EERB 3EUUA 3TO4B 2A6IA 1RULL 5D71H 1QO3A 4JKLA 2PXYD 4QWWD 3OJMB 3GIZH 5FV1L 3ROLA 1PYWA 2Z91B 4MCZA 1MHPH 2BXZA 3ULUF 3RUGE 3FQTB 4L3AA 2NY2B 4UOJA 1KF9B 4U6YB 2EDRA 3X14B 3MXWL 4YHIB 2HH0H 1EVTC 5EB9A 3G6DL 3JUZA 1IM9B 4F9PA 1FNEA 3IDMA 5HI5D 4MDJA 2J12B 1FDLH 1AGDB 2J4WH 3VXPB 1WZKA 4K7PY 4I0PB 3VFRB 5IVOA 3TIEA 1CBVH 4ZTOH 3V6FB 5DJCA 4QXUL 1LO2H 5I76A 4GBXC 5D1XC 4GKOA 2XZQH 5FYLE 1IGCL 4M5YH 5IHZA 3SDXE 3BWAB 5L2KB 1U8KB 1C5DB 1H3WM 1XEDA 2F8OA 4K23L 4LEXH 4GXVH 3EDJA 4NO0D 3KYMB 2BJMH 4LRNL 4X4ZA 5BVPH 4BZ1L 3QFDA 4HWUA 2NXZB 3VXOB 5IB4A 2NYYD 1OAXH 1VEOA 3GSXB 3TC9A 5F1IB 4Y2OA 4YAQA 4YNYB 3V9FA 3QJFB 1LWRA 3FRUB 4BSWB 1DQQB 1KJMB 1MJ7H 3U1SH 4ELME 3MUY1 1KIQB 3WEXB 3H9HB 2CXKA 5FGRA 2IFGA 4XAWH 2Z31B 2FLRT 5D93B 3VRJA 4Y5VB 4G7VL 2A2QT 1KN4L 3NMEA 5FA4B 4UAOB 1GGCH 3V7AG 2AK1H 4U6HA 2HT2C 1GSMA 1B4RA 4HIEA 4CW1A 4X4YB 1TQBB 3NCFB 5B4MC 3ZE1E 3S5LA 1D7FA 1SYSA 3NCCB 1FH5H 4O58H 4XMPL 3BD3A 5HHQB 1I4FA 1F97A 2V5MA 4HIJA 2R4SH 4U05A 1TCMA 1NC2A 2XA8H 4BFBD 1D6EB 4WWID 3QHZH 1Z2KA 5C0IB 5AYUH 4QHUA 3MV9B 1KN2H 4V1DA 4XCNA 4YHYB 4OKVB 1X7QB 4XH2B 2ZUXA 2WM0A 2GTWB 3W39B 1QFOA 1HQ4B 5FCUL 4RFNC 3UBXB 5EOQH 5C2BH 4N0UE 3FAWA 4BJLA 5J12C 5IEHA 4P46B 5DD6A 3OGCB 5GGSA 2CR6A 1PX3A 5J6HA 3FMGH 3GO1L 3WXWL 4C58B 3VWJA 2O61B 4NN7C 5EUOF 1I1FA 1GPOH 1KCVL 7FABH 3E2HC 5GRJH 2GSIA 2JJTA 1NAKL 1WTLA 3PL6B 1ZA6A 2XWJB 4WUKH 1K3ZA 4NNYA 5KSVA 1RZ7L 3GKWL 1PG7X 2YOCA 3P4NA 4ZNCD 1ZHLA 2FWOA 4EEEA 5FYKU 2CIKA 4Q2ZB 1CD0A 2GK0A 2O26U 1FO0L 1Q72L 3L95A 1A4KB 5GIRA 3A6CH 3FT3A 1I3UA 4POZC 3T4YA 2B7DT 2ZSVA 1TPXC 4PJAE 4UINL 3X3FL 4KK9D 2C1PA 1CVSC 2OJEA 3WDHA 