5AYUL

Crystal structure of hyhel-10 fv
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Crystal structure of HyHEL-10 Fv
rcsb
source organism Mus musculus
total genus 23
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2015-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ayuL00
1KNOA 2P5WB 1OTTD 3DECA 2Y6SD 4CU6A 1S7SB 2V5TA 4PJ5D 4P3CH 3OHXB 4KHTH 1CXIA 4XPGH 1F4YL 3ALXA 1ETZB 4IIQB 2B7DT 1C12B 4YDVA 3MZGB 3O6KL 1CVRA 3I84A 4JKPH 1QFWM 3VXTA 1V3LA 3WJJC 2K7PA 4YEFA 4MA1B 2BHZA 4P2QD 1BD2D 5B8CC 5GIRB 2DQGL 1IGCH 3C6LB 1Q9KA 5FCUL 3VXMA 5DJYB 1VFOA 4GG8B 4F33B 2FZ3A 4FZ8L 4MNQB 5KSUA 4LHQB 3STZA 2P7TA 3D9AL 1TTGA 4Y16C 1FO0A 1IT9L 3AS3A 1QFHA 2WBWB 2XWJB 3BH8A 4PLJD 3MPCA 1S7UB 3LN5B 2GSIB 5DJCA 4QOKD 5JXEA 5BW7C 2NTFB 3JUZA 2CKBA 3IXTA 3OXRA 2VL5B 2QQKH 1CFNA 3CVHH 1AIFB 4U6YA 3UTZB 5J1AA 3F6LA 3NFPA 2IJ0C 4HKBB 2K7QA 3WL9A 2ED8A 5D6CB 5GRUL 3S3PA 4KJQD 3T08A 3PWNA 5B3JF 4G9FE 1JHKL 4ZFFB 1GC1C 3RUGF 3EW3B 5TE7L 2EDRA 4A2MA 5EIQA 4WIQA 4Z95H 3FHAA 1KB9K 1NKOA 2NXZC 2AJVL 1AC0A 2F54B 1JGVH 2CLVA 3L9RA 4Y4HC 5B38B 5GS1B 2OP4H 4E5XB 5J1SC 3U36A 3D39B 3GSVB 3KPQA 3HNTH 5ESAB 2HP4A 1U8MA 4GRLA 1N0LA 3N0PB 2EYTB 1MFAL 1BX2A 3KPSD 3O81A 3O9WB 2YMXL 4OD2B 4IRJA 3H6JA 1G0DA 5GS3A 4LPTA 1G6VK 1YUHB 4OZHB 3HZYB 2V2XA 4CDHA 5IWLA 4W68A 5BS0A 3HG1A 4QXTB 4OD3L 5JXEC 3MR9B 5FYLH 3VGHA 3TLRA 5JORB 3LKQA 4WCYH 2JB6A 4J8RA 1P6FA 2VDOH 3QCUH 3LPWA 3RZCA 2YPLE 4UOJA 5D2NE 2GUOB 2LVCA 3HZMA 1NEZG 3BYTA 4X7SH 2YC1B 3QPXH 3LKSA 5I19L 5D7IA 4HAGA 3DSFL 5DMYA 2Q86A 4RX4A 2FSEA 5I15L 1FNGB 5D2NA 1I8MA 3HR5B 2IAMD 4D3CL 3MYZA 1KGCE 5LQBL 2O5XL 1F4WL 3HI5L 4M1DL 3WFHA 1OGAA 1WC7A 4JHWH 4KUZH 1JGEA 2APTA 3U0PB 1YEEL 3ARGD 3PDGA 5IP4A 3MLRL 1J5OH 3DX9A 2XZAH 4IRJC 1HEZB 1H5BC 1SMAA 4P4RB 3QFJB 1D5IH 1T0PB 4PJBA 4NOBA 4Y5XB 3VH8G 4YE4H 3PWUB 1NCAH 3E8UH 4OB5H 1YMMD 5IV2A 4JFFE 3DTXB 2DQHH 1QKZL 3VRJB 3IETA 3IAPA 4JVWA 1R3HB 3MUZ1 4QHMB 1DL7L 1XGUA 3DRTB 4JFFA 3RKPA 2YPKB 4MDJB 3UZVB 1YY8A 1HWHB 4NZDA 3PL6D 43C9A 5JMRA 3KPNB 3MV7D 4PJHA 2I9LA 4WW1B 5DVLA 4J2XA 3EYFA 1DLFH 4HS3A 1MQ8A 5D2NC 2E3VA 3O4OB 2C3WA 4Z8FL 2YD4A 4EN3A 1ZGLP 4G7YH 2A9MH 4G6MH 5I76A 2LU3A 2M1KA 4KWUA 1NMCC 5FAAA 4U0RB 4OCSH 3VXRA 1S7XA 5CILL 4PRIB 4X6DE 4AENB 1EAJA 2QL1A 4DAGH 3P0YL 3TP4A 1T1XA 4XNZB 5EIIA 5DMIH 3RA7L 3T4YA 1A2YA 2XZQH 4X6DA 2VMFA 1TLKA 4NKQB 5CP3H 3CFDA 4HIJA 3MV8D 2AJXH 1TENA 2QSQA 5GRVK 4HWBL 4JRYA 4FQQA 1TIUA 1NDGB 1V05A 4Q0XH 4LCCA 5IW6A 3V5HA 3PG2A 4FQCL 4C55A 2AQ1A 1ZA3B 3E6FB 1U91B 1P2CA 5F88B 1G9NC 3PDOA 1F90L 5CIPA 5HHNA 1WGOA 4EN3C 1W0WA 3UJIH 4QHKI 2A73A 4RNRA 5BOZG 3PV6B 3P0VL 1K6QL 4LSVL 4MA7H 2N7AA 3FOMB 4LDLB 4NBXB 3TN0B 2VXUH 3P40A 5T3ZH 4IRSB 5T5FL 3P3YA 2D4FA 5HGHA 5FA3A 3OR6B 4I0PD 2ADJB 3CDGB 2JJWA 1HNFA 2ZG3A 3EJYD 3IKCB 4LFHG 1RURL 4ZDHB 3I85A 4DGVH 5IMLA 3WNKA 2UVEA 5GRWA 3ZDYE 4LP4A 1OL0A 2DIBA 3LH2H 5IESH 2VXVH 4BUHA 1A6UL 2HT4D 4HJ0D 3ARED 4NC1E 1DQTA 3HLAA 1FV1A 4GXUM 5I73B 4PJIE 5DC4B 3ARPA 4YDKL 3NACH 5FO8B 1A14L 2FHBA 4TYUA 1AQKH 5FHAL 4Z7OE 3O2WH 4LSTH 1F8TL 3FT3A 2W38A 4KKBC 5E8PA 1PD6A 5E08H 2R1XB 1DZBA 3ULUE 5J13C 3BUYA 4FNLH 3OJ2C 3PWVA 2NY0C 2VB5A 1KV3A 3MRNB 3QDHA 3KYKL 5EZLA 1TTFA 4RFEB 4HLZG 4KJPD 4LOUD 4ZOAA 2PO6A 5F9JB 3JTTA 3NN8B 1RIHH 1QUNA 4LLYA 2BHYA 4XP4L 3HNVL 5I74B 1I7UA 2J8UE 2ZCLL 3KNBB 4OZ4B 4BSVA 3OAUH 1UB5B 4UAOB 5F96H 2R0WH 2J8UA 2GITB 3DUUB 4LVNB 3H3BC 2A74A 1DQLH 4X9GA 1KJVB 5KS9E 5F7NC 4ODXB 5GJSL 1PKQA 1M71A 1ES0B 2LTQB 3P73B 2XWTA 3WFCL 5K9OB 2H2PD 4NJAH 2VDLH 1KT2A 3V4VL 4M43H 1HQ4A 4OCXL 1X5HA 2NY6B 4G9FD 2Y5TA 4Y5YA 5AEAA 5D7KE 5B39B 4MJ4A 3QHZL 1A1NA 1RAMA 1RULL 4XPBL 3ULUC 4FXGA 1ORQA 3L3OA 4QTIH 4XMPH 5BZWB 5IFHL 5E2VL 3VXNA 2Z91A 2WW8A 4LAQL 5JR1H 3MRDA 3EO9L 4LL9A 2YSSA 2F58H 4JR9L 1C5DA 4XCFL 1I9IH 5F7UA 3QIWD 3BI9X 1TITA 4Q9RL 4IS6B 4GKOA 4GMSH 3RVVC 1U8OB 4LCWB 3P9LA 5JHDB 2BY0A 4ZXBD 1SYSB 2VLRB 4X9FA 1X3DA 4DKFL 5FKAB 2YR3A 1VEMA 1EK3A 1YC8A 2AEQL 1YMHB 1URLA 4LSQH 1HOCA 1K4DA 5TFSL 2CD0A 4M6OH 3WXVL 1WFUA 5HDQL 2R0LH 4JFXA 3MNWA 2F5BH 4U1MA 4AH2B 1YEHL 5EFIA 1DR9A 2QQQA 2XQYK 3C5ZD 2KBGA 1KJ2L 2DWEA 3OF6A 3WUWB 3MC0A 1BEYL 4S1DD 5IK3A 1AGEB 1R3JA 3LQAC 3FKUS 4MJID 3O6FB 3HMXL 4XNYH 4JANA 2NY5L 3I75B 4GSDH 2DQCH 4MXVE 3OJDA 4DK6A 3BP4A 4PJGA 5E8DH 5MENE 1JGUL 4YHIB 4MAYD 4P5MB 1Q0YH 2NZ9C 3KHOA 3VFSB 3PHOA 4WU5B 1KIUA 2ADGA 4HGMA 1KB5L 5E95B 5IR1B 4WO4A 1XF3B 3S96B 1KIQA 3O3DB 5HHXL 5DVOA 4OZFH 4Z7WF 4Y89A 4ZMAT 4X4XB 4Z7UF 2G75B 4TNWK 3U4BL 5AD0B 5ANME 5D2LB 2QADD 3D48R 4TTDD 1QFPA 3LKPA 4OTXH 1R3LB 4UBDD 3W2DH 1OARL 1I1FB 2R69H 3TBSA 4X5XA 4G8GB 1QEWA 2V7NA 3O3EA 3VJ6A 5DI8B 5KW9H 4NN6B 3WE6A 1HHKA 4HKJB 5HHVL 3DI2B 5LBSL 4MA8H 3TH4T 3U7AA 2MPAH 3IJHA 4FQ1H 4ZPVA 4LCUA 3EFFA 1JL8A 3FO0L 4S1SH 5EBWA 2XNAA 5HGAB 1LO0L 1LEGB 2AKRA 1SEQH 3VW3H 3SN6N 5J7CC 1M7XA 2VDKH 3GKZA 1G7JB 1VGEL 3EOTH 5BVPH 5KN5A 1S9VB 3OWEA 4LHJB 4XWOD 2RFXB 2X4QA 3FMGL 5KVMC 3DO7A 1RU9L 3GMLB 4Y1AA 4XCYB 3PP3K 4HJJH 4DUVA 4WHYH 4OLUL 3WIIH 4HMEA 5KVGH 5FGBC 3DX6B 4D9QD 2HFGL 3NBNA 