3K6FA

Crystal structure of mouse t-cadherin ec1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
SGIVVSPILIPENQRQPFPRDVGKVVDSDRPEGSKFRLTGKGVDQDPKGTFRINENTGSVSVTRTLDRETIATYQLYVETTDASGKTLEGPVPLEVIVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cadherin
publication title T-cadherin structures reveal a novel adhesive binding mechanism
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 19
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3k6fA00
3Q2NA 2A4EA 2YSTA 4ZMVA 3K6DA 4ZTEA 1EDHA 3LNEA 3LNFA 1NCJA 4ZMTA 1L3WA 3PPEA 4XXWC 1FF5A 2OMUB 4QD2E 4XXWA 4AXWB 3LNHA 4AK1A 2WD0A 4AQ8C 3MVSA 2V37A 4AXWA 1Q1PA 3FF8A 2WHVA 2WBXA 4OY9A 5JYLA 2OMWB 3LNGA 5KJ4A 2YQGA 4ZI8A 3LNDA 1ZVNA 4ZMPA 4ZMNA 4ZMLA 4APXB 3K6FA 4ZMZA 5JYMA 1OP4A 3K5RA 1NCIA 2O72A 4AQ8A 5CO1A 4ZT1A 3UBGA 4APXA 3UBFA 2QVFB 3Q2VA 5CZRA 4ZMXA 1WYJA 2OMZB 2A4CA 1O6SB 3K5SA 4NUPA 3UBHA 4ZMYA 4ZMQA 4NUQA 2OMVB 1SUHA 2EE0A 2X2UA 3Q2WA 4NQQA 4NUMA 1ZXKA 2WCPA 2OMXB 4AQAB 3Q2LA 3K6IA 4AQEB 4ZMOA 1WUZA 3FF7A 3QRBA 2QVIA 1NCHA 1NCGA 2OMTB 4ZMWA 5DZVA 4AQAA 3LNIA 4AQEA 2OMYB
chains in the Genus database with same CATH superfamily
1ZA3A 5K1JA 4ZPTA 3LXAA 3HPJA 3MOAH 4JCMA 5FYLL 3D34A 3HZYA 3SO3B 1Y1UA 5HYIA 2CUHA 1ZS2A 1KIRA 3STLB 1VAHA 3MRDA 1SJHB 5G4OA 4NNYA 1GYAA 5IZ7A 1ZEAL 2JWYA 1ORSB 1QRNB 2PYEB 5DK0B 3GJEB 2XVGA 2JCCF 3WO4C 4UM8B 5GJSL 2X1PA 4IU3B 3STBA 3I02B 5ANME 5EUOB 1Z0MA 3JWNE 4QEGA 4PJHE 1IAIL 4PJGF 2WVVA 3DLQR 4LNRB 3T0ED 1FH5L 1TU2A 3G6JB 1MKFA 5FYKU 2VLJA 3FS9A 2AJ3B 5F7HA 2ARWA 3IDYB 3V4VB 5DVOA 3BRGC 4GXVL 1IEHA 3MGTA 2LR4A 2HWZL 1XAKA 4S1DC 4UQ2B 1R3KB 1H3PH 3SJVD 3GUTA 3LTVA 3R18A 2PCFB 1CK0H 3GBML 1SLUA 3TBVA 1DBJL 2ZCHL 2NT1A 4GNKB 4DZ8A 4JRYE 5DVKA 4TVSa 2ADJB 4MLIA 2C9UA 1SN0A 2X1XR 4N0CC 4D2NA 4YBLC 1S7WA 4CVXB 1IGCL 4NAMA 2K4WA 2CDGA 2FO4B 3QUYB 1IAKA 4NFCA 3ZYJA 4PQXA 4QOKB 4XI5D 3LX9A 4MWFB 3BVDB 4DKFL 5E4EC 4LEXH 2OYPA 5LQBL 1EBAA 4PVNA 4Q14A 4FFZH 3TPUA 1VFAA 3LRSA 4OZIE 2W07A 1S8DB 4H8HA 1S7TA 2PO6B 1TLKA 2CRYA 4NM4H 4YFEA 2WQAA 1FE8H 1RHHA 1EHKB 5B39A 3F7RA 2WZ6A 3G5ZA 2ZUTA 2H2SD 1N5YL 1S78D 4PHXA 5EEVA 2BERA 3MRKB 4EO5A 3F7VB 4OFQA 2FR4A 3DSFH 3MJ9H 5I73C 2DYSB 1N6VA 2VLLB 4JRLA 4UILH 3HNTH 3P9MB 3TO4D 3SE9H 2GAZB 1NFDF 2FHFA 4NUMA 3O6FB 4QRAA 1T66D 5TDOA 3VQMA 2HFFA 2YAQA 3FQXB 1GYWA 1V27A 3HE6C 4PCYA 3RVWD 2OSLB 4QNPF 3D18B 1B0WA 1NCNA 4IRZH 3BI9X 3HCVB 3FAWA 4K5LA 4NO3A 5EO1B 3DROB 2VXQA 4Y5VA 3VXRB 2BNRA 2C7UB 2GJ6E 3X13A 4BA0A 1UATA 1UHVA 5FA4A 1AQHA 5A2BA 4R7NA 1P5VA 2NT0A 4B3VA 4C4UA 5CD3B 3KH4A 4F20A 3H3PH 3EYUH 4G80A 4LSSL 1MDAA 2J6EL 2VDPB 2D4DA 8PAZA 4IDLA 3WTUA 3JWOC 3KBFA 2V5TA 4WRLA 3QNYB 2B1HL 3I84A 2DQTL 4PP2A 5JHDD 4N0UE 4I0PB 3QZLA 5C09B 2YSSB 2WBJD 4HIPA 2WQUA 4FABL 1OAKL 3K2UL 4LAQL 3D05A 4JKLA 3V4UL 2MWCA 3JWOH 4Y9EA 1NWPA 15C8L 1FFOA 3IVKA 2BVOB 3RE0A 1VF5C 3P3YA 1J0JA 1KIPB 1MNUL 4G9DA 1JHTA 4K7PY 4JR9H 4OAWB 5AVXB 1URLA 3KCWA 3AS2A 1XX9C 2AK4B 5IB2B 5BZWB 3ZL1A 2V33A 5K59F 1U58A 2YMOA 1OOWA 1PW3A 1X5IA 5C0BA 2P8PB 3FQWA 2DPKA 5C0GB 5ID1A 3AITA 4FQLL 1HIML 3BH4A 1Q9WB 4NJ9L 4E41D 4G5ZH 1BD2D 3VWKD 4ZSOA 1K3ZA 3MLWH 5KYYB 3U4BH 1F5WA 1S9VB 1IC4L 2WK2A 3MSPA 1IZJA 3QZPA 4MTMA 3S6CA 3ZTCC 1KFAH 2AANA 4Y4FA 3NA9H 2J56A 3C60C 2XIDA 5K5YA 3KHQA 4ZODA 1XMEB 2ATKA 2XWRA 1SDDB 1P6AB 1X6NA 4N68A 2VXTL 2ZZUT 4JFPA 1M05B 2DJ4A 1DZ0A 3D0VA 4YOKA 2WMPA 1KEMH 4A39A 1DE4A 3QPXL 3UYRH 3I6GB 4D3CL 4JQVC 4LLYA 1LWJA 5D1XB 3NCFB 2X6BA 1I9RH 4H26A 2WM0A 4CVWA 4ZMXA 2DIBA 1NCWL 3FT2A 3QR2A 4UM9B 2J5WA 4Y1AB 4XMLL 1FHGA 2E8YA 4TXVB 2X87A 3B9AA 1O6SB 1U8NA 4O02H 3BKCL 1FNFA 3JV6A 1PAMA 4MAUL 3RB7A 1VENA 5TD4A 1AZUA 3KPRB 1Y18A 2GPZA 2UWEA 3GPSA 2IC2A 2I25N 5IROC 5E1GA 3RNQB 1Y6NR 3BUYA 5D7IB 4WUKH 4UDTB 1DVFA 5B1BB 3ESOA 5E6IB 2OCFD 1FFQA 1FFNB 2EEFA 3ATAA 1KGYE 4Q6KA 4OFKA 1KUMA 2R8SH 4HKJA 1WUZA 3RB5A 3RY4A 2GFBB 4LSQL 5HYFA 2CO4A 3ISYA 4D9RD 2GJZA 2HRLA 4NC0B 2VXUH 1LD9B 1CLCA 2XJKA 2Y7OA 1A8ZA 4K07A 1JGUL 4X7DC 2ZXCA 1Q4NX 3I9IA 3CGTA 3PJSA 3HS0C 1I8IB 2B9BA 1NKOA 5L9DH 3FUNA 2Q2EB 1U8LA 1MHCB 1QRNE 1L9QA 1WE5A 3PV7A 1NIEA 4UTAL 2FJFA 2PYEE 1HOCB 1JGVH 1JZ8A 4P5TD 1U8CB 5GRZA 5KSAA 5EUOE 2WQ8A 4P04A 4GI6A 2F74B 4J6IA 4I7ZC 5EIIA 3GMOB 2Y2TA 4WU7A 3G6JE 3WD5L 2DYRB 3SE4A 3OAWA 2CDEA 1NCBH 2E59A 4CN4A 3IDGA 4XNMB 1ZGLA 1E4XL 2WWMD 1C5DA 1S9XB 1LMIA 3ZGHA 3IAQA 1HHIA 3LVTA 1J0KA 2M1KA 5FGBC 2WD0A 5LCVA 2XI9A 2IH1B 4V2BA 2NZ9D 4EOWH 3PGDA 3EXLA 3Q6GL 4LOFA 4MCZB 2HT3C 1DO5A 2EXSA 4LO9A 1I53A 5EU3B 1N8ZB 2G3NA 2ARJQ 3V5KA 4OLZH 4EQ3A 1NH6A 1F41A 1KZYA 3VI3B 2ADIA 5JQIB 4ILDA 2P24A 2PR4H 1VDGA 5CP7A 2JNZA 1GC1C 2YPLA 1N59B 4EPSA 1KTKE 1A1NB 5FA3A 3PGCA 3UZQA 4ZI8A 4L0YA 1AS8A 3WU1A 3L48A 3SGKC 2CAKA 1AC6A 1S3KH 5GRUH 5IQOA 4ZX5A 2DWEB 3SKNA 2AJVL 4QRRD 5KSBF 4OCXL 2WGXA 3LPOA 3GUFA 4Z0BL 4QOKE 3X14A 2DB8A 1TQBC 4L8CA 2Z7YA 1BQLH 2N59A 3L3OC 4OF8A 1J48A 3KPSB 4TS6A 4XP6L 2F15A 3BDYH 4M62L 5D7SH 5HJBA 4B6ZA 1I31A 3RWEB 4HWEH 4AQ8A 2Z35B 3IKKA 1M1XA 1Z66A 2VWEC 5HGDA 2AEQL 5EPMA 4HISA 2XOTA 5AKSA 3WV0A 5IHLB 1JV5B 1KCRH 1RK7A 4HPYL 