1A5FL 3DIFB 4LCUB 5FO9B 4WFHE 3O8XC 4D0BB 3OR6A 5ERWA 3TA3C 2HA1A 4HK0A 4XVSH 4F3FA 1XF4B 2NY4D 1XCQB 4L4VB 4LPYA 2RIKA 3GMMA 5DMKA 1VB9A 3SJVA 5BJTB 3RPIB 1QLEH 1YEIH 2CDFB 3MRRB 1BJ8A 1I7RB 1MHCB 4JO3H 4LLMB 5EIVA 3QEGL 2WIMA 4KI5F 5HDLA 4TUOA 3DO7A 1IRAY 1SEQH 3MRNB 4M1GH 4YHKH 2AK4E 1CE6A 2IAMC 1GJIA 4JFDB 2ZCLL 5GISH 2DJSA 1OY3B 2G5RA 3VFMA 2MKWA 4KWUA 3TBSA 3BPOC 2VOTA 4X9GA 1FFOB 1CD8A 2BY3A 3MBXH 4W81A 4PGEA 5DK2B 4WDIA 2AXFA 2FGZA 4LVNC 3CLFL 4QHNA 2VN4A 5ICXB 2CJUH 5EWIH 5T1LD 3UJTH 1DVFB 2C9AA 5E03A 4OGYH 3QUXB 4ZTPH 4Y4FD 4MAYD 4NZRH 3GSOA 5IVXE 4LMQE 4NKDB 3F6LA 3LZFL 1IQDA 3F65A 3O4LB 1YYML 5D7IA 5BQ7A 1BD2A 4WTWA 4LVHC 2DQUH 4CKVX 4O4YH 3VFOB 2NXYC 4MA1C 4Y1AA 3HZVA 1UM5H 2R0WL 4G5ZL 3T8XA 3KPMA 4OJFH 4OLWL 3UTZA 4XPFH 2ZUQB 4KV5E 2Z92A 4LP5A 1C1EH 4TSBH 1OB1B 5TDNB 1CFVL 4JM2C 4LKXB 3TVMD 1FSKB 1IAIH 4XB8A 5HYJA 2CLVB 2VXTL 1INDL 1TVHB 5HHMD 3BD5A 1T6WA 2YA0A 1QSFB 3BQUA 4R6UA 3CH1B 1QPPA 4BM7A 4E9LA 1U8QA 5TPWL 4C56D 4O5LH 1P4BL 4QOKD 4PJ7E 4H5SB 3K1KC 5MEND 4M03A 1KULA 4Y16A 1HNFA 1M7DA 2IQAB 2YPVL 4UT7L 4CADA 5HDBE 3UJJL 4JKMA 2CUMA 3I6GB 1MPAH 1FO0B 1NGPL 3W0WA 3NIDE 1FYTD 3LQZB 1IEAB 4GW4B 4QHLB 4U1JA 4LCWA 2HT3D 1GIGH 4JM4L 4NO5B 1KXQE 1KJ2A 5I1DA 5F6HI 3W11C 4X7FC 1QSEA 4Z7VA 5F1OB 4NUGH 1UQSA 5IOPA 2W9EL 3H9ZA 1IFHH 4PJIB 5D1QD 1HNGA 1GGBL 2VZTA 2CRZA 5FYJL 3QXAA 3I3EA 1I1AB 4WO4B 1MF2L 3OR7B 2UVFA 4WNQA 1TQCB 3KG5A 3S37L 2PYFA 4EXPX 3BGFB 3IXAA 4OZFA 5I1HH 1DTUA 4M7ZC 3RHWF 1MVFA 1ONQB 1T04B 2ARJA 2F54B 5D1ZB 2A1WH 5TH2B 2LV4A 3IFLH 1H8NA 1N2RB 3T0AA 2R29L 2WQ8A 5T1MA 4QRRB 4NRYB 3QCUL 4UDUA 5L88H 3S36H 3EYQC 5CIPA 