3K6FA

Crystal structure of mouse t-cadherin ec1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
SGIVVSPILIPENQRQPFPRDVGKVVDSDRPEGSKFRLTGKGVDQDPKGTFRINENTGSVSVTRTLDRETIATYQLYVETTDASGKTLEGPVPLEVIVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cadherin structures reveal a novel adhesive binding mechanism
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords T-cadherin
total genus 19
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3k6fA00
3LNEA 5CZRA 2YSTA 3K6IA 4APXB 4XXWA 3LNFA 4NUQA 1NCGA 5JYMA 1NCIA 4ZTEA 2WD0A 4ZMOA 4AQAA 2OMZB 1ZVNA 4QD2E 2A4EA 3Q2VA 4AXWB 1WUZA 4ZMYA 4ZMWA 4ZMTA 1OP4A 3LNIA 2OMXB 5JYLA 4AQEB 3QRBA 4ZMNA 4AQ8C 1O6SB 3Q2LA 2WHVA 2EE0A 1NCJA 3UBFA 3LNDA 3K5RA 4NUPA 1FF5A 3UBHA 1Q1PA 1SUHA 3LNGA 4AXWA 4AK1A 2YQGA 5CO1A 4ZMLA 2OMUB 5DZVA 4AQEA 3Q2WA 1ZXKA 1L3WA 1WYJA 2OMYB 3MVSA 4ZMPA 4ZMXA 4XXWC 2A4CA 3FF8A 1EDHA 2X2UA 3K5SA 2QVIA 4AQ8A 4APXA 2O72A 4ZI8A 3Q2NA 2V37A 3UBGA 2WBXA 4NQQA 2OMWB 3FF7A 3K6FA 3K6DA 2OMTB 2WCPA 4ZMVA 3PPEA 4ZMZA 5KJ4A 1NCHA 4NUMA 3LNHA 4AQAB 4OY9A 2QVFB 4ZT1A 4ZMQA 2OMVB
chains in the Genus database with same CATH superfamily
3LMJL 2W94A 3LNEA 1EZUA 3P9LB 1V05A 3K7UA 3P4NA 1DR9A 3FQTA 5E03A 4UTAA 3TJEL 4OLXH 3QZWB 4V33A 3MV8D 4BRJA 4CW1A 3AT0A 4OGXH 2WSKA 2UY6B 3BIAX 2MSPA 3D39E 1I8AA 1MCPL 1KCVL 1U8PA 3BP6B 2NZ1A 4GIPD 4TVPE 2X4PB 1JF1B 2HZHA 3LXBA 4GH7B 3VFSA 4MCZB 4JPKH 5DFVD 1L6ZA 1Y1DA 4Y2OB 4W9JC 3N44B 4MD5A 4B50A 4CJ1A 4E9RA 2VERN 3C6LC 2WANA 5KSVA 3BXNA 1ZSDB 2R2CA 2AJXL 2LR4A 3ARFA 3MOBL 1T1ZA 2WOYA 2ZXCA 1F42A 2G9HB 4RQQA 4OFVA 3UTSD 3U0WH 3OAZH 4I3RL 1FDLL 1RJZB 4LIQH 2KQMA 4CJ0A 4M43H 4PU2A 2YD9A 3ML9A 4Y4KA 2VXQL 1OAJA 4MA1C 5BS0B 4PLKD 1UD2A 2ZWZA 3IMSA 2KKQA 1D5ZB 3REWB 1EAJA 2O6EA 2GTWA 4GG8A 1SLVA 4NM8L 3DUSB 1NDGB 4RVBA 5IK3B 5B38B 2NY1D 2YQ3A 1M7DB 2X3AA 3IDGA 4MAUH 3WY1A 2P5ED 5G55A 3ZDXB 3POCA 3L5WB 3LHPH 3FUMA 2AK1L 4LDLB 3KM2A 4OLYL 2Q8AH 4O5LH 5M7QA 5E5MB 1LQSR 2YEZB 5DZLA 2CR6A 4H20L 3PWPD 2P48B 5EEXA 4CDGC 2WUBL 2B2XH 3X12A 1TZ8A 3QUYD 2OMUB 1UG9A 4HUUA 4DK3A 1VCBC 4PJFA 2R1YA 3D25B 2ESVE 4RAUB 5T1MA 5CD3A 5IHZB 4FKKA 5HXMA 3QQ3A 5HSFA 3BH9A 1JGIA 1U8MB 2GG1A 2VJ0A 3BEVB 3OGCA 4YHYC 5TDOA 3T6VA 3WE6B 3SJVD 1OAKL 1JPEA 2C8NA 2PXYB 2EDOA 3DRQB 1XT5A 1DBBL 1KXHA 3U83A 4DUXA 4AV5A 5EZJB 2JMRA 2K45A 4XNXL 3LEXB 1VB9A 4WNQA 3IVKA 4NS0A 4F7TB 2C3GA 2JIXB 5GGQL 3WTSA 1DLHB 1MCEA 1OWWA 3GXUB 4N2FA 3ZHDA 4XPGH 1EHLH 1AGDA 2V5YA 3ARXA 2CMRL 4NO0A 4UZUA 1JYVA 1A14L 2XICA 3HG1A 1DQLL 2HKFL 3VA6A 4JN2B 1WAAE 2W0FB 1BZEA 1JWSA 2OR7A 1AKJD 2IANA 4GQRA 4FQQA 3WIHH 2I7OA 4LESA 2P24A 1YUKB 2GB2A 5DFAA 2OK0H 4WV1B 1S3RA 3PJLA 2MPAH 1WA1X 2ICEC 2I85A 4TVUA 1JGEB 1ETA1 4PJGF 4AZ8B 4WHTA 4M48L 2ZQKA 4Z5RA 1MFNA 1SDYA 4KJWC 1OAQL 3KPRE 2H2SC 1VERA 2QKIC 2ZICA 2O6PA 3P73A 5DEJA 5E2WH 4PY7B 1RUPH 4YHNB 3CNKA 3QXAB 3F85A 2CD0A 4Q52A 3VJ6B 1A8ZA 2NQCA 3S9DB 4KKCD 4PJFE 4BCYA 1A22B 2IBBA 2OQJA 4X9FA 3U6RB 5JPNC 4NQSB 1T0OA 3ARWA 1HVXA 1RJLA 2C9XA 4UNUA 4HPOL 3SJVE 4BK8A 1HXMB 3WLBB 1MI5B 5TTRA 3JVGA 4OSUH 1MXDA 3BUDA 3UYPA 3EJSA 4PVBA 2FJHA 3B2DC 3CVHL 4NC2B 5FO8A 3BO8A 4LP8A 2XN9B 3H7BA 3K81A 1J1PL 4JHAH 3FOLA 4JFHD 3CZEA 3PAVA 3SQRA 2X4SA 1WA0X 3IS1X 1A4AA 3B7SA 3GLAA 1NLBH 3CZFA 3BWUC 5KVFE 2BVPA 1UYWL 1R19A 4LSUH 3ZYIA 4TULH 4DP4X 3U6XA 2EINB 5HYQA 4UQBA 2ITDA 5I23A 2O6FA 5I18L 3MJ9A 1AO7E 3U4AA 1QKZL 4N1CA 5ETUA 1IKOP 3F2LA 4FCHA 4WNSA 4NO5A 4HEME 4LQ1A 1IKNA 5F96H 5DK2A 5CLWA 3PDOA 5AD0B 4QLRA 1UCBH 2GJPA 2IG2L 3MBED 3DHMA 3VDAA 1JHKL 1KV3A 4PJAA 1O5PA 5F7AA 4OLYH 3FZUD 4AIZB 2Z1PA 5AW0B 2H26B 5DEGA 2IALA 5ALCL 3TWYA 3KYAA 3Q9PA 3DRTB 5HYJE 3GUTB 4JE0A 3CC5B 3V0AC 2RH0A 1FNEA 2BHYA 4AW7A 1YNTF 4F20A 1JTTA 4U6VH 2Q7YA 5DZAA 3LN4B 4UNVA 1AJ7L 4XCEA 4XP1L 5T3ZD 2CKBH 5D1ZD 1PLCA 1KCRH 2GTZB 3HMWH 5FCSH 4PP1D 3K1KC 4DCQA 3OD3A 4G42B 4FXLA 4UYQA 5JMRA 2C5DC 1GGIH 2CALA 2J88H 2WK2A 3Q6GH 2YKLL 3V4UL 3FFCB 1TZGL 4F5CE 2K8QA 1S78D 1S8DA 2FVNA 2RBLA 2PWHA 3D69A 2EDMA 2OCJA 1BF5A 4XNUH 1Z0NA 3GSVB 1FBIL 2IPUG 2KLRA 4GXUN 2G60L 2PW2A 1RIVL 3GSOB 3APMA 1PKQB 4ONHB 4ZOEA 1QMUA 3IMTA 3NGBC 3T09A 3MNMA 3OAYK 2F8OA 2VMDA 4L0YA 1YQVH 4GBXD 1A9BA 3ECBB 2NZIA 3H85A 4M5ZL 3SGKA 4JKNA 3PJNA 4LCWA 5BVJB 1HJCA 4E0RB 3PFUA 5J9PA 1HHGB 4HBCL 1F3DJ 3A67L 4LVNC 3K71B 1RMFL 4M29A 4PJ5E 2JJSC 4HGMA 1RMFH 3RTQB 4FXKA 1OEZW 2B4CC 1IAOB 4EKXA 3NP4A 2TAAA 3N3EA 4NZUL 4MQXC 3L6FA 5EU7C 1S9KC 1T7YA 1E5AA 3AQZA 4DN3L 1TJGH 4KZCA 4P5TB 3KYNA 4MZ2A 3GSUA 3M1OA 1H3GA 2Z8WC 1XF2B 3LEYH 4JZJA 1RZKH 1TETL 5FUOL 3UC0H 2E3VA 4ZFZA 4BZYA 5FF6A 1WZMA 1BZ9B 1FL5A 3ZK0A 1I85C 1U0QA 3L45A 3O3AA 4J39A 2Z65C 4EUPA 4NC1E 2VDOL 3VXMD 4Y7MA 3ZTDC 4DNLA 4YXLL 1KGXA 4NEHB 1BQLL 4UDUA 3CFCH 1B0IA 4P2QD 1BYNA 2XVKA 2GHZA 1T1YB 5E08L 2RFXB 4HHAA 3MFFA 4JRXA 2V33A 4TVPL 2UXGA 2B4CH 2HFTA 5FGCE 5I71C 5DZJA 4E9QA 1P69B 1DVQA 5L4IA 3ZE0B 1MVUB 5KG9A 2UZXB 2M2DA 4XX1E 1U8JB 2X1XR 4BK5C 2BIQA 3RZCC 3WTWA 5E2UH 3RFZB 4MXWL 1W8EA 1GOHA 1OZTG 3VXQB 1UD5A 4XNMB 1BIIA 4X99A 2P5PA 2B5IB 4G9FD 2FBRA 2ZG3A 1IC7L 2VR5A 3G6JF 