3K6FA

Crystal structure of mouse t-cadherin ec1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
SGIVVSPILIPENQRQPFPRDVGKVVDSDRPEGSKFRLTGKGVDQDPKGTFRINENTGSVSVTRTLDRETIATYQLYVETTDASGKTLEGPVPLEVIVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords T-cadherin
publication title T-cadherin structures reveal a novel adhesive binding mechanism
pubmed doi rcsb
source organism Mus musculus
total genus 19
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3k6fA00
4XXWA 4AXWB 4NQQA 2OMTB 5CZRA 4ZMYA 4ZMWA 4ZMXA 4ZMOA 3LNEA 4AQ8C 2YQGA 3UBGA 3FF8A 2WBXA 3K6FA 2X2UA 2QVIA 2OMVB 1WYJA 4ZTEA 3K6IA 4NUPA 3Q2VA 1EDHA 3UBFA 4ZMZA 3LNFA 2WHVA 3LNGA 1O6SB 4AQEB 1NCJA 4AQ8A 1SUHA 4AXWA 4AQAB 5DZVA 1WUZA 2EE0A 1NCGA 3LNIA 2QVFB 4APXB 5JYMA 3K6DA 5KJ4A 4ZI8A 4ZMQA 4AQAA 4ZMNA 2WD0A 2OMUB 1NCHA 3LNHA 2WCPA 3Q2LA 4NUQA 2YSTA 2A4CA 2OMZB 5CO1A 1FF5A 2A4EA 3K5RA 4AQEA 1Q1PA 3MVSA 4ZMTA 3Q2NA 4NUMA 4ZMLA 1ZVNA 1OP4A 2OMWB 4ZMPA 2O72A 4QD2E 3UBHA 3K5SA 3FF7A 4OY9A 4XXWC 4ZMVA 1NCIA 4APXA 3Q2WA 4AK1A 1L3WA 5JYLA 2V37A 1ZXKA 4ZT1A 3QRBA 2OMYB 3PPEA 2OMXB 3LNDA
chains in the Genus database with same CATH superfamily
3QDJD 5GRJH 4AQ1B 5BPPA 3HA0A 2VDQL 2FSDA 4H1LA 2C4FT 2DQDH 4BK4A 1AXSB 4WHYG 3M17B 5ENWA 3KL0A 2IFFH 1U91B 2CUAA 3DXAD 3EYFB 1TT6A 3BOVA 2B08A 1AXIB 2V9UA 1P4IH 4AVIA 2YPKA 1KCUH 4WFGD 3QYMA 3D9AL 4M7LT 1Z1WA 2D0FA 4P5TD 4PJAE 3M1BB 4L1SA 1GY2A 2VUOA 1CL7L 2XIIA 5FS5A 2VDOL 4I48A 3IMBA 1I1YB 2CO7A 6PAZA 4PW9A 2JIXA 3FFDB 3PF2A 4OQTH 3TIDA 4K7PX 5I1CL 3ULUL 4X9IA 1XX9C 5EOTA 2BIMA 5BO0D 4QHNA 3MA7B 4XNMB 2UZPA 3HZKA 5D4JA 2NZ1A 3TCLA 1CYGA 3UDWA 1IARB 5D7LB 4HCFA 4OLUH 4BSWB 5ISZB 1T5XB 3ISRA 3OKOB 1NFDB 3FO0L 3O0RL 5AALA 4POZD 5B38G 3VD2A 3CVBA 3NZ8B 4XNQB 4WO4A 3GHEL 3QC6X 2NOYA 2PCYA 1CGXA 3D9AH 4CKQA 1IAMA 3QIUA 2KKQA 3QO1A 1HZLA 4OIAA 2YPLB 1CL7H 2GABA 2VDOH 4N1CA 3KDPB 4F91B 1Q9KA 3OB0K 2HLEB 4APXB 1TTUA 2QVKA 4ZTOH 4APQC 3QIBD 4PSRA 1EVTC 3GNML 5LB1A 4MNQB 4PJEA 3OHXA 5JXEC 1KIQB 5MEPA 2J3SA 2A9MH 2EDEA 4W9EC 1EFXA 2XWTB 3RY5A 3WGUB 3CWGA 4Q6IA 3FO0H 4B3VA 3O0RH 2YSSB 3RPIB 2B1OA 2VN3A 3GHEH 2XACC 3F7RA 5HYSB 4ZNEA 3JTTA 4HIIA 4XNYL 4DUVA 3W38A 2YD7A 4FN0A 1HYRC 3BPCA 2WUCH 4BGDA 3N41B 1JTTA 1O9ZA 4H8VA 4NPJA 1H3VA 3GNMH 4RA0C 4TLSA 4QDGA 1B4JL 3I6LE 1N18A 2CA4A 3RVWD 3K0YA 4ZS6D 1OF2B 4I1NB 4MWFA 4KDWA 1AHWA 2CRMA 5LBVA 2F19L 4QXGL 4G3YL 4P9ML 1MW0A 4LLQA 3DMMA 4Q6KA 5KG9A 2ZNWA 5D72H 3S0PA 3WAKA 5JA9A 1FNEB 2YEZB 4N1EA 4AEFA 1RZFH 43C9A 4AENA 2NUTB 3I3BA 4HUKB 4AYGA 4D94A 5E6YA 1NCWL 4P46D 5KSUA 3RU8L 4WNQB 3RGVD 3VGEA 5CR1A 1B4JH 5M7QA 1N19A 3PV6A 3SY6A 3D8MA 2G4GA 4PRNA 5EF3A 3K71B 3BW9A 4J7RA 1X4XA 1H3XA 2Z31A 2WSKA 3SDDB 3B2PA 5BOZG 1HEHC 4YFLF 5IM7A 3FTWA 1IVTA 1H6TA 1MWOA 3UBGA 5KYXB 4G3YH 3GZOA 1FL3A 1P9MC 1WF5A 1R34A 3NABL 1HE8A 5C07D 1JGVH 4YN3A 2AV1A 2E7DA 3GSNL 2ZIDA 4EIUA 3TBVA 3L4UA 2FJHA 4A2FA 2R2EA 1NGXA 3RU8H 2I69A 3MCG1 2EE2A 1F2QA 1MOEA 5T33H 3HHSB 3Q3GA 1NL0H 3UBXG 5BRZA 4NHCH 4BFGA 2XN9A 5BV7C 5C7ZA 1PS3A 1QNIA 1ICTA 4YBLB 4K9JA 4XP4H 1DVYA 4XMTA 4GQZA 4U1HA 4M6OL 2NY1C 2VQ4A 5DK3A 4LCWE 4XODA 4D8PA 2QKIC 4KTDL 4YZFE 4HUXB 5GXBB 3GSNH 4TM9A 2J72A 5KVEL 3WN5A 2WTRA 4Q4IA 4JO2H 3SBPA 2VR4A 4RIRA 3U48A 1A6AA 4X6CB 3IDUA 4WKXA 1P7QA 3PABA 2F74A 1HEZA 4M7LL 1HL4A 2I24N 4M61A 5JIMA 1ZLDA 3WFHA 1C08B 3D85B 4LLDB 1CDHA 3COOA 2BH0A 3FQNA 3MLZL 1HX0A 1OPGL 3EUUA 1T0MA 1JNJA 1AO7E 2CAKA 4M6OH 3QQ9C 3EJQA 2COVD 5DUPH 3VGFA 4KTDH 1CGSH 5E1AA 1Q0YL 3DIFA 1TFHA 4JE4B 5DGQA 1Q1JL 2XWJA 3PWNB 5I73C 3S88H 1L3WA 2P5WA 5B1BB 4M7LH 3V4PH 4X4YA 1Z7JA 3NIGB 4WU7A 3PRZA 3GTNA 3IDIA 4HD9A 5J8OA 1T2JA 4PB9H 5ID1A 1S9VB 1XGRA 4EIGB 1LDPL 2R29A 3RY6C 1OPGH 3V6OE 1H8SA 1U41A 4G9FA 5DK2B 3SGKC 5PAZA 4E9VA 4NN5B 4XC1H 4G59C 1JZHA 1UXSA 1K6QH 3HS0C 3KYOB 1IGJA 1SRDA 1HQRB 1VZGA 1Q0YH 1J5DA 3HCVA 3FCGA 1UM4H 5ETUB 3QG6A 4HS3B 3QUXB 3V0JA 4M43L 3VI3F 3MX0B 4UOJA 3IFNH 5FGBC 4L3FA 5FKPA 4NIYE 1ND0B 1KGJA 4L1BA 1HTYA 3GXPA 3NDZE 3PHAA 4UM9A 2I60L 4HIEB 1P6AB 1VENA 3O3EB 2HXAA 3R4RA 4JVWA 4JFEB 5IWLA 4RX4D 1UGNA 1LDPH 4I0PC 2JI1A 1A14L 2X4RB 1LHZA 1M4KA 1INDH 5DURB 4YFEA 4AL8L 3EOAB 4NUPA 1LQSR 4GP8B 1EPFA 4L3EE 4ZFQA 4E9WA 1N26A 1T83A 3LRKA 4PJ7A 2OYKA 1G7JA 1YPZE 2WXJA 3D48R 4GNKB 2FZ3A 4JQVA 4AW4A 3VQ1C 2ED9A 2BMKB 1IBBA 5LAXA 4L4VD 3D18A 3J7HA 1W9XA 5BO1L 4YK4B 1JPTH 1COBA 1YHPA 4PTTA 3ISYA 1NCUA 5JIDA 1R3JB 2YRPA 2VZOA 2XVLA 3IAPA 4GKSB 1A5FH 1DBAL 3QHTC 4C4BA 1X4YA 4P57B 1Q94B 2FX7H 4QRBA 4PN6A 3NIDE 2OTWB 4FQIL 2D4DA 5HHNB 2BY3A 4MYPA 3MRQA 1U8CB 3WNMA 3RZWA 3VXSE 5DS1A 4ECNA 4P4KD 5HDBF 2JWYA 3NCWA 1PIFA 3UEQA 3VGBA 2FIKA 2YD6A 3OC5A 4K0OA 4A6YL 1JD9A 3SPIA 1SOKA 2XKUA 3S4SA 4IKIA 5C9JA 3AG4B 5DD0H 3QARA 4TL4A 3V95A 3VMOA 5E6SB 1JGDA 3K5RA 2HMIC 4IGBD 1KYDA 3AXLB 4W4NA 5I17A 1A4KB 1J05B 2VDPH 1PZ5A 1T0NB 5I1AB 5D7KE 4RBPK 1CXEA 2OQJA 2APSA 5T5NF 4UZGA 3M45A 3QFJD 4K3JH 2P45B 4ZFFA 4FQIH 5BZDA 4ORGA 4HWNA 1G1YA 4ELMB 4TTDC 3VXRB 4U1SB 4DP4X 3NFSL 1J9QA 1BX2B 4DZBA 5EF2A 2V37A 1EUTA 4ODXA 3SHSA 1LQBC 4YLCA 1UKQA 2LTQB 3BYYA 2Y2WA 