4JVWA 4L8SC 3WUWG 1FA4A 1I75A 3BAYA 4RQQB 4AI7A 1NCOA 3ECBB 3K4DA 2AJYL 4RMSA 4E42A 1ID5I 4IDJL 1U92B 3QDGB 2XWZA 4TVPE 3ASNB 3O6LL 1QG3A 4YAQA 5KVGH 4GOSA 2JJTC 3GIVA 1RPUA 5IB1B 3CMOH 1YPZF 3LMJH 4F7PB 2UZXB 3KDMB 4NKDA 4UIMB 2MQGA 4BK4A 2D0HA 3T1FB 1GGYA 3DBSA 4ATTA 3L8QA 2CM5A 1OTTC 1MVUA 2VZ3A 4XAWL 1U41A 1OCWH 2V7HB 3DX1A 1S7QB 1BREA 3ARPA 2PCYA 3GB7B 3MA9H 3UJTL 4YHZL 5JO5A 3VXRE 5TQ2L 1EMTH 1I8LC 2ARJB 3MOBL 4KQ3H 5BVPL 2JI2A 4A6YA 1FDLL 3FB6B 4WK0B 3QEQD 3NCYS 1MH5A 4WWNA 4HT1L 3QQ4A 2P49B 4I87A 3GPEA 1NFIA 5D6CA 1R5IB 5DD1H 4H8WC 3OMIB 5I19H 3QIWC 1YEEL 2VLME 4NBYB 2AJXL 3IDIA 2VL5B 2FGZA 5HY9A 4S10A 5C09E 3TJPA 4N86A 1DDHB 4U3CA 5C92A 3S4SG 2VDLH 2Y6SD 3O8XB 4H8WH 4QUOA 4WTQA 1LTXA 4G9FA 4KTEL 4XXWC 2NR6A 3N41B 5TFSL 1MI5A 3JQOB 1SXNA 3BPLB 3LCYA 3QCVH 2WXJA 5JZ7C 4BH8A 1OK0A 3P0YH 1KTBA 2XTJC 1OW0A 2AK4E 4XVUD 1XCWA 1IIIA 1UC6A 3H3BC 2ZE0A 4UB0H 4ES9A 3PRZA 3V9CA 1UCTA 5IB5A 5DRZA 4JFQB 4GUPA 3BD3A 4ODWA 3BKJH 3P3UA 4ZYKA 1JPTL 3F58L 1P4UA 1MCIA 1PIGA 1P7HL 3ZU8A 3KGSA 5GZOA 2P80A 5D1QA 4KKBD 3HC4H 3RTQC 4ODSL 3QZBA 4UNUA 5J7CC 2HVBA 3D2UD 4KPHH 2O6CA 1ZV9A 3BUPA 2VJ8A 1MJUL 2E76C 1WWAX 4MQXD 2H45A 4N8PA 4PJEF 5LDSA 3AT0A 5EF3A 1E2ZA 4ZOEA 4RRPM 3MBEC 3QIBA 4YR6A 3BZ4B 5FOBB 4X8CA 5H8DA 2DMCA 4E9RA 3QSKB 4EDWL 2APBA 4KI5C 5FIEA 2AKRA 3HLKA 5EUKB 1AC0A 4JREB 5D1XE 5I15L 5HXMA 1A9VA 4ZMZA 4EIUA 3SDXF 1NCIA 4NQDA 1CLZH 4Y1AE 4O58L 4PJAF 2A6IA 2UYLA 4W9EC 5F9AC 3VGBA 1IBFA 4XOEA 1R0AH 1XHHA 1DJWA 2KLTA 4Y19A 1MW0A 3VYOA 3S88L 3KL0A 4ZFZB 3U79A 2QKIC 4MASA 3KPRE 2W9EH 1N0XL 2ED7A 2J88L 5MERA 2YEZA 1JNHB 2ICEC 3NFNB 5D7IE 5E00A 1A6PA 3SD5A 3BO8B 5JW4M 1NAMA 1QLFB 4E9QA 2VLKB 3RWGA 3QCUL 2AXHA 2NY0C 1AQ8A 3QCTL 2HT4D 3QUKB 1QFWH 3J07A 5DZAA 1XTMA 2YLHA 2VUYA 2Z91B 4HUKB 3RURA 3JV4B 3TA3C 5JOFB 5DHMC 5B1AB 4Y16B 3PG2A 1F58H 1GW6A 3CZJA 1CD9B 4EI6B 2B15A 4RMQA 4J8RA 1UFGA 5LGJB 3F04A 1QNZH 5IHUL 1QSED 3IJSA 4LHUD 3RU8L 3LQAL 2HRPH 1J0IA 1RIVL 3EJSA 1RK0A 1RL1A 2UX7A 2D7TL 3FTXA 3SQOL 1FGVL 2QZQA 4ZS6C 3H9SB 3RFZA 4F7CB 3OGCA 2A1WH 3ARBC 3LNEA 1C16A 3RVXC 4ICWA 3ENEA 1WICA 4JN1L 4KO9A 3EJYD 5C0CA 3TV8A 3LRGA 3MR9B 3QRGH 3GSOA 2WOYA 1CXEA 2NYYC 2VW4A 1TMQA 2IADA 2DKSA 2J44A 5C07A 4YHIA 3CMGA 3WXWL 3O3UN 3DBXA 1I9IL 3BUBA 4U33A 5HJ3B 1LO4H 4PGJA 4J3WA 1G7HB 1SHWA 2GITB 1XSOA 5DQ9B 3VI3E 4L4VD 4YHML 2K9UA 3BQUA 2I9TB 3WFDH 4MNGB 2A83A 2C1PA 1UOKA 3D85D 4GBXC 1UT1A 2WWKT 4KVCL 4LDOB 3CXDH 1MQ8A 1BBJA 3FFCB 4MMXA 4M48H 2Q20A 4KQ4H 5HDQL 5F1SA 3HUJB 3VJ6A 2O5NA 3VXSA 2GCYA 3DTXA 1HHHA 3MLUL 3MNMA 4HUXB 4BK8A 1A4KA 2RIKA 1SJVA 3MV7D 3KXFD 1HU8A 1NC4B 2MOVA 3DGGB 4ZMPA 1P4BL 4U1KB 1AGDB 1JK8A 3KPSE 1QWNA 4RETB 1MIML 3HN5A 5CS7A 5DT1H 4DAGH 1A66A 4ZUUA 4U3SA 4XWOD 1A65A 1TF4A 3QXTA 1UWEL 1DFBH 4F1ZA 3MXWH 3CN2A 3M8OL 5F70A 4QRSA 1EPFA 3L4TA 4CAGA 2WYTA 3HG0A 4X5XA 3B8YA 2J25A 4OF0A 3SPHA 3QDGE 1LE9A 1PYWB 3OXSB 4G83A 2Q76A 4POYA 4Z1PA 3ZR5A 5GIRB 5A2LH 1RSYA 2CLVB 2XWCA 3GIZH 4JM2C 1G7MA 3G7TA 3GSNB 4ADIA 2YPVA 2WXRA 3BT2L 3MLXH 4PGDA 3O45B 5CWSB 4CU6A 1QKZH 3BX7C 1HILB 3P2DA 2X05A 5H4ZA 5F6IC 2EYRA 4HV8A 1OAUH 4A67A 1B2WH 1NC2D 5DQJB 3K8LA 3UJIL 1PY4A 1REIA 3KPOA 3KW7A 4UAOB 4H8UA 1X3DA 5JOPD 4XC3H 5L0QC 4Q9BA 1BQHB 5MI0C 3H0TB 2ZNWA 3O4OB 2X41A 1XZ0A 4OFPA 2E75C 1OE2A 4QRPD 1GL4B 1NLBL 2JI1A 1T7WA 4G2AA 1PBYA 5I1JL 3IXAB 4PCSA 1GGBL 4F7EA 2BOBB 1IC5H 2DMHA 3HC3H 2H8PB 2Y5QA 1X44A 3TN0C 4B9IA 3EH4B 3KD4A 4J3OD 1JNNH 4CDHA 2IMNA 5ISZA 3ZKQD 1EEYB 4LL4A 3GXPA 5LG6A 2F19H 5I1IH 4L9LC 1DBKL 2BSSB 5IESH 4HIIB 2ENPA 3CN0A 5J1AB 3ZDZF 1KXHA 4M43H 4X7CC 3P73B 4CN6A 3GMPA 4KROD 3EYOB 1NPUA 2BFVH 4XMZA 5C0ND 1WZ1H 5TE4H 1IL1B 1PZ2A 3DX0A 2VW7A 4KK8D 1G7PB 4P2RA 2Y0SA 1NIAA 1DVYA 2A6DB 2ZQKA 4IHBA 4HVBA 5KYWB 3S36X 5FHAL 5L4MA 1A2YA 5J13C 4P2QA 1A21A 2ZYIA 3IDJA 3QNXB 3C6LC 5F1IA 3SHSA 4EVNA 3OKEA 3FO0L 1CFMA 2FSEB 1CXHA 4AEEA 1FL6B 4FRWA 1KBVA 4LDCA 4CILA 4NZDA 3A4FA 1ZV5A 3AQXA 3EJTA 4LEBA 5D1ZC 1U8MB 1NIBA 5EDSA 4HIXL 5HI3D 3QJVB 1Q8MA 5SWSD 2IDUA 2Q8AH 4Z3TA 3TZVB 1EJOH 5ENWB 3ILPB 3VFNB 1PU0A 3MTRA 4L8DA 2F53A 2WQRA 2IFGA 1QASA 2B1HH 3ZTNH 3DDFA 1AO7A 2X0VA 3G5WA 3Q0HA 4FFZA 3V55A 2YAHA 1HQ4A 1U91A 4KRPD 4Y2DB 1IKNC 5F93C 4FULA 4KUZH 5LGHL 2QR0B 2P42B 4NC1C 3BXNA 5CLXA 1N18A 2OTWB 1TVBB 2ILLA 4TUJA 1I7ZB 3L3DA 4IBVA 3FT0A 5AYQA 1PLGH 1U3HC 1QAWA 3OKLA 4IJ3B 5C6WH 4R7XA 3MJ9A 2AW2A 2PTTB 2VLKE 1TQTA 4U1NA 3UAEA 3BSHA 4HLJA 4EN3B 3VD4A 1KENH 3MRIA 2F8OA 3UTTB 3V4VL 1JG9A 4G8FB 1YMMA 4IRZA 4AY0A 1CTOA 3LN4A 1TCRA 2ZOKB 4NZRL 4FG0A 1CYWA 3MUY1 3QIUB 4XNZC 5HVWA 2PN5A 1KC5H 1ZWIA 5CEXA 3HE6A 4DFIA 5E9DD 4Q2ZA 5I8KH 1LWHA 3H9SE 2Z8VC 3N6YA 1E8XA 3D25B 4CJ0A 5I82A 1D6EA 1HK6A 3IF1B 4XH2A 3QDJD 1EZVX 3PJNA 4OH2A 4RFOL 4MFHA 2EUVA 1KGXA 4MAZA 5CJOH 2ZX7A 2GYSA 2OX5B 3ILDA 1B4LA 4HOZA 2XWDA 3ARRA 1HSAA 3ECUA 1OSPL 2FNBA 3F5WB 4JDZA 4AYMC 1M1SA 3HZ3A 2OL3H 4PHZA 2JKIS 4XOAA 3TT3L 2HFGL 3AB0B 1BG9A 4I5BA 1JRHH 3C12A 4HBCH 3QH3B 3ULSB 4HXBH 3B7RL 2ENSA 2HKFH 1JAEA 3B2VH 4N24A 4RRPG 5MEQA 2Y9RT 4HK0B 1S2EA 4MNGE 5SX4I 4F9LC 5IJVA 3TF7C 2P8MB 5L4IA 