3HZVB

Crystal structure of s73-2 antibody in complex with antigen kdo(2.8)kdo(2.4)kdo
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
220
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLAFIRNKAKGYTTEYSSSVKGRFTISRDNSQSFLYLQMNTLRAEDSATYYCARDINPGSDGYYDALDYWGQGTSVTVSRAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S73-2 Fab (IgG1k) light chain
publication title Antibodies raised against chlamydial lipopolysaccharide antigens reveal convergence in germline gene usage and differential epitope recognition
pubmed doi rcsb
total genus 42
structure length 220
sequence length 226
ec nomenclature
pdb deposition date 2009-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzvB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzvB01
5I6XB 4PJCB 4WW1A 2JE8A 4R0LA 3K3QA 4WDIB 3GSOA 1JF1A 5DVOA 4BSVA 1XGTB 3V7AG 4LSPH 1FNEA 4IJ3B 3BKMH 5IMLA 1JK8A 4XH2A 4JGJA 4OF3A 4MDJB 4XAKE 5FKPB 3QRGL 4V1DA 5D9SB 5EO9B 3GKWL 1RU9H 1LDPL 3SN6N 3RWIB 1MAML 2IH1A 1UJ3A 5C0BE 1YEFL 3MRBA 4F7MA 4PJ7A 4QEGA 3S35H 2BNQA 2V2WB 2X4PA 4MJIE 5H2BA 3OJMB 4U49A 5ICXA 1LO0L 3KPQA 4WFGE 5E8EA 2KKQA 1WWBX 5F89B 4KDTA 5I17A 2E9JA 3LAFA 5DEGA 1IFHL 5IP4A 4NN5C 4H88H 3RGVC 4X6DE 2ENYA 5DFWH 2BSRB 1ZWIA 5C07B 1NGYA 3DMMC 1XZ0A 1WF5A 1U8OB 2NTSP 4OIIL 5E8NA 4W4OA 5GIRA 3SJVE 2DJUA 2FJGA 1MFEL 1D9KB 3LV3B 4HS8H 3A6CL 5GGRY 3B9DA 3STLA 5IB4B 4WGVB 3K8LA 1JGDB 1U3YA 5B39B 4PY8J 5FOBB 3VRLF 1U0QA 3CFIC 4L4VA 4H25A 3SGEH 4PGZA 3HLAA 3SDCA 4DVRL 3SDXF 3HI5L 4XPBL 5F9OL 3RTQA 4YFLF 1DUZA 4IRSB 1OARH 5EO9A 3RUGE 3DX8B 3BHBA 2IQ9L 4X98A 2DQIL 3TVMB 3L7FB 2GJZA 1FYHB 3LRSA 4NRXA 3THMH 2OLDA 4IDLA 3AGVA 1U8HB 1TJIH 4CU8A 3LQAH 5GGQL 1FPTL 1IGCL 1KEMH 3BZEA 3CGTA 3OTTA 3W0WA 5IV2A 3PV7A 1IT9H 2D9CA 3LN5A 4JFEB 4M6OL 2Y23A 4PB0H 1U58A 5KJRH 4WHYH 1JIBA 5DVNA 1HINL 1KC5L 4XVSH 5IHBA 1A1NA 2A2QT 4JFQA 1F4HA 2IEPA 4AH2B 4TOYL 3G5VB 4ISVA 4KHXL 4PBWD 1RZKL 1V7NH 3MRKB 1U42A 1X5ZA 4FQ1H 1E28B 3EDKA 2F8VA 1DE4B 1JMXA 3OKNA 4LLQB 1JGDA 5DZLA 1QLEH 3SKOB 1P7KB 3ZHKA 2BERA 4ODSL 3VGBA 2CMRL 4YWGL 2GTWA 2NW2B 1ETZA 4WIQA 1TENA 2OK0H 3D69A 4EXKA 4UMGA 4WY7L 4O2FA 1YN6A 1QKZH 1Q1JL 2ZUTA 4PJAE 4PRDB 4P2RD 2Y9RT 3QUXC 3MLYL 1UCBH 4ZFOL 3P77A 4Y4HC 1KTLA 1QUNA 3MLVH 5A3IC 3K2UH 2ZSVA 4E0RA 5F21B 1E6JH 1HKLH 2ICCA 3O6FC 1YY9D 2C3VA 4XPHH 3HI6H 4MXWH 1BJ8A 3KJ6H 3SKUD 3T0AA 1FL6B 1FYTE 4KTYA 2LV4A 5L6YL 5JW5A 1E4KA 3KXFB 3IDUA 2IBGA 2I24N 1G7MA 2M2DA 4NZJA 4WWKA 1A6ZB 4WHDA 1CXFA 1K8DB 1ZLWH 3CSGA 1QQDB 5IBUG 4P9HC 4JVWA 2V17L 5C6PB 5JW3H 5D2LB 5FO7B 1A7RH 4ZUWA 5GGSB 5HGBB 3I75B 4BKLA 2IFFL 5I1AA 2NW2A 3TT3H 4YHLL 4HBQA 2VC2H 3U30B 2FJFA 4WI3A 5L0QB 1QFHA 4IDJH 2H32H 1E4WL 3QYCA 5CLWA 4S1DD 1T4KA 3ARGD 4L1DA 3L3KB 1H3UA 3H9SA 1IILE 2BX5A 1IC7L 5B3JE 2HJFB 4EI6A 2CKNA 1OAXL 1OGAE 4NZUH 3O6ML 1VDGA 3JWOH 1FZMB 3IFNL 1EGJL 4G9FA 1U3ZA 1BLNB 2AP2A 4ZS7L 3WFEL 5T33L 1DQDH 4I2XE 3MNVB 1S3KL 2W65B 1GHFL 1GPOH 5FYJE 5JHLL 4OZGA 3L3GA 5GJSH 3V5KA 4WO4D 4HUUB 4RBPK 1A7OL 3RWFA 1OTUC 1FDLH 3G04A 4HPYH 1A4JB 3DXAA 4NT6A 2EDXA 4H8WH 4UDUA 3H9YA 5CJQL 3WXWH 2YOCA 3GO1H 1K8IB 1JF5A 5GGVH 3BDYH 3T0EC 4N0YL 1AGEB 4MSWB 3DHJA 4OFDA 4JFHE 4GXVL 5DJCB 3CFEA 1AGDA 5DJZB 1YEDA 1EFQA 3QCUL 1FGNH 4UNVA 4DCQA 1PZUB 2R1YB 1A6AA 3MCG1 3KPLA 3NCYP 3CX2A 4GAFB 4P2CG 3KWWA 5ITBL 1VKXB 4MAUH 3G6JA 1T2XA 4GG8A 2ZUWA 4UB0H 1CXHA 1QSVA 5D72H 3RGVB 1UB6B 3GSNL 3SPVA 3GJEA 3V0WH 2FEEI 4Y4FA 1WWWX 5FOJA 5E9DD 5IMMB 5D1QA 4BYHA 2NY0D 5HHNA 3P0GB 1U2HA 5C0DA 2CK0L 4P3WA 4QWWC 5HXMA 1VPOL 2P45B 5FUCC 1MJUL 3AS2A 4HWUA 4RWHA 3BN9C 4ZS6D 3WNLA 2H6PB 3HNVL 3JV5A 3O6LH 5E7BA 1JPSL 5HHXH 3PXJA 2AKRB 3RZWA 1AP2B 4UINH 3S3JA 1YZZA 1IMHC 4Y19B 5TE7H 3I02A 5EIIA 3AROA 2K3TA 2WWKO 3BXNA 4KTDH 4GRMB 2F74A 3PF2A 2F54B 4PJXE 3UTSD 4YIQA 3NZ8A 1K8IA 3RAJL 4GW5B 3V6FB 2EZ0D 4FMFA 5GRVK 4JY6A 1MREL 3N1QC 4POZC 1PG7X 4JLRB 3HPLA 3DGGA 2IQAA 4TVPH 1F97A 4YNYB 1VENA 3OX8B 1AXSA 3N85H 2N4IA 1I3VA 1M7DA 3MLWL 1U3HC 4KKAD 4IOSD 3VFTA 3FRUA 3RGVA 3B6SA 1XCTB 2VLJE 4FQ2L 3C60C 5E99H 5FUOL 5TQ2L 3DMMA 2DN7A 5IF0A 3Q6FA 5SWZB 4EN3C 3MODH 1ZLSL 4Q9RL 3AM8C 5D6DC 1ACYL 4K7FA 4L5FH 4BK4A 2NZIA 1H3TA 1FJ1B 4MQTB 3QI9C 4OI9A 2NZ9C 4N1CA 3FFCB 5KVGH 1AP2A 3VDBA 1HH6B 1QNZH 4M1DL 2HLAB 3FO1B 2BNRD 4UI2A 3F7YA 5CBAA 5B3NA 4XMLL 1D5ZB 4ZSOB 4LCWB 1G9EA 2O5YL 5D2NC 5DRNB 4APQD 1G7PB 1NDMB 4ELKB 2BK8A 4L8CA 3MV11 3S96B 4UV7L 5CGYD 4N0FB 3IXAB 4MX7A 4U6VH 1H0DA 3CCHA 4K3JH 3B4NA 3VXSD 4TNVK 3PQYB 1EFXB 2YA2A 1CICC 4L29A 1WAAE 4HKXB 3D39D 1AGBB 3SDXB 3MYJB 1TCRA 5KSAB 2Y36H 1NGXA 3WCYA 1IAOA 1FSKC 1QTYT 3KPSA 2V6HA 5BS0A 4YPGA 4WVRA 2RAMA 3OAZH 3H9ZA 2ESVA 1XIWB 1OP3K 2OQJB 5HVHC 5DR5L 1MCHA 4HPOL 4O4YL 5E24E 4MCZA 3G9AB 2A74B 3DYMA 1HZHH 4Z8FH 3GSQA 5F3HB 4PJ5D 1G7HB 4W81A 1H3PH 3DSFL 3QXVA 5GS2H 3U4EA 1MJ7L 3ARFC 2ARWA 3MR9B 2ZOKB 4LLUB 2EIDA 1DBAH 4DN3H 3KHQA 3NIGF 3QUXA 4IRZL 4X9IA 5D70H 5K93A 4Y4HA 4QCIA 4LLAA 3FB8A 4IMLA 5CIPA 4UQ2B 2HFGH 3HR6A 2DS4A 2DYPB 3S96A 5DLML 5GZND 4HWEH 3ZTJG 1RZ7H 3O6FA 4AL8H 3IDJB 4HSQA 2IMMA 5JORA 4J8RA 1MRFL 3QA3B 4EOWH 4GQ9H 4I77L 5EUKB 3AVEA 4UT6L 