5EMYA 1EAPB 1FHNA 4PJDB 1KB5L 3C8HA 4FLSA 3CTTA 4RZCA 1I8LA 2ID5A 4A39A 1OSPL 3T65A 2WBKA 5GS0H 1L9MA 3BLBA 1ETZA 3L4WA 1QVOB 3HHMA 4N8VB 2OMZA 5K39A 4DUXA 4IBTA 3VXNB 5E1HB 2DLGA 3QQ3B 3OB8A 1J8HA 5T3ZE 3PXJA 2I32A 4GINA 4GW1B 3SY0A 4BXVA 1BIHA 3LQZB 5GGVL 1XR9A 3IU3A 1X44A 3JWNG 2A77L 4BSJA 3SKNB 5CU9A 1TTBA 3T3PE 2QR0A 4KRNA 5HI4C 1AXTL 2L7UA 3MRBA 2VLRD 3JYBA 2YAMA 1SQ2N 2ERJC 1QBLH 1OSPH 4JY4B 3MACL 4MBRA 4O5LL 1JPGA 2BHUA 1MI5B 3HE6D 4KRMB 4A2HA 1PAZA 1SHXA 4OZIE 3QG7H 1UATA 2IWGA 3K74B 4GRWH 4XCYA 1ZJAA 2DH3A 4JGUA 3B7SA 4IRSA 4QAWA 1RSFA 1A8ZA 1TQVA 3BHBA 3BPNC 3EJUA 1AY1L 5GGVH 1TTAA 4YHZH 1GHFL 3ABGA 1SXAA 2A77H 1BQHA 3CMOL 1SMAA 2NLJA 1ZT7A 3UAAA 2I27N 5GS1C 3U30B 1T7WA 1LEKA 1AXTH 1V8HA 4I3SL 3GUTB 5GS3A 1VIWA 4LCIL 4ODSH 3IDJB 5EHFA 3T1WA 3B37A 4O5LH 5AZEL 3CVDA 4X8JB 2I7OA 2ZONA 1WWBX 3CDFA 1RJZB 5I19H 1KBKA 3RVTD 3MLRL 5G55A 5ITFB 2MWCA 2VDQB 2ZTBA 1R3HB 1U36A 4XVSL 1RURL 2FO8A 4Z7UF 1G84A 3NFNA 4QTIH 4XCNB 3EW3B 2V5TA 5JOPE 4ATWA 2PN5A 2X3BA 3VJ6A 5IR1A 4F92B 1GHFH 1CE1H 2EDQA 3VFVA 4NUGH 1IEBB 4EI5A 3MJ8B 3QEQA 4ZMTA 4I18C 4EDXB 5D7LE 5ISZE 5I1KH 4YHLH 3GZPA 1NFDE 3KWWA 5AW6B 3DVGB 4FG6D 4FQHB 3DHJA 2E9BA 3L1FA 3MLRH 3BRFA 4MXQC 3MNVB 4Y7MA 4ANUA 4XVSH 3NPSC 2YPLE 5DEFA 2ETWA 2X1OA 4IDLA 4B6ZA 1NEZB 1A7NH 5C92A 4MNQE 3IJHA 3X11A 2C9PA 3MUGB 2K8QA 4NQCD 2RQ8A 4KY1L 4MB4A 3TF4A 3ZDWA 4JM2B 4R5TA 4DW2H 3WY1A 5CEZE 2PW2B 3F62A 1OGAA 3PWPD 3FOMB 3L45A 4BK5A 1XCQB 1J5OH 1E9PA 3T0BA 2P5PA 5AOMA 2O5XL 3V79C 1GJIA 4Y88A 2XVGA 4TUOA 2HFEA 1FFQA 1I8IB 3BMWA 4MZ2A 2FQGA 4M93C 1IBHA 4LOVA 4XZUB 4PJCA 2IH9A 6PCYA 1DLHB 1EA9C 4AGMA 4UQ2B 1SY6A 3V52H 3GXUB 4CW1A 4YL9A 4KV5F 3FCTB 3KPSB 2Z8SA 3MRCA 5E9DA 1QR1B 2TSBA 4QTFA 1XF4B 3NCBB 1AGEB 4QRQB 2EIBA 3WEMA 4GEIA 4BCXA 3O6FB 1FIGL 1QRNA 1XZ0A 1S6NA 4NQTA 3BUQA 1D5IL 1BVNP 1TJHH 2ZNXA 3QCVH 4K94H 5IFAL 5JA8B 1ZANL 3QDGB 4M7KL 4MKMA 3QUZA 1HXMB 3FT4B 3NZSA 3MV8A 1PZ3A 1WUNT 2DY2A 2VC2B 5E5RB 3IRCA 2J8OA 2XYCA 4MMXB 2JIXD 2OZ4L 3A23A 4E5XG 3G5WA 1O75A 5ICYB 4C54A 4EN2A 4OCLC 1IIKA 2MJWA 3O8XC 2NNFA 2CXGA 2HJFA 2A6DA 2VAJA 4L3CA 4UZSA 1E40A 1CDYA 2BNQA 5BMFL 4XAKE 3T8XA 1ZIAA 4P23D 1NC4A 4PJXB 1PZSA 1FIGH 4YDNA 4WO4D 3WIHH 4BBWA 4A2GA 1D5IH 3BZ4A 2K7PA 1ZANH 5D55A 4LHUG 1V54B 1CJYA 5IG7A 3BIBX 1JI2A 1G5AA 3AU1B 4MCZB 4R2GB 4EDWL 1IX2A 5E5MA 1XCXA 3LKNA 5IQNA 4FEIA 1TXKA 3K2IA 3CZNA 4Q0XL 3BVUA 2IEPA 3U0TA 4C56E 3TPKA 2YGOA 4PRAA 4AOFA 1EFXD 5DZLA 5ADPH 3KLHD 2P5ED 3RUGB 2R23A 4LSRL 1JSYA 4RMVA 3RWGA 5BMFH 1UZ6F 1TQBB 3DX0A 5IV2B 3PNRB 5H2BB 3NJIA 4DPCX 1MEXL 4N4YB 1A6ZA 2IAMB 5A2KH 5CSGA 1NGQL 4F3FB 1NH6A 3PHOA 4G6FD 4OGYL 3QYNA 1EJ6A 2F7QA 1GW0A 1J87A 4R6UA 3Q8FA 4MAYB 2EYSB 3LQAL 4JQXA 4EDWH 3OWEA 3HUJF 2KZWA 4DPRA 5D2LA 3FUNA 3MV01 3V0GA 5IBLD 2YGPA 5LLIC 4HH8A 4KJWC 2JJSC 3FCUB 4X6CE 3S5LG 3GIZL 1C1EL 2WO3B 1DE4A 3GSXA 5IBUG 3DX7B 3A24A 5I24A 5IJVA 1YEEL 1MEXH 4FADA 2G75A 3MODH 4HJ0D 2ZCKL 4OGYH 3OKDB 4FFYA 3QNXB 1QSFB 5L4FA 3D3VB 4WFHD 2OSLB 1CR9L 1DJYA 1KWGA 2V7NB 4X5PA 3NQIA 1JYXA 2WQ8A 4LSSL 2F9BT 5EUOA 4YHKL 2F53B 5HHMB 3GK8L 1KNOB 1KBGL 2BCKA 2X4QA 3AT8A 4FGMA 4KKPA 1I1RA 2V0AA 1KEGL 2BXYA 3NRQA 1NICA 3GIZH 1EERB 1C1EH 1W0WB 2VSMB 4TVPL 5IW6A 1HSBB 1YEEH 5EZOL 3ZRCC 3NIGE 1E8YA 4J6IA 2P24A 5KS9F 2Q20A 3JZYA 3SPGA 4YSTA 3B9KA 4ZBJA 1IU1A 1CDBA 5AVYB 1R33A 1CR9H 1M7DA 3DRQB 1X5MA 5DRNB 3SQBA 5DXWA 5AVWB 2E75C 1HILB 4F7MA 4LSSH 5LWYL 1XB8A 5D1QC 1YRKA 5DD6B 4L8SA 5GGUA 3GK8H 3N42F 4WW2B 3SPVB 1YUKB 2DYPA 5SV3A 1KBGH 4NKDB 12E8L 2ADJA 3M8OL 5TE6H 3VWKA 4PJFE 3IMRA 3PWVA 2XN9D 3IEAA 1NKOA 1MIEL 3FCBA 1HVXA 2EO9A 4JFEE 4UV7L 3DSFL 2WQUA 4Y5VA 3UO8B 4F8NA 3DETC 1B4RA 1DJZA 1C5CL 2AQ1A 1MAJA 1KJ3L 3CDGA 3ULUC 4FZ8L 1QPPA 1FNHA 4NNPL 2YPKB 4J4PA 3NBNA 2DLFH 1EEUA 3DWTA 5EWIL 3QEGL 4JHAH 4FNQA 4DPAX 3EYOA 3NCYP 4XO5A 2P8PB 12E8H 3EJPA 4I48B 4OUUA 4CGTA 3M8OH 4LEOB 1ZLUK 1QUPA 2NY5L 3WHXA 5FPIA 2D7TL 3DX4A 5L9DL 1FH2A 1MIEH 5EOTB 4PJGB 3N5AA 3A0OA 4WGWB 2Y9RT 2X05A 2XBDA 2HRLA 3B2VL 3TCLB 1EDQA 1WISA 5IB4A 5E9AA 4X4XA 1VSCA 4UV7H 4D7BA 3ZE2B 3FB6B 2F2HA 2DIAA 5HHPB 4WO0A 4X7SL 1ES0A 4CVXA 5C0CA 2X4TA 2XCMC 4FZ8H 2DRUA 2GBVA 4PMEA 3TWYA 4F8PA 3X2QB 3TV8A 1OAUL 2MOGA 3FN3A 1W15A 2P5WD 5E2UL 2NX5A 2Q3XA 3LRHA 3BUDA 2DN7A 3UYRL 1MFDL 1Q9KB 3CLFL 4PJ8A 2KLSA 5F3BA 5SWZA 1UYWL 2PTTB 3B9VA 3MROA 2XZQL 2NY5H 5KSAA 1ZJBA 1XVSA 1JZ6A 3OHXB 1PZUB 3DGGB 5MEPB 4JG0L 4S0SD 4G9FD 4JFZL 3F3HA 3B2VH 3C75A 3CHXA 2VJ0A 1F11A 4I9XA 5EIIG 5G5DA 1WYJA 4Q6IB 1YCSA 3CDZB 4A6YB 1CD8A 4QLRA 5F9WC 4ELME 3OJ2C 4R4BA 3R7RA 5I1LB 5LDUA 3HW7A 3IPFA 1OAUH 3JTTB 5FYKD 3BLKA 1MY7A 1Z66A 4HPYL 4K4KA 5ANMA 3U4BH 4FMKA 1H3WM 2A74A 3BPCB 3NGBB 1MFDH 3CLFH 4HCRA 3AUWB 4NGHL 3FNKA 3T71A 2Q86B 3PGFL 1UYWH 1XL4A 4UBDD 2X6MA 3QEHB 4PJDE 5B4MD 3X3GH 3N1FC 5AAMA 3RNQA 5IJBC 5I8OL 5L2KD 1MJ8L 1U6AL 1DP0A 4MWFB 3ROLB 1MCBA 1F5WA 3N04A 4G5ZL 5IF0A 5JPMB 1UA3A 3HZ3A 4AMKL 1F2XK 1ECYA 3C09B 1KB5B 3Q43A 2KQNA 5KG9B 2AQTA 3KLQA 1U8OA 3LSOA 43C9B 3RWFB 3EJCA 1BAFL 2Y7OA 4BZ2H 5I71C 4NGHH 3U7AA 3ARFD 3PGFH 4OVUA 1UCBL 4FP8L 