3K6FA

Crystal structure of mouse t-cadherin ec1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
b'SGIVVSPILIPENQRQPFPRDVGKVVDSDRPEGSKFRLTGKGVDQDPKGTFRINENTGSVSVTRTLDRETIATYQLYVETTDASGKTLEGPVPLEVIVID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cadherin
publication title T-cadherin structures reveal a novel adhesive binding mechanism
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 19
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3k6fA00
2OMZB 4ZT1A 4AK1A 2YSTA 4ZMVA 4ZTEA 2WBXA 4AQAB 2OMUB 3Q2VA 1NCJA 4ZI8A 1ZVNA 4APXB 3FF7A 2OMYB 4NQQA 1L3WA 4XXWC 2EE0A 4NUQA 5JYMA 2QVFB 3K6DA 1OP4A 4AXWA 4AQEB 3Q2NA 3UBGA 5DZVA 3K5RA 1O6SB 2OMXB 5JYLA 2V37A 2WHVA 4ZMOA 4AQAA 2YQGA 1SUHA 4ZMWA 2WCPA 3MVSA 3LNDA 3LNIA 1WYJA 4ZMNA 3Q2WA 2QVIA 2OMTB 1NCHA 1FF5A 2A4EA 1Q1PA 2WD0A 5CO1A 1WUZA 4ZMXA 3LNFA 4AQEA 4AQ8C 4AQ8A 3UBHA 5KJ4A 3LNGA 4ZMQA 1ZXKA 2OMWB 3QRBA 3K6FA 4APXA 2X2UA 3LNHA 4NUMA 4QD2E 1NCIA 1NCGA 3PPEA 3K6IA 4OY9A 4NUPA 1EDHA 2OMVB 5CZRA 4ZMYA 4ZMPA 4ZMZA 3LNEA 3UBFA 4AXWB 4XXWA 4ZMLA 2O72A 3FF8A 3K5SA 2A4CA 4ZMTA 3Q2LA
chains in the Genus database with same CATH superfamily
2YGVA 3IS0X 3RRQA 3I50L 4NC1E 2P24B 2VITA 2GJ6E 2ZXDA 5J89A 4AEHH 1W9XA 1DO6A 1P4LB 1JHTB 3V9CA 2NT1A 3HMWL 2ZNXA 4RFEB 2OTUA 4PJFF 3IJHA 3S6CA 2BNQE 3F7YA 4GLRI 4BK4A 1DJSA 5AW9B 4BFIB 2FB4L 5IFJA 5FECA 1J8KA 3L4YA 4TVSa 2YQ2A 4HMEA 3PYCA 1R4XA 4FX5A 5I6NA 3STLB 1PLAA 4Y4KA 4YH6A 4K5NA 3WKMH 2OR8A 1UURA 2GJ6D 3U6RB 2PP9A 4CU8A 1KXVC 2DL2A 2I9TB 1AMXA 2O26U 3VI4E 4S1RH 5FF6A 5ICZA 2F61A 5ESQA 2HRPH 4R7DA 3IJSA 1SHXA 2QMKA 3H56A 4JG1L 5F7LB 4N5UA 3HI1B 2XQ0A 4PJXE 3VXTB 4E42A 2EKSA 1H15A 3QI9C 3QFJB 5AOIA 3PXLA 5IBTL 2PWDA 1D2PA 1IEAB 1T2QH 4TVUA 2YIHA 1NA8A 1BOGA 3TFBA 2X6AA 4U7SA 4B9IA 4KXBA 5MP6H 4OCSH 4XBGB 3QNYA 1URIA 2UXTA 5IBTH 4WQOA 5SWZA 1WLHA 4FMVA 3T6QC 3L4ZA 4FNQA 5IW1A 2XPZA 1T20A 3QUXC 1A1NB 1AZRA 3PUCA 2AK4E 2BZ7A 3BESR 4Q9CA 5T3XL 3WKYA 1R3IH 1BMZA 2WKOF 4HKBB 4JDVB 5B1JA 1I8LC 3L1GA 4I18C 5F0LB 2G9KA 3FFCB 4M43H 1XGPB 2WXNA 4CDGC 4E0RA 4OGAD 3C2SA 3FO0H 1A1MB 2WAHA 3V5DB 2DQDL 1FO0H 4XTRC 3TN0A 3ETTA 4I0PB 1DE4B 4HDIB 1IU1A 1UD2A 4DN4L 2ERJB 2AK4D 4D0DB 4MJ6B 1F0LA 3F6JA 2P80A 4WTZG 2GQHA 2WXOA 5I73C 4K9JA 4ALAL 1YECL 3L3KA 3MXVL 2CKNA 4PBXA 3AREA 2JB6A 2EXWC 1RZ7L 3D25A 5A3ID 2HLAB 4DN4H 2R69L 4GKZA 3MQIA 4G43B 3WAJA 3L3GB 5I0YA 4GXFA 5GJSL 3EJTA 3GSRA 3NSCA 4A2LA 2EILB 4PGCB 4YDIL 3SQOH 1RZ7H 5C7ZA 4OKDA 4FXKB 1A3QA 3S34L 4PRPB 5HGBB 1PQZB 4XNUL 1OGSA 1TCMA 2Q3AA 3NSXA 4JRXA 2ENJA 3KLKA 4L37A 4M4PA 5F9DC 4JW3A 1LP9B 5GJSH 1GY2A 3MRGB 3N1PC 43C9B 4KZDH 4YDIH 2RALA 1AP2A 3UC2A 3HVNA 5FUCC 2VLLA 5I1IL 3KJ6H 1OTUD 4LOFA 3CVDA 1XIWC 3I74A 4LL4A 3T6ZA 1DUYB 3HE6B 1S9KC 3NCJH 4XNUH 4AZ8A 2WUCL 3H0TA 4BQ6A 3FQUB 3MUHL 4XAWH 3KYOB 2CO3A 5E6RB 2WBXA 4RCAA 1S7WB 2NXYD 3CVBA 4QO1A 3RTQD 5JQ6L 1NMAL 1MFCH 2WQUA 4S11A 2HT3D 3OJDA 5MEOB 5E5LA 1W72B 3MV7B 1MFEL 4HU8A 5IMLB 3K2MC 2ZUVA 3V6OA 3P3RA 3QPKA 4APXB 1WRFA 3WIHL 2ZAIA 5EU3A 4QRSB 1F4WH 5AL8A 5IREA 3FUNA 1MFEH 2EDHA 4YC2B 1JRHI 4QRQB 3UMNA 1C08B 4F7MB 2PCFB 2ZWKA 1UWEL 2LTQC 4FTVA 3ULUL 1S9WA 3VE0B 2XLLA 3MR9B 3UAAA 3O3UN 4LSVL 1T0MA 3WOVA 2QGBA 4C54A 5L7XH 1E9OB 2QQLH 2V37A 2IMNA 3GTTA 3P4LA 3FU0A 3FOMB 1JF5A 1PNCA 5TDPA 2FT6A 4G70B 4X6DF 5F71A 1HNFA 4CGTA 2NXZD 3N41B 5C0ND 3SY0B 3VAEA 3E1ZA 1LWHA 5CEZH 5F7EL 2LT9A 3NFPA 4UI2A 4AIXA 3IDGB 4ELKB 3VSQA 4HCGA 3FQ4A 3LKPB 3O41B 2NR6D 2AEPL 4YGVB 1OSEA 2NMSA 5DC4B 1UZ6E 2BVQB 1A9BA 1EV2E 4P9ML 2LHAA 2R2BB 3BP4B 2JKSA 3IVKB 1F3DH 7PAZA 1ZGLA 1NWOA 1D5ZA 3PWJA 3QEGH 4CMMA 4GRWE 4LIQH 1U30A 3ZYZA 1NBZA 3QXDB 3VD5A 1AZUA 3HZYB 4FQQB 4QJ5B 5KJ4A 2R29H 2B59B 5E5MB 4GQ9H 5HJ3B 4GO8A 1ZSDB 4ES9A 5E1AB 5H2BB 5D7HA 3K6OA 4KO5A 3CFJA 1F56A 1NEUA 4K5LA 4HG4J 4JDZB 3GGWB 4QOKA 1IL1A 3NSFA 1RURL 5AKSA 5AYQA 3GIVA 3H2QA 4W6XB 1FL5B 4Q0XL 1OAUL 5B38A 3UBFA 4KKBD 3R7RA 4M62L 4PJ9B 5CJ8A 1S9VA 8FABA 4G9FA 15C8L 3RL1B 1Z3GL 1EANA 4Y2DB 3C08L 2FGWL 5C3LD 1WISA 2NNFA 3DSFH 4M62H 5E8EA 1FVEB 2BIQA 2BS9A 4KJPD 4FQIL 2EEAA 2XY2A 3N04A 15C8H 1HL8A 2OTWA 4Y1AB 5IVZB 1Z3GH 2GTZB 3H8NA 1K2DA 4GSUA 5KYYB 3B7SA 1SFDA 5DJ6B 1RPKA 3SSGA 4JHVA 1Q9KB 1SDDB 4FQIH 3T0EE 3BUTA 1NBQA 2GJRA 4QY8B 1G0XA 4PVBA 3V6BR 1C1EL 1WIPA 2I60L 4YDKH 3K72A 3CN1A 2KS0A 2R0LH 1BSIA 2XN9E 1UFUA 3FQTA 1FZJB 3Q0HA 1YUHB 4HCRA 4NN6C 4YHZH 5ERWA 4A63A 3VYNA 3VJ6B 2C7FA 3FAWA 5K9KA 1C1EH 1VFAB 1CGSL 1U8JB 2I60H 1IO4C 1I82A 4IEFA 4KKRA 3T0ED 4UMSA 3KW7A 4NUJB 1O9VA 3CG8A 3JYBA 3KPOB 4FQHA 4UOW1 3QSKB 1LO4L 1C7SA 1WC7B 1ZIAA 2XI9A 4NXSA 4MMZA 3R0MA 1BBDH 1E9QA 3KPPA 1IAOB 1RZPA 4U6XB 4OCWL 1NANH 1BBJA 3G5XA 3GFUA 2O5ZH 2HPTA 4KPHL 2QV4A 4WHCA 3UERA 1E67A 1LO4H 1U58A 4LHUG 4FQ2L 4OSUH 2BMKA 1E4XL 4NB7A 2WKLA 3MLRH 4JY6B 1B0WA 2QHRL 3UAFA 3VXNB 5F21B 3OLDA 1JV2A 4OCWH 3HPLA 4O5LL 1TZAA 1BZ7A 3NJJA 4JE4B 4JFQB 3U7YH 1U8OA 4XHJC 5J11B 4FQ2H 4YSTA 1TO4A 1BREA 4PJHA 4PB0L 2GK0B 4H8WC 3ULAB 5I1KH 1YMME 1GRWA 2WXRA 5H94B 4YN3A 1S7SB 4R7XA 2FEDC 2QLVB 2UZXB 3GYRA 5IBLC 1YDPA 1P2CB 3UBXG 3MOQA 