3WLBA 1DVFD 4W6XB 5EU6A 4WUUB 5C2BL 2BJMH 4HKXA 2DAVA 2P5WE 3OXSA 4MNQD 3L3JB 4GKOA 2C1PB 2P43B 2RJMA 4S10A 3VFMA 1A1MB 2XRAL 4JDTL 2C7UA 4LHUB 1P7QA 4DGVL 3HC0A 5DFVD 3EYSH 3VXRA 4J3UA 3GMMA 4C4KT 2VUYA 4HZLA 3PWUA 3V5DA 1Q0XH 4JO1H 3DRQA 5SV4A 3QJHA 4X99B 4ZNCD 3JWNC 4XZUA 2AABL 5EC1A 2GFBB 5E6IB 1GOHA 1QVOB 4HCRL 1GOGA 1OCWL 3CUPB 3ZTNL 5C92A 4X83A 3CAFA 4LAJH 1N59B 3QSKB 3MRPA 2M26A 1IC5H 2N1KA 3CVIL 3IETB 2CLZA 1D5XA 5C09E 3SKNA 4BZYA 1RJLA 4DZBA 4ODTH 4MS8D 3UBXB 2A83B 4U6YA 3EO0B 2IH3B 2H3NB 3BPOC 4XNZC 2J8UE 5C0AE 3VFGH 4AT6B 5IB3B 2DLHA 3IDJA 4Q0XL 5CSGA 4KZDL 4EQ3A 5LJYH 4NZRH 3HG1E 2AV1B 3GK8L 3AUVA 1B4JL 3UDWC 4WUUA 4LEXH 4P9MH 4TUOA 5BRZB 1YEGL 3QNXA 2R4SL 2GTZA 2HWZH 3RWHB 2O5ZL 4C57C 2J7LA 5FYJU 1SJHB 1LILA 4JFDD 4LAQL 3VMPA 2VSCA 1RZJL 1SY6H 4KQ4H 2A6KB 4W6WB 4X9FA 5IGXL 4LBEB 4QY8A 4CW1B 2WANA 1A9EB 3T0EA 2OSLB 2ZNWA 3AFLA 5EOQL 5I76A 2QR0A 2ADIA 1MFBH 3LHPL 5DJ2A 4PUBL 2EDKA 3OXRA 4ESKA 4GG6E 5JO5B 2VH5H 4ERSL 4N9GB 3G6DH 2R0LL 2AI0H 2HJKB 2A83A 5DD3H 3V5HA 1IGYA 4LCIH 4D3CH 1WICA 2PF6A 4FQJH 3RHWF 5IB3A 4G6AD 1ZLVK 1CQKA 2FJHB 4HFUL 5FDWA 1HOCA 4IS6A 3LKOB 5EBLA 3MRIA 2JJWA 2E8YA 1T2JA 4YX2L 4ODBD 2RIKA 3NGBB 4ODHH 1A5FL 2QKIB 3FT3A 4KVCH 5BRZA 3W5NA 3BSZH 1QSEB 3HC4L 5HTSA 2DKUA 4Z0BH 1MRCL 3O4OC 4RA3A 4M7KL 1ZKAA 2FECI 4YBLC 4PB9H 1AKJB 1I1RA 2AQ2A 2UWEE 4LVOC 4KK9D 1I4FA 4LBEA 5J13C 4X4XB 3FO0H 1PD6A 3GHBH 3UXFA 3MRJB 1LDSA 3R06A 4DTGL 3TESA 5JLZB 5DQJB 2V5SA 3RWDA 3VFWA 1GZQA 1RZGA 4X80L 5DTFA 3EUUA 3NCMA 1LP9E 4EUPA 1CN4A 4OD3H 4NRZB 5D7IA 4K3EL 2ERJB 1U3HA 1BJ1J 2P8MB 4DVBA 3ULUF 5J1AA 1UACH 3C60A 2XN9E 2FEEL 1FSKB 2P7TA 15C8L 5GRYA 3IVKA 5F3BB 2W60B 1QHOA 4JFZH 4RGNE 5T5NF 5JHDB 5HVHB 1E4XH 1YMHB 3K46A 1TLKA 3FB7B 3GSUB 4EN3A 3AM8A 4OCMC 1RUKL 2KQNA 5HYSA 2NQCA 1YY9C 3T3MF 1VACB 1S7SA 3F7VB 1ZGLA 1FRGL 4NO5B 3QI9A 2V9TA 3IFLL 5TQ0L 5J56B 3BPCA 4TSCL 4UNUA 5HVGB 1GXEA 3QDMB 4BQCA 1P84J 3EO1B 5D2NA 3QQNA 4P59L 3C8KB 5E2VL 4BA8A 5BMFL 5CUSH 1SYVA 1DBKL 1YJDH 5HYFA 3QDGE 4NJ9H 3MRMA 3R0NA 3KYKH 3C87A 1RHHA 4Q74A 1GYAA 1BX2A 5L2KB 5EOCJ 4LFHG 3VFOA 1WK0A 1WGOA 5L7XH 1CICA 3N9GL 5J9PA 1EH9A 2H2PD 4JZOB 3MCLL 2IF7A 4U7KA 4XAKD 3VFNB 1HCFX 3SDYL 3O45B 4Z0XA 4HZAA 5C0BD 1DLFH 2V7HA 1MH5B 2EKSB 5J12C 5HYJE 4S1DC 3ZDZF 2XWTA 5ID0A 3ARTA 3MOQA 3ARGC 4F80A 5IB2A 3OKEA 4U0QB 4PG2C 1HHGA 1KENH 3LEYL 4K07A 5DRWB 4M6NL 2CGRL 2E27L 3ARFA 1YEJL 4X0KA 4PJ7F 1BWMA 1I85C 5F1NB 3CDYA 2F9BT 4LGSB 1CFVL 3SJVD 4YXLL 3DJ9A 3O2DL 4S11A 2FB4H 2OJZH 1KYOJ 4WO4C 3OKYA 1ED3B 3UZEA 4LSUL 3UTQA 2IG2L 3DV4B 3HNTH 3WD5H 3V79C 4X4ME 4K9EL 2A1WL 4PPTA 4GKZB 3EKCA 5AG9A 3ARRA 5ICZB 12E8L 3MLRH 4ONHB 1D3CA 1RHFA 5SX5H 5T1MA 4NGHH 3GSVA 3WFBH 3KPNA 1I8LC 4RAHA 5C9JA 3VH8G 3PGCB 4CMMA 3W9EA 4PRPA 3EO9H 2Q20A 3MBED 1HIMH 4N5ED 1WLHA 4JQVC 4WU7A 2EYRB 2AJUL 1WUNT 2UV3A 5ISZD 3U4AA 3O3DB 3G5XB 4ZQKB 1QPPA 4M5YH 1FNSL 1X5HA 4NHUB 3DVFA 3SE8H 1MJJB 3F58H 2NY0C 5IVXA 3QHTC 4KK5D 4OFYA 4TSBL 3PWJB 3ALWA 1NFIB 2VWEE 1NBZA 4ZS6C 4Z7VE 4MVBD 2IBZX 1I1YB 5GXBB 4PJIE 5F7EH 4DW2L 4HEPG 1N5AA 1KJ2H 5FECB 4HXAL 4GW1B 4TUJA 1PG7L 1C08B 1MSPA 5GSVB 3QXDB 5TE6H 1UVQB 4DFIA 3C6LD 4XCFL 5ICZA 5ALBH 3LPWA 2EZ0C 3IU3B 1DZBA 5DRZB 3UDWA 1T20A 4OSUH 4FQLH 7FABL 2YPKB 3ARXA 3D18A 4OCYH 1WZ1L 3S3PA 3ARSA 1DBML 1KJ2B 4KHTL 4OD2A 1JGVH 2V5TA 3BW9A 3KYAA 4OV5A 4YBLB 1MCWM 1HXMA 4IIQC 1A6PA 2X1WL 4Z5RB 1JWSA 3VGGA 1GGYA 2GJ6E 1J8HD 2ADJB 1KT2A 1N64L 2EEAA 5FUZL 1FYTD 1V3JA 3QUML 4H5SB 3GMQA 4XC3H 1NGPH 4LU5H 2OI9C 1ORQB 1UXSA 3PWNA 1FLRL 3MJGX 5SWSE 3KJ4B 4DUWA 1OWRM 5IFAL 1UEYA 4Z6AT 2EE2A 1EJ6A 5J57B 1TVHB 3X14A 3HMXL 3QNYA 3QDJB 3HN3A 2FIKB 2OP4L 1B2WH 4A6YA 2BDNH 4IOFD 1DQJB 3REWB 4APQC 1HYRC 1J0KA 4NM8L 3IS1X 3IU3A 4OD1H 5CGYC 1A02N 1JGUH 5DRZA 1LD9A 3LH2H 5F6HJ 5DC4B 5F7LB 4R4ND 1BFSA 3E8UH 3QIUC 1NCUA 1UB5A 1S7TB 3F65A 4PJDA 4WTZG 5J1TC 4JRYD 4U33A 1IC1A 4PJBE 5F7HA 3IJSA 4KDVA 5D8JH 3IAGC 1UENA 5DJ6B 3P0YH 4MDIA 2VDLL 3U36B 5FHBH 1U91B 2CKBL 2E6PA 4M8QA 5SV3A 4OUOA 2JELH 5EBWA 1ND0A 3OR7B 5DHVA 4JY4B 3WSQL 2ZUSA 4QYOB 1CDIA 2LFGA 2QSVA 2XTJE 4QHMA 4Z7NF 8FABB 4HKZB 5IHLB 1CS6A 2V5YA 2Z93A 4AQ1B 4JM4L 2C5DC 2W59A 1FH5H 1MCQA 3GB7B 4HX1B 3D25A 4P2RA 1U8NB 3UJIH 1ZV5A 3ULUH 3DHMA 5J12B 3Q2CA 4LCCB 1L7IH 1F3RB 2HH0H 4N0RA 3QJFA 3ZYZA 1JHTB 5T3ZE 4KI5F 1MJ8L 1M7IA 2BSTA 1W2KT 5GZNC 5DGQA 1EHAA 1KXVC 2Z0BA 3WN5B 4RMTA 1ZHBA 1CR9L 3NFSL 4OGAD 1DVFC 2DWEA 4JFYA 4Q9QH 3MNWB 2FECL 1SHMA 2B2XH 4TTGA 3BE1H 1INQB 2P47B 4L4TB 3OJDA 5INCA 4K2UH 3T77A 3TBTB 4JPWL 5JPNA 1UM5L 3IF1A 4MNGA 1F4AA 2IPUG 3G6JF 2IGFL 2RGSA 1INDL 4PJHB 1CFBA 1PGRB 5DT1L 4TSAH 1Z0MA 1CLOL 3H7LA 4RAUB 3BZ4B 4R7DA 2J1KA 4G8EB 1G9NC 1KGCE 4K7PX 2Z91A 4Y5YB 5LAXB 1S7WB 1BBDL 5C1MB 4ETQB 3MRNB 3ULSA 3V0VB 3TO2A 5DD6A 5C70A 5T1LB 2X1PA 1EZVX 1KEGH 5DFTA 1FGVL 1NH6A 4OGXL 5FCUH 3SE4C 1PSKL 5I74C 4LSPL 2D9QB 1URLA 1NQBA 4KJYB 4MS8C 3BKML 4PP1C 4PRAB 5GQBA 3ARGA 3HFMH 1MFCL 3U0TA 5FA4B 3JV4A 4PG2A 5C3LD 3HRZA 3P0VH 1MCCA 2Z31B 3C5SB 3QH3A 3PHQA 3UTTD 3ILPA 4AENA 3S35L 3ZDXE 1I85A 2CRIA 2R1XB 3RWEB 1HI6B 1JNHA 1NGWA 2VLJD 1KB9J 2ZCKH 3B5HA 