1WT5A 3VH8A 1OW0C 3LN5B 3PV6B 5I8OH 4OCRL 4PRNB 1MJ8H 1SN2A 3ESMA 3VXTB 1MI5E 1CF1A 3ES6A 5IM7B 1TMQA 4XP1H 3ZL4L 4G5ZH 4AVKA 2VITB 1QW9A 4Y9CA 4F7CA 1QWUA 2YGQA 3RWIA 4HJIA 1JN6A 2BP0B 4JM0A 4AMKH 4GY4A 5E56A 1EXHA 1M7UA 2JCCB 1FL3B 1M71A 5DD5L 1MHPL 1YAZA 1EEZB 3N85H 2QFPA 3CNKA 2R2EB 4E9RA 1BQUA 1UCBH 3BIAX 4FP8H 4ZNCD 4K3DL 4HWBA 4OCRH 3KJ4C 2WLJA 3Q3GB 4XI5D 5CCKH 5BRZB 2AMUA 3WNPA 2R0ZL 1MHCA 1MHHA 2LLGA 2NW2B 3ARQA 4J3TA 4UTAA 3ZL4H 3BD3A 5DHEA 4AV0A 1EO8H 1INEL 3UZVB 4QCIA 4U1HB 3ECVA 5DD5H 4X7TA 1PD6A 3ZKXC 2R8SL 1MFEL 5H37H 1FAKT 2BRQA 3X13B 5BOJA 3V6ZB 5FK9B 3CD4A 1G1CA 2BFVL 2WXNA 3U1PA 3WN5B 1SYSB 2ADGA 5FUZH 4DVBA 4L1TA 1IFGA 4B50A 1EO7A 4K3DH 5DJ0A 2WQSA 3PABB 2F74B 1HEZB 3I9IA 3IJYA 3VGGA 2WXKA 3S7GA 4N9OB 5KBMA 4M61B 4Y16A 3RG1C 2R0ZH 3QRLA 4IRJB 3WFHB 2O5NA 2XQYG 3TX4A 3VU1A 4GO9A 1PY0A 1VGKA 5KVDE 1INEH 1JK9B 1OARH 2B5IC 1KDIA 4PRBA 4B9KC 1INQA 3DC0A 3TNMA 4E9XA 3EYVA 3UPCA 2FBRA 5IVOA 5DFWH 2H6PA 1K85A 5E1AB 4JDEA 4WW2C 3G6JA 2BFVH 2CCWA 1YY9D 5IY5B 1E5UI 3QDHA 3T6VA 3CSFA 3N0AA 2BY2A 4JFOB 4BFRA 5CKAA 4HC1L 2XU9A 3T0EC 4JRXA 1AACA 1IB5A 5C08A 3TT1H 1FZMA 4X4YB 4BH8A 1QR4A 4WU7B 3EGXA 1ZEAH 3IDIB 5DMGC 4IRSD 5BQDA 3BWAA 3C9NB 2XN0A 4FQJH 5ID1B 2XQBL 5AW1B 5LBSH 5I76A 3MRMA 3QORD 4CADB 1LNUB 2VM9A 4LP8A 1C9SA 1BZ7A 4KO9A 4Y5XA 3V0IA 1SOXA 2HT2C 2PYEB 4MMZC 3KPSE 4AMXA 2O61A 1OTSD 1CICA 3RILA 1DJIA 3QG6B 2CKBA 4IBSA 2VH5L 5DRXB 4HMEA 3Q2NA 4H88L 5FKPB 1J5CA 2AJ3A 3QDGE 4I2XA 4AL8C 4UM9B 3TL5A 4WV1C 2X6VA 5EF1A 3MUY1 2MH4A 4ZS7H 1TYJA 5FM5O 3R1GH 5IT2H 1U3ZA 2XQBH 2BP5M 5HGGS 4DKDC 4ANXA 3V55A 3GSRA 2X70A 3IJ7A 5B3JF 3KGSA 5JOFA 2FJFA 4FHKA 4K7PL 4PJ7B 4BHUI 4PJXE 4AZUA 2WM0A 2VH5H 2FZ3B 4H88H 4D8OA 2B39A 1NLDL 4ABUA 3HNTL 4HSAC 4B60A 3HBQA 3WDHA 2LVCA 4IYKA 4N2LA 2FDBP 1G7HA 1JXJA 1TMCB 1IBZA 3L3OC 3BKJL 3FC8A 4N22A 1IGML 1D7CA 1MCNA 2GT9A 3GF8A 1UB5A 4JANB 2G2NA 2NY7L 4WUKL 3E7JA 1UM5L 1ZD6A 5FDYA 3D09A 3RUGE 5HPOA 1OGAD 3MRQB 2VXUH 4K7PH 2AANA 3LZFL 5F1NB 4HIXL 1BQSA 2KZKA 4H40A 5GS0C 3RTQA 4XMWA 3SE6A 2FIKB 1B6UA 5AVQB 3OB0H 3US9A 1XSJA 3D51A 4BD4A 4ADJA 5C9JB 1B3IA 4E42B 1UD8A 2AC0A 5FO8A 3L13A 3H0TA 4KNSA 5I17B 5AW0B 1L6XA 1ADQL 3OR6B 4P2OD 1PFCA 2M2DA 3ARBB 5EFIA 3NDYE 3FKUS 5C1MB 1JHTA 4JUTA 4PWEA 2F54A 1IGMH 3IU4H 5CILL 4BWUA 1WUZA 1FBIH 3BPLC 5IMLA 1N5YL 2Y6TE 1AZUA 3UTTD 4ZFFB 2HP4A 1IM3D 2NXZD 1HE7A 4ORGB 1FL5A 2IDQA 1DVFA 4RGOL 4HV8B 4WUKH 4Y5YB 1PMYA 4GSDH 4KRPC 3VU2A 3NQKA 3O3AA 4S2SA 4Z7QF 5F7EL 3VRJA 2P28B 3ELAT 3FTGA 3L1GA 3LZFH 2ZCLL 4HIXH 5D7IA 4AIXA 1PVHA 5B38A 3QUZD 5CP3A 3IN2A 3ME0A 2DQIL 2UXVA 5D96B 3RPKA 4BKTC 2PR4L 3QO0B 2NW3A 3DX8A 5GZNC 3RPBA 2WQWA 4DJMA 3N40F 3AT0A 3WGVB 1QSFE 3WSQH 4PH8A 4ZX5A 3RHWF 3HB3C 2DMKA 2Z4TA 3D3VE 2MNWA 3BXNA 3T65B 1Y6KR 4JPSA 3W0WA 1ITBB 5CILH 4ZK8A 5K39B 1A4AA 2IQ9H 1MCPL 2BNQD 1FHGA 2OMZB 5F0MB 2F53E 2OBGA 1NC4D 2YD5A 5HHME 3SGEI 1J88A 5F3FA 1J8HB 3ZDXF 1BCIA 3LEXA 2GFBB 2V17L 5F7EH 3IU3B 3CN4A 5D1XD 2WXFA 1TJGH 4ZUSA 4ANKA 5T3XD 1U3HB 2Z8VC 4DK3A 2PR4H 3MKKA 4MBOA 1IFHL 1UXLA 1NTDA 2CHZA 4N0UB 3T2PA 4BELD 2NUPA 3MRBB 4RAUB 2YKKA 4HD5A 1ACYH 3PL6D 4H25A 1AGCB 5TK2A 3DGCR 1T2XA 3I85A 3FU7A 3LJ3A 2J6EA 4JDZB 4WWKA 5EEVA 4XWGL 3U4KA 4QNPF 5FW7A 3UGXA 3SKJH 4CKVX 4Y4FB 4YHNB 1EZVX 5I28A 2HVKA 1C12A 4BZYA 2V17H 1ZVYA 3VGAC 1KTKE 2HVJA 4R9HA 3U9WA 43CAB 3MRFA 2G4EA 2BWDA 4HK3N 3QJTB 3BWSA 2CHDA 3GM8A 3GLDA 5F7LB 1FYTD 3N40P 4MA7L 3CDYA 1PKQA 3NSJA 4PREA 5TTRA 3VG9B 1N0XL 1QSVA 5LN8A 5DQ9A 3TM6A 5JW3L 1XGYL 4IRJC 4B96A 1KIUB 4QJ3B 1DEEB 1QUNA 4DTGH 1R3KA 5KBKA 1U8IA 2NY6B 3X1GA 2N59A 5BZZA 3NCCB 3FB7A 4JKMA 3ML8A 2DMHA 3L4CA 5E6ZA 2K45A 4PJGE 2YBRA 5GGQL 3VFVB 4P2RA 3QEQB 4KROC 4F2EA 1F56A 1YY8B 2JSFA 3ZE2E 4YUEH 4IBVA 2HTKC 5F1KC 4CVWA 3KWWB 4MA7H 4QEGA 2DEXX 4S1DC 1X5GA 5D1ZA 5JW3H 3APCA 1ZTXL 3GT6A 3O41A 1RIVL 3QA3B 4HSQA 4XE5B 5A3IC 1OE1A 5HDWA 4DP2X 3T1FA 3UBXA 3UL4A 3EUDA 5KSBA 1BJ1J 4BQBA 2PLTA 1NIEA 5ERWA 4GAJL 4HHGA 3UTOA 5KTEH 3GI8H 3IJHB 4PJEE 5KVMC 1TCRA 3OZ9L 4B27A 3K4ZA 1HESA 2ICEC 4FFZH 1BAWA 3RZCA 3HEIB 5HD8C 3DV4A 4Z23A 4YHML 1TO4A 4LQ1A 3B9AA 5E51A 1MCSA 4K23H 2DYPD 3ZX1A 4EVNA 4AQEA 1QFWM 4YSRA 4CN4A 3VWKD 2HFEB 4M1DH 2JJTA 2KQMA 4ZNEE 1N4XH 1RIVH 4N26A 1WDAA 3IGUA 5CJ5A 5LXVA 4PJCB 4GG6B 4N85A 1T6WA 3AU0A 4BQ9A 4MJ4A 3ZRSA 4CNIA 4GMSL 3ZE1F 1H3PL 4CC4C 4GAJH 4KK8D 1QAWA 5F88A 4E41D 5KVFL 5E9DB 3U1SL 3MRCB 3QHZL 4S1RH 5KYYB 1QRNB 3O2DH 1RPUA 1KJ2A 5AVUB 1KV7A 4JUSA 4KO5A 1MVUA 1SEBA 4ENZA 3MV8B 4PRPD 5J6GA 4QY8A 1JDAA 4ACPA 3HBZA 4EZLA 2HN7A 2F68X 5FWRA 3VVWA 5C0DB 2XG5B 3JUYA 2ADFL 1CN4A 4WHCA 2FJSA 4LRIC 1TU2B 1PZDA 3GXNA 4HXAL 3V5HA 1YNTB 2ZUUA 2HJFB 4GMSH 4L3CB 4YSUA 1B9ZA 4JKNA 4FG4A 3PWUA 4ZMOA 3T8XB 4CJ1A 4PY8I 4NHUB 3V4VA 5C0CD 4LP4A 3GSQA 1YMMB 1CVRA 1S7TA 3BZ4B 4Y4HC 1FI8C 5FHBH 2X1XR 4GB9A 1DUZB 5I5RA 1A6VL 2GTQA 3NCYS 2XWCA 1ZT1B 2NX5D 4GJTB 5IG7B 5EOCJ 4GQPH 2JCCE 1LP9F 1H6UA 3FT2A 2EDLA 2YOAA 2YS4A 2Z91A 3IN0A 4NKOA 5L88H 4HXAH 4BGLA 4Y5YC 4PRAB 2R23B 3LQAC 5HVHB 1Z32X 1FNLA 3VB9A 3LPFA 1R3IH 3LPOA 5DJ6B 2Y23A 3CUPB 1D9KD 