4HT1L 4XR8C 5FHAL 4HWUA 3DIFB 3G04A 1MHHA 3RIKA 3X1GA 2YAHA 4FLSA 1E5ZA 4AMKH 5E8EB 4XXCC 3T6ZA 4L9LB 4U0RB 3EJPA 1ZWIA 2ADIB 2BHFA 3MLZH 1Z1WA 4HK0B 2RALA 2G3MA 3APFA 3CBJB 2Q6WA 1RSYA 3RTQD 1TQTA 1JV5A 2FL5B 2NR6A 4JHVA 3QG7H 3IJHA 2Z92A 3RJQB 1UACL 4UV7H 2NLJA 1MWAA 4LHUA 4PG2A 4GT7A 4P5TD 5HHOE 4XNXH 2H9GB 2CDGB 3IU3B 2MNUA 3GZOA 5GGRA 1KLUB 1X44A 3ESMA 3IBEA 3AXHA 1U91A 4Z77A 4ODSH 3SPVB 5KSAC 1PS3A 2EEBA 2CBMA 3MI6A 1XIWB 2BIMA 3QWRA 4L1BA 5I1KL 5IJKC 3HPLB 4ZTPH 3FC8A 5CJXA 1T3FB 2TRHA 4P23B 3SKOB 4QHUB 5LAPA 5BJTA 1M42A 1E4XH 4XOAA 2ZAIA 4X6CA 1WTLA 1U92B 3GMNA 5DJ6B 4H8PA 3S2AA 3EO0A 3V0FA 5JW3L 4ELMB 3ETSA 1JZ6A 1XTLA 4RDQF 2RACA 4B53A 2GSMB 4RFOH 5HYSG 4B60A 3ZO9A 4S1RL 4X6EB 4I48A 3QJOA 4GP5B 2HH0L 1S9WA 4NM4L 1ZLEA 1XQ4A 1NFDF 4R4ND 2OTUA 3QHFH 3US9A 4PEEA 4A63A 1SUJA 2JKWA 3ARDB 5F7EH 4WKXA 5CJOH 2BZDA 4WWKD 3DX9B 3RX8A 1MXGA 3TZVD 1M6OB 3LX9A 1WFOA 4PJAE 5KVDH 1ZHNB 3BJLA 3I02A 4IBYA 2BCKB 3S3BB 6CGTA 3WO3B 2QPEB 4KAQH 4G7SB 1C08B 3DX8B 1ZMYA 3DJ9A 1CLYH 4LAQH 2EDLA 1E0OB 2X1PA 4Z7UE 3V0WL 3PHAA 3F7KA 4G8EA 5DMJB 1F5WA 4XBEL 2GSGB 5BUPA 4IHBA 1D7BA 4AGNA 1OAYH 4H8WC 1TZHB 1MWAL 1LTXA 5C09E 3MV7A 3HE6D 3OB8A 2VDRB 1JHTA 1X5MA 4OJCA 2CUHA 3AY4A 3FTVA 1KEGH 1D5ZA 3ILDA 2GY5A 5F70A 1HZLA 3V95A 1ITBB 1GS6X 5DSCB 1NDGA 5IK3A 1GPOL 5C0RH 1QQDB 1E2ZA 3X1NA 4W93A 2OMYB 2PTUA 4R3SB 3SEPA 2ADGB 1VEPA 4XP4L 2ZONA 3E9TA 5E6UB 4TNFA 1ET5A 3HAEG 2YK1H 3DSNB 3GXDA 5GSRB 3TGXA 3CBRA 4OKVA 3PAYA 4XPHH 3V9EA 4APQC 2XA8L 1VFUA 1SLUA 1T2QL 4WI8A 1TFPA 3VXUD 1X5FA 4AK2A 1ERNA 1DUZA 2QSCH 1RJYA 1LP9E 2CO7A 4FQLH 4J4PC 3U4BL 2XY2A 2V3FA 1QFOA 4KXCA 3IYLW 1BVOA 4JQIH 1FI8C 4XWGH 3DVGA 4PBVC 5TDOB 4QOKB 5IG7A 5GZOD 1I3UA 4IOFD 1DBKL 3VCLB 4TSCH 5KYYB 3W82A 1CFMA 4HX1A 1KSRA 3GRWH 1PFCA 4EF3A 2A9AA 3FQNB 4DP8X 1XGYL 2JIXA 4CGTA 4CSPA 1A1OA 3QH3A 4Y5YC 3VFTB 5IFJB 4ODWB 3CVBA 4YHKL 1MCDA 3HG1B 4TLSA 1MPAL 1JWSB 2XYCA 4H8WL 1G9MC 1J8HB 1QRNA 5DC2A 5TDNB 3I75B 1FBIH 3QXVA 4I5BA 4M9PA 2XKSA 3EH5B 2EIZA 3BAEH 1IM3A 1OD9A 3KS0H 1KXTB 2XKNA 3C5ZA 3IGAA 4AZ8A 4BZ1L 4F7MA 4NN7C 4MNQA 2MHAB 3EYUH 3K1DA 5CIPH 5J6SA 4DO4A 3KGRA 4G6FD 4M5ZH 1PGRB 4IRSD 2CHWA 4JM2C 4BQBA 3LPGA 3GEWB 4PY7A 1WWBX 4L5FH 1RZGA 4PRIB 3FH5A 1WPCA 3JZ7A 4FMVA 3IB4A 4GW5A 2BIOA 3D39B 1XGPB 4NKOB 1QFUH 2AAAA 1SHSA 1D5IH 2OTWA 3MUY1 3Q5TA 4NQSA 4PJIB 4XNUL 2V2TB 4JPVL 3MRHB 5D4HA 1YVLA 4GY4A 3PJSA 5IJBC 4BM7A 3QJQB 1HU8A 4PJ5B 5BCAA 4NRXA 4OH2A 4GRMB 3H2QA 4QNPE 3GMRA 1ADWA 3PHOA 4U1IB 2FJHB 3BISA 2YUWA 4M1GL 1JWUA 1XCTA 4YLCA 3P9WB 4XI5C 4XB3A 2BVEA 1F3JB 2KERA 2J1WA 2XIIA 4X5QA 5FV2A 1L0QA 3GSXB 4A2EA 1IE5A 4ZUSB 2WUBH 1BYOA 1MAMH 2Q9OA 1T0NA 4TNEA 4U31A 1JG9A 1RUAL 4KK9C 4LARH 3TBWA 3KL0A 4YO0B 3B7RL 5BOJA 5L2JB 2BM3A 1L3WA 3MRQA 2XQBH 2HT3C 3HE7C 2AV1A 4KV5E 3DI2B 1JL8A 2VZUA 4YDLB 3NK3A 5HYQB 2XTJB 3WDIA 3LKSB 3AG4B 3SE6A 2ZXDA 3MFGB 1NTDA 4BFGA 1Z32X 2N01B 3CXHJ 3MUHL 3NIDF 1KYFA 1IAKB 3L3DA 4S10A 4RMRA 1ES0A 4XRCA 1BECA 4RAVA 1HESA 3QNXB 1CGXA 1D5MB 4N5ED 4NOFA 1JZJA 2PP8A 3CZNA 3WFEL 4EDXA 4YWGL 1TQVA 3V5DB 2WNGA 4F57L 2HFEA 4CSTA 3SDCA 3QUHA 4MHHI 3MUZ1 4Y16A 5DEGB 4YSCA 2CGRL 2PYEA 3KGSA 1EGJL 3GDCA 3L1GA 3F05A 3VFUB 1NGPH 1X4XA 5K9JH 2XV3A 1T2QH 5I9QB 1T5XA 2VDKL 2VZSA 4RFEB 4MAZA 4ZT1A 1RVFH 5AUMA 2XFGB 3LKOB 3SDAD 2A4ZA 4W4OA 4BCXA 1BD2A 4ABVA 4LF3A 3GSNA 4MVBC 2WMPA 1BZ8A 3QORD 4L3ED 1S7WA 2H47C 1JWMA 1MCRA 3QXDA 1RAMA 4K9EC 3NTCL 4XN8A 5SWSD 1N2RB 3R1GH 1TEFA 2QADB 1DBKH 4MXWH 3RP1A 3QK0A 2JCWA 1K4DA 3FULA 3LZNA 1U8NB 4ZYKA 1HC1A 1JE6A 3BT2H 1SOKA 1LO2L 5FYKD 1PZDA 1R3HB 2FJSA 5BV7H 3D69B 4HIEA 1BMGA 4O00A 3GI8H 1E9QB 4BH8A 3FHAA 1A3LL 3MUUA 2JJUA 2F5AH 1WIPA 4JEGB 2Y5QA 4K5OA 3CK0L 4AYDC 4DP7X 2YN3A 2DMHA 1VAHA 4ZS7L 5LCVH 3HZ3A 3CFKB 4KK8C 1CXLA 3S3SA 1TF4A 4PW3A 1R75A 3HAEB 4WI4A 4B27A 3HZYB 3G6DH 4GRLC 3U2SB 3UTQB 1DVFA 3FU5A 3ARED 4M5TA 2ED8A 1DEEB 5I8EB 1NCUA 5AALA 2PP7A 5L2KD 5HD8D 5ILTL 3LZQA 2RD0A 4JFFE 1QVOA 2NY4B 4AMXA 3ZDXE 5GGTA 3L6FB 5L7XL 5GRVL 1R3JA 1HHHA 2AXJA 1TZOA 1BA9A 4LOEA 4OCXH 3QZNA 2QPFA 1NOLA 1SYVA 2AGJL 2F5BL 3ARGC 3HS0A 4LSSL 4OFYA 5D55A 4ZMLA 1N6QH 2K7QA 2XVGA 4Y4FB 4G43A 4Q9QL 5FF6B 1BZ9A 1FL5B 2BCMA 3DJSA 4F37K 5LHDA 1ZJAA 4MFHA 4AH2B 5A3IC 2AXGB 2Z0BA 1BDYA 1Z9OA 2V7HB 3NJGA 3WKQA 4KMQA 4ZMXA 1OAQH 1JAEA 3T2PA 1S5HA 2EECA 2HH0H 4JCMA 1WUNT 3MCKA 3TP4A 1R46A 2AQ2A 4D8PA 1ZHBB 3BVVA 4PJCE 2A99A 3IRPX 4XNBA 5HGHB 1JMXA 1HXKA 3O9WC 3H3PH 2UZXA 4MLIA 4MVBD 1BXXA 1ACYH 4PRNA 2GQHA 3NSCA 1GYVA 4X4XA 4JG1L 3VI4B 2LTQC 4OGXL 4WW2A 3C6LD 1QSEA 3NCYS 4N0FB 1QTPA 3BQUB 3MDJA 1XR9B 5J1SC 3B2UC 2YWZA 4KU1A 3MZTA 1J5HA 1ZWIB 2ADIA 1Z6JT 3HNSH 4L9LC 1R5IA 3KJ6L 3MRFB 1A47A 4L8SA 3DK0A 4QF1B 4QOKD 4UANA 4UT9A 1KTJA 2APVA 4DP9X 2YARA 4MWFB 1JV5B 3VFPB 5K9KA 1CDHA 3K46A 4YHML 4NP4L 3W3BA 4HQQH 2VZTA 3BWAB 3CVDA 4Z95L 3T2QA 1CI3M 1XH2A 2LU7A 2PW1A 1X7QB 2H9GA 1MW1A 3KCWA 3P4LA 2YPLA 3RZCB 3QHZL 3LHAA 5KSUB 1KLUA 2YFOA 2H32H 4H25B 1E9OA 2A74B 1G0YR 2CHXA 3ATFA 3GJFK 4ZMWA 3UO8B 4PJ7B 2PXYD 3LHPL 1RUPL 3LRHA 1M2VA 2A0LD 4FJZA 5E95B 3SDXA 2HTKC 4L1DA 