4GXUN 1TJHH 3PWPB 2V7NA 4XP4H 5BZDA 4WO4A 4GUPB 1IVLA 1T5XB 2DM4A 1QBMH 3NMEA 3P9WB 4KI1A 4XTRD 2OXHA 5F7KC 2VRAA 2Q86A 3KPPB 4H88L 1JWUA 5C7XH 1FNAA 3S9DB 4JR9L 1CL7L 5FO9A 2VLRE 3P4NA 3UTSB 4LSQH 4B7LA 3UCRA 3ZYOA 3QRFM 2PYEE 3EOAB 1BAFL 4ETQA 3MFGB 4HS8L 3LKNB 4NQED 3BZFA 2FLBT 1QSFB 4L9LB 2GSIA 4RAVB 1I8LA 1F6LL 1BIIA 3T2NL 4Z95H 4M93C 2GSGB 3V4PH 4ZOBA 3EYVA 2EDYA 2PTUA 3QG7H 4JQVA 1CD0A 2XWBA 4KJQD 3QIWD 5EU4A 4HIHB 5HGGS 4MCYB 4PRAA 3I6GA 3DI3B 2FX7H 3GGWA 4OF5A 3UTPE 1OARL 5L88H 4G6AC 4JFFE 1IZJA 5E9DA 3DPBA 4F7EB 5M94B 3VD4A 4FN0A 1EHLH 1JPGB 1KELL 2OBGA 3TPKA 5E08L 3ESUF 3RPIB 2L7JA 3VE0B 2YS4A 3Q1SH 1KB5H 1I1FB 4JM2F 4LOUD 3PIQA 4GMSH 4JPIB 3V6ZB 1KEML 2HKFH 4NN7C 4PJGA 3WMSA 4N90E 1IT9L 2YSSB 4PTUA 4NCC1 3EYFB 4XXDB 1JNJA 4LGRB 5KVFH 1Z2KA 4F8QA 4XVSL 2NX5E 5F88B 4KK9C 3UTSA 1HSAA 2OL3H 5TDPA 3EOBA 5GGTH 1NMAH 3T2QA 3EOAA 1KB5B 3NZHL 3UBXI 1YN7A 4FQ1L 4QXGH 4I48A 4HULB 4MAYD 1FCCA 1MAKA 2C4FT 1ZGLP 4RFNC 4YC2B 4QRUA 3O3EA 3NCCB 4QHUA 1MWAL 4XBGA 2VXQH 4IIQA 4LEOB 3C08L 1U9KA 3D39B 1UT9A 1BD2A 2VO5A 4NQCA 1MI5D 2H9GA 4YHPA 2OL3B 1NSNH 1WJ3A 1UCBL 1KIPA 4PY7A 2VXUL 5DEFB 1J88A 3MLVL 1C16B 4U05A 4HLZG 4X7EC 5IB5A 3OWEA 3TN0B 2VZUA 1E6JL 1HKLL 5DS8A 4JREC 1P4BL 2VDKH 1CFTA 4KTEL 4RDQF 5C0EB 4M7ZB 4I0CC 3HI6L 4JPIA 1BFVL 4PJ5B 3KJ6L 2CDEB 5EZLB 1JRHH 1F4XL 1NGQH 2OR9H 2BNRA 3X13B 4XXDA 5IOPA 1HKFA 4PRIA 3VFUB 3F12A 1ZSDA 2E6QA 4GAGL 2YXFA 4G6ML 3RU8H 2W0LA 4HUWB 4APQA 1KSRA 2AK4D 5KS9E 2Q6WB 4NNYB 1CGSL 2VDRH 3LS5H 3AU1B 1FCGA 2WQRA 5JW3L 3QIUA 1A7RL 1Y6KR 2CO6B 3TBWB 1MLCB 2EE9A 3VXSA 5C09D 4D9LH 5IBTH 2HTKD 5AZEH 4G7VH 3QHZL 2H2PC 4LLWA 3TT3L 1IQDA 2VC2L 5A43C 4NO0D 4MNQB 5C0AD 2BZDA 1OAKH 2P4AB 4J2XA 4HGWB 5MEQA 3HG1D 3SDAD 2A6DB 2XZQH 5FHAH 1E27A 3VG9C 1ITBB 1EX0A 2MWCA 5J6GB 4XCYA 3MNZB 3IDMA 5C0EA 1UWEH 2CQVA 1E6OH 4PJ5A 4G8IB 4QTIL 2D7TH 2VXTH 1DQDL 3GMRB 4OFVA 5E2TL 1GPOL 2JIXD 4HF5H 4QGTA 4QXTA 5I74B 4YHNA 3CIQA 4MD5B 5I15H 1EJOH 1NC4B 5F7WC 4AG4H 1FC2D 4OUUB 4TRPH 1IJ9A 3ESVF 1AQKH 5KSUB 4CAGA 2A38A 2RFXA 1U8JB 3WXWL 3JTSB 3GO1L 1Y18B 2ZUQC 5GGVL 3BDYL 1QFWL 2DQHH 2B20A 4PV8B 1RUPH 1YYMH 5D6CA 3FT4B 4GLRH 1DVFA 2SEBB 2QTEA 4CVZA 4YEFA 1B3JA 1FGNL 3TH3T 3MV7B 1LQSR 1JNLL 4YR6B 3PGDB 1GGCL 4X4ZA 1LO2H 1A8JH 2B8OT 3MBEC 4N5EC 1UZ8A 1N0XH 1MELA 2X1XR 3IU4H 3VXTB 4GAJH 2YD4A 4BH7A 2O61B 5D72L 3PJSB 4QRRE 3O9WD 5EBMB 5IBLD 1KCRH 2X4SA 1XF4A 2AV7B 3MLXL 4LRNH 1E4XI 1WIPA 1Z9LA 1MRDH 4ZNEE 1DLHB 4KK5C 2W91A 4N1HB 2P8PB 4PJEB 4LVNC 3D48R 5HHPB 3GMRA 5KSBE 2I60H 4M93B 3O6LL 1CBVH 2GUOA 2NMSA 3ZE1E 4S1QH 3REVB 3B5TA 3SE4A 1CGXA 1W0VA 1YNLH 2AK1H 3FMGL 5DWUH 5KZCB 2HT4D 2VXSL 1VFAB 4UUJB 3NIFE 3M1BA 2IADB 5DRXB 4I5BB 4KTDL 1B90A 3R8BB 1N7ML 3EZ8A 4JDVA 5CILH 5ANMA 3C6LC 3KLSA 3VGHA 3FB5B 3GRWH 3ZL4H 3W9DB 2UYLA 3G5YB 3EJYD 1ZVHA 2SEBA 4LNRB 2OXGA 4Z7WB 2XN9D 3L3IB 4N9OB 3VA6A 3T0BA 4QXUH 3BEVB 4TVPL 4PGJA 3I84A 2FGWH 2NY5L 2VZTA 4JFDA 5D7IF 1OF2B 1AY1H 3N85L 1ZVYA 2X4QB 1K6QH 1L0XA 4YHIB 2G60H 3MRDA 2FSEB 5E4EB 4CKVX 5I19H 5I1EH 2RQ8A 1ZGLM 1AXIB 5D96C 1PVHA 1C5BH 4XCEA 3QQ4B 4WFFE 4X6CF 5E56A 1QYGH 1BJMA 4G8GE 4MD4A 5BXFA 4L5FL 4Z7OF 3KYNA 4NIKB 3KLAA 1ORSA 3D1MC 5HGAA 2W1NA 4PJCE 3FN0H 4XBPB 4HUVA 4CJ1A 2PXYB 2Y7QA 4MNHA 1VFAA 2D0FA 5EUOF 4TTDD 2EIZB 1IKFH 1G7LA 3QDGD 1PG7W 3SDDB 4OZ4B 3AAZB 5ESAB 3CX5J 2GT9A 4MB4A 4IOFC 2GAZB 1N2RA 1DL7H 1MCBA 1T6VN 1XF5B 6CGTA 1KPUB 4U6VL 1CIUA 1QD0A 5C0RL 1RZIB 4R4NC 3O0RH 3V0AC 3L3IA 4LKXB 4M7LT 1YMMA 2IALB 2QBWA 4UDTA 5CINH 3V7MA 1B0WA 5HYJD 4X8XA 5KVMC 3QQ3A 4WHTB 1A9BA 2HT3D 3PABB 5MEOB 5EO1A 1EVTC 2IPTH 3RX8A 1NFKA 3EBAA 4U1LB 4YGVB 2Y36L 4EQ2A 2Y07L 2EDTA 4NJAH 5FEBA 4U1MB 4W6YB 5C07E 3I50L 3HE6D 3HZYB 1IEHA 5INDB 5GSRA 4OCLC 4GRWF 2FHFA 2AW2A 4JM2B 2XQBH 4JCMA 2YK1H 3SKJH 5MERB 4HWBL 4LLDA 5CP7A 1EAPA 5DA0B 1HZHL 4JQXC 2ICWJ 5FM5M 4U7SA 1SJEA 3CLFH 3VRJA 1H3PL 4HMDA 2LVCA 5E8OB 2JKXA 1NAKH 5GS1C 4LVHC 3DROB 3CH1B 3VWJD 1T0NA 3IKKA 5ESAA 4P2QD 4KRMB 1G6RA 3VG9B 3TNMB 4HWEL 3W39A 1RZ7L 4HS3B 1HILA 4P57A 4ONGL 4P2YA 3SOBL 2JCCA 3VD5A 2G2RB 4WU5B 4EOWL 1XF2A 3K80A 1P1ZB 4QHNB 3WO4C 1JN6B 4OGAC 4JFEE 4K71B 2BJML 2DQGH 5CJXA 1D6EB 3MJ6A 1P7HL 1U93B 2OMNA 3V6OE 5KSVA 3G5ZA 2VDNH 3SKMA 3EYSL 5K9KA 5DI8B 1XGRB 3NABH 4LRIC 2ZUQB 4RMUA 1Q0XL 4Z76A 2BVTA 2RB8A 4BUHA 4OLVL 1MOEA 1TZIA 1Q9OA 3MGTB 1JVKA 1T6WA 4ZTOL 3BMWA 3DROA 5L9DH 4HH8A 5T1KB 5LGJA 2CLVA 5C0BA 5TDOA 1R5IB 3NAAL 4OI7A 3S4SB 4A2MA 1LO4H 2BRQA 2A6IA 5ISZB 4KJPD 1I1CA 2FIRT 5F8RC 3TJEH 5EO0A 4KGJA 4MJIA 3VFGL 4Y88A 1IEBB 2QQQA 4QRPD 2L4OA 1VEOA 1BVKB 3IXTA 5TGBB 1KLFA 1KV3A 4LEXL 4P9ML 5LBSH 3Q48A 4X6DA 4ZXBD 3MA9H 1ZS8A 1A6WH 1T5WB 1Q0YH 2GJ6D 2HWZL 3SJVA 1J12A 4BQ9A 3KXFE 1TJGL 4P5TC 4KVNL 2DWDB 1VADB 4R96A 4Y16B 4AMKH 1SY6L 5F1SA 4YE4L 4XTRC 1OAUL 5DI8A 1PFCA 1AD9A 3GSWB 5SWSD 1HCVA 4OZFH 4PLKD 5D2LE 1OM3H 1RZ8B 1YY8A 5J6HA 1FV1B 1MLBB 3PDOB 4CL7A 1S9VB 2AEWA 5GGRB 2VL5B 5J3HD 1MCRA 3AMLA 1PKOA 4H0HB 2VITB 1MFBL 2R0WH 1RULH 3B3IB 4D9QD 5DJ0B 3CVHA 3ZE2E 3RUGA 1A3LH 4U1NA 1IGJB 4XT1C 3MBEA 2VH5L 3RWGA 3G6DL 4KJQC 2DI9A 2AJ3B 5DD3L 1B0GA 4OZFB 5HI3D 