2XWTB 4QHUB 3SD2A 4FNLL 3JZYA 3FFCE 3MUHL 4TVPL 3G9AB 4AE1A 4KNSA 3HUJE 5L8KB 3AXLA 4BHUA 5CXPA 5DEJA 4N2KA 3UIYA 1GIGH 4IGBD 2OTUA 3BYTA 3CJJA 3R0MA 4HS6B 4F57L 1U8KB 2GG1A 3TOPA 3RIKA 2VDQB 4LPWA 4BZ2L 5DMGD 1A47A 2PCXA 2QQKL 2BW5A 4Y4HB 2MFNA 1F45A 5F9WB 2M8XA 3U46B 1F97A 5IKCA 3BP6B 3C60A 3QWRA 4RBPH 1PL3A 3UERA 1JPGA 1NGYB 4XPGH 4YDMA 4HWZB 2VDPL 3TBYB 1W2KT 4KXZH 4N8CH 2N3JA 2AJSL 3QUXB 5GISL 1FYTA 4O02A 2I5YL 2XFXA 3I9AA 2VQ1A 1DVUA 5KYXA 4QWWD 5FYKD 2IGFL 3AS0A 4FQQB 2ZWYA 4NZUH 5HHQB 1E4KC 3BAXA 3PNWA 4L18A 3L7EB 3BAWA 2DQDH 3FO9B 1E9OA 1IM9B 5ALCL 5BXFA 3HNSL 2DRUA 2A9BA 4XB7A 4MVBC 4GRLB 4Q6IC 5IROA 3W82A 4OW6A 1ASOA 4E0RB 2XTSA 4F7KA 3HN8A 3OB0H 1RMFL 4Z0BH 3L4VA 4FZEH 5AB0A 3BISA 3AG3B 1M42A 1L9NA 2ADGB 3AXHA 4JFEA 3L7FB 1MREH 3P02A 4N0YH 1T83C 3HS9A 1ACYH 5HGBB 5IK3B 3KJ4B 2BVPB 5T5FH 1F1AA 3NYKA 4Q56A 4X80H 1HNFA 3WTSA 3KYMA 3L3GB 4R8WL 4JY6B 3HS0A 3DYPA 3GSXA 5F7DB 3U1PA 3GSVA 3ZKND 1FG9C 2EVHA 3WUWA 3B4NA 3QHZL 4HWNA 5C0DA 1MY7A 1QTYT 3H42H 4OZFG 3WEAA 2YD1A 1F0LA 4S1QL 1AR1B 3MLPA 2Y7MA 2NY1B 5D5MF 4EIZC 5AZEH 2G60L 4Y0GA 1AFVH 2ZTBA 3EGSA 5GXBB 4ZK8A 5FO2A 4JFDB 5DS8A 3E7JA 3EGXB 5DF0A 4FI7A 1COBA 5T1DH 1G4RA 1A7NL 4I3RH 2XG5B 3GGWB 5EIQA 1T1WB 1AKJD 4TQPA 4OGXL 4QHMB 5FGBA 5HYSB 5E9AA 5K9KB 1IFHL 4NO2A 3IGAB 1M2OA 1TTCA 3DHJA 1KB3A 1MCSA 2FX8H 2H4EA 1T1ZA 3VD1A 4ADJA 5D7JD 5KBPA 1HINH 2V8MA 4XI5C 5MEOA 5JPNC 4J8QA 2XWXA 1O6VA 5IVXA 1XGUB 2R4SH 1JGDB 1XXFC 2IXQA 5GGSB 4O5LL 1BQUA 1G6RL 4N8VB 3H3KA 4OVUA 1KCSL 4H88H 1XGTB 1NFDA 1RULH 4JCLA 3SGKA 1ACZA 4HJSA 2XV2A 3DX7B 2VDNB 4BZ1H 4L4TB 1U4EA 1J8HB 2EC9U 5A3ID 2X89A 5DD6B 4PJBA 3GS4A 2VN7A 4BKSC 3L3OA 1ZLUH 1W91A 2BP8A 3FO2A 4R96B 2MCPL 1F2QA 3DVFA 3TO4C 1WHPA 4ZT1A 2QVFB 1T66C 1A9EA 3QXDB 5IQ7L 3RVWC 3VXPA 5KVDH 1UADC 4NP4L 4PTTA 3WTVA 3B43A 1JVLA 4L8SA 4QXTA 3UTTE 5TPWH 4I89A 1Z5LA 3IT8D 1OAXL 4ZFFA 2GTQA 3BP7A 2P9RA 1P4LA 1CQKA 4FL4B 4UDUB 3OMZA 3MRNB 3H9ZA 5J9PA 2QZ5A 3S2AA 5ABAA 1ZLEA 2VITA 3D4GA 5H35A 1KNOA 1I4FB 2V9QA 3DRTB 3FB7A 2QPDB 1Z0NA 4LEOB 3WLBB 4OFYD 3IGFA 1I8LA 4ELMF 3D2TA 1EANA 3C8HA 5T3XE 2M83A 4LARH 2G30A 1WISA 5TH2B 3QZWG 2FB4H 2FLRT 1A6VL 2WBJC 5MP6H 4M5TA 5FYLD 3SSGA 2NDFA 4GKSA 5CZVL 3ME0B 4A68A 4MJ4A 4YXLL 2EYTA 5C0EA 4PV1C 4A2DA 2Y6TE 4K0OA 4GW1B 4B5ZA 1CZ8H 3JBG7 3QIWA 4JDTL 1N0XH 5IUSA 1IQWH 3NPSB 3ZL4H 2FDBP 4ZO9A 2J71A 1EGJH 4LIQH 1ETZB 4FCHA 2VN5A 5EZOL 1EEUA 4XNBA 4P2OB 3I6KA 3A6CH 1SLXA 4BM7A 4HU2A 4XXWA 2VNCA 3UXFA 4CSPA 4DW2L 4KHXH 1YYML 3L5XL 4LCYB 3L3IB 3RIAK 3M1BB 4WEEA 5J11B 1ADQH 1INDL 1I8KA 4P05A 3DIFB 3L3HA 1T0MB 3ZYOA 5DMIH 3NIDF 5JNYB 5MEND 1JNJA 3EH2A 5DMKA 5DRWB 1U8PB 1Z3RA 4DVRL 1MY5A 1S5IL 3FT3A 2VABA 4CC4A 3P11H 1Z6JT 1A3LL 2NY3D 4OF5A 1XF5A 3EF4A 2IQ9H 5E6YA 3DX8B 4X98B 3UMNA 4G5AA 3C08H 4PRAA 1J8KA 3F7QA 4JVPA 2A9AA 3VXOA 4EIBA 4WWKD 3RTQA 4F3FB 3GSQB 2FX9H 2YKLL 1UCBH 4QT5B 1OAZH 2LAAA 2Z1KA 1FL5A 4RDBA 1VZGA 2UXGA 1HHJB 3JZ7A 4RDQG 3FTGA 2FWOA 5E08L 4N90D 1CGVA 4HUUB 2ZKMX 4ORGA 3W1ZA 2X4QA 4QXVA 1CDYA 1JF1B 3MBEA 3KPQB 2ID5A 3ZRCC 4M7JH 3AAZB 1TTBA 5TF1L 3TYFA 2QPSA 3VX0A 1PAZA 3ZO9A 5K9QG 12E8H 4RVBA 3DARA 3B7YA 4EE2A 1DJYA 4EN2A 3IS1X 1ILUA 2E9GA 4URKA 3IJ8A 5FUZL 5K9JH 1E4JA 2ALAA 1WCBA 4J2QA 1I8AA 5IFJB 4QRFA 5I30L 3THMH 3DC0A 1D2OA 5IIEA 2PR9A 1ZPUA 2QKIA 2R2EB 3U1QA 3FB5B 4C57C 4DPAX 2DV6A 1KPVA 2ICEA 1BFVL 1MCFA 2BP0A 4LCCC 1YQVL 3TEWA 2FECL 3PABA 4KHTH 1FZKB 1DQKA 3K6IA 5FXCH 4FHJA 3ARDB 2AXFA 3TA3A 4I13B 4MD0A 5E0QA 3DUSB 3EO1A 3O3AB 3KWXA 2Y24A 3U1SL 3PIQB 2HP4A 1SOXA 4FQ2H 1A14L 1NAKL 5IW6B 1YDPA 1VFBA 1ZVSA 4S1RH 1BPLB 5SWZB 3F12B 2WWMC 5GGTL 3E0GA 4JL2A 1T1YB 1T80A 4KY1L 3PS6A 2V2TB 3QORB 3MRRA 5CUSH 3ARBA 3BCFA 2YARA 4QKXB 2VLRD 5GS1C 3B9EA 1YEFL 1FVDA 3ROOB 3MV11 3AWFA 2WO3B 3BEVB 4JFDE 4YQXH 3CFIC 1T6VN 1ICTA 5CCKL 2X4PB 1FCGA 2DDQL 2J1WA 2H7WA 3UCRA 4X99B 1GOFA 1OWWA 1N7ML 5DJXB 5GZND 2RA1A 2EDRA 4GAYA 1HFUA 1YY8B 2BJML 4HCRH 1UA3A 3TCLB 1A1MA 1X9LA 4JG1H 1U2YA 2IPUG 1F90H 4HUMB 5CN2A 3DWTA 2D3VA 3UJIH 3V9EA 3WFZA 3X3GH 1E5UI 2YRLA 3OBAA 2Z93B 1E27B 4RNRA 1RZGA 3V5HB 2KLSA 4NWUL 3VXMB 2P8LB 4GBXA 1AGEA 3VXTB 7TAAA 3F6IA 2DYPA 4LLDB 3FQRA 3EOTL 3HW7A 1ZHLA 1S7UA 3IMVA 4OGYL 5FWQA 3IE9A 2Q6WA 2P5EB 5KEZA 2XWBB 1TIUA 1UWGH 4L4TE 1KIUB 1J8HE 4ZTOH 5C86A 4HUVB 3FCSA 4QRUA 4D0DB 2UXFA 1YYLL 1KELH 4QRQB 3QARA 2PP8A 1J1PL 1G94A 2WW8A 4OJFL 4AKOA 3RVUD 3V8OA 4MA3B 4U49A 4XCCH 1O5PA 1WQVT 2LW3A 4ANXA 2CBMA 4GT7A 5TQ0H 4MJIB 2V9UA 1FFPB 2JJWA 3D9AH 2YOCA 2X6MA 2O72A 1J11A 1IGYA 1ET7A 3K2IA 4RGND 3Q8CA 4JL1A 1SFHA 4YUEL 2NQDA 3TU6A 3IRCA 2FHBA 4QDGA 3NK4A 1HT6A 4JY5H 3SDYL 2P4AB 4AVJA 2BIPA 4ERSH 3T2LA 4HOWA 4ETQA 1DBAH 1X7SA 5FHAH 3K5SA 5I16A 1D6VL 1F3JB 3QFGA 1YEKL 4OIIH 1FL3B 5AYTA 1LP9B 3DURB 1MCLA 1VGKB 5EWIL 3UDWC 4JM2A 4G43A 3SO3C 1I1AB 3WNLA 2DTSA 4LXFA 1TQCB 4UV4L 4MZRA 4PJCB 2X4TB 3FUKA 1TQWA 4BUQA 5JXED 5DHVH 2DM4A 4QF1B 1CDHA 1JOIA 5E99H 5HHNB 4E68A 4LF3A 4ONOA 3QWNA 3VFMB 1TYRA 2GK0B 2Y6SC 3DV6A 3N1GC 4NM8H 3ZLQC 4ZNCD 4YEFA 1E28A 3NSDA 2FIKB 2V2XA 4K5OA 3SKJH 5C6PB 3U9PH 4CGTA 