1Q0YL 2NTFA 1NCDH 4ERSH 3BVWA 3OB0H 3UP6A 4O58L 3BW9A 4K15A 2IANE 5DC0A 5ENWA 5EWIH 5DJ2B 1MCHA 5JHLH 3BUYB 2WWMD 4WFFD 4AJVA 2RAMA 4ELMA 1CO1A 3P0YL 2W91A 3N0PB 4POZD 1CDJA 4Z7NF 3MOAH 1K9TA 5HI5D 4DKEL 5BRZE 1NAMB 3NFSL 1FG2A 2EDBA 1J12A 2HX9A 1EAPA 2NDGA 1V7NH 4N2NA 1BQLH 4KDWA 4P5TC 1UXWB 3AS3A 3CHRA 1NPUA 3ZYZA 1DVUA 1FGVL 2OW6A 2YN5A 4JFHE 4OJDH 4ONFL 1SBSL 4HXBL 2JVUA 3RVVD 3D87B 3FQ1A 4MLSA 2VYRE 5T3ZH 1P6WA 3V4VA 1RL1A 1FH5H 1RLWA 2G60H 2XWRA 1T2JA 2WLLB 1OF2A 2ZT9C 4ORGA 1NBYA 4HW6A 1A25A 3S35H 5JA9A 2HMIC 2H32B 1UCTA 1JUFB 4HCIA 1UA3A 4LVOC 1ZLWH 2GJJA 1BREA 5KBLA 3X11A 4G8EB 3HN5A 4HPYH 2HLAA 3OXSB 2BW4A 3MBWB 4U7KA 2BP3A 1BVLA 4KXDA 1C5DA 2VW7A 2O26U 3KDMB 5G4NA 2OYLA 4GNKB 4XO8A 5FGCB 4OCWL 1NPNA 3FT4A 4OCWH 2DWEB 1G6VK 1FL3A 1MY7A 3I3BA 1KWKA 1JPSH 4W9FC 4ADGA 4HWEL 3D5OF 1IEBA 2ADGA 4S0TD 5D7IE 5E2WL 1HYSD 1HNFA 4WDIA 1NC2B 4M4PA 5K1VA 3JVFC 1KYUA 3O2WL 3UTPD 4PRPD 4NP9A 3FJTA 2DD8L 4LHQB 2WXHA 2VQ4A 2GW5A 1QW8A 5KJ7E 1UD8A 5JZ7C 2N7AA 5CBAB 2MCPH 1RJYB 1TETH 2CO7B 5FUOH 4MQXD 3MNZB 3HNVH 4TV3A 1G1KA 3CCHB 1MFAL 1W6WA 1UM6H 3CQQA 4OM1H 1PBYA 5BZXA 1XF1A 4TQPA 4LLUA 7FABL 5IBLD 2ARJA 2C3XA 5C0BA 3BKJH 1PZCA 4B6ZA 4J3XA 1P7QB 2ZKHL 2X1WL 4NO2A 3FHEA 2B4CL 3FQNA 3QUXB 4LASH 3V52L 1OGTA 5H35B 2PR9A 3KWXA 4ODHH 1A1OB 1HNGA 3LYRA 4OCMC 5E6IB 3SGEI 4YHLL 1L0YA 4RFOL 3MNVA 1OLZA 1KJ3L 4YHPB 3BPCA 4I9WD 4CADB 2P52A 1QX1A 3BUPA 3FTZA 4OV5B 1L4IA 1DFBH 5F1KC 1CBVL 4HQQL 2WYHA 4ELKB 1SVCP 3FO9A 4ZMNA 1X5GA 3BEWA 4P4RA 1U8IA 5JNYA 5EZOL 1XF5A 1N7ML 1H5BC 4D2NA 4WY7H 1BQHG 1KXTA 2WXNA 2VKWA 2XKNB 3IGAB 4X98B 3GS0A 2MCMA 4P57B 5EV7A 2O5XL 2VR3A 3UBFA 5F3BB 4IIQC 2FIKA 5C0EA 4X9BA 3BKYL 4DEWA 1AZNA 4FFYH 1E4WH 5JIDA 4LHJB 4UQDA 5FO9A 1XH3B 4ZFGH 3OC8A 1SOSA 3SYQA 3UYRH 3EFFA 3ME0B 2C1OB 4JPKL 4LLYA 5EU7E 3UTSA 1SN0A 3L7EA 3FAXA 3RPIA 2L04A 2A74C 3G5ZA 5DMIL 4AIOA 2UZIL 3HPJA 5DMIH 5C3TA 3BRFA 1OB0A 4HZLA 5F7DB 2NZ9D 4OQ1A 3NFPB 3Q0HA 3CPLA 1CD8A 5DU7A 2ZAGA 4N22A 5E6RB 3IDJB 5F1IB 1KMGA 4K7PH 4WFGE 3QWQB 1FNGB 1TTGA 3T65B 4EIGB 1AR1B 1OOWA 2E46A 3C12A 1HT6A 4HUMB 4LKCB 2AJVL 5FGSA 3GSXA 1E4XL 2AMGA 5LNGA 5ALBH 1ZLSH 5GRJH 5KW9L 1WCBB 3UAEA 4JCLA 1YUHB 1BP3B 2W9DL 4NPJA 1PLAA 1V3LA 4LXFA 1AR1C 2VZ1A 4AM0Q 2WYZA 4NQEE 4JL2A 4P5RA 5DTFA 5L0QB 2X38A 5LGHL 3O2DA 4CBZA 2DQDH 4HS8L 2KDYA 5C71A 2BLFA 3FYIB 4PW4A 3BI9X 4FQIL 2R69A 3OKLA 3NOIA 3GMMB 1FFRA 4GKZB 2G9KA 1EZLA 2WNXA 4X7EC 1VFAB 4XRCB 1ES0B 5J8OA 3WY3A 1IMHC 3QZBA 4RAVB 1F4HA 1XGYH 4KZEH 4C83A 1M3IA 4Z0XB 4Q7DA 3X2QB 3GSNH 5JQ6L 1G4MA 1C16A 2P47B 5EA0L 2E8YA 3B7YA 4M00A 4U3SA 1YEJH 5BNXD 4P2RE 2CDEA 2FX9L 2FX9H 4O5LL 2FZ3B 2NRDA 3AGVA 1NUGA 4WUUA 4RFEA 3ZE1E 4LF3B 1ACCA 4Y4FC 1GW0A 3TVMD 3WLWC 3WNIA 2BXZA 4L8SC 3ARGB 3EOBB 1U8OB 4KUZL 4HMDA 1E6JL 4WEEA 2J12B 2XRAL 4J8QA 4FG6D 3GMPB 4OW6A 3ZDYB 5AOJA 3WFZA 2IWFA 4XGZB 1U8NA 4ZYKB 4N2DA 5CZVL 1KENH 5K59F 3CFNA 3OPZH 5JPNB 2NY4C 3C5XA 3T3PF 5HYJA 1PIFA 4YXKL 4YR6A 1JPGA 1CTMA 3ABMB 5LG1A 1G7HB 5H94A 3ULSA 2ZG2A 3UBHA 1AD0B 3HAEA 4XWGL 2G2RA 2OXHA 1KIUA 3K8MA 4K9JA 4Y1AE 3WNKA 5F1OB 2GJZA 1QACA 4ODTH 1XZWA 2VDMH 4DGIH 1Z66A 2BHZA 2ATKB 3HZMB 5DZVA 2WTOA 3F8UB 5DJAA 3GLDA 2FJFA 3VQLA 3BN9D 3HFMH 3JT2A 1U8CB 2NW2A 4LNRB 4Z7VE 4XBGB 3C60A 2UVEA 4JG5A 4OD2A 5ITFB 3SPJA 3RHWK 3UPRA 4UINH 5I1HH 2DJMA 2DQFB 4G6JH 4I18C 1HHHB 3UBXB 4ZFGL 3HG0A 4CC4C 2A73A 4UV7L 5FFLA 4HWNA 1XB6A 5DJ8A 5CINH 4TL5A 1SYSB 2WKOA 1BZDA 4ONGL 4O2CA 2XWJA 4PVMA 3WELA 5FDWB 3Q13A 2OZ4L 2I32A 1J10A 3O0LA 4XX5A 2JSFA 4UNIA 3S0PA 1ETZB 4KHXL 3QFDA 2CK2A 1DJWA 2IDQA 1S9XA 4E9YA 4ZAKC 3MBEA 1YMHA 3KLHD 1JVLA 3TIEA 1RKRA 2XZAH 1LDPH 2BWQA 5AZUA 1KWGA 4JFEA 2LW3A 2JKNA 2YUZA 4HK3N 1Q4NX 1NKGA 5K9JL 3PP4H 2VXQA 4JREC 4NQCD 3T1FB 4FA7B 3A4DA 5AOIA 3DX7B 4G8GD 4IGBD 1EO7A 2F53D 1C7TA 3SO3B 1WWWX 4GO8A 4OZHF 2Q1EA 4KI1A 1CFQB 1HWHB 3IGUA 3AT8A 3PXLA 3TYFA 3HB3D 4XPBH 1MF2H 4KJQD 4KITB 2P5WA 3S35L 3OJDB 3WS3A 1CPUA 4XAKE 2XTJC 1QYGH 2B1AH 4J27A 2F68X 2ZYIA 3CVIH 1K3ZA 1QO3A 3CH1A 1I1AD 2L4OA 3HE7B 3ZMRA 2D73A 2ZF9A 4K71C 3ZVVA 4KK5D 5T1KA 5CM1A 4FG4A 5I8CA 4DKAA 4FJ6A 2XTJE 2WJ5A 1QSVA 2X2HA 3T0ED 2CKBA 4KMTL 4U6YA 1FN4B 2I07B 1SJEA 1I8LA 1JJUA 1NDTA 3KHQA 3QPQC 4LHUG 1HYRC 1KY7A 4M61A 3JWOH 4P3WA 3TC9A 4PGEA 5KANI 2X6MA 3CZLA 4DEPB 2YPLB 4KO5A 1AYRA 4UQ3A 4R96A 5LDUA 5BQ7A 4M56A 1UH4A 2DEWX 3H42L 3NDYE 3ZRCC 1M1SA 3QQ4B 4X4ZA 5CGBA 2VDNH 4MJHA 1BJ8A 4XMKL 1U8KA 3U48A 5JHBA 3EJUA 3GRGA 4PJCB 4OZIF 2BOCA 3COOA 3DMMA 4FI6A 5FYKH 4H5SB 1C5CH 5DJ2A 1DQML 3BUYA 5KJRL 4Q9QH 3PFQA 2NNFA 4QKXB 1L7TL 2JWYA 1NMAL 4M7JH 5LQBL 4JFFB 4OBRA 4DJMA 1ZPUA 2V2WB 4OZGF 5C7ZA 1V55B 2HJKB 1GGBH 4XH2B 3HBPA 4HH9A 1MCLA 4P2QA 1XAKA 3H9SB 2BVYA 4M7LL 4O2EA 3A6OA 5JPMC 1UOLA 4Y5XB 4DIXA 3FU7B 3H55A 4KVCH 2ZCHL 3EDDA 3C08L 5J13B 5JHDB 1WSST 1I75A 4PB9L 1I7ZA 1A4CA 4B3VA 3MV8E 1NBYB 1MREL 1W72A 1UD3A 3KL5A 4JPIA 5EDXA 1FIGL 1UUNA 1MPAH 3QIUA 5C2UB 2ID5A 3OLEA 4PJBE 4WGKA 1ROCA 3EH4B 3TT1H 1FCCA 1EFQA 3IMBA 1EJ6A 5FM5O 3FQYA 5GRJL 1NGYA 1C5DB 1DEDA 3DOSB 3L95B 4IOSD 1DJGA 3PV6A 3KLLA 2WTRB 