2HYMA 4RAVA 4M3JA 4HIIA 3ARED 1ZA3A 3HCVB 2D7PA 5CLTA 3HC4L 3OWEA 3HI5L 1B2WL 3NA9L 3H9YA 3VXRE 4ETQB 3SE3C 4APQC 4MNGB 5IQ7L 1J0IA 4GSDH 4XZUB 5FYLD 2AP2A 5I1LB 1W0VB 3ARBA 3DSNA 4NC1C 4QYOB 1M6OA 4GKSB 4ZYKB 3SDDA 3ZE0F 4DUXA 3WJJC 1T80A 3NCMA 3ROOB 4QLRA 1G9EA 2FHFA 1JUFB 3T2QA 2ZCKH 3T0EA 3J8F7 4JFHE 3PHSA 1KIRA 3ZDYF 1YUHA 3GMPA 2IANA 1T89C 2VZ3A 4BH8A 4WGVB 2F5BH 1A9EB 1J11A 2BMKA 1JFQL 4OCRH 1D5MB 4PJGB 3D85D 3ARWA 2QR0A 4J3OC 4PJ9C 5F9AC 2LU4A 5DVNA 4D2NA 1TZHB 3DETD 3NTCH 4KXZI 1S7RA 2XKNB 1GRWA 3NGBB 2RJMA 2PTTB 1XIWA 3O6LH 1F3RB 3SO5A 3B2VL 5JW5B 2QHLA 4BQ6A 4U1MB 3SE9H 3K4DA 3GMQA 4U33A 3SDAB 1BQUA 1L0XA 3L6FA 1I9RH 3THMH 5BMFL 1EEZA 2VLJE 4NDMB 2QSCL 1FGNH 1FJ1B 1BOGB 3VD4A 3U0WH 3L1OH 4X6CF 5BZDA 3P11L 2FH8A 1JJUA 1CICA 5CEXA 1IARB 3W9EA 1G0YR 1HH6B 2PYEE 3BUYA 5F6IB 4LSRH 1IBGL 3GBLA 5JOPD 1TIUA 3BZFB 3PE9A 4X98A 2HKHL 4OUUB 5IIEB 3VRLE 1IGTB 3ZDZE 3KPNA 2R8SL 1JV5A 1JRHL 1NLDL 3IS1X 4M4RA 4K94C 4HWBL 4OZIE 5K33A 2AXJA 5D8JL 4R3SB 4JPVH 1ZLWK 1TCRA 3HZKA 5H2BA 2A0LC 4F58H 1NBZA 5D7SL 5CD3B 5GHWL 3RWIB 3KLHD 5DI8A 3MRJB 4JFXB 4LLQA 4MVBD 5DHVH 1X5JA 3QHFL 4KJQC 4PJEB 3RGVB 3WLWD 4N1HB 3BMVA 1I7TB 1ZWIA 4OV5B 1CXKA 1NUFA 2V9TA 3O3EB 3CFKB 3IFOB 4PJ8A 5ITFA 3PWVA 4HXAH 4M3KB 2R4RH 3MLYH 1JNNH 1YMMA 2Q76B 3BUTA 4MS8D 3VGFA 1ORQB 1S7UB 3D69B 4FFWC 5EC1B 1A7PH 1IKFL 4U7MA 4TSCH 3UTSE 3C09C 1S3KH 1CGSH 3QDMB 1ZANL 2CMRH 3R4DA 1KTKE 4Y88A 4HGWA 3BHBB 1I8KA 4KZDL 1NBQA 5EBLB 4K3JL 3EDKA 2GKIA 4X9BA 2DLFL 1AO7A 4H0GA 3RBSA 3V0VA 3KR3L 2J88L 1GC1L 1U91A 4RQQA 5ITBH 3B5TA 4HUWA 2DQCL 1VACA 5IQ9A 3U30C 3CK0L 4UDTB 4HF5H 2W60B 3VWKD 1RJZA 4EI6A 