3K6FA

Crystal structure of mouse t-cadherin ec1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
SGIVVSPILIPENQRQPFPRDVGKVVDSDRPEGSKFRLTGKGVDQDPKGTFRINENTGSVSVTRTLDRETIATYQLYVETTDASGKTLEGPVPLEVIVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cadherin
publication title T-cadherin structures reveal a novel adhesive binding mechanism
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 19
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3k6fA00
1NCHA 2OMUB 1FF5A 4ZTEA 4ZMLA 2EE0A 4ZMXA 5JYLA 2WCPA 3QRBA 4AQAB 5JYMA 5CZRA 2WBXA 2X2UA 2A4EA 2A4CA 4ZMWA 3Q2NA 3Q2LA 3UBHA 2OMVB 2QVFB 5KJ4A 1Q1PA 4APXB 1NCGA 4NUQA 4AQEA 4ZMNA 3Q2VA 1SUHA 4NQQA 1NCIA 3LNHA 3K5RA 5CO1A 3UBFA 3K6FA 1ZVNA 3LNEA 3PPEA 2WD0A 3LNDA 4AK1A 1WYJA 4AXWA 4ZMOA 4ZMTA 1WUZA 4ZMZA 4QD2E 3K5SA 2QVIA 3LNFA 2WHVA 4AQEB 3Q2WA 4OY9A 1NCJA 1O6SB 3FF8A 3FF7A 3UBGA 4XXWA 2OMXB 2OMWB 4NUPA 4AXWB 4NUMA 4ZMQA 5DZVA 4ZMPA 3MVSA 3K6IA 1L3WA 3LNGA 2OMZB 4ZMVA 4ZMYA 4AQAA 1EDHA 2OMYB 2YSTA 4ZT1A 4AQ8A 2OMTB 4ZI8A 1ZXKA 2YQGA 2O72A 4XXWC 1OP4A 4APXA 2V37A 3K6DA 4AQ8C 3LNIA
chains in the Genus database with same CATH superfamily
1FIEA 4ISVA 3TJEL 1GGBH 1SF3A 2NDFA 1ZLSL 2OSXA 2DM4A 4RSYA 1XMEB 1YNTB 3UROR 4MD0B 4D0CB 2MOQA 2YD6A 4Z18A 4N1HB 1NGWB 3RE0A 1T7XA 3DUUA 1NEZA 2GG1A 3QDGD 4JFXA 4K9EL 4Z0BH 3T4YA 1JZHA 4JHAH 2E4TA 3F6IA 3S3DB 4JHZA 4WKXA 4IHOB 3WUWB 1SXSA 4GH7B 4YBLC 1CDCA 5C08B 1JMXA 1NAMH 4FQCH 5K9JL 3KR3H 1N7MH 1MFCH 4HWBL 5KJ4A 3W0WD 4JPVL 5D70H 1EH9A 4MFHA 4HS8H 5DSCA 1X3DA 5SX5H 3FT3A 2D0HA 4NBXB 3ZKMC 4BWUA 4PN6A 2A0LD 4YJZL 4DAGH 4LHUG 5FYJU 2A9BA 5D2NC 5I6MA 3ARBA 4D9QE 1F5WA 3BT2H 3ARZA 1VCBC 1U8IA 4Y88A 4RNRA 1JVOA 2HUEA 2DJ4A 1OAJA 2VN5A 3LD8B 1KYUA 3LH2H 2MTPA 3PWUA 1B0RA 2GEEA 3D25B 3B9AA 2A9NL 5E6IA 1YNLL 2QLVB 4W9IC 1LO0L 1U92A 1BMZA 3ZL2A 2F8XC 4HLZG 1DBKL 3SYQA 4HS6B 5CJOL 1BAFH 5FYJH 5L9DH 4MD0A 2VC2L 1GHFH 2XWRA 3UL4A 5KSBE 1VF5C 4D0CA 4MDRA 4HK3N 2ZWKA 5LNDA 2IDSA 4XPTH 3TGXA 1NGWA 4YHZL 4F8QA 3QJUB 4HD9A 1IM3B 3V4UL 4I87A 5F6HI 2LLLA 4OZHB 5EG6C 5K1VA 5ECGA 4FLRA 3QCUH 3RIAK 2ZD0A 3VXNA 1AQKL 1T1ZB 3LAFA 3N44B 1HDMB 5D7JC 2O61A 5HI5D 3FT0A 3H56A 1UH3A 3PGCB 4WNSA 1PY9A 5BZWB 3A47A 5FGCB 1MRDL 3BZFB 3OMAB 3BP4A 5LBGA 4NT6B 5KZCB 1UJ3A 1H19A 1YYMH 1FVDA 1A14H 3OLGA 4JRLA 4TNWK 1MHHB 4XNDA 5T5NG 4KTYA 1IKNC 3WDHA 2YFOA 4J6IA 4LB8A 1U8CB 3D25A 1HZKA 3NIGF 5H2BB 3V8OA 1QFWL 3BE1H 4XVTH 4UANA 3MLZH 3GRBA 5FXCH 3RVVD 1NC2B 4HS6A 4N8VG 1H8LA 2E75C 1RKRA 3GHBL 3FTSA 4XP6H 3R1GL 1GIGH 3FOLA 3JV6B 4OZFB 1LEGA 1JGDB 5CSGA 4ZTPH 3VD1A 2R0KL 4MD4B 3V9FA 4X4XB 4YHLH 1IM3A 1I7UB 4MNQB 3GSVB 3L4ZA 1FAIL 5IMOB 5DYFA 4MJJA 1ZHBA 1ETZB 2GSMB 2WO2B 2WWKO 4OZHA 5MHSE 1OTSC 3WJJC 3UBHA 1HE7A 2XY1A 1T1ZA 4I5BB 3BT0A 1HDMA 4UQAA 2GBAA 1UATA 7PCYA 4ZFOL 2A6IB 2GIYA 2FB4H 2VO5A 3LEXA 2ODHA 5FGRA 3RP1A 4M9OA 4XO9A 3SCMD 4G8AC 4IEFB 3T0AA 3PGCA 3TTSA 1MDTA 4L0ZA 1ZD6A 2J1ZA 4BH7B 1Z9OA 3P3UA 2YOCA 4J3BA 3BZFA 4ZFOA 4MXVF 5TE4H 5DVOA 4HAGA 5GJTL 4XN1A 5I1JH 4XPHL 2YD5A 3MACH 4PB0L 4ENED 3CVIL 1MHHA 4Q0XH 2KERA 4YBLB 4K94C 3UIZA 2VR8A 1UD3A 5I0YA 2O5YH 1U8CA 1WP6A 5CXPA 3GIZL 2YXWA 5H2BA 3ZQWA 4OFVA 4G8IB 4ZNCD 5HDQL 3X3FH 4FQHB 5D2NB 1RHFA 1NC2A 2H3NB 2FLMA 3RAJH 2EACA 5KYYB 4UT7L 1KFAL 4LLUB 3JV6A 1CLZL 4OZFA 2RCSH 1JGDA 3V0HA 4MD4A 3UZVB 2C9SA 5GGTL 1E5UI 5JA8B 2DWYA 2IWKA 1EANA 4X9YA 4XE5B 2ICWI 4MNQA 2W5PA 2P5PA 2BVPB 3QPQC 4IIZA 4KWUA 3UTQA 2QQQA 2JE8A 1KWKA 1ETZA 3BAJA 4UTAH 5C0CB 5GGTA 1ZY9A 5GS3A 3IJHB 3GO1H 5IBUB 2XYBA 2A6IA 2ZCLL 5GHWL 2BSEA 3QUYC 4IEFA 4S2SB 3FQ1A 4BH7A 2YGQA 3WIHH 3CAFA 4B7LA 5JR1L 4H7VA 2DF3A 4WGVB 1B2YA 3MLYH 3MJ9L 1P7KB 5I1HH 3IPFA 4Y4HD 3ARFD 5KSAD 5D7JB 3TBSB 4Y19A 