4Z7VA 1OGTB 3U0WL 3WY4A 4XNDA 3SKUD 1ESOA 4WIQA 4Y5XC 3NZ8A 3UTQB 3V0VB 4L9DA 1UUSA 1MIEL 5C08D 4PRBB 2VUOA 1UH2A 3SOBH 4WI3A 1P7QA 2LU7A 3NK3A 4HXAL 4JUSA 1LK3L 3TN0A 4K3DL 5T1KB 4WGVB 3T3PB 3T65A 2YLKA 4J27A 3NN8B 4JFTA 2VAJA 2BHFA 3APNA 2WNXA 1JHKL 2XY1A 2HFEA 4MQXC 3GSNL 1EFQA 4XHJD 2XJLA 3KPNB 2VJXA 4J3OF 1TEYA 3FHAA 3ABMB 5IMKB 1R17A 2DQCH 4NQUA 1TTFA 3L1FA 4HEME 4M6ML 4L23A 4ELDA 1RP9A 1UWXK 2B7DT 3IDMA 2IPTL 2Z1PA 1CFSB 2WCGA 1IE5A 4Q4EA 3V4LA 3EFOB 1XD1A 2YGVA 1Y0LB 5BQ7A 5IMOB 5F7LB 4CL7A 5G2NA 3MRLB 5D1ZA 1TKWB 2CXGA 1RK1A 2LU4A 5IMMB 3TBSB 5EN2B 3EHBD 1H0DB 4NQTA 1T0NA 3MYJA 2ATPB 2JIXB 4IM8A 1XIWB 1ZHNB 2EH8H 2GI0A 3EJZD 5IBLC 5I9QB 4DVBB 5CEZD 4FTDA 1T5XB 3KYKH 3X11B 2AQ2A 1A0QH 4F2FA 1G6VK 5ES4B 1ZT1A 1DN2A 2HH0L 2VM3A 3CLFL 3QI9C 4LCIL 4XP9L 1E8YA 1IKNA 3HE7B 1ES0B 3V8CA 3WY1A 1KF9B 1L6XA 4DGIL 4JFHD 1DSWA 1U3HA 5TE7L 4HHAA 3AT9A 4EZJA 1YN7B 3B5TA 3BOVA 3PQYA 4XAKE 4HIEB 4XP1L 2CR3A 2FBOJ 5AZUA 3WGUB 3N0AA 2ZOLA 3QXVA 1UKTA 2QQKH 1XWVA 2OMBA 1OF2B 2Q7YA 1INEH 4N2NA 3J2PA 5GGUB 3UP6A 2BDNH 1SJEA 4PY7B 4AE0A 4S0TD 4H44C 3N1QC 2Y4SA 4M1CD 1B4TA 3FOLB 4JK0D 4IKJA 5SWZE 2X4UA 3TNMB 1MEXH 2QQNL 4XNUH 4HAGA 2HRHA 4XZUB 4Z3FA 1G7JB 4HJIA 4HAKA 3O6MH 1NGXB 2WUCL 5FKAA 4K7PX 1CC3A 1RSFA 2OL3A 3KGRA 2CRZA 1KG0B 3W2DH 2EIEA 3EH3B 4KRLB 1FV1B 1QR1A 5CILL 4R7DB 3U7WL 3POHA 5AG9A 4QTFA 1JFQH 1KCBA 5DJ0A 3HG1B 4H25A 3T8XA 3NCWA 4WNJA 4WFFE 1AE6H 1FF5A 1GY1A 2BNQD 4BFEA 1PFOA 2NTFA 2W91A 4WZ9A 1B3JA 3QHFL 4HC1L 3RAJL 5KTEL 3ZTEA 2CA4A 1F13A 2HJFA 5F9JA 1E8WA 3VXME 3MA7A 3MYZA 4F9LA 4FG6D 1P9MC 4OD3L 2DKMA 4AMKL 3VFUB 4IOFD 4K23H 3VXUA 1K3IA 1NBVL 4KK5D 4LHUG 2QV2A 3NCJL 4XWOC 3W39A 2CLRB 2P5EE 2X38A 3VE0A 5CJQL 5AALA 1PDKB 2C1OB 4JDVB 2X88A 2WLYA 3L9BA 4KDTC 5CLYA 5I17B 3G3LA 2MJWA 5T3ZH 5F96L 4YSTA 3QEGH 5LBSL 1UA6H 2IH9A 4OZGA 2CGRL 1LEGA 5FO7A 4MJIE 4EF3A 1N2RB 3NJVA 5T3XL 1MWAB 5AAPA 3H4HA 5EZJB 1O7VA 3GT6A 4AIEA 1DSYA 3ETBF 3TONA 5IHWA 3SY0A 1O9VA 5E6IC 3PWPD 4F91B 2A9NH 3GF8A 3VM7A 3L5WB 3EDEA 5G5DB 4AZUA 3ZE2F 4AITA 1LP9E 3QQ9C 3HLAA 3CFKB 3NCEB 4M7KH 4QY8B 1YECH 1YNLH 1I9JL 1QUNB 4FFTA 2ZG3A 2H1PL 1L9MA 4OGAC 3L1OH 4CMHB 1E4KA 3BLPX 3U0TA 4M8VA 4PJCE 2E6PA 5JMOC 3T5WA 5DEFB 3HBQA 1QABA 3ZHNA 2Q87A 3IAPA 1OT1A 2TSBA 4WGKA 4XPBL 4PJDF 1GA2A 1MJ8H 5DJ6A 2F54A 4IW4C 3BDXA 5KSUB 1XF3A 5IV2A 5IBUG 1ZA3B 4JEGB 4ZPTB 1ADWA 1U3ZA 3HPJB 4PRPB 4EIGB 3HZYB 5EMYA 5T5FA 2K45A 2JCWA 1KIRB 1UD5A 3OPZH 1EO5A 3MRDB 1VKXA 4NNYB 4NPKA 4QGTA 1IBGH 4FAAB 1JNLH 4OLXH 3F05A 3U48A 1T03H 1EVUA 3GBNL 3PAYA 3VDBA 4MKMA 1T83A 3VI4A 3CZKA 5C0NC 2BOCA 2CBTA 3WNMA 4WVRA 4GRWF 1LO3H 1TCMA 2L0DA 4KK8C 2AK1H 5IVZA 2YQBA 5AB1A 2WVVB 2PPEA 5HI5D 3SPCA 4W6WB 4M7LL 1BXXA 4TTDC 3T3PE 1TU2B 1A6UH 1U3YA 1MCWM 1F1GA 2R2CA 4X8JA 3TBCA 4UYQA 4DN4L 4XPTL 3BIKA 3MGTB 3TBWA 3HC2A 3SJVA 4UTBH 3D12B 3ET9F 2FCBA 4KJYA 4PUBH 1ZANL 2R69L 2NXZD 3GUTB 4YX2H 5HI3C 3D3VA 4K73A 5BCAA 2YUWA 3CH1A 3TBVB 2VC2H 2A9CA 2H6PA 1D9KD 2V37A 1FG2A 2Y2YA 1DQLL 1NMCB 1NEPA 2YUVA 1B90A 1SMOA 1KT2A 1IARB 5AW6B 2K1MA 4MRCA 3RBGA 2FUQA 3B2PA 4RISL 1JGEA 5FUOL 5TE6H 3LRMA 4HGWA 2KH2B 1KPUB 4FC3E 4XMPL 3F01A 4YK4B 1S7WB 4XP4H 1HXYA 3O6KL 2H0PA 4IYKA 3RX5A 2CDGB 4OD1H 1F42A 1IAKB 3X1FA 4DKEH 5JPNA 4BZ1A 4XCYA 5FHBL 5HHOD 3GRWL 1JS4A 1BXUA 1I8MA 1CLYH 4FP8H 1LO2L 3TPUB 4E9WA 4J3OG 1VFAB 3LRSB 2W07B 1B0IA 2A74C 5C3TA 1S7TB 2ZKWA 1E4WL 1S7VA 1JK9A 3CK0H 1XSIA 4JO1H 1RHHB 5E56A 1XD0A 1MFBL 5B39B 3RYMA 1NBCA 3WG7B 3NACH 1Z9PA 3G5ZB 2K78A 3MX0B 5I1CL 1L7IL 1J10A 3GINA 3QK0A 3IFPA 2FR4B 3TO4A 1N0LA 2EC9T 2EE2A 1TVHA 2HG5A 1CE1L 1M71A 2WN2A 2XN9D 4WWID 4L0ZA 1OZTG 5TDOB 9CGTA 1YNKL 2NNXA 2HFFB 1FNHA 4OLUL 1AMXA 1CVRA 1PVHA 2RMNA 4KRMB 4NO3B 4TOYH 4Y5VB 3UADA 4AJ0A 3SOTA 3W37A 3K4ZA 4QPEA 4Y4KD 1H3GA 2BNRB 3GJFK 5E0FA 3WKYA 1MFNA 2MTAA 4NAJA 3X13B 4X4YA 3T6QC 5FA4B 1Q0YL 5E2TL 4R7NB 1R3HA 1P5VB 1IAIM 1TJGH 1BFOA 5HVHC 4LPYA 4GKZA 1DQDL 5INDA 4QKTA 5J6SA 3MLZH 2R1WA 2CK0L 2FL5A 4OM0H 1Y6KR 4G80B 2YSTA 4HUCA 2VDKB 3PNRB 4NX0A 3VFGL 5A40E 1GGTA 2VDNL 5JHDA 2QHRH 3IJYA 1EDHA 3FN0H 2WBJA 1U3NA 4PP2B 5AW8B 3WAKA 4OQTL 4BUGA 4PJ8D 1MHPH 1MCQA 1EGJA 1WO2A 3HG1E 5JUEH 4GT0A 1H3VA 2J8UA 4D0BA 2CSPA 1HJCA 2WKOA 1FFOB 3K80A 1RUAL 2FT8A 3IVKB 1A3RH 2YO3A 4G9DB 1JHTB 25C8H 3MZGB 1CTNA 1Z9LA 2BXYA 2DJUA 3RWFA 3FC8A 4HGMA 4LEEA 1ADQA 4WI0A 1R3IL 1U58B 2ZUUA 1IBDA 3KPLA 3U6XS 5JHMA 2Z92A 3IFLL 1KJVA 5LXGH 5C0BB 1BD2A 3FQWB 2VXVL 1QBLH 5ID1B 4GUOA 2J2ZA 5C2UB 2EDNA 4ZSOB 2AI0L 3P77A 4Y9GA 1CDJA 2QSTA 2CA3A 4M6AA 4EDXA 4Y4FB 4N2BA 1TVDA 1JVKA 1HCYA 4Q52A 1QHPA 2ATKB 1ZVYA 5CLZA 1PSKL 1WAAF 5E6SB 5LNEA 3TVMD 3CFNA 4JFPB 3U30B 3L4XA 3D0VB 5DFAA 4OFDA 2WMPB 4X6CF 4LRIC 3ZKMC 1DE4B 1TZOA 1Z32X 3S34H 2F7QA 2PCPA 3WIAA 4LLYB 2VDRH 3VYNA 2X2HA 2ZXGA 4H26B 2VZUA 4J12A 3ZZ1A 2ED8A 3FT2B 3L5HA 4Z7NF 3UGEA 5JYMA 5IQMA 1KCUH 3ISRA 3S5LG 3HMWH 1U8NB 4PRHD 4XVSL 5FYKH 5I8EB 1FLTX 3AQDA 3OAUL 2A38A 3JV6B 2B20A 2HVKA 4Y16C 4J5VA 3EYVA 1KY6A 1HL9A 1Y18B 3QJFA 2UWEB 1UM6L 4XPHL 3VD5A 4DOHB 1GOGA 4LCUA 2CM6A 3BUYB 4YHNA 2A99A 1DVFB 4NCDA 