3HC4H 3HG1A 3EKCA 2M1KA 4XVJH 1B88A 3ARBB 3MRRB 3EYOB 4P3WA 3QJFA 4WHTA 2X6BA 2VDKB 2W0LA 4LVNC 5GZND 2MPAL 1EFXB 4AGQA 1IEBA 2X89D 1YMMD 1HQRA 4HGWA 2VDMB 4JHZA 1AY1L 4N0RA 3B6SB 3EFFB 4M8QA 5HYFA 1CFQA 5C0CA 3W39B 1PLBA 5D7LB 5D5ME 1RZIA 2C1PB 3HI5L 5CN2A 4YO0B 1Y18B 1ZTXE 1E4KC 3OQ3B 2H7WA 1AY1H 1JNNH 1K8IA 2J7LA 3B83A 3STBA 3L5IA 2J55A 3PAZA 1ZLVK 2WLIB 5BUPA 1VHPA 1AFVH 3HI6L 1CFNB 4AX3A 1C12A 4AIZB 4AYEC 1XCQA 3LZRA 1BYOA 3T4YB 5GIRB 3TIEA 1W0WA 3NFNA 3IPFA 1IM9B 3BCDA 1S3RA 3TVMA 2XU9A 3WY1A 3APFA 2VZ3A 2DQMA 5D7SL 4AGPA 5A2CA 4ZX4A 3O6KH 2IBZY 1NGXB 3IF1B 4PIBA 2D9CA 4NAMA 4OFQA 1T5KA 3CCHA 4JGJA 4KMLB 1Y6KR 2X4UB 4U49A 1A7PL 5D7SH 4LLVA 1J88A 2DZEA 1TKWB 3GZQA 1VGKB 5GRYA 2FIRT 2HVBA 2R27A 1BGXL 5DJCB 4R4ND 1JPGA 1MCPH 2A3TA 1A7PH 5K9QI 5BQ7A 1CDIA 4PJ8D 4CMHB 2XN1A 3QDHA 1YY9C 2XVGA 4FQXB 5C92A 5LUMA 3EBIA 3D50A 3WO3B 1WV7T 4GI6A 5CD3A 4YHML 2XPGA 3SDAA 3B9KA 3C6LB 2DQFA 1MCJA 1LLAA 5EA0L 5T5NG 4KXAA 4B7LA 4XMZA 4M61A 4YHMH 3KDMB 2FX8H 4IKIA 5ELIA 1CDJA 3DURA 2BNQB 4PWKA 1GVIA 2VM4A 3QDGE 5IG7B 4H1LH 5TK4A 4I3RL 3G6JF 4MQXC 2GUYA 5IVXA 1MCKA 5E94B 3PABB 1G6RB 4UOW0 5IJVA 1KFAH 3HKFA 5E1QA 4Z3EA 3NP4A 4IS6B 3DSNB 2K3HA 4FL4B 3LXBA 4AQOA 2HMID 1PIFA 3T04D 3WJJA 3CZLA 2GY7B 2IWKA 1J8HA 3TOPA 3AMKA 2VLJA 3QDGD 4PBDA 4HWNA 1UB6B 4FYQA 1ZE3C 4R90L 1ACZA 2FX9L 1UJ3B 4KUCD 1A5FL 3MSPA 5HGDA 2O61B 1QPXA 2A6JB 4OLVH 3SDXA 4NKMB 5B39A 4DGYL 2XX1A 4FG0A 1EXUB 2C8NA 1FPTL 1L9QA 2LAAA 2FX9H 2BVPA 1A5FH 1ASQA 3A0OA 3CFDB 4JFPB 3T5WA 2V5RA 5FO9B 3CJJA 4I9WE 3KR3L 1WS7A 1IZKA 1BM3H 4DGYH 3RZCB 4F9LC 1OGAA 1DTUA 3CVIL 1OTTC 3M7FB 4YDLB 3I9AA 2PR9A 2MOGA 4KXCA 3QQ4B 4GP8B 4BBWA 1A6VL 3KR3H 2CCVA 2VMCA 5I8OL 1UATA 2XZQL 3QJHB 4XX1E 1P5UB 3BW9B 2G2RB 3VU1A 1T80A 2P45B 3JV4A 4I9WD 4OZFH 4KXDA 1M7DB 4X4MA 1DQTA 4QDGA 3ZO0A 3NN8B 1CFTA 2YLKA 5EOTA 4DPRA 5HHNA 2PO6A 3QIBC 1T66C 3O8XA 2V0AA 3Q5TA 4H8QA 1E9PA 2XZQH 3CMOH 3Q6FA 5IHUL 5EIQA 2X6CA 1ZAGA 3L1FA 1VFBA 3CHPA 4QKTA 1PYWB 5GS0D 3ATEA 1X5MA 2NY4B 3BP7A 2ADGA 4MQTB 3VXRD 5A43C 3ES6B 5IHUH 2KLRA 4LLYA 3K80A 2Z31B 3O3EB 1A0QH 1Q9WA 1WCBB 5HI3D 3NBNA 3TJHC 2VXQA 3M46A 2YEQA 2F5AL 3Q48A 4TQ8A 4TTGA 2IDSA 2KUTA 5HD8D 2Z64C 3T65A 1BA9A 3DXAA 2YEVB 2FJFB 3GMLB 4N0CD 2R4RL 4YQXL 5E4IA 4EDXA 1UKQA 2XICA 2Z3FA 3D3VE 4H13C 1SBBA 2GSMB 1WPCA 3BGMA 3ZBMA 2ALWA 1I7RB 3QRFM 4QHLA 5EIIB 1SGKA 3K7UA 3MNVB 4FLOA 4FNLL 1NANI 5EU5B 2R4RH 1SM3L 1SEBA 3WCYA 5IVNA 4RETB 1WHOA 4FRWA 3BKYL 1YEDB 3E1F1 3QZWB 2CO6B 4GINA 1BFVL 5IESH 4FNLH 4P4RB 4L8CB 3D3VD 3KCWA 1SM3H 5J6HB 4NSKB 2GAZA 5CIPH 1E4XI 4GRMB 4DGIL 2CO7B 3T2OA 1YZZA 4KK5C 4UNUA 1BFVH 4K15A 4JFFE 1KWGA 3CK0H 3I2CH 4OQTL 5DA0B 3VFUB 2XWTB 1EEZB 3EADA 2EUZA 2Y36H 4ADGA 5AZ2L 2DLGA 5ANMB 1JE6A 1YN6A 5EU7C 4TM9A 2ADFH 3SBPA 3MLYL 3FO9B 4ZPTB 4OQTH 3K6IA 5ACMA 3L4TA 2EAEA 4JM2C 1AXSB 3ZX1A 1RHFA 4JCLA 5AZ2H 3PGFH 4ZMYA 5DD0H 4D0CA 1GHFL 1K3IA 1MLCA 3F01A 3MLYH 5HHXL 3CWGA 4FERA 2UXFA 3HNVL 5FYJE 4Q97A 1U3HA 3CBJB 5D4IA 4G9DA 1LE9A 4ZXBC 1NGZA 2ZKHH 3FO2B 2RMNA 4R5VA 1FRGH 3KWWB 1GHFH 4UM9D 3LEVL 5HHXH 4JPKL 2EDOA 5C2BL 3BEWA 2LV4A 3HE7C 1E2WA 2ORBL 1JN6A 3HNVH 3MFFB 1J86A 1EBAA 2FIKA 1MHEA 2R9HC 4RMVA 5IZ7A 1DJHA 1PZ2A 1QX1A 2ZCLH 3GF8A 3TJEL 3NZUA 3THMH 4B96A 4XPHH 2P26A 5FYJD 1U91B 2JVUA 4JPKH 2J1XA 3BAJA 5EOCJ 3FTWA 2R8SL 1S7RA 2ORBH 5IBUB 1IAIH 2YD8A 5EF0A 2YXVA 3QJTB 2ZCZA 5HVGB 4RSYA 2JIXA 3RVVC 2F54A 5INCA 5BMFL 1YPZB 3KH3A 4CW1A 3WN5C 4PR5A 5JO5A 3VD1A 1DO5A 43CAA 4WHYH 3INUL 3RY5A 1SHWA 5HHVH 2XTJE 2B5IC 5IF0A 3OKNB 4X7CC 3HJ0A 3DO7B 3TA3C 4XN5A 1DEDA 4X5XB 4XWGL 1XR9A 2MTPA 1KGCE 3KVQA 4L1SA 3V9FA 4B6ZA 4JG0L 4XNAA 5J6GB 1A66A 4LEOB 1JWMB 3BAYA 1YEGH 1H5BA 2WINB 1QBML 3RAJL 4XWGH 4UT9A 3PNWB 1JUFA 5GGTA 5I66A 2XTJD 3UJTH 5LGJA 4WV1B 4PG2C 5H8DA 2P8PB 1J5OH 4JFEE 4PJFA 5SWSB 1I7UB 1ZVYA 5DEGA 2EDMA 1EAOA 5T3ZH 1KGCD 3VWJC 4XI5C 3PAYA 3IS1X 2ZCKL 2FHFA 3ILPB 4KNTA 4G8GA 3KWTA 3ZE1F 4RISH 4YBQC 3HFML 3HLAA 2Y2YA 1R5IA 3BZEB 1ML0A 3AW5A 2ZCKH 4F92B 1AOHA 1U2HA 3Q43A 1BM7A 3QNFA 1PKQA 3KPSA 4JFED 3HHSA 3KS0H 2XN9B 1Q4NX 5A2IH 5IEKA 4J6RH 3G04B 3OB8A 4Z7VE 1F1AA 3MV8A 5E99L 3W5NA 4E9QA 1UASA 1NC4B 2P7TA 2VH5L 4HIHB 3BAEH 4V1DB 4PRNA 1HHIA 4NQEB 3MREB 5DJ2A 4JDEB 4HCFA 3M17B 5LJYH 2ZP0T 4CC4A 1CE6A 4F7EB 3WFBH 3V4VA 4GBXB 4KDVA 3PHAA 4NUPA 1TU2A 1ZV9A 3OAUL 4HGMA 5FGBC 3NEXA 3S5YA 5I15L 2VQ1B 1Q0YL 4BFEA 3WIFA 4XNMA 2ZP9A 2UYLB 1ZLUK 1VPOL 1L3NA 4R3SA 2WKOA 3NPZB 4QRRA 5KWYC 3RNKB 3HS0C 4DP7X 5A2JH 2PWEA 3V0AC 1Q0YH 2WGNB 4C4KO 1UFGA 3NH7L 2KPWA 2RCSL 5I26A 4HPHA 5E08L 4NP9A 2VDQL 5GGSB 1R3HB 2UY6A 2ZSVA 4IRZL 1X4YA 1FNFA 1DLFL 2RTTA 3RWDA 4YIQA 4RFOH 3O9WA 5AEAA 3KGRA 3NH7H 3O4LE 5EBMB 4NT6A 1YEKH 4A6YB 5E08H 1D3CA 5JA9A 3KNBA 3OVUB 3GRWL 4YGAB 3CFIC 4IRZH 3QC5X 5I30L 4WFHE 1OARL 5C0RL 1G9ML 2ZXCA 3FQRB 5FA3B 1R24A 4M7ZB 1F6LL 3I75B 4NQXB 2DYSB 3DYPA 4YSRA 4IW4C 4OI8A 3RJDA 3GRWH 5I30H 1N70A 2EICA 4PJIF 1YQVH 4X98B 2AEWA 3O4LD 1T3FB 4KAQL 3X3GL 1XSIA 3O3DB 1WDAA 3RP1A 4XGZA 4KK9C 4U3HA 3BOVA 3BUYB 3GJFA 1QRNE 1UOLA 3ZTNL 2AXWA 5EORL 1S9YA 3S96B 2KI6A 