3H9YA 4LQFL 1PG7H 3QULB 1QACA 2Z4QB 4U1HA 3TBTB 1UM4L 5F1SA 3V7MA 4P9ML 5HD8C 2Y7QA 3D18A 2XTJB 4ZS7L 4UUJA 4LARL 1N4XH 2RQ8A 1UM5L 4D9RE 1I9EA 2VAJA 1CR9L 1NGWB 5FYKD 5T5NG 1CIUA 4AMKL 1T6WA 1IGJB 3P4NA 5D7LA 1O7VA 4NM4L 3F7PC 2C3HA 1X5GA 4DVRL 2NY3D 1JNHA 2ZSWA 2BVPA 3AUVA 3KHQA 4PJFB 4YJZL 2UVFA 4Z7VB 3ZT5A 4HW6A 2ADFL 4X9IA 1Y0LB 4TVPL 1ZS8B 3BAEH 4V1DE 3PUCA 3O3AB 1Q72L 4I8DA 4CN4A 5K9QG 2NY2B 1FG9C 4YHNA 3ULUD 5D7JD 1E27A 4ZAKA 3D2UD 3RWCA 5CAYB 1GXEA 2WAHA 4V1DA 1FNEA 4UQ2A 3FRUA 3MRPB 2DJUA 2FH8A 4GH7B 4YHLH 2XRAH 3FB8B 4OKVA 2PYEA 4AG4H 2BSED 3IB4A 4UV4H 4N0RA 3TJEH 2QSTA 4HWZA 5EN2A 4QRPB 1WLHA 1FORL 1A7PH 5EB9A 3VFGL 1J8KA 2KZWA 5F3HA 1MRFH 3TPUB 4OCNC 2R2HA 3RWJA 1FNFA 1XF4B 4QTHA 4LKXB 1VA9A 1ZTXL 5FV2A 2BRRH 3WKMH 1EHLL 4XZUA 2PKDA 1BVLB 1U3YA 3QEHA 4EXPX 1O5DT 3UXFA 5FUZH 4CMHC 3N1GC 5K9KB 5HHOE 1KJ2A 2W9EL 3CLEL 1PGRB 4HULB 3BDYH 1KBGL 5IBLD 4NO5A 5E1HB 4FMFA 3KYMB 4RGNB 5DJDA 3UTTD 4KVNL 5BRZE 4OUUB 3TV3H 8CGTA 3SDDA 2I07B 1VPOL 5JW3H 1DVFD 2EDWA 4J12A 4WUKH 2HN7A 5D7KD 3LDBB 4W4OC 3FCTB 3N1FC 5IW3A 5H35A 4HZLB 5F89B 5KAQG 3A6OA 1UVQB 3MLXH 4HUKB 3V5DA 4BZYA 3HI6H 1HNGA 1KB5A 4Y4KA 5CMAB 4O4YL 3QRFM 1XT5A 4IOIA 3C8DA 4H88H 1NBVH 3JV6B 1UEYA 1XGRB 1JWMA 4KQ3L 3OTTA 5EPMB 3DYPA 5TPWH 3L1OH 1NC2D 4MX7B 4N8CL 1OAYL 4ZFGL 4H26A 4XX1G 4X6CF 2FNBA 5L9DL 5E8NB 3WFBL 3PABB 1UYWH 3TT3H 2X4SB 3GMQB 3MLUH 5CUSL 3WJLA 3L7FB 4YX2L 3MV01 4KTDL 3BKJH 4FG6D 2EYRB 1I4FB 3BN9C 4NDMA 1NFDB 2DD8H 1PW3A 3SDDC 2NY5C 2VH5H 3MOBL 3G6JE 3MOAL 1S9WA 3RI5F 5FGSA 4GMTL 3SCMD 2UUDH 1XIWA 3QPQC 4J1UA 5HGDB 2QEJA 2V2WA 3QUXD 3RNQB 4AQOA 4O2FA 3MMEB 3JWDL 4BH8B 5ETUA 3BXNA 4PJEF 2QHRL 3IU4H 3V4PL 2W0FA 4ZUSB 3CSYA 3JTSA 4L3CA 4Y4KC 4ERSH 4MDIA 1FZOA 1CIDA 1G7HB 4QLRA 4JY6B 5L88H 2X4PB 2MWCA 3V6BR 3VD7A 4NHCH 4L3EE 1FZKB 1FAIH 2P24B 1IVLA 3S8WA 1YECL 2R9HC 5DO2C 4MLSA 2EH7H 1GGBL 2CIKA 5EOQH 1ZEAH 3WJLC 3HAEG 4NQSA 1NCBL 4ENEC 3TPKA 1W72A 3L3DA 4TPRH 3MLZL 1EJ6A 2X2YA 4NCC2 2JE8A 1EEYB 2HG5A 2CSPA 4OLVH 4P5TA 5D4QA 1DEEA 3SDAB 1MAJA 5C8JA 5MP6H 4FFYH 4GS7C 3RUGA 4ODSH 2BFVL 4Z7OF 4J3OC 3VI3E 1ZT1B 4PTTB 1ZAGA 2H32H 2X1QA 4WW2B 4BQBA 4GKZA 1YYMH 3D3VB 3V0AC 4HS6B 3W9EA 3QFDA 1MSPA 4GXVH 4S0SD 1XR8B 3B9EA 3BP5A 1NSNH 1MWAL 1I1YA 3VFWB 5HYJB 1OSPL 4OIIL 4HT1L 4RWHA 1KN4H 3U2SB 4YHOL 3C2AL 4CMMB 4GUPA 4BJLA 1W8NA 5BQ7B 4DUXA 3VD3A 3EYVA 1JN6B 1B6DA 3EO0B 1S7VB 1D9KA 3GSWB 2HRPH 3R0NA 1EFXA 4JRXA 3RU8L 1MOEA 1I8LC 1EZVX 1NGZA 1M7DA 3KPRE 5TH2A 2NW3A 5IHZA 3HE7B 4XPTH 4D94A 2HVKA 4O2CA 2DICA 5KSAB 2KQNA 3SGEH 5I1IH 1YEJH 2PYFA 3SY0B 3Q6FA 5KVEH 2FIKA 4K23L 5AUMB 1YQVL 2CXKA 1OAXL 4LSSH 2J12B 2EIZB 3KLSA 4U7SA 4ODWB 5C08D 4EBQL 3QJFA 2AJ3A 4JFQA 4MHHI 3EDEA 3BGFB 2WMPA 2WP3O 4ONGL 4WHTB 4X6FA 4U4BA 1ZHNA 4I3RL 8FABA 4APQC 1R24B 1D9KC 1F4AA 2LE9A 5I1AB 4YHMH 1IKNA 2X4RA 4QHKJ 4CW1A 1PDKA 2ZJSH 1P84K 1VESA 1XGYL 5H94A 5KSBF 2QJDA 2ARJQ 4BZ1H 4NKMB 2AEWA 2DRUA 3WEXB 3RTQD 4HCRA 2D7MA 4U1SA 1OLLA 3ZLQC 1KENH 1NMBL 3GM0A 1O7SA 1TFHA 4PB9H 5KVDL 3ZO0A 2DN7A 3KPOB 1U8IA 2OL3H 3BEVA 1F3RB 2WZPD 2NZIA 3TA3D 2DQUL 3VFTA 5C0IA 5I1CH 4HIIB 2VR4A 1LO4L 1LHZA 3VFNB 2OBGA 2NMSA 4HXAH 4XPHH 5BMFH 4G9DB 1QBLL 3MRQB 3VA2C 2R2EB 4OCYL 1EEZA 3TIDB 1T5XB 3HA0A 1OCWL 5EC2A 4QT5B 1CICC 3R1GL 2FX9L 1KNOB 2PXYD 4ZFOL 4P2QA 1A1MA 1ONQA 3KYOA 1IKNC 3A6BL 5JLZA 5TDNA 3C08L 5EU4A 3LS5H 3W0WA 1GIGL 2XN9A 2NY1C 3WFEL 4L3AA 2NXZB 5EORL 4LASL 2HT2D 1G7QA 5BRZD 3DHMA 1U42A 4GW1A 1E6OH 2YPVL 3VI4F 2BVQA 1BAFH 3MYJB 4LLMA 5D7SL 1Q9KB 1E4WH 2VZ3A 5DQ9B 3VXMB 4S10A 2BVTA 4NZRL 2FZ3B 2VN7A 2OMNA 4JKKA 5KSUB 1X9QA 2P7TB 5DEZA 4DCQA 2I60L 2YEZA 3U48A 3BH8B 3HC3L 4JY5L 3NIGE 4ZQKA 1EH9A 35C8H 5LGJB 5DJCB 5DYOA 2L7JA 4LMQE 1F13A 2J4WL 5DO2D 1U2HA 3IXTB 2CKBB 3OXRB 3SDXF 4UTBL 5SWSE 1CFNB 4U05A 4L8SC 4U6YB 3BIAX 5J1AB 3VGBA 4ENED 3I2CH 3NFPB 3WL9B 5CJQL 5GRZA 3PWNB 3HMWL 2R23A 1LD9B 4JG0H 1FYTE 5I1GH 1L9NA 1U6AH 3G5YA 4M93C 3BE1H 1JZ3A 4BZ2H 4Z5RA 3I6LD 4M62L 3FTGA 3WN5A 4M7ZB 1NCDL 4R97B 4WFFE 5EUOE 5LG1A 1I3UA 1N6VA 2CLZB 3L9RB 2CLVB 1C5CL 5FYJE 4L9LA 2B1HL 3MBXH 3U36B 5F6IC 2AXGA 5LWYL 1U8MB 3TWCH 2D31A 3S34L 1BX2B 1XH3A 4IRJB 1IKFL 1H5BB 4RA3A 4Z0XA 1MWAA 4N90D 1QNZL 2V2XB 3HC4H 2AV7A 5BS0B 1ZLUK 3HG1B 4RDQF 4OF5A 3U9PL 1CGTA 4YK4C 3RGVA 3MNVA 4Y0GA 3LKQB 1X5ZA 2JB6B 2P45B 4J8RB 4L3ED 2ERJC 3V2AR 4JKPL 4MD4A 2GK0A 3G5ZA 3H9SE 3HZMB 3ARGA 3BMWA 3GHEL 3LKSB 1MAKA 2YPLB 2Q86B 2FSEB 5D2NB 1IC1A 1CS6A 1I8MB 3CSPA 2DBLH 4PJXF 5DC0A 5M95B 3WFHB 2EXYD 1OGAB 5L2KE 1WC7B 1YMMA 4L9LC 1JGEB 1OTUD 5TDOA 3DX9B 4TNWF 4G6FB 5TGBB 1QTYT 3GBLA 2HKFL 5DJZA 1NFKA 4R2GC 1EZVY 2DLGA 2YUVA 4PJBB 4PLKC 4XB7A 3PL6A 5GRYA 2RJMA 1RJZB 4ZTOL 1DTUA 3K4DA 3IETB 4GRWE 3MLYH 3RX8A 4X0KA 1T1YB 1XGUB 4JFFB 4Q97A 4PRNA 2GT9A 4Z95L 4Z76A 1ZLUH 3KPLA 4L5FL 1YY8B 1HXYB 43C9B 4PJHB 3VD9A 3EYFB 1FZMA 4YWGH 2OP4L 1RZJC 1UACH 2DLHA 4F3FA 3QI9D 1TJHL 1ULVA 4L29A 2HTKD 2E6JA 4I77H 3OAYK 1RFDL 4EN3B 2GJ6E 4KV5E 3QZWA 3KG5A 5I76B 4XWGH 3VXRB 3L5XL 1WZLA 2YD9A 4YQXL 1K8DA 1KFAL 5BJTA 2FGWH 2DTMH 1T1XB 4XVSH 3GMNA 