5FYKL 1ZA3B 1MHPH 1QFUH 2ADGB 4FQJL 3WFZA 1LE9B 5FGRA 1J8HB 1PEZA 5F97E 1ZOXA 2AEQH 5CWSB 5MI0B 4M9OA 1BVKA 2E7HA 3GUTA 3PHSA 3U7WL 2IBZY 1J8KA 3QEGH 4NKQB 2BRRL 5CBEA 1FFOB 4Z0BL 2VLKB 4LKCB 4PB9L 3JVGC 5D5MF 1PQZA 1QA9A 2MKWA 2XTJD 2ZPKH 3BFOA 4PRNB 3VXNB 5KW9H 3FO0L 3C6LA 4W68A 4OV6F 1RQ5A 1FV1A 1Q9KA 2YR3A 3GHBL 3BH9B 3LMJL 1S7XB 1DQTA 3V4UH 4PJAA 4NRYB 1Q9WB 4U1IA 5DMIL 4JRYB 4MAYC 4RGMB 4TVSa 4OD3L 4Y8DC 1I8KB 1AQDA 2NY6D 3H3BC 1W72B 4XMPH 5IFJB 1G0XA 2AXHA 4PS4H 1OGTA 2XZCH 1UACL 5F7MC 4EZMA 2GY5A 1S7QB 4RBPH 2QL1A 1E4XL 2XFXB 1FYTA 1V7MH 5JR1H 4YJZL 5JW4N 1GGIH 1SEQH 3FONA 2N7AA 1OW0C 4LSSH 2E7LC 1A7QH 3K1KC 3VH8A 5F7NC 1VFUA 2W9LA 1OSZB 3BIBX 1RIVH 2BNUB 3PWVB 4HV8A 4ZUSA 1FVDB 4WJ5B 1HHKA 4Y4KD 5J11B 5DJYA 4Y19E 1W8NA 5EWIH 5HHMB 3WHXA 2ICWA 1KGCD 3OGCB 1FBIH 2F54E 2EE6A 3JV6A 1X4ZA 5EZJB 1S9WA 3HR5B 2WUBL 4U31A 3VFSA 2BVYA 3ES6B 4CNIA 1RUAH 1CLYH 1F4YH 3AY4C 4X6CB 1CDCA 2ENSA 4NJ9L 4GS7C 3KYKL 3LSOB 3NIDE 2XKNB 4HC1A 3U7YL 2G9HB 5ERWA 5F93C 5L7XL 2FH8A 2W9DH 3B8YA 1ZLUK 3GIVA 5K9QG 3ARZA 2HTKC 1W72A 2HFEA 1IM3B 5JPMB 3LKRB 2VDMH 4NZTL 1BQLH 2EIBA 1A21A 4QRSB 3RI5K 3MRLB 3QDHA 4KKBC 4RISL 5CSBA 1OGAA 3AS1A 1DLFL 5CFHA 1IARB 3FQXA 3SDAC 4NC2B 5SWZE 4UIMA 2Q8BL 1ZANH 1RUML 3T2PA 1T04A 4I2XA 4GRWH 4XWGH 4JQXA 2X05A 5D71H 3MRQA 4U1KA 1S5HA 1KENL 5JDJA 3JV0A 4TVPE 3U1SH 3PWVA 1EAJA 2ZCLH 3IYLW 5EOTB 4YLQT 5GS1A 4TNWF 5J4MA 4NUJB 4I3RH 3FN3A 4PJXB 1Q72H 5DSCB 4ZSOE 5FO8A 4LCWE 1TPXB 3OGCA 3K4AA 4NO2A 2PYED 3FQTB 2OJZL 3IDNA 5EPMA 1HK6A 1LEIA 4K94H 4FQHA 3HNTL 4GRWB 3WD5L 4OKVA 1JUFB 4I9WE 1AD0A 5GS0L 5E8PA 3RVTD 2YBRB 1UKSA 1C12B 3MLRL 3UTTB 4NKDB 1UYWH 1AHWB 3AB0C 1NDGA 3PQYE 4NGHL 5IG7B 1TETH 5DD5H 3WFBL 1BGXH 4OGYH 3UTPD 1F4WL 5I8CA 3RWJB 4UTAL 3SDXE 2VN4A 1LMKA 4FQQB 4H1LH 4JFFD 3VJ6B 4XNQB 2Y06H 5EN2B 3STZB 5JOPE 3EDEA 2RR3A 1NLBH 1ADQA 2PW2B 2B4CC 2R2EA 4L3ED 3LPFA 4M5YL 3O9WC 4K7PY 1JHLH 3MBXH 1F90L 5IBLC 1AE6L 4WTZA 4U1JA 1ZTXH 3F58L 4IMKA 4NQEB 2W0FA 5ACMA 1H9VA 2E5EA 4D0CA 4Y2DC 3P9MB 4P23D 2HJLA 2C1OB 1EZVY 1A0QL 4MQ7A 5CZXD 1O7VA 4H1LB 2NX5D 4PJXA 4PJGF 3VWKD 2F8XC 4ZO9A 4IOIB 4ZO7A 3GKWH 2GK0B 5F7EL 4G42A 1JRHI 1KJ2L 1WBZA 4NWUL 3QIWB 5DVKA 5H37G 4ODWB 4P4KD 2EDNA 2X4NB 1LEGA 1ZT1A 4Z7UB 5E2UL 2MCG1 2YBRA 3BQUD 1UJTA 5ALBL 2G5BB 2YEZB 1HHHA 3EJYC 4OCYL 3OKKB 2VLJA 2B1AH 1NAMH 5A16B 4P5TA 1JGVL 4OIIH 3B9VA 4EKXA 5JDSB 3UROR 4PV9B 1TVBB 3BKYL 1K4DB 2I5YH 4UU9B 2WBJD 3LVEA 1G9ML 4U1GB 5GGUB 2D4DA 1MHCB 1JP5A 1ZEAH 4AEIL 4XC3L 1NGPL 3LEXA 3CSYB 4GXUM 4DVRH 2AXGA 3C5ZD 1NAMB 3HI5H 4MAYB 1JTOA 4Q2ZB 5F9OH 4F7CA 1BQUA 3EFFA 2IQ9H 2DQIH 2HTLD 4YDVA 1MI5B 4TTDC 3L95A 4GW4A 3D0VB 1B2WL 1KBGH 2BDNL 4YDLC 1FPTH 5E94B 4A6YH 2HFFB 5EFIA 5HYQB 4M6OH 1JYNA 3CFKA 4OD1L 5DQDL 1CFQA 4D8PB 1WAAA 2YEZA 3N0PB 1JGUL 4CUCA 3LH2L 5BJTB 3RNKA 1JHKL 2I9LB 1U8MB 2H2SD 3LB6C 1KC5H 3CFCH 4P3DB 1CDBA 3KPOB 4GLRI 1T1ZA 3EYOB 1RZKH 4QHKI 4JN1H 1NUGA 3FQUA 1KG0B 3C8DA 2HT3C 1H5BC 3WJJC 3BP7B 4FFWD 1K4DA 1W0YT 2AGJH 2FD6H 1I7RA 2AK4B 4KROD 3WDIA 5GGUA 3HE6C 1J0YA 4JHWL 3WBDA 1A3QA 1HQ4A 1GVIA 3ZYJA 2EXWD 4DWHA 1BZ9B 1Q1JH 2A6JB 4J4PD 1CU4H 2MFNA 4HIXL 3FQWA 3KPTA 5HHQA 5IW1B 1DANU 2FYYB 4ZFGH 3EIFA 3QQ9D 5ILTL 3DX6A 4NO0B 4IRJD 3UJIL 3ULUL 1EERB 3VWJC 1ZAGA 3LKSB 4OZIB 3I2CL 1L7IL 2HH0L 5E94A 1I7UB 2HFFA 1PX3A 5HI4D 3CPLB 4HKJA 3DX9B 1WEJH 4IHOB 1OW0A 5BJTA 4BFIB 1CE6B 2P5WA 3CDGA 5L6YH 1GZPB 2I9LA 3O41B 4F8TA 4ZFOB 3WKNA 1ZT4B 1VGKB 1QSEE 3D85B 5AYQA 2NW3B 2JB6A 2OZ4L 3GSRA 3EYOA 1BVLB 2AS5M 3VI3F 4QRRD 4WI9A 2V17H 4K2UL 3DVNA 4H26A 2JIXB 5IW3A 4DK3A 3MV9D 5JXED 4Y5VB 3BP6A 2VQUA 3SO3C 3AXLA 3L9RB 4QOKB 3AY4A 4TSAL 2VWEC 1ZLVH 2VQTA 5DO2C 1BZ9A 4JZNB 4JZJA 4NQXA 3CFBA 1DBBH 1ONQB 5C09A 3AB0B 4LP5A 2HG5A 2FYYA 1KULA 1X5LA 4KUCF 5C0AA 2J8UA 2R1WB 1KEGL 5TFSH 3DRTA 5FCUL 1OAXH 3T65B 2GJJA 3HG1A 3O6MH 4L8SC 4JHAH 3SDAA 1I7UA 2WINB 5JHDE 3VW3L 2YA0A 1MFDH 3DTXB 3HFML 1EGJH 4HDIB 2EDRA 4KJPC 4P5MA 4TN9A 3O9WB 4ZS7H 3Q5TA 5T33H 5MEND 2EC9T 5B39G 3VD9A 5E0QA 5IQ7H 3P0VL 5JHLH 5T5FH 1A7NH 1EEZB 4KC3B 4KMTH 3CLEH 4UILH 5CJ5A 2UWEB 2NXYD 1L4IA 4PG9A 3S36H 2ZCKL 4ZXBC 1TJHL 5CJQH 3QDME 3WFHB 4XP4L 2ICEA 4PGDB 1KFAH 3GMPB 3U9UB 3MV8B 4HHAA 1GC1C 4N0YH 1QBML 3P30H 4MXQD 4WFFD 4GXVH 1TVDA 1F02I 5C7XL 4LSQL 4PLKC 2EDJA 1XR8A 3VMNA 4GKSA 1OP5K 5L2KE 4GG6A 4LMQI 4X8JB 4ZAKC 4HUNB 5J3HC 2DL9A 3DVGA 4F15B 1FVEB 2VJXA 3KYOA 4NSKA 4UQ3A 3T1FA 4Z95L 1QR4A 32C2B 3V4PL 4XB7A 2R15A 3C5JB 2MHAB 3QWOA 4NQUA 4O02H 5HD8D 1UQSB 1T21B 1TQBC 4HDIA 4M62H 5HI3C 3ZYIA 3HNVH 3RY6C 1U8KA 5L88L 2UY6A 4GBXC 3U46B 1EHLL 4DGYH 1PYWB 5BOZG 1C5DA 4WI8A 2XNAB 2PUQT 1LE5B 4Y2DA 2J2ZA 3Q1SL 1N4XH 4CU6A 5DK0B 1I8MA 1T7XA 2UWEA 3GSNB 4OJFH 2IBBA 5DJAB 2HKFL 1M7XA 2VDOL 4FABH 1WIUA 3PP4H 5C07D 1A22B 2PCPA 1ZA6B 3Q0HA 4ZFZB 1B0RB 3HCVB 3U9UA 1TZHA 1D9KD 2A73A 5IEKA 2VABA 4GRLC 1MHEA 2XTJC 4BH8A 4O2EB 5CGTA 4ZO8A 2Q8AH 3BGAA 5E7FA 3VFPA 1LP9A 1WWCA 5GGTL 2X7LB 3BWAB 1R3KA 2ORBL 4RZCB 3U9PL 3MLWH 5C0IB 4RWYL 1QR1A 2UUDK 3TYFA 2XN9A 5FKAA 4FQ2H 2K9UA 5BCAA 1UA6L 4LLMB 5HYJB 4O5LL 3PL6C 4PJ9B 3TBVA 2VXQL 1QBAA 2P46B 1WC7B 