3MLWL 5BRZE 3QUMH 4FMFA 2QVFB 4RMWA 1YN7B 4UANA 5KJ4A 1A6VH 1JMXA 3MLUL 2HVBA 2Y7MA 3U25A 3N9GL 4NOFA 3I74A 1EMTL 4AM0A 3W9EA 5D2LB 4PG9B 5EO0A 1XAUA 2EDWA 4P5RA 3IXAA 5LG6A 3LB6C 4HLZG 4IU3A 1SYVA 3FZUD 1BM3L 2DQMA 4GW5A 4N6QA 5MEOB 1ZK5A 2X2YA 1FF5A 2QV4A 3BQVA 1EDYA 1URIA 1Y1DA 2OYPA 4P9HL 1B6DA 4NS0A 3C6LA 1EAQA 3P2DA 4M7ZC 1S9WB 1XF3A 2FQFA 5C0AA 1EIBA 3FSWA 3HNVL 1TJIL 3A4EA 4UT9L 4YPJA 1I1AD 3N9GH 2YAOA 4NDMB 1DQJA 5AB9A 3NFPA 4ZD3L 3UIZA 2K3HA 4FDWA 4NN6C 5CXPA 3C60D 2GUOA 3KHOA 2BCKB 5E1IA 3ARSA 4QRRA 1OCZB 4NO2A 5D1ZI 2L7QA 1PW3A 1AE6H 4YIQA 1ZA6B 2H2SD 2YK1L 1HOCA 2VR7A 3JWDL 4ZAKB 5CBEB 2E9GA 1IT9L 3BVXA 5IMOA 2QSQA 4P9HH 2NTFA 3GRGA 2P24B 2YMXH 1SXNA 5HBBA 3G04B 2Q3AA 3K2UH 3B9KB 2BS8A 2GUYA 1HHJB 3EO0A 2IG2L 3I50L 3QZOA 1H3UA 4L1HA 2VRQA 2H0FA 4RGNC 4FQPA 4UT9H 2PYEE 4QYAA 3ARTA 4RGMC 5KVDH 5SWQB 1H5BA 3L3GA 4F7MB 2VSDA 4XBMA 2FUTA 3FW6A 4M4RA 5HHVL 5D93C 2ADJB 3RURA 1TUPA 4IRZL 1OQXA 4ERSL 1NJ9A 3PWVB 4RSYA 1OO2A 2OZNA 4U6HA 1E4XH 2YK1H 3VI4A 5C0FA 3EO9H 4GXVL 2B9AA 1F4XH 2ZXEB 1QFUH 1AD9A 4P3CL 4Y5VB 4G6MH 4HK0A 1TQCB 2IG2H 3I50H 2OCFD 3N50A 2NY5C 3CDGB 4ABWA 2BSDA 1DJHA 1FWXA 4PJ7E 2IBBA 4JMNA 1VADA 1FAIH 3BAWA 3EYOB 5CKGA 1VA9A 3P11L 4Y9FA 3HG4A 5DZAA 4IRZH 3UAEA 5T1DL 5IOKA 4AE1A 2BJML 3BESR 4GUQA 3WN6A 5ES4B 1N2RB 4EZMA 1JUFB 1BYPA 3VFTA 3RWDA 1JZ3A 1VB9A 2LFEA 3AW5A 4U0RB 5IB4B 4X4XB 3KPMA 3WJLC 3NESA 3BFOA 4R3SA 4L0YA 2X09A 3UZQB 3OAUL 4KKLC 3QW9A 1ES0B 2K1MA 2ZP0T 2APBA 5DEZA 1ZY9A 4HWZB 1Z5LA 5EU6D 3KW8A 1A9VA 4QXVA 4PWJA 4P06A 2HFFB 2VMFA 1Z5HA 2HSIA 4F37K 1XGQA 2FECI 3OX8A 2VERN 4NO3B 5EPMA 5C08D 5JW5A 1MHEB 5F3BB 4PJ8B 4RWYH 3THML 5T1DH 1Q1PA 5SWZB 4YDJB 3WELA 2EXWD 1KBWA 4Y1AB 5KSAB 5IUSA 4Q14A 1J1OL 4S10A 2WP3T 3O4OC 3UBHA 5BRPA 1FNGA 4XBGB 3SOBL 2D31A 1UOKA 3JV0A 3A6CH 5A2BA 3ILQC 1QG3A 3O81A 1YEWA 5G5DB 1D5RA 3G5ZA 5TDNB 3ARDC 5J3HC 4R4BB 1MLCB 2PUQT 4OAWB 3ZE0B 4ZUUA 3PPSA 4O51A 4OLXH 3PLYA 5HY9A 5ANMB 4UIKL 2A74B 3MNMA 5DLMH 5GPRA 1ACXA 5B22A 3THMH 4MDIA 4QRUA 4MAUL 3GDBA 4LB8A 4YEFA 3BSZH 1J1OH 1K8IB 3RNQB 3HJ0A 3H7LA 4LDCA 1LO5A 4Y4KC 5EEWA 3WTXA 1OM3L 3IMVA 3FH7A 3Q0HA 4FQ1L 4ZUWA 5IF0B 1J9SA 2JTDA 3D39D 4G7QB 1LTXA 1T22A 5EC1A 3BSHA 4L18A 1J8HE 1V3JA 2EXTA 3KPQA 1KJVA 1EQWA 3SCMA 5HJ3A 4DP1X 3LSOB 4NZTL 2VDKL 4L9LC 3O6ML 3VRIA 3QHFH 2H4EA 3GSVB 4GLRI 4UIKH 1J12A 3EYQC 2AEIT 3GMOA 5HYQA 1RULH 3F7VB 5T8IA 4BFIA 1J8SA 4N0UE 4WI3A 1UXMA 2CLVA 3OSVA 4JFFA 1N8ZA 1S3RA 4MNGB 3S96A 3SPCA 1IILE 3VH8B 4DPBX 4N87A 4ZDHB 4ODUA 2VISB 3MYJA 1OM3H 3BN3B 1I7UA 2APXA 1E42A 3KBEA 4ICWA 3JSSA 1BLNA 3LDBB 3ZMNA 1JN6B 1GC1L 1UACL 2L0DA 5J6HA 1E43A 1BIIA 1I9RL 4OD3L 2NYYD 3AABA 1M71B 1L3NA 3GSUA 3QIBB 4HQQL 2VDKH 3U9UB 2EP6A 5F7FA 4IBYA 3IETB 3QCTH 4U2ZA 4TV3A 1FFTB 1YEIL 4R7VA 4E5XA 1SUJA 1BXXA 1FZJB 4CMHC 3C08L 4YHOH 1MH5A 3OJMB 1BFVL 2AS5M 2P48B 3Q2LA 5J11C 2J12B 3QPXL 1MHCB 1FA4A 2CGYA 3K2KA 3PG2A 2O5ZH 2VDLL 2J1WA 1IGCL 2N1TE 2BWIA 1GC1H 2HUEA 4OD3H 3UP1A 5LNEA 5IOPB 5ICUA 4X7TB 1NDMA 5FUCC 2EYTB 4HQQH 4LHUA 1SVBA 4CSPA 1YLBB 3TYGL 3WV0A 1CFSB 3SE4A 1AOZA 4G8EB 1AGFA 2ADGB 1YEIH 3QEQE 2GIXA 4DVBB 4HWUA 4WI9A 3W0WD 4H44C 1UJ3A 4PGEA 3C08H 3CSPA 5I5MA 2CR6A 4H1LH 1DHKA 4LP5A 1Y07A 2IGTA 2XJLA 3L95A 3WJMA 3LX9A 5J12B 1A1NA 4Y16B 2WV3A 2XWBA 4G7VL 3SE8H 1DCEA 3QPXH 4ZW7A 3H9HA 3KS0H 4XPGL 2VDLH 3KNBA 1OV8A 1RJYB 4U1JA 3BVNA 1TLMA 1II4E 1NCOA 3H8NA 1MN4A 2ZQKA 4OJYA 1INQB 1KXHA 3TNMB 4HCIA 4X6BA 5GS2D 3LRGA 4NP4L 2CDEB 2AI0H 4M8UA 5SX4I 5IMKB 5B3NA 2J8UB 1JF1A 1PPIA 1ZXQA 2H6PB 1GGBL 1U33A 1L6PA 3O6KH 4JDEB 5FF6A 5MHSE 2OMXA 3G6JB 4NJ9L 3M46A 5AZUA 1TPXC 1IAKA 5GGVY 4ZZFA 1UTDA 4JRXB 3Q6FB 1AZRA 4MDJA 1FZMB 2CKNA 4Z0BL 5HXMA 2H32H 2QKSA 5SWSA 3Q05A 1CLYL 3NRPA 5DC9B 3BWAB 2VLME 5HJBA 5C07B 3K91A 3IWVA 3S5LA 5I76B 5JNYA 4PJCE 4GG6E 3VXUA 2NXYC 1BZ7B 4Y5XB 4FQLL 4XTRC 2AW2A 4UT7L 5D5MF 5CEXA 2MSPA 2HRHA 4M00A 3IPEA 4NP4H 5E9DE 1IKOP 2X41A 3WO3B 1JV2A 3P73A 3O2VL 3B2DC 1HCYA 1CICB 1UEMA 5EEXA 2B4CL 1QRNE 1CWVA 4KKCC 1SJVA 2CKBB 3RBGA 2GBAA 2C9RA 5DFVD 2GBTA 4Z0BH 2DTSA 3MV8E 3HKFA 1EK3A 4M4PA 4I85A 4ZXBB 1CLYH 3KDMB 4Y2DD 2WIIB 2C1OA 2X2HA 4M6ML 4HUMB 4QXUL 3L3JB 3GSRB 4FFVC 2BP3A 1E5YA 1G7MA 1CZ8L 1P6WA 3UAJD 1MFCL 4FQLH 3RX5A 3MOQA 4UT7H 3TVMA 1UUNA 2D0GA 2R27A 4LBEA 4PW3A 3WI9A 5GRUH 3T0DA 25C8L 1J7VR 2FJFB 4IHOA 4PGBA 3J8F7 2SEBA 3O2VH 3VWJD 4U1IA 3SJVB 4PI2A 5HYSG 1YMME 2WC7A 3EKCA 5CFHA 5D1ZD 1EGJL 2QPUA 3T4YA 1B2YA 4JG1H 3RWHB 1RZGB 4MS6A 4TUJA 3PP3K 1JHLL 2J57A 2PO6C 4X5WB 1G7HB 3HAEH 3ULVE 4ODVL 1BF5A 3ELQA 5K9JH 2Y22A 2N7AA 4QXUH 2RMNA 3QWOA 5EOCL 3KGRA 2M8XA 3P0GB 2YXMA 3IDNA 1UB5B 5FFGA 3KYKH 4B5EA 4LMQE 1JGEB 2EVGA 2A83B 7TAAA 1GZPB 3C5ZB 5EA0L 3UP6A 1DFBL 4J3OG 2GITA 5BZWA 4PYGA 3RTQB 4JO1H 4ES8A 1NLBL 1ERNA 2NY2D 1WZ1H 3LRLA 3WDJA 3KYNA 5FO8B 5I2IA 3BX7C 1JHLH 3TN0A 5EFIB 4ODVH 1NUFA 1JHTB 3KYMB 2F54B 1SLUA 1U42A 3DUSA 3VXOA 5D2LE 1CGWA 5IMLB 1Z3RA 3B6SA 3TZVD 4P5TC 5IQ7L 3DBSA 4L1LA 3SE9H 1F4YL 3LZOA 5TPWL 4PHXA 1DVFB 2AEPL 1L9NA 4ZMYA 4LGRB 1DUYA 4ZMWA 3GTTA 4OI9A 5EA0H 4S2SB 4U1GC 3VRJB 