5EIIB 1SVCP 1JCKA 2MNUA 3D85A 3QCUL 3T4YB 1A2YB 1KLUA 4X6DB 4PJ9D 2BSRA 1A6VL 2MMXA 3CFDB 3CDYA 4HIJB 4OGXL 3LHPL 2O61A 3H7BA 4ZFOA 2B2XH 4JRYB 3ZKXC 4FQQB 4LLWA 5IVOA 4NQEA 2VITA 5IW6B 3LKNA 3V5HB 4XVJH 1G7IA 4BFIB 4NZTL 3F58H 3NMEA 4WWKD 3U1SL 4HG4J 2AQ3A 4XVUC 4Z7WA 3E3QE 4KUZL 1CFQA 1P2CB 2Z35A 2WWKO 3JSSA 4Z7UA 1AHWA 1KCSH 4EDXA 1GRWA 3PDOB 5D9SA 4H1LA 1F3DH 4KKCD 5CIPB 5JOFA 4Z9KB 5HHNB 1TZGH 3F65A 1W0WB 1YEFH 3PNWA 2VZ1A 5F1IB 1OAUH 2A73B 4A2LA 4M4RA 4RNRB 3FB7A 5E0QA 1D5IL 1F5WA 1DSFL 1UA6H 4MLIA 4XCEA 1IGYA 1NCAL 1MVUB 4KQ4L 2DQHL 5FA3B 5HGHB 4IMKA 1JV5A 5LVEA 1F02I 2Y07H 5DJ2B 4K3EL 3W5MA 2CJUH 3HLAB 1FV1B 4MSWB 3U9UA 1CQKA 4D0BA 2YKLH 1DE4A 2P5ED 4PJCE 1DLFL 2VTFA 4FQJL 1D5XB 5I6XB 4AEEA 1T7VA 3P77A 1J7VR 4KUCD 1U8LA 4G7YL 1PX3A 5KTEH 2A9ML 1SEBB 1A5FL 4PFEA 3FT3B 2F8OA 5E8PB 3FJTA 4OCSL 4W70A 4O58H 4NQXA 1AHWC 1JI2A 2Z31A 3BUYB 3VG9C 4D8PA 1V7MH 4UNVA 2NR6C 3RVXC 4AEIL 4URTB 5I8OH 3E3QC 5EZLB 5C3TA 5FYKL 4O5LH 3WO4C 3ZTNH 4O00A 5DHVB 5AG9A 2Q87A 1FNAA 3JTTB 4LLYB 4UV7H 2AJXL 1CQYA 4X7CC 1I7UB 2IPUG 2YBRA 4BSWA 4NO2A 4I0KA 4BSVB 2A38A 2VXSH 4GW5A 1NGPL 2J8UB 4TSAH 3ZKNC 1QSED 5BVJA 5SX4H 2A74B 4ODHH 2KDGA 4AEHH 3VI3F 4N0CD 1AI1H 5FUCE 1J8HD 1M71B 3BRFA 1JI1A 5SWSD 2XWTB 3G6DH 3UJIL 3VXUD 1I3RA 3ARDD 4KRLB 1IFHL 1CGXA 1KT2B 4K94L 4MA7L 5LGHH 4D0DA 1A7OH 1MIEH 2D9CA 1FYTD 2Z31C 2Y5TB 5FCSH 1KYOJ 4Y5YB 3PV7A 2KUTA 3MO1B 5GGUA 5TQ0L 4XP9H 5TF1H 4WFFD 2W65A 3GBMH 5IESL 1W2KT 4FXGB 5ENWB 4ZXBA 1ORQB 3L3OB 2X89A 4TTGA 3RDTA 1A6ZA 1K9TA 3VXNB 2Z91B 4PGCA 4RAVB 2D2OA 3MRDB 2HFFA 2YSSB 4RISH 5IT2L 1C5DB 2FATH 3IF1A 4JFPA 4Q9QH 4RMQA 1YNTA 3MRJB 3CXHK 1RHHA 3P9LB 4EI5D 4UDTB 2W0PA 3MRKA 2K9UA 1ZHBA 2FDBP 1GZQA 5GRVL 1QBAA 4KTEH 1PG7W 5E24E 5BXFA 4CGTA 2BNUA 2C3VA 1HOCB 1K4DB 5IB2A 4IDJL 2E7LA 3MNWB 5FYLE 3WYRA 4QRTA 1ZV5A 1JZ6A 4P2YA 1RIHL 4JLRA 4U1MB 4MAYA 1XCTA 5EFIB 4H20H 5KBNC 4GAFB 1IGFL 3V4UH 2DWEB 3WNOA 1R3JB 5J6GB 2Z8RA 3HUJE 2DLTA 3RDTC 3H3KA 4WI3A 4JANB 1XZ0A 5L2KD 2AI0H 2R2BB 3LEXA 1NL0H 3CX2A 5LKNA 4WV1A 3OJDB 3BP4B 4PJGB 4XC3H 4UT6L 3HUJA 2HWZL 4HD9A 5FK9A 4DTGH 1IM9D 1KCRH 2VSCA 3ULSA 2ADGB 4KKLC 3DV6A 4NJAL 1JGLL 4CADA 4WO4B 4NKIL 4M43L 2CPCA 1X4XA 4LPWA 4AT6B 5IW1A 4G43A 2B1AL 1JFQL 2P8MA 5F7DA 4YBQD 5CGTA 5CD5D 2VWEE 2DM2A 3LKPB 3ZDZE 4X6CA 3DX7A 4J3VA 2X41A 1MNUH 1BOYA 5HVFB 2BCKB 1RSFA 3TBSB 5JR1L 2F58L 1QEWB 4HF5H 2V7NB 3O3EB 4ZOCA 3VJ6B 4Q58C 1I9IL 1PQZA 2E9IA 3WE6B 4LSPH 4YXKH 1HHKB 2B8OT 3QEQE 2FEDC 2GJ6D 4GMSL 4KUCF 5C0CE 5C9KA 5I2IA 4M7LL 1EVTC 2FD6L 3IJHB 5I1KL 5J3HD 3IT8D 3EFFB 3RQ3A 2P43B 2XNAB 4J7RA 1ZVSA 1T0NA 1TJGH 2AKRB 3U7YH 2WIIA 3BD5A 3Q1SH 4K7PX 3DETD 4PJEA 1OVZA 1CGSH 3LZFH 3RKDD 5BO1H 1N7ML 5GSRA 5KN5B 1QSFE 3DMMC 2X4QB 2F5BL 3DO7B 5DUMH 4Y1AB 4DKEL 2NY4D 2NXYC 2DKUA 1IAII 4UQ3A 1HWGB 1VDGA 3NIGF 1YPZE 3O3BB 1HI6A 1Z3GL 3ZYOA 3GK8H 4GSDL 4U1HB 3WDJA 3BZ4A 3OKKB 2Y7QB 3D18B 1Q0YL 1SBSH 1EHAA 2ZUWA 1OTSC 2MJWA 4UUJB 2QTEA 1LP9A 5IB3B 2FECI 5CD3A 1F58H 3CC5A 1E0OB 1ZLSH 2F8XC 5CSZA 3P4NB 2CGRH 4WTZA 1DBAL 1YYLH 1RY7B 15C8H 1ROWA 3I50H 5EUOF 4WEUD 3B9VA 2AV1A 4G7VH 5IROA 5T3ZE 2C3GA 1WV7T 3W2DL 2R69L 1JNHB 2ZSWB 2BVPB 3SDYH 3GRWL 1KF9B 1P53A 2XY2A 2JIXA 1I1RA 3FAXA 5D1QC 1MFEH 3VFRA 4CUCA 4MA8L 1H15A 3MLPA 2MPAL 5LAXA 1WICA 5C0JA 3HE6D 3T2NH 4YHNB 5FDWA 1E27B 4ZAKB 3RWCB 4EIZC 1G6RH 4V1DB 5IMMA 1U8JA 4UQ2B 3FRUB 3QDJE 1MEXL 1OAQL 4KZDL 3VW3L 3RJQB 5J0BA 3OPZH 4OKVB 2PYEB 4NIKB 4IOFD 3EOTL 5FHBH 4HWZB 5ELIA 5EN2B 1E28A 1FFNA 3NVQA 3EZJB 5T1MA 5HI4C 3QO0A 5F3HB 3QXUA 1JPGB 4LCIH 2R2HB 2ZZUT 4QTHB 4C56E 1JRHI 1XF5A 3UTTA 1B2WL 4XZUB 5F9DC 3QEHB 3QG6A 5TE6H 1OPGH 4TSCH 4JZJA 3CIQA 1SQ2N 1Q8MA 1KCVH 1IM3A 3AGVA 3TEUA 5F7LB 1KJ2B 1GCFA 4K55A 4OLYL 2FHCA 4NO5B 4HUVA 1ZANH 1U0QA 1TQBC 5DJDB 1J12A 3P9WB 4MHHG 3ARWA 4X83A 3SDDB 2P49B 5HHOB 4LLVA 5GHWH 4F8TA 5HYSG 2HN7B 1NMAL 5H35B 1X5LA 4PJ7F 2AJYL 5DZNA 5EIVA 3OKDA 4U2YA 5DFVC 1VEPA 1WTGT 5C0DA 3V5DB 3TZVA 2CQVA 3H9HA 3BPNC 5KSBA 1QSVA 4EI6A 1KB5B 4Y4KB 2FH6A 4IOIB 4KKLD 4OF0A 1JWMB 3AS2A 1UWGH 4E41E 4CRPA 1CL7H 2CR3A 4IEFB 4QRRD 4L4VE 5A2JH 5IM7A 4H26B 2BNQA 4OFPA 4XPFL 5IFJB 4TUKH 1LDPH 1YEIH 2AEIT 3MA9H 3SCMA 2DDQH 1YZZA 4JZJC 1LMKA 3RVTD 4O02H 2F19L 3SBWA 3QUXA 5HHPA 2ZCHH 1A4JB 1S78C 4R4FH 4AG4L 4NNPH 1DBMH 2JLLA 3DGGA 2MQCA 2FEDD 4QNPE 1EO8H 4B7IA 1BECA 1S9WB 4NHUA 4MNGE 1A7PL 1XIWB 4J1UB 1CXEA 4GS7B 5F7EL 4YHYC 3MJ9L 2V5MA 5IB1A 2RHEA 1SJVA 3RZWA 2V2WB 3FONA 1MRFL 4O2FB 5ETUB 4WJ5A 3TZVC 2W0FB 2W60A 3NPSC 2VR9A 3CSYB 3JTSB 4EXKA 5C0RL 5JIIA 4HHAB 1NCCH 4YNYA 1SJEA 1FZOB 4LHUD 4PBXA 5FUZL 4UMGA 3T0EE 2ZUYA 3ZKMC 1SM3L 5D8JH 2FO4A 3QQ9D 3BDYL 4ODTH 3SDCA 4R0LC 3T0EA 5TE4L 1ZA6A 4EOWH 2CIKB 4JPIA 3TV3L 5JW3L 4NQSB 1RI8A 4F7PA 1BQLH 1VHPA 1W72B 3L3DB 3SDXA 4K7PY 3NA4A 1VACA 2IC2A 2HG5B 3MLXL 4P5TB 1DEEB 1QP1A 3HI6L 3LN4B 3MX0A 3DUHA 5C8JB 3CXDH 2VQUA 2VIRA 2X40A 3RUGB 4OZFA 1JF6A 3SE8L 5D71H 3QEQD 1I1CA 1OD9A 4GKZB 4WHDA 4F8QA 1PFCA 5DGQA 1AR1D 3SKNA 1NAMB 3W9EB 3QFDB 1X5YA 1AXSA 4XNMA 4GLRH 4WGWB 3MLUL 5CGYC 3GRWA 5B22A 