2NY6C 1KTDA 3TVMD 1JCKA 3SCMC 1H5BB 4QRQA 5IB1B 4CVWA 4CDHA 3U79A 1ACYH 1NSNL 1RK1A 3UMTA 4AIXA 2GI7A 4HLJA 4NUGH 3HE6B 4D0DA 2DDQL 2IPKA 4JO2H 4JFED 4M1DH 3EHBD 4HIEA 2VDKL 2JCCF 3GSNA 3PP3H 2X4UB 3UPCA 5F72S 3UTZB 3MGAA 2O5YH 2YUWA 1JRHL 3DBXA 3OQ3B 3T3PE 4HT1L 3B2VH 2OR9L 2P49B 1A7BA 3E6HA 3QNZA 3D3VE 3NFNB 4PP2B 4Y4KC 4X7TB 3QDGA 2YD7A 3RL1B 4PRBB 4P2QB 1F6FB 5L8JB 3RU8L 3OKOA 2ZG3A 4G80B 1HSBA 5EU5B 1FFQA 4M7JH 4QT5A 3LS5L 1L9NA 2I9TB 4FOMA 5C0IA 4HIIB 5GJTH 4WNQB 2FCBA 4UZGA 3BYYA 3WL9B 1J5OL 5HYJA 1NL0L 2WV3A 4G7VL 5AZEL 5F1IB 4JKPH 5DR5H 2XICA 3WJJA 1XAUA 4O4YH 4CBPA 2BCKA 4MXVF 2OM5A 4WEMB 1T2QH 2X1QA 3DSFH 3HE6A 1HH9A 2XZQL 1N5YL 3NN8A 2WUCL 3OKMA 2PR4L 1FO0H 5I8EA 4U1HA 2GY7B 2ZUXA 3AS0A 5D1XD 4EBQL 5JZ7D 2VIRB 2JK5B 4PJIB 2WWMD 5I0DA 4WENB 3WYRA 2D7TL 4LP4A 5K9OA 5KAQG 2VXTL 1KNOB 1NBQA 4X4MA 4ZYKA 4YEEA 3TPUB 1CGTA 1QHPA 4X6DF 3MMEB 1XGQA 3QUYB 3EGSA 1M05A 3VWJA 4HF5L 1U92B 3QDJE 4MA3B 4S2SA 5I15L 1GL4B 4WI7A 1FO0B 4UT6H 4TRPL 4XPAH 1Q94A 2X4TA 2YD9A 3ARBD 5C2BH 5C86A 1AH1A 2I9TA 3OKLA 4FQPA 4ELMB 3L3DB 5ETUA 5HPMB 4QRPB 2FL5B 1IGTA 1MCPL 3QFDA 1U36A 4PGBA 4KK6D 3LN4A 3P4LA 5HPOA 5HVWA 2XRAH 1NGZB 3CSBA 4R3SB 5DJXB 1QLFA 3VXUD 1UH2A 3U0WH 4C56B 1X5AA 4JG1L 1LO2L 2ZOLB 3BDXA 4HH9B 1BOGA 1N0XL 5TJWK 5CZVH 2Q7NA 2AABH 3IDGA 4HCRH 4Z7VA 5BV7H 1WBXB 4RQQA 3ZTNH 4DAGL 2APWA 1KCRL 1CQYA 2FH6A 2VIRA 3MX0A 4NNXA 5DJ8A 4PJIA 1RIHL 4LRNL 1CXEA 2ED9A 3SQBA 1TTFA 5I73B 3CMOH 4P23C 2FATL 3TPUA 1CBVL 3VWKC 4OLUH 1A2YA 4JJ5A 1QEWB 3R0MA 4S1QL 4X5XB 3MRFA 4LIQH 2AK1L 5GRJL 5DWUL 2BVPB 4L8SA 4N1EA 5E1HB 4KZDH 5C08D 2XWJA 2IANB 3CMGA 1TQBB 3VD3A 2Z92B 2V2XB 3RX7A 3ZKMD 4P4KC 5D7SH 3S8WA 2NY7L 4S1SH 5CILL 3KDMA 2ZSWA 1JV5A 3BQUC 2O5ZH 2WMPA 3ZL4L 1HEZB 4G43B 1IRAY 4LAQH 2AERT 4R3SA 2VQ1B 1RZJH 1S7UA 4PJAF 2Q76A 2MQ0A 4ZXBA 2CR3A 4K9EC 4QHLA 4ZPTB 4L4TE 5IGXH 3U2SB 4QXUL 2GJ6A 3ULUE 3OF6A 2FGWL 1IL1B 4XC1H 1AY1L 5GS3A 1X6LA 3OKDB 4PJHE 4FQCL 5EOQH 1K6QL 1KPVA 3D0LB 2CXGA 3IKCA 3BGFB 5SWSA 1UXWA 1G7IB 1NEZB 5DMKB 3T3ME 5I19L 4PUBH 3ULVF 4ZAKA 5AUMB 1KLGA 4GKNA 2I27N 3QBTB 4MA7L 3BVNB 4FXGA 4ERSH 3CU1A 3G9VA 1AGFB 1QYGL 4NKOB 3I9GH 2R0LH 4Y19D 4OI8A 1VFMA 3VFRB 4PBVC 3C5ZC 3WNNA 2D4FA 3FN0L 4HUXB 3ARDD 1R5VA 3RVXC 2CIIB 2V9RA 5C3TA 2V2XA 4WTWA 1J1XH 3RY6A 3QULB 1BPVA 1K2DB 4GBXA 4I0PC 4NKIH 3HC4H 3OHXB 1WITA 5DJDB 3TCLB 3IS0X 4PJBA 1DL7L 4M7KH 1CDJA 3QZWB 5E70A 1PLGL 5I1JH 1JZ8A 2GEEA 3GJFA 1FVCB 2H2SC 3O0RL 1NUDA 1CT8B 3O3AB 1T7YA 1K4CB 4NDMB 2X4OB 3PWPE 1IL1A 1RJYB 1R3IH 3L3OB 5SWZD 1CK0L 1MVUB 4JGUA 3MGOB 2NLJB 4GRLA 3ZDZE 5B3JF 5ICYA 4QF1A 1W8OA 4NJAL 1G7IA 1NEZA 4I4WA 2DL2A 3EYUH 4TVPD 5DMKA 2ATPB 4KROC 1YEIH 2ITDB 2XQBL 2YK1L 1QSFE 3ECBA 3SKJL 2EXWC 4ODVL 1TZGH 4J4PC 4LCWD 3TJHD 15C8H 2XPGB 3PL6A 3TO4B 4LHUG 2BVOA 3SCMA 2CIIA 3ZSTA 1NAKL 3QQ9C 4I9WD 4HJJH 3ZKND 4NBZB 3KNBA 1RUKH 4P4RB 1EXUB 2E8ZA 4KXZH 1FL3B 4KPHL 5ADOL 2EYTA 3RA7L 5HI4C 3IFLH 3FO2A 1X5GA 4POUB 1CG9B 5LG1A 3K7UA 1QLRA 4LCUB 5I75B 4L8DA 2PW1B 4DKFL 1HHJB 5I8OH 2LTQB 1YNTB 5JOPD 3INUL 1QRNB 4Y4KA 1V8HA 3UBXG 5EIVA 3TP4A 1XIWD 2DQGL 1MY7A 2Q7YA 1X7QA 2CIKB 1LK2A 2OTWB 5IKCA 2J6EA 2F19L 1B6DA 3E6FA 4MWFB 2CRYA 5JXEC 1T66D 1OOAA 4K23H 4XNMA 1CE1L 5BVJA 4M48H 4NC1E 4WGWB 3VXOA 2ATPA 2VDNL 3N9GH 2DB8A 3NABL 3MA7B 4P9HL 3MCLH 4I18B 4XGZB 1NMCB 3SDYH 4C55A 1DDHB 4JPVH 3VCLA 1T1XB 1RJZA 3QIBD 4H0IA 3GMOB 2D7QA 1QO3A 2DYPD 3D39E 3HZKA 5L9DL 3ILQD 4P4RA 3LRHA 4KRNA 1XCQB 1ZHKA 4JKWA 1LWRA 1LO5B 3TF7C 2WBKA 5GS2D 4M6NH 2E27H 1YEJH 4L3EB 3BMVA 3TJEL 1TQCC 5KBNC 3GIZL 5TF0A 4FQXB 3AREB 1INEH 3B43A 4LQFL 2DM3A 1CFVH 2PW1A 5CD3A 4YXLH 3O2DH 2DTMH 4P23B 3QAZB 4JRXB 4HWNA 4LSUH 1OB1B 2IG2H 3DLQR 3MA9L 1M71B 1A6WL 2VLRA 4E5XA 2A1WH 2VLLB 4LL9A 5FM4A 3KGRA 3QEQB 3FT2B 1UFUA 5BW7C 2PYEA 1WBYA 2ZP0T 4P5KA 4MHHI 3DX7B 1LNUA 4MXQC 4X6FA 1NBVH 5E6ID 3MA7A 5JNYA 5C0JA 1OM3L 4DQOH 3M17B 2YRPA 5I6XC 2X44D 3RFZC 5CEZH 1CXLA 2X70A 2AJUH 4MD0A 4NPYA 3HTLX 3L5XH 4IJ3C 2R0WL 1RULL 3BP5B 3ZLQC 2YD3A 5I2IB 5B38B 4MNQE 3T4YA 1A3LL 4JFFA 4UTBL 3I6KB 1XCQA 4Z77B 2FX9L 1G7QB 5GGSY 1AO7D 4ACPA 2I07B 2Z4QB 2WWKT 4TSBH 3KLDA 1MHPL 1QFUL 3GI8H 5DZNA 1TNNA 2VDPH 3MRGB 3DO7A 5DUML 4JFXA 1EUUA 1A4KB 5F6IB 2WBJB 4LDEB 5FK9A 2AEQL 3KR3L 1N3NA 4PTTA 4TPRL 4P23A 1WAAF 4HXAH 1PG7H 3RNQA 1RK0B 2DBLH 3DUSA 3CJJA 4GAYA 3VWKA 1JE6A 2NX5A 2E9WA 4OIBA 5CSZA 2OS7A 5LQBH 1A1OB 5ID1A 5K9JH 2R2HA 1WCBA 4XCFH 5TE4H 3DX7A 1CD8A 1X44A 1QFPA 1UGNA 4QLRA 1D9KC 3ZSSA 4P4KA 5B22A 1FFNA 2CLRB 3L3HB 7FABH 4N8CH 5KW9L 1DQQB 3BQUA 4NQSA 3SE9H 3DETC 4CN6A 3RPKA 1FN4A 4HS6B 1M6OB 1P4LA 1NC2A 3MV7E 2QV2A 4IRSC 2EKJA 1N64H 5FGCB 4AIZA 5FUZH 2APBA 3TVMC 4XMPL 3QUMH 2DQUH 2P24B 5KN5B 2XZCL 1FE8H 4RIRA 1FLRH 3HUJF 3P3YA 1T22A 3MRGA 5DHXB 5CAYB 2BOBB 1R24B 2NY3D 3MRRB 1V7ML 3ULVH 5JR1L 1S7VB 5KANI 2WK2A 1A7QL 3EHBC 3LEVH 5FYKD 3C5ZA 4NQDD 4PJEE 1F6AA 2QHLA 1PZ5B 2CPCA 1RIVL 2L0DA 2OP4H 1L0YA 4LPXA 5DK2B 3NA9H 5KS9A 4HWZA 3V6OC 1GGBL 3QUMB 5DGRA 1DN0B 4IRJB 2PTTA 4HK0B 2EDLA 3LQAC 5I1DB 1SMAA 2AJXL 2M8XA 4I0PA 5FAAA 4IBLT 1RIUH 1SYSA 1NCBL 5HGHB 4ENED 1CLYL 1F4YL 5F7DA 3MCKA 