4X5LA 3CUPA 2DLGA 5T1DL 2VAAA 3WO4C 4NBYB 3LIZL 5TGBB 4UNTA 4AI7A 3SHSA 1UKSA 1UENA 3VXNA 2W81C 4APQB 2XY1A 3D06A 3QPQD 4F9PA 2PTVA 2BVQA 4DGYH 4NQEB 4WDIB 2OX5B 2FCBA 4X42A 2IAMB 2J20A 2R4SL 1EUUA 2GSIB 5EUOF 3C6EA 4N9GB 3Q8AA 1JXKA 2LFEA 4KUCD 1OAUH 3HBZA 4F2EA 4P06A 3HVDA 1GHFH 2R4RH 4Z7UF 3U36A 1WGVA 4ALAL 5CBAA 3MN8A 2JI3A 3PHQB 3RL1A 3O6FD 5BO1H 3O4LB 4AYSA 1JERA 2HG5A 3QCVH 1Z3GH 5F72S 3BDBA 1GOGA 3IT8D 1OXYA 2ARJB 5FW6A 3BX7C 5F9OL 2A9MH 3MRLB 5F3HB 2A9ML 1CXIA 4XBMA 4PS8A 3PL6C 3EO9H 4PV9B 5GPRA 1G1CA 3MKGA 4HCFA 4QTHB 4IMLB 1PVHA 4KXAA 3O8XB 1OGTB 5H35A 3MV8A 4L9DA 5E94A 2ZCKH 3MGAA 4QRFA 1CBJA 4YHPA 3HN3A 3OM3B 4PJBA 4XCFL 1LP9F 3H3BC 4OV5A 4MXQD 4HETA 2NW3A 4LL4A 3K2MC 1O7DE 1U95A 1ZT7A 5FYJD 5B1JC 2DOCA 4JPWL 3TWCH 2ZP0T 4F8TA 1KYAA 1MDAA 5JXAH 5L2KE 4J3VA 5EIIG 5ISZA 5HVHB 5L9DL 1O5DT 2QZQA 1OT1A 1D5IL 4YHIA 2CNZA 1NJ9A 4OIIH 4P48A 4IW4C 3VFOA 3O3DB 2M83A 1A9VA 1UOWA 1G7QB 4PJ6A 3WIHL 2ARWA 3R0NA 2XBDA 1H3UA 5I0WA 4KHTH 5GZNC 2ENPA 2C1OA 2BWIA 3ZJAA 1RVFL 4ENZA 1MAML 5T1LB 1KPRB 1D9KA 4PWEA 4UM9B 1INQA 2C7UA 4JRYE 4K0OA 5I1LB 2G4GA 1ZJBA 4DFHA 5EN2A 3KLHC 4FMFA 2OMWB 1FORH 3RWDB 1ZD6A 2ZZUT 3IDJA 4X7CC 1P5UB 3TA3C 4JDEA 1H0DA 2WCPA 1I9IL 4XC1L 4NZRH 5DI8A 3O2DL 2JJTA 5C6PB 4UMGA 1NCHA 1WFMA 1WEJL 5ID0A 2FR4B 1XB3A 3NCFB 3EAKA 3EYVB 3M46A 4KI5C 2XWCA 4LU5H 1D5XA 2WSPA 3VE0A 4AV0A 4Q9CA 3MODH 3CK0H 1YEIL 4FFZL 2AK4A 3D09A 1T89C 1CF1A 4LLVA 1LDPL 5ESQB 4FTDA 3SCMA 1I8LC 3N91A 4EKJA 3SKJL 2IDTA 4B9YA 5I76B 4FQXA 1HZHH 5CGYD 4NSKA 3HLAB 5FS5A 4CN1A 5DHYB 5GS1C 3RFZC 3NRPA 1E40A 1VFAA 2WQUA 4HWBL 5MENA 2VZVA 1UWGH 3TH3T 4E36A 3VGHA 4DKTA 2F1EA 3EGDB 2IBZX 4MSWA 5IGXL 3AGWA 1JVOA 1MNUH 1NCTA 1CT8A 2CJUL 2FWLB 1Q9LB 4S2SB 4TULL 1N8OE 1C16B 4BSJA 4E9XA 1OT2A 3TCTA 1BX2B 1I1AB 2AXFA 3EIFA 3FQ2A 3MHZA 9CGTA 4N90D 3RGVD 4B9PA 4GEJA 4PG9B 4XCCH 1HL9A 2XBTA 1IQDB 3CXHK 4XPTH 4IHOB 3U25A 2TRYA 1LEKA 4P07A 1TU2B 3JWDC 3PYCA 4KMTH 2GAZA 1IM3D 3CSGA 1EA9C 4FNRA 4GXVH 1ORSB 2E4FA 3SBRA 2W9EH 1XSOA 2E56A 4MD0A 5E2JA 1RUKL 1FRGH 1KG0B 3KBFA 3MLSH 5A1AA 3BKYH 5DUPH 3TO4C 4WO4C 3HBGA 2X4RA 4IRZA 3D1MC 1GKOA 3FCSB 1BJ1J 3FN3A 5I2IB 3HA0A 5F88A 4K3DL 5AAPA 2PYEE 4UTBA 5F7YC 4Z3EA 1A6TA 1NGWA 4XP1H 3ZRSA 1Y07A 4CMHB 5EIVA 5GGTL 5SX5K 1AP2A 2YPLE 1INDH 2CBTA 4JJOA 4DQAA 3LPOA 1KPVB 3TYGL 3U0PA 3T8MA 4CNIA 1EDHA 2F54D 2YKLH 3VX1A 5C1MB 2NY6C 5GGVH 5B21A 1HHIA 3BKJL 1Z5LA 5AYUL 4FTVD 1NIEA 4EPSA 3H9HB 4WK0B 1PG7L 2GIMA 2ATKA 4TNWK 5DK3A 3HZMA 2JELL 4WWKC 1JPFB 1UXLA 1J05B 1X9UA 4ODXA 4AJYV 4OR1A 2NUTB 5D7LE 3QYNA 3IDXL 3MMEA 1L9SA 1NAML 3CDGB 5EN3A 5IROA 3UPRB 1M7IA 2DQFA 4MJIE 2DJSA 4R2GB 4WI3A 3NACL 3RVUC 3H56A 1N6UA 1UOVA 3BC9A 4L5FL 4NAJA 2LGNA 3TM6A 4BZ2H 2BSEA 4AGPA 3ROOB 4B0MB 5ACMA 5I15L 3TPUA 2XV6B 1IQWL 3U9UB 3WDJA 6PCYA 1AHWB 5H4YA 4N8CL 4XOCA 1VKXA 5LNEA 4EZJA 4UYPA 3VWJA 1TQSA 2WNWA 1MCOL 4QT5B 2DWDA 3UTPE 4W81A 4HFUL 5FCUH 4HIIB 3QJHA 2B5IC 4OLVL 1JGDB 5CMAB 4JFEB 2CLVB 2XZZA 3EOAA 4KKZA 4ZMOA 2CRYA 2DM2A 4P4KC 5CHNB 5C0JA 1SY6H 3SPCA 3E3QC 5KSBB 3OJ2C 4LPUA 3ARDC 3DX7A 3T4YB 3QFJE 1WBXB 3L4WA 5HHME 1BQUA 4XZ4A 2L8AA 2FX8H 3EJTA 1JZDC 1TYJA 1V3MA 3UBXG 3TIDA 3QZWG 3WS3B 4OLXL 4AQEB 1G9NL 2VDRH 5HJDA 3AXLB 4KJPC 5TE7L 4JFYA 3BVNB 1FGVH 3C8KA 5E9NA 5ESAB 2ZOKA 3NJMA 3D12B 5J0BA 4N8VA 3F7YB 4Q58C 4Y8DC 4EN3B 3FHQA 1NOAA 4OCRL 1MFMA 3QUYA 5E1IA 3OKKA 1JFQH 5I30H 3SSGA 1GGCL 1DBJL 1OY3B 4AVIA 2NX5E 5CJQL 2F7RA 4X8CA 5IT2H 5E8PA 1IC7H 1LO2H 1QHQA 4HPYL 4R7XA 1UZ8A 4BFRA 5SX4H 1QEWB 3ATDA 4Y2LA 3WTYA 4KKQA 4FQHA 2WBJD 4UQ3B 5BQ7B 2XN1A 5JUEL 1JVKA 2C3VB 3QQ4A 1UZ6E 3ESOA 3DSFL 1IE4A 4F7EB 4MMXB 5FEBA 2FBOJ 1K6QL 3KLAB 3OLIA 2DTMH 2A3TA 4KMLB 2AJYH 4RWYL 2W5PA 3BFQG 3MRDB 4NRZB 1U8KB 2LU3A 4F3FB 4P5MB 1M05A 1TZGH 2WVVB 3ZHKA 3Q9QA 1RUQH 3QT2A 3ARUA 3A5VA 2VSCA 1A7RH 1YC8A 2G5RA 3PREA 3QYCA 1CYWA 4YSUA 4Q56A 3BAEL 4OFYD 4Q6IB 1A2YB 1NUDA 5L8JB 3U4KA 4NAQA 3FH7A 4KI5F 4GSRA 1T21B 1RCYA 2DMGA 5BMFH 1E6JH 1UEYA 3BSZA 3E7JA 4B41A 4ZTPL 1YQVL 5DQ9B 4QXWA 1WO2A 3PABA 4OB5H 4G1EB 2Y06H 4I8DA 2YRLA 1VACA 1QPPA 1MCSA 1THCA 1U58A 3ZE2F 3TBSA 4KTDL 4A04A 4MXVE 1GVIA 5DD1L 5JXED 5HBBA 2COVD 1MI5E 3V9CA 1RERA 2YSTA 5AB2A 2F53B 3K6NA 1G7IA 1AANA 4JPIB 4YK4C 3PWJA 5FECA 1B2WL 4NI6A 2QL1A 4IBZA 1RZJL 3X3GH 2FT6A 1QYGL 2B1AL 2PCXA 3UTTA 5CEYB 4YHYB 1H6FA 5I17A 1PJ9A 3IFOA 4HLJA 4Z7VB 3DHUA 1F00I 5KS9A 1DBAL 1Z0MA 2DM7A 3CUPB 1BOGB 5AVZB 1KY6A 3VGEA 3L8QA 4Z7OB 2HRGA 2O5XH 3FQRB 4N9OB 2A1WL 4NFDA 3H9SE 1HH9B 4YPGB 5TDPB 32C2B 3W2DL 1MQKH 2AKRA 1I7UA 2BVQB 5DMGC 4NQEA 3T71A 4GRWE 1WGOA 2CBQA 4OAWA 5CEZE 5IB2A 4ZFOA 2GBTA 1K85A 3BDYH 1OAYL 4F2MB 2PPAA 1KEGL 3RL1B 1JRHL 2IOIA 2A6JB 2HG5B 4H13C 2H2PD 4MA1B 2CQVA 5EO9B 2DEYX 4MXVF 4JN1L 4AKQA 3K6OA 4K8RC 4KQ4H 1KDJA 4JZJC 3OG4B 5C3LD 1R5WB 4Y2DD 4HT1H 3IM1A 1N26A 3L4XA 5BQDA 3W0WA 3ILEA 5ICXA 4XC3L 1IGML 1LD9A 2JQZA 1CXHA 3ABLB 3LCYA 2OYPA 4IMLA 1U3HC 3H8NA 5E6YA 2ZOLB 1XZ0B 4ANXA 4IKIA 3IXTA 4B9FA 4GAYA 3M1BB 4LEEA 2WLYA 3GLEA 1UWYA 3FONB 1OGAE 1SLXA 4FYQA 3NCJL 4MZ3A 3CZJA 4PGZA 4HOXA 2OI9B 2NY6D 4TTDD 