1I7TB 3MUHL 4O00A 1C16B 4WY7L 1WT5C 4PPTA 3SD5A 4F92B 3CH1B 4TVPE 4G8IA 5E1QA 5C09D 2IDQA 4FQHA 4HJ1A 4JHBA 3FUFA 2G4GA 3IU3B 3WXVH 1R24B 1DHKA 2H3NA 3ZKND 5MEPB 5F96H 5KYYA 1IILE 3LNIA 5FOJA 2GJZB 4L5FH 3PRZA 4RMBA 3P0YH 4GW1A 5D7IE 3SYOA 2NXYD 2AERT 2RTTA 2Z8WC 5C0CA 1NCAL 2YS4A 4P5TD 3DTXA 4HJJL 1PG7W 5EA0H 1S9YB 5EU6B 3GEWB 3IJHA 3WELA 1IT9H 3SDXA 1NJ9B 3D3VA 3T08A 1B4RA 3CSTA 1DQQB 4BDVB 1DBBL 4EDWL 4QUOA 3BQUC 1DFBH 3QEQE 2IPKB 4J2QA 1TQCC 1JE6A 3KLAB 4GXFA 3JWOH 1P7KA 5D7JA 3TBSA 4AL8H 1WHPA 2Y2WA 3AT8A 1C16A 3ZXAC 3K2MC 4LDLB 5CCHE 3A4EA 2QGBA 2X9XA 1L4IA 2UXFA 3VE0B 3WNKA 4PAZA 3X17A 5MEPA 3CFUA 2WHVA 3CVBA 4OF8A 3E0GA 5EBWA 4XAKE 3OWRA 3KVQA 1IKNA 4UOJA 2GSGB 1G9MC 3GS0A 4XO3A 1PNCA 3DWTA 3S36X 1WZKA 2V0AA 2APTA 1G9EA 2WYIA 4URKA 2F2HA 2QQNH 4OM0H 2ZUSA 3ZTEA 5C7XH 3S37X 1VZGA 1FGNH 2G9HB 3B1TA 3QIWC 2JELL 2VUOA 4LP5A 1S9YA 5EU6A 1H3TA 4QHUB 3KW8A 1DQQA 4GRWF 4BDVA 4ZMPA 4G8EB 4XBGB 3W11D 4XT1C 2ORBL 3BC9A 3JYBA 3AS2A 4BZYA 5IESH 2IQ9H 3P4LA 4NC1E 4FA6A 3LZNA 3LQMA 2IPKA 2Q9OA 4TRPL 4FI8A 4PRHE 3RVTC 3SJVE 1TZOA 2O5XL 4F37K 3FZUC 3WJJA 2FATH 1CYWA 2BFVL 3MRHA 2Z64C 3FO0H 3MJ6A 5IJKA 3EJJX 4L8BA 4J3VA 5FLUA 3QUYB 4OCXL 2YN3A 4NQDE 2Y5TB 2CGRL 4XN9A 3Q6GL 2CALA 4JKPL 3VE0A 4AC2A 1U91A 2KLSA 4ABVA 3CHSA 5AWNL 2PPEA 1M7UA 4QXUL 3RGVC 1U8MB 4OAWA 1WBZB 2ZNXA 2FX7L 1OSPL 4AIXA 2WQAA 5SWQA 4Z7NB 2GSGA 3EDDA 1IC0A 2ITCB 4W9EC 1WS8A 4N0YL 4PJ5D 4HT1H 1AXIB 1MQKL 3H0TB 5GZNC 3DX1A 1SOXA 2QQLL 4L9LC 3TBYB 2GVYA 5J6HB 3RVUD 4Q9QL 5E8EB 3Q2NA 4QHUA 3ZIMA 4BSJA 5ECJE 1RVFL 2VLKE 2DI8A 2XTLA 1YEKL 3N9GH 2VXQH 4IBYA 1T0MA 3MUGB 4Y8AA 3KLHC 2XLLA 4KHXL 3VFTA 5D6CA 4ZUVA 5DGRA 3L7FB 3KPQB 2XZCL 3ELQA 2ROYA 1L9RA 3DHJA 4NI6A 1N64L 3LQZB 3FH7A 3OAUL 3G9VA 4XGZB 3GJFH 5C0GB 5JLZB 1UENA 1MELA 4J6RH 1N9PA 3HIZA 4K23H 3QUYA 2ZWNA 4KJPD 6FABL 4ERSL 5JW5A 3THML 2Y5TA 3FPXA 3I9GH 1RIHH 4HPYL 2CJUL 3BQUB 1SYSB 3IFPB 4KKLD 3IPBA 1TQCB 3HC2A 3SPVA 4RQQB 1MCOH 1F1GA 4FMKA 5I1GL 2EECA 2JJSC 2HT3D 2WKOF 3L4WA 1U8MA 4OGYL 1AFVL 2N01B 1T66C 1WBZA 3IGKA 2B14A 3VNYA 2H9GB 2ATKB 3C5ZD 4XWGH 1UCBH 1WT5A 1XBDA 2ITCA 3CVCA 3RIFK 2OR9L 1EXGA 1MDAA 2ZX6A 3BH8B 1MAKA 5IROC 2OSYA 3H0TA 3UADA 1N67A 4J8RA 3UBGA 2HT4C 2IGLA 2V9QA 3VB8A 3TBYA 4PRPD 3R0NA 1NCDH 3V4PH 4E68A 3QWQB 2NY0D 2P80D 5IBLD 4ZK8A 3M86A 3SGJC 1FL5B 4JR9L 5A2BA 5AAPA 1I9RL 1PKQB 3MUGA 3NIFF 2IF7A 4HZLB 4D9RE 1DJGA 3R19A 3IDJB 3L7FA 4AV0A 2DJMA 3QIWB 2F5BH 4P07A 3PS6A 4IDJL 2NZIA 4P4KD 2IMMA 3HS9A 5JLZA 4M8UA 2BVYA 2H26B 1RPKA 3WE6B 2QDWA 1OEZW 3ZMNA 2NY3D 4YPGA 3BQUA 1WAAE 1SYSA 5BVPL 3IFPA 4NFBA 1LQSR 5ACZB 3ULVL 5ISZB 4JCLA 3Q0HA 4KQ3H 4PWJA 4JZJC 4RBPK 3ISYA 1OB1A 2H9GA 2ATKA 2ICWJ 4PJHE 3AWFA 1JF5A 5FM8A 1DSYA 3UZEC 4XHJC 4KKAD 3BH8A 4KFZC 4XC3L 4Z7VE 3S5LG 4RWYL 3PABB 5I18H 4Z6AT 5IHBA 2X09A 5E0FA 4M1GH 4ODVH 1MFAH 3ZJAA 3H9SB 1RJZB 2YARA 4E9VA 1VEOA 4YDNA 4KO7A 2NLJB 4YHIB 3RGVB 1IJ9A 3C12A 5TQ0H 1F3DJ 5DMJB 3H2QA 3VRIB 3FO2A 2VDQL 1FL5A 1B0WA 4NCC1 4C4BA 1GAFL 4K0OA 1XAKA 3EJQA 3BFQG 2WVUA 3IDJA 3ZE1E 1XMWA 2AXWA 2Y1ZA 2XTJE 4XRCB 4DZBA 4L9LB 3QIWA 4OV5B 1M7DB 3NFNB 1OAQL 4WEEA 5IHUH 1FCCA 4GKSA 3W5NA 4CW1A 2DV6A 3MYJB 3FTXA 2H26A 2N7BA 1T4KB 5FCSH 2FK9A 2LGNA 2XT1B 3AQZA 3LIZH 4JFDB 4N1CA 4Y4FC 3WE6A 4LRNH 3ZYOA 5J1AA 3PU7A 1YAZA 4HXBL 1BBDH 4FNQA 15C8L 4JJ5A 3CFNA 3N91A 5ACZA 4KTGA 4AXWA 2DM7A 2FD6H 3VYPA 5HYIA 1UYWH 1OD7A 1YQVL 4LLWB 3US9A 4Q9RL 3CN2A 3WNMA 2JKRM 4JM2C 1WA1X 1S7RA 1OGAD 3L08A 1XGPB 1B0IA 5AW0B 1Z3GL 1NCJA 3FB8B 3HRZC 3PABA 3MRRB 5FK9A 3SKJH 3U6RB 1E9QA 1SBBA 4BKLA 1JAEA 4I4WA 3QWRD 3RZCC 4CNIB 5J6GB 3H9SA 3NZSA 3F7YB 1RIUL 3I02A 4LKXA 4CKQA 2WQVA 2DDQL 1OCCB 2NLJA 4YHIA 5DYOB 4J23A 3U2JA 4ZX6A 5E2WL 4WO4A 