1AXTH 4CU7A 3BP5B 1OM3H 1YA5A 2CRMA 1I1YB 3SDCC 3T0EC 1QSFD 2DD8L 5D1XA 4GUPB 4HQQH 1KTKE 1HHIA 3ZL4H 5ERWA 5CEZE 2VH5L 3EYVB 5J6HA 1E6JH 4E42A 1D9KB 3PXJA 1T4KA 5GISH 1Z9SA 4NQVA 4U6HA 4PRPD 1EFXB 1X4YA 3V7AE 4JRXB 2G5RA 1IZKA 4XNUL 1H3XA 1H3PH 3EGSA 5AYQA 1NGZB 3IU4L 1M7DB 4QO1A 1FCGA 4QHUA 1V3KA 2NW3B 2ORBH 5TH2B 1G1YA 5IHZB 1WTLA 2ED9A 2HVKB 5CFHA 4O2CB 2ICCA 5J89A 1B88A 5ADOH 3P30L 4J3UA 5L88L 2PYFB 3Q6FB 3ULVE 3BKYL 2FIKB 4MB3A 4LFHD 3S5LA 5HI4D 5J56B 3ZT7A 4LSUH 1ORSA 4LIQE 3F7VA 3QJFB 2AJ3B 5EOQL 1T66D 1ZEAL 2VE6A 3FN0L 4YBLC 4POZC 5MEPB 1LGVA 4TPRL 4JDZA 4X6FB 5MERA 2X9YA 1ZHNB 5D1XC 4OLVL 8FABB 3RBGA 1CICB 3SKMA 1FGVH 2CKNA 5E4IA 3U83A 4MQXC 3AMKA 3ARSA 2M26A 2XQBH 4YHZL 1RZKH 1EAPA 4WI4A 2X4RB 2IH3A 4JKLA 2GQHA 3WDIA 3WLWC 3H3PL 3TA3A 4CW1B 1U8KA 2NY1B 2X1OA 1FO0H 5H94B 3JWNC 2ESVE 1X6LA 4CVZA 4R9HA 4GXVL 4U1SB 1FQ9C 4XNQA 1E4XH 3QDJD 1OP9A 3GO1H 1NSNL 3MXVH 5ICXB 3BKCL 5IVXA 1YDPA 5GGSY 4YFLF 1HDMA 2HH0H 3ARUA 3RWHA 2HMID 4RWYH 1T2QH 4NBZB 4NWUH 2NW2A 4XT1C 4LPUA 5CINH 2DOCA 4J3XA 1QR1A 1MH5B 3QQ3A 2HRPL 4IJ3B 5GS0H 1EEZB 3RBSA 1RVFH 4OLZH 4C56D 5EC2B 4L8SB 1C7SA 2IGFH 4P2QB 3R06A 3VXSD 1ONQB 3KYOB 4AL8H 4I1NB 3GEWB 5JLZB 5ILTL 1CT8A 5C9JA 5TDNB 1YEJL 3MJ9A 5EU4B 3MRBA 3W0WB 2XN9B 1MVFA 2ARJA 2V9TA 1G0XA 1JHLH 4GW1B 4IOSD 4LU5H 3D5OF 2BVQB 4M6NH 3RIAK 4LLMB 3WNLA 3FFCE 3QDGE 1CE6A 3N1MC 4V2CB 3OQ3B 3EZ8A 5ID1A 4PJ8D 4QWWD 2YEZB 4ZQKB 3PIQA 3KYAA 5KOVC 1RUPH 5DYOB 5D1ZD 3VRIB 3OB8A 4UNTA 4P57A 3P9MA 4YK4B 4YHML 1KB9J 3U46A 1CD9B 4JFEA 4L4VD 3ZHKA 1NANI 1U58A 4KJWD 2ZJSL 4NNXB 1WWWX 1N0XH 3DXAE 5DRNA 3VDBA 4BZ1L 3VFMA 2R23B 1VENA 1S7QA 1KENL 3G5YB 3HAEH 1FAKT 4M8QA 4Z5RB 4HX1A 3FTGB 3WN5B 4ELKA 3GMRA 4PY8J 3DSNA 5AAWA 4K71C 4TUOA 5FYJU 3IFOA 1B0GA 5SX5K 4KHXL 5I1CL 5H37G 5I16A 4L9LB 3HNSH 4FQXD 1JE6A 4HXAL 4XPHL 3BD3A 3Q5TA 2AXGB 2ICWA 4Y19E 1UXWA 1ZT4A 1XH3B 1NGYB 4LP5A 2QSCH 4Z0XB 4R2GB 3VG0H 1YPZF 4C4KO 1MWAB 4OGAC 3DRQA 1IGTA 4PG2C 2AV7B 1SHMA 5IVNA 2KL6A 2VKWA 1INEH 4JDVB 3VFPB 5DJ0A 3QWQB 1WBYB 5IUSA 4N0FA 3RGVB 3MNVB 4A6YL 3T1FA 2VL4A 4GXUN 3C5JA 4F7MB 3QQ4A 4MQSB 3S37H 4MD4B 2GK0B 3G5ZB 2VLJA 4CAGA 4PV8A 1OWRM 1LK3H 3FOLA 1E6OL 2ZUVA 3R8QA 1MRDH 1LE9A 2JJSA 2CO6B 3H42H 3WBDA 3ZZ1A 3DNKA 1YMMB 3GZKA 1ZSDA 35C8L 1B0WA 5SX5H 3QNYA 2X4UA 1F4YH 2MHAA 1NH6A 4P2OD 3DIFA 2ZNWA 5I1GL 4P2RD 5CIPH 3L3HA 3BE1L 1D6VH 2DQGH 4Q7DA 5F1NB 4JPKL 2DQIL 1X7QA 1IAKA 1M7IA 1BM3H 4X0KB 4Z76B 1UB6A 3MJ6A 4PRNB 2GT9B 3H7LA 4FZ8H 3KPLB 5A3ID 2AGJH 2H32A 1YNLH 3HHRB 3D9AH 5CEXA 5CEZD 2VQ1A 2VZUA 3AU1A 4OBRA 1FZMB 4I9WD 4F3FB 3MBXL 4PGZA 4L29B 2GJZB 2JJSC 1A6TB 4AZ8A 3VRLE 3OX8A 3WIHH 2FYYA 2I9TA 3QZWB 4WI8A 5IJKC 3QUZC 2XZCL 4PJ9A 1LO3L 4XTRD 1MLBA 3HC4L 3NABL 4O51A 1W8OA 1K8DB 1WAAE 5BJTB 3IRZA 3H9ZA 2XKUA 3GMNB 3MBEC 2XA8L 5TE7H 3ULVD 3D85B 3C60D 1FJ1A 1KLUB 1X4ZA 3NIFF 5HTSA 2DQTH 5CCKH 2BSRB 4WWKA 4ONOA 2AJVH 5FO9A 5I1DA 2O61B 3H7BB 3DVNA 3K80A 4LLWB 3WHE0 4NQEB 2VITB 1JWUA 2P5WE 3LKNB 4RGOL 2DBLL 1MFAH 4WFGE 2YMXH 1G7IB 3MREA 1MCSA 2A6JA 2C1OA 2E7CA 3KWWA 2IBZX 1CFQB 2GK2A 2Z35B 3EDFA 3SE4C 3IDYC 1AHWB 5IOPA 3FAWA 3VG9B 4AYFA 5D9SB 5B3NA 5JOFB 4H1LB 1VKXA 3JV5A 1NC4D 3UBXI 3PNWB 4Y8AA 3OKLA 1CTNA 3FB7B 3WO4B 1RIUH 3K2UH 4XCEB 1IGYB 2P5EA 2I25N 4MNQE 3ILPA 3MCKB 4IMLA 1F2QA 5I19H 5DD1L 4NQCE 5I15H 1JV5B 2M2DA 2FEEL 4ZO9A 4FS0A 4D3CH 3ORJA 5LQBH 2O5XH 4DN3L 1F4WH 3HI5H 4M1DH 3FO1A 4D0BB 2PTTA 4NN7B 4NQCA 3ZSSA 1DE4B 4M1GL 1YEEH 1UACL 4OM1H 3MLRH 2DTSA 4I77L 1D5BA 1FIGL 1FL3A 1JHTA 3P77B 5KZCB 1YEDA 1U8LB 4RQQA 2RAMA 4WENB 3IDIA 3ISWA 2OL3A 2YD3A 4BM7A 1LQSR 4XWGL 4KK8D 3PWPE 1ITBB 3ARFA 2Z31B 2AJUL 2XXCB 3HI1B 3HRPA 3ZMRA 3P2TA 4FTVA 4IIQC 1DL7H 5JOEA 4R8WL 3D39E 2QSVA 3LD8C 1QSEA 4QGYA 3BGMA 3IYLW 4M00A 3O11A 1CU4H 3FN3A 5GQBA 3QDGD 2YBRB 1U3ZA 3MGOA 3KJ4C 3BZFA 5T1KD 2E7MA 3VXUA 3KXFD 1RJYA 4GW5B 5I8KL 1P7HL 1BJ1J 1C5BL 2UYLA 5BVJB 5CILH 2FWOA 1GGYA 2BNRE 3NZHH 5EC1B 1DDHA 1TZGL 3P0YH 4N5ED 3CPLA 1I3RB 4PG9A 2DL2A 3DXAD 4D0DB 1JIBA 1UA6L 2BNRA 3Q2CA 3FN9A 4U6TA 3ARFC 2VO5A 2ZUUA 2R1YA 5ALCL 3MLWL 4HWBH 5GGUB 5C6WH 2OK0H 2JJTC 4P23D 1AXIB 1MPAL 3TNMB 4NO0A 4ZXBB 3RDTB 5L8LB 2CJUL 1A6ZB 4LVHB 1IJ9A 1IEBA 2HFFB 4ZS6C 2APFA 4RRPG 3IF1B 4JFPB 4HDIB 1KN2H 2UZIL 5DUBA 1F90H 3QIBA 1YNTB 1RHHB 3P4OB 3U4EB 5KTEL 3WUZA 3MRKB 3G5XA 1GZQB 3P0VH 1K6QH 4LSVH 4M48L 5BV7L 5BXFB 2EDKA 4O58L 5EWIH 4HFWA 3ZE1E 2C3VB 1MLCA 4C54A 5CZVL 3ULVF 4FHBD 4KI1A 3V9FA 1WZKA 3ZTNL 3FB6A 5IB2B 5DDHA 5H2BA 5CJ8A 4QRTB 4X4MA 2XG4A 1R5WA 4JLRB 3RVWD 4MAYB 1BQHA 1XCTB 4YDKH 2XZZA 1P6AB 1BVKB 4TQEH 1A9EB 2GKIA 3K1DA 5AZEL 4M8VA 1XZ0B 2HT3C 2CUMA 4KRMB 3QWRA 3LEXB 4TSAL 3GSRA 4TN9A 1GSMA 4WV1B 4NRXB 5JZ7C 1PZ5A 1UJ3A 3AVEA 4LGPB 5ISZE 5FIEA 3HUJB 4AEHL 5FK9B 1AI1L 3EHBC 2X7LA 4PJ7A 2QADB 3ULSB 3G6DL 3KYKH 2XKNA 3L6FA 4F2MA 2EEDA 5ISZA 3K1KC 5LGHL 5F93C 1JUFA 4ETYA 3RL2A 5HSFA 5IW1B 4G43B 4M3JA 4XP4H 3HNVH 2Q7NA 4MJ5A 4OZGF 1S9KC 2ZCLH 4GBXD 2P8MB 5F7DB 3UAJC 1I8KA 4PGEA 3GBML 4FQ2H 4EUPG 2NXYB 1I1AD 3W39A 1BJMA 4X6CB 3DX7B 3INUH 4JM4H 3GSQA 