4AT6A 3HUJA 1VADA 4D9RE 4RMVA 4IBUA 3RA7H 3SGKC 4OZFB 4PGBA 4X6FA 5JHDD 4HIJB 1MH5B 1AO7B 4ZBJA 1E90A 1R0AL 4F58L 4MCMA 3H9SD 4YHIB 4K8RH 4JDVB 3RYMA 1MFVA 3W9DB 4J3TA 3FF7A 2H2SD 4FDWA 2FUTA 5B1KA 4LCIH 1AQMA 1IGJA 2CXGA 5EA0H 4NERA 5I5JA 8CGTA 3QDME 3QEGH 3SBWC 1K4CB 1SXSA 1QATA 5B8CA 2J72A 2FSDA 4KPHL 5D1XE 3MJGX 4FNLH 3RNQA 4WWOA 5A16A 4F8NA 2P5EB 3Q8BA 3TBVB 2FO4A 1XTMA 2HPTA 4YSRA 5LGHH 4NKMB 5A3ID 1QI3A 4YBHA 3PWNB 2XZAL 3FT3B 3KPNB 4FTVA 5LBSH 1ACXA 2FT7A 3PNWB 3PXHA 5F7MC 4AEEA 4LSRH 2EO7A 3E8UL 2CLRA 2XN0A 2VABB 5ICYA 3GIVB 3IMWA 2FR4A 1E6OL 2GJ6B 2A4EA 3U0TB 5IVOA 5K93A 4BKTC 3X1BA 1KCUL 3MCG1 3AMLA 4ANWA 1FAIH 3STZA 3IU4L 5JZ7D 3ISYA 1N64L 2R29L 4GSQA 4ZUUB 2IOOA 1ZK5A 4LLVB 3C75A 2CRIA 4OCSL 4UT9H 4N8VG 3SCMB 3WSQH 5CR8A 4FQXB 2DQHL 2DYSB 4XB7A 2VLMD 1G6RH 1SMOA 3VWKB 3VUAA 4L5FE 5KYNA 2P8PB 2ILLA 1WD8A 4CDHA 2F61A 2R23B 4G2AA 3SY0B 3N9GH 4CVUA 5CP7B 4W6WB 1K8IA 5D7LA 5I0ZA 3LZFH 4UT7L 3QXUA 1KCSL 3O6KH 1M2OA 2BNQE 1RU9H 5FM4A 2B77A 3BZEA 5D93B 4OZGA 1Q9LA 1OE2A 1VZGA 4K73A 4S2SA 1ZEAL 2AXFB 4J7RA 3WY4A 2N1TE 5D1XA 4YSOA 3QS3A 4EN3D 4PJXB 5D2NE 3RI5F 3C6LB 4ZUTA 5F3FA 1TEYA 2OMXA 1E2VA 3IDNA 5HPOA 1J8HD 1KJMA 4R7VA 4N6QA 1HAWA 1KNOA 3HB3B 4OZIA 1HINL 4L05A 1RZKL 1CFTA 5IZ7A 3VFRA 5AQ0A 2D7QA 3ELAT 4NJAH 1VRSA 1BZ7A 1O6SA 2GVYA 4JRXD 2EE2A 5TE6H 5EC1B 2DI8A 2PETA 4F8PA 2EH8L 3O6FC 3BYYA 3MR9A 5DJXB 2A2QT 3KR3L 3MRBB 5JIIA 5EBMA 5J89A 3QSKB 2HFFA 2A9DA 4N0UB 3SD5A 5B4MC 2WYTA 3HI5L 4RRPA 1QBLH 1WVZA 1VEOA 3QEUA 4DESA 1KLGA 3G7TA 1NM9A 3F12B 1PW3A 4OCRH 3HMXH 4LEXH 5L6YL 1KPVA 4X6DF 3VH8G 3WMQA 3U0PB 2J1KA 2X10A 1TT6A 3R1GL 4CNIB 4XP5H 1N3NB 1UXSA 3HI6L 3QDJD 1IJ9A 4ILDA 1EPFA 3KYKL 35C8H 1ND0A 2V17L 2ZWLT 3L3OA 4NNPH 4A66A 4KKAC 4L4VD 2BSRB 1FF5A 3NZ8B 3WUZA 4PFEA 3D34A 1GCYA 4HFWB 1JGLL 3EHBD 4HYTB 4O02H 2BERA 2ZSVA 4GO9A 3CQFA 3C60C 5D70L 4GQPH 3ZE0E 1L6PA 3ENEA 5AVSB 1ID2A 1T83A 1E4WL 3Q1EA 4QPEA 1AXIB 4FHBD 2JCCA 1XSKA 5CD5C 5DD1H 3PE9A 3LXAA 1TTCA 3K3QA 2JJTC 4Y0GA 5HGDA 3GPSA 1AHWA 4G8AC 1KXQE 1ADQH 1AD9A 4LE8A 3GSQA 4JQIA 1OB1B 2I69A 4NN6C 5SWSB 1SXBA 2NY5C 4XZUB 3D2UB 5IGXH 5F89B 1XF3B 1V10A 5DFTA 5D8JH 2X53A 5IJCC 5JW4R 43CAA 1H3XA 3DROA 3L3JB 2QSVA 1NH6A 1P6AB 1QAWA 2R7EA 3U4EB 4GRLD 2EYRB 1EFXD 4U7SA 1I1YA 5HY9B 4QXTB 3WTXA 2HVBA 3TF7C 1SJXA 4G8IA 4NGHH 2A77L 3WFHA 3SYOA 3BIKA 4R26H 5F96L 2EO1A 2X4TB 5C0GB 2GITA 3U7YL 1Y6KR 3KPQB 5DHVH 4POYA 4M4RB 4M6AA 3QDJE 4JO8A 2XI9A 1F4AA 1BAFH 1E8XA 3K6SB 3TIDB 1NA8A 3L3IA 3BRGC 4U1JB 5GHWL 4MKMA 4N2CA 5KYUA 4W4NA 2NY7L 1Z9LA 4FQIH 1G0DA 1YAZA 4ZUVB 3BRDA 3QHFL 3BLBA 1I7RB 5ECJE 4YBLB 1QWHA 1JNHA 1W8NA 3ZUNC 3TA3D 1GJIA 3RVTD 1J87A 4HKZB 2YIHA 4HLZH 1L9NA 4DERA 4KQ4L 2W0PA 3DGDA 5CEXA 5KVDE 3BD5A 3AREA 1N0XL 3J27A 3L54A 4BSVA 1CUOA 1AY1L 2Z0UA 4BKLA 3V6FB 3DKHA 5H2BA 2ZUQB 2FH6A 4P4KD 4ZXBD 4OLWH 1F1DA 3OSVA 1KGCD 3HNTL 4UTAH 3SPIA 2IOMA 2P5WE 1KJVA 5DRZA 1LE5A 2APTA 4FULA 4HWZB 5DHDA 3RVXD 1L7TH 4ZFFB 1T7XA 3LKPA 1I1FA 4KNQA 4Y2DA 1DQJA 5F7WC 4TOYH 5TH2B 3U1SH 1CYXA 4OD1H 4KUZH 1ITCA 3QQ9C 4H4NA 1S78C 1AO7D 4KJWD 4DOHB 4ZMVA 2DICA 5JIPA 2JKXA 4M93B 3SJVA 2VXVH 3UGEA 5CD5D 5DC9B 3ARQA 3HI5H 1W0YT 1N67A 1KBKA 4QDGA 1ZLUH 3Q01A 1U3HA 3C09B 1ODUA 3GMQB 3HHMA 5HVGB 1FFPA 3F7QA 3H1ZA 4DN4L 1KC5L 4GAJL 2ZD0A 1RD6A 5DFVC 4BWTA 4MB5A 4KXBA 1OK0A 3AB0B 4HXAL 3W57A 5DQ9A 1JNLH 3PABB 4YL9A 2W65A 1EXUB 1NMCB 1KTLA 3PWVA 1JK9B 5IOPA 3KD4A 3VW3L 1UTDA 3LKRB 4ZPVA 1TTRA 3RX9A 4F2FA 1GW6A 2Y07H 2H0FA 3S88L 3QJUB 1A7OH 2J6EH 4MJ5B 3QO0B 3GB7B 1LLAA 2R39A 3UMTA 3LKNA 1G7IB 3LNIA 4IGBC 3CTTA 4XAWH 3UFIA 4ODUB 2HRLA 1KEML 2NCMA 1AKPA 3UCQA 1L9MA 3ECVA 2W92A 1GGIL 2J88L 2QLYA 3QRBA 4GRWB 5D2NA 4EI5A 1K8DB 3E80A 4K5PA 5GRUL 4LVEA 4JZOB 3HBQA 4OZIE 4JO1L 4QOKE 1BOGA 2LFGA 3WXWH 1ET7A 1CI5A 2OZ4H 2R0WH 5TDPA 3CHXA 4BV1A 2Q76A 2E7LC 3G5XB 2BP8A 2G0LA 2EIKB 3GBEA 1HKLL 1I7UB 2AKRB 2GK0A 3II2A 4RIRA 2R0LH 2FO8A 4JPQA 1F86A 4NPYA 3CWGA 1FO0B 3PGCB 3CLFH 2VLJB 3EYQD 1J9SA 4OTXL 3WCYA 2VDPH 3WFBL 4F2MA 2BNUA 1BEYH 3IDUA 1JZ2A 1MKFA 2A6JA 4JFOA 4L4JA 3CFEB 4PJFF 1WYJA 2FLRT 5F1NB 1CTNA 5D7IA 1G43A 4GAGH 1BBJB 4DZBB 1OGAB 3QQ9D 5KBNC 5MEQB 2Q3XA 3DXAB 3TWCL 5IBTL 4LRNH 4Y16D 5IHWA 5EB9A 1LEGB 4LRNL 4IRJB 4QHNB 4WU7B 2PYED 3BUTA 3HG5A 5LBVA 2QSTA 5CBEA 5KSAB 2C9QA 4XMLH 1E2WA 4WWPA 4JFQA 5DYOB 5KVGH 5EUOE 5LNDA 2RCSH 3BE1H 1P1VA 4F9LA 4NJAL 5IW3A 4JJ5B 4NQVA 5HJ3A 3A21A 3HNVL 3GJFH 1KTCA 3BPOC 3WUWA 4X6DA 1IAIL 3D9AH 3ZL2A 2F7IA 5C7XL 2X28A 3BVTA 3FONA 4W70A 1AIZA 5EIIB 3STLA 4IKKA 4PTTA 1I9RH 3ATBA 5DA4A 2WAHA 4BRVA 2EDKA 2ZOWA 1W0WB 3OL2A 2GIYA 3CG8A 2LAGB 4G80B 4P2OB 4E5XB 3HMXA 4LCVA 4YDZA 3STBA 3UTZB 1AGFA 1NBQA 4MZIA 1RZ8A 2HUEA 5BS0D 1IBDA 1HQ4B 4OU3A 4RNRB 1B0RB 4XVUC 4PB0H 2O1AA 3ZXAC 1BMWA 4J2XA 4AV4A 2NY1B 4UDTB 2PCYA 3ZE2B 4HKBA 4RISH 1SEQH 3BT2L 3TA4D 3VD2A 2QADD 3FSOA 4M7LH 5IB5A 3BPLC 4R5VA 3L5XH 4LB8A 3WMSA 5IQOA 1EMTH 3LB6C 1NCDL 1C1EH 5IHUL 2G75A 5FR3A 1CF8L 4JO3H 4P46D 1XWVA 5EOCH 2G5UA 2K8MA 1L7IL 3TN0B 4NHUA 5IIEA 5L2KA 2CBPA 5DRXA 2VIRB 4GQ9L 2RGSA 3QR1A 1TSRA 3D7PA 