1DFBH 3FTGB 4QYOA 5D7IB 5B38B 1UEYA 5F96L 2W07A 5EULV 5EO1A 5IVNA 5LGHL 4HSCX 3NAAH 3T3MF 4AUJA 1S5HA 2BC4A 3Q06A 1QSED 2HPOA 4POZC 4QF1B 5LNDA 2CGZA 3TWCL 4ZFOA 3A22A 4TSAL 4XP9L 3MRIA 3D0VA 3F58L 3T0XA 2V2WA 5DTFA 3EYSH 3VCLB 1HSAA 4UAOC 4X9GA 1F4YH 2YRZA 1WFMA 5EU4A 1WCBA 1GRWA 5E8PA 3UIYA 3HR5B 5T1LD 2OCJA 5HPMA 3MREB 4L37A 5AVRB 2C9VA 4W4OC 3EJZD 5F96H 1JRHI 4NC2B 5CBAA 2X0UA 5E94B 5J1AA 3W56A 4ZUSB 1G9NL 4O02A 2HLFD 1XIWB 2FHBA 4P59L 5LGHH 1HKLH 1SLWA 3CFJB 4R26L 4ZSOA 5F9AC 2KYIA 2GCYB 4WK2B 1CXIA 4LSPL 5HVGB 2C5DC 2DWXA 1RUAL 3WTSA 1L7TL 3TWCH 5AKSA 3M1CA 4TSAH 2DM7A 4H25B 3JVGC 3F58H 1PG7X 1LWRA 2QQQA 3MRHB 3FU7B 4KXCA 3D87B 4IIQA 3OJDA 4WWKB 4LKCA 2OMVA 3RDTD 4A7GA 5FKAA 2B59A 1Z5YD 2JKLA 4X4ZA 5MI0B 4BZ1A 2CJTA 1EHNA 3O0LA 4D9LH 5GGTA 2HVJB 3BJLA 3RVWC 1S7SA 1KG0A 4OUOA 2I9TB 4GOSA 1G9NH 5FA4A 3MRFB 3P4NA 4MD4A 4P59H 4ZS6C 5FYKL 4R26H 1OL0A 3VYPA 2KLRA 4HBQA 1ZT4A 1X5LA 5EZJA 1NGZA 2NY0B 1C7TA 5IJKC 4LSPH 3RJOA 5E8DL 1PKQB 1RUAH 3LKSA 4DH2A 1L7TH 1P2CA 4GAAA 1J5HA 2ED8A 2R29H 3L9BA 3WS6C 3TA3A 2FNBA 1E50A 3GS0A 2ZUXA 3P3SA 3VXPA 4JGNA 1ZKAA 3H3KA 3U6XA 1R3KB 1AS7A 1U8IB 2G3ZA 4FNSA 4ETYA 3HE7A 2FL5B 3GRWA 3RVUD 3FB7B 5JMRA 2Q8AH 1T7XA 1D5BB 2H0JA 4P46C 1WFIA 3RGVC 1TENA 2YBRB 5C0AD 3V10A 3UPRA 3E38A 1RJLB 3KVDD 3PUUA 1LM8V 2VDRL 4IW4C 3E3QE 5D70H 2F6AA 4N2AA 4WGKA 1DO5A 4G71B 2Q6WA 3GD1C 4UOZA 5CN1A 3QI9A 4XO4A 5C0RH 4TNVK 3ZTCC 1WZMA 4L4TA 4ONHA 4HFWB 1KIRA 5KYUA 3KPLB 3D4CA 2XWXA 2DQGH 4PUBH 4TUKL 4Y2OA 3X14A 4WUUD 5KSBB 3T1FB 3UBXB 4CJ0A 3V6BR 3CH8A 3FQTB 3K1DA 4X8GA 5SWZE 5ERWB 3OKNA 3I6SA 4Y1AE 4HXBH 4MJIA 4AMWA 1HL9A 3ECWA 3B9EA 2PPCA 3DYMA 4DP8X 1TCRB 1KC5H 2WZPA 5EU3A 5IB3B 1SNRA 5C0JA 2DI8A 5IB2A 3RZCB 3BCFA 5A7BA 3E0GA 3QJUB 3QZPA 2WHVA 4N2CA 2WO2B 4AQEB 4LIQH 5DZNA 3ZE0E 4K73A 3MRJB 4ETQB 1MZZA 1ZLVK 3V5KA 2HWZL 3FU8A 5ANME 2HRGA 1YJDL 3GLAA 4I0KA 3X1NA 3WDIA 4CNIB 1UZ8B 3CXHJ 4P48A 2GHZA 4W1TA 4XH2A 3GBNH 3ARPA 2IAND 3K6DA 1RHHB 5TGBB 2IGLA 4JLRA 3UJIL 1KJ2B 1F41A 1GYAA 2EUXA 5JIIA 4UIMA 3O11A 1MVUB 2AGJL 3ETSA 1YEHL 3H9SD 3FUIA 1GGIH 1ZHNA 2PNDA 5J6GB 5F89A 1NCHA 2JQMA 2O5YL 3EFFA 2W9DL 1BYOA 5IKCB 4F1SA 1FN4A 2HN7B 1F6FB 2GEQA 1OAYH 3F84A 2W38A 3FQ2A 1OVZA 2YA2A 3K8KA 4QGYA 3FULA 1DR9A 5TF0A 3FTYA 3MC0A 4NKQB 4G7YH 2MHAB 4XCEA 1GS6X 1J0IA 3EHBB 3L1OL 4BFJA 4MNGE 3PWUB 4M48H 4OGXL 4YR6B 2FBJL 3HPJA 4QD2E 1GKOA 3UJIH 3V4VB 7FABL 3D4YA 4OM1L 1IEHA 4WI0A 2H41A 1NGYB 3GSQB 4LCCA 5IVXF 1S7TB 2VZTA 2A1WL 2E7LC 3CJJA 2JQAA 1YEHH 5DI8B 3LEYL 5HJGA 1YNKH 3EDKA 3MI6A 2BERA 2O5YH 1UD6A 4PW4A 1UXWB 2R1WA 2FWLB 2XETA 3FT2B 1ZVSA 3GI9L 3HN3A 5B8CC 4E68A 2FWUA 2Z7ZA 4PTUB 3AROA 1QO3A 3PJLA 4N8VG 4FJ6A 3IDMA 3PWPB 3REWA 3F05A 2OSXA 2UUDK 2UVEA 3OQ3B 4OGXH 4CILA 4OQ1A 3B5GA 1MAML 2FBJH 2AXHA 4DESA 4JQIA 7FABH 3UAFA 5HI4D 1A65A 1USZA 4Z77A 4F1ZA 2IPTL 3PFQA 1I9IH 2V2TB 1ZGLM 5JHDB 1G7LB 1G1OA 3MJ9A 4OCXH 1T1YB 2MNUA 3QUYD 5E4IA 1HS6A 3GI9H 1T3FA 5E1QA 4P9HC 2ZP8A 2JB5L 2DQTL 2X0WA 3O2WL 2EAEA 3PV7A 2MFNA 2JVUA 3IXAB 5C0GB 2WKLA 4IU3B 1SYVB 3P0YL 4CA4A 2QGDA 4F9LA 1FFPA 2XRAL 5FFLA 2J88L 1NAKL 1XCTB 3LKOA 2X40A 3C6LB 2JXMB 4KWUA 3NP4A 1XF3B 1D2OA 4AG4H 1JPFA 1OAZL 1R5IA 2VOTA 3FFCD 1Y7VA 2VM4A 1FGVL 3U9PL 3S37X 3JWDC 5C09D 1DQJB 2X4OB 3NFPB 4EKXA 2J8UE 1JNHB 4JFFD 5JYMA 2JB5H 4IM8A 3RJDA 4P4KC 3G6JE 1ET7A 1U8PA 4NXSA 4QRRB 3K7UA 5KANI 4NO2B 2ZUQC 1FGNL 3P0YH 4JRXE 1FYHB 4YIQB 2MQGA 1HOCB 2J88H 4IGBC 1NAKH 5E6IC 5IMOB 3T6QC 2F7IA 2AQ3A 2GIMA 1OOAA 1P1VA 2NTFB 5HDBB 2P46B 4X83A 2YOCA 5JZ7D 2XTJD 4FLOA 4HFUL 1GZHA 2G2RA 1Z6JT 2FSEA 2QQKH 3EO0B 3MUUA 3D1MC 4NZRL 1RH8A 4PS3A 1FGVH 2CIIB 3FO1B 2Q7YB 3L6FB 3I3EA 2L8AA 1H5BB 2IADA 3L3GB 5J13B 3MV9D 3IK2A 2CK0L 5D2NC 5IHHA 4X6EA 5E5LA 3SDAA 4XVJL 4N9GB 1GGUA 1HCZA 3Q44A 3BEVA 3BISA 4QHMA 2DL9A 1OCWH 4KX9A 3DTXB 4U6HB 5L0QC 3DIVA 3R8QA 4GRLA 5AB0A 2CLZA 4PRHA 1NEZG 4OIIL 2WK2A 3BP5A 4NWUL 4JCMA 1BFOA 1AD9B 2WB7A 2AZUA 4HK0B 5F9JA 3ZIYA 2OI9B 4LHUD 4IKJA 1MXDA 3U46A 4GUCA 1NMCC 4NZRH 5FECB 2XA8H 5CLYA 1QFOA 3GZKA 4ZW5A 3BWUC 2P8MA 3ZLQC 1P7BA 3M6DA 2BVUA 1YYCA 2CK0H 3SJVE 4XT1C 5JPNB 1CFTB 4XVJH 5AL0A 4O2EA 3W3BA 1F8TL 4QHLA 4PGJA 35C8H 4KO7A 5EUKA 4Z78A 5J89A 2ZX8A 3N1GC 5D4QA 4OIIH 4GIAA 3RWDB 1EJOH 3BC9A 4PWGA 3HE6C 1WIPA 5T3XL 4R3SB 3WG7B 3CBRA 3CC5A 2E74C 2UWEF 1QHQA 3HI6L 4F24A 3ZTNH 2R0KH 1JZ7A 5E6UB 1NCAL 4YBQD 3G5YB 3ZZSA 3WBDA 4KTGA 1KN4L 1AJ7L 4JG5A 1D5ZB 2AEWA 3O8XD 4FG2A 3OX8B 4XHJD 5JW5B 2Y36H 3MV7A 3ZYJA 4OF3A 4KNTA 3RX9A 2GJ6B 1F8TH 2J5WA 3O3DA 4WAFA 3BUYA 2JB6B 2Q9OA 1GAFL 2MPAL 3QIWB 5T5FA 3UTPE 3ZTJH 1VRSA 1OOWA 1AQDA 1QQDA 2J6WA 3VXUD 1FNGB 4XNDA 3VW3L 2D31B 2PWEA 3FAXA 1O6VA 3RVTC 3BKYH 2F54E 5TK4A 1QPXA 3TV3L 4B7IA 1JWUB 4LLYA 4M7JL 3HZVA 3HI6H 3G5ZB 2YR3A 1NCAH 1I8MB 1P0SE 3OV6A 1XDTT 3LXAA 1KN4H 4LGSB 4O51B 1AJ7H 2I9LB 4XMKL 5DJAA 1JYNA 1HT6A 5D7IE 5F6IB 4NCC2 2AXGB 2IQAA 2X1QA 4MDIB 4Z7UB 4PJBF 1RZIA 1GAFH 2MPAH 4CVZA 4GUPB 5D7JA 3I6KB 1VF5C 5L6YL 2R9HD 3BP4A 1Z3GH 4NNYA 1DCLA 4F8OA 1LO5B 4FG6C 1KULA 4QAMB 4FFYL 4ANVA 1FCGA 5DYOA 2CDGA 3RKDD 3WNIA 3TV3H 