2XNAB 2YPVL 4X7FC 1U3ZA 3PAUA 1EHNA 1ORSB 4NRXB 5CWSB 3S7GA 4BHUI 5DZOA 2J8HA 3VMNA 3AY2A 1RZJL 5GZNA 3U4KA 3ILDA 2YPVA 5KSBA 5SX4H 3H42H 4JFUA 4L9LA 3QFJB 4NQEE 3HG0A 4J4PC 1UHVA 3TBWB 3T3PF 3HC3L 2YXVA 3HAEA 4KRNA 4UNIA 3MYJA 3HJEA 4KV5E 4K3EH 4Y89A 2J5WA 3GMRB 2P5ED 4Z7WF 2DJUA 4X6BB 3OMZA 2MCPH 3IDNB 1JNNL 3ZW3A 1S3RA 4JJHA 2WXKA 2B59B 1ZV5A 4PJGB 1HHGA 2QMKA 1V8HA 4LLWA 1JZEA 3ZZ1A 2DBLL 3PWVB 5FDWB 1H6UA 3QEUA 4I1PA 2DQEH 3W57A 4LASL 1TZGL 1V54B 1XGPA 2R39A 4L4VD 3AQYA 5I1LB 3FB8A 3D85B 3U6RA 5MEOB 1INDL 4FKEA 3WTSA 3AC0A 3LVTA 4GG8B 4TLUA 4CNIA 3GTVA 4IBWA 4J27A 5CN2A 3F7YA 4MASA 7FABL 3FQ4A 4JPKH 4DUXA 1HILB 2JJSA 4JZJB 3VXRE 4NOFA 2XZAL 2XNAA 3Q8AA 1T1YA 3CMGA 2MNWA 4NRXA 1K8DB 1ORSA 3NEOA 3SGEI 1O9WA 4NSKB 5D5MB 3K2UL 5KUKA 5IROA 2JSFA 2CXKA 4DW2H 2IG2L 1CDHA 3S35H 3P0VH 3T77B 1DO5A 3PGDB 25C8L 4ES9A 5DRNA 2WXIA 3TBWA 1KTKE 5I1IL 2CAKA 2CA3A 1PY0A 3IETA 3GMRA 4LLQA 4OVUA 4PJCB 2FGWH 4X6BA 4Z77A 3IVKB 4X80L 4KXZI 2IGTA 4UIMA 1HSBB 1ZPLA 4G6JL 2FBOJ 1AGBB 1T0PB 1KGCD 5KVGH 3QC6X 2A99A 3CZFB 3LNDA 5EOTB 2ZX8A 4PJGA 5IWLC 1BVLA 2I25N 2OBGA 2EKJA 5FDWA 1QNZH 3C87A 3L5WB 1JWUB 3N55A 5AG9A 3K5SA 1RZKC 2NX5E 3WFEL 5D1QE 3CN1A 4Y4FB 5I1LA 3D85A 3RGHA 5MEOA 2O5NA 5AW6B 3RX7A 4HKJB 1OWWA 1X5LA 2YEVB 3L1OL 3O2VH 4P46D 2QZQA 4FQIL 3T4AA 2J6EL 4YQXH 3CSYB 3VB9A 3GC3A 4KK5D 5I26A 4KQ4H 4YE0A 4B9JA 1Q0EA 2G75B 4F27A 3FMGL 4TUJA 3I84A 4HIJB 4TXVB 1IGFL 2EDFA 2Q7NA 4JM2B 3B43A 4NSKA 4YO0B 3UZEA 5A6MA 2J6EA 3KVPA 2P24B 3HRZB 2EXYC 4HG4K 5F0PB 3T0DA 1IO4C 4UT6L 3GMNB 3GIVB 2OULB 3T77A 4H8UA 3RZCB 2DPKA 3PGDA 4DQOH 5B22A 3A21A 1B2WH 3HE7D 5F7WC 2EVIA 2F7PA 1GYAA 4UT6A 1WICA 3FU5A 3KYKH 4PJCA 5T5NF 4G43B 3D39B 1BIIB 2DQIL 5TJWK 1J1XL 5F9JB 3WBDA 3D34A 2C4XA 4IHBA 3TASA 1HSBA 3D0VB 2EE3A 4PV1C 4AZ8A 2JWYA 1FBIL 3SKOA 2DD8L 1SLVA 1T5WB 3UBXG 1RUPL 4IS6B 1RZ7L 5BV7C 1R46A 3L5WA 2HJLB 5GGVH 3FFOA 3ELAT 2Q7YB 4FQJL 1E4WH 4Y4FA 3VVVA 3ATEA 4N20A 4TVPL 3QJHB 2DM2A 3R18A 4FKKA 1CFMA 3R06B 5JHDD 1YVLA 3JWNH 4ZOCA 4N2OA 3C60C 3KPPB 3HNVL 1AS8A 4JFYB 1RP8A 1VJSA 2ZYSA 3HR5B 4MB3A 3CSYA 3I6LD 1DCLA 2G75A 4BRJA 5J12C 1DJWA 5E9DE 4JM2A 1EERB 4L4TD 1OOWA 2Q3XA 3UG4A 4POZD 3GMNA 3RZCA 3RIAF 4UYPA 3NG5A 3A6BH 3DJTA 1QLEH 2WBJC 4LLAA 1G5GA 3QJXA 5SV3A 1P4IH 1EHKB 5IVXB 1S7WB 1PAMA 5IJVB 2YMXH 2NUPA 3BKYL 4G43A 1BIIA 5F9JA 1I8LA 5T1KB 5B3JF 1IBDA 3D0VA 3GLAA 4OLVL 3VXPB 5HVWA 1X7QA 2XX1A 1RQ5A 1BFVH 1T5WA 2Q5BA 4NKMB 3SQBB 1E30A 4IS6A 3VI3B 1DBAH 3AROA 1MQ8A 2R27A 5CSZB 3COOA 4J4PA 4U1GC 3QEQA 4P59H 3EFDH 1N8OE 4FG4A 2X4PA 5C0JA 1UOWA 2WY3B 4IMLB 5E6SB 1YUHB 5IBTH 1E4XH 4Z23A 4IM8A 3GTTA 3R06A 4A2FA 2PKDA 1HHKB 5EDSA 4YK4C 3KPPA 2I60H 4XNBA 4FZEL 4PUBL 1NCCL 4JFYA 4P2RB 1CURA 4K8RD 4ZZKA 1QQDA 5B8CC 3BUIA 4U6HB 5DMIH 5TH2A 1X5XA 5F93C 3NJLA 1UT2A 4HBCL 4FLHA 2A4ZA 3GLEA 4DQAA 4WFGD 1DVFD 5DVMA 1YJDH 5I9QC 3PWJA 3ATDA 4I88A 3UACA 3B2PA 4UMGA 4ZD3L 1CXIA 5E2VH 1A3LL 1EGJL 4GRWH 4R4ND 1S2EA 1L3WA 5KJRH 1GSMA 3DX2A 4YZFF 5AOKA 4NN5C 3F12B 1S7WA 4LCWE 4M02A 3CHXA 5IJBC 2NSXA 1TQUA 4S0SD 3HZ3A 5T1KA 2UZYB 4X0NA 3V0DA 1EGJA 1KXTB 1T89C 1G9NL 2P28B 1LQBC 3VWJA 1SN2A 1CE1L 4RRPA 5B1JC 5IG7B 2GJ6B 3SQBA 1O75A 4DGYH 3VI3A 2RACA 4G7VL 3FU6A 2P1YA 4U6VH 5CSZA 3O4LE 3CXHK 5HHMB 4RDQG 4W9HC 3N40F 2IV8A 1GY1A 2YPLD 1OP5H 5MP6L 4JFED 1YUHA 3IRCA 2X42A 2NSMA 1AO7E 4QO1A 2ED9A 1XSOA 2FJUB 3V0VB 1HHKA 4RIRB 4WV1C 5T3XH 4JPSA 4XMKL 5C9JB 2TSAA 5HI3D 1E9PB 2R59A 1YSOA 3WFBL 3O9WC 5IWLA 1CQKA 4HWUA 4NQDA 1PCXA 1BD2D 4U6HA 3TZVD 4ZMXA 5BV7B 4KDTC 1ZIAA 4Z7QE 4O9HL 2WZ5A 3LJ3A 1NC4A 1H3WM 1WEJH 3E8VA 4K5NA 5L4FA 2WLIA 3C60B 5GRJH 5LWYL 4P2OD 1CDJA 1UA6L 2P8MB 3VVWA 1NGPH 2PW2A 3QNZB 3OSKA 4PH8A 1ASQA 3IJYB 3LEYL 