4RMQA 2YHGA 2PYFA 1U2CA 1AIFA 5EULV 5I1LB 1Z5LA 2LVEA 3TBYA 1IGML 4WW2C 1WIOA 5FCSH 5D7JD 1OTTD 1M6OA 4UIKH 3CZFB 4Z7WE 1ACZA 2VDLH 2CKBH 2E9IA 3T4AA 4JFPB 1UKTA 3MROB 1BBJB 1NBYA 3TFKD 2VDML 3NA4A 1BQLL 4M7LL 3WSQH 2J8UF 1UM6H 3MV9B 3ROLB 1YQVH 4L3CA 3MUGB 5HHOD 1R5WA 5F9AC 2QSCL 2FEDD 4BSWA 4F7TB 1DEEA 3MRRA 4JM4H 4AEEA 3E0GA 4FXLA 2H26B 4Z18A 5KSBB 5IVZA 1JTPA 5D1XC 4J4PA 5D71L 5JZ7C 5GRVL 3DV6A 4PD4J 3VXPA 3QDMD 5FYJH 2CKBB 2VAAA 1C7SA 4G7YH 2WWMC 2LQRA 1QFWM 3UPRA 2ZCLL 4BJLA 1DQMH 4W4NA 1MJ8H 4I3RL 1Q72L 4HK0A 1YPZB 4MJ6B 1FIGL 4O51B 5EB9A 3FQRB 3WS3B 1N6UA 3PWLB 3GMLB 1P2CB 3H0TB 1IE5A 4K94L 2VUOA 1NJ9A 5MENB 3ARBC 3VXQB 4YFEA 3FQNB 5C0GA 3HMXA 3L7EA 4JANA 4OF0A 4JPWH 3U30C 4Q6IC 4ONFL 2B5IC 4E41B 7CGTA 4OAWA 4GG6F 3FFDB 5L0QC 1WZMA 1PBYA 4KK6C 5C8JA 2GITB 1AGCA 2IGFH 1INDH 1NKOA 3DOSA 1TETL 2NXYB 3BN3B 4JFOB 1BGXL 4GSDL 4OGYL 5DT1H 4QRRA 3RZCA 1CLOH 1K3ZA 3LQZB 3QEHB 5E8DH 1G1CA 1IBGL 4XP1L 5F7FA 2Y06L 3SGDH 3MUGA 2FO4A 1NFDF 1JPFB 2HA1A 1NLBL 2BVQA 4ZNEA 5J8OA 1HWGB 3F5WA 3O8XB 4OZHB 3SBWC 4N0CD 1EO8H 1FZOA 3QO0A 3C6SB 1JHLL 5KSBA 3MBXL 4CRPA 3BKCH 1OPGH 2QQNH 1ZTXL 1FGVH 2BSSB 4OGXH 3BEWA 1A6UH 1PSKH 2R2BB 4L3AA 3PV6A 5SWQA 4HXBL 3FOLA 5H94A 1MFCH 5EC2A 3GBLA 2YUVA 3RI5F 5C0FB 4YDJA 5IW6B 3JWOC 2XA3A 2YXMA 4BZ1H 4LMQE 1EK3A 3RWCB 4N0UB 3X11B 5T3XH 2A0LD 3ZKMC 2A9NH 1S9YB 3DUUA 2W38A 4BELD 4JHBA 3GMNB 4PRHD 3BH8A 2Q3ZA 1JTTA 2JB5H 4YXHH 1BEYH 4G6JL 1N8ZA 4DKEH 5CMAB 4GOSA 4Z78B 4XVJL 3D2UB 5GS0D 3GI9L 2BOCB 4H8WC 3HS0A 2B1AL 3HE7B 1NAML 1FNGB 1CL7H 4JR9H 3LQZA 3QEHA 3UPAA 2AAVA 1X5KA 3P9LB 3ROOA 2XKUA 3FCTA 3DVIA 4XNUL 5DUBB 4XCNB 1BAFH 3IJHB 4S0SD 3L1OL 4K3GA 4R4BA 8CGTA 4G8GA 1XH3A 3KG5A 1V3LA 2PO6B 2I5YL 4ZFFB 4PGEA 3T2NH 4ALAH 5FA3B 3OAUL 4PJCA 5HDOA 1ZEAL 2FBJH 2WLYA 4WDIA 2BSSA 1ULVA 1R6VA 1XGTA 5DC9B 4F3FB 3D3VD 4PLNC 3HMWL 4D94A 1T0MB 2BY3A 3ZDYE 1N0LA 2JJVA 4RX4D 4Q6YA 1RI8A 4MDJA 5FKPA 3HPJB 5D9SA 4FTVB 3RWIA 5E00B 3ARDC 1KELH 5E08H 5ISZE 2V2WA 1KBGL 1QBLH 1H15B 4A6YL 4XRCB 4QTHB 1IGIH 4RFEB 5AAMA 3W2DH 2F5BH 3BP4B 4NYLB 3W11D 4WI6A 5IT2L 2FNBA 1IAIM 5F89A 2YD6A 4HMCA 1FNHA 3CFCL 4HW6A 3K0WA 1CGYA 4HIJB 4KMQA 5JOFB 2O5XL 2BSRA 5C07A 1U8OA 1ROWA 4JG0H 1GIGH 3RJDA 4JN1L 1LGVA 1D9KA 3LV3A 4Y2OA 3NZHH 3QPXH 4XNXH 1QSZA 3O4LB 3TZVD 3ZHDA 5IB4A 3WLWD 2AGJL 2FD6L 5B39A 2KDGA 5FOBA 1J0ZA 4HGMA 1MWAH 5ESVB 3H3PL 1EEYB 3C08H 3KYMB 4WW2B 2NR6D 3B2UC 1CU4L 2DQFB 4ODUB 3QDJD 3BKJL 5M7QA 3BJ91 2VXUH 3DGCR 3TJHC 4NO3B 5E1AB 4IRSA 4U6HB 1G1YA 3DX8A 4M9PA 4ZFGL 3KPRB 3OMZA 5T5NG 3TVMA 3L7FA 1UCTA 1U8IB 3ARVA 4F9PC 1I7TB 1H8OA 3OPZL 3ZKNC 1U8HA 2C26A 1P4BH 4KTEH 1BQHB 3CXHJ 5EU3B 1BFVH 1J8HE 2HN7B 1UWGL 3X3GL 1MWAB 4XRCA 3D9AL 3L5HA 1WEJL 4JFEA 5DVLA 1F4XH 4UV4L 5D1XB 4OF6A 4PREB 5D7LD 5KSAC 3SGJC 1KIRB 4GAGH 3CXDL 3V6OA 2H8PB 4G6MH 4AH2A 1F58H 4Q58C 3G5VA 5AYUL 1G0YR 2VLKE 3MRKA 1XIWC 1CGSH 4K55A 1SEBB 4PJFF 1E28A 1L7TH 3HUJB 1DE4A 4MMZC 4LLQA 2X4RB 4XPFL 5CJBA 1J1PH 1T66C 3SKOA 1P7KA 1JZ6A 4UBDD 5FXCH 1PY9A 3ARBB 4YHZH 4E9LA 3C2SA 1MUJB 4KRPD 3VI4E 3QHZH 4Z7VF 5M95B 2COQA 4EI5D 4WW2A 1OWWA 4Q6IB 2B5IB 4PRDA 3TIEB 1BM3L 2IFGA 1DBBL 4JRYE 4U2YA 3QIBC 3L6FB 3VXUB 3T8XB 5MEPB 3N1FC 1D7FA 3ILQC 4WCYL 5TFSL 1S9XB 43CAB 5DK3A 4JHAL 1JNNL 4QTIH 1FL6A 3ISWA 4WFEE 5F70A 1MFDL 1OD9A 5C2UB 3K4DA 1T80A 3MLPA 1U8QB 4L4TD 5E2TH 3ULUD 3DURB 5IQ7L 2H32B 3KXFA 5T5FL 1A7NL 4KMTL 4M61B 4AEFA 3CLEL 2FHCA 4UILL 1A6ZA 4M43L 2MOVA 4YAQB 4Q9CA 1K8DA 5BOPA 3S36L 1QQDA 2QQKH 2LE9A 5D2LA 5FO7A 5HHME 2EECA 4KFZC 4PGCB 1QFWH 1KFAL 1WTGT 2P1YA 5GGSA 5C08B 5HGBA 1J9CT 3BX7C 3I75A 3P30L 2VR9A 3ARBA 1XR9B 4G9DB 1K3IA 2R2CA 5E6IC 4X6CE 5T1LD 1T1WB 2H1PH 5IESH 4F37K 1X3DA 1JNLH 1NMBH 3TIEA 5EIQA 1K9TA 1GGCH 3KPMB 5GPRA 4KAQH 3WNPA 5D93B 3OAYK 5EUOE 3HRPA 3L3KA 1OT2A 5KOMC 3BISA 2HJFA 1RURL 3MLXH 3ARQA 2Z31D 1FZMA 4O02L 3R1GL 3SBWA 1ZXQA 4GFTB 4EDWH 4M62L 5C0CB 1BLNA 3MNVA 4WEUD 5ADPL 2W65A 4DGYL 5IROC 4KXZI 2AJZB 2H32A 3PWPD 4PJBF 4M61A 3FMGH 1N4XL 2VXSH 2NTFB 4HUUA 5IEHB 4OJFL 2GCYB 1A4JA 1ZLUH 4V1DD 1ITCA 4FABL 1N7MH 3PP4L 4YHML 3ARDB 1NFDB 1OT1A 5KOVC 1AGEA 4MSWA 5DJCA 2BP3A 3L5WB 4YHYC 1QSFD 4GRWE 5JW4Q 5DJZA 4TQEH 4G9DA 2Q8AL 1HE7A 2EH7L 1HHIB 4DZ8B 4M4PA 2R1YA 4WUKH 3RP1A 1Y0LB 1VKXA 2NY5H 3UTTE 5CEXB 4JO3H 1YDPB 4R7NB 1X5XA 1UB6A 4I3SL 3WDHA 2NY2B 1OAZL 2DJSA 1BZQK 2OTUB 4F7PB 5IMMA 3TNNB 2JLLA 2FWOB 1FP5A 1VERA 3QPQD 1MF2H 3L5IA 2H6PA 5TH2B 4MJ2A 3NGBC 3R4DA 4NUGL 4L4VD 1E4JA 2AKRA 2NY3C 4JO2L 4NQEE 1CFSB 3MC0A 2ZKHH 5DHYB 3V6BR 2JJTC 4Y19A 5CP3H 4X6BB 4GRMA 3B9KB 3H7BB 2F54A 2R56H 2FZ3B 1MFAH 3B2VL 4GW5A 3V6FA 2FDBP 4JLRA 5C0RH 2HRPL 1HHIA 4Z7UE 2V5MA 4ENEC 4M7JL 1KACB 3W0WD 4YNYA 2DLIA 3OX8A 1FZJB 1MPAH 5CEXA 1I1AB 4MJ5B 2ERJC 4ZUUB 2IWGA 4POYA 1WVZA 1KJMB 1OTTC 1XCTA 3BT2H 5HY9B 5GJTL 4HG4J 4P48A 2YC1B 2Y07H 5IHZB 1IAIH 3I50H 4UAOB 5SWZA 1NPUA 1EUTA 3FOMB 4JKPL 5DQ9B 4X7FC 3TFKC 3TN0D 4ZD3H 4HWBH 2EICA 4ZPVB 5F71A 1T2QL 3QO1B 1FJ1A 3S5LB 1M1SA 1KPRB 2FEDC 3FFCA 3VGAB 1FO0L 1HH6A 2HLAA 3FO1A 1H3VA 3F7PC 2XT1B 3GBNL 1JFQL 5HDBE 4XVTL 1D5ZA 4ZSOA 1UWXK 4LCWA 4LLVB 3NFPB 1CXKA 