3EXJA 4WSKA 4PY8J 4XMVA 2YPVA 3EBGA 3R4DA 4EQ3A 2KBGA 1T22B 4F33A 5ALBL 1BWWA 1JVKA 4Z1PA 1IE4A 4GBXD 3KPQB 1KJVB 1KDJA 4XBEL 3DURB 4JFXB 3VRIB 5K9KB 5DDHA 5FM5M 4JN2A 4O00A 5ID0A 2IVFC 2N01B 4HX1B 3B7TA 2F7OA 4BFIB 4K7PY 4G8AC 4K8RD 1GC1C 3N1PC 2K6WA 1AIFB 5L6YH 4GAGH 5GZOC 2YJLA 1A7RH 2H0PA 3AJ7A 4KQ4L 3PYCA 4FFYH 2IIJA 5INDA 1W8OA 2RTTA 4D9QE 2JJUA 3PNWA 1DO6A 1CXFA 4M5YL 5HGBA 1BLNB 3HS9A 4BQCA 3OZKA 3O3BA 2XI9A 5J6HB 3KZ8A 1BIIB 2Z7UA 3BO8A 1U9KA 3POHA 4XNXL 3GSUB 2ZX5A 4IJTA 4HOXA 1L9TA 1A7QH 2O6EA 1A6TA 5FW6A 2YA0A 4P2QA 2JLLA 4WI5A 4YNYA 4IDJH 5E8OB 3CGTA 3D0LB 4XB8A 3SSGA 3QFDA 1WWCA 2DQFA 3LTVA 4KBPA 3BGFC 1E5CA 2V2XA 4ZW8A 3S5YA 1KTDA 1PKQE 4ZTEA 4X9FA 4KQ4H 5DQDH 4A7QA 2ITDA 2YAEA 5KAQG 4N6RA 1S7UA 4G9DB 4LSDA 4M5YH 4GIOA 2J44A 4WFEE 4BJLA 5FDWA 3ILPA 3MRNB 2YAQA 2PTVA 2DBLL 5HYJD 3SO3C 1NDMB 4CVUA 2HB0A 3KPNA 4HKZA 5LQBH 3WEOA 2KDGA 5IQ9B 2NYKA 4ORZC 4P23C 4P2RE 4WO4C 1BQLL 2QSCH 5K9QG 1AGFB 4HAGA 4BWWA 4NQSA 4G8GB 2NNXA 3RNKA 5DSCB 1LO2H 3PWLA 1KXVC 3TO4D 3X12B 1FCCA 1KELL 1PBYA 3QIUC 3SDCA 1BYNA 3B3BA 3IKKA 3OJVC 1Z9LA 2EH7H 3WJMB 5F7AA 3BRGC 5AVSB 4NEHB 1A1NB 2XWBB 3H9HB 2R0LL 3KNBB 2VDRB 4UV4L 2VXQA 2HLAB 4U1JB 5KSBE 5HP5A 3ARFB 4X6BB 3KLHC 2I26N 4GAYA 5LCVA 1BZ9A 5E70A 4EXPX 4LLWB 1N5AA 3FK3A 1IM9A 3ARED 1NWPA 3PAZA 2R2BA 4U6VL 4G8IA 1IAKB 2QGBA 1KELH 2X9XA 2Z7WA 3BYTA 1HL8A 5ACZA 2O93L 3SGJA 2WBJA 3K5SA 3T2QA 5SWSB 4HIPA 3MJ7A 3BQUA 5FCUL 2R83A 3S5LB 5JNYB 1E30A 4PWKA 4UV4H 5IBLC 3P4LA 3HC3H 3UC0L 4YBHA 5CEXB 4OD1L 1H15B 4OCYL 4ZT1A 4QIRA 1AHWC 4AKOA 2J43A 3P73B 3P9WB 4X4KA 1SEQL 3N55A 5CIPA 5FX3A 3GMRA 4Z7WF 2KZBA 2YD9A 3DMMC 1LK2A 4DP6X 5J4MA 1XH2A 3C2AH 1U3NA 1P4LB 3O9WB 2FWSA 3MCYA 3BZEA 3DA0A 1S7VA 4PY7A 4LCUA 1P4BL 5ESVB 5BJTA 4F9PC 2OR9L 4OI7A 3DOIA 2FLMA 4YSDA 3D69A 5FGRA 4AI7A 3CSYB 2EABA 3ARXA 4AQZA 2BOCB 1G7MB 3QS3A 4EN3D 1PCXA 2XV2A 3DX3A 1AD0A 1SXSA 4YHYC 1XD1A 4LBEB 1YEKL 4OD1H 4WY7L 4OCYH 4LCWA 4XB7A 4Z7OF 2Z31C 1HHKA 4HCRH 1FO0A 2SEBB 4J3SA 1ZK9A 2YZ8A 2GB2A 1NIAA 1R17A 4U1IB 2ZWZA 4G8FB 3WCYA 1E6OL 2QGCA 3DYPA 1X3DA 4L4TD 1NBYA 1CD0A 4JPWH 4I3GA 4XC3H 1N59A 3IKCA 3LV3A 2LAGB 3KLKA 4DO5A 4O2FA 3HG0A 1A9BA 1P4BH 5E8EB 1XF2B 1QSZA 4DQOH 3HG3A 2C3HA 4WJKB 2XKSA 5KS9B 4JL2A 2BNRA 4GRWF 2C1PA 3IDNB 2NY4D 1A1OA 3EJJX 1E8XA 2WZPD 2ZG3A 4UMGA 4O9HL 1YEKH 4N2MA 4WY7H 4MQSB 3PWPE 1JV5B 2C3WA 1NZRA 4X50A 4YE0A 2BSSB 3A6BL 3FOLB 5F6IC 3FUKA 1F3DJ 1E6OH 2DV6A 4V11A 5EZLA 3STZA 4HWBL 4NZUL 4DN4L 3DRTB 5I74C 1TDQA 1RZKH 1THCA 3CXDL 3MRPA 4UQAA 1MNUH 4IK7A 4ONFL 3PJNA 1OAXH 5JHDE 5I2IB 2XPGA 3DPBA 4V1DD 1G7PA 1YYML 3V6OA 4QOKD 3QQDB 3B6SB 1YQ2A 3CPUA 1MWAL 4APQA 2X6CA 2A4EA 5GRYA 1X5IA 4JHVA 1NC2D 2CJUH 1X5KA 1QASA 1QFPA 4QYOB 1F6AB 1KLFB 1RUKL 4FXKA 2AJXH 2W07B 3HG1A 4KHTL 3FF7A 4HWBH 3SYAA 4DN4H 1FZOB 2IDSA 3OZLA 3UG5A 1DVQA 4DP0X 2BC4B 5F7UA 4AK1A 4JJOA 3H9ZA 4X8XA 1QLEB 5J6SA 2E4TA 1YYMH 3MRIB 2C9XA 1G9NC 3ET9F 2GSIA 2JK5A 5EBLB 1N68A 2WWMD 4QRSA 4U6XA 2ITCA 5F71A 3HHRB 1G0XA 1WCBB 1Y0LA 3EJRA 4PJAF 3PAVA 4L3EA 4M1GH 4YDVA 5HPMB 4QRRE 4L37B 1F3JA 4KI5E 2H9GB 4PP2A 4HEPG 4ENED 1UB6A 3WU1A 2HRPH 5CBAB 1RUKH 1O5DT 3ZT7A 3CZEA 4KHTH 3X1FA 3GBML 1A0QL 4PV8A 1E5AA 4AWJC 4HGMA 5HDBE 4P3DA 3SGEH 4ZSOB 4XOEA 2P8LA 3BSGA 3N2JA 2W88A 3UTSA 2Q0ZX 1AP2A 3H54A 4A7UA 3GMLA 3ISWA 5D7HA 4JO4L 4N2OA 3PQYD 3VD9A 5CHNB 3WTVA 3V0VB 4IIQB 3OJDB 4NN7C 1T7YA 2OMVB 1RMFL 2WP3O 2B59B 3VFMB 2O30A 2W60A 1F86A 4UBDC 4XBPA 5IWLC 1QBBA 1MJUH 3FCSA 3GMPA 1KG0B 1KLUA 4R97C 4NO0A 1FUNA 2QV2A 3SO5A 1JYVA 1ZT4B 8FABA 1NGZB 3KXFA 3MXWL 1CF8L 2DDQL 3TO2A 1IKFL 4OZGF 5DMGD 1P2CB 1P9MA 4JO4H 3TC9A 4K3EL 4BRVA 3RDJA 2PCXA 4H8QA 5JDJA 3LRSA 4BFOA 2P80D 5BZXA 2OX5A 5IHWA 3JT0A 3VXPB 1B0WA 5DEGA 2WZ6A 4IU2B 3HE7B 3RLSA 1QNZH 3W11D 3CCHA 2EYRA 1D2PA 4N8UA 3IMSA 4PWIA 4RDQF 1KOAA 4PR5A 4YJZL 4Z7NB 5IGXL 4ODTL 4WFHE 3D07A 4LSQH 3LYRA 5GGRY 1M3JA 3FT3B 2LT9A 2Q6WB 1HNGA 1RUQL 1WBZA 3QI9B 1FFOB 4K3EH 4N8CL 5ALCL 2ODIA 2HKAA 2QKIA 2EDBA 5H35A 1MVFA 1PF3A 1LD9A 1WHOA 4I5BA 2W9EH 2WXRA 4WLCA 1ZVNA 3K80A 5D1XB 4IMLA 2AQNA 4D2NA 2GJ6E 1OAKL 4WK0B 1I3RB 2ZP9A 1SQMA 2OL3L 3OKNB 4MJIB 4AYFB 3Q1SL 4GKZA 5F1IA 5IGXH 1A8JH 1TG8A 4ODTH 3EG9A 1HKFA 4HBCL 4Q97A 4XI5C 5EU3B 2WMPA 2P49B 4MA8L 3KHQA 4B0MM 1KPRA 1YJDC 3HRZC 5BQ7A 3UACA 5DRZA 4L8BA 5GJSL 2BCMA 1RUQH 3SDAD 1N3NA 4JCWA 3NCJL 4UZUA 1E4HA 4OZIA 2BVQA 4N90E 3DHMA 3T77A 2MNJB 1QEWA 3ZO0A 2E46A 4HJJH 4WHYH 3QXAB 4DKEL 1OAKH 1W72L 4RAHA 4XPBL 5GS0D 2HX9A 3L16A 3QGVA 4PU2A 2VLLA 4AQ1A 4I87A 1M1XA 2ZX9A 4G42A 4HAFA 4ZG1A 3RY6A 5C6TL 1YUHA 2H6UA 5DFAA 1U91A 4UIMB 3G6DH 4FYQA 4MCMA 3SGKA 3ESPA 1UWGL 1L0YA 1ZHNB 5GJSH 3OAYK 2COQA 5F89B 4HHWA 3A67L 3HS0A 3GBEA 1OD7A 4NRYB 1FN4B 1QYGL 2YUXA 1WD8A 4AEHH 3M1BA 3QULB 1K72A 1I1YA 1MCWW 5FGBA 1MFUA 3FFDA 1ZOXA 1XSKA 1YY9C 4O4YL 4NAJA 4XCEB 4YZFF 3ARZA 1IAOA 4HOMA 1LMKA 3MA7A 4YO0A 4DZ8A 4GQRA 3HPJB 4DO4A 3LKRA 5D7LA 4AVJA 3ZGIA 1UVQA 1IBGL 4LCCB 3OD3A 4WI0B 5ISZA 3OKOA 1U8JA 4I0PA 4IRSC 4LVHC 5I9QB 3LVTA 5C6TH 1MW3A 5E2JA 4WCYL 4IJ3C 2WN3A 3W82A 3QORC 1FV1A 1JNNL 1L7IL 