3F12A 2E3VA 1IGJB 4F80A 5J12B 5DCCA 3GSWB 1CZ8H 2XXFA 4JGMA 4U1HB 4MB4A 4TSAH 5F7DB 5SWSB 4JS7A 3VJ6B 5D72H 5E2TH 5JPNC 5I1DB 1UUNA 1WGOA 3FQYA 2IEPA 3IWUA 4M5SA 4WI2A 5CBEB 4CSZA 5EV7A 1CJYA 1RL1A 1CLCA 4FFVD 5IG7A 2EKSB 2E8ZA 3APCA 5BRZB 4E0RB 1KCBA 1URZA 1YY9C 4J7RA 2XG5A 2CPUA 3LZFL 3EFOB 3ISRA 5HDLA 4DKTA 1J0HA 1XBRA 1XGQB 2WP3T 3LKOA 5BV7L 1D7BA 1HHHB 5F7AA 5C0DB 1IFHL 1X9LA 5EOCH 1C7TA 3NRQA 4K7FB 4M6AA 2BZDA 3QVAA 4G6FD 4U1GB 3ROOB 4PWHA 3TVMC 1JOIA 3J7HA 2A3TA 3QH3B 4QHLA 5DA4A 5J3HD 5IMLA 1ITCA 2WV3A 1WWAX 4YK4B 3C60A 3BJ91 3GSRB 1J5CA 2VQUA 2DOCA 4BA0A 2P8MA 3UYPA 4FP8L 2QKIA 3QNZA 2VR3A 2H2PC 4A38A 3SDXF 1IGJA 3PIQB 1BOGA 1KJ3H 2CUHA 3QORA 3KL5A 5D7SH 4EJ1C 3WSQL 5F7DA 5SWSA 3VJ6A 4KKCC 1DVYA 5I1DA 3LZQA 3GPSA 1FG9C 2IDFA 5I9QB 2EDKA 2H0FA 4UUJB 2R8SL 4E0RA 4F8PA 1DDHB 2WBJA 5GISL 3NBNA 1PX3A 2E7MA 4NN5B 1CS6A 4FABH 4YEFA 2VM9A 1ZXKA 1XGQA 4XZUB 4YDZA 1A7NL 1HHHA 4MJ6B 3GRWL 2LVEA 1OALA 5C0DA 4B9GA 2IVFC 2VLRB 1OCOB 2BHUA 4IRJD 3QQXA 3O11B 2CNYA 4OZ4A 5DRWB 1U8OB 2XHNA 5HP5A 4IBQA 3GRWA 2IOIA 2ZT9C 4QI3A 3O8XC 1ZVYA 2JJWA 5DJXB 1JZ3A 3WMQA 4XMWA 4AITA 1XB3A 3TPUB 2EEAA 1OPGH 3QH3A 3JWDL 1K5NB 4WV1B 4FNPA 2XICA 3GSNH 4CDHA 3GSRA 1AQDB 3P11H 1WZAA 4UBDD 4ZUWB 1CR9L 3ABMB 3O9WB 5B8CA 4N2DA 1TSRA 4ADJA 3QZMA 4M7JL 1VFAB 3PIQA 3FCBA 4DP5X 5T1DH 1UH2A 4NP4L 1EO5A 3NZHL 3B9DA 4MHHG 4TQ8A 1R5IB 5GGSA 5DHVB 2X4UB 4MAZA 4E42A 1DQML 2GIMA 1KJ2L 3IU4L 3OMNB 4UUJA 4F37F 2YAHA 1JZIA 1DDHA 1U4FA 1SOQA 3C5XA 3WENA 1LLAA 5D1XE 3RUGE 2ZSVB 5ESVA 4IJTA 4DF9A 4LOFA 5I0VA 4I3SH 1KJ2A 1DE4B 3BUDA 2G3ZA 5C97A 1UWEL 5JPNB 3HNSL 2ZPKH 2UV3A 4JDTL 5E8PB 1E8ZA 3SDYL 2CK0H 1UD5A 2W92A 3W37A 5IFJA 3DRTB 2UVFA 5J06A 1CGSH 2UWEE 3RB7A 1TO4A 4W93A 3O11A 1UVQB 2QHRL 1V27A 2X89A 3HG5A 4FXGC 4UT9H 1BJMA 2VJ0A 5DRWA 3V5DB 4DPAX 2X4QB 4A55A 2XFGB 3LKPB 5DJXA 3P9MB 1VEMA 2ENYA 2B3RA 3M7FB 5ICZB 3LMJH 3TPUA 1RHHB 4KQ0A 2H1LM 4N26A 1K5NA 3LHPH 4NUPA 4N2FA 3P1VA 1C7SA 1UM5L 2ZAIA 1I1RA 4ZUWA 5GZOD 3KAAA 3O9WA 5ITFB 5ADPH 4HJIA 5IB2A 3DVNB 4KNUA 4KDTA 1PD0A 4TSBH 4U3SA 3TVMB 2E76C 1TVDA 1R5IA 3VRLE 4QCIB 1SVBA 5DHVA 3C8DA 3QDME 4X7CC 2X4UA 2FT8A 4QRQB 1N18A 3QJVB 2YGNA 5DD3L 3QXTA 4NKIH 2HFGL 4NKOB 2ZXCA 4ZTOL 4HU8A 3NCEB 1PY4A 1DVSA 2QZ5A 3VNZA 2J1YA 1N6QL 5BOJA 5EIIB 2G2NA 2YPKA 1DE4A 3TTYA 3NTCL 4H8WH 4JLRB 4XI5D 5BVJA 5JPNA 4NQEA 2JKSA 3FQRB 1AOHA 3U0PB 5E8PA 1D5BA 1I7RB 4UINH 1HEHC 1KC5L 3DRTA 5AZUA 2JCCB 5JOEA 1TSHA 4PJIF 2BDNL 3RY5A 3FRUB 3RWJB 1D6VL 1P1VA 3D69B 3V5DA 2FSDA 3NH7H 4NO3A 5FM5O 1P0SE 1XT5A 3P9MA 3ZZSA 2XPZA 3RWDB 5ICZA 4Q2ZA 1JI1A 2Y3NA 5AB1A 2BJML 5L2KE 3HMXH 4WEUD 3IJEB 5DJCB 5DO8A 3V0FA 1ZLWK 4MWFB 1Y18B 1ZVHA 1A7RL 1DUZB 2FR4B 4UTBL 2COVD 4WDIB 3STBA 1V55B 2DLFH 5ITFA 5LGJB 2X12A 1JD9A 4NJAL 2VDMB 2CO3A 3BSZH 1GYWA 1FNAA 4FQXD 3D0LB 1ED3B 3MMEB 3TVMA 2KHAA 4RFNB 3K1KC 4QXVA 1YYLH 1T2QL 1XHHA 4QCIA 4UTBA 1L7IL 2YEZB 4QRQA 4F15C 2FRGP 3VXRA 4L1SA 4YHKL 1EX0A 4JCMA 4MYWB 4WI3A 5JHLL 1F42A 4JVPA 3QQDA 3BGMB 1G4RA 1OCWL 3D9AL 3LNEA 4JKLA 5EIIA 3F01A 3O4OB 2C8NA 1VFBA 2HKAA 3DX7B 4H44C 3IBOA 5JHLA 4JLRA 5EEXA 4JKWA 2O6DA 1PIGA 3HI5L 1GKEA 5HDRA 3S3JA 1MFEL 1VSCA 3TYFB 3RDTD 1UURA 1FHNA 1I7RA 2QBWA 4O2CB 3U0PA 5KYUB 1CLYL 1N10A 4M29A 3EYVB 4X6DE 2ZP0T 5ETUB 1L5GB 4PIBA 4YDJB 3VM5A 3D69A 4KZDH 4OCSL 2DQJH 1TQBC 4I89A 3K0WA 3D8MA 1LK3L 4BH8B 1QYGL 3RWDA 5IOPB 3ULVF 3X13A 5IMMB 4KVCL 3WKYA 1H0DA 2Z6FA 3L3KB 2VDML 2VDKH 3G5WA 3IJEA 5DD6B 4YXKH 5HYQB 2N0MA 2WLHA 2P26A 1I1CA 4MWFA 1Y18A 2FR4A 1YCSA 5LGJA 1TTCA 4EKXA 3B4NA 2F53B 4FXGB 3MVSA 4BCZA 3D0LA 3O8XA 1ED3A 3TJEH 2AF2A 3MMEA 4AMWA 4EVNB 1BXAA 2FCBA 2YEZA 4TNGA 2CE6A 3EJCA 3CFKB 3T6XA 5B38G 1WFIA 3H3KA 4JRYD 4KROC 1TZHB 5E23A 