3QIBB 5DRNA 1G7PA 5JUEL 1NDMA 2QSTA 1MY5A 2E3VA 2ZUVA 4ELKA 1MCNA 3GBMH 1HXYB 5EZOH 5GISH 4F9PA 1F11B 3P4MB 1SBSH 4N0FA 4U1SB 3IXAA 1XGUB 3MUY1 1MI5E 4ONGH 3SOBH 3UZVB 1O0VA 1ZVSB 5ENWB 4M5ZL 4J1UB 3PQYA 1EFXA 1ZHLB 4XPAL 3ME0A 3WE6B 1FZJA 4MJ5A 1AGBA 3SDXA 4K7PH 3MYJA 2KQMA 3SGJA 5KSAA 1KJMA 2R9HD 3TBSB 1XGPB 2PETA 1U8LB 3QXUA 4R2GB 4P49A 3TH2T 4XHQA 4OFIA 3QHFH 4RFOH 1XIWA 2VKWA 2OQJA 1HDMB 1RFDH 1YJDC 1OLLA 4KKLD 5CHNB 3U0WL 1G7JB 2A74A 3QXTA 3UAJD 5F3HA 4X6EB 2AK4E 1G7HA 4ZDHB 5CZVL 2AXFB 4HFWB 4OLVH 5BV7L 1A6TB 4N0CC 3MR9A 2ZOKA 3CFDB 4LLUA 2Y5TB 2VXVL 4ZTOH 5GHWH 3WXVL 4YQXH 4UT9H 2ZUUA 2PKDA 1SM3H 3NAAH 1Q38A 5C0ND 3CMOL 4UQ2A 1NC4D 1CVRA 1L9MA 43C9B 3ARYA 2DYPA 5D5ME 1U95B 4PJFB 4U1SA 4OLUL 4LSTH 1D6VH 4LIQL 3IJYB 1QACA 4OZIE 2XY1A 1AO7B 3QA3A 5ENWA 4HUKB 3CDCA 5EUKA 5SX4I 1P84K 2A0LC 4O2CB 4G9FD 5D7SL 3BD4A 4F2MB 1CGVA 4S1SL 1R3LB 3L3JA 3MV7D 1MCDA 3RDTB 4F33B 1N6VA 1TJGH 2C1PA 4KVNH 3OB0K 4HK3J 1A1MA 4LHUA 5E2WL 4B0MM 1AC6A 3AS3A 4YE4H 2F5AL 3Q6GH 4KI5D 1OAUH 2VZVA 3DXAD 1LK3H 1CI5A 5CHNA 3WS6C 4NFDA 1AR1D 2VZSA 4LPCA 4XC1L 3S88L 1SBBA 4X99A 1X4YA 2XV6B 2V9QA 2R8SL 4YHYB 4QOKE 2J8HA 3BYTA 2GFBA 3QG6B 1QVOA 5E6IA 2VTFA 1U41A 3WIFB 1XGYL 3CUPA 2LAAA 1N59A 3T04D 1KJVB 4M6AA 4X4YB 4AK1A 1BF8A 2J12B 3IETA 2B0SL 5KZCD 1KCKA 1FORL 3UBXA 3I9GL 2Z35B 3QDAA 3EO0A 5FYKH 5IVOA 2JJSC 3WO3B 2IH3A 2H3NA 1Z9OA 3HHRB 3NCJH 5HGDB 3WUWB 4AT6A 4KUZL 5AG8A 5KS9F 1F13A 4Y4FD 4QGYA 2E7CA 2NXZD 3H6JA 5D1QD 2AV1A 2D03H 1YNKL 3BGMB 1V5JA 1J1XL 2HVJB 3U7WH 3PDGA 4X7SH 4NKIL 1KYOK 2BRRH 2HP4A 2NY3B 3RWHA 2VISB 4A2LA 4UOW0 1SJHA 3FZUD 3W11C 3QB7C 4NQDB 5I1JL 3MREB 1A7PH 2A6KA 4LPUA 1H3WM 4CW1A 1IAKB 1A9EA 1R3IL 2OSLA 2NY1B 3MV8E 3VMOA 1F3JB 3PG2A 3LMJH 1EHXA 1L0QA 2B1HL 1JL8A 3TZVC 3WLWC 3SGDI 3EYUL 5DMIH 3KJ4C 1J7VR 1YEIL 4TNWK 5JO5A 4FS0A 4HJGB 1SY6A 2PXYD 4JQIH 4N9GA 2NR6C 5D7JB 1TZGL 2HJKA 4E42B 4OCRH 3SDDD 3T1WA 4EIGB 2OJEB 1CD9B 3IRZA 1H8NA 4LPTA 1U6AH 1VFBB 4M00A 5HGDA 3WUWA 2BXZA 2FJHA 2ED8A 4HJJL 5D6DA 3LKOA 3BGMA 1HQRB 3P73B 4RDQG 4KV5F 5HHOB 2QKIA 4JN2B 1QSEA 2HVKB 3RIFK 4KU1A 2VISA 3PE9A 5TDNB 2JJTA 1OP5H 3SGKC 4LSRL 1AKJA 5C9KA 1RUQL 4UNTA 4WV1C 5HDLA 5I8OL 5IMKB 5IK3B 1U8PB 3VXMB 4X4XA 2Z8VC 1CFNB 2WUBH 4NNPL 3S4SG 2DICA 3LQMA 3MRJA 5HJ3B 3OG4B 1CL7I 4JM2D 5JLZA 5DQJA 5J0BA 4K23L 3U7YH 4M48L 3RVUD 4XBEL 4NRZA 1X5FA 4HJGA 4KRPC 2YN3A 4NZTH 5LXGL 2P8MA 2C3XA 3V52H 4E42A 4JPVL 2BC4B 4OTXL 3SGEI 4RISH 1M4KA 5F3BA 2W60A 2AJSH 5BS0D 4NWTL 4LCCC 5JHDA 3BPNC 4JKKA 1AI1L 1YMHA 2ESVD 5AZ2L 2Q8BH 3FB7A 1RUMH 3GSUA 3Q5YA 1VACA 3P73A 3F7VA 1T7VA 5EU7E 1BZ7B 4JN2A 4NO5A 3WN5C 4WEBH 1CZ8H 3WKMH 5F96H 1DP0A 1INEL 1A6VL 2VE6B 4B7IA 3QDMA 3ULUC 3EO1A 1J0HA 3C8KA 2DTML 2UUDH 5A3ID 1QBBA 1Q9LB 4YBQD 4OZFG 5GS0H 1F8TH 3N1MC 3IDXL 2NY4D 4B53A 5L2KA 4P2QE 4Y5YC 5F9DC 1OTSD 1NBVL 2BHUA 4JZOA 1BFTA 3FB6B 1F4WH 3VFNA 4CADB 4UTAH 4PRHB 4DQOL 3O45A 5T1KD 3MJ8B 1MCOL 5CEZL 4G6KL 2FGZA 3K4ZA 1MH5A 2EKSA 3HAEH 3L5XL 3MO1B 3VXRD 1T3FB 3C09B 3CVHL 1F90H 3QXAB 4D0BB 1AE6H 5EBGA 2ZG1A 3FHQA 2Z31C 5DRWA 5BO1L 1P5UA 3GI8L 3QISA 2VDPL 5E5RB 2NNAB 5F1NA 1A0QH 1IGFH 4M1GH 3G6AB 2VE6A 5KVDL 1QZ1A 2B7DT 1BWWA 3HAEB 4R0LC 4P99A 3D3VB 4NKMB 4NWUH 3B83A 4Y16D 1ED3A 3F6LA 2DBLL 3DV4A 3U48A 5LQBL 5E2UH 4GKZA 5K9JL 4S0TD 5TE4L 1UJ3C 2VB5A 2WSKA 4ONHA 5DYOB 4LCYB 5I0ZA 2DQJH 3VRIB 3JUZA 1I3RB 4L9LC 3WIIL 1JPTH 1TMCB 4N8CL 3PGCA 4ELME 4QRPE 2EDQA 1KCVH 3SE9L 5D7KD 2P5EB 5CCKH 1Z3GL 2EYRA 4KDTC 4KKAC 3BKYH 4ETYA 3WS6A 1S8DB 3O3DA 3G5XA 4ZQKA 4NHUA 4LLYB 3MFFB 4C56E 1B9ZA 1G9MH 4KQ3L 1MJJA 2VZ3A 5KVEH 2DQUL 4AEIH 3TA3B 2A9ML 1FE8L 3PWJA 3TZVB 1YEEL 3QPQC 1NFIA 5CLTA 4Y89A 3U0PB 3M07A 1G6VK 2G75B 2MMXA 3G08B 5HBBA 1I1YA 3ULVL 3MRHB 1ES0B 5FDYA 3WFDL 5EA0H 2VLKD 3RQ3A 3D3VA 1T83C 5FECA 5FV2A 4GW1A 3LEVL 4RX4A 2JJSA 3IFPB 3GFUA 4D9QE 1C08A 3IRPX 2N56A 1CD1B 2YPLB 4OQTA 3NA9L 5GSVA 3QXDA 1UVQA 4NC1C 3LCYA 4MZ2A 5E95B 3W5MA 5ABDE 4QWWD 1KB9K 4YO0B 5DQDH 2IANE 3HC3H 4YHOL 3WEXB 3BN9D 2CDGB 1JHKH 5B8CB 1RIUL 2KL6A 2YPKA 1QFWI 2FR4B 2JTDA 1F42A 1KJ2A 4YC2C 2RHEA 5AD0B 2WM0A 3F6IA 1R3HB 4ZUVB 2BHZA 4U3HA 4WV1B 5FM8A 4EVNB 5D7LB 4Z5RA 1D5MB 4UIKL 1A14H 1LEKB 1ZT7B 4DGIH 4BFEA 4HC1L 4LIQE 5CZKA 3QUKB 4LLYA 4N8VB 4MMXC 3PUCA 5L2JB 3HA0A 2ADJA 4WFED 4Y7MA 4JHWH 1PKQB 4H5SA 5H37H 1UM6L 1ORQA 3TZVA 1YQVL 1I3UA 3TN0C 3BZDA 5F1OB 3U0PA 3BIKB 3ALPA 4M7ZC 3WIHH 4HIXH 4I1NB 5ITFB 1QPXA 3MRHA 1MCIA 4KRPB 5ILTH 4EI5B 3DIFB 1TVHA 2DLGA 3QDJA 5FYJL 2FIKA 5HHMD 5IQ9B 3A6OA 1CD1A 4G7YL 4OZGF 3I2CH 4RMWA 1DQJA 3BPNB 3REWA 2APXA 1G84A 3MJ9H 1DQML 1KXTB 4AM0B 1GJIA 2I25N 2CDGA 2WIIB 3WUZA 2MPAL 3RY5A 4ZUTB 4X7DC 1S7TA 1S7RB 5H35B 3ZMRA 4H20L 4AIOA 1MIEL 4HKBB 3N06B 4GO6B 2OZ4H 2CJUH 3SGKA 4DKAA 3MPCA 3OZ9L 4H1LG 1D5IH 2R9HC 5DJ6A 3U36A 1DQLL 3EJJX 1U91A 4HAGA 4ZMAT 4JDZB 2BY0A 4ODXB 3P4OB 5DFVC 2J4WL 3OR7A 4JY4A 3RL2B 3IDIB 4QYOA 5E8DL 4KKLC 2P8LB 8FABA 4HKZA 2Y6SD 3JWDH 3UAJC 1UADC 1ADQL 1EO8L 2IJ0C 3GB7A 3V9FA 1MHHB 1G0DA 4HX1A 3ORJA 5MHSE 3BO8B 3BKCL 1OPGL 2X09A 2QQNL 1U8NA 1FG2B 5DDHB 1A6UL 4LCCA 3TIDB 3VW3H 1JHTA 3P2TA 4LPWA 2ITCB 