4L3ED 1OGPA 1QI5A 1XH0A 2ICWA 1JZFA 4P07A 5DLMH 4U4BA 4FERA 1XO8A 2GW5A 2AFNA 1MFVA 4CMMA 4HKJB 4X4ME 1UZ6F 1KXTA 1WFIA 7CGTA 2GJZB 4XOCA 4YHYC 4JPKL 3FCTA 2GJ6A 4K3EH 3C5SA 4PRPE 4GG6A 1EV2E 4LCCA 3ZKNC 3FOMA 4MA1B 3ARVA 1VCAA 3PJSB 4W9IC 4YZFF 4AVKA 2DY2A 3QJHA 1U8LB 1OP5K 5KVEH 3KR3L 2FJFB 4P5TA 5E5LA 2ODHA 3SZKC 1U33A 5KSAB 3A6BL 2WSDA 5EIIB 5F7EL 4P48A 1UB6A 2ATAA 1H8LA 4KUCD 3WKNA 4WU7B 4A2FA 3L16A 5K33A 1DQTA 2CDEB 4PRDA 4YHLL 2RALA 5IJCC 3IDGB 4Z7UF 1ZGLB 1C5DB 5GS1A 5DJYA 1HHIB 4XBPA 4KDVA 1RUPH 4EBQL 3PGDB 4UU9A 2GJRA 4FZ8H 4HCRA 5D7JC 1JZGA 4PLNC 3MO1A 1VIWA 1IBZA 4KTGA 4FLHA 2CJSA 2VO8A 2ADIB 4LNVA 1AAJA 2P24B 5CP7B 1Z9MA 5A2AA 1QOKA 1A7RH 2BNUA 2K3HA 4ZDHA 2YPLB 3O3EA 2AJUL 5FA3B 3UZQB 1HCFX 4PN6A 4QRRA 1NA8A 4A7VA 4MNQD 5A3IC 1XGRA 3BE1L 4N2AA 2NY4D 2ZSVA 2C9XA 3SKNB 1AQDA 3TV3L 5CM1A 2EZ0D 1UGNA 4BRJA 1A4AA 3X14B 2WUBL 4L8CB 1H6UA 3BFOA 35C8H 3F7YA 3N2JA 2OM5A 3EJPA 4XN7A 2QTVA 4U1IA 4HFUH 4BK5A 1AXTL 2ZUXA 3QQNA 1O5DT 4HW6A 4ZPVA 1KYOK 4PJ5D 4QXWA 2RQ8A 4LSVH 5HGDB 1M1XB 4KKZA 4UINH 5FECA 4U7MA 2MQCA 2I69A 5EPMB 2XZAL 2V5YA 3FZUC 5I1HH 2F8XC 3S37H 1QPKA 3LD8B 2G4GA 3DJTA 3UG4A 4XMKL 4E42B 4OUOA 4MCMA 4PSPA 2VLMD 2VDOH 4IRSD 5EEYA 4L3AA 4YAQB 1X9RA 1ZKAA 3GIVB 2FVNA 5CD5D 3DSNA 2PXYD 4Y88A 1IU1A 4NKDB 3RKDD 5C0RH 1G7IA 1X9UA 2NYZA 1MVUB 3B7SA 4HQQH 3OZLA 5HJGA 5JO5B 2CHDA 1A7QL 2BNRE 2AABL 4YS4A 3G6DL 2X2UA 3QEQA 2N7AA 3EYFA 1CDBA 2R7EA 4NKQB 5DHVA 3RGVD 2CPUA 4A6YB 2V9RA 1PZDA 1MH5B 3UDWA 1OHQA 2IAMB 3QQ4B 3VG9B 5D6CB 4GQPH 2IG2L 3I6LD 4MDRA 2DW5A 5BMFH 2QELA 3US9A 5TTRA 5JMRA 2DN7A 3TS8A 4C54A 3KM2A 3CVHH 3IDIB 4ORZC 4NEHB 1BAFH 2AJZA 3LPPA 2A4EA 5HY9B 1L0XA 3QISA 4A63A 4F37K 4HFWA 3GBEA 1E65A 2NQCA 3IPBA 4NUJA 4TLUA 3X1EA 3IJ7A 4G9FB 2C3XA 1MI5B 1E2VA 3P30L 4Y5XA 4KMTL 2Q3AA 2IFFL 3T3MF 3V6FA 4BH8B 2O5XL 2DQJL 3NJXA 3W0WE 2GT9A 4N6RA 2ZG1A 5DO2D 1BFTA 5GSRA 4BHUI 2NY3C 4PWEA 3ULVE 3BVTA 5C0BE 1PMYA 1X5ZA 3GK8L 3GM8A 2CDFA 4TQHA 5IB5B 5DRZB 4XX1G 4AUUA 4GUPB 1OCOB 1O7SA 4ODWB 4PD4K 1CD1A 3PU7A 4ZYKB 1C5CL 4ZSOE 5SWQB 4K7FA 5D1QB 1XR8A 5DHYA 2OYKA 3WFBH 3D2UA 1TLMA 4NUGL 4X9FA 4HDIA 5FX3A 5GRWA 1I7RA 1VB9A 3NTCH 2MSPA 4YVUA 1R4XA 2VDMB 4L5FH 2R1XA 4XC1L 1PLCA 3CSGA 4Y2DC 2JELL 2R27A 2JFCA 4TNWF 4G6AD 3QIBB 3N91A 4YR6B 3ELAT 3MXVH 2QADC 3EGDA 2AKRB 1J86A 1GSKA 4JMXA 5F7MC 1ZLSH 1FAKT 4OUUA 4IJ3C 3RWHA 1R24A 2XHNA 1OM3L 4NQDB 2PW2A 4NRZA 2A6IB 2UYLB 2IBGA 3SKOA 4IKIA 4AGPA 5LGKA 1MNNA 3K8MA 4Y19B 5D71L 3UG5A 5IOPA 2UWEE 3DRQA 5MERB 4DOHE 2YEZB 3F7LA 3GO1H 2E4TA 5E00B 4JPSA 4G59C 4M7ZB 4PJFF 5D2LF 4Y1SA 3NZHL 1NAMB 3LZFH 3RWGB 3QI9A 1C9SA 3UBXI 5DURD 3TURA 1JZEA 3MNWB 4TV3A 4HJTA 5I23A 3BVXA 2IH8A 3P0GB 1RY7B 5F7WC 3S36L 3BGAA 32C2A 2D7OA 5I0VA 2EDHA 4XGZA 2VXSH 2D3JA 1QSEA 4LHUA 4LKCA 4Y5YC 4J8RB 3BC9A 1WZLA 1VSCA 2EEDA 5KBLA 4HG4J 3S3SA 3IJSB 1F1DA 4B9KC 2EDFA 2X2JA 3E8UL 4HH9A 4FQJL 1S7RA 1RK0B 1FVEA 1HZKA 3W9EA 2PWHA 2VR6A 1JI1A 2HXAA 3SE8H 3RFZB 4DO4A 2WNGA 1U42A 3OGCB 4DHLA 4R2GC 1C16B 3AB0C 2Z8RA 1TTRA 3B2UC 3V0GA 4U1LA 4A2MA 4MLSA 5C0CB 4HIJA 3GSOB 4YHOL 4FYTA 5GJTL 4CW1A 3Q5TA 4P9ML 2KQNA 5GZNC 2IADB 4H4NA 1U4FA 3P4NA 2ZUYA 4MXQD 5C07B 4YHIB 5E9NA 1WA2X 1E3XA 2WWOA 1DVQA 5I5MA 3DBXB 1KIPA 3OVUB 1FP5A 2LFGA 4QHLA 1FZMA 4L4VA 5DVNA 2VZVA 2J6WA 3RL2B 3D85A 1QTSA 3APFA 5EDXA 2K6WA 2A83B 2C1PB 4TQEH 4XB8A 2YPLE 5E1IA 4W4NA 6PCYA 1BBJB 2VB5A 4MMXB 4NN6B 3PREA 4K8RD 5DYFA 1ZJAA 2AXWA 5GRJH 2OZ4H 3VJ6B 3VXSB 2GCYB 1HHHB 3KXFA 2DM2A 3DKHA 4TL5A 4JM0A 1A4KB 2W80C 1W0YT 2H0JA 4P5SA 4WFGE 2VDQH 5B1JC 4E36A 1KGCE 4FYRA 3U7YL 5B4MC 1P9MA 1UEYA 1J0ZA 1BZ8A 2D2CC 2J8OA 2YXWA 3BVWA 1WVZA 3RVTC 4ZOCA 2FQDA 1WA0X 1OSYA 2CGZA 3WTWA 2B0SL 3I3BA 2OFQA 3ML8A 3P69A 1BXAA 2X40A 3LSOA 4ZUUB 5C9JA 1EXUA 3DO4A 1P84K 3NFSH 3EBHA 5T8IA 1M56B 4KDTA 2VMEA 1SMDA 3B2MA 3IFNH 5AVUB 1JWUA 4QRSB 1G1OA 2BS8A 4X5XB 1EK3A 3N9GL 3LIZH 1M2VA 2Q76B 1TG8A 2ZYHA 3AUVA 4FJYA 1LGVA 1C7SA 2AS5M 5F7FA 5GPRA 2NQ3A 3QPQD 1W16A 1G7MB 3ALPA 3D4YA 4UT6L 1DHKA 4JPWL 4QXUL 1CN4A 4OCWL 5JXEC 4PGDB 3ARUA 3NIGF 5ITFA 5EIVA 4GIPD 5DD0L 2XZCH 5D4JA 3TEUA 1XBDA 5DYOA 2EYRB 4HV8B 1IBHA 2C4XA 3CXHJ 3EH5B 1BJ8A 3KPOB 3HAEH 4M56A 1KCVH 3GZKA 2XRAL 3O6KH 2O6PA 4APQD 3QJXA 2LLLA 4J1UA 2VJ0A 3P2BA 1P1ZA 5AB9A 4QRPA 2D7PA 5FHBH 1XZ0B 1Q0XL 1AI1L 2ESVD 3BPOB 4G3YL 2ZXQA 1AR1C 2EDWA 4NIYE 2NSXA 4PJHF 4F7EB 3KBEA 1HSBA 4AQZA 4CADA 5C0AB 1K4CA 3KPMA 3ARGD 5H2BA 1NMBL 4G9FE 1CFBA 5MEPA 5ISZB 5T1LD 1MI5E 4I9WE 1MWAL 2BSCA 3GZOA 4XHJC 3WS3A 1I7TA 2X6UA 3WO4B 5EORL 1OM9A 3GMPB 1KGWA 4WJ5A 1RFDL 5FCUH 1L9PA 4UTBA 3MLRH 1CBVH 3APDA 4P2RB 1GAFL 5AW4B 1XL6A 2B08A 1A2YB 5D1QE 3IJHA 4RA0C 2Y23A 3CBRA 5JDJA 4P2QB 3VGAB 5HI4C 1KGIA 1N59A 1IKFL 3IDJB 5F1IB 4EVNB 5LAXA 3OKEB 3WDIA 2Y07L 4YGVA 2ZKHL 5JLZA 2WP3T 2VLKD 1BZOA 1PCXA 4I2XA 2FT6A 3EHBC 5SWSA 2A9ML 3H6AA 2C9PA 4IHOA 5KJRL 2NY5L 4Z7OB 4HMEA 5LWYH 2CIIA 2OJEA 3H8NA 3N44F 4CSSA 4DP1X 2NSMA 4OZIF 5IBTL 4L8DB 2F53B 3WYRA 1WH0A 3WDHA 1NLDH 3QO0A 4BRVA 1XDTT 2J20A 4NQDE 1X5FA 3SBPA 3MODL 1AO7B 2FD6L 4X0NA 5CJ5A 2YA0A 3KZ8A 4MCYA 