3A6CH 1S7XB 3LD8B 4FLHA 2R29A 3V2AR 1CE1L 2YS4A 5DJCA 1B9ZA 1G9MH 3UYRL 4R97C 4ANUA 1YMME 5GGUA 2Q7AA 3BVUA 3FB5A 4K07A 3N85L 1FC2D 1P2CB 5SWQB 2BNQB 3H6JA 3T2LA 4HOZA 4JFTA 1XV8A 4MAYC 5D7KD 3VXME 1NLBL 3Q3GB 3THML 2R1WB 4AENA 3EYOB 2O61A 4U0QB 5EU6A 5AZEH 3SQOL 1MVYA 3VH8B 2YD1A 3BGFC 3V7AE 5BMFL 4KJQC 2QQQA 1EIBA 2IPTL 5ISZD 3UGUA 3EF7A 3L9EA 4Y7OC 3MNWA 3H0TB 2CHZA 3NYKA 1YNKH 4KRNA 4NJ9L 2JLLA 4ICXA 5CP7A 1ZY9A 1K8IB 5D7LB 5DHVA 4FF9A 3O41B 5GS1A 3ULUE 4LSQL 4M93C 3UJJL 2WINA 1X4YA 5CJQH 4U1KB 1XGTB 2OMTA 3F64A 2EDDA 3CZGA 1OSEA 2X6BA 1RK1B 2XVBA 3P9LA 1YYMH 4KK9D 3CDFA 3BH8A 4PP1C 2LVEA 3ZDYF 4AZUA 1A7QH 4Z7VF 1F13A 1BEYL 1IBZA 4G6FB 3SDXF 4NQQA 2OCCB 4OGQC 2LABA 3BP6A 1ZV2A 2FATH 4C56D 1MFAH 4MA3A 1GCFA 1CDCA 3KWVA 3CGTA 1F3DH 2H3KA 2XG4B 4RMSA 1P4BL 1GC1L 3QO1B 3FUDA 3QI9A 5BRZB 2X89D 1E5CA 2WAQA 1CG9A 5FB8B 2EKSA 3DA0A 1AC0A 2HKAA 4QRRB 1URIA 4M8QA 3X14A 3CFIC 1IARB 2D8KA 2G9HA 3OG6B 4QY8B 2AK4D 5SV3A 4ODHL 2CMRH 1JYWA 4HSAC 2JV6A 4GSDH 5LGJB 3H3PL 5HDBF 2H3NB 3ZTCC 4GUQA 1R3KB 1Q0EA 2FWSA 3PWLB 5KZCD 4L3AA 4DVBB 1JGUL 5IQLA 1IGTB 5LBSL 4UV4H 1N3NA 1UXSB 3DUSA 3DYPA 4AGMA 5B38A 3D0VA 2CO6A 4XMZA 3VXUE 1LHZA 2YMXL 3D3VD 4JR9H 3EFDL 3EKCA 1QHPA 3P02A 4MMYA 3FT9A 1H15B 3MV7E 3OBAA 4XO5A 1A4BA 3SE3C 4DVRH 3PCYA 3SO5A 2ZSVB 2OMUA 4HUUB 1JNLL 3UP1A 1KBGL 4QRUB 3CU1A 5INDA 1RZFL 3S97C 3WKPA 5IF0B 1ZIBA 3JWNG 5I74B 2O4EA 2BSSB 3BH9B 3TZVA 1U8MA 2KLSA 1BBDL 4X7SH 4NQDD 5HHNB 4KHTL 3WXVL 5HGDB 4ZZKA 2N4IA 4KH2A 2DIJA 4NT6B 1AD9B 1L7IH 5FGRA 3MRIB 4URTB 5JHLA 1VF5C 3I9IA 5EZJA 2RMNA 4QRTB 2CM6A 1QBBA 2EDWA 4CVZA 3MA7A 4JKLA 1AOZA 2I9LA 4Y19A 2R7EB 1JF6A 1MHCA 1GL4B 1H8LA 1UKTA 1AAJA 2VDNB 2K6YA 4GBXC 3WIFB 3KWTA 4HJUA 4BFOA 1CZ8H 4YVUA 4UIKH 4A2LA 1MCQA 4Y8AA 1HINH 1NCOA 4KK6D 4ZSOA 1REIA 3DJRA 2Z7WA 5F93C 5MP6H 2KZWA 1CYGA 5F7UA 5F9AC 2BDNH 3TASA 2OFQA 1BVZA 1C8PA 1KN4H 4JANB 3K6SA 1G7MB 2ZXQA 3VG0H 4ONOA 5DCCA 4GLRI 4WHTB 5TQ2L 3RWEB 4Z7OF 1UKQA 5F8RC 4KUCF 2IJ0C 2QKIB 1HZHL 5DYFA 2R2BA 4OFDA 3P73B 4RGMC 1J1XH 2F53E 1D9KC 4KZ0A 3WIIL 2VLJE 4R5XA 1X5ZA 1R3LB 3D3VB 4NZFA 5D9SB 2IGTA 2LV4A 3QZOA 4GMTL 3O4OC 4DPAX 5CEXB 1LDSA 1P5VB 3RY6C 5D7JB 2YBRB 4F1ZA 3KM1A 1UH3A 3JYCA 3I74A 2NY5L 4RGNE 1FZOA 3OKNA 5FA3B 2YMOA 4NQDE 3CAFA 3D85B 4KGLA 4LCYB 4GT0A 4UZGA 4XODA 4ES8A 4L4VB 4FZ8H 1FYTE 5D2LA 5EH1A 4LL1A 5DURB 2HJLB 3AQYA 1WBZA 3C60D 4HMEA 4RZKA 1FFOB 4IU3A 3WNPA 4AJWA 5E1GA 1LE5B 4DGVH 5A2JH 1A3LH 3CBKB 5BUGA 4BA8A 1IUZA 1QPXA 3BO8B 4KO9A 1ZHKA 1NKOA 5DUMH 3JQOB 1Q72H 4KY2A 4P0DA 4FQ1L 3U7AA 1BZQK 2BMKB 1C12B 5D1ZI 5JO5B 2Q86B 3CZSA 3O3EB 3PQYE 3U46A 5IROD 4AWJC 1L3NA 2BVPB 1RULH 4PJDE 5E2VH 2V5SA 4WJKB 5LXGL 1OAZH 3V79C 4HJTA 1FNFA 3C8HA 5DD3H 3OKDA 3I6LD 4IRSA 5EHFA 3E38A 4C54A 4F15B 4R2GD 2ARJQ 1C8QA 1TMQA 1WIUA 2V0AA 3DX6A 3RUGB 3CPUA 3AG2B 3FFDB 1J0JA 4MNGE 1SEQL 2EDJA 4Q14A 2E7CA 4UAHA 5TF1H 5F9DC 5C97A 3KPRB 1SMDA 2Y36L 2DY2A 2Y24A 4Y1TA 1EMTL 2W59A 4GW1B 5BXFA 3MV9B 3Q06A 3B8YA 2BIPA 4GEIA 1ML0A 2WQWA 2H26A 3AS2A 4J6RH 2IALB 5GGVL 4MCZA 2WHVA 2AGJH 3DBXA 4MAYD 4AVHA 2XZCH 3GUTA 1TR7A 1WC7A 5BW7C 1ZVSB 1SXCA 3NUKA 2E9JA 5F44A 1JZIA 3LIUA 4IDLA 4Z7NE 2EXYC 3ARFB 2RB8A 3LH2L 3GKZA 4U6TA 4LAQL 5GJTH 4LPVA 3QJSB 1GGBL 1PCSA 1CVRA 4M7LT 3NIFE 4HV8B 3LEYL 4D7BA 5I5IA 3NACH 3T0EA 3C5ZC 1F0LA 1PX3A 4HS3A 5LWYH 1F45A 4U6XA 3BP5B 1DDTA 3QDMB 3NSYA 1U33A 3TBTB 4PIRF 3FCBA 5CWSB 1LO4L 3QP3A 5D7JC 1H3VA 3AJ7A 1BD2E 3QJVB 1XH0A 1ZHLA 3P3RA 5IB4A 4ENEC 2F8VA 4XXDB 4JHBA 3VYOA 4HALA 4TRPH 5DUBA 2DLHA 2EXTA 3LPPA 4FNLL 4FFTA 1G9ML 4HU2A 5CD3B 5IR1B 2R1YB 3D25A 3ZZLA 1JTOA 3P54A 3QJZA 3TEXA 1MJ8H 4G3YH 2OV0A 3QUYC 4ELMF 4HJEA 3DV6B 4JRXE 3ZUCA 3OMZA 5J9PB 1HHGA 1V7MH 4DZBA 5E9AA 4F1SA 2YJQA 4RGNC 3RTQA 3DXAA 5AZEL 1J86A 2DWTA 5DD0L 5ITBH 1EZVX 2O5YH 3CZKA 4NUMA 3H7LA 4EIUA 2FNWA 5LKNA 2OL3A 5I82A 2WLJA 2HAZA 4WNQB 3IVKB 1PZ2A 3N0AA 4IOIA 2D9QB 4HUKB 5DYOA 4ZAKA 5HDQL 1DLHA 1HHKB 3F3HA 3ULUL 5AW6B 5BO1L 3RLSA 5F6IB 4JY5L 3UZEA 2L7UA 2OJZL 1ZA3B 2EXWC 3CSTA 4HKXB 1Y18A 3B3IA 3WUWB 1WQVT 3L1OH 4JZJB 4X6DB 4PJ7F 1P4BH 3ORJA 3G5VB 5I1GH 1C5BL 2PWDA 1HE8A 3EBIA 2R51A 2W07A 3RY6A 2IC2A 1OPGH 3QULB 4JFZL 5D7EA 1Q0YH 5EU3A 5C0DB 2CU9A 1NEUA 4ESKA 5E9DD 3UX9B 4P2OA 1ZANL 4E5XA 3BHBA 5CJ8A 1TJIH 1MLBA 3GHEL 4JM0A 3V7AG 4R7NB 4Z7WE 3W11D 3M88A 3RWCB 5D1ZB 4N28A 4WGWB 4KKPA 4TVSa 3QIWC 2H0PA 1I82A 4B0MM 5JQ6H 5GIRA 3QI9C 4PJEA 5C9JA 1R5VA 4U3HA 5AVWB 3S5LG 3Q8CA 2WWMC 3U6RA 3CFTA 2FEJA 2J2ZA 1JZGA 4H88L 3V6BR 4W9LC 1MVFA 2H7WA 4I2XE 1IVLA 2JXMB 4OFKA 4FHJA 3ML8A 1DVXA 5GISL 3TN0A 3G04B 1NANH 2IADB 3JTTA 3KJ6H 2VIRA 5I8KL 1ONQB 4X6CE 5TE6L 3QCTH 4MCNA 3S36X 3LEVL 4EEEA 2EABA 3EZJB 3LQZB 3BD3A 2NY3C 1OP5H 2VN4A 4E9VA 1E4HA 4M3JA 4G6ML 4TLUA 5DMGD 3H7BB 4JGUA 3RVXC 3FB5B 4FI7A 4M1DL 4XN2A 4JRYD 5AOKA 2JCCE 2X4SB 3Q1SH 1KIPA 3VG9C 5IY5B 3ULVE 1CK0L 4FXGB 4E9SA 3FQ4A 1BFVL 1PG7W 2C26A 2V8LA 3LMJH 4N2KA 5T5NG 4YSAA 5EF1A 4XTRD 3C6SA 3HJ0A 2CDGA 3ULUF 4Z8FH 3SGJA 1VLXA 1HDMA 3RFRA 3PG2A 4YFLI 2VLLB 3TJPA 3KNBA 4NQDA 1NFAA 3SPVA 2ICWI 3QBTB 4ONGH 1MCPH 2CLZA 