1F58L 4NN7C 2HTLC 1D5XB 2YWYA 1MCEA 3MCLH 5I23A 4MXWL 1IKNC 2WNXA 3LZQA 3BRDA 4Z9KB 4R9HA 1LEIA 1IIIA 2BVOB 2G2NA 1MQ8A 3MRNA 3SE3C 3B2UC 4L3EA 3GBDA 4LCUB 4M7LL 3GPEA 1ORSA 1QRND 3KE0A 4MXWH 2G9HB 2WZ6A 4P2RD 2X1OA 1OW0C 4XXDB 1AR1B 2XWEA 3P73A 3CXHK 2F7IA 4GKOA 1MCFA 3DTDA 4M7LH 3D9AL 5C0AB 1OVZA 4WW1A 3PWUA 3U46B 3OQRA 2ZUQB 2JI3A 4X4YA 5K9OB 3L2NA 1I7ZA 2D7QA 5F9JB 1MH5A 2PW1B 3QYCA 5DRWB 4POYA 2W9DL 1C5DA 2G0KA 2J73A 4CVZA 3BO8A 4L1DA 1ZRUA 5K69A 3DVGB 1NFDB 1NCDL 2L0DA 2RHEA 5JQIB 4X6DA 3IFLH 6TAAA 1BZOA 1CXHA 4OZHB 2FZ3A 3ENEA 4DVBA 1SXCA 3ZTDC 1G7QA 2BIOA 4Y4FA 5CGTA 3C60B 1A65A 1XTLA 3KWUA 3V8CA 5I0ZA 1JHKH 2W9LA 5EZLA 5JHDA 3VSVA 3PGDA 2IDFA 3AWEA 5D1QE 5KVDL 3LKNA 3RPIB 5ITFB 3MOAH 5DVKA 4PYHA 1KIRA 2AGJH 4WNQB 1D5MB 4H20H 2PPAA 3ZUNC 2B9BA 1KXVA 2EDLA 4G6MH 4GG8A 3FTZA 4OCRL 3L16A 2ROXA 1BD2B 2DEWX 4KRPC 1NDTA 3VFPA 5T1KD 2ZONA 3E8VA 1O9WA 4KJWC 3QI9A 1DUZA 2XNAB 4EN3A 1GAFL 1RUKL 3C9NA 4YSPA 2PYEA 1TUPA 5D1QD 2N1KA 5JIPA 5DR5L 4AKQA 4HZLB 1IBHA 3GINA 3C5JB 4QF1B 5LGYA 1HEZB 5GQBA 1XGUA 4ZX3A 2VXTH 4TUKL 4FG6D 3QUMB 3KGTA 4L4VB 4M1DH 1THAA 1FQ9C 4PRIE 2K6YA 5AKRA 5AVQB 4APQA 5C86A 3QUXA 1AZNA 2EIJB 2PXYC 3MDJA 4I13B 2AMGA 3MV9A 4TUKH 1R17A 3OAYK 1U3JA 2CIIA 3MJ9A 4HW6A 2VR4A 4GRLC 1I8LA 4KKAD 3ATBA 3EO0A 1Q9LB 4WFFE 4BKLB 4YL4A 5J1AB 2QSVA 2EC9T 3OLIA 2NYZA 3CZEA 4KRNA 1BEYH 1WSST 5AZUA 2ZOOA 3FU9A 3JZ7A 4IHOB 1II4E 3FTGA 4R5TA 4LAQH 5T3XE 4HH9A 5FM5M 4UT9L 1UT2A 5GGTL 3KPRE 2VLKB 1GKEA 4RMRA 1JBJA 4K23L 1R3LB 4OFKA 5EN2A 3KLHD 3FCTB 4WFFD 2VL5A 3PV6B 1PKOA 4MJIB 5DRNB 4GAYA 2HVKB 3FB5B 4NPYB 5GGTH 1HILB 1OLLA 2FVNA 3FB7B 1I53A 4K23H 4G7SB 3EDEA 5IKCA 3S5LA 2CJSA 3EFOB 1CGYA 1XR8B 3TC9A 3KPRD 4BA8A 1ZDQA 3IAQA 2NZ1A 5I28A 1P7HL 1UXWB 4I1PA 1DLHA 1XIWA 4QUOA 1FJ1B 3QC6X 4HUUB 5DQJB 4IQHA 3DX0A 1NWPA 1AKJA 4NNYA 5DUJA 5IMKB 4N5EC 5I75B 1KCRL 5AUMA 2HZHA 4MZRA 2G3MA 4Z5RB 4QRPA 3V4VL 3DUUA 5CR8A 2B2XL 3FU5A 3LNEA 2H2PD 2WXMA 3FQYA 4QTFA 1NIBA 3MLSL 3AS0A 2G3ZA 1TNNA 1BF2A 5KOVC 3K8KA 1NDMB 3S35L 1A9EA 2N0MA 3CLEL 2B2XH 5FYJU 3MLSH 1ADQH 2V9RA 4P57A 4ZQKA 2HRLA 4X5PA 4E9LA 4KMTL 3MAWA 2IOIA 1LQBC 3RDJA 1MCCA 3QUYB 4LCIL 4FP8L 4Z76B 4BKTC 2AXHA 4NAJA 3CLEH 1CT8B 3GXUB 2GT9A 2APSA 3GMOB 1TQVA 3MJ6A 3OWEA 4LQ1A 4JFFB 1YMHA 1TCRB 3FF7A 4LCIH 3ULUE 4FP8H 4UCFA 25C8L 1L9OA 4FNSA 1KLGB 4Q52A 2A4ZA 5F3HA 4J2QA 5J13B 2L7UA 1CDGA 3AVEA 5I1CH 4A7UA 4ODUA 1F8TH 1L9SA 4I0PC 4NQCA 4HZAA 4ODWB 5I19L 5EO1A 1NEZG 1OSZB 1S3KH 1SFHA 2ERJC 4ONGL 4YDNA 25C8H 4XN4A 5AVTB 5AWNL 4F20A 1OM3L 4K8RC 2VWEE 3QZOA 1ZHBA 4PEEA 1M3JA 2BHYA 3IJEB 1UYWL 3D39D 4HWZB 2WQ8A 4UWQB 1H9VA 4XVSL 3VXMB 4NDMB 3AS1A 1O7DE 4ERSL 5TE7L 4OT1L 2AQPA 3ZR5A 1OB0A 4DP0X 1HZHH 3S2AA 3QXTA 4PWEA 1G9EA 5JXAL 2JCCF 2MOQA 4UMGA 3RWCB 1UYWH 3OZKA 5TH2A 2VN5A 4HJGA 2WCPA 1KIPB 1MNUH 4ERSH 1OK0A 4FXKC 4U1MA 3H9HB 2ENPA 3BP6B 1SXAA 1BX2B 1VF5C 1UG9A 2J8UB 4GP4B 1OTSD 3D2UD 4N2KA 3F7KA 4PVMA 2E4TA 5JXAH 1KLFB 1IFHH 1QG3A 1N2RB 4OFVA 4B95C 2R0WL 3TIDA 2GBVA 4K3DH 4P04A 1SJVA 3GBML 4K73A 3MO1B 3HE6C 1WWWX 1M1XA 4GKNA 5FKAB 4AMWA 5AALA 4HPOH 4RNRA 1VKXA 3JYCA 2Q20A 4AJVA 3DBSA 5FYJH 2C26A 3GBMH 1QFHA 4UUJB 2J72A 4P59L 5KBKA 2XQYA 4H8VA 5JOFB 1M3IA 1QW9A 3KL5A 5JXEA 1UJTA 1J05A 4LXFA 4WK0B 5AB2A 5H37H 4JZOA 2F53A 1CD8A 1ET7A 4LASH 1YY8B 3APDA 1Q90A 1OAXL 4HUXA 4BH8B 4CDHA 3A67L 2NX5E 1TJHH 4YC2C 4PMFA 2K8MA 2DQUL 2H1XA 3ALWA 1AQKH 1PSKH 4OBSA 2UVEA 3NIDF 4ANVA 1OAXH 2CDEA 3B3IB 3D08A 1KELH 1Z3RA 2Q76B 2ED9A 1KJVA 2XN2A 2OMBA 1JMXA 3G6JA 3ZHFA 2DLFL 2F1AA 3O45A 2YBRA 4O02B 4AT6B 3IGUA 2FO1A 1F18A 1R47A 2CUMA 3PUUA 1NIDA 2X1WL 3UTSB 3EJYD 5C3IA 2XJKA 3T1FB 2WLJA 2CHDA 4LHJB 3MOBH 4LOEA 5J06A 1IGIH 1U93A 3RVUC 1TJMA 1AQHA 5JW5A 2NZ9D 3V5HA 4KOBA 4Y9EA 3Q8EA 4JS7A 3GMRB 4RWHA 5KYXA 1ZJAA 4Z7VB 4NRZA 1IBYA 2QFRA 1J11A 4GS7B 2VDOL 4I48B 3D4ZA 3DMMB 3SO3B 4JFOB 1EXHA 4WJ5A 1A1OB 3HPJB 4L4TE 5HGGS 1N12A 3T08A 3WELA 3CXHJ 1IGCL 4Y4KD 1PCXA 4LLDA 2WXKA 1KB5H 3IDNA 4G7YH 5C0IA 1CU4H 3KPQA 3MJ9L 3KYNB 2A77L 4J3OD 1KCSL 4XC1L 5AVUB 1VRSA 2Q6WB 2JQMA 1IGCH 1B2WH 2XVLA 3MRMA 4L4TD 5E8NB 1P1VA 1GS8A 5E00B 2NY0D 3QPQC 2Z7UA 4XPBL 4HJSA 4JFXB 1OB1B 1IIKA 1GCFA 3CBRA 5FOBB 1EGJA 4LLUA 4GKSB 4LBEB 4M1CC 1WBYB 2FLBT 4LLQA 1O7SA 4OZIB 3IDUA 5LCVH 3ZTJH 4PJ9C 1BPVA 5KSVB 5HYIA 3GUFA 4F2FA 4LNRA 3V6FB 3B56A 3ARFB 2E9IA 4ILDA 1TENA 3FONB 5EG6C 4Y2DC 1DFXA 1FZMA 3OAWA 4QJ3B 2DWSA 5T1MB 2V6HA 4YDMA 1E4KA 1J7VR 3RA7L 1HSAA 4ES8A 2YFOA 2R7EA 1ID2A 2RFXA 3QVAA 5LBVA 2B4CL 4MWFA 4NJ9H 3TN0D 3CFTA 1N3NA 4DKEL 3MV01 5J57B 1J0HA 1XF3A 4F33A 4L3AA 3WIIL 2HUEA 3I84A 3GMMB 1NM4A 4JL1A 4NHCH 2B4CH 1ZA6A 4JRXE 3WSQL 3O2DA 1AGEB 1T21B 1YYLH 2DWYA 4DKEH 3LQZB 1IAMA 5E1GA 2OMVB 1NOAA 2P28B 3HG2A 2A1WL 3L5WB 4G2AA 1LP9F 2GITA 4BH7B 1KJ3L 3WIIH 2H4EA 2ICWJ 5AW5B 1P7QA 2XKUA 3NCBB 4P5TD 4AENB 3NJFA 4F2MA 3WSQH 2FQDA 3SD2A 4BRVA 4L1TA 1Z9SA 5HY9A 2A1WH 1HT6A 3PP3K 1DANT 5IW6A 2XHNA 3HRPA 1KJ3H 2JCWA 2W80C 3DX7A 4JRXD 4KDWA 2YPLB 2YUVA 3EBAA 3MLWH 4M5ZL 3EH4B 4P2YA 2YMXH 1NMCB 1AXIB 2Z35A 3F8UB 2ATKA 1WZLA 4KVNL 1C7TA 