1WD8A 5DS1A 5CEZH 1HQ4B 1U91B 1BOGA 3GQFA 2IGTA 4GINA 2NX5D 4Y19E 3H9SD 3S48A 2ORBH 5FPIA 5E4EB 1CGXA 4TUJB 2ODIA 3L3DB 4PBWD 2HLAA 3OKLB 2A74A 4Z8FL 4NZJA 1T7ZA 3E8VA 5F7BA 3EAKA 4U1NB 1RIUH 1RIHL 2EDEA 3IJ9A 3A4DA 3PUUA 3MRIB 1X5GA 5DC4B 1UH4A 3IU4L 1EUTA 2D3NA 1RZKC 4J3VA 1CR9H 1DEDA 1V7ML 5I73B 1RLBA 2J55A 4DGVH 2YGQA 1TCRB 3LN4B 1DBMH 4HF5H 4P23C 2JLPA 3OGOE 3KJ6H 4M1CC 3RJOA 3FFDA 1NMAL 1FZOA 4XMWA 2OMZA 1PJ9A 5E9DA 1ZWIB 5CEXB 3HE6B 3FRUA 5E1HB 4WF7A 4U6TA 1RZKH 4Q2ZB 1MFDL 1UACH 1FORL 1KWKA 4MMZC 4XH2B 5EU6D 4UV7L 1EX0A 5C0CE 2MPVA 4Q58C 5F97E 2O93L 2X9WA 1NC4D 4GSDH 2P5WD 1HSAB 5C07E 5F89A 1LDPH 4JDZB 1OE3A 5BQDA 3KLDA 3S5LA 2MNJB 2BY2A 1P0SE 5EC2A 2YD6A 3QJOA 2ICWJ 4I5BB 4Z5RA 4G6ML 2MHAA 2RJMA 4K9EL 4LQ1A 1BEYH 1CFVH 3U83A 3PDDA 3GTNA 4OI8A 4JHAL 5MEQB 3VRLE 2YMTA 3O2VH 4IOFC 5IJVB 2OTPA 3PF2A 4JHVA 1AGBA 1V3MA 2FYYA 2GHWB 3SPVA 5HVGB 1EUUA 2B5IC 5EOCH 3NJLA 3AXLB 1G0DA 3TWYA 1G4MA 4OCYL 3VXSE 2HKAA 2DWTA 1Z9NA 2BXZA 2F58H 2FATL 2P3YA 3ZTDC 5I1EH 2BPBA 2OTUB 5DCCA 2VXQL 1U6AL 1THCA 4WW2C 3QJZA 1N64L 4JHWL 2MTPA 3ARYA 2JKWA 4NLAA 5JYLA 2MKLC 3HI1A 5BRZD 2Q86A 1T5WA 4OCSL 5IHHA 3CCHA 1N4XL 5IKCB 4AQ1C 4ZG1A 3C60B 1HZHH 1Q72L 5B7MA 5DLLA 1PD0A 2ED6A 1QSVA 2VSKB 1KBGH 2DI8A 4LSUL 4AVIA 1MFCH 1YEHL 3PL6D 3FCUB 2YZ1A 2IO5A 5KJ7E 2DAVA 3AU1A 4PI0A 2VDKL 4LRIA 1IM3D 4OGZA 5CHNA 1FYTB 4O02B 3VSUA 2XFXB 1JP5A 2BVYA 1P4IH 2VQ1B 2XV3A 4XX5A 4B41A 1E90A 5KYXB 3ULUD 1XFPA 3HNVH 5KVMC 3CLEH 4LSRH 1QLEH 3BPCA 3PNWB 3CBJB 1E9PA 3W5MA 4BYHA 1E9OB 4NJAH 3N42F 5BXFB 2OP4L 43CAB 4LESA 2X1QA 4OV5A 3VD7A 4ZMYA 4U1HA 3H54A 1JHLH 1XCTA 1YMHA 4KTDL 3DO3A 3ULVL 2B59A 3T4AC 1JDAA 5GS3A 3T2PA 5ESAA 5E95B 1F8TL 4RSYA 3QP3A 1GRWA 4JFEB 4UOQA 4FHKA 3QFJA 1KWGA 3DUUA 4DIXA 2ZCKL 1OGSA 5EUOF 4YVNA 1GPOL 4OSUL 1UYWH 2EO9A 4GXUN 5HI5C 1FC2D 1Z7JA 1QEXA 3HG2A 5C0AE 4JANA 3V5DA 1TZGH 3FRPA 1BBDL 3G6JF 4V33A 4AOFA 3H53A 1MRFH 5HHMB 5HYQA 5ISZE 1F11A 1XT5A 2Y7QA 3HS0B 3GSXB 3KS0H 3TJHC 1C5BH 3TZVD 3WUWB 1ML0A 4D8OA 2KZ1B 4LQFL 1R5WA 1IQDA 3JV0A 3MMEA 5C0DB 2DWYA 1BQRA 3D0AA 3SDDD 1R6VA 2YK1H 1TENA 2RCSL 5HJ3A 2BO0A 5AZ2H 1P53A 2YD0A 3EGSB 3KG5A 2PW1A 3KM1A 1D9KC 4P2RE 5DQ9A 5DS8B 3ZY7A 4OBRA 2X6AA 3CQQA 3M45A 3R1GH 3RY6C 4K94L 4P2QE 1QVOA 3ZVVA 1AKJA 3OJMB 4KI1A 3ZDWA 4QD2E 1UT2A 2AQSA 2WVSA 3U9UA 1CLOH 1G9ML 4WWPA 2OJZL 1XGPA 4FLOA 4NO2B 5SX4H 5D7JA 1MCKA 2Y7SA 4YL4A 1T1ZB 2D03H 2D0GA 3KLSA 1Q1JL 4GO9A 5MEOB 5IVXB 1MCJA 4Z7OE 4JG9A 5ETUA 5AD0A 2JK5A 2K8QA 2F53E 2IXQB 4JFZL 2ZOTA 3RZCD 2B3RA 5JDSA 2AQTA 1JPFA 3UACA 3L4UA 1QNIA 5JIMA 3PWVA 1AO7E 1NFDB 3S96A 4ZO7A 3EBAA 4FLRA 2EABA 3CSPA 1QI3A 5GGSY 4I1RA 4L1TA 4PJBB 4B9JA 2CO6A 3S4SB 5E2UH 1ONQA 1TQBB 5HP5A 3L3OB 5K39A 1JMXA 1LILA 3FO2B 2BP8B 1ZY9A 2DBLL 4NPJA 1OCZB 1A9EB 4KX9A 4DP2X 3C5ZB 1XMWA 3EBIA 1U8QA 4KO6A 4R4FL 3VXPB 4PTTB 3S8FB 4L8SB 1I1AC 1CE6A 4QXTB 2VQUA 5CWSA 4ANUA 1Z5LB 1T89A 4BDVA 3BKMH 1JUFA 4ZFFB 3BP7B 5DXWA 1P4LB 5LCVL 5A2CA 2QQQA 5GS0L 3F7KA 3A67H 5J9PB 4PV9A 3RDTD 5L88H 4R84A 1K6QH 4TL4A 4JFFD 2B4CL 3RY5A 3M07A 2P5PA 2VITB 4L8BA 5H35B 1KNOB 5BZZA 5TGBA 3DOSA 3VWJD 4XNAA 3V95A 4Q8BA 4OFYA 3B83A 5JXAL 3FB7B 4A66A 5FDWA 3VM5A 4NPYA 4GAGH 1BAGA 3AWEA 1IZKA 2RB8A 3CVHA 5BRPA 1QFPA 1KN4L 4GKSB 2WXLA 5CSGA 2X4SA 6PAZA 5C0EB 2EYTB 2QVIA 2DH3A 1F56A 4WQOA 5H4YA 4DKDC 2KQMA 1KCKA 5HDBB 3RA7L 4N1HB 3V2AR 2VDLB 1J5OL 1N26A 1P7BA 3QIWB 3ISWA 2Z4QA 4F8OA 3KYNA 5FEBA 2YOAA 4NKMA 4X6EA 3MU3A 1E7VA 3I6KB 4FQPA 4ELKA 1CF8L 4QGYA 3WKML 1YEIH 4OBSA 4F2EA 1J5DA 2C7FA 3ABZA 4PH8A 4JZOA 3VXNA 3QUXD 4BELD 2WLNA 5ACZA 3GHEH 5MENA 4ODHL 2P44B 4MDJA 3L3HB 4B9GA 1FNAA 1TYJA 2XTJB 4K5NA 3BKYL 4L1BA 1U8JA 2YS4A 3WNIA 3O0LA 3FT3B 2VABB 4AYSA 1T0PB 4GS7C 6FABH 2UXVA 3TVMC 4M6NL 3GMNA 4JKNA 4JZJB 3I50H 5B1CA 2XVBA 1XF5B 2IPKA 2H1XA 3IU3A 2EECA 1IM9D 3LRKA 4AYEC 3ZDYB 4PRAB 4ALAC 1S9WA 1GMEA 1P5UA 3VXOB 4A6YL 3KBPA 1NGQL 3RTQB 5IT2H 4O4YH 1BVKA 1N19A 5CINL 1A7BA 1FL5B 3FTGB 2FWOB 4QXGH 3MV9D 4ALAH 1CURA 3S8WA 3ATEA 1F6FB 4ORGB 3GHPA 2X4QB 4DN3L 3B5HA 3MBEB 3B9KC 2ZWKA 3BWSA 1FYTE 1UKSA 5L6YH 3TYFB 5D7IF 1ZT7B 1AY1H 3ATDA 3L4CA 5F44A 1NEZG 3GMLA 2I07A 2XX1A 3ML9A 2EDYA 1L3NA 3L3JA 3EBGA 5DQDH 3B56A 3WIIL 1KIQA 1WCBB 5CO1A 2V8LA 4OI7A 5IIEB 2QKIB 3CTTA 5CZRA 1AXSA 2DWSA 3P2TA 2WOBA 2EUZA 1KPVB 3A5VA 2ICEB 1CYXA 3CZGA 1F4AA 4IBYA 4KKCD 2EXWD 4ONFH 2BP0B 4JFDD 1H3TA 2G2RA 2WLKA 3PABB 2Y22A 3O4LA 3L13A 4DCQA 4JQIH 2PWFA 2NY0B 1NCDL 2XKNA 4JFEE 3ZKXC 4BWTA 2AXFB 3TA3B 2HX7A 4M1DL 5I1AA 1OY3B 1PEZA 4XP5H 5AW5B 4MD0B 5F2FA 1AQKH 3HZKA 1FNSH 3RJDA 3EO1B 4Y5YA 1OXYA 4C8XA 4DGYH 3MNVA 5ICUA 2NNCA 2VDML 3ZHFA 5HHME 1FBIH 1YY9D 1YDPB 4BSWA 2DQIH 1VFBB 1ZVSB 1BVNT 1N5AA 5GHWH 2Y7NA 5I74B 2YFNA 4JG0H 3QDMD 5FO9A 2VLRA 3MRRB 4BQ9A 4FI8A 3ARBB 1BWWA 4ZTEA 2Z31C 3H1ZA 3LAFA 1FVDB 1MJ7L 4L4TD 5DJAA 3VI3F 4PBDA 2W59A 1ETJA 1KBPA 2ZF8A 4TLTA 1MCHA 1IAMA 3CSYA 5GZNA 4WUUD 3T71A 2AGJH 2AMGA 1X4YA 4QHKI 4XN8A 5FM4A 1MPAL 1OT2A 5CBEA 4OT1H 4GAYB 2M26A 2OK0L 4TQ8A 1A1MB 2L8AA 4KXAA 2NY4C 1NAML 2ZNXA 3FTUA 1DFXA 4UTCA 1SLVA 4UF7C 4PWIA 4ENED 