3KJ6L 2XBDA 3BGMA 2W9DL 3TBTB 5ADOL 2CO6B 4NWUL 4GKZB 4LXFA 2A6JA 3GS7A 5E6YA 2OTPA 1UGKA 3DX7A 3UTPD 2GHWB 3BWZA 1BVKA 2ICEC 2Y6SC 3TYFA 5IV2B 5EO0B 4O2CA 3RFZC 5KYUA 2D7PA 2AQPA 2AEIT 3EYVA 4GI6A 3M17B 1A7PL 5ETUA 1L5GA 3FFDB 4FFWC 4YDJA 1S5IL 4E9QA 1TTBA 2P4AB 1P7HL 4BH8A 1P7QD 2DB8A 3L3KA 5DFAA 1XH3B 2WINB 4TQEL 5K5YA 1ZJBA 1A2YA 5F71A 2A9NH 5D7LB 4EBQL 1YNLH 5LHDA 2F53A 1LO0H 4FXGA 3W1ZA 5KYXB 4Q9BA 1ZEAL 3II3A 4G7RB 2VRQA 4BJLA 1TPXC 3FHEA 3QP3A 2VC2H 3CHQA 4GFXA 1FWXA 5M7QA 3CFKA 2VMJA 3ARDC 4YHZH 5KSBF 2AJUL 5E9DA 5CD5C 4P2QB 2CJSA 3V4UH 1RP9A 1KB9J 3WOVA 3UBFA 2WUCL 3TBTA 1F00I 2CO6A 2ZP8A 1ZVNA 3BUPA 4GKZA 4MDJB 4H4NA 4E9TA 3TO2B 4XO4A 2WNXA 1AQKH 2F5AL 1SJEB 4G9FE 4WK0B 5EO0A 3A22A 4F15B 5LGYA 5I23A 2K3TA 1B88A 1G94A 2FL5B 1D5ZA 4JDEB 1W72B 3VXTB 3UPCA 3HBPA 3OKEB 4LLMB 3HUJE 4ZBJA 3SGDI 3X1FA 3HC0A 2IH8A 3VRJB 3E1ZA 2KLTA 4QT5B 1MRDH 4U1SB 2K78A 1ZK5A 4XCEB 4OU3A 4NZDA 1F2QA 5F7BA 3LSOB 4PJBE 5CD3B 2IDCA 2WINA 3VUAA 5CBAB 3NIDB 5IK3B 2XVBA 1S3KL 4LSDA 1QFWH 5CJQL 5D7LA 3ZRSA 5PAZA 1OT2A 2NY6C 2QADB 3VDAA 3UJTH 4D9LH 4Y5VC 5KYXA 2FECI 5HYEA 1TQBB 2AEPL 2AI0L 1IBGL 1PLGL 1BX2A 4BA8A 3GHBH 2V7NB 4WUUE 2JKLA 5E94B 1IM9A 3ESNA 4XP5L 2MHAB 4FQPA 4AM0B 1G9HA 4U3XA 2HVBA 4NWTL 5FYLE 3ZKXC 4Y19D 1B9KA 2EDDA 1E4KA 4P2QA 1IEBB 2FX9L 4OIAA 4IRSC 3TBVB 2AJVL 3WNIA 5I73C 3IDGB 4AQAA 3IM1A 1GCFA 2F74A 3TO2A 1NUNB 1HQ4B 1WBYB 3BAYA 1SJEA 2Z93A 1NOFA 1PU0A 1UGNA 4WJKB 5D1XC 2BNUB 4W4OC 1SVCP 1IC4H 4NM4L 2FL5A 1KCKA 4JDEA 1W72A 4LDOB 3VXTA 5ABDE 5I5RA 4LLMA 2IDTA 1KBPA 4KROB 3ZE0B 2OP4L 3VRJA 3BCFA 4U1SA 3VGEA 4CN6A 1G87A 4NNPH 4WFEE 1FUNA 5GJTH 4XCEA 5DXWA 4YMPA 3CVIH 3FXIC 3LZRA 3ZE2E 1R3LB 4BK5C 5CD3A 2DMGA 2ICEB 3QJRB 5EN2A 4KKPA 2BOCB 2Q0ZX 3F7KA 1Z3RA 4KKRA 3RFZB 5IK3A 2H7WA 1DQJB 2RHEA 3D3VD 4XE0A 1OT4A 4OZFH 1VGKB 3FQXA 1JF1B 2EIMB 3PL6C 4LT7A 5HDQH 4PJXF 5DMGC 2E7CA 1YY8B 2V8LA 3KPMB 3CZJA 1KFAH 4UT7H 1PMYA 1CLZH 4J3OC 4AM0A 1G0XA 5GGTH 3Q2VA 1OARL 1DJIA 4H25B 3BVXA 3ZU8A 1OHZA 3I6KA 4LSQL 1IEBA 2Q20A 3M07A 4AW7A 3PDDA 2BERA 3F84A 2MPAL 4IBZA 2XXGA 1LE5B 3LPFA 3NP4A 3OAZH 5I75B 4OCWL 4HF5L 4FQ1L 1HQ4A 2LU3A 2Y7QB 1GY2A 3BKML 3EBIA 2W8CA 1TPXB 1V7ML 2BNUA 3BESR 1JCKA 2Q8BH 4OIFA 3KYOB 2KPNA 2OS7A 2ZCLH 1QLRA 1YPZB 3DV6B 4ODBD 4TUKL 4DGUA 3ARDB 4P5MB 3KGRA 4LRIA 5C0AD 5TDOA 5JR1H 3MUZ1 3UGUA 5C3IA 1O9VA 3LPOA 3MX0B 2YRBA 3C9NB 2TRYA 4U1LA 2HJKA 1R3LA 3UO1L 4KZCA 5E1AB 2BOCA 4X99B 2CRMA 2I5YL 4HHGA 4QHKI 3N1MC 3RFZA 5E4OA 1DQJA 4CSTA 4G9DB 4PJ8C 3L3DB 3ARED 3EYOA 2J25A 2G3XA 4KDVA 1GS7A 2ZKWA 4XCFL 4M8QA 5L4JA 1YY8A 3BZ5A 1MLCB 3FK3A 3U1SL 4L1DA 2RQ8A 2X1OA 1VACB 2WXJA 4H25A 3RWIB 4Z3GA 1JSYA 4XBEL 5FECA 2FWOB 1A4KA 5D7IF 1PLBA 4NYLA 2NY6B 2ZOWA 3L5JA 1NCAH 4ZUUA 1LE5A 1JN6B 4Y5VB 3WUWG 4HJJH 4H1LB 1A4JB 4KMQA 4CL7A 5F70A 2Y7QA 5AG8A 4PVLA 1IC1A 3L5IA 3ZUCA 4M7ZC 4OD3H 1EHAA 1VFMA 3KYOA 1ASPA 4TMPA 1MI5B 1YPZA 2GC7C 3DV6A 3P77B 4HX1B 4P5MA 3EDFA 1WBXB 2J8UE 3HG4A 1DANT 4LSUL 4KGLA 4IRSB 3I9PA 3CVHL 1NBCA 1CGXA 3HNTH 3C9NA 4KXAA 1H3PL 1MWAL 1EBPA 3FSAA 4YHNB 1WC7B 5E1AA 3VG9C 5D1XB 1UD4A 4X99A 5GGVY 4ZMLA 5ABAA 4A7QA 4KJYA 2EEFA 1AKJB 2HLFC 4G9DA 3FB5A 1IAIL 3OHMB 4PWFA 1MWAA 4LEOB 3MOBL 5J6SA 4MMZA 5DI8B 4X9BA 1MLCA 2CR0A 5EORL 4FRWA 2DH3A 2ETWA 4KJWC 4BINA 3MSPA 1VACA 2XRAH 1F97A 4ZQTA 1QUPA 1DBJL 1QHOA 1HEZB 2XZQL 1UASA 2ZUQC 2X2JA 2ZUYA 3PL6B 1JN6A 2D7NA 3PQYB 5H4ZA 2JELH 2YOAA 1I1YB 2K9FB 4J12A 2FQFA 1PZSA 4ZAKA 3ASOB 3TH4T 1MCPL 3NJVA 3K6SB 4AK1A 5HDBF 3P77A 2C9VA 3U0WL 4K7PL 1WBXA 2FO4B 4AYSA 4PGJA 1X9UA 2MIZA 3DXAE 3K8KA 3QDMB 2YKKA 4IRSA 4TRPH 4FNUA 3VFSB 2YD1A 1IEHA 1CDGA 2O5XH 4H8QA 4OF6A 1BEYL 2X38A 4UWQB 5HXMA 5L8KB 3Q2WA 4OB5H 3FC8A 2XN0A 1AD0B 