3GI8L 3BVDB 3BE1L 3V6OE 1N6QL 2APWA 4ODSH 3GMNB 3POHA 2H3XC 3GM0A 4Z7WA 3SN6N 3QG7H 4O51A 1DVFD 2NY2C 1TYEB 2F68X 4DP1X 4YXKL 1G7MA 2WO3B 4MD4A 3MA9L 4E5XG 3B5HA 4G1EA 1N6QH 1DDHB 4I0KA 2X87A 5J11C 1GZPB 2A83B 4FTVE 1EAPA 5ETUA 1DQMH 3GPSA 2J5LB 2HT2D 2UX7A 3FSWA 3QZMA 3F7RA 3KPNA 1AZCA 2HX7A 3ZZ1A 1DZBA 4AKOA 4ODTL 4HS6A 2ZCHL 3S4SB 1T6BX 1GS6X 2FJHB 1UT1A 1DL7H 4YLBA 5LBGA 1O6SB 2CHXA 4PRHA 3ARBC 4DH2A 3A6CL 5ABAA 3T2PA 5MENB 4FTVD 1NGWB 1QYGL 2BSEA 3DRTB 1WGOA 4FI8A 4TXVB 3Q7JA 4NM8L 2ZCHH 4ODTH 3WNIA 5CJ5A 1BZ8A 3X13A 2VDLL 1SN2A 1GJIA 3N41F 3A6CH 5AOZA 2A74B 1CI5A 2WN2A 4ZS7L 1HAUA 3EUUA 3ABMB 5FKPB 1A2YA 4GPVA 1BLIA 1CFMA 2VDLH 3UEQA 1GGTA 2VUYA 1BFSA 5TGBB 4PJ7B 1AZBA 1MAMH 2IALB 4N0YL 1BQRA 4PJAF 2WLZA 5GRJH 3U36A 2UWEB 2EUVA 2NY6B 3WU1A 3IDIA 3QAZB 4P46D 4N8VA 4PRIB 2YMOA 1CLVA 1QSVA 4A1RA 4UM8A 1A7QL 1BPLB 1HINH 1WA2X 4F9LA 3MPCA 3GNMH 3UBHA 2CBMA 3BFQG 5IQNA 3WTSA 1D5BB 1RY7B 3FRPA 5DWUH 5FHAH 4DZBA 4Y5YB 3ULVC 4OD3L 3LRGA 4QOKE 4RAUA 3KBFA 4AJWA 1F1GA 4ONFH 4Q4EA 2AFNA 3HNSL 4AIOA 2D3LA 2VR8A 5FB8B 5EEYA 3HJEA 4B0MB 2I5YL 2D3NA 1IJNA 1PFOA 1WZMA 3E8UL 3NTCL 4N9GB 1X5LA 4L1HA 1AMYA 5B3JE 1T1WA 3CN3A 3H9SA 3T0DA 4DO6A 1KPVB 1DSYA 4QOKD 4AXWB 4YDVA 4BK5C 2I5YH 1WCQA 5HHQB 3NTCH 4NZRL 4Z18A 3GSVA 1ZT7B 2H3NA 4RZKA 4CMHC 3KW8A 4FQXC 1RERA 2WZAA 2XC8A 4FADA 3G6AA 4F8OA 5E24E 1VADA 3BAIA 3TBSB 3PFUA 3BJLA 3QFGA 4KKLC 2YMTA 3C6LC 3QA3A 1RK0A 1HOCA 1BZDA 3SB3A 4NNXA 2EYRA 5DEFB 3OSKA 1AHWB 1CYWA 4JO1L 3EGXA 3DGGA 2IF7A 1U95A 2D7MA 3BMVA 4HJ1A 5JNYB 3OC5A 2IO5A 2VCOA 5AAPA 1BJ8A 2VSMB 1LO5A 3RWIB 1N8ZB 3P4OB 3X14A 1U8KA 4FL4C 5HDRA 3R18A 5SX4I 3IGFA 2P5WA 5EU4A 5FO2A 3OKOB 2EZ0D 4G82A 2CBTA 5HGHA 2BP0A 1F11B 2XIDA 1CF8L 4KDTC 2ZIDA 2JLLA 2XXCB 4OQ1A 2A38A 3EG9A 1T04B 1CFSA 1UJ3C 2WTRB 1X5JA 3MKGA 3O2VL 3S88H 5ADPH 4YS4A 5KJRH 5E7FA 1LO0L 4EBQH 3BPCB 3V0VB 1MCLA 4H8WL 4BHUA 3GO1H 1CF8H 2YOCA 3AADB 1H6UA 2WV3A 3P9MB 3WUZA 4PRAB 4J5VA 1AI1H 3O2VH 4TS6A 1LO0H 3QDAA 4PGBA 2CNZA 2BCKB 3UH8A 4ABUA 1EGJL 2HJFA 1U33A 3NCCB 1Q0EA 3RZCC 4PJHE 1OCWL 4I2XA 4GIOA 4OM0L 2ZQKA 3C5XA 4MS8C 4YDLC 4J4PC 1XH0A 4PWHA 1XCXA 4E41A 3ARQA 3LY6A 1EGJH 4GSQA 4IDJH 3HG1E 2CSPA 1OF0A 4P2OB 3GB7A 4Z7OE 1P5UC 3JWNE 1JWSB 4OM0H 4PY8I 2BSTB 4PJIA 1T03L 4NHUB 4ZXBA 2NUPB 1I3UA 4UINH 3BWAA 1RFDL 1U8QA 1MI5B 2GTWA 4QRUB 4FFTA 2WVSA 1ETB1 1HC1A 1T22B 2MNJB 3I6KA 4NFBA 4WO4B 1HOEA 4GNKB 3APMA 1WJ3A 3GSNL 2TSAA 5C0CE 2AV7A 3HG1D 3RX7A 2NY4C 1RFDH 1KIQB 2CK0L 1RLBA 3DPBB 4HFWB 5HSFA 2YGQA 1E3FA 2FEJA 2L4OA 2YPKB 2BP5M 2R2EB 2Z31C 2W0PA 1S46A 3QEQB 2AJXL 3NOIA 3O2DL 3GSNH 2YAMA 3REWB 4HS8L 3WEMA 3LJ3A 1P5VA 2VSDA 1LEKA 2EYTA 1J5CA 1UZ8B 4N2GA 3WN5A 5EB9A 3RTQC 2P52A 5C0CD 3C5ZB 1MLBA 2V9TA 3QHZH 3K5SA 1S7QA 2AJXH 3QK0A 2VRKA 4L3CA 3ZTEA 2I85A 3AM8C 3PWPA 4JM4L 4HS8H 4GQQA 3FT3A 2AXFB 3IGLA 1FZKB 1YEHL 1OANA 5FK9A 2WP3O 3WHE0 3BKML 4WU5B 4XMLH 3RBGA 2BIMA 4UTBL 4IGBB 4JM4H 1P7KB 5A2AA 3MUGB 5IM7B 1F5WA 1KCUL 4LSRL 4M3JA 3VD9A 2V7HB 3BZDA 3FU8A 3LPOA 4DW2H 3LH9A 4JFDB 1JVOA 3HC3L 3QJXA 4PG2A 4UTBH 3RVWD 3TVMD 5E6IB 4QPEA 2DQIL 1IC7L 3LPFA 2WQSA 4ODVL 1KCUH 4LSRH 4OVVA 4AM0B 5D8JL 1AQMA 1E6JL 2CDGA 4LVHB 1FN4A 1EEYA 3KBPA 1DQQA 4WU7A 2NX5B 4LQFL 4F15B 1HKFA 2ARJQ 1Q38A 2DQIH 1IC7H 1OPOA 5I1JL 5D8JH 4H25A 5I18L 2C9XA 3CQQA 4GKLA 3D85B 1GTNA 4XCCH 3GTVA 4AZUA 4LQFH 5TQ2H 1E27B 2E7DA 3BT0A 2VMFA 5BZZA 6CGTA 2QGCA 5EEXA 4XRCB 4FKKA 3K2UL 5I18H 5BVPH 2OTUB 4NOFA 3IJHB 3O6FA 3RGVD 2BINA 1KPUA 5IVXE 5C09A 3MXWL 5IFJB 2YR3A 4XP6H 3SDAD 1QNZH 3B9KD 4JB9L 3N5AA 5I5JA 3SBQA 2NY1D 3K2UH 4EIGB 5ACZA 2WD0A 5I71B 4GW1B 3US1A 5FGBA 2KZKA 3MXWH 1XF4B 2GBAA 1WFOA 1J8HE 2VLJE 2X28A 4AQ8A 4Z0XB 3T77A 4J8RB 2DWDB 2BP8B 4GH7B 4YSAA 5FM5O 4Y16A 4NX0A 3VFVB 5D2NA 1H15B 1B0IA 3ZE2E 3CSGA 3SDXE 2NLJB 3QIWB 1JG9A 32C2A 2G3NA 4N2IA 4YWGH 4B3VA 4C56A 1MRCH 1HQ4A 1J8HD 3RVTD 3L45A 2V2WA 2YD4A 3FB8A 5SWZB 2HA1A 3NIFE 4NZDA 3APNA 5IW1B 3BVTA 3QQNA 1F02I 1OGAE 5ID1B 2I07B 4HT1H 2ZUSA 4P9HL 2RJMA 3DUHA 1X9UA 2KKQA 4HXAH 3Q8FA 4ATTA 1EAJA 4KFMA 1CF1A 2OK0H 1SJHB 4KJYA 1HWHB 4N8CL 3NRQA 2DWTA 2Q7YA 1RZJC 5E5RB 5ADOL 5ICYB 1E5CA 3F00A 5IB4A 6FABL 4XN9A 4P9HH 5EO9B 4X4ME 1IRAY 1ZK5A 2NNAA 1OGAD 1EFQA 1I1YA 3CBKB 5DQDH 3O81A 4WV1C 3D8MA 3BKCL 4LF3B 1IC4L 1UA6H 3RKDC 3E0GA 1F2QA 3AREB 2JB6B 3D25B 2OMTA 3FQNB 1BJMA 3L17A 1IQDA 2ODIA 1NUDA 2WPGA 2VISB 3UGUA 1SBSL 1IKNA 3BKCH 4IOIA 2ENYA 1KJMA 1TFHA 3RL2B 2PO6D 1CTMA 2FQFA 1INEL 4B0MM 5EBLA 5FFOA 2G75B 5JDSA 2K45A 3O3BB 3RNQA 2ADJB 3SE3A 4GI9A 4EXKA 3IPEA 5D7JB 5F7BA 2CRYA 3WS3B 5L2KA 4FLHA 5DF0A 4EVNA 3DXAE 3NIGB 4OIIH 2FYYA 1OW0A 4ZSOA 3LQAC 1INEH 4EDWL 5IB2B 2A73A 3TNNA 3HAEG 2X4RA 3ZKNC 4D8PA 5I6KA 2ZWZA 5B4MC 1A7OL 3U4EB 4KI5F 3H0TB 4RZCA 3I02A 2F19H 3BQUA 4KHTL 4Y0GA 5DJDB 1SVCP 3HN5A 4GBXC 4U1SA 1I9RL 1GC1L 1JV5A 3DXAD 1A7OH 4M7LT 3OJDB 5KBMA 4KOCA 5DZNA 1FAKT 1SDAB 1GC1H 3TEUA 1UACL 2NNCA 3PHSA 1KEGL 5CO1A 1OP5H 2VN7A 4W9JC 4LSPH 3KGUA 1BIHA 1L5GA 1RUML 2ATPA 1PPIA 4EUPG 2DLTA 2PPDA 5DHDA 4PJ5B 4AUUA 4X6FA 2DBLL 2H1PL 3S3PA 1RUMH 3TONA 3K81A 5HHOD 