3TURA 3NJVA 4S1SL 4JFED 4MGXA 5DHVB 5JIHA 3O41A 3S3DB 4NENB 4D9LH 5KVGL 4LCCA 2WZPA 5IBUG 3VXTB 1MJJA 4H26B 4G9FB 4Y9CA 2XLLA 1JSYA 4X5XB 3VGFA 1MFDH 4FADA 1J0KA 1AXSA 1DZ0A 1RK1A 3VXMB 3L81A 1CDIA 1YY9C 4XC3H 1G84A 4PJDA 3BH8B 1X5JA 2P8LA 2WXMA 1PF3A 3NQKA 3NQIA 4X6CF 4I3SH 4EO5A 4DF9A 3W5MA 5E08H 3ZL4L 1MIMH 1KB3A 1I3GH 1TITA 5F0JB 1SNRA 4NQCB 5T5FH 4PJIF 2BVOA 2AZAA 2BZCA 4WHYG 4B97A 3M17B 3QNZB 1MRDH 3ARDA 4RMBA 2XG4A 2OZ4A 2CCWA 3QS2A 1DFBL 2NT0A 5HDBE 2VXUH 4UT6A 1M6OA 5BRZA 3NCCB 5CGYC 1B4RA 3EUDA 3G9AB 3V9FA 1ORQA 4PY8I 3ULVD 4HAKA 1CF8H 4R97B 4QY8A 3GXIA 3VD4A 2GT9A 3RDTC 2WXQA 3ZGHA 1TZHA 3F7RA 3LD8C 3ZE1F 3QC5X 3QXWA 3DETC 4KDTC 1E43A 1VPOH 4OQTA 5D5ME 3ECBA 1PEZA 2BSDA 1IGTA 4I0PD 2KMWA 1A6ZA 3HZKB 1RULL 5E2VL 3DO3A 1QQDA 3S6CA 5CSBA 1ZDSA 1S7RB 1OHQA 2BFGA 4Y4HC 1B2YA 4JUTA 3ZW3A 4M02A 4NKDA 1HXYB 4PJGB 5DWPA 4HUCA 3RVVC 2GUOA 4GG6B 3R06B 4Z3FA 4F8LA 3FCGA 1W2KT 5GS0H 2DI9A 1B0GB 1NFIB 4FTVE 3WS6C 4YSQA 4KKCC 5EZPA 4FD0A 1BXUA 1XGRB 4U1HA 1KUMA 2DQGH 4JGMA 4MA7L 3B34A 4FFWC 1YAIA 3IXAA 5D7LD 3LTVA 3I50L 3O3AB 1HH6A 4I9WE 2GBVA 3VD5A 1RQ5A 3QRGL 5JHAA 4CVZB 1SM3L 3RGVA 4OJEH 4UDUB 4AOFA 4DTGL 1R3IL 2QVIA 3GSRB 1PYWA 3ZRFC 1T1XA 2UYLB 1N10A 3EFOA 1D5BB 5I66B 1HCVA 1KELH 1O9ZA 1U3JA 1WEJH 5I15H 5J1AB 1BQHA 1FQ9C 3WFBH 4M3KB 1PLGL 3C09C 5EZOH 4Q6YA 1ZGLM 2OSYA 5IUSA 1MVUA 1J8HA 2WO4A 3NPSB 4HGWA 1SXZA 5FKAB 5D5MA 3QUZD 5IESL 3QAZC 3I75A 2GTQA 2PN5A 3AS1A 3FKUS 4X99B 4ZQKB 1XSJA 3X13A 4OI7A 4PRPE 3SOBH 4OCNC 2WLNA 2HX7A 1OK8A 5EBGA 1CTOA 4CMHC 4XBEH 1JF5A 1Q94B 5D1QA 5GZND 4XMLL 3N1GC 1FYTB 2C1PA 4NCDA 5TPWL 4YHOH 2KPNA 2Y5TA 4YHOL 5HVWA 3HZVB 4Y89A 4KX9A 2V8MA 3VGAB 2X6CA 2WN2A 4F57H 2AEPL 2DKSA 3CLEH 3ECQA 1RPUA 3A4FA 1MFDL 1CICB 1P5VA 5E5UB 3NJFA 3RPKA 3VB9A 3WENA 1UGKA 4WHCA 3GO1H 1OARL 4R84A 4I0CC 4S1QH 1MWAB 3FU3A 2VDRL 2X87A 3LAFA 5TE7H 4YDKH 5H37G 4EI0A 3IU3A 3DC0A 2C9PA 1YNKL 4MTMA 1HEHC 1WBZB 2HJLA 1AHMA 5E24E 3OAYH 3CXDL 5KSBF 5EBLA 1CGSL 4JHZA 4ZUSA 3US0A 4P99A 4HA1A 1UADC 2FWOB 4HJSA 1RZFH 1U2HA 3UMNA 1IX2A 3T0VA 3IJEB 4X9YA 3MRQB 2D2CC 4A38A 1BOYA 2PWGA 1UATA 4W6XB 4WVRA 4WTZG 2YBGA 3GMNB 5DJ6A 2MKWA 4AEFA 2WQXA 2AQQA 4R83A 1JGLH 3HG4A 3AB0C 3B3BA 3FFDA 2BRRL 3P2TA 4PJAF 5JIKA 3JVGC 4LCIL 1OAKH 4WSGA 3OMIB 1E42A 3HG1D 3SN6N 3OHXA 4X4ME 4NQXA 5DVPA 4NKIL 1XGUB 3HI6H 1DN0B 2H45A 3IJ7A 3RDTB 4PBWD 2WJ7A 3DBXB 2PYEB 3PDDA 3UACA 3S37L 2Y6SD 3VFUA 1KFAH 3RTLA 4L23A 1T5XB 2H6PA 1I8MA 4M8RA 3DX8A 2HUHA 1KN4L 1BD2B 2UX7A 1R17A 4XVUD 3KYMB 2NR6D 2VTFA 2Z7ZA 4XVSL 5FA4A 3S34H 2MCG1 1S7WB 3L3GA 3MV7B 1Z5HA 2A77H 4EI5C 1E3FA 1TIUA 2DQGL 4HS3B 2VW4A 3A67H 4GUOA 4U6XB 2UWEA 2WM0A 5SV4A 1WFIA 1BWWA 2GJ6D 5D6CB 3T0XA 1R3HA 4R5TA 4BE5A 1FCGA 3K6DA 1DJIA 1N19A 1N64H 1E9QA 4S1RH 4LRIC 4BH8B 1I3RB 4HIHB 4FC3E 1I4FB 5DZNA 4GRWH 4WI0A 4LFHD 1KXVA 5GSRA 2C4FU 5C07E 4CU6A 4S1SH 5KBPA 5KS9E 5IM7A 3PPSA 4JZNB 3IDYB 1U8HB 4HCGA 4HH8A 5BZWB 5IR1A 4X7SL 3LKQA 2IAAC 2J1YA 3OZ9H 4UQ9A 5HDOA 5C0FB 3UTQA 4J12A 5MEND 1DVFB 5ECGA 3ZHNA 1N0XH 2PKDA 2HRPL 1BFVH 5C7XH 2X05A 4R90L 4N2GA 5TJWK 4OFPA 4FQJL 1ZEAH 3ESVF 3V5KB 3IF1B 3IKKA 3O8XC 4WHYH 4KWUA 5IW6B 1QD0A 1MJ7H 4P3CL 2XN9D 1HHKA 3UPAA 2FYYB 5CILH 3NP3A 2HFGL 2PUQT 3S8GB 4X9IA 4AY0A 1AG0A 2R0ZH 3OC5A 4A6YL 2VLKB 2WP3O 3FTSA 3GBNH 3KPSB 1OLLA 4MXQC 2Y1ZA 3G5VA 4R7LA 4Z7WF 4X9HA 3J7HA 2W07B 3W0WE 4JS7A 1N8ZB 3D3VE 2V7HA 3MXVL 3RY5A 5C0DA 4A2HA 2NY0C 1ZCRA 2EIZB 5I73B 1IM3B 3EJYC 3ARDD 3BHBB 3GNMH 1IBGH 1FH2A 4I3SL 4MNQB 3RIAF 4LBEB 1SBBA 2IFFL 3SDYH 3ZKND 4IKJA 2R8SH 4HF5L 4PJ8D 2KI6A 3M07A 1DJYA 5D1ZA 3B2PA 1ZTXL 5MEOA 1GR7A 1IGFL 4ABQA 1U8LB 4CAGA 1IGFH 5HGHA 3U1SL 3QIWB 1BXVA 2BO0A 4A7VA 3N1PC 4AQ1C 4ERSL 2Z3FA 4NDMB 1LE9A 3A23A 4PLJC 2J2ZB 2OTWB 2ZCHH 4PJIA 3CQPA 3IFPB 5L88L 5FW8A 4EUPH 5DS8B 3FB6B 3MBEC 4KZDL 1A7PL 4NRXB 3QDMD 4GRMA 1ZDQA 3GMRB 4LO9A 4U1IA 3FZUC 1XL4A 5I0DA 5J6GB 5FW7A 2BY1A 4OV6F 1YY8B 3NZHH 2EZ0D 4ODVL 4N2MA 1BPLB 1NFDB 1R5IB 3KJ4B 3MRFA 1I8IB 3LV3B 1EVTC 4YFLF 1FV1A 2H6OA 1WE5A 5T3ZL 1MCIA 2XWBB 5J13C 4UIKL 4ZI8A 4Y5XC 5LXGH 5JPMB 3MYJB 2QQLH 5T33L 1QTYT 3TBWB 5L2JA 1FZKB 3MROB 4JM4H 1B4LA 3QE5A 3RZCA 3QIBC 4Y5VC 4ZMAT 1IGIH 1GZPB 1JP5A 2VLLA 4OVVA 3QXTA 3KNBB 4NQDB 5DJYA 1GZQB 3MOBH 5BV7C 1HL5A 1P4LB 2H41A 3L3DB 3G9VA 4LT7A 5AAWC 5JW4M 2A6IB 3QNXA 1D5MA 3OAWA 5AG8A 3MLRH 4NGHL 4AC2A 2AW2A 4E5XG 4WU5B 4GMTH 4JPVH 3B5GA 5T5FA 4AYGA 1JNJA 3GSNL 4Y16B 1ZLWK 5IQ9B 2CO1A 4ZSOE 4M6NH 3WNNA 4MJ4A 4LRIA 3VXMA 5CKGA 1SY6A 3MC0A 1FG2B 3WHE0 4IDJH 2X6AA 4JGNA 4GKLA 4ENED 3LPFA 4X7DC 3OZ9L 3QQDB 1CFVH 1GRWA 4PS4H 3L3KB 3BFWA 1GPOH 5C0RL 1BXAA 1L0PA 4KO7A 1VZHA 5EULV 2XPGB 3D39D 5BRQA 1MCOH 3CFJA 4LZKA 2WLLA 4ORGB 5KWYC 1J8HE 1L5GB 4HIEB 1SEBB 2NTSP 1TEGA 4K71B 3HR5A 1XR8B 1NIBA 4I1RA 3VVWA 5DD3L 1TVBB 5CFHA 1OTSC 4K7PY 4XN4A 2WBJA 1FHNA 3GBNL 4Q6KA 5E51A 4ELDA 2GCYA 3NJXA 1S9YB 4X0KA 1ZLVH 2X6VA 3MYZA 2EADA 3U2SA 3MRJA 1A6ZB 3HZKA 5F6IC 1FL3B 3P1VA 2QELA 4N0CD 1Z3RA 1QBAA 1TUPA 3G6AB 3N1QC 4KROD 1QBLL 1ROWA 1VGKB 3DX0A 2V9UA 4PRHB 1H8NA 3NCYP 4RGNB 1J88A 4PRDA 1X9RA 