2OZ4A 3H56A 4RNRB 5IVXE 1VZIA 2DH2A 1OCRB 1RZGB 4MQSB 1T7VA 1D5IL 4HCGA 3QW9A 4GBXB 5E5RB 4GFXA 1AGEB 2CJTA 2UV3A 4KVNL 2DYPB 3UAFA 2GTWA 5IEKA 3FQRB 1ZHLB 1MVYA 1S7UB 3FUMA 2XYBA 1NFDE 1D5RA 2Q6WB 4MXWH 3EO9H 2F08A 4WI4A 3BHBA 1D7FA 2Y2WA 2Q5BA 3DX4A 3CPLA 3FCSB 3OHXC 4GAJL 4NLHA 4PJBE 4QRUB 1RVFH 3GWJA 1IGIL 5CGBA 2H9GA 5ANHA 1JPSL 5B1JA 4DGUA 3CFBA 5AWNH 4DKTA 1AH1A 4IRSC 2DS4A 4RX4D 2VO5A 2HKHL 5ADOL 2APXA 1U3JA 2PXYC 4LVEA 3WSQH 2F5BH 2H5UA 1IGYB 1AD0A 4K7PL 5EORH 2YIHA 5HYJD 5KVGE 4LLVA 3LEVL 3V0HA 3EYSH 4BUHA 4YSCA 1TJHL 4M1GL 5CAYB 4ETQB 2ZG2A 4JO5A 3RGVC 1GGIL 1DN0B 4P9HL 4NZTH 1RJLA 2R0WL 4P46D 5KZCB 2G9HB 3H6JA 1YNTF 1WBYA 4IS6A 4JM2B 3CAFA 2NW3A 3T04D 1VADA 1XGZA 3NSCA 4G43B 5JXEA 2CPCA 2F0CA 3HAEA 2DM7A 5KJRH 1CXFA 2EE0A 2C5DC 1CXKA 4FDWA 3QGVA 3L7FA 5JR1H 2NPLX 1OAJA 1K9TA 4DZBA 2PNDA 1UWXH 4LOUD 4LF3B 2IALA 4GYBA 1IEAA 5DR5H 3DV6B 3ZQXA 1H6TA 4R26L 1E28B 4KZ0A 3N41F 4KK9D 2V2XB 5DMYA 3U25A 3FYIB 4BH7A 5HDBE 2NY2C 4G6JH 4ZTPL 1OD9A 4Z7VB 2R0LL 3K7UA 2FEEL 4LU5H 4NNXA 3EOAA 2LTQC 3NZ8B 3VFSA 1JXJA 4XPAH 5HHXL 1T22A 4RMWA 3FUHA 2WLHA 4I18C 1P7QB 4HIHA 4FKHA 2FIRT 3TN0B 1ETB1 4J23A 3VGFA 5D8JL 4YWGH 2JKNA 1R19A 1WBXA 3Q5YA 1I1RA 1KTDA 3ZSSA 3JT0A 2OXHA 3UO1L 3GKWH 5CCJA 1GVIA 5LDUA 5E2VL 1BMZA 1ZTXH 2XTJE 3VU1A 5EU4A 5K9KA 3QB7C 3SO5A 2EVJA 2HFEB 2YPVL 3QUZD 1SF5A 2YJQA 5EC1A 3SIKA 1FWXA 4KZEL 1FAIL 5HD8D 1X4ZA 2JH2A 4G6AC 4OCRL 3ZDYE 2B1AL 5EZLA 5IJBC 3IDMB 1CQYA 5GGVL 4OM1L 1G9NC 4YE4H 5J13B 2BIQA 2IH3A 2YXMA 4LMQE 3FSZA 4KGJA 4ZUSA 5BOJA 2R39A 3NCBB 4OCNC 5D2LA 2XQYG 2BP3A 5I76A 4XVJH 4AX3A 5BQ7B 1Q94A 4AXWA 2AP2A 2W5PA 4Q7DA 3BMWA 3MOAL 1W72H 5D1ZB 1FN4A 1F3RB 4G70B 1RK1B 1G9NH 5G4MA 3RUGA 2CXKA 2GEEA 3FBQA 1T0NB 3MYJB 2ITCA 4FF9A 1NCAH 2WXMA 1ZVNA 5BRQA 2XACC 1MAJA 1UXLA 3Q43A 4KI5E 1JYNA 4Z23A 3T0AA 2CK2A 4FFWD 2CJUH 1ZT1B 1KJ2H 3VQLA 1FUNA 2X2YA 3ETBJ 4H0GA 4XB3A 3H7LA 2DIJA 3RPBA 2YN3A 3ECWA 1X4XA 5E1AA 2XPZA 3UCQA 1H8OA 5GRVK 4UWQB 1BM3H 1U3HB 4HHAB 3KAAA 1T6WA 4YSRA 1H3PL 2OBGA 4NWTH 3PQYB 1A7PH 3AG2B 1CK0L 4IJTA 2ZOLB 4TSCH 1LXMA 1EFXD 1RZ8A 3RILA 5ALBH 1KPRA 3LZLA 4BFNA 4OLYH 3WN5A 1WDAA 4P23A 2Q7YB 1KZQA 1SJEB 1YA5A 3CXHK 3SYOA 2F7RA 4XNZB 3NRPA 1IILE 4LSUH 4G8GD 4MXQC 3PFUA 2X4UB 4XVTH 3MACH 1ZIAA 1BP3B 1O7DC 3KNBA 3T0WA 1WFMA 3EDDA 4TRPH 4MMZA 1DSFH 5FKAB 4LEXL 2P5ED 3BWUC 5I0DA 1WZAA 4FFZL 2OL3B 2A6JA 4P3CH 5DZVA 5EBWA 1HL4A 3B37A 4NM4L 4GXUM 1QR1B 1A64A 2QLVB 5JW5A 1DVSA 4KY2A 1FE8L 3JTSA 5F9DC 4H25B 3T8XB 1JZ5A 3QZOA 2XA3A 2BNQA 1YJDH 5L2JA 1CU4H 3QT2A 3HUJF 3L3IA 4HCFA 4GP5B 2NTFB 4N25A 3W56A 4ABQA 3DIFA 3KLAA 1MCEA 1U95A 1DJSA 3DSFL 3MJ9L 4U1MA 4M93B 4PRID 4F9PA 4UILL 1XXDC 3HNTL 4Z7WA 3SE9L 2EC8A 2HJFB 5F9JB 3C5JA 3MLTA 2X9YA 4BQCA 4FA6A 3FT4A 4K8RH 3MA7B 4N2OA 1IC1A 2ENJA 4IRZL 2HSIA 1I3GL 1LHZA 3VXUB 3W39B 4Z7IA 2EDLA 3Q1SH 1F00I 3VE0B 5C9KA 1OPOA 4KNTA 1NL0H 2JB5H 8CGTA 2V5RA 1NGZA 3JTTA 4WW2A 5CR8A 3QUHA 4OZGB 3H3PL 1LEGB 2BCKA 3EYUL 5FO7B 2WJ7A 4L2YA 3OZ9H 2FT7A 4JGMA 1THAA 2YN5A 4AQ1A 1J7VR 3SY0B 3PWPA 2KS0A 2ETWA 4U3HA 2QVMA 1F3DJ 1UWYA 4XCNA 2IAND 5IFJA 4KJQD 2AXJA 1OP4A 3JWOL 3MLSH 1CICB 3GI8H 4GQ9H 5KVFH 3HLAB 1HXKA 3Q9PA 4JR9L 1GOHA 4FNRA 4KMQA 3W5NA 4APQC 3PE9A 2VSDA 3P3RA 3U0TB 4NN7B 5EN3A 1QEWA 1A6WH 2MCAA 4G5ZL 2WNKA 3R8QA 4F8LA 1MFEH 5DJ6B 2F54B 2VZTA 3MLWL 1TNNA 3U4BL 1WITA 1XF3B 4PTUA 5HDOA 1KFAL 1OP9A 5AOIA 4QHPA 2QPFA 3ARGC 2ENYA 2J4WH 3NA9L 3NSYA 1XTLA 4UANA 5DRNA 3T4AA 1ZXKA 4W93A 2AVFA 2NY6D 4FQHA 2ZICA 4Z7VE 3TH3T 1VKXB 4D7PA 3KWUA 3PHQA 1X5LA 4G7VH 1KEML 4GFTB 4MXVE 1FO0B 3VI4B 3FKUS 5J4MA 3UYRL 2BOCB 2C9VA 3UTSD 4FKKA 1BZ7A 1J12A 4ESKA 4BFBD 5IVZB 1I9RL 1PTZA 2APWA 1QSFD 2CIKA 3F6LA 1J1XH 1ZIBA 2JIXD 4AEHH 4X99A 3W38A 4X8JB 2OMTA 4O02L 5K1VA 5DFWH 4C83A 3LPFA 1NCCH 3AY2A 4PW3A 4R97C 3BIKB 4HHGA 2ZUSA 3TBWB 4EZKA 3SJVB 1K8IA 4KJYB 4XWGH 3PY9A 2XU9A 5EZPA 4HKZA 4PLOB 1J05A 43C9A 1CPUA 3CDGA 4WUKL 5IGXH 1D9KA 3D3VB 2L7UA 3FQTA 3CH1B 1OTUD 5IVNA 2YAEA 4PYGA 5J89A 2H6PB 4XXDA 2B8OT 3FUEA 1FG2B 3RY6A 3V0EA 5AW1B 1M3IA 2F18A 5D7LA 2JKLA 2R8SL 1KT2B 3WNNA 2FX7H 2VXUL 1HWHB 4AQ8C 1JGEB 1DL7H 2WIIA 3MVSA 3GJFH 4HGWB 3OXRA 1KXQA 1HXYB 4TUOA 5HHOA 2YAOA 2KZKA 5JPNB 4U4IA 3EDFA 4R9HA 4RLDA 4XCYB 5D4HA 3B1TA 5TDNA 5L9DL 2WQSA 1RAMA 5L2KD 1I8MB 1WFUA 1JGVL 5B1KA 2CMRH 5DMJB 1S7VB 3VSTA 4M3JA 4B7IA 2ZXAA 1JK9B 4B9FA 4UQDA 4UMSA 5DJ2A 1XH2A 2AV7A 5E6ZA 2VR8A 2WXNA 4FOMA 1HC1A 3OKKA 2DKUA 1NCBL 1CYGA 2AQ1A 3IFPB 2CO1A 3TO4B 2XN9A 4NHCH 2CHNA 1FL3A 1N0LB 2HG5B 1TVHB 1WAEA 1M71B 2NY7H 4P5MA 3B7UX 2AAVA 3ZSTA 5FOJA 4EOWL 2IAMC 1A4JB 3PQYE 4P8QA 3HG1D 1AYRA 1I1AA 3KWVA 2D8KA 4OLZL 2IGLA 4PJCA 4Y4KA 1GTNA 1ZSDA 2PR4L 4TSBH 1HX0A 4OJDH 5ILTH 4I8DA 1MCRA 3BW9A 3W11D 4F7TA 4X4YB 3IJEA 1AHWC 5E4AA 3SCMD 2OI9C 1R3HB 1FLRH 4B7LA 1S3KL 5GRUL 1BFOB 4FLSA 1JJUA 4LPVA 1M9WA 4GKZB 3HR6A 5INDB 1FVCA 3QEUA 4GRMA 2R1WB 2FL5B 1BQLL 3GLZA 2L4OA 3NCYP 3BDYL 5D7SL 4HWEL 2WXGA 3SY6A 1OW0C 5JHDB 1MJJA 3IJYB 4R3SA 1NEZA 2WBJB 4OLVH 1XR9A 4FNUA 4E9TA 4WWOA 1VEMA 3CE1A 1KCRL 5D7KE 4NENA 2J8UB 2KYIA 1FIEA 