5HHME 5CD5C 2E76C 5C0FA 1KOAA 2BC4A 2B9AA 3BRGC 3WGVB 4H2AA 3INOA 2JKRM 4FN0A 4JAMA 4DSYA 4RGNE 4H1LB 1DQLL 4G80B 5FYKL 5KVDE 1NIAA 2C3WA 2JCCA 3OR6B 4M7ZC 1RHHA 3KXFA 1NH6A 5C9JA 5GRUL 4IM8A 4LP8A 4Q2ZA 4L5FE 2DW5A 3FQWB 4A04A 1DQLH 3N1GC 4U3XA 5FYKH 3FUFA 5HHMD 4KROB 4JFWA 4RGND 5GRUH 1HSBB 2OMXA 5ESAB 2GCYA 1A9BB 2ICES 4IBVA 4CMMB 1N4XL 5DZOA 2LAGB 1U3HD 2X6UA 2HPOA 5D2LB 2BSSB 2DIJA 4KX8A 4X8JB 2DYPB 4JVWA 2V5TA 3EYQD 1MW1A 1FVCB 3GSWA 1HX0A 2W9EL 4JHWH 2F54E 3E9UA 1QQDA 1INDL 5DFWH 1SEQL 2Z34A 1U42A 3OMNB 1YPZF 2WWMD 3SO5A 1HHGB 1IC5L 2W07B 4MAUL 4X0KB 1Y1DA 5DFVD 1AR1C 1I8UA 1AO7B 3L7EA 2XG4A 4Y19B 4FHKA 5GS3A 5TQ0L 5L2JA 1YG9A 1TFPA 3GLAA 4TOYL 1G1YA 3BAWA 1NOLA 2JIXD 5AOJA 1E7VA 3T3PE 2F54D 4M6AA 3L1OL 4DEWA 4MAUH 2ZUQC 3MLVH 4OZFB 2GSGB 2HVJB 8FABB 2WLNA 4G9FB 3SKMA 1M7UA 2WK2A 4DN3H 3SPGA 1EEQA 2PYFB 2QPEB 3WNPA 3S8GB 3L1OH 3M45A 4UTCA 2P24A 3S36H 1VERA 4LP4A 4PJFE 1JHTA 2X2IA 5HYSB 2OTWB 2NQDA 4RFEA 1SUHA 4ORGB 1F3DJ 1FZOB 2IOOA 5H35A 4DVRH 4OJCA 3QRGL 4BFIA 1KYDA 4W9GC 2D03L 4G8GE 5F0PB 5KANG 3CAFA 5KBLA 2FNWA 1MCWW 3RDTD 1L7IH 3OHXB 3STLA 4WW2F 1A4BA 3UEZA 5I6OA 3QRGH 3U6RA 2FD6H 3K72B 1PKQE 3KPSE 2D03H 4XC3L 1DQJB 4U1HB 1NGPH 3CD4A 4JMXA 5CU9A 4KK8D 1GGIL 2LU4A 3MV8E 1HCYA 1E28B 1D5RA 3L5HA 3LIZA 2H6PA 1F45A 3BIKA 3PL6B 3QWRA 4G8GD 4I4WA 3HI1A 3AXLB 3MRCA 3DWTA 1EO5A 1A7NL 3QFJA 4XC3H 2YARA 3GS4A 4BFBD 3KPSD 2AVGA 4XBGA 3C8HA 4OCMC 5EUOB 4L9LB 2O5YL 3U9UA 4G6JL 4JFYB 3KPPB 1TJIL 3FT4B 3MV8D 4UQBA 4MMYA 4OGQC 3FTXA 2GI7A 1VENA 1A6WL 4B50A 2A0LD 1SY6H 1ZJBA 4CVXA 4QRRE 1JZHA 2HT4D 4HKBA 2WWKT 4HS3B 4JDVA 1VIWA 3HPLB 3KLQA 1NIEA 1SOQA 1JXKA 1XGPA 2WC7A 3FQ2A 1U8OB 3F7VB 3LVTA 2YA0A 3LN4A 2MWCA 1YAZA 2R0KL 4I0PA 1HS6A 1QVOB 2CM5A 1DBAL 1EMTL 2OMZB 4MJ6A 4BZYA 4QRRD 3MLTB 1YDPB 1IKFL 3T71A 3PP4L 4Z7OB 4PS4L 2HLAA 4PUBH 1DBAH 1B2YA 1JGDA 3QJFB 4G43A 1JPTL 3JXAA 5I8KL 5CR1A 1TZGL 5I0DA 1W0VB 1HQRB 3QIUA 3FMGH 4PGCA 3Q8CA 3LD8B 4WUUA 3DVIA 5HJDA 4IBZA 5SWQA 5J12B 2CR0A 2JMRA 3O9WD 3DX8B 4FXKA 5ITBH 4IU2A 4PRPA 3VMOA 5HGBA 5I8KH 2Y7MA 4I1RA 1TZGH 3IKCB 5HP5A 1M6UA 1LP9A 1PG7X 43C9A 4EEEA 1U3ZA 3NGBB 2OZ4H 2V5MA 1DUYA 5DD5H 4XCEB 3MCKA 2FJSA 2E6QA 3SYAA 3AG3B 4GT7A 1C12B 4J3UA 3HNTH 1TZ8A 1IFGA 3HRZA 4HWBA 1B3JA 1FORL 3RTLA 4XVUD 5I75C 4L3EE 3ZQ9A 1X5GA 4XMTA 3ARDA 2VR5A 1W72A 3MV7A 5IMLA 2FWSA 3O11B 4QCIA 3OXRA 3VTMA 3H9ZA 4X5WB 3SE4C 3WFHA 1M7XA 2Q7NA 4JE0A 3VSUA 1IARB 2V4LA 3HC0A 1KACB 1N10A 5EMYA 1CTNA 3FFOA 4K94C 2BDNH 3CCHB 4QRQA 4GAJH 5CP7B 1C08A 3QJSB 4A2MA 4F7MA 5J56B 2PCFA 3CX5J 2O1AA 4BHUI 3IMVA 2DKSA 2ESVE 3EJZC 2OV0A 3QUYC 1CICB 5BPPA 3P2TA 4Z0BL 2P1YA 5KZCB 1JPGB 4JGUA 3TURA 1PFCA 3B7RL 5DJAB 3UAJC 3FOMA 2BOLA 2L7EA 4X6DE 1NFDF 1U6AL 3TWCH 2OMYA 4OLXH 2BPBA 4OZHF 1RI8A 3QB7C 2ESVD 1OF2B 3L1EA 5JHDE 2DQFB 3BSZH 3ECQA 1X4ZA 1RJZB 4JX0A 1U6AH 3E3QC 5EN3A 3TX4A 4M61B 1AR2A 1S7XB 3IDGA 4QT5B 1KT2B 4AW7A 4ELKA 4HLEA 4C4BA 1GGBL 3LKPA 2VN6A 2OLDA 1X9RA 4YGVA 2XVBA 3CU7A 2SODB 4FE9A 1I8IB 4B27A 2VXSH 3IVKA 4PJAA 1KCBA 1HVXA 2YRLA 5JHDD 4FQQA 5JPNB 2PYEE 3D51A 1SN0A 4Z1PA 1MJUL 4GIAA 2E9GA 4XN7A 2AQTA 2B59A 2HN7A 5E5MA 1ZSDA 5E1AA 1NLBH 5H2BA 1FFPA 1AD0A 1JGVL 1HNGA 3MRHA 2VLJB 2OCCB 3RIAK 5BUGA 5HYQB 4OF3A 1IGJB 4MTMA 4PLKC 3WUWB 1N6VA 1OE2A 4R2GB 5HGDB 3VX0A 3NJXA 2AERT 1MWOA 5EWIH 4JDZA 3GGWA 5F0MB 3QI9D 2PYED 3TFKC 1T0OA 1L7TH 3A21A 3P4NB 4X6CB 3LRMA 1EK3A 3LSOA 1P4IL 3H55A 3C2AH 3P3UA 4CUCA 3U7WL 4PJ9A 5ALBL 3SY6A 1VAHA 2VR7A 3CSFA 4APQD 1YA5A 3RL1A 3QUXD 1DQVA 4Y2DA 2ZYIA 4EN2A 1L9MA 4HBCH 1P4IH 5I1AA 5ALBH 2YN3A 4PTTB 4Y1AA 4AUYA 3MRPB 5KYYA 5KVFH 3NFSL 1DBJL 2FH6A 3EBGA 5DJ6A 3V2AR 4XTRD 4E9YA 1TIUA 1Q9KA 1SDDA 2GKIA 5D6CB 2ZUWA 2OBGA 2YXFA 2YZ1A 3O8XB 1E9PB 1HH9B 3Q6FB 4GSRA 4QY8A 1RJLB 1VFBB 1U0QA 1W16A 4W4OC 3LKRB 1AC6A 4OLUH 3HBPA 3U9PL 1KN4L 4ZFFB 4ISVB 4YSSA 1BQHG 3BP7B 1FZJA 2ADGB 1YUHA 2EXWD 4NC0B 3CMGA 2BS71 3VJ6A 2ENSA 3VFMA 5FUCE 5CJXC 4MYPA 4Y2NA 4DWHA 4EE2A 1U8JA 3TBTB 3U9PH 3MUUA 1BAFH 1PG7W 1KN4H 3N85L 3V5KB 4W70A 4NUJA 3KPOA 1MJJB 4WNJA 5C08B 3MRLB 3VFGH 3P0YH 2D4FA 3BKJL 3K8MA 1WC7A 4BIKA 3BI9X 4PD4K 4YUEL 1IAOA 4QRPE 1V7ML 4GS7C 2WLYA 4WTQA 5E2JA 3DMMC 3SO3C 1XIWD 5FM8A 4EDXB 1PU0A 1J0JA 3BKJH 1MRFH 3JUZA 1ACYL 4XBPA 2XTLA 1RD6A 2QQKH 1CG9B 2EDBA 1AKJD 3PDOB 4JY6A 1QA9B 2FE0A 4XPAL 4PJBB 4JFQA 4MGXA 3VFRA 3QJQB 4F3FA 5KAQF 3S37L 4PY7B 2Y22A 3T2QA 1FVDB 1NDGA 5G2NA 1B0RB 4X7SL 2GK0A 4W9KC 5FEBA 4B41A 4JPSA 2DIAA 5H94A 4FJZA 1S7SA 1Y07A 4QXGL 2X44D 2UZXA 3S37H 2E6PA 1GYCA 1SMAA 4YX2L 4XP4L 4X7SH 2C5DC 2A9MH 3ARBA 3MRRA 2ZD0A 1LK3H 1G94A 3EYOA 4K8RL 4M7KL 1CBJA 2VO5A 4QXGH 4OD1L 3U1QA 1KLUA 3ZZSA 1FHGA 4YEEA 4YX2H 2IH3B 3ARFC 4JANB 4ANKA 4NQCE 3B6SA 3EFFA 4M7KH 4BYHA 3WTYA 4EI5D 2XUWA 2CR3A 1DJGA 3L9BA 3W39A 5CINH 5D7LA 5CZKA 3ARXA 3HR6A 3WS6C 1RVFL 2C1PA 3QQXA 4ZBJA 3S97C 1MNNA 1FNSL 4YO0A 2FO8A 1PLCA 4CA4A 2XG5A 1LE9B 4N3TA 1WE5A 3EYFB 4RA3A 5GJTL 2ZUTA 2WLIA 1H9DA 4FQJL 2L3BA 4NQCD 1NBVL 1P0SE 4GO6B 3S98A 1GOGA 2V2XA 4RQQB 3WEXB 3PHOA 1USQA 3CZJA 1TTCA 2ITCA 4NIKB 3CVHL 2DM2A 3HS8A 