1T2JA 2PN5A 1KG0A 1BHGA 3I02A 2R0KL 3JWOC 2FATL 2NY7H 4XCCL 1PQZB 4Q9QL 1AQDB 2VXTL 4OQTL 2IPUK 5I2IB 4P46A 1N6QH 3WFCH 5C0AA 3L3GA 3MROA 3QUML 5DZLA 2IBZY 4AIOA 4U0RC 3NA9H 3RWGB 2XQYG 1UJ3C 2YK1H 5MEOA 4OCXH 4N8VA 3FZUD 1ZVSB 1T0NB 3CFKA 1S3KH 2ATKA 3AY4A 4OIAA 4K3DL 2A0LD 2WIIB 3QHZH 3BPLB 1RULH 4PJEB 1J0KA 5EA0L 2EDOA 4YDJA 3TO4A 4Y2DD 3EDKA 4LAQH 3BZDA 3EO9H 4JR9H 4H20L 5HHQA 2LV4A 4XCFH 3V4UL 3CFJA 4Q9RH 4NQDE 4MAUL 4G8IA 4HH9A 5CZXD 2EDDA 4MS8D 1HI6B 1ZXQA 4Q9CA 4Y4FA 1NL0L 4DKFH 3E1F1 2E8YA 3ES6A 4XC3L 2AEQH 4XXCA 4DTGL 4FFZL 5GZND 5CS7A 2EZ0C 1J05B 1LP9B 4P46C 2KZ1B 3OKOA 5GPRA 3WXVH 2X09A 3CC5B 2H2SC 3C6LD 5ALBL 5HDQH 3R0MA 1J1PL 4MNQD 4K8RD 4I2XE 5CSZB 1DN2A 3EJZD 3AY4C 1CG9A 3O2DH 4NKOA 1KJ2H 2IANA 1XGPA 2AV1B 4XHJD 1YNKH 2H45A 1T80A 4I2XA 3L95A 1RZ8A 1EDQA 4POUB 3HMXH 3HE6A 1OSZB 3TO4C 3UX9B 2AAVA 5KANI 3GI9L 3W81A 1JGUH 4YXKL 2JIXB 4CKVX 3S4SG 3VFRB 4XCNB 5LAXB 4Y4FC 5C0JB 5EBLA 1TQBB 5HHXH 5FDWB 5GZOD 3F12A 3FRPG 4NP4L 2ICWJ 2G2RA 5IMMB 1N3NA 1U8JB 3RPIA 1GGCL 3U4BH 2F54D 4S1RL 1PKOA 1WZ1H 4ZS6D 3OMZA 4N9GB 5BO1L 2ITCA 3D39D 3T0XA 1E28B 1FFNB 1OARH 3O9WD 1K5NA 5LJYH 1TZIB 3TIEA 2L4OA 3MV11 4KRPD 4LCWE 5T1MB 5JHDE 3VGEA 2UZXB 3MRFA 3LIZH 3QO0B 2VLRE 1K3IA 3BWUC 1EHXA 1V7NH 4XMLL 3MODH 2OLDA 3MSPA 5HHVH 5DMGC 1WEJL 5E4EB 4X8XA 2R39A 4JGUA 1XF5B 3UTTB 4XH2A 3NFNA 2R2CA 4D2NA 3FO0H 3RIAF 4JZJB 3RX7A 1LO0H 2GAZA 5K93A 4GRMA 3SOBH 4LEXH 2R0ZH 4PY7A 4WVRA 4HUVB 1F58L 1F3JA 1VGEH 4J4PC 4U1KA 1FHGA 4QRQA 4J6RH 3S36L 3QYCA 4LLVB 4XI5D 3ROLA 1QO3A 1EERB 1RU9H 1YYLL 4YHYB 3I50L 3OKDB 2EIDA 4NZUL 2BOCA 3V0VA 3VFOA 5C0DB 2HFGH 3TZVB 3H9HB 4U0QB 5KSBB 2HA1A 4B53A 3NPSB 2QKIA 5IEHA 3A6CH 5I1HL 2GJJA 4P48A 3SDYL 3QFJD 2AQ2A 2ZOLB 4HKZA 1NEZA 1UM4H 2AABH 5GSVB 2E7BA 4ZS7H 1M05A 1FDLL 3AFLA 4LARH 1UM5H 1VSCA 5SWZA 1MFEL 4O9HH 5IM7B 2BNQB 1HKLH 1CR9H 4E41B 3LEVH 5D2LE 3KLHD 3UAJD 1Q94B 4R0LB 4AMKH 3CLFL 1G6RL 2OZ4H 1R6VA 2W92A 4LKCA 5HHPB 5J11C 3OPZL 4G8GE 3QDMD 3BP6A 1B6UA 3DGGB 1BLNA 4DZBA 2FR4A 5FO7A 5DRXA 4YHKH 1BP3B 3VH8A 3QUMA 4NHUB 1UG9A 1P4BH 2OX5A 3AXLA 5IB1B 1H0DA 4OFIA 4CBPA 3FONB 1HYSC 2IMNA 4WJ5B 4LK4A 4PRID 4YNYB 5TE6L 1A7BA 2WP3T 1OPGL 1ZKAA 5GS2H 2A77H 3PE9A 5I66A 5IFAL 2DJSA 3DURA 5IQ7L 1RUQL 3QG7L 2FO4B 5K33A 4PREB 3WXWL 5MHSE 3SDCB 3NAAL 1IBGL 3O45A 4RMVA 3T0EB 1ZA6B 3QIUD 2F9BT 4JPIB 4U6VH 2WWMD 3SPVA 4F7PB 4EVNA 1GOHA 3ESVF 3N06B 2CLRA 3SDXB 1VACB 5DJXA 1DUZA 2UWEF 4LF3A 4EZMA 1ZTXH 5C09E 3D69A 1EHLH 4F9PA 2X1WL 4LLDA 2Q8BL 2VIRB 4OZFB 2H2SD 1HCFX 4X6BA 3TN0D 1CL7L 5C09A 4IRSD 2CDGA 1ODAA 2W9EH 3CLEH 4PRHA 5HYEA 1KBGH 4TUKL 1LDPL 4P4KA 3MA9L 4QYOA 1EXUB 1AXSB 4XNMB 1WIUA 3GI8L 4O02L 1XFPA 4OSUL 3G08A 4PRPA 4YBLB 5F21B 4H0GA 5IEKB 2Q8AH 4R4FL 5HDOA 3AM8A 4HS8L 4NNPL 2B39A 1EMTH 5D1XB 4WEMB 1HHIB 4Z7VE 2DM3A 3FO9A 2WLZA 3RY6A 4GAGH 5C0BA 5J6HB 1KLGB 4Z77A 4JZNA 4E42B 1X6NA 4OZHF 1T4KB 1B4RA 1N2RA 4U6HB 1ZE3C 3CDCA 1AGDA 3EGSB 4N8CH 1YEKL 4QHUB 2B4CC 4DW2L 1NCCL 3WFBH 3WS3A 1MCBA 4ZUVA 5EO0A 5CUSH 1I85C 5DF0A 5M7QA 2YD1A 4YX2H 1A7RL 3S5LB 4U7MA 4OV6F 1ORSB 3QEUA 4P4KC 1Q9WA 4PJDE 5HDBE 4L4TA 3F7VB 2Q20A 2PW2A 4X99A 2VE6B 3MOAH 3VWJA 1BQLL 1P84J 3BH9B 4I18A 4JDZB 5DRZB 5MERB 3JWDH 4XBEL 5CEZL 3S35L 3V6ZA 5HYQA 1L7IH 2QHRH 2VUYA 1H3GA 3V4PH 3BQUD 4K9EC 3RY6C 2ZUSA 1GAFL 3O6MH 1MJJA 3CXDL 3PF2A 3UEZA 5SWQA 1T1ZA 2DYPD 1PYWA 1EAPB 4M4PA 5J06A 4J4PD 5D71L 2JTDA 4MD0A 3K8KA 4RGNE 2IH3B 3T0DA 2NY6D 1MIMH 1YECH 2NY2C 4NKDA 1RUAH 1GGBH 3ZE1F 1UZ8A 3E6HA 1AXTL 1KXTB 2L7UA 1QOKA 1OM3L 3REWA 3NCJL 5IVXB 1HDMB 4ESKA 3ZL4L 4ETQA 2NW2B 1M4KA 5AG8A 1KTLA 5JHDD 1E6JL 3VWJC 1ZGLM 2GCYB 4GJTB 2VLRD 5GISL 1QR1B 1X5KA 2BFVH 1YJDC 1G6RA 3QQ3B 3UC0H 3QUYD 2HLFC 1D5ZA 5FOJA 4NJ9L 1H3PL 3LB6D 3ZE2E 1RHFA 2CK0H 1ZLVH 2IQ9H 3AS1A 2ORBL 1T7WA 1S5HA 3R06B 4PR5A 3IXAA 3E0GA 1RK1A 2OR9L 5ADOL 1NFDE 1CT8B 5C9JB 4OFYD 2BY3A 1MWAH 2ARJB 4PJ8A 4K71B 1C8PA 4LSUL 2Z9TA 3IGAA 4HT1H 3UO1L 1TCRA 4RGNC 4YHOH 1HHJA 1KACB 3C2AH 3SHSA 3O6FD 1DJSA 1IAOA 3HZKA 1LVEA 3KDMA 3W5NA 1CE6B 4DN4L 2F15A 1KSRA 3G6AA 4HPOL 2MQ3A 4KK5C 3RU8H 4RGMB 5ID1B 4Z7NE 5JIHA 3X14A 4GW4B 1FGVL 3PIQB 4HK0A 5EBGA 1FH5L 2XQBL 1KEGL 4KKAC 4P57B 3P9MB 3FT2A 4YUEL 3U46B 4M1CC 2DLFL 4JFEB 3UBXG 1JF1A 1IGMH 1U58B 4PJAE 4B41A 2FLRT 4K23H 4NGHH 2HJLA 3LQMA 2D7TL 1QFWI 2ADIA 4IDLA 5DRNB 5I8CA 4OFKA 3VFMB 4XAKD 1CDJA 3O41A 1S7QB 1WVZA 4M8QB 4PJAA 1Z0MA 3CH8A 4HX1B 4ELKB 3GO1L 3GMRB 1WWAX 3MXVL 4G8GD 5LGKA 4I5BB 3IFOB 1B0GB 2HH0L 4I3RH 5FA4A 3WNPA 5HPOA 5I16B 4RWYL 1T2QL 1D6EA 2Z8SA 3K8LA 3DGCR 3GSUA 4EEEA 1SYVA 3S3SA 3D3VE 2ICWB 2OJEA 1UXWB 1ZT4B 5IBUG 1MI5A 4WUUE 3UTSE 4JZOA 4OLZL 4RAUA 1UT9A 1IGTB 3HCVA 1IILE 2IGFL 3VCLB 3OAZK 4WUUA 3UTSA 1U93A 5D72L 4MMXC 3BT2H 5HYJE 3MRIA 2C3XA 4AL8L 1NMBH 4N0FB 5KVDH 3T1FB 4NO3A 1EJOL 2WM0A 3C5JB 3CSBA 5GGRA 2WWKT 4XP5H 2DQUH 2VLJB 2F74B 4PV8B 4LU5L 3FOLB 4QKXB 5DD0H 5ESVA 3BO8A 3X3FL 3OXSA 4LLAA 1W0VA 1GYAA 2OQJA 2YN5A 1OCWH 2XTJD 4RA0C 4NSKA 3RRQA 3ARYA 3SDAC 3R1GH 2FX9H 4Q2ZA 4QXGL 4X6EA 4N1CA 4PGDB 1ZSDB 4P2RA 2V7HA 3NCMA 