4I7ZC 2OJEB 5MP6H 3NJKA 3QDMA 4G72B 5CINL 2H3NB 1A9EA 4XNZB 4NNXA 1HH9A 1Z9MA 2YPLA 3CVHA 3S98A 4ODWB 3NZHL 2VQ1A 1ZVSB 1OTSC 4Q2ZB 1XF1A 2CBQA 4UTBL 2DD8H 3TEZA 1QO3B 1G9MH 3UJTH 2BRRL 2OA9A 3CHQA 3IDMB 5IESL 3TBCA 1S9YA 2WN2A 4JKLA 3DX2A 2Y69B 1HCFX 1CFNA 4WW1B 5CCJA 2ZCZA 5KVGL 4PJIA 3TT3L 1YEFL 2HFTA 5JOEA 2X2JA 2PCPA 2YSSA 3RPIA 5FYKE 1OP3H 1U2YA 3HPLA 2NY3D 3K4DA 5HYSA 1L7IH 4UINL 4F27A 4GFTB 1WAAF 5SX5H 4EI5C 1VPOL 2A2QT 3FQUB 5CS7A 1DN2A 5EN3A 4I13B 3UYOD 3CFBA 5AYTA 1O7DE 1T3FB 3KGTA 3C8KB 1YMHA 2N0KA 5DJYB 4D0DA 3U0WL 2KPWA 4YXKL 2BRRH 4H8PA 4E2OA 1V7MH 2C4XA 4G8GE 3QJSB 2MKWA 2JKRM 2P43B 3BPOC 1T1WA 2E59A 3RI5F 3CXHK 1XBDA 3ARUA 3GEWB 5IB5B 1KPVA 4BM7A 3FQ1A 3TT3H 3LKOB 1I7RA 3CFNA 2BY0A 2WAHA 3U4AA 4HKXA 1KGXA 2YWZA 1UT1A 3TIEB 4YDMA 3T0VA 3MRGA 1T7VA 1IZJA 2DLEA 1WA2X 1VPOH 3F2LA 2IGFL 1JL8A 4OFIA 2P44B 5K1JA 2NUTA 3TH3T 3ESNA 4FQXD 1T2QL 4GS7B 1A2YB 3UCQA 3WIIH 1A1MA 3TCTA 3IDYB 4LSTL 1YPZF 3BDXA 4TNWF 4WNQA 1E4WH 5IFHH 5DGRA 3PXHA 2PXYD 3FXIC 1BG1A 3K71A 2ZOWA 5C2BL 2KMWA 3RWEA 4P2OC 5SWSE 1ZV2A 3NTCL 4OR1A 2VDMB 1J86A 1QTYT 1WZAA 3HC4H 5FV2A 2G2RB 5F0PB 3EYUL 2FSEB 5D8JH 1ZDSA 2BP8A 2ZCHL 2NXZC 3KPPB 3OAZK 4WFFE 2FD6H 4JPQA 2JF1A 4MZRA 3DUUA 4C8XA 3D25A 1S4IA 3EZJB 2AJVL 3QUZC 4Z3GA 2ZJSL 4X6EB 4XOCA 4LPCA 4MA1B 5DJCA 5FHAH 2ZOTA 4LSTH 3A4AA 4QHMB 1E5BA 4UTCA 1J0HA 2V7HB 3HHSA 2XY2A 4Z7QB 4GRLB 2CLZB 4AH2A 3CE1A 1UA6L 4FXTA 4Z8FL 3BP5B 3RIFK 2OTPA 1IC7L 2VTFA 3KGUA 3NTCH 1BFOB 1PG7H 2G9KA 3RFZC 5E99H 3K4AA 5F9JB 2J1KA 2XBZA 5CLTA 1CBVH 2J73A 3F7KA 1M57B 3US1A 2EC9U 4B9YA 1URLA 3QXDA 4NUQA 3I6LD 4TNEA 1U93A 5E0FA 3GXIA 1OB0A 2P8MB 3SDCD 5GSRA 4RFNC 2ZJSH 4WTQA 4O2EB 4X6CA 2Z0UA 4QHLB 4F7PB 1BWMA 5DS8B 2F5AH 4V2BA 1Q4NX 3B7UX 1UA6H 4FLHA 3PL6C 2EQDA 1Q0EA 4J1UA 4F5CA 2VL5A 3D85A 1IC7H 2FECL 4PV9B 2Q7NA 5KS9E 5AZ2H 4LASH 3CC5B 1QA9B 3BJ91 2XNAB 2GC7C 2LU4A 2IDCA 4PJ9D 2O6CA 4HDIB 4LPWA 5AAWA 1BBDL 1XTLA 2Z64C 4UYQA 1QBML 3E80A 3HVNA 1H3GA 4KZDL 1U2HA 4L2YA 3UERA 3QRGL 5I15H 3UZEC 4I18A 3C5JB 3MV7B 3PWNA 4FQCL 3VDBA 2BDNL 3O3DB 2O4EA 4H8WL 4AX3A 3K3QA 2QADD 3V4VH 3ABLB 3T3PF 2Y5QA 3TH2T 1SFHA 2CO4A 1AQDB 2QMKA 3C6SA 1WCQA 1GPOH 1S9VA 2Z93A 3OTTA 1TJXA 3SYPA 5BS0A 3QRFM 3BAXA 3LKPA 3HZVB 4KITB 1BBDH 4TSBL 4URKA 3KYOA 3N44F 1JZ2A 2C9AA 2B0SL 4K7FB 2VMJA 4OJFL 1V7NH 5ETUA 3QRGH 4HS3A 3QUXA 3MX0A 5IIEA 4NP9A 1KGCE 3LY6A 1U8KB 4YDIL 4H8WH 4RESB 1MWAB 3QEUA 1M1SA 1P5VB 4CVZB 3PJSB 1MCCA 1L9QA 3F12B 5D7JB 1N6QL 3BP4B 4NNYB 2NNAA 1K8DB 3PHQA 1M7IA 1MQKL 2ENSA 1DJWA 1IE5A 4TXVB 2J5LB 2VLJA 2X4RA 3F7PC 2ARWA 2BSCA 4J6RH 2YA1A 3EOAA 4F33B 2PW1A 4TSBH 4XP5L 5DC0A 2BIPA 3U6RA 2XYBA 3MR9A 2V8MA 4A7SA 4LPVA 4JN2B 3P4MB 2YLKA 1FVEA 2BMKA 5ID0B 4JFQB 5KYWB 4PLNC 4ZSOE 4LLMA 2F18A 2MQ3A 1UQSA 5DYFA 1N6QH 4LF3A 2WXHA 1AO7D 1E9QA 4L5FE 4L8SC 3WO4B 1NFDF 4GKSA 1A4JA 1FC2D 4GLRH 3VWKC 1UGKA 4Y19A 1NBVL 3PNWB 3VE0A 1TQTA 3E2HC 2VQUA 2HX8A 5HHNA 3DROA 1LVEA 4J2XA 2GC4C 1P69B 4U1KA 4C83B 3HI5H 1U2CA 4OKVA 3WHE0 1G6RL 4KK8C 4PD4J 4WI4A 4CC1A 4PWHA 1AFVL 4BXSV 4IIZA 2VUKA 3ULAB 1J9TA 2AXWA 2PWDA 2Z9TA 4FL4B 4P2QB 4Q7DA 4YNYB 5HI3D 1F4WL 1GIGH 3H4FA 1ACCA 2IXQA 2DQFB 5FB8B 1ZGLA 2UUDH 2V2XB 4U7KA 1J05A 4LOUD 4PJHA 4XNAA 3ZN6A 5I1AA 2NRDA 1TZIA 1F42A 5E7FA 2K9FB 2QZ5A 3US0A 2KH2B 1S7UB 2Z3FA 2V9QA 3STLB 1NBVH 2XXMB 1DSYA 4G11A 5A2LH 4XMLL 5D71H 4MQTB 3PE9A 2YGVA 3QRBA 5EN2A 3BGMA 3IJEB 4JHWL 5DMIH 5FDWB 3MOAH 2OMUA 3ILPB 1I1CA 1IGYA 5GRVL 1D6EB 3N41F 3G08A 4Z7NE 5E2WL 2JQZA 4KUZL 2YKLL 1EAPA 4PJDA 1F4WH 4LVNC 3W2DH 4KXAA 2FLBT 1FRGH 5LGKA 1G7QA 2AK1H 3PWLB 4JCLA 4K71B 2E3VA 4AC2A 1Q72L 1JZ4A 2MTPA 5F7MC 3TEUA 4U3XA 1L0QA 1E4KC 1CXKA 4R8WL 1RXLA 5EF0A 5A2IH 2AABH 1QVOA 4N8VA 4L3ED 1CXLA 1VFOA 3S37L 3JWNH 4L8CB 5TQ0L 1IVLA 5D1XE 1MCDA 2JJSA 4JO3L 4FI6A 1LLAA 3FSAA 3RA7H 1LILA 2A6KB 2CU9A 1GTFA 1BZ9B 4MJIE 1LP9B 1THAA 5E2WH 2D2OA 1IM9B 1PQZB 1EXGA 1NINA 4UNTA 1D9KC 4GO8A 4NOBA 4UM8A 4URTB 1KZYA 4MA1C 4M29A 2UY7B 1GGYA 4Q74A 1HZKA 2APTA 4G8IB 3D2UD 4P04A 1BZDA 3CLEH 3KVPA 4TVSa 3ZDYB 1VCBC 4JY4A 5ACZB 4D0CB 3H1ZA 1MRDH 5I26A 4Z7VA 5IQMA 4U3SA 5SX4H 2WXMA 2WBJB 2PP7A 4KAQL 3S37H 4QT5A 3MJ7B 3VXSD 3BQUB 4CU6A 1BMWA 2DICA 2ADIA 1HHHA 2MIZA 3EDJA 1FFNA 4LPUA 3NOIA 4JO3H 4ZPVA 2NCEA 2XIBA 2YXFA 3FTVA 4DEPC 4TRPL 4MB5A 4BQ8A 3P3UA 1AH1A 3WHE1 2A38A 3FZUC 1VCAA 3W1ZA 1OLZA 1RP8A 3S3PA 3M1OA 2AQ2A 3UMNA 5D7KD 3GPSA 3BDYH 3R19A 3L7EA 2NSXA 3GUTA 3ZL1A 3IDJA 4DERA 4X8JA 3BZEB 1S7VB 2NZ9D 3GDCA 4PY7B 4FA8A 1FQ9C 1ZRUA 1NAML 9CGTA 4YSEA 4KAQH 1I1AC 1R3HA 2WXOA 3OPZL 3H53A 1B0RB 5D1QA 3DHPA 5KBLA 1S78D 4Y89A 5J3HD 1R4XA 1JXGA 1E2ZA 1BVLB 3C60C 3EBIA 4H26A 3V9CA 4K9EL 2ZSVB 1BM7A 4JREB 3UPAA 1HHKB 4JJHA 1FO0B 2DAVA 2H2SC 3VRLF 1DZ0A 3S35X 1E6JH 3T0AA 5I1HL 2WYTA 3EO1B 2CPCA 3DVGA 1N59B 2ZWNA 3IKCB 1K3ZA 4FQHA 1XMEB 5E4AA 1NAMH 2C7UA 1ROWA 1A6WL 3MNVA 3MGAA 1A4BA 3L5IA 1W8NA 1CQKA 1GMIA 3AB0C 2BNRB 3F7YA 2C1PB 1OGTB 1A1OB 4G1MB 3EXLA 1H6FA 4QKXB 2NNCA 1AR1D 4B9IA 4N2KA 4PJ5A 4U3HA 1OANA 2PW2A 3ASWA 2XPZA 3FOMA 3WY4A 3H6AA 1G0DA 1XCQA 3SD2A 5L8KB 3NIGF 