4WEEA 2XV6B 5GJTH 4DIXA 2EH7H 1IM9A 4HWBL 4CGUB 1E4WL 4B3EA 4NM4L 4NO3B 2J8UF 3LRHA 2IPTL 3FH5A 2AXGB 2EEFA 3CVHH 5DZPA 1NGXA 2XWXA 3IF1A 4HWBH 5FS5A 1E4WH 2CGZA 1YVLA 2AJYH 4ZFZB 4CW1B 5I74B 1ZPUA 5JO5B 1KY7A 5CGMA 4JN1L 2IANE 2N01B 3FC8A 4I87A 2V3FA 3LNFA 1TKWA 4TSBL 4MVBC 1XWVA 1VGKA 4QXUL 5AYUL 1NMCC 3SE9H 4A2DA 4BK5A 3DOSB 2EE2A 3GRGA 1ODUA 1X5ZA 1XR9B 5GPRA 5TD4A 4E9XA 2F53E 2Y1AA 3IM1A 5TE4H 3BH9B 4TSBH 3MKKA 5AYUH 2AZUA 4FQXA 4QXUH 4YVNA 3EDFA 4K7PX 2OSWA 3SE8H 3IJ7A 1JZ5A 1IAIM 1S5HA 1J18A 4BFRA 3SYCA 1KSRA 2IAND 2VN3A 4X7FC 3C6LA 1QKZL 2XQBL 4GYBA 4NQUA 1NUGA 1JZGA 2J5LC 3PS6A 5DEGB 4ATWA 4ZG1A 2F53D 3KDMA 3G6JE 4C55A 5DLML 2NSQA 2J1ZA 3QQ3B 2XQBH 1PAMA 2P5EB 4TL4A 1CFBA 1T83C 3PABA 1ES0B 3HLAB 1KTRL 3B3BA 1IBGL 2IAMA 1J5HA 3BZ4A 5DCCA 3H1ZA 5JPMB 1L9NA 3FCGA 1MCSA 1QFWL 4HQQL 5IQLA 1MFBL 1MQKL 1NL0H 4KDTA 2A74C 4AYMC 4U6TA 4F7KA 4NLHA 4WI5A 1IBGH 3D09A 1UB6A 1EZLA 3NCMA 2P7TB 2ZOTA 1UJ3A 2B3IA 2O61A 1LM8V 1XF5A 4BXVA 4AH2B 4TQHA 1QFWH 2A6JA 3BSGA 4NKMA 1CE6B 5E9AA 2FUQA 3VXOB 4W9HC 4FFYA 2ZWLT 5F2FA 5HI4C 9PCYA 2JQAA 2NY6C 3CFDA 3QAZC 5FO9A 3GBEA 3S7GA 4MRCA 3WIFB 1T1ZA 2WJ7A 2J88L 3RZCA 4L1BA 4J4PA 4U1IB 5L8LB 2J12B 3QQ4A 4HK3N 4Y5YC 1RZGB 4AEIH 2CO4A 2J88H 1A9VA 5ES4B 2BIHA 4XHJD 3ABZA 3BW9A 3ETBJ 5FW7A 1U8HA 2X9YA 3RI5K 3VXSB 1JVLA 1MJ7L 1M7DA 3WHXA 3NN8A 3ATAA 1QZ1A 3ZL4H 3G3LA 4OZIF 3IPBA 5KBPA 3ESPA 3U6XS 1IGYB 3KS0J 4YIQB 1D6EB 3SGEH 2FEDD 3KLDA 1MCOL 5IBLD 2HFEA 1PYWA 2WW8A 3GEFA 4TVPL 3KLSA 4HHWA 4Q9RL 1R24B 5GGQH 2K4WA 4LGPB 2Z31A 3O3EA 2O6FA 3PXHA 2O93L 2FWOA 1WCBA 4K9EL 2GB2A 2MHAB 2WTOA 1J10A 1WD8A 1CLOL 4ALAC 5LHDA 1IT9H 4MB3A 1ET5A 1NZRA 1KXQA 1PBYA 4FQLL 4DEPB 2GG1A 4J2XA 5EBWB 2VDNH 2FJFA 3AM8A 3BPOB 5FM4A 1CLOH 2JXMB 3GMLA 1AHWC 4Q7DA 5ILTL 5BOZG 4FQLH 5F1SA 2EO7A 1XB8A 2BS8A 2DICA 5IOKA 1KTJA 5EIIA 4OZGB 1LEIB 2Y6SC 4DP5X 5EU5A 4F2ME 4ZMPA 4ZMZA 2BHZA 3CSYB 4UT7L 1YNTB 1GKOA 2Q3XA 4HX1B 4L3EB 4MD0A 5EOQH 1QSFD 5EOCL 3PFQA 2BHUA 1YEDA 5EV7A 3DV4B 3QZWA 4NCDA 2CO6A 5I24A 4GI8A 1L9RA 1D7CA 4L8CA 4P4RA 1CVRA 4LLWB 4UT7H 2YAQA 5J6HA 4HC1A 4FKHA 4Y9BA 1E5BA 3DX6B 3BRFA 4N2EA 4MJ4A 4TLSA 2CO7A 2XSKA 4HJJL 1I85C 3LEYL 2IQ9L 4BCXA 1RZ8B 2B1AL 4X4YB 3DX3A 3VFUA 2XWTA 3PIQB 2Y5TB 3WTTA 2ADYA 5IT2H 5ANMA 2CCWA 3EO1A 1C5DB 5IJCC 1AD9B 4CVZB 2B1AH 1G7IB 1Z5LB 4EOWL 1H3XA 1AXSA 1VLXA 3QHFH 4OLZL 2OCJA 1HIML 2X42A 3ULUC 2FZ3B 1YY9D 4F58H 1QSEE 4JG9A 1HXMB 1Q1JL 2LU3A 4RIRB 1I3GL 4XNXL 4Y4FB 2AQQA 3BUPA 4P2OC 4PRHE 4EOWH 3FO2A 3NQKA 4OLZH 1HIMH 4LOVA 5EZOL 1NGQL 3KWWA 4GUCA 4WO4C 1I3GH 5JYLA 4XNXH 1LO3L 2C4XA 4NO2B 1QSED 4IRSB 4MQXD 4ZMAT 2NNRA 1CQYA 2AANA 3DROB 2YHGA 3L2LA 5FOJA 1HYRC 1W8NA 3NABH 4PRHD 4EN3B 1K72A 2WXJA 3TCLB 1RJYB 3IGKA 1LO3H 5CLTA 2X10A 2Y7OA 1WAPA 2D3VA 1P1ZB 3M07A 4MQ7A 4PJ7F 3ZKSD 3VQ1C 2XVKA 1I75A 3P77B 3HG5A 4WI7A 1YPZA 3R1GH 1GPOL 5DDHA 2VKWA 2UWEF 4I5BB 2WZPA 2ZWYA 4ETYA 3C5ZC 3ZYJA 3O6LL 1TMCB 4UT6L 4NO5B 4XMPL 5HDWA 3MV9B 3SEPA 3OKNA 4YXLL 2CIIB 4X5XA 3SQBB 4HIEA 3O6LH 4UT6H 1BLNA 5J6GA 4IGBC 4LEOA 1JWMA 2EIDA 4TPRH 4XMPH 5C07B 1ZXKA 2XBDA 3ZRCC 4BXSV 5DU7A 4YXLH 1OD9A 3O2WL 4AM0Q 3PNWA 1JGEB 2YD7A 1R3JB 4N3UA 4XP1L 3U7AA 2X70B 3AB0B 2EE3A 3AQZA 1OTTD 4WV1A 2P8PA 3H9SE 5E6IC 5SWSA 2V2TA 1I7UA 3GI9H 4WKXA 4X50A 1I9IL 3D07A 4Y5VB 3O2WH 5SV4A 2YBGA 1F90H 4RWYH 4LVHC 3ZE1E 2B0SL 2W1NA 2VL5B 4OBRA 4XP1H 4YHOL 1XGTA 4F15C 4AJYV 2EUWA 4LDEB 4XNZB 4ZMLA 1LO2L 4M8VA 4P3CH 1B3IA 5M7QA 4WW2A 4ODBD 1WICA 3QIBD 5JIQA 1T66D 5CJOH 4MA7L 3BZEA 1T0PB 1HYSC 2B0SH 1I3VA 3PWNB 4YHOH 3S5LB 4HIIB 1AG6A 4WI4A 4MJJA 3G04A 1CXIA 4MA7H 3ZQXA 4HIHA 2WQXA 3D6GA 4V1DA 2AMUA 3MREA 4NQEA 4G8EB 4XCFH 4JDEA 3TJHD 1M1SA 1Y0LA 3V6ZB 5JIMA 3ZDXB 3M17A 4F7EA 2EH8L 1OWRM 2O6EA 1FBIL 5I71C 2PPFA 2P5WE 5F7WC 4J3OC 1QFWI 2VQ1A 4QRPB 4AYGA 3VXUB 3BWSA 4FFYL 2EH8H 2YD2A 2DWXA 1EPFA 3PLYA 4U3SB 4UQDA 3TT3L 3RNKA 1E5UI 2VXUL 3GXNA 4PJCB 3QIWC 4FI7A 4ACTA 3LHAA 2GI0A 4L8BA 4G83A 3EH5B 4J12A 5K1VA 4P57B 4ZQKB 2DIEA 3TT3H 1MPAL 3WFEL 2VXUH 4JGMA 1R3HA 3NAAL 1OWWA 5EU7E 1JZEA 4O2CB 2GT9B 4ZO9A 5EBMA 1BWWA 2ZXGA 1QAWA 3TZVA 1CDYA 1PCSA 3JBG7 2OCFD 2ZG3A 3ZDZB 4A6YA 1YMHB 4KK5D 3WXVL 1HWWA 3P54A 4E41E 5B1JC 2AEOA 3ERXA 2DL9A 3FQRA 4M29A 3HN8A 5FO8B 4UNTA 3I75A 4BFKA 4NQXA 4PJIE 3FJTA 1OAYL 4X9IA 2CLRA 4JG5A 4S1DC 5EO1B 1HTYA 3V0IA 2BRRH 5CMAB 1T3FA 1FDLL 4JM2D 3O3DA 3Q05A 3GIZL 2FDBP 4HFUH 4E41D 4MNGE 1ZHBB 2AV1B 1JZ6A 5IQ7L 3BUYA 1OAYH 3SCMA 1MUJB 4Z6AT 3AREC 1EJ6A 1NOFA 4CN6A 3DO3A 3S96A 2VDLB 3BDXA 3I3EA 4U6VH 1GOFA 1D5XA 1FDLH 4ZAKB 4ZXBD 5BO0D 4M9PA 4WSKA 1EHNA 5TH2B 2DKUA 4HJGB 1AXTH 4B7IA 2BVOA 4YDJB 4UIMB 1MF2L 1UM6L 5CLXA 2Q1EA 3VG0L 2VQUA 2R9HD 1E3XA 5D7JC 2ITDB 1G5GA 3NK4A 1ZTMA 4S1SL 4XXDA 3PWPE 4S0HA 1MF2H 3TBVB 4KKCC 3VG0H 3BAXA 1ET8A 4O00A 5AB9A 1M1XB 5JOPD 4HF5L 5FGRA 1BOYA 3KCPB 1HI6A 3LKSA 3RVVD 5KSUB 4HC1L 3LVEA 2JB5L 3PWLB 1JFQL 2WN3A 5F9JA 3MBEB 2IDUA 2CR6A 5DRWA 4EKJA 1BG9A 1J05B 3NCXA 1EHKB 1RUQL 2YGNA 35C8H 4JZOB 3VMPA 3TA3D 7FABH 4HEPA 4EPSA 4G6KH 1NFDA 3ECWA 3QORB 4I1NB 4ICWA 3RLSA 2XBTA 2PABA 1TJGH 4OZHA 