1RUPL 3IFNL 4QY8A 3VDAA 5E7BA 2P48B 2OM5A 3MBEB 2X4UB 2MHAB 3C08H 4JQVC 1BOGA 1GIGH 2X70A 3WFEH 3T0AA 4FFVD 5EORH 5DEGA 4LASH 1BJ8A 2Q3ZA 3E2HC 5JW4Q 4POYA 1X7QB 1IAKB 1M7IB 1U3HA 2EEAA 1UB6B 3OAZH 2H32B 4ZTPL 1N59A 5CEXB 4G8FA 4N8VG 2VQ1B 3AU1B 4F7EB 4JY5H 3HNSL 3EBAA 3IDYB 4OT1L 3OX8B 2FYYB 2J4WH 2I9TB 3LV3A 3JUYA 1OGTA 4R7DA 1ZHKA 4UTBH 4KI5E 2X9WA 1MJ8L 3N9GL 3BRGC 4NRZA 1MLBB 1AO7D 2HKHL 4PBWD 1INEL 5CJQH 4PUBL 1D3CA 1JYWA 3WKNA 4JPVL 1QFUL 2JF1A 3ZDXF 2BOBA 4QRPD 3LRGA 1CN4A 2PUQT 1HCVA 3MRCB 1YN7A 1VCAA 1ZK9A 4KROD 3S37L 4WWKB 3FQTA 4GG6A 3BYYA 2E8ZA 1C5CH 1IQDA 1LK3L 3ESUF 5I1DB 3BGFC 5HI3D 1NC4A 3DO3A 1MHHA 1TVHA 1U3HC 3QNXA 2DKSA 3H42L 1VFMA 4X8JA 3CFBA 3MREB 3PWJA 2DQDL 4M6ML 4ZO8A 5T1LD 2OR7A 2C1OB 3BVNA 5T33H 1QNZH 3KWWB 2YZ1A 4ODBD 3I6GA 3T0VA 2K1MA 1VKXB 3U9PH 1UXSB 4OZGA 1QQDB 1EFQA 4XVTL 1F45A 3T04D 2EXWC 3OKLB 2GI7A 2DBJA 3LSOA 2X4NA 1CVSC 2DQEL 3SGJA 3LD8B 3VXME 2P5EB 3OB0H 4JQXA 4QHLA 3T09A 2W9DL 4KI5C 4OM0L 4IMLB 3GHEH 4ELMA 1D6VL 1N64H 5E1AB 3LKRB 1P7QA 2EH8L 4N9OB 1CLCA 1BM3L 3KJ4B 3GSNL 4JM2C 2AGJL 1U92B 3MACL 1YNLL 1REIA 2YD6A 5DK2A 1CDCA 1G0YR 3FO1B 2PTTB 4NQCB 1MQKL 3MRLA 1T0MA 5I0ZA 1CLZL 5F7HA 1L6ZA 3WIHL 1FL3B 1JHTB 2HKFH 3MFFA 1YEDB 4RQQB 2FGZA 3IDIB 3T1WA 2OL3B 4DWHA 2DWDA 3ARFB 1NBYB 4ZTOH 1RZFL 5T1KA 1A7QH 3LOWA 4XX1E 3KXFA 4PRAA 3PWPB 3B2VH 4HKXA 4FTVB 3EDDA 5E70A 2F8VA 3S3JA 4PD4K 2DQTL 3B9KA 3T77A 4K8RL 5CCKL 4L5FH 5T3XE 4KTYA 3BGMB 2VLMD 4JQXC 5H37H 1EUUA 3O11B 4HWNA 2JJVA 2YUWA 4U1GB 1RZKC 1TJHH 3GFUA 2R4SL 1M6OA 3MGOB 3BZFB 3QEGL 3VA6A 3VXUB 5BS0E 3LEYH 1RFDH 1RJYB 3HG1E 1L4IA 1DQDL 1S5IH 2WBJA 1EBAA 2H1PH 2UYLB 3C9NB 3L5XH 2FWOB 3RI5K 4YQXH 3FQRA 1KFAH 4P23A 4YZFE 1DDHB 3FQXA 5B4MC 3MFGB 3CPLB 4NZJA 5EUKA 3GBNH 4PG9B 4DOHE 5E2TH 5D7IE 1RIUL 2BNRB 4ZPTA 1QA9A 3K2UL 1A6VH 3MV9A 1LWRA 4OGXH 2R1YB 3CUPB 3LHPH 1OGAE 3V0WL 4M7ZC 1MCWM 4R97C 4PJFF 4NO0B 5GS0C 1TQCC 2JCCA 3B9KC 4JQIL 4K2UL 5GXBB 1N5YL 3NCYS 2MSPA 4NZTH 1DUYA 1IEBB 5DTFA 5KANG 1JMXA 3U1SH 3DBXA 5C2UB 4LSDA 4OM1L 1DBJL 4WFED 4PJBE 3D3VD 3EOBA 5DUBB 1LDSA 4GRLC 3HAEA 3QIBB 2LQRA 3G5XB 2WBJC 4JFHE 4LHUG 1DSFH 4K7FA 5IWLC 2X4OA 4NC2B 2OTPA 4HZAA 4HFWB 5I9QC 3MGTA 4KQ4H 2A2QT 1MLCB 3Q3GB 2X1XR 3ZE0E 3KJ6L 4PJHE 3TNNB 3RZCC 4X7EC 5DDHB 4UB0L 1QBML 4Q6IA 5H2BB 4DUWA 5HYFA 1UCTA 4K3EH 5E56A 1J0YA 1R5WB 3OJMB 4YXLL 1BQHB 1CU4L 4YH6A 1F11A 5CBEA 1G84A 1DBBL 4FQJH 5L7XL 3VXRE 3EYQD 3HE7D 5KSAD 1A5FH 2HTLC 2VOTA 3GSRB 1PZ5B 1UJ3B 4PRDA 4KDVA 1MHEA 3NZHL 4LVOB 4AEIH 4PJ7B 2X7LB 2AK4A 1FFPA 5A43C 1GL4B 4MXQD 4BQCA 2XKNB 3L6FB 4YGVA 5FYKH 4F2MB 5ISZB 4JRYE 3WS6A 1JUFB 4ORGA 4S2SA 2A6KA 1N8ZA 3RL2B 3VXPA 2BVOA 3VD5A 4I48A 1KCKA 2OK0L 2AXJA 1I8KB 1J0ZA 4JY4A 4PGEB 1ZOXA 4MZ3A 1NGPH 3KGRA 3GSQB 1KG0B 1XGTA 3I02B 2ZG1A 4Z7QE 4FQLL 1KN2L 4YO0A 3ZE2F 3ARBA 4P46B 2ILLA 3BIBX 2QQNH 5C0AB 1HQRA 3FQWA 2JELL 3ILQC 1IFHH 3L3GB 3MROB 3SO5A 3ULUH 4QRUA 4K94H 3GSNA 4P3DA 2AJZB 5MEOB 5EWIL 4EQ3A 1T3FA 3I3BA 1NFDF 3CFKB 2ATKB 2NY4B 5TQ0H 4Y16D 3UYRL 1MJUL 3WIHA 4G6JH 2FBOJ 1RZGA 4OCRH 1JNNL 1OP5K 4PBVC 4OLWH 4YDJB 3TO4B 3MTRA 2DI7A 4H25A 4TQEL 5IT2H 3CFJB 2ENYA 4LCCC 3T8XB 4ZUTA 5GIRA 3CFCH 4Z7NF 4G8IB 4HH9B 3QT2A 1Y18A 4X5LA 4Y4FB 3RVUC 4F33A 5J1TC 3IVKA 4NQDB 3ES6B 4HSQA 2VSDA 5EU3A 2NXZD 4NUGL 3MUY1 3ARBC 4XNXH 4Y4HD 4JGMA 3OKOB 5I8EA 2UWEA 4J3WA 1BZ9A 4IDJH 5GJTL 3VXMD 5HHMB 4R4NC 3IDNA 1HE7A 5GGVY 2NCMA 4HKBA 4ONFL 1CG9B 4NKOB 2IANB 5EU6E 1IGFH 1KPUB 2DI9A 1R0AH 1JWSA 2QQLL 4FQ2L 1LK2A 1HSBA 2QBWA 4I2XB 3L95B 1RZ8B 5JXED 3HE6B 4D9LL 3INUL 4JM4L 1PKQE 4WW2F 3LY6A 2Y25A 5EU6A 4WTXA 4HPYL 5E99H 2NY7L 2P44B 4UT6H 2HWZH 4KK6C 5I6XC 1OP5H 5EDXA 1N6QL 3BX7C 3O4LA 1JGLH 4I3SL 2M8XA 2YOCA 5EBLB 5C07A 3NA9L 2FX8L 4NKIH 3ET9F 3F12B 2YK1L 2XG5A 3C6SB 2G2RB 1P7KA 5C0NC 4OZHA 3RPIB 1NBQA 1AGCA 1S3KL 2B1AH 1JFQH 2V5YA 4G6KH 1MAMH 2PO6C 3RX5A 5JORA 5T3XD 1FGNH 1K5NB 3TIEB 2OR8A 4IRJD 3CZFA 1WWBX 4B5EA 2MCPH 5DZOA 1S7RA 3LPGA 3HG1D 2KKQA 1Y6NR 3DI3B 1DQQA 2CUIA 1FNGA 4M7LH 3CDFA 4JO1H 1P5VA 1I3GL 4RAHA 2FD6H 5I1KH 4XH2B 3NFNB 3BWAA 2JB5L 5IF0A 2GAZB 4LCYB 4GRMB 1WBZB 4BQ9A 3S6CA 4ZNEA 5J11B 1NGQH 2YPLD 4PY7B 5IB4B 1F3JB 4RX4D 4NC0B 4U1KB 1N7MH 3TJHC 4P4RA 4QRQB 3ROLB 1QO3B 3PWUA 4TUJA 4Y5YC 1OGAD 3O2DL 4DKEH 1AGFA 2BOCB 3V0VB 1OD7A 3VFOB 1YNKL 5IG7A 4PJGE 1KGCD 5GRXG 1P69B 2QKIB 5T1DL 1BJ1H 1HIML 1JPFB 2Q7YA 1A64A 1Z3GH 3BGAA 3V8OA 3P11H 4GAYA 4JHBA 1NEZB 4G6AC 3VDCA 2ZPKH 1M05B 4HUWA 2YUZA 4PS4H 5ID0A 4HWBA 3QDMA 5SWZB 2Z92A 4JFHD 1VFBB 2DIAA 4MD5A 1LEKA 3EUUA 1DLHA 2LVEA 2Z8VC 4RMWA 4JFFD 1QRNA 4M61A 5C86A 4LKCB 3O8XA 5E9DA 1DBAH 1CF8L 1WZ1L 5CJ5A 5HYIA 4OGYL 4EUPH 1G9ML 3VWKA 3BP6B 3M45A 1Z9OA 3BFOA 4JFZH 1BLNB 2FR4B 5GGQL 5FO7B 4EN3D 5DRXB 2NYYC 3VH8B 4OZIA 1KXVC 2F53A 3GRWH 3AXLB 5EU7C 1AY1H 2AERT 2VR5A 5I18L 3D1MC 1H0DB 1EA9C 2ARWA 3LIZL 3DJ9A 5DR5L 1V7NL 3MODL 1IL1B 1CE1H 2OTUA 3QIUA 4NPYA 3N50A 4MNHA 2HAZA 5FGRA 4F7TA 4JN1L 4RFNC 3V95A 3LMJH 2MCG1 1HSAB 3IFLL 5I66B 2MOVA 3DURB 1MEXH 3SOBL 1OAQH 4LEXL 4KZDH 3D6GA 1ADQL 4UOW1 2R0ZL 2IH1A 