4RFEB 5E8PA 4WFHD 2YD6A 5I71B 4Z7UB 1NC4B 1NQBA 3UAJC 3IDUA 2BHYA 3ES6A 1I75A 4JVUA 4ORZC 4FTVB 5GJTL 5M7QA 1NSNL 5JW4N 1P5UA 3VG9B 5JIIA 1BZ7A 3O6KH 5IT2H 1MFBH 2PTVA 1VSCA 5F7DB 1T3FA 3GDBA 4UT6H 2DQTL 4P5MB 4YE4H 4M7LL 2AK4D 1G1CA 2IPUG 3B4NA 5CSBA 4IMKC 4PRBA 4JRXB 3CFDA 4JR9L 3G9AB 1H5BB 4JCMA 3TIDB 1CLCA 3MFFB 2R56H 4Y2DB 1MCNA 2FB4H 3S3PA 4NC0B 4XC1L 3VH8B 3LIZH 2CDEA 1MHEB 4HIXH 4PLJC 1UVQB 2ZPKH 4X7SL 3WHE0 3F62A 1WTGT 5ENWB 3GI8H 4HCRH 4I2XE 4FNLL 1CDGA 5EG6C 3BX7C 4DGYH 4DFHA 1JGEB 4XXDA 4EDXB 4PJGF 4L4TB 4NJAL 1HHGB 3VGAC 1TJHL 3IU4L 3IT8D 3I85A 2LU3A 3VGDA 4M00A 1IC4H 1F42A 3CCHB 3BKJL 3HE7C 2MQ0A 4KKCC 5FO7A 4PIRF 4X7EC 5CZXD 3MYZA 1B6UA 1CU4L 4L8CB 4OZFG 4KZEH 3BO8B 1S7SB 5IMLB 3SGEH 3MV11 3TPKA 5I18H 2HN7A 4I0KA 3QFJE 3UPRA 3CFCL 2XTJB 1JPGA 1UH3A 2F5AH 1EDQA 4GXUN 4X6BA 1KEGL 2JE8A 4M8QA 1WFNA 3S4SA 4LHUD 2BVUA 1EJOL 1RULH 4OD3L 4PRNB 1GYAA 1KYOJ 2OMBA 2OL3L 4NO3A 1EX0A 2VB5A 5CP3H 4DVRL 4ZO8A 1N7ML 1EGJL 3TBTB 5CMAA 1ZT1B 1AKJD 3GHBL 1T1ZB 3MXWH 1SJVA 1U8MB 2APTA 2QQNL 3B9KC 4KH2A 3MJ9A 2VISA 4PY8J 3G6DH 4PJXA 4LF3A 1P84K 1KT2A 4HKJA 15C8L 4OFKA 3CUPB 3HNVL 4PJEF 3TN0A 43CAB 4NRZA 4KKBD 2I25N 4O2EB 5T3ZL 2YC1A 3QNYA 5C09B 43C9A 3CDCA 3ZTJH 2X9WA 3DX6B 4KGJA 5I75C 3D1MC 2Q1EA 4QXUH 2YD3A 4W6YB 3MR9A 5DA0B 1IGCH 2YD9A 3DJ9A 3RI5F 4H0HB 5KBNC 2Z8RA 1HCVA 3WS3B 1FQ9C 5DQ9B 1PVHA 3ARDD 4N1CA 4K23H 2FJGB 3OKOB 5F1SA 1V5JA 3WIHL 5E94A 4FFYL 4LRNH 2WZPD 1HYSD 4BZ1H 4AY0A 3MJGX 3GJFA 3LDBB 3UZEA 1HSBA 4X6EA 4PG2C 3T2OA 2XFXB 3SEPA 5I9QB 4XXCC 3ZKMC 2UUDH 4Z7UF 3WO4B 2W65A 4I9WE 4R7NA 4I0CC 3VXRD 4OM0L 5ABDE 2VSDA 1MCSA 2WBJA 2KQNA 3V8CA