5A2FA 3QCUL 1TTUA 2ZKMX 3G7TA 4D3CL 1JPSH 1RUQH 4IBWA 3D34A 3C60A 1J9QA 4N2NA 3SDCB 3R4RA 4R84A 4I77L 2PLTA 3L81A 1QI3A 3N9GH 3QCUH 1IGFL 1KJVB 5ITFA 4BELD 4WNQA 4D3CH 1D5MA 3VWJD 2JNZA 2YS4A 4XI5D 3QPXL 3CZFB 1EHXA 4I9XA 1BD2A 2XZZA 1AVAA 2XWBB 1KGJA 3B2MA 1TXKA 2NY7H 4YBQD 4DP9X 2IH9A 5LKNA 2XNAA 4NQSB 5C09E 4NERA 4X4ZA 1E30A 2NRDA 3DGDA 4H0IA 3WLWC 5JHLA 4HZLA 4ZW8A 1XQ4A 4NRXB 4QF1A 4A7TA 2XZCL 2Y1VA 1K4CB 4HSQA 5F3FA 3QUMA 2AVFA 4L4VA 4XT1C 5I16B 2VJXA 2A9DA 5EFIB 4KROC 1UVQA 3N44B 4MSWB 1EJOL 3RQ3A 5C09D 2BNRB 2V9QA 2XZCH 2D7PA 3DYOA 1SQ2N 5D2NE 5EH1A 4PSRA 2BZDA 4TMPA 3P1VA 4YAQB 3KVDD 2E3VA 3IDMB 1MCHA 5IFHH 2C3VA 4GXVH 5DSCB 5C0IB 2OR9L 4NO0B 4BKLA 3KPQB 4UQIM 2OJEB 5J1AA 4OJEH 1E6OH 3JVFC 5E9DD 1QHQA 2CG9X 3U30B 2WJ5A 3MRMB 1N8OE 5HDLA 1JD7A 2MQ3A 2OR9H 5A2LH 1PD1A 2VLKA 2E59A 5C0BA 1R3LA 1PVHA 3SYPA 3MROB 4CBZA 3FCTA 4DOHE 3BEVB 2ATAA 3K4DA 3PV6A 1HEJC 4IOSA 3L48A 5DRNA 2HVKA 1BQLH 1A22B 3ZMEA 5CJQL 1QR4A 2X4PB 4NPYA 1HILA 4UTAA 4PJDF 3FB7A 5I8CA 2PCPB 1B4TA 1SMDA 3M7OA 4ZNEA 1XR8A 2GEEA 3FNKA 1E7UA 1CI3M 3MZGB 4G8IA 4Y4HB 4ZMTA 5CJQH 1JZ7A 3QDMB 1I1FA 4YE0A 5K5YA 5M95B 1UXWA 3GSXB 3ZYOA 3ZVVA 1JP5A 1O7VA 5IBUG 2IMMA 3T0BA 2RFXB 3NCFB 3VFTB 4F93B 2MSPA 1FJ1A 3GSNB 5DQJA 2AI0L 3SKUD 2A9BA 3OHXC 5IMKA 4IMLB 3LZOA 4F33B 1L3WA 5IJKC 2YO3A 1GSMA 3CHOA 4TRPH 4KK9D 4NUQA 1TQBB 5L2KE 4ZSOE 1MAKA 3EO9L 4WEBL 4LO9A 2YD5A 2PTTB 1KJ2A 4ZUWB 2HTLD 3PL6C 3ISRA 3NIGF 4JO3L 1VFUA 3HB3B 1P7QB 4KKQA 2LQRA 5B7FA 5BS0B 4TULL 5E2WL 4FNRA 3W82A 5D72H 4HOZA 3EO9H 5DZJA 4BSVA 3B2UD 4MDIA 1YYCA 1NC2D 5IW6B 3OD3A 4KU1A 4LSSH 1QMUA 2DM7A 2FJUB 4QHUA 4L9LC 4M7JL 3X12A 3QUYA 3C87A 3ARUA 3IBOA 4Z76A 4JL2A 4WF7A 1SOXA 1QLEH 1FYTD 3GMOA 4LEXH 4Z7WB 5DUPH 1JOIA 2Z6FA 4PI2A 3UAJA 4JQVC 3CNKA 4WEMB 3E2HB 4HULB 1UEMA 4KY1L 3AG4B 1TCRA 4M7JH 3HKZA 1S8DB 1TR7A 3AU0A 2YAOA 1KLGA 2ZKWA 4A6YL 3JQOB 4W68A 3F7QA 2GSIB 4KY2A 2WXHA 2O5NA 3U0TB 3Q3GB 3N50A 2F0CA 4ODWA 1YCSA 1P9MC 1OSZA 2WLKA 3V79C 1IE4A 4N85A 1XD0A 3OB0H 1M71B 3MJ7A 5LNGA 3G9VA 4HS6B 1FIGL 1KTLA 1Q72H 1UOWA 2NDGA 2IBGA 4RA0C 4L1LA 1VGEL 3QWOB 4HWZA 3VXMA 3IRPX 1I9EA 4NDMA 1IMHC 2JCCE 4K5OA 2OW6A 4KGJA 1TPXB 3COOA 4LHUB 3CDZA 3KXFE 1V54B 4XVTL 3X13B 4MJ2A 3RWCA 1VGEH 2X5PA 2A9AA 2SEBB 3LD8C 5F7FA 5J12C 3H7BB 1A47A 1XZ0A 1AYRA 2NYYC 3L4VA 4FFZA 3MA7B 3EBHA 4RAVB 3BP6A 1BX2A 2J8UA 4KRPD 4JM0A 4XVTH 2XWDA 1KLFA 4Z7NB 3FYIB 1N2RA 4KJWD 3NGBC 2YD9A 1WZ1L 3UC0L 5FLVA 1O6TA 3I6LD 3MO1A 4G11A 1V10A 2WXLA 2RQEA 3KXFD 3OPZL 4XZUA 3JV5A 3K46A 1FH5L 3U36B 1T4KB 2ZF8A 3UBXB 2A4CA 5FKAA 3QDJB 4R0LB 5JR1H 1AAJA 1YNKH 1OO2A 4N22A 5D2LF 5D4HA 1Z6JT 3O3AB 4V2CB 4UUJA 5E2VL 3AQXA 4K5PA 5JOFA 2B08A 2PXYD 1Y6NR 3WKPA 3BP5B 3Q2VA 4CU6A 3EAKA 4N2CA 1RMFL 4DZBB 3SPIA 3FQ1A 4ZTOH 4M5YL 1UT9A 2ZKXA 3N3EA 4GRLD 2YA1A 1NCAL 1YY8A 3SKOB 5FW8A 3TASA 1ZE3H 3ARGB 4BH8A 4N6RB 2D4DA 4DP6X 1LVEA 4ZW5A 5BRPA 4ZS6C 5LQBL 3B2PA 2F18A 4D9LL 3NIDE 3I9PA 1CLCA 4M5YH 4XNYL 4JJOA 5I1DB 1V7NL 4CKVX 1NCAH 3VH8G 4HSAC 3B3IA 4ENZA 3H9SB 4HOWA 1E2VA 1CICC 2XRAH 1CLZL 1DJYA 1A6TB 1WTLA 1J9TA 4J3BA 5GGVL 4Q6KA 1OQOA 3ET9F 2WMPB 3GSVB 3J2PA 4O02A 4S0SD 4AT6A 4XNYH 5ECGA 2ITEA 5GRZA 1ONQB 1YEFL 3UTSA 3OG4B 2X41A 4CN1A 1CLZH 1JTOA 2QJDA 3T1FA 4E68A 5GGVH 3HAEH 1VADB 2QQQA 2QDWA 1SMOA 3LV3A 3CC1A 2QFPA 1BXAA 4JR9H 1RK0B 5ALCH 3RG1C 4KNSA 2H9GB 4RVBA 1QPKA 4C58B 2KC0A 4NNXB 2ZG2A 2VZSA 5T5FH 3GSQB 4JFOA 2DTSA 4P23B 1KY6A 1A1OA 3DOHA 3HPJA 4JZJA 3W81A 3WKNA 4IBTA 5BZXA 2OKMA 2CH8A 1HH6B 2CGRL 4X9BA 1LO5B 3QFJE 4OJFL 2YKLL 4NUGH 5C6TH 5JPNC 4N5ED 1X5IA 1T7WA 2AJSL 2P5WB 5EU4B 3EJRA 4F7TB 3WJJC 3KYNA 3ARSA 2QLYA 4EUPH 1KDJA 4OJFH 4AL8L 3ML9A 1BXUA 5E8NA 2WCGA 3EG9B 3QWRD 5EUOF 1CFSB 2B39A 4R2GC 1FAIL 1OP5K 3GBLA 5AD0B 3LCYA 3QFJD 4H2CA 4JFXA 2APVA 3F7PC 4NBXB 4Y9GA 5ICUA 4WTWA 5FOBA 4RRPG 4AL8H 4GKSA 4LBEA 1WBYA 1AE6H 2WNGA 4OZIA 1FAIH 3ETSA 1A3RH 3P02A 2JELL 2WB7A 3T2LA 4OLWH 1CCZA 1BVNP 3W0WA 1T89C 4Z3JA 5ABZA 2QQNH 4J6IA 3V6FA 2MJWA 3FONA 4I2XB 5JUEL 3S3CB 4ADJA 2VC2H 3S3JA 1UD6A 5CUSH 4UTAL 3U0WL 4P49A 4GMTL 3WS6A 3ZKXB 1M56B 1M05B 5T1MA 1GYUA 3F58L 2ZXWB 4BFGA 2KQMA 3FFCD 4AKPA 5JUEH 4ZTEA 2XV3A 3OZ9H 5KSAB 5J1TC 4GXUM 4OFDA 3BWAB 1DN2A 4GMTH 4P48A 4I0PD 4KI1A 1G5AA 3O8XC 3I6KB 4WUUE 4JQIH 5F7KC 5CGBA 2X3CA 4TNVK 5DI8B 1KXHA 3FK3A 4K8RD 3GMMA 4PRPE 5J6SA 3CZNA 2AV7B 3DC0A 4HP5A 4X42A 4DAGL 1LP9E 4JBSA 1A25A 3LQZA 3DIVA 3MZTA 5LBSA 1A7RL 3L5WA 5F7DA 3CFEB 1ZEAL 3V4PH 4U1KB 4BH7A 4OIFA 2DTMH 4AENA 2CALA 3A24A 4PJGB 4UILL 4DAGH 1KJ2L 1P5VB 3BDBA 5KVGE 3P30H 1A7RH 4PRPD 4FJ6A 1ZEAH 4N2DA 1CC3A 1MLBB 1ZD6A 5F97E 2H2SC 4L3CB 4ZUUA 3GTNA 4K94L 1RIVL 5AZEH 4POZC 3PWPB 2BSRB 1GGCL 1MW0A 3FT3B 4L2YA 5E03A 3MV7E 4JRYB 1I4FB 4LPWA 4R7NB 2DY2A 1A4KB 3HE6D 4P46B 4RBPH 3GMNA 5FK9B 1H0DA 1A4AA 4XX1G 1RIVH 3JWDL 1U4EA 5HPOA 2YPVA 1YJDH 3UTZA 4Q9BA 1FC2D 4CU7A 3U1PA 1DDHA 2AS5M 1UB5B 1GZPA 2A83A 2OXHB 4CAGA 3MV7D 1D7BA 1WZAA 2O30A 4AMXA 4OI7A 3BN9C 4FULA 1QPPA 1N5YH 2CUHA 1FUNA 1VA9A 4OD2A 2AAAA 1ITBB 5B3NA 5LGKA 4WU7B 3PJSB 4BWWA 2K0RA 1O6SA 1T83A 3O0RH 