2BFVH 4YHNA 3CU7A 1GGUA 4OT1H 5D1XA 4M1CD 4W4OA 1T83C 4HLEA 1LD9A 5JHMA 4MHHI 1AKJA 2GK0B 2L8AA 2CGRH 4XBPB 4G11A 2IBGA 2OJZL 1D5IL 3KZ8A 3F65A 2PNDA 3OJ2C 1CFQB 5AWNH 1ZE3C 2VDNB 4QXUH 2D0FA 3VGFA 1YMMD 2CIIB 2UWEA 1U93A 4D7PA 3W56A 3ZPDA 4OZFG 4URTB 4BK5A 2CR6A 2WGNB 4MDIB 5CZVH 4NUJB 1M56B 3AXLA 3D2UD 4P23C 1URIA 1LK2A 4N0YH 5KBMA 1T0OA 2OMUA 4PJ8B 1E40A 3ES6B 3PL6A 3Q8FA 2XWJB 1JFHA 1UQSB 1QTSA 3AITA 5EB9A 4ZPVB 1I1YA 3EDKA 4Q9QH 1KG0B 5SWZB 3GBNL 3WEXB 1FZOB 3BHBB 3QB7C 3BW9B 3GT6A 4HUMB 2BH0A 3O45B 3V4VB 3PPSA 1QSFE 1RK0B 2FO4A 3NMEA 3OC8A 4KHXH 3ULVD 4WTWA 2B8OT 3UYOD 3G08A 1I3VA 3QDMA 1G6RB 1F2XK 2Z7UA 2XZCH 1A4BA 5CKGA 4ZXBC 3MRCB 1N64H 3BAEL 3TNNA 5F1IB 3K71B 1AD0A 4JFFE 5JW3L 4RETB 4M7ZB 1MKFA 1DVUA 1A1OB 4D7BA 4FQQB 4NGHL 3CHRA 3MC0A 4ERSH 1Z9MA 5B7MA 4B9KC 4RGNC 1QBMH 4R8WH 4WWKD 2CJUH 3CFCH 1LP9B 4G8GE 5FCUL 1HINL 3MJ8A 1OVZA 1CFQA 4B6ZA 4L0YA 3IGLA 2KMWA 3DMMC 4FLSA 2EC8A 4X6DB 2YWYA 1HJCA 4OGYH 1AFVH 2CIIA 1HYRC 2NW2B 1IGIL 3I74A 1YEFL 3P3SA 3CXDL 3VG9B 4MDIA 3VU1A 2DYSB 1VA9A 2E46A 1HN1A 3REWA 3TV3L 2PO6D 3T0ED 2OR9H 1PFOA 5GS0C 4LU5H 3X12B 2EZ0C 3ZDZE 3QWOB 4LCUB 1AR1D 5IHWA 3ES6A 4W9CC 3SPJA 4IJ3C 2XWJA 1UQSA 4ZPVA 3ZR5A 4JFOB 3MLWH 4YSSA 5AUMA 5SWZA 1THCA 5IBUG 1FZOA 1AVAA 1G6RL 3QDHA 3BHBA 3BW9A 5EUOE 5MENB 1UTDA 1J11A 3MLUL 3O45A 3F62A 5IB5B 3V4VA 1I9RH 1C5DB 1RK0A 2WQWA 1A6ZB 3OZLA 1A1NB 4D9QD 2IH3B 3L5XL 1G6RA 4NZUL 4PP1D 5GS2D 1A3RH 1BF5A 5DHMC 4YXHL 1F90L 5C0EB 4IDJH 2RFXB 1OL0A 2CRIA 4FJ6A 1MAML 4TULH 4Z78B 4FQQA 4IMKC 5HHOE 4WO4D 5LNGA 4PGBB 1XH2A 4LEEA 3C2SA 4WW1B 3ZYZA 4P3CL 1LP9A 4LBEA 3GHEL 3SDCD 1I3GL 3ULVH 5AVSB 1WAAF 5JORB 4X6DA 4H20L 2ADFH 3O0LA 5FX3A 4GLRI 4DN3L 1KDJA 1M7IB 4E41D 3OMIB 1TCRB 2VDOL 3U48A 1E8YA 3CBJB 3KNBB 4IBTA 4RWYH 4XC3H 4PJHF 4B50A 1RLBA 3D1MC 4LCUA 5FKPB 1WRFA 4Z7VF 1TZ8A 1G9MH 3BP7A 4X9IA 4ADGA 4JFOA 3QJOA 4MAUL 1X5JA 2E7LC 5LUMA 4N28A 3I3BA 3FUDA 5E08L 4IOIB 5ICYB 3GTNA 2VDQH 1EDHA 5IB5A 4I77L 1C5DA 1A6ZA 3G5ZB 4P23B 1A1NA 4PJ7F 4PJ9B 2Y25A 4TSCL 3T2QA 3WIFA 3V9EA 1YC8A 4QTHB 3AWEA 3HLAB 2NR6D 2AITA 4HQQL 3ZE1F 2OI9B 4RCAA 2QHLA 5AW5B 3HI1B 3CX2A 2JKIS 5C0EA 1MHCB 1T2XA 3BRFA 2PMZA 4QHKJ 2RFXA 4YHMH 3R7QA 4DERA 2BVQB 2X4TB 3DSNB 4UM8B 4Z78A 1MSPA 2C7UB 4CMMB 3P02A 4PGBA 2Y1YA 4HXBH 1RU9L 2A77H 3WFHA 3IGAB 4OTXH 4PU2A 5A43C 5JORA 4ZXBB 1SUJA 4XN5A 1YQVH 1NGQL 1RD6A 5GS2H 3ZDXE 4KHTH 3DUSB 4PCKA 3CQPA 1NMBL 1CU4L 3MCLL 1ZHLB 1M7IA 4B9IA 4YWGL 1TCRA 1E43A 3KNBA 3INOA 4NQXA 1LO4L 2J88L 2OMVB 3H9HB 4BEIA 5IB4B 1Z3GH 3N6YA 1XGUA 2H2SC 4HZ1A 3B9VA 3Q5TA 4NNYB 4O02L 4RGNB 3NQIA 5FKPA 5AFAA 5K9OB 2ESVD 1J5OL 4BFJA 5DZJA 4YSAA 1OTTD 1RIUH 3DO7A 2BSSA 4F7MA 5A6LA 3DMMB 2V2WB 5DUJA 3MRBA 4UAHA 4Z9KB 4ZX4A 2OFQA 2YPVH 4IOIA 1KXHA 1XSJA 4LF3B 1B6DA 4J3TA 5ICXA 2WB1A 1WWWX 2C3GA 3G5ZA 1Q9OB 3HAEH 5GGQH 4WUUB 5JNYB 2PXYD 1PJ9A 2BVEA 3HLAA 4QTHA 2W07B 4AYEC 4IJ3B 4EI6B 1SQ2N 4JFZL 4I18B 4UOW1 4OFQA 1XH0A 1A65A 3WJLC 5DJDB 1MHCA 2EDQA 4U1KB 3WIIH 3HC3H 1S7TB 2IBZX 5KN5B 2BVQA 4Z7AA 2X4TA 3DSNA 4UM8A 5F7KC 3B7UX 2GTWB 4WKZB 4KV5F 2QSQA 5KS9B 2GI7A 4G9FA 5CCGE 3LOWA 1CYXA 2C3VB 3MO1B 2HTLD 2PYEE 3HRPA 3IGAA 4F3FA 3HZKB 1MWOA 4ZXBA 5I1KL 4NRYA 1P6WA 3OKMB 3FB7B 3DUSA 2K7QA 2OSLB 3SY6A 1HWGB 1MCWM 4QRPE 5I1CL 2ZWZA 2EIBA 3CXFA 4YLBA 1TZGH 4J2XA 4HETA 3L4XA 3E80A 2OMVA 4PBVC 4WI4A 1DYZA 3OTTA 1T21B 1INDH 2EYRA 3L6FB 4S1DD 5L8JB 3UAFA 2ERJC 3II2A 4B97A 5GS0L 3DMMA 2V2WA 3NSCA 2XZAH 4UOZA 3C6EA 2GC4C 5AVTB 5DVLA 4S1RL 4QRRB 4FG0A 5FYLL 3MUJA 4R7VA 1JK8A 3EO9H 2DMKA 3FUHA 2DEXX 4UU9A 4WUUA 5HYJE 3FFCE 1JV2B 2IG2H 2OMTB 1FL3A 1TFHA 1OXYA 4ALAC 4EI6A 3RBGA 3S88L 1A6UL 1UKTA 25C8H 4HKBB 2XN2A 4I85A 2BS71 3RJQB 2WQXA 3GFUA 3KDPB 4JRFA 