2EYSB 4AM0A 4Q97A 4YFLI 2X10A 3WN5A 4BZ1L 5E5MB 2UZIH 1MFNA 5T3XL 1J0JA 3BUYB 3ARFD 2A9NL 3MNWA 4FXKB 1KTRL 1Z0NA 3HZMB 4RNRB 1INQA 4L4TA 5J89A 3TBTA 4WW1B 4R0LB 2CDFB 2JB5L 4YXHL 3GSOB 1JF1B 1BEYL 3M45A 4OCNC 1S5IH 5KAQF 1DN2A 4PJHA 1FNEB 4DKEL 1QRNE 5IMLB 2YPVH 1JK8B 3GNMH 4XH2B 3RVWD 3RKDD 4KI5C 4V1DB 4RAUA 3BZ4A 1KTKE 4G8EA 4Y5YA 1AR1C 1IAII 2IH1B 1UJ3B 5LAXA 1S7WA 1DSFL 3MRNA 3MUHL 1FC1A 3MRBB 4F7MB 4PJ7B 3EAKA 3V0VA 1CDGA 4LASL 2Q3AA 2W9EL 5H2BB 5T1LA 4ALAL 3CSPA 5ICXB 4OBRA 1EO7A 5HVFB 4LSVH 1CF8H 1AFVL 2FBJL 3KPQB 3BIAX 2FO1A 5E8EB 1CXIA 5I17B 2VERN 4KJYA 5DEGB 2J5LB 2NYYD 5I1KL 2ICES 4I13B 5FA4A 1ZWIB 4WI2A 5B21A 4V2BA 1NGYB 1XZ0B 1VGEH 4Y4FC 3OSKA 2FJGB 4XX1E 2NXZC 3WFCH 2Z31A 5GRUH 1FNLA 3C5SA 3VDAA 3STLB 4NQVB 4L3EE 2R1XA 3RWEA 1HI6A 3NIDF 1QBLL 4L4VB 1IC4L 4H25B 2VDOH 3PWPA 3ELAT 2DJ4A 1IGIL 2CDFA 3W2DL 2F5BL 3HLAB 4MHHG 3EFDL 4K8RH 3SDCB 3FZUC 2DLTA 4GUPA 1T5XA 1WISA 3WHE0 4JRXE 4QHKJ 4K3DH 4OCSH 1NUNB 3KPPA 1T0PB 3RTQB 1DUZB 5E4EC 3QEQE 4JG0L 3BHBB 4MXVE 4X98B 1GIGL 4Q7DA 2GJZB 3I3BA 1NCAH 3LRSB 4NRXB 3LKNA 3NACL 3QPXL 4XNXL 2ORBH 1QSFA 4L9LA 3U9PH 4RAVA 4RWYH 4RA0C 4J3XA 3BZEB 5I1GH 1MIMH 3GHEH 2GSGA 3TC9A 3W0WB 3BRDA 1UA6H 5IV2B 4O5LH 3LN5B 1TFHA 2PXYC 1U58B 4HIHA 4MCYA 1MNUH 3DUHA 1A1NB 4JFQB 1R0AL 3SDDC 4ISVB 4F7EA 1JPGA 2DDQH 3RPIA 3VE0A 1I1FA 3OKNB 4NQVA 4U6XB 3UJTL 3ZKXB 25C8L 3V6ZA 4NN6B 2GTWB 1FG9C 5CEZE 1ETZB 2YSSA 1T83A 3IDYB 3D69B 4HT1H 2K7PA 3EYFA 4O2FB 1F3DH 1YN6B 5I71C 1RVFL 5F88A 3P77B 3SEPA 1F58L 3IT8D 1CLZH 1KTLB 2ZSVB 1KB5A 4E0RB 3OB8A 4XPTL 1L7TL 2LU3A 2C3VB 4JM2C 1J1PL 1JWMB 3RVUC 4DEPB 1J5OH 4X7CC 4YHZL 5I1IH 1NL0H 5EG6C 4OCXH 3KVQA 4LEOA 3D39A 4OF7A 5JW5B 2OL3A 1MCSA 5DEFA 2GW5A 1G7MB 5GGTA 3LKPB 4WWKB 5FGCE 4X9BA 5KANG 1C16A 2VR5A 3VDCA 1N5YH 1WFUA 2WUCH 4AQOA 2PR4H 5F9JB 3TN0A 2APTA 4EBQH 1DFBL 3HB3D 1L6XA 1N26A 1UZ6E 4ZUWB 1F00I 4U6XA 2X2YA 4MGXA 3KS0H 2CDEA 4BKLB 5EZLA 2D3VA 3D85D 5I1AB 3Q3GB 1I9RH 3CX5K 3NPSC 2AQ3A 4K71C 3X13A 2EC9U 1BP3B 1V3MA 4C58B 3VFUA 1EMTH 2FJFB 5IIEB 2Z8SA 5A1AA 1MAJA 5LCVL 4HUWA 5ECJE 1T4KB 2Q6WA 2IAMD 4QOKD 1KCSL 4NNYA 2QQKL 1WFOA 4YBQC 3H9SB 3DARA 3AU1A 4NC0B 5E2JA 4EI6B 2NY4C 1JWMA 3I85A 5LGKA 3TBWA 1MCPH 1MLCA 1F5WA 1AXTH 3ULVE 4Z7QF 1OTSC 3C9NB 3MUJA 4G9FB 2DIAA 3FN9A 3STBA 3E3QE 2H1PL 4MNQA 2XZAL 5IESL 1J10A 1DBJH 2BVUA 1NMBL 4JG1H 4HGWA 3V4VH 4OZGB 4N8PA 3L3GB 3U4BH 3V5KB 3LKPA 4KAQL 2YRZA 3BJLA 3RWFB 2A6DA 3G04B 3DXAB 4NT6B 4UDUB 5F9JA 4DAGH 5J6GA 3MV9E 3MNZA 1RIHH 3N1GC 1WSST 3DYOA 4G8IA 3Q3GA 3CFEB 4EDWL 1AGDB 3ZT5A 1YEDB 2ZCHH 2B4CL 2XI9A 2FATH 2R0KH 4MVBC 4XWOD 4DCQB 1JZ2A 1A6AB 3RRQA 5IIEA 3KPLB 3KWWB 3ZZ1A 5GRJH 3G6JB 4OLYH 4MD5A 3MV8D 4GG8B 1NC4A 4Y16C 4Y8AA 4OUUA 1T03H 3SPVB 3GJEB 3LY6A 5KSUA 4UOW1 1YPZE 1U8JA 2NY7H 4V2CB 3JTSA 4XI5D 1X6NA 4Y4FB 1Y18A 2HFTA 2NXZB 2QHRH 5D1QB 4PV8A 5HHNB 5C0DB 1B4RA 4ZO6A 3QEUB 3FT4A 3C9NA 4TQEL 4R9HA 2MCPL 5MENE 3MV7A 4XXCC 4WUKL 4R97C 4YR6A 3PGDA 4E41E 4FFYH 4JO3L 5EIIB 3I02B 4FQCH 3VXTA 2O61A 3BXNB 3PJSA 2F74B 5A2IH 5EBMA 5IHUH 4YIQB 3NZ8B 4AY0A 2AV7A 4XB8A 3RVVD 5JQ6H 4MA7H 4JY6B 3UYPA 2BXYA 1DLHA 5MI0C 1MF2L 1XT5A 4XNYH 4OZHE 2P8PA 4PJEA 2F58L 5HHPA 3HPLB 2OR8A 1GH7A 3QCTL 4YZFF 1WV7T 3DGGB 2IQAB 3RX5A 3REVA 4EDXB 4W70A 4F37F 2DI7A 2ZKHL 1AXSB 1M7DB 3I6LD 5T1DH 4UUJA 4DUVA 3VFTB 3ZE0E 3FRUB 2C3GA 2ZWLT 4NN5B 2IADA 3BAEL 5DRXA 3B6SB 1F2QA 1NANH 4I5BA 3DMMB 5JA8B 2R56L 1MFAL 5IF0B 3Q6FB 3RBGA 3P11L 3FB5A 3B9AA 5FYLH 3QEUA 3W9DA 3DYPA 4N0UE 3G5YA 4R26L 4LNRA 4K7FB 1PLGH 3TV3L 35C8H 4Z7WA 5DA4A 3BEVA 5L8LB 4CN1A 3D87B 4RGMC 2VDQH 4UT7L 1MPAL 1OF2A 4PJ9D 1CK0H 3B9EA 3F7YB 5CBAB 5I71B 2X4QA 5F8QC 2NPLX 3MQIA 3BT2L 4YHIA 2QJDA 2FSEA 3U82B 1CCZA 1IAIL 4XCCL 3GRWA 4L8CB 4BFGA 4ZG1A 5T3XE 4MX7B 3O2VH 3QQ4A 4ZD3L 1H0DB 3CCHB 4ODVH 3OJ2C 4TULH 4XBPA 4EDXA 2PXYA 4L29B 5J11C 4I0KA 1BD2D 1TCRB 2EIZA 4NQCD 2R0ZH 3SDDA 4OZ4A 1WFTA 2YWZA 3AAZA 1NGXB 1IAOB 3KPSB 3QWQB 3T0VA 3B8SA 4OLWH 5BS0B 4FTVE 2GAZA 4YPGB 4KPHH 2ESVB 3GBML 5CIPH 5EZOL 5GISL 3RA7H 5ADOH 5JTWA 5K9QI 1SBSL 1XF5A 2C3WA 1KPUA 3QWRD 4MCZB 3UJJH 1XF3B 1RZIA 3GSQB 4DKFH 3X3FL 4LKXA 4WTXA 3INUH 2IALA 4PIRF 5EORL 4R90L 3U4EB 4J6RL 3NPSB 4H0GA 4WHTA 3PABA 4K7PL 4OB5H 4URTB 5MEOA 1TITA 4PRID 2IPUK 3QUXB 1OHQA 2F19H 3JBG7 4JPKL 4U1LA 4YGVA 4Y4HB 1CE1H 4QCIB 5E6YA 3FB8B 4U1MA 4IMLB 5CIPB 3QHFL 3HZYA 1GCFA 4RFOL 5INDA 5L8KB 1GRWA 1RFDL 3O6FB 4P9HH 4JM2A 2C3HA 2NY4B 3O4LE 4CDGC 5MERA 2YZ1A 3QIUD 1MEXH 2Y6SC 5JORB 4J8RB 1SJVA 2QLVB 5IVXF 3WLBB 3A67H 5EU6B 2AEPL 5E8OA 2XZZA 2NCMA 5GHWL 1Z9SA 3OXSB 4FP8L 3CH1A 3QUYD 4YQXL 4WI4A 3S98A 4UT9L 3VFMB 1SM3L 1TPXC 2C7UB 2DQDH 2BY2A 1P7QB 3HNSH 5I1CH 3HC0B 3KPRE 3TNMA 4RCAA 3VXRB 4FG6D 2HKHL 3GMMB 4QNPE 4HS3A 4WFHE 3GIZH 4LSTL 3S37X 1D6VL 3J7HA 3PWUB 4HZLB 3V5DB 1XF3A 4LQFH 1NEZG 2XXCB 2G2RA 3DRQB 4WU5A 3QJHB 1P1ZA 4QHNA 4XZUB 4NCC2 5EC1B 1AHWC 1CTNA 1JN6A 4KH2A 1EIBA 2YD8A 2O93L 4U6TA 1I3GH 1D6EA 2YRLA 1YYLH 3MRPB 2WQ8A 4C56D 2CLZB 1D5XB 4JVUA 1U93A 3SKNB 1RJLB 4DZBB 4K94C 4U6YB 1OP9A 3Q6GL 4FZEH 3RVWC 3RKDC 1XGRA 1LK3L 4J3OC 5CGMA 5F44A 3HUJE 5LWYH 4M8VA <