5E8OB 3S0PA 5MENA 5CF3A 1NGWA 3DRTA 4G6FB 3UXFA 5ICXB 5IQOA 3LZFH 1SF3A 3IDXL 3ETBF 2QZ5A 3HZMB 3AT8A 5FFGA 3BT2H 3G9AB 2A74A 3RWEA 4MRBA 5FYLD 3O6FB 5FKPA 5K1NA 2FUTA 1PLGL 1KZQA 3Q8BA 4FFZL 4WO0A 1KPUB 2CU9A 5D1ZB 4EI5B 1HL4A 1Q9OA 1T7ZA 4PJAE 4PJ7A 3RVUD 5EZIL 2IALA 3IN0A 3ATDA 3NA4A 3QEHB 1QD0A 5A6MA 1MVUA 2AK1H 4S1QL 3SDYL 1M53A 1OXYA 1E40A 1U21A 4NQTA 1YAIA 1VZGA 4OKVB 5EZIH 1LQSR 4Y16B 12E8H 2X3AA 4Y7MA 5D2NB 4S1QH 1N18A 5DFVC 4Y5YA 4U7MA 2CKBH 4JY5H 3RIAF 2G60L 5E4EB 2C9PA 4C56B 5FB8A 3DYMA 3AACA 1HQ4B 4U6HB 5HJBA 4X6CF 5I74C 1FO0A 1RUAL 4W9CC 3D48R 2YLHA 4E9TA 4JPVL 5EF3A 3QPQD 1IQWH 2YD1A 1IV8A 1NEPA 1EHAA 1KPVA 4AXWA 2VUKA 4HWEL 1MREL 5HHQA 4Z8FL 1RUAH 1WVZA 4KJYB 1ZT7A 4DOHB 5F9AC 4D94A 4M1CD 3SOTA 4Y1AE 3AMLA 3EF4A 5DVMA 2X0VA 4K5MA 2R0ZL 2E7CA 1PZSA 4CSZA 4PJ9D 4PW9A 4O4YL 3T6WA 2EDDA 4Z8FH 4JPQA 3TBSA 1XBDA 4ZX5A 2NNAB 2YN5A 4Y2DD 4DUVA 3VFSB 1NUFA 4UDTB 1R75A 4TVPE 1CUOA 1MHCB 4FG2A 2R0ZH 2DV6A 1W8EA 4U05A 3SDDA 5DEFA 2DQEH 1N64H 1AHWA 2OMTB 4Y1AD 3SPHA 4LEBA 5H4YA 4IHBA 1IQDB 1U8PB 5JNYA 2LGNA 2YUWA 4URTB 1RZFL 2NCEA 1KJMB 1BQ5A 2VMEA 3K4AA 4GAFB 3FHQA 3WXWH 3QR2A 3VDBA 1NCCL 4NC2B 3V0HA 3RWIA 5LXGH 5EBLB 1ZT1B 5F3BB 3RNQB 5IROA 3ZTCC 5JPMC 3S2CA 3OKOA 1RZFH 3DI3B 5L2KB 3P0GB 4FFVC 4OAWA 3TJPA 5HI5C 2LE9A 4LHQB 4LVOC 3MNMA 1T04A 4D8PB 3LX9A 4PB9L 5G4NA 2VZTA 4KV5F 4RZCB 1OAKH 3I02B 3V0VA 3BQUB 1I85A 1JXFA 1HHKB 2C3XA 3P9MA 4K7FB 1WBXA 5CKGA 5HDQL 1JV5B 5GS1A 4U6YB 3UZQA 5CZVL 2BCKA 2ICWI 4PJBF 3FTYA 2GJZB 5DJXB 5L6YL 1NFKA 4HISA 1QWUA 5HDQH 1KBPA 5IFAH 2WWKO 5CZVH 2NY2D 1EXGA 2J44A 4NENB 3GS0A 3T8VA 3ZJAA 5DHYB 2EVFA 2EYSB 5L6YH 5GGRB 3ZOAA 2JI1A 2YK1H 1JWSA 1S5IL 3Q13A 2BW4A 2BSTA 4Z7UB 3REVB 2NTSP 2EVHA 3EF7A 4NHUA 3QG6B 2AJVL 3HR5A 1TLMA 2DJUA 1MI5A 4QRUA 4WO4A 1T22A 2G5RA 2VB5A 3GSOB 3PF2A 4ABQA 4L48A 4BQ8A 2XBZA 4HIXL 1MFDL 4X9YA 3UX9B 2HFFB 4NZFA 2AJVH 3VVWA 5D7LE 1KIQA 2IJ0C 3DPBA 4HFWA 5E8DL 3SGDH 3ARBD 1LWRA 2JCCB 1ZS8B 2EE9A 3GHEH 4RX4A 4NRYA 2M2DA 3QEQA 1EFXD 1MFDH 3KWVA 3REWA 1MXDA 5HGAB 4FZ8L 5KW9H 4LRNL 4PCTA 5LBSL 3KPMB 4OF8A 3RVXC 3H6JA 2R29A 2F5BH 3DVFA 5DYFA 4DEPC 3TYGH 3C5ZA 5D7LD 2OMXB 3ABGA 3P2DA 3V7AE 5AW6B 5E4AA 3BPOC 4QLRA 2CQVA 4BV1A 4NWUL 3B9DA 2AXFA 3K6NA 3II1A 4X6BB 4NAQA 3SGKC 5BV7L 2EDTA 1CZ8L 1LXMA 3DJ9A 1CBVH 2J1WA 2Z1KA 2RB8A 4AGLA 1DSFL 3L3IA 1P7KA 3VG9B 3MUGA 1HZLA 1HU8A 2WOYA 2Z1PA 4RSVA 2WXGA 4ANUA 3JTTB 4UQ9A 4JFDA 4KUCF 2IGFL 1THCA 2AF2A 1IM9D 2YPVL 3MX0B 5E6IA 3ULVD 2QVKA 1WFIA 4AM0A 3GMQB 1MW3A 5A16A 4N1CA 2IGFH 1ZSHA 2QSCH 3NIDB 1TLKA 4ZPVB 1L0QA 2AQSA 1EH9A 3STZB 3VO0A 3LNGA 1HEHC 1ZT4B 3D85A 3LKQB 3DRQB 4UYPA 3QUGA 3VFWA 1E27A 1FV1B 2A6KB 5B22A 1WEJL 1V3JA 5IV2B 1G1CA 3AY4C 3D52A 4XRCA 3OX8A 2QT6A 4QRFA 4P5MB 1TO5A 3WKML 1DJWA 4FQXD 5H35B 2YC1B 5J7CC 3RFZB 2DMBA 4Y4FC 1PS3A 3S3SA 4F8LA 4N0FB 1CD0A 1WEJH 3ISWA 4KKLD 3ZKQD 3C6LD 4PAZA 4S1RL 4DJMA 5GGUA 1R5VA 2HRPL 1KCVL 3U82B 1H3UA 4GW1A 4EAEA 1D6VL 4BFJA 3WEAA 4X99B 1XF4A 2A9CA 2ZUXA 3OMIB 1T2QL 2R2HA 3FAXA 2BNQD 2HXAA 2J21A 4IRSC 1FGNH 4J8RA 4Z0XA 5JHAA 3W37A 3SJVB 2VYRE 1MHPH 2BP8A 2DWDA 2H6PB 3BIKB 4OCSL 4I4WB 1KCVH 3K1KC 5MP6L 3VFVA 1B90A 3MRCB 5ANHA 1D6VH 1U36A 4EN3C 3RX8A 2QDVA 1FFTB 2NLJA 3QIWA 1UA3A 2AQNA 1P4BH 1S7TA 3BGAA 5IOPA 5EEVA 4XMUA 2QR0B 1KUMA 3U9UB 2E86A 1C5BL 1R3IL 3CX2A 4OLEA 2N59A 4MMYB 4APQC 4XMWA 4M43L 3UIZA 3DGCR 2FSEB 2WANA 3FO0L 3EH2A 5ID1A 2I07A 4CVXB 1FO0L 3TEZA 5L8JB 2MIZA 4G7VH 1C5BH 3S4SG 1SJHA 4FXLA 4M6NH 2GK2A 5I5RA 2BY0A 3VD3A 5ICYA 2KZ1B 4PJDA 4YHPB 3FRUA 3IJYB 3LN4B 1TDQA 2DPKA 5EO9A 2Z8RA 1RK7A 1E4JA 3RZCD 2AAVA 3AB0C 3FTUA 4MS8D 4J4PD 1XF2B 3PU7A 4P2QB 4LF3A 4WFEE 5FC9A 3IEAA 5DWPA 3RI5F 5L4MA 5F88A 2LVEA 1XMWA 4XB3A 1AGDB 5KVEL 1XGQA 4Y5VC 4ABVA 1J12A 2MCAA 2Z4TA 1M6OB 3CU1A 3FQNA 3SQOL 5BRQA 5EC2B 3P2BA 3UP1A 1JGDB 1IFRA 2QPUA 2BSDA 2VISA 4XNZC 5T1LA 4MNQB 1CL7H 3RL2A 3FZUC 4KZDL 5KVEH 5I9QB 1NCBL 3QIUB 4WUUB 4YHNA 3SKNB 5SWQB 1G7PB 1K5NA 3KJ6L 2G75A 3O3BA 2ADJA 2FRGP 1MIML 3NJMA 4G1MA 1KXQE 4IU2B 3NCJL 5D7JA 2VW7A 3WS3A 3CLFH 2BCMA 2NY4D 2Z8VC 1NLDH 4ZYKB 1OPGH 4XAWL 1NCBH 4D9QE 1UXLA 2P46B 2B4CC 2HUHA 3V0WL 1UGNA 5H4ZA 5IB2A 1KMGA 2F8OA 4XNBA 4KI5E 3TWYA 4M1GH 2Z31D 1MIMH 1NCWL 3KD4A 2C9AA 1MFCL 3MCKB 3H54A 5BQDA 3GM8A 3U4EA 5HVHB 3IGAB 4ZOBA 1G0DA 3MRDB 4R8WH 2UV3A 4B53A 4UOZA 3CVHB 1SYSB 5KSBB 5DJDA 3V0WH 3JZYA 4M93B 3HRZB 1JK8A 4DFIA 1MFMA 2WWNA 1TYRA 5DZLA 2WAQA 1F4WL 4TYUA 1NCWH 4OZGF 1Z9OA 4AYFB 3ARDB 4DKFH 4D9QD 4LSTH 1YNTF 4NKOB 3CZUB 4QCIB 3OXRB 3LPPA 4HKJA 4FJYA 4HA1A 3WFHB 2YAEA 1JWUB 2HTKC 5IHHA 4GXUN 5EUKA 4JRFA 3HC0B 1RZKL 2N3JA 3CH8A 5L7XL 2PCYA 2QQLL 1FL6B 1I8KA 5MERB 5D1XB 1AH1A 4PJ5A 2QGDA 4LKCB 4ZNCD 5TF0A 2HKAA 5ANME 2WSPA 1E90A 1RZKH 2AZAA 3K6SB 1C16A 3DIFB 1BF5A 2MCPH 1DEEA 2O5XL 1DFBH 5I1GH 4M00A 5L0QB 1EO7A 5CEZL 1ZVNA 4H1LA 1TVBB 3QR0A 2OMYB 1BHGA 4G80A 4LARL 3F6IA 3OR6A 4Y1SA 3MGOA 2O5XH 1KEML 3SGDI 7PCYA 1RUPH 3KGSA 1KGXA 2CWRA 2P3YA 3FQWA 5FV1L 3EOTL 4LARH 1KTCA 3QEGL 4LIQL 3TH4T 1F3JA 1PZ5B 3RU8H 2NYKA 3Q2NA 4BEIA 1HSBA 1KEMH 5ESAA 2X4OB 4RGOH