5CJ5A 5A6MA 3WG7B 1W72H 2VLME 3KBPA 2APWA 3OKEA 1R3JB 3AS0A 3ETBF 5AVYB 4IJTA 1T6VN 1NFIA 3MX0B 4EI6A 3GDBA 1SYVB 3HS0B 4KPHH 1XGRA 1FAKT 1JGVH 3MA9H 3GTTA 4OD3H 4U1HB 4G43B 2ICWJ 2D3VA 2OJ1A 5C0BB 3C5SA 4P04A 4G11A 4LSDA 4UQEA 2AXGA 3FTXA 3VD9A 5J11B 4OT1H 4Y9GA 4HPOH 1S5HB 2E9IA 3RWGB 4O02L 3ZR5A 1E27B 1L9PA 4P2CG 1T1XB 4R4BA 1F4YH 4JY4A 4LGSB 3UAJC 4UU9A 2IMNA 1BQHB 3DECA 3ZL4H 5HHXL 1TJXA 4ELKA 4JFFD 1ZT1B 2AJ3A 4IKLA 1NAKH 8PAZA 3TH2T 1MCFA 1LK2A 5TF1L 3TEYA 5DXWA 3VNYA 4WW2B 4UT9L 1XGQA 3MREA 1QSEB 3UL4A 4P57A 4JHAL 3ZTNH 2DKUA 5FKPB 4AYMC 1ASPA 3BP4A 1AE6L 4QUOA 3TIEB 2O30A 3ATEA 5LAXB 2ESVA 4LMQI 1Q94A 5D1QB 2Z93B 3AACA 3CVHB 2RTTA 5C0EB 2VN3A 1JXFA 2BSCA 2CG9X 5JHMA 4HD5A 3EJZC 1OTTD 3QC6X 5FO9B 3IKCB 3W1ZA 2ICWB 4D0BB 4JVWA 4LLYB 2UZPA 2BFVL 3NIFB 1T89A 3MAWA 4J1UA 3FU0A 3VFPA 5K9KB 4N8PA 5BZDB 1AFVH 3DMMC 3VMPA 1RFDL 4XBPA 1USZA 4HZLB 5F7DA 5ADOL 2MOVA 1D7CA 3F58L 2ADFH 3V4LA 1CQKA 3IPBA 5F7NC 2FYVA 1MOEA 4U6VL 5KSUA 1WZLA 2AEOA 4KKNA 1QLFB 2G4EA 5A7BA 2A38A 2NY0B 3GJEB 2EUWA 3MODL 4LKCA 4G82A 4BFFA 1KZQA 1UJ3B 4ZG1A 1SUHA 1M2VB 4JK0D 2E8ZA 4O02A 3V5HA 3NZSA 4N8UA 2PMZA 4J3WA 5LG6A 3WD5H 2JTYA 1EO8L 1JYXA 1LQBC 5HI4C 4H88H 1GZHA 5ENWB 4DZ8B 2VN5A 3HNTH 4CKVX 1RZQA 3BWSA 1MRCH 1LXMA 1YYLL 4URKA 5EEUA 1WZAA 1HN1A 3IBOA 4G8GB 1RZ7L 1AKJA 3VXOB 1EAPB 1J48A 3UG4A 2BNRD 2VNCA 2UUDH 5E23A 3V55A 2J56A 5DJ0B 3AVEA 4AQ1A 5ANMA 4OFIA 1AMXA 3ZDZB 3TZVC 2BINA 4YVNA 4EUPG 3L5XL 3KYKH 3RWHB 1DN0A 2V37A 3APDA 3V4VB 1IVTA 3UAFA 1IGMH 2YMXH 5F0PB 3UBGA 5E2TL 4DP1X 2C3WA 3K80A 4P9HC 3IDYC 5J06A 2FZ3A 4L1SA 1YEKH 3I9GL 1ZA6A 3RPBA 2X5PA 2H32A 1JUFA 1ZTXE 1H9DA 1DSYA 1NCBH 1LJMA 5FGBA 2I25N 1HHJA 1NDMB 1YEDA 3ULVC 4WEMB 3IFNH 3D18A 3ARGA 1GAFL 4N4YB 4XCYA 2F08A 3RWIB 3O45A 1U8OA 4HUVA 2XXMB 2IAND 3FO1B 3KDMA 4I87A 4RFNC 2YGNA 2APXA 3FT4B 3UC0L 4U1MB 1U3ZA 1QOKA 2R56H 3ZO0A 1WWAX 1AZZC 4WNJA 3V6OA 2E7LA 2VRKA 3I6GA 3TBYB 1QNZH 5AOMA 1D6VH 4QJ4B 1IEBB 4HJ1A 1MIEH 5D8JL 1KEMH 2ZOUA 2WV3A 4QRSB 1AQKL 1JK8A 3T77A 1JYNA 1OARH 3CHOA 3N40P 2P5WD 3L4CA 5IVXE 3WKMH 2B14A 1T0MA 4J4PD 4R7DA 1FDLH 4JB9H 2CWRA 4W9DC 4BXVA 5IP4A 1JD7A 3CD4A 5ABZA 1U8HA 4ALAH 1KIQB 1VFOA 1WAAF 1OW0A 5C0FA 4U6HB 5CLYA 3IDMA 1WF5A 2GJZB 5GGVY 4ZD3L 5CFAA 2QGBA 4TQIA 1EAOA 1GGCH 1H3TA 3NZUA 2ORBH 4C4KO 4TQHA 1J1OL 1FVCA 1QWNA 4G6KH 4QEGA 3W37A 1QG3A 4FP8H 4UQ2A 4XMUA 2BWDA 1P1ZA 4AUYA 3CLFL 2KT6A 4PWIA 4P2RB 5IW6A 4J3BA 5ITFA 1CXKA 2J8UE 3DX2A 3QUXA 4KTGA 5A2KH 5D2LE 1AQ8A 5KVFH 4H1LH 3V7MA 1I85A 1CC3A 3FT2B 2CPCA 1VPOL 4K5MA 3HRPA 3MQIA 3ESNA 3KPSA 3IU4H 2EDHA 5D7SH 4JKWA 2QGCA 4FGMA 5CJXC 2DDQL 3BEWB 5HGAB 1KBPA 4WEBL 4LLDB 2Y7SA 2WGNB 4D0CB 3QFDB 5FOBB 5C92A 1XF5B 3FB8A 1CU4L 3V4PA 1ADQA 1CU4H 2F1BA 5KBKA 4MA8H 1RZJC 4X98A 4QCIA 3G08A 1SF3A 4IRSC 4LBEA 5I6OA 3ZKXB 1UB5A 4MBRA 4DO5A 2HT4D 2J43A 1I1CA 4V2CB 4JVUA 2EH8H 2F54E 1MEXH 1IBHA 1UM6L 2YKKA 3Q44A 3VGGA 4BQ9A 5LBSA 1NBVL 3BAJA 3OMAB 1I9RL 2Q2LA 4WWKB 4UV4L 3EFFB 4PJ7E 5IQMA 1DQMH 1GC1C 2X9ZA 4KTDH 4YE0A 3RPIB 3G5ZB 4B9CA 3D52A 2AQPA 4BWWA 2J7LA 4RBPK 4DQOL 4Z7AA 3KVDD 1LEIB 2NX5D 2WXLA 5T1KB 4BBWA 5J6GA 2CDFA 5F1IA 3VYNA 1AR2A 4TNGA 1YY8A 4PRBA 4UOQA 4YSPA 3OAZK 5EFIA 1SJHA 2MQCA 3C08H 2ALAA 2BW5A 3RWFB 3OZLA 3VXRE 1WCBA 1B3IA 2XWBA 1DVFD 3FUNA 3KH3A 2F5AL 2UY7A 5FOJA 3WXVH 3L9BA 2WXOA 4OT1L 5HDLA 5DRNB 1TCRB 3O8XD 1JV2B 3DWTA 4IRJC 2VLRE 4QKTA 4APXB 3FUEA 3DSFH 3SBWA 4GQ9H 4G6AC 1GZPA 1NEPA 3NABL 3U7WL 3CMGA 1HSBA 2V4LA 2E4TA 5JR1L 5GJTL 1Q9WB 5E5RB 4POUB 3WTVA 3MU3A 3TLRA 2YMTA 2JQAA 4Z3GA 4QD2E 3EO1A 4CA4A 5EF2A 1ADQL 1A7RL 4UM8B 1KB5L 3TNNA 1KFGA 3WFDL 1WD9A 1RH8A 3NIGE 4BA0A 2VDQH 2N7BA 3ATAA 3GXNA 2DYRB 4N26A 5IQ9A 4DK6A 2BDNL 4KOCA 4U3SB 5F6HI 3SDAC 2XHNA 1SHMA 5FYJH 5I1CH 1IRAY 1S7SA 4K23H 1B0WA 3CSFA 1EV2E 2XPZA 3FB7A 2BPBA 4AEHL 1DJHA 2F74A 4XCCL 5BS0E 4JY6B 5KAQF 4FQ2H 1ZAGA 1MI5D 1WAAA 1F11B 1MCJA 3P69A 2PO6D 1JN6A 3QIBD 3FU7A 3VM5A 2NR6C 3DVNB 3GMPA 2NXYB 2EE3A 3AT9A 3GBML 3MJ7A 1I7ZB 1XVSA 2D7PA 4XHJD 4Y2DC 4IKNA 4XGZA 2NYYC 4XX1G 5E9DB 3CFJB 4AKPA 1UXMA 2NMSA 4RMUA 1W91A 3ES6B 3LQAL 1ZANH 4MS8C 4F7CA 4C55A 3LQAH 4U1GB 3SE4A 1QSED 4F93B 3F5WA 1SEBA 3GKWH 4P2OC 3W38A 2CR0A 1TVBA 3CN0A 3N55A 3TX4A 4L29B 1G0XA 3BQUC 4C56E 1ACYL 1IGYB 1BVKB 3B6SA 5CZXC 5K39A 2XXCB 2PTTB 3TA3B 5J57B 3MLPA 2WWKO 5DVMA 1S9YA 3ZKMD 1QPKA 2GYSA 2XU9A 4DP5X 2YD5A 1AD0A 4QTIL 2G2RB 2QFPA 3GK8L 3MRJB 3QEGL 5B1JA 5J12C 1JDDA 2UZYA 3VXNB 4APQA 3U9PH 2ITCB 1FVEB 4ZJ9A 4PJEE 3WHE1 4PJXF 4HDIB 3VRIB 2QTVA 2J3SA 3G6AA 2OMNA 3QWRD 3V6OE 3V0GA 5K9OB 4I3GA 2VMCA 4Y4HA 2BNRB 2AEIT 4DAGL 1H6UA 2YGQA 4PGDA 1NAMH 5ISZE 3OKEB 4JN1H 4FQCL 2MPVA 4NYLB 2VDNL 3OKMA 4EI6B 3BZ4B 1RI8A 5I1IL 4BZ1H 1AY1H 4G1MB 1USQA 1AGEB 3WN6A 2XWJB 4HSQA 1TTUA 3RJOA 1OTSD 2K7PA 3O11B 4M62L 3W39A 4J6RL 4YSEA 4JHWH 5DO8A 3K4DA 2MFNA 3GMLB 2Y69B 4PV9A 1CLZH 2CIIA 1YMHB 2NZ9C 5FV1L 5TF0A 1NICA 3MRKA 3RWGA 1PD0A 2EQDA 2WCSA 1Q9KB 5T3XE 5F0MB 2X2YA 1E27A 4AEIL 3LEVH 3AAZB 5LLIC 1KB9J 1SJMA 2DQHH 6TAAA 4DOHE 4PJBB 3W9EA 1EHXA 3V8OA 3T1FA 2EICA 4D9LL 1A7NL 5ACZB 2R9HD