1RZ7H 4JRYD 1BGXL 2IMMA 4Y1AE 4WO4C 3K8MA 3O45B 2X42A 2YD8A 3JV4A 4HV8A 4J6RL 2ATPA 3LAFA 4HFUH 5GGTL 3SPVB 3O8XC 1SVZA 4EVNB 4U49A 2CLRB 5DSCA 1NLBH 4KKBD 3VWKC 3IDMA 5DJXB 4X4ZA 2NY0D 2XPGA 3D69B 1B2WH 4MB5A 3A6CL 1MCPL 3CK0H 4LLDB 4QF1A 1UC6A 4WI7A 5D5MA 3V7AG 2AABL 4X6BB 5C09B 1HXMA 1OP3K 2CDGB 4HGWA 2EKJA 4O9HL 5DVMA 1HKLL 4PRHB 4OLYH 4CU8A 5D7LE 3G9VA 4P4KB 3LEVL 3GHBH 4QYOB 1WSST 1NBZB 3M1BA 4G8EA 2OZ4L 3U79A 1RK0B 2D0GA 1NMAH 3W11C 2AJYH 1MFCL 1MRCL 4BA8A 1U8PA 5E6IA 2AP2A 2ZP0T 3V6OA 4YHKL 1CFTA 5C0BB 5HVHB 5F9JA 1P4BL 1I7RA 3NN8A 1N2RB 1V3MA 2EE6A 1HH6A 3F62A 2BXZA 5DS8A 1AGDB 3MXWH 4HUUB 3KNBA 3BZEA 4XPFH 2BDNL 4NQTA 1BQUA 1UB5A 2VLKE 1XMWA 3PP3H 4QXWA 4ZUVB 2A77L 2PYEE 5EO0B 2F19H 3DWTA 5L0QC 1F42A 5GRJL 1EHNA 1SMOA 2VLKA 4OQ1A 3BQUA 4DQOL 1J11A 1QRKA 3QEUB 2VDQL 3TH3T 1Q9WB 4PB0H 3S9DB 1C08A 2E7HA 4QGTA 4L4TB 3F6IA 2PW2B 4X99B 4U6VL 3RVVD 4M7JH 2DYPA 1BIIB 5EOCL 4XPAH 2RB8A 3VWJB 5F7EH 3WD5L 3MJ9H 1H9VA 4PJDB 1UADC 4KRNA 4I18B 3UTPE 4AEFA 3V6ZB 5HYQB 5E6IC 4WHCA 5C0RH 4N0UA 2NX5E 1MJJB 2IFGA 3B3IA 3LCYA 4PJBF 5SWQB 1T1ZB 5BZWA 1PYWB 4BKLA 2PCPA 3FQNB 4TRPL 4R90L 1SM3H 4AIZA 2NX5A 3O2DA 1P5UA 1BBJA 5E2UH 2BY2A 4NKDB 5SV4A 3HMXA 1EO5A 5TE4H 1K4CA 1GHFL 4ZAKC 1SYSA 1UZ8B 3E6HB 3VFUA 3ZE0F 4PJHF 3QUYA 4C4KT 4UIMA 3REWB 4NT6B 4X98B 2Q8AL 3EO1A 4P5KB 1T6VN 1JNJA 1A9BA 4G6AD 1EMTL 2NZ9D 1NUNB 4WY7L 4ETQB 1K8IA 4GAGL 1JZ5A 2E6QA 3QAZC 4JPWL 2R4RL 3MQIA 3V79C 3I3DA 4OFYA 3SE8H 1G6RB 4FFWC 4I4WA 5D6DA 3PGDA 1D5ZB 2XXMB 4F58L 2VLLA 4JHZA 5JIKA 2EC9T 4OFDA 1S5HB 3O6FA 4U1JA 1ZWIA 4X6DF 3WSQL 4ALAL 2UZYB 1BFSA 4M6AA 2DL9A 2V17L 4PJ8B 1QSZA 3IGAB 2YHGA 1TCRB 1HHJB 4JFDA 3UPAA 1F6AA 1IAOB 3QQNA 3X11B 3KDMB 4WRLA 3G6AB 1U8QA 3QCTH 1JPST 4XNUH 3ZYJA 1L7IL 3O6ML 3RGHA 4Z7QF 1OAKL 1R3LA 1MREL 3CJJA 3B8SA 5HI5C 5MEND 5GGTA 1VERA 1I7ZA 3FT2B 3P30H 4UILH 3PQYA 5DI8A 2XACC 3BKYH 1MIML 2HJLB 4UTAL 5I8CB 2ADIB 1ACYL 3GJFK 1CGVA 5IB5B 3Q5OA 1RUAL 3O41B 3WDHA 4PJAB 3DHJA 3FN0H 1CXKA 5F9AC 5E6YA 1Z5LA 3ZDYF 2ZUTA 5HGAA 5B3JE 2DAVA 3RUGE 5HD8D 1B4JL 5FA4B 4PJIF 3LKOA 2X5PA 4PP1C 1D6EB 3SJVE 2O93L 1S9VA 1XIWC 3GMMA 3GSUB 4YHZH 1SYVB 1F6FB 3UC0L 2OJEB 2OZ4A 1MI5B 3GJEA 4JZOB 3SJVA 3H3PH 1NANH 2CK0L 1KELL 1QFOA 2IQ9L 1A3RL 2EC9U 3M07A 4RAUB 3HCVB 4NRYA 4OJFL 4BFBD 1MFNA 1MCHA 4NCC1 3ULUF 1XCQA 3L3IA 4WUUB 5MEQB 5TQ2H 3UTSB 1U93B 3MRIB 1IAMA 2AW2A 3E2HB 4TVPE 4NM8H 4NO3B 3VE0A 4KK9C 4QRSA 3TBTA 5I30H 3BKCH 4ZSOA 4DKDC 2IADA 3L5WA 5GGRB 5EU5A 4C59B 4S1QL 2E5EA 5DC9B 4JRXE 2EE3A 5ESVB 2J8UF 5E5MA 3BO8B 3OXSB 5DD3L 1C1EH 5ICZA 2R56H 2OQJB 3H8NA 3VGAC 3B2UC 4P5TC 4NSKB 4DGYL 1AC6A 4Q2ZB 4X6EB 2V7HB 4JO4L 4QY8B 5BOPA 5KS9F 1UZ6E 3HZVA 5ILTH 1II4E 4R96A 1LEIA 4PJFA 1BBDH 1IGML 1BOGB 1BREA 4D9RD 4NGHL 2X70B 1YY9C 4LSRL 5DEGB 1Y0LA 2VKXA 1ZS8A 1FVCB 5DD5L 2BVEA 1KIPA 5DMKA 1U3HB 3B4NA 1Q9OA 1TETL 1DP0A 2DJ4A 1N59B 2HLAA 1AO7A 1X5AA 2XFXA 3FB8A 4PGJA 1NCTA 3GMOA 2BHUA 4RFOH 3VD4A 1A3QA 1KOAA 1CGWA 4QRPA 1OGTB 3MCLL 4R7DB 1ZHKB 4X80L 5DRWA 4KY1H 4V1DD 3TFKC 4NRZB 2RCSH 3S97C 4LDEB 2ED7A 1XF4A 3TVMA 1WIPA 1S7TA 2PYED 3BT2L 4L8CA 4MQ7A 4KXZH 1BVLA 5C2BL 3VGDA 1NGXB 1J10A 2BOBB 3UZQA 1YN7B 5T1LA 1JBJA 5CJXA 4JM2B 4JN2A 3SE9H 1DANT 3FQTB 4XP5L 4GG6B 5AYUL 4KHXH 3WNMA 1IQDB 4NN5C 5DD0L 5L6YL 5IHLB 1XF2A 4PJ5A 5E8EA 1NC4B 1MHHB 1TVHB 2YA1A 4NWTL 3UTPD 1NEUA 4X8JB 4P2QE 1AKJB 1FVDA 1SJHA 3CFBB 3OSKA 4HZLA 1OOAA 3BVNB 1UWXK 2RGSA 4ZUUA 2CRIA 3AMLA 4MXVF 1FVEA 3W0WE 2XN9E 1INQA 1BD2A 3L5IA 3DVIA 1B9ZA 1H8NA 5CMAA 3BN9D 4ODVH 5DWUL 4RMUA 4A6YH 3SDDD 5HHOD 4RIRA 4QOKE 3LSOB 5IQ9A 2WINA 2X4NB 4YDVB 1YEGL 2DS4A 3UJTH 3QPQD 3WLBA 1NLDH 3TVMC 3VXTB 1UFUA 4I13B 1T20A 4QHLB 3EJJX 5ESQA 2PETA 1DQJA 4QOKA 5B38G 4DFIA 4ELMB 3FB5A 1P7QB 2OJZH 3IJYA 4Y4KD 4Q9BA 3DYOA 3NH7L 2X4SA 3GMQA 5CJXC 5HI5D 1G7PA 3STZB 5DK2B 3OV6A 2Y6SC 1FO0B 2KQMA 3B9DA 3MRLB 1T0MB 4JFYA 2BP3A 3G04A 2BK8A 2R9HD 4IJ3C 1GC1L 5HYSA 3MFFB 2X1PA 3UROR 1EGJL 2D7QA 3RNQA 1RUMH 3IDUA 3KPSE 5DQDL 2DWDB 4HEME 4YPGA 5F1KC 1NUGA 2FL5A 5EO1A 1J1XL 2O5YL 4PRAB 3OKYA 3KPSA 4JPKH 4HKXB 4NUJA 2DQIH 1MF2L 1TQCB 1DANU 1MJ7H 3B9KB 3JWDC 4WGVB 3T77B 5IGXL 3TYGL 5INCA 4JG1L 2C26A 4JJHA 1V5JA 4LPCA 3AB0B 2V5RA 3S88L 1MCLA 1NAKL 3KPQB 3L5HA 4GRLB 2DMKA 4GLRI 2CKBL 2YD7A 3S7GA 2XZCH 4HUNB 2WBJB 1LO3H 2EIEA 4KJQC 5JIPA 5T33L 4KK9D 3THMH 1EEYA 3NABH 3DOSA 3G5VA 3K46A 5I9QB 3FQRB 4P23B 3ZSTA 3FQXB 4JO3H 5DLML 2IAMA 2XA8H 5EUKB 4QHNA 3S98A 2V5SA 2A83A 3BESR 3RZCB 4DEPB 5KOMC 4ZPTB 3MV9B 3X17A 1HZHH 4GRWH 4DOHB 1GPOL 5K9QI 5D7IB 1N64L 3WN5C 1T7YA 1YMME 4U6XA 2AEPH 4BELD 3LVEA 4RGOH 2JCCB 4XAWL 4KMQA 4NFBA 1KEML 5EZJA 3GSXA 5DJAA 1DUYB 5DTFB 3R8BB 4NNYA 2X6MA 3REVA 2BVYA 4TSBL 5I71C 3EOBB 2BSSA 3HAEB 1RV6X 4E0RA 1INDH 1JN6A 5I1EL 1S7VA 2B20A 4OF6A 5I0DA 1NFIA 4K7FB 3MV7A 2X4OB 2EYSA 5J9PA 3OL2A 5IV2B 3MRMA 3MGTB 1PVHA 4TVPD 5DD6A 3RGVC 1A7QL 2IAMC 4IHOA 1JNLL 5DD1H 4APQD 3B2VL 5ABDE 4HH8A 4Y88A 1JK8A 1TDQA 1D9KD 4Q6IB 4ZO6A 4DN3H 2DIJA 1EFXD 3ARGC 3I9GH 3M8OH 2I9LB 1ZLWK 4M1GH 3N1PC 4HS3B 4E9LA 4ODWA 2FB4H 1I7TA 