5KN5A 1WFUA 2A9DA 1K6QH 3OGOE 2GTWA 3RL1B 3NJGA 4X80H 2WIIB 2V3EA 4G6JH 4PJ6A 1FA4A 2C3VA 3MO1A 2XVLA 2FEDC 3HZKA 4XAWL 2IOOA 4G3YH 1RFDL 2R15A 1TETL 4H26A 2L4OA 3OKMA 5CZRA 1MCJA 1GKOA 2OSLA 3KE0A 3MU3A 4IOFD 4NCDA 1BQ5A 1BBJA 5I24A 3L48A 5EU4B 1TYJA 4IMKA 2UZIL 1VIWA 1XO8A 3M8OH 3RLSA 3U4BL 4LESA 1T21A 2ZZUT 1MW3A 2FAUA 3L4VA 1RZ8B 3P30H 4FQIH 3IFOB 3QJFB 2J6EH 4WTQA 4XX1G 1MVUB 3DPBA 5G2NA 4RX4A 2WZAA 3CU1A 4MAYC 5BZZA 4QRRA 1IGFH 3VQ2C 4KKBC 2VSKB 2EO7A 4MCZB 1ETA1 5H35B 1INQB 3VQLA 2FIRT 3FS9A 3QO0B 4HH9A 1HL9A 4UT6H 2OMTA 1E5CA 3WMSA 2HRPL 1NIFA 4BSWA 4QXTB 4GP4B 3WTUA 2E7LA 4XNMA 5C86A 5KEZA 2GBTA 2YD8A 1RMFL 2NY2C 3LY6A 1SPDA 4FOMA 3RRQA 3RL1A 4LOUD 2DQIH 3DRQA 1UXSB 2VLJE 1ACCA 5CF3A 1XAUA 1IBHA 4F58L 1O6SB 3GINA 3OXRA 3MLVH 2DD8H 4FX5A 4BFEA 1JJUA 2Y7LA 4XAKD 4HIXL 1RUPH 1ZHNB 1RZ7H 2KKQA 4JL1A 2J8UB 5F2FA 4HUVA 3L17A 3DOIA 4XMPL 4KTDL 2V9UA 2C9UA 4ZW5A 4PS4H 3C09C 3Q8CA 4TVPH 3QXAA 5C0BB 4N22A 2BMKB 1CFVL 2WXPA 4QMEA 3OXSB 2CCVA 1JP5A 3GKWH 2EVFA 4OZGB 3O3DB 1AGCA 1LO2L 3HNVH 3QJFA 4L1HA 4ZS6D 5T1LB 3VWJD 3S36L 1MVUA 2DWEB 4HUXB 3EO1A 5EOCJ 2ITFA 3O6KL 4X98B 2BP5M 3S37L 3O3BB 3QZWB 5H35A 1JNHB 1INQA 4PRHD 3SJVD 3QO0A 5ERWB 1NCWH 2ENQA 3N1QC 3SDAD 4QXTA 4PLOB 4JDZB 1JGEB 2PR4L 2XWTB 3AABA 5FW8A 4ZFQA 4AENB 2YD3A 1WFTA 2BOLA 3MZGB 4MQXD 3GSUB 4PW3A 5K39B 2QSVA 2V4LA 3BKYH 1WSST 3LKRB 1UXSA 4YSTA 1NIBA 4UV7L 5I6XC 4BZ1L 1NKGA 1O6SA 2JNZA 4DK3A 3FCSB 3UAAA 1KN2L 1B3IA 1O7DC 3BDYL 4GAYB 4CC0A 4QOKE 2AJ3A 2EICA 3RA7L 1S8DA 1TIUA 3ARGC 3WJLA 3K4DA 2J8UA 5K9KB 1TJHL 4CAGA 5CR1A 4BCXA 5KANI 2X1XR 4UQIM 2OR8A 3QCTH 5E00B 1BQHA 1USQA 3LTVA 5CU9A 3VGGA 4OZGA 5AW4B 1BAGA 2LVCA 5HGDB 3QPXL 3M1OA 1H15B 2VLKD 3LN4A 4HUXA 2WCSA 4J1UB 4P5SA 1ZV9A 3W9EB 2WOYA 4HBCH 4DVRL 4JFPB 2Y7SA 4KY1L 3QZWA 5F89A 2AKRB 2HG5B 4LE8A 3Q8EA 3OR7B 5HGBB 1S9WB 3CZKA 5ERWA 2UY6B 1NCBL 1L9SA 4N9GB 4JDZA 1JGEA 2XWTA 4ZD3H 1EGJH 5GRXG 2CJTA 3ML9A 3GSUA 5K39A 4Q9CA 3CDGB 2YUVA 4MAYB 4X5QA 3LKRA 3ZDWA 2Y07L 3UX9B 3DYMA 3FRPB 1S5HB 2D31A 1IU1A 2E9GA 1G9NH 2HH0L 3X2QB 3FQTB 4JREC 1PZ3A 3O3UN 1SEQL 3ZSSA 1CE1H 1XL4A 4LSRL 1EEYB 2AVFA 4GAYA 4G7YL 1QFHA 3OKKB 4NERA 3OPZH 5BS0E 4G7VH 1HCZA 1QSFB 5I28A 4KZEL 1QI4A 3DXAA 2NY2B 3RNKB 1QOKA 4IRZA 2B9AA 5MP6H 4NXSA 4ZUSA 4RFEB 5DO2D 4XVSL 3QORD 2HKHH 1J8HD 4EQ2A 5FM5M 1MG2C 2WC7A 1I7ZB 3ATAA 4XMKH 1HXYA 3KPOB 1B0GB 1JCVA 2AC0A 1IE4A 3WFBH 2IBZY 5HGDA 3U9PL 4BFIB 1H15A 3T3ME 3UG3A 4J1UA 3K1DA 3AY4C 4M8VA 2FT6A 5LDSA 4JFPA 5D1ZI 1SHSA 3VFUA 3BQVA 3C09B 3G5VB 3TN0C 4FNRA 2HG5A 1QFWM 2DKMA 4HV8B 1P5VB 4Z7QF 3OR7A 3KXFE 1S9WA 5HGBA 2UY6A 3KG5A 4D94A 4CBZA 5AD0A 2OMYB 2YSTA 1NAMB 2XOTA 3SOBL 2EH7L 4R7DB 1UA6H 5DVKA 3WFCH 1S7VA 3LEYH 4ELKA 5HI5C 4MAYA 3N5AA 2YRLA 4CMHC 4JQIL 4BXSV 4N5UA 3HC4L 1AY1L 3FRPA 3VSQA 3VFRA 1D7CA 4E9SA 3FQTA 3MUY1 4AIZB 2KUTA 2Y72A 1EEYA 1QP1A 2V5MA 3CG8A 4TOYH 3R4DA 3OKKA 4JQIA 4P2AA 1IZJA 1X5KA 3KW7A 3V5KB 1QSFA 1DQDL 1BA9A 3BRGC 4DP2X 1MFDL 3RNKA 2AXJA 3PLYA 3SBWC 1M6UA 1I9JL 5I6XB 1JDCA 5CINL 5BV7H 2R29A 1BGXL 1BG1A 1UA7A 3RVVC 1B0GA 2MFNA 4XPAL 2EXWD 5IF0A 3X1GA 2Z31A 5J56B 1T7VA 3ARGB 3ZYJA 2PWHA 1YQ2A 5L4MA 4WTXA 3UABA 3N1GC 4G8GA 4XVJH 4PRPE 3ZX1A 2WMPA 3CSPA 3G5VA 1NBVH 1J1PL 5EEZA 4HV8A 3BGFC 1HQRB 4HOZA 1QSZA 2XTJD 3VXUE 3V6ZA 1LMIA 1E7UA 2EDYA 3MV9E 3U2IA 1ZT7B 1YEWA 2OMYA 4HMCA 4QJ4B 4R7DA 4TLSA 4FP8H 4PP2B 1E6JL 4ZNEE 2X53A 2EDNA 4M3JA 3SCMC 1HWHB 4R4BA 1D7FA 3KS0H 2FJHB 2YAMA 3WSQH 3QDGB 1RK1B 2WW8A 5DJ8A 1T0NB 4UM9D 1KYOJ 5HBBA 5F0JB 2LE9A 4Z7UB 2ZKHL 4AIZA 2R8SH 1W2KT 5EUOA 3I75A 3TT1L 4ENEC 3PGFL 2XQBL 4N6QA 5GISH 1GPOL 3W0WB 1PL3A 4NQSB 1HKLL 1T1XB 1UWXK 4GAJL 2L04A 2VSMB 4DWHA 1BVNP 1A7NH 1NDGB 3QI9D 3L1GA 3GRWH 