4LARL 2ZWSA 4FULA 2BZCA 5E9NA 2ADYA 2WCGA 3DPBB 1I8IA 1A6WH 4KRLB 4XWOD 3CSGA 1G7PB 1UD3A 3VH8G 1XTMA 2B1AL 2PYFA 2V8LA 3QR2A 2CK2A 4APQB 4HH9B 1LXMA 3NUKA 4N2EA 3GKWH 1CLZL 1QR1A 3JTSB 1AGEA 4NQUA 1Z2KA 1SMOA 4PJFF 1F13A 4QRPA 2XFXA 1LE5B 2BIQA 3AXHA 3E9UA 1JZDC 3HG1B 4OFQA 5KZCB 3CH1B 3G5VA 3QDGA 3LHPL 1ZLSL 4LARH 1HXMA 3DDGA 4OBRA 3D30A 1K5WA 1I3GH 2ICES 1SXZA 1F90H 5JOPD 1DQLL 1KV3A 1JRHL 1HJBC 3RB7A 1FORH 2Z34A 3UGUA 1E7UA 2VABA 1CPUA 3TBYB 5JHAA 3L5XH 3FTXA 4ZO7A 1RFDL 2GW5A 2ITCB 3LS5H 3P9MB 4XPFL 3WD5H 4DCQA 1Y0LB 4KX7A 5D7LD 4YDVB 5ISZD 1CLZH 1MQ8A 3O6LL 5IQOA 4YC2C 2EXWC 5DVOA 1E2VA 3N1MC 1UB6B 1E3ZA 1I85C 1XGTA 5I1IL 4U1NA 2G0LA 4XX5A 3LHPH 4P3DB 3GGWA 1ZLSH 5K9OA 2OM5A 2P8LB 2YPLD 1VFBB 9PCYA 3VD1A 3UTSB 1AP2B 3AU1A 1JRHH 2XG4A 1ED3B 1PFOA 1V05A 2LVEA 4MNQD 4QI3A 5KEZA 2FX8H 1A3LL 1SVZA 4PIRF 3CFDB 3WL9B 5A6LA 4XPFH 5CEZD 3LXCA 1P5UC 3MA9H 2YJQA 2B20A 3O6LH 4P2AA 5EU7E 2W60B 4XBPB 5FFOA 2DL2A 3DKHA 2J56A 3CXFA 1NOLA 3FCSB 3GMPB 4ZO8A 4PRHE 5CZKA 4Z7QE 4NQVB 2OW7A 4Q9QL 4NFDA 2XWRA 2E6QA 1ZIBA 4TPRL 4NO0B 8FABB 3MLYL 3CFTA 3KXFB 5DD3H 4MAYA 2WNKA 4O58L 2AP2A 3RL2B 3NH7L 4UT6L 3UJJL 1NUNB 1PNCA 2PWGA 4OCWL 4F7TA 2G2PA 3LRSB 3S3JA 4AYSA 4ELMF 1M42A 2WGNB 4U05A 1A3LH 2AQPA 2OX5B 4FKKA 2RGSA 3L3DB 1BZ8A 3I6GA 4OB5L 1NANI 1OSZA 1KFAL 1TZ8A 1FPTH 2CD0A 4IOSD 3MNWB 3VAEA 1O9WA 4PB0L 3FRPG 4J3OD 2UY6A 3JV6B 1SN5A 4HPOL 4Q9QH 3GMNB 4HJGB 2AJYL 5BV7B 4CN1A 3ZJAA 3QNXA 4QTHA 3WEXA 3AUVA 2OSLA 3IJ9A 2V7NA 4K8RL 1WBZB 1OB1A 2NY1B 4UT6H 3UJJH 1EANA 2B3RA 2NYYC 4OCWH 2QKIB 1PLGH 1AANA 4QO1A 4XAKD 2H26A 1LD9B 4I5BB 1KNOA 3OG6B 4OB5H 4NQEB 5CJOL 2OXGB 4KH9A 3MV7E 4NT6B 4X7FC 3SDDD 5D7SH 2VYRE 3CN0A 1VERA 1W0WA 1BD2B 5DZPA 3BH9A 5C3TA 3EG9B 2ZUWA 2FE0A 3LKQA 1OEZW 4FG0A 4WU5A 2AJYH 1X6LA 2WMPB 3APNA 5FCSH 3DOHA 4UCFA 4C56D 3DRQA 4WGVB 4B3EA 5DVNA 4K8RH 1E4XI 1KCUL 3EOBA 5I16B 1N3NB 2N3JA 4FYRA 3FHQA 4JHZA 5DJ8A 3T77B 4WW2A 4DIXA 3SPVA 5CJOH 4H0IA 1QEWB 4NKDA 4HK3J 2CG9X 4AGLA 3T0EA 1EZVY 3H42H 5I73B 4MJHA 2JJWA 5JTWA 4PCKA 1SZNA 5LO7A 2VLLB 1IGTA 1MJJB 4ZMLA 1KY6A 1M1XB 4G42B 2F8IA 2DWDA 2YRBA 4OLUL 4W9DC 5F9OH 1YUHB 2UYLA 2EUVA 3ZKQD 1JVLA 1ZS8A 5IQLA 4FTVA 2AQQA 2E8ZA 4GW4B 4MMZA 4KGLA 2YHGA 3HS0B 3FPYA 2DWSA 3ATEA 3FJTA 3CQPA 2WVUA 2P8PA 1N6UA 3ESUF 3JQOB 3WY2A 2AV7A 2H5UA 3B5HA 4L48A 4LEOA 2OFQA 4NKIH 4S1SH 4ZTOL 4FE9A 3D85D 4XO8A 3CZSA 1IAOB 1OTUD 4PJGA 3T2LA 3WUWB 2CO6B 4O02L 4YO0B 4DZ8B 1YG9A 4WV1A 2A9ML 2YN3A 1CG9A 1EEYB 3PP4L 3LKRB 1U95A 4FLQA 1UVQB 2XWZA 2YD8A 3FB6A 3N91A 4I0PB 1U8JB 5TH2B 4OF8A 3OKKA 4HU2A 1AKJA 5HHPA 1KPUA 1QLEH 4JR9H 5IB1B 1FV1B 2ZKWA 1PZCA 2CM5A 3NK3A 3QDMB 5HYEA 2J55A 1A9EB 2WKGA 4YSPA 4NNXB 1HH9B 3CVHB 3U7WL 2VQ1B 3QNFA 3T5WA 1ZPUA 3Q5OA 2NQ3A 2WUCL 2OLDA 2VRKA 2L7JA 5FW8A 4BZ1L 4P2QE 2CRIA 2PTTA 4HAKA 4J8RB 1U8NA 3MLSH 4JM2F 5IBTL 4O02H 1GYCA 3DGGA 1S9YB 3MDJA 4GSQA 4N0CD 5DFVC 1CFNB 1G6RB 1BQKA 1TCMA 3DHUA 2DKMA 1CYWA 3L3OA 3PP4H 4PJIB 3REVB 3IBOA 5K93A 2PCPB 4Y2DC 3CDZA 4L5FH 4A6YA 3JBG7 4JL1A 2ORBL 2XTLA 3C12A 4HS8L 3QUXD 3HPLB 3L3IA 5I1LA 3UAJC 1OE2A 5D72L 1BVOA 4PVNA 1M2VB 3U4EB 4HP5A 4KJPD 3HJEA 1RZFL 3U7WH 3CFBB 3SOTA 2J21A 3WMQA 1YMHB 2Q86A 3CQQA 3VWJC 4BZ1H 4LRNH 4D0DB 4NBXB 3QEHA 4JFED 2HA1A 5A2CA 5GGTH 5I1GL 5E5UB 5HHOB 5D1ZC 5IBTH 3ZQWA 1T1WB 1F45A 5LN4A 2B7DT 5DURD 1E3FA 3ROLA 1KPVB 5J9PA 4OZFB 1DZBA 2DW5A 1I7RB 4JFUA 5KOMC 3INOA 4HKXB 5JPMA 4BIKA 3C6EA 2ORBH 2JKWA 3MRGB 3ROOB 4XX1G 4GUOA 4HS8H 1KB5A 3VVVA 4OI8A 3CPLB 3VGDA 3ECBB 5EU5A 3RWFA 1LP9E 1JGVL 3EF7A 2VDNL 1KCVH 4XVTL 1ZHKA 4HEMA 4UILL 1A1MB 5GZNA 2CR3A 4Y2NA 5I1GH 2NY2C 1E0OB 1KXQA 1E8ZA 4PJXF 4BA8A 3LN5A 4R90L 2ITEA 1L0PA 3ZDYE 5T33L 2FAUA 3BUIA 4WWOA 1MUJB 1NL0L 3BWUF 3VXTA 3SDXA 4YH6A 3RWEB 4AIZB 1I7TA 4NHCL 3DJSA 1DVTA 2VITA 3TU6A 4AVHA 5LKNA 5E2TL 3UROR 2BP0A 1QKZH 2GBUA 2EDJA 4XP4L 2AK4B 3TZVC 3ZZ1A 2BP8B 2JCCA 3HN5A 1IGIH 3QXVA 3VDAA 3RX7A 3ARGD 4NPYA 3DUUB 1O9VA 2CMRH 1PG7W 4M6AA 4JFHE 1EEZA 2DQCL 2VDNH 3D25B 3RUGF 4NAQA 4XVTH 4UILH 5DJCB 1KB3A 2IH8A 4JO2L 2FTAA 5D6DC 5K9QI 3MLXH 3TESA 4PM1A 4R90H 1I3VA 4XMPH 2ERJB 1AS8A 4L1DA 2AAVA 4AH2B 1DQVA 2NW2A 4GG8B 2DOCA 1KTJA 2HZHA 4HEPA 5E2TH 2JE8A 1B4LA 4XPHL 5BW7C 4OIBA 2ZD0A 3UZVA 4A63A 4AYEC 2D3NA 3BPNB 3EH1A 1RZ7H 2QPFA 5DJ2A 5DUPL 3QXDB 2J25A 3FUMA 2DYSB 3X13A 1YNLL 4WVRA 1U93B 1CGSL 3EJZC 3V6ZA 5FK9A 5DHVB 2DQCH 3JZ7A 4PCYA 5GSRB 5GS1B 1SYSA 3HLKA 5ILTH 2Q2LA 1N7ML 2DIJA 2HLFC 3Q01A 5F6HJ 5I1JH 1D6VH 1KBBA 3S88L 2UZYA 1WFUA 2OXHB 5IEKA 3V4PL 4ZZKA 3ZUCA 2GEEA 3IE4A 5IEHA 4PB9L 4IRJA 4J1UB 2VL5B 2YD2A 2VW7A 5C09B 1AQHA 3EGDA 3FU0A 2BNRE 4XPHH 1JK9A 2K6ZA 2YAPA 4H8WC 4XC1L 3RDTC 3HFFA 1K6QL 2C3VA 1OP5K 2JKXA 1YNLH 3SGDI 1S7XB 4X0NA 2CR0A 4L23A 2IPUK 2Z65C 1UM4L 5GGSY 1Y1UA 4I18B 1MI5D 1N7MH 1TVDA 3IFNL 4JFOA 4BUHA 3LVEA 1H8LA 4WHDA 1Q38A 2A73B 3J07A 3SKOB 2ARJQ 4WHTA 1GVIA 4JQIL 1RZ8A 1ORQA 5AW8B 4ABQA 4KKBD 3NT0A 5DQJA 2W94A 3C6SB 4TUUA 1UADC 3C9NA 4Z95L 2Z93B 3NPSB 4MA3A 1JNLH 5BS0B 5KVGE 4CADA 1LNUA 4FHJA 1INDL 3LKPB 2Q76A 7PAZA 3KM1A 2PYEA 5DHYB 5A16A 1HEJC 4WEEA