5GGVL 3SQOH 1R3KA 1FIGH 3DUSA 4Y2OA 4QCIA 3LEYL 1E4XI 1G1CA 2G9HA 4UINH 3QR2A 1U8NA 1MCQA 1S5IL 3KPRD 1Z0NA 3PHSA 2H1PL 4GAJH 4OLEA 2BMKA 3MV8A 1S7XB 3VXOA 4PRDB 1RUKL 5IBTL 5JUEL 2J1KA 1MHEB 3NCYP 2AJUH 2VDML 4HBCL 1A0QH 2AK4B 1FFPB 1J86A 1R24A 2WQRA 3GBNL 3ABZA 4YGVB 5E2TL 3PL6C 3J7HA 4R8WH 4ZD3L 4NQEE 4ORGB 4S2SB 2A6KB 1N8ZB 2PW1A 2MKLC 2BVOB 1QLEH 4I48B 1CICD 5DJ6A 3WEXA 3WJJA 1HINH 4JY4B 4Z7WE 1G9NL 3AC0A 4LCCB 5B8CA 3BRDA 4Z7UE 2DB8A 5I8KH 3BISA 4ISVA 1EX0A 2VERN 1C5BH 2NY1D 2AXFA 4TNVK 4I0PA 4Y16A 4HIIA 1U8HA 2XWBA 3ARBB 4JEGB 5FUOL 3QXAA 1HQRB 3FQWB 3AREA 4IBLT 3ZTJG 1WFOA 4QRUB 5BW7A 3GSNB 4P3DB 5DHXB 5K9JL 3QJHA 4HC1L 2P46B 1T3FB 3OAYH 3L7EA 5ALCH 3MLWH 4YHPA 4OCLC 5IMLB 1MPAH 4LGRB 1T04A 1MCFA 1TXKA 1RZGB 3FT4A 4FP8L 1EGJA 3IAQA 3MUHL 4HJGA 2J2ZA 3G6JF 4H25B 2IG2H 2JK5A 1TVBA 4LEOA 2MQ0A 4Y4HA 2UZIH 1MCOL 4ZUTB 1MCKA 3MYJA 4KMTH 3PDDA 5DQ9A 2VZOA 4DZ8A 1Y18B 5BV7H 4M48H 3IVKB 3W0WD 1WJ3A 2XN9D 4I0PC 3EJYC 4BK4A 1SBBA 3PWVB 5EU3B 4KVCL 1WZMA 2I5YH 5CZVH 5LGJA 1MFBH 3NZ8A 1KJ3H 4HUXA 5B39G 2HT4C 4HJ0C 3EYUH 3AREC 5I8EB 2UWEB 2DMBA 1BZ9B 1KTDA 2PO6B 3H2WA 3OKNA 2EKSA 3BHBA 3IDNB 1W0YT 3O6LL 4HIXL 3TH2T 4IMKC 4HK3J 1LD9A 1JWSB 1LK2B 1HSBB 5CKAA 5AZEH 2KPNA 3OJVC 5EU6B 4NN7C 4G9FA 4N1EA 1YQ2A 2CLZA 4GOSA 3VMNA 1PKQB 4KJPC 4LOUC 4MJ6A 5E2JA 2QQNL 2AXHA 2IBBA 3O4LB 3ULUL 3QBTB 1CD0A 4EIGB 5C07B 1HQ4B 4KRPB 1H5BA 5ADPL 3PHQA 1P7KB 2ZKHL 3QIWA 1PY4A 1AGCB 4BQ6A 1A1NB 3NTCL 1NJ9A 2I26N 3WUWG 3U0WH 3STLA 4G6JL 4OCRL 1JYVA 3VGGA 4FOMA 4HXBH 4OLWL 5FYJD 3CZFB 3NPZB 2R0KH 4R2GD 1L6XA 5C6TL 4PLKD 1PAMA 3TC9A 4XCCH 1S7RB 2H2PC 2QHLA 2VXTH 4KZEL 4YC2B 4OQTH 2YPLA 1SJXA 1DQQB 3QRGL 3CFCL 3OGCA 1MFDH 2GEEA 3RGVD 4Q6YA 3BWAB 3QUMH 4MJIE 5IF0B 1P1ZA 5E94A 1UZ6F 2CR6A 3C5ZA 2WNGA 3B6SA 1BFVH 4K3DH 1A7NL 4XNXL 1Z9MA 4MJIA 5TGBA 3RL1A 5EA0H 3ZHLA 3B43A 3LQAL 1GOGA 4XC1H 3H9SD 4JFXB 5F6HI 4DKAA 2ZCKH 3QIWC 2J8OA 4TUJB 5EOCJ 5FV1L 1RJZA 2W0LA 2VABA 1AGFB 1R0AL 5IK3B 5IG7B 1BIHA 3ARVA 3ZT6A 4ZXBC 1IAIL 4MAUH 3WV0A 1DBKH 2D7NA 4UT9L 2Q7YB 4LVHC 1T1YA 5I1LA 1LO2L 4GAYB 4RFNB 4X7FC 6FABL 5E99L 3VU2A 4R7NA 1HXYA 4GKNA 1JZ2A 1FC2D 4HUWB 5ID0B 4FFZH 3PHOB 4UT7L 3QDMB 2FECL 2Z92B 2EDLA 1LEKB 4MD5B 4R4BA 5ALBH 1DLHB 1KIQB 1JPTL 1J1PH 3L3KA 1QRNB 4M61B 3C5ZC 1P4IH 3O8XB 4X6CE 5E9DB 4S1DC 4XVUD 5LCVL 3BP7A 4G6KL 3VWKB 5F9WC 1MAML 3V5KA 2YUXA 3BIKA 3WHE1 2E7LC 1QYGL 4R26L 1FGNL 3O0RL 4OZIB 4MAYC 4X5XB 2F53B 3TBYA 3GI9H 4HC1A 5A2IH 1P9MA 2H3NA 2MCPL 4OBSA 5CLWA 2Y36H 2OTUB 4JO1L 5JO5A 3QIUB 4NPYB 4MNHB 4OLXL 4ZPVB 4LCUB 3D85D 4D9QE 4WV1C 4F7TB 1J0JA 4BFIA 4PJEE 5EO9A 1MCWW 4NP4H 5EBWB 2VZTA 1GGCH 2QADC 4TTDC 3IU3A 4S1RH 4CVUA 4LNVA 4UBDC 2IH1B 4X5WA 4ZOEA 1NGQL 2GW5A 2C4XA 5L8KB 4NQED 1OWWA 3I6KA 1T2XA 1Z9LA 5F1IA 3JV4B 5TJWK 4HV8B 2ATPB 2UV3A 2NPLX 2D03L 5FYKE 1QPXA 4YDLC 1MVUA 4OD1H 5DSCB 1PZUB 3IDMB 4XMLH 2DKMA 4K7PH 4YAQA 2NR6D 1WEJH 2XPGB 3RVXD 1JRHL 3GUTA 4ZUWA 2ZSVA 4QF1B 1LP9E 1R5VA 2CDEA 1OB1A 5DJ2A 3UPCA 5D5MB 3P11L 4MSWA 1P9MC 2H9GA 4I0CC 1HXMB 1QHPA 1HKFA 5L0QB 2ZPKL 4HGWB 4PS4L 4XGZA 1QR4A 4C83A 1D5XA 4HLZH 3WFDL 2BJML 4XWOC 5A2KH 4Y8DC 4PJIA 4YEEA 2Y4SA 2OCFD 3M1BB 4G8EB 4PLNC 3S36H 1SEBA 4U3XA 2N1KA 1OF2A 5IJVA 5D7LB 3D87B 3ZKND 3BPLC 4NZUH 5INDA 3RIFF 1U8PB 4JFZL 5E6IB 3UJJH 3GKWL 4GQ9L 3RFZC 3VXQA 4LLUA 4NBYB 5D7JA 1CFTB 5DHVA 1RQ5A 5I1HH 1TJIH 3D2UA 5KZCD 1ZGLA 2CRYA 1AY1L 1I7RB 3QO1A 3M17A 1HH6B 5DS8B 1FDLH 1MUJA 2YXFA 2Z31D 3RWIA 1JTPA 1GZPA 2BZDA 1CE1L 3BZEB 1KC5H 1JGDA 3WMSA 3JZ7A 3LMJL 4XRCA 3CLFH 3A67L 1FNEB 1JYNA 3IRPX 2VLKB 4NC1C 1RZ7L 3BQUB 2NY3C 1C08B 4Z0BH 3KPMA 4XMKH 1GGIL 4HFUL 2DYPB 1DQMH 3QAZB 5KS9A 1EEQA 3UTTE 3C5SA 1KCLA 1NLBL 5IROC 2V2TA 3RWJB 2EDEA 3MO1A 3PGFH 5D7JC 4MJ2A 4N0UB 3SGDH 4K94C 3CK0L 3B3IB 5ENWA 3RY4A 1WBXA 1DVFA 4TULL 4BKLB 2PCPB 5IFAH 4RAVA 4F15C 2XA3A 2VDPL 5E2WH 5IQ7H 1RUQH 4AIZB 2NX5B 3QG7H 5I75C 3GGWA 1BBJB 3WXWH 3NAAH 1IBGH 2FRGP 3GHBL 3MRJA 1K4CB 4UDTA 2IF7A 5EZIH 1CBVH 2X89D 3VFUB 3RDTD 3QUYB 5KSBE 4GRWF 1IQWH 1NC2A 4UIMB 5F7FA 3NCBB 3EO1B 3KPPA 1A9BB 5FGCE 2DI8A 2A1WL 1K8IB 4U1NA 1CZ8H 2BNQE 2Q8BH 3Q6GL 5FM4A 4I4WB 3PGDB 4KV5F 1TCMA 3MXWL 5IBLC 2EDTA 4FQIL 1A6AA 3P4LA 4JRWA 5E4EC 2VLLB 2VXQL 5ITFA 4U1JB 5J6GA 2DQJH 1DVFC 1ZWIB 1LE5A 2R2BA 1FFOA 3GI8H 3EYOA 5C0EA 4OSUH 3MLTA 4RRPA 1JTTA 2R8SH 3K81A 1BFTA 1FN4A 4HS8H 4NDMB 4HIEA 1MCJA 4PB0L 5FYLD 4CN1A 4JFDB 4AIXA 1F6AB 4M7JL 5MENA 1Q9LA 4XPAL 2FX7L 1U8QB 4AT6A 3BXNB 3VI4E 7FABH 3JVGA 1F4HA 5DVKA 1YEKH 4L3CB 4MA3A 4DW2H 4MDIB 5FGBA 3QXTA 3SKOA 3HTLX 3EYSH 3DVFA 5ANMA 1I7ZB 2BCKA 2V6HA 4K3JH 1CLOL 3DMMD 1CDYA 4FG6C 5DK0A 5F1OB 3PQYB 3UP1A 1A7RH 5E2UL 1PEWA 3SCMC 3SDXE 1C7TA 2NXYD 2WUBH 3SBWC 5ICYA 3BW9A 3QUXC 2YWYA 4OI8A 5F44A 1Z5LB 3P4MA 4LVEA 4CJ0A 2Q1EA 1FBIH 2D7OA 4XBEH 3S35H 5CEZH 3VGAB 1MCNA 4U1LA 3LKOB 1OTSD 4JDTL 1GAFH 5C6PB 4PJCF 1WQVT 1PG7X 3GMMB 3GMPA 5CSBA 4G80A 3GJEB 1D7FA 3JVGC 3SJVB 1FL6A 5C0CD 3C09B 1ND0A 3OKEA 5F8RC 4NRYB 4EUPA 1QFWH 1UKTA 1XCQB 3L3IB 4MZ2A 3BPOB 3UZEA 3IDGA 3ULVH 3O3BA 4RMSA 2J3SA 4P3WA