3CXFA 2NUTA 4D0BB 4MCNA 2XC8A 5D1QC 3V7AG 3N55A 1EIBA 4PVBA 2X1OA 3RWFB 2ITEA 2X0UA 5KVGL 2PP7A 4WI0B 3GMMA 3TGXA 4ZMTA 5I24A 3CMOL 1UENA 4EXKA 3LMJL 3KPLB 4GO6B 4RWYH 4BCZA 2Z92B 4E9SA 1KJVB 1RURH 1ZE3C 3H7BA 4E41B 1BD2B 4PJIA 2J2ZB 2LVCA 3BUQA 5JA9A 1SLWA 1OCWL 3H2WA 3VXUE 2G3MA 3MA9L 2BSEA 5FK9A 1P7KA 1W8OA 3P77B 1EMTL 4AL8C 5BJTA 4R4ND 4PI2A 4EDXB 2ZX6A 4KQ3L 3CX5K 1XH1A 4AUYA 4FXGC 1G5GA 3GMRA 4JQXC 4MS6A 3TVMA 1GGUA 4OZGE 1WF5A 1UJ3C 4AL8H 5ELIA 1VCBC 2F61A 4RH4A 5DD1L 3TM6A 2B2XH 5I19L 2J12B 2PCPB 3MCLH 1OP5H 1RZJC 4BFJA 1EDYA 3KLLA 4ZAKC 2BMKA 3APMA 2WN3A 2G3ZA 1OB1A 4X6DA 3K6NA 2VDLL 4H8WL 4FG2A 2WAQA 3ULUH 4P3DB 1ORQA 1RZJH 2XXFA 3AG4B 3GC3A 3B9KA 4Z3JA 2HVKB 4OIAA 4W9ZA 3EYVB 3QCVL 4FXLA 2H0EA 3HZVA 5A6MA 3QJFB 3P0YL 5GGQH 4LCUB 3LZQA 4NXSA 4L3EA 4YHNB 4NQXA 4UB0L 5IY5B 2PPCA 2ICWB 2VLJD 4YSOA 2EIKB 3BKJL 1E3FA 4HETA 4JQIA 4X9IA 3GLEA 2F54E 3VACA 3VRIA 4KVNH 1LM8V 4CMMB 3O2WH 2DZEA 1KXTB 3QXWA 5F3FA 3HC4L 2WZ0A 4WSJA 1OF2A 3WHE1 3FCTB 5CGYD 3C5SB 5B7EA 4GG6B 4KPHL 3FSVA 4LCCB 3FOMB 4I9XA 3MRPA 4AZ8A 4FEIA 2ZCLH 1SEBA 3QJHB 4GIOA 3SDDC 1XB6A 1BQHG 2UUDK 4P5TB 4TUKH 2GJPA 4WKZA 1DVZA 1LO0H 1NGXA 3FT1A 4PJ9D 1PZUB 1KG0A 1N12A 2F1EA 1QX1A 4P9HC 5E8DH 3IEAA 4HS8H 1G5AA 1CLZL 5EU5A 1UB6B 4XMVA 1I9EA 4X2UA 2R56H 4A2GA 2H26A 5AL0A 1R0AL 3RJQB 4PRDB 4FX5A 4CKQA 5JOEA 2R0WH 2FK9A 2XKUA 1AXIB 1BIIA 3GDBA 2W9EL 1W15A 4N2MA 3SJVE 5GS1B 3WENA 4XBPB 5I1GH 3ZOAA 4YL9A 4ZUWA 2Z31A 4UU9B 4BIKA 3MO1B 2JKSA 4C4BA 2I60H 1L3WA 3D3VE 4YDKH 3M7FB 5FYJU 2YPKA 2DQHH 5DK2A 1QFWL 4X7SH 2BNUB 1BA9A 4ZDHB 3O3EB 4WHCA 1F58L 4HZ1A 4MNQA 4OB5H 3QC6X 1HEHC 3RGBA 3MC0A 2VR5A 4QRRB 3RNKA 1DJIA 1XGRB 1N8OE 4TPRL 2ZSVB 1QNZL 3OQRA 1AQDB 5LN4A 2HRPL 4KNQA 1JGLH 4IBLT 4FQIH 5DHDA 3HZMA 3F7YB 1J18A 4CGUB 1H3XA 4ZXBC 4U1IB 4ONHA 4L05A 4E2OA 5D2NC 4UAHA 2MH4A 1NTDA 4OIBA 2A1WL 2QSCH 1HNYA 3LNGA 4AH2A 1XEDA 5FECB 4UUJA 5BZXA 3QRGL 3KE0A 2V3EA 3OHXA 3VW3H 3A23A 5KVDE 3L5WA 4IRSA 4N2LA 3UJJH 4EUPH 4Z3HA 3DYMA 3VH8A 3LZRA 1GZHC 4V1DD 3RDTC 2PXYA 3HR5A 2C9AA 4RFEA 4UMGA 1LO4L 3TH2T 3ARQA 3DSNB 4I0CC 1G7IB 1LK2A 1EEQA 2BFGA 3JTBA 1V54B 2CU9A 1M7UA 1GYUA 5DEFA 3GEWB 3WFDL 3UTZA 5HTSA 5IQLA 2XV0A 3RGVA 1IKOP 2FJHB 3CXDL 1OWRM 5AL8A 4WV1C 3QEQB 3EYFB 1GCYA 3DGDA 4M48L 2R7EB 5DHVB 4KQ4L 2C4FU 1BVZA 3ULVD 1TSHA 5DZOA 1KSRA 2DLIA 4JKMA 3K2MC 4PRPA 2E5EA 1VFMA 2EICA 4MS8D 1VESA 2YXVA 2W0LA 1VA9A 4RGOH 1MZYA 4FG4A 4WCYH 4HOMA 4Y4FD 5JHDE 1YG9A 1KJ3H 2AJZB 5DT1L 1CDUA 4DAGL 1MVFA 1G7LA 3KLHC 1OO2A 2ZOUA 3QUMH 3LOWA 4FQCH 4HFWB 4JGUA 4LIQE 2J8UE 2HJLA 2VZSA 3LS4H 1DFBL 4KKLD 1YEDA 3MXWL 1SVZA 2NNAA 4NUJB 3KVQA 2PWGA 3BUIA 4JO2L 4Y5XB 4WFED 2C34A 3V6FB 2WWKO 3FAXA 3VGAC 4EUPG 1SM3H 2QMKA 1CL7I 2XZZA 2O5YH 2GT9B 1X6LA 4N6RB 4U6HA 1KB9J 2WQXA 1IGFH 1SOQA 1PLAA 5GSRB 4I18A 3GIZL 1HAWA 5E6RB 4E41E 5EEWA 2BSDA 1BD2E 3MRMA 1L9OA 2CDFB 3QAZC 2BLFA 4G7YH 3MLXL 4NQCA 1CD1B 1UQSA 2QGDA 4A7GA 2BW4A 5AW7B 1QKZL 4K7FB 1TJXA 3WFEH 5DHYB 1XR8B 3V7MA 1PZSA 1RU9L 3D2UB 4OIFA 4HDIB 4N2DA 2EH7H 3C9NA 1OAUL 1B2WL 1DVFD 2P46B 3PAUA 1I7RB 1KLGA 1EJ6A 4Q9QH 1KPUA 2GIMA 1EHAA 2MMXA 4XC3L 2OQJA 2R1XB 1G43A 1RZPA 2AERT 1DQJA 4KKAD 1L5GA 2VZ1A 1W72A 4ZNEA 5E8NA 1G6RA 2XA8H 3C87A 4UYPA 3EGDB 3NABH 3WTYA 4OUUB 3NVQA 3RWHB 1R24B 3DXAA 3F8UB 2NZIA 1IC5L 2PW2B 3N40P 3HC3L 1TR7A 4NRZB 3A4EA 3S98A 3SKOB 1FSKC 1JNNL 3MX0A 5EOCJ 4LP5A 4U0QB 1KJ2A 2W9DH 3AROA 1NCTA 2F19L 5I1IL 3II3A 5IOPB 3VDAA 5IESL 3DRQB 3GRBA 1YZZA 1RERA 2EXWC 4KKCC 4M43L 4O2EA 4XODA 1F4WH 1M6UA 3J7HA 3DVNB 3PP3H 1QZ1A 1JE6A 4Z9KB 5F9OH 2BFVL 2N1KA 1WZ1L 5TE4L 3QI9B 5FFLA 4KXCA 1TZ8A 4D9RE 2EXYD 4W68A 3MUUA 1I3GH 5F88A 32C2B 3P3SA 2NXYC 3IMBA 2LHAA 3MV8D 4XGZB 3T2NH 4E5XG 3AS3A 1QSEB 1SVBA 4LHUB 4LKCB 3FMGH 1KCWA 2YWYA 4GG6E 1J5IA 4ZQTA 2FGWH 1EH9A 1FH2A 4XN9A 5F1NA 2K7PA 5E2JA 1Y7VA 2YUZA 4HH9B 1S7RB 3GEFA 4GMTH 4BD4A 3IXTA 5F3HA 1FVEB 3W9EB 4XBEH 2YPLD 4P4KD 1MG2C 2Q8AL 4AGNA 3D30A 1X7QA 2APSA 3MBWA 1EJOL 4CSTA 4Z78A 4BINA 2GABA 5GGRA 2Q3ZA 3S3PA 5IW1A 4U1LB 4JPVH 1L9RA 3WKQA 4WTXA 4HIJB 3ZTNL 2CKBH 1XCXA 4CW1B 2C3VA 3CDZA 3FW6A 1BECA 3GSWA 1TZHA 3P4NB 4S11A 2WQVA 4KUZL 1CCZA 4QJ4B 3GS0A 3BGFC 2H6OA 1AG6A 3EFFA 6TAAA 3W0WA 5DHXB 1PLGL 5L7XH 4HCIA 1TJIH 3BDBA 1FZMB 4L4VB 4QHLB 1NUGA 3CU1A 4U3XA 3FH7A 3D85B 1WIUA 1YC7A 1KENL 1JPST 5F0PB 5EF1A 1K2DA 4UQIM 2NLJA 4QRRE 5DJZA 4JRFA 5T5NF 4KH2A 3KS0J 3KXFB 5IBUB 4CRPA 3WHXA 4WK4B 5IJDC 1MXDA 5HYSG 1KC5L 4DUXA 5E8PA 2A77H 4Y9CA 3AGWA 1PZAA 5I8KL 1BVOA 4DERA 3CWGA 3FUJA 3KLQA 4FNQA 4IRJD 4NO0A 2J43A 4CUCA 4IK7A 1FJ1A 4KAQH 4JO4H 4TNFA 3V9FA 3HHRB 3LSOB 5C9JB 1HEZA 1EXUB 5C3IA 5CJOL 2ADYA 5KJ4A 4PJ7A 1W6WA 2A2QT 3MREA 3Q8EA 2CCVA 4PREA 1RXLA 4WHTA 1MDTA 1JWUB 4DP9X 1EHLH 4JKKA 4IBZA 5I8EA 1LP9F 3SYAA 2OL3L 1M2VB 2CRIA 4YDJA 3E1ZA 1JRHL 1EO8H 1RZ7H 4HBCL 1UT9A 4HXBL 1WS8A 1CDGA 4R4BA 4IOIA 2HKFL 4Q4IA 2GY7B 3B2VL 3ZX1A 3V6ZA 1DJHA 4G9FD 3LKRA 4IMLB 5ITFB 3ZQ9A 1XZWA 4NP9A 1GZPA 4LOUC 3VSVA 3BAIA 3FN9A 3QEQE 1RP8A 5DYOB 3MRCA 1X5XA 3NT0A 1SEQH 4LVOC 4DP8X 4WTZG 4KK9C 4APQA 5E5UB 5KBNC 1E0OB 1M9S<