3VWKD 4LIQE 4WWNA 1XZWA 2QSCL 3IMUA 4AVHA 2YC1B 2Y0SA 4GSUA 4N0UB 1OM3H 2MMXA 2Z91B 4G42B 2IWEA 3ARGA 2AFNA 1M1XB 3UMNA 3X3GL 4G83A 4OFYA 3HBZA 2YD7A 4OQ1A 5AVVB 4MJIE 4WWPA 5HHNB 4XXDB 1R34A 1OP9A 1J18A 1HQRA 3JWOC 4XOAA 1ECYA 4ETYA 2WNWA 2N1KA 1ZT7A 5I66B 5ABZA 4NQED 5E1IA 3MJWA 5DC0A 4AL8C 5C3LD 2PW1B 4FA8A 5DZLA 3KMDA 5DD0L 2ZTBA 2FJHA 4NP4H 1IQDB 1RK1A 1RZGB 3QDGA 3CLFL 1BFOB 3TN0B 4L37B 2IH1B 4JFWA 3QAZC 5JZ7C 1KJ2H 3IU4H 2XETA 3BWSA 3EDJA 3HEIB 4B9ZA 3C6LC 4X0KB 3S96B 4Y4HC 1QLFB 3ARFC 5KSAC 2W65B 4HHAA 5FO9B 4JN2B 5FA3A 4X6FA 4ODUB 4JO2H 5AVWB 1BQSA 2VERA 5IGXL 4BUGA 1PEWA 4CMHB 3RUGF 1J5DA 1EUTA 1I75A 1HHIB 4Y2DA 2G30A 2A73B 1UWEH 1NDGA 2BIMA 3GI8H 4HCIA 3QCVL 4OLYH 1XGZA 3PJLA 4XNXL 5KG9A 1MCHA 3SDYH 4BD4A 35C8H 12E8L 4OF7A 1NLBL 2FVNA 3ZKNC 3VFOB 3VXRD 1CXKA 2X3CA 4N0UA 4BM7A 4G42A 5DJAB 4W9GC 2QHRH 1DJXA 5EZLB 2OCFD 3KH4A 1CLVA 1M1XA 2UWEF 1Q1PA 3HI6H 2BM3A 4WSKA 1U8PA 2NXYC 3FQWB 3KPSD 4XXDA 5D71L 4R2GD 2DLHA 3LS5L 3EXJA 5KVFE 1MCFA 4P5TC 2HSIA 1U6AL 4A66A 3N42B 1AGEB 1L9MA 2PW1A 2BCKB 3EBGA 5DHVH 3WLWD 3MFGB 4MQSB 1X6NA 4ORGA 1OV8A 4J3OF 2VAAB 3AY4A 5EC2B 1CF8L 1MCQA 2BZCA 3CFDB 4AWJC 4E5XB 4UCFA 1MCKA 4IU2B 2NQCA 3EGSB 5FC9A 1XF2B 4L37A 2IH1A 5D9SB 1EK3A 3MGOB 5DD3H 3MLPA 4HWEL 2HFGH 3AS1A 4X0KA 3S96A 3MGAA 1QLFA 2DQTH 2W65A 4HW6A 1IAKA 1WTGT 2NX5D 4JN2A 5FO9A 5I5IA 3ULUD 2OMZA 5D1QD 1N6QH 3FF8A 3SCMB 2IH9A 3K3QA 3V95A 2OMNA 3EIFA 3NTCH 3AM8C 1WD9A 2A73A 2BY2A 2WXLA 3VFOA 3F6LA 5I6PA 5DJAA 3SYAA 2BDNH 5EZLA 1D6VH 1NOLA 1E67A 4C4KT 3IF1B 1AGFB 5DD1H 5BZXA 2HWZL 3BD4A 2WKLA 3FQWA 3DX3A 3SBWA 5DUMH 2BJMH 3N85H 3EJYD 4M9PA 2FZ3A 1OAUL 2GBVA 3VI4E 1Z0NA 2G5BB 4NLAA 4Y9CA 4GSXA 1A7RH 7CGTA 4UTBH 2AEOA 4PRNB 1AGEA 1CB4A 3IS1X 4NJAH 1KPUB 3L3GB 1NFAA 1PD1A 2VAAA 1BQRA 5EC2A 3JQOB 3CFDA 3DHUA 3W11C 4E5XA 4EN3B 3DVGB 4JPIB 4IU2A 1L7IH 2E9BA 1XF2A 1EJFA 3OKLB 1CK0H 1ETB1 3BN9D 3MGOA 4HDIA 5D9SA 4I9WE 5H37A 4FGMA 3MNMA 1SM3L 4JRWA 1TEFA 2EH8L 2J3SA 4YHKH 5EBGA 5KVEH 5JHLH 1XFPA 2B1AL 3EHBD 2P7TA 1FYTE 4KJQD 2DIJA 3D9AH 5FB8B 3SCMA 4OBRA 5HPMB 2J44A 3DSFL 3FFCA 4V1DE 5HYJA 4U7SA 3AG3B 2IGFL 5T3ZE 1WIUA 1MFEH 4PJAE 1TYRA 3QAZB 3F83A 1J48A 4ILDA 1CLYH 4HIPA 5KTEH 4IKIA 4PYHA 1Q0XH 3C6LB 3Q05A 2KZBA 4Y4HB 3AAZB 3ARFB 1J0YA 5KSAB 5E9DD 3MBWB 1X7SA 1AGFA 1UM6H 1LK3H 3MCKB 4YSUA 4HWNA 3SE3C 2VDMH 4LGSB 4F5CE 5C09B 1J88A 3LKQB 5MERB 2FBRA 2G5BA 4BK4A 3RVUC 3G6JF 4LLVB 5EOQL 5I76B 1ZDQA 4P2CG 4A2GA 3L3GA 1TCMA 1QI3A 4G80B 3WHE1 1QX1A 1XGTB 3IYLW 1XEDA 3DVGA 1QFUH 4XB3A 2EUVA 2D8KA 3OKLA 4TNFA 1V3MA 1ZTXH 1KCSL 3BRDA 2DIAA 2GK2A 4P5TB 3QNYB 4FYSA 2EDBA 2I32A 2Y69B 3KJ6H 2XV2A 2PPDA 4W70A 3U4EB 3ESOA 2D3JA 2O6EA 5ADOH 1ITBB 1HE8A 2ID5A 5HPMA 4DUVA 4KJPC 3QRGL 5FHAL 1MRCL 5TF0A 1EFXD 1Y1UA 4UQ9A 4KKLC 4LQFL 1Z66A 4QXGL 5DJ2A 3NABL 3QZNA 2HT3C 4Y4HA 4OJDH 3AAZA 3ARFA 5KSAA 2VLJA 1S5IH 3EH4B 4AUUA 3MBWA 4WHTB 3C5ZC 4KTEH 4QTIL 1CBVH 2GY5A 3MCKA 1IQWH 2J8OA 3I6LE 5AAWC 1VAHA 4C56D 1XCTB 4GI9A 4POYA 3QDJB 1DN2A 4OGXH 2NYZA 2Z0UA 3TA3A 4TQEH 1D7DA 1ZOXA 2D3NA 2WXHA 4XP1L 4WTZA 3CC1A 1YEGH 4L4TE 4EBQH 4I48B 3MRPB 4UI2A 1F4WL 4F7CA 4WWOA 4AM0Q 2NY0C 4LCWD 2WO3B 4CUCA 5IBLC 3IMVA 3L9RB 5I76A 5L7XL 2HLEB 4PJDB 1NCTA 1ZEAH 2XA3A 1C5BL 4G80A 4R5XA 1XGTA 4PWGA 1L6PA 4AQ8A 6TAAA 1ZGLP 3QS3A 2ZOOA 1IRAY 1XIWD 3RKDD 2GJPA 1GOGA 4IQHA 3KWTA 3QNYA 1Q0YH 5B39B 2AJUH 4M61B 4NKDA 4APXA 3O4LD 1TU2A 2KBGA 4P4KC 4NI3A 4F2EA 3P3YA 5GGUB 1U58B 2ED6A 2CDGB 2APBA 1AO7D 2JQZA 3RVWD 2F5AH 2NY3C 4G5ZL 4RMQA 2DLEA 1AGDB 2OZ4L 2CDFB 5AAMC 1U8QB 4ICWA 5C08D 3RY4A 1DLFL 2VZ1A 1J8RA 1BW8A 1JGLL 2J56A 5IB3B 2A9ML 3HUJF 2PP8A 4F1SA 1M53A 3PNWB 2YRPA 4WCYH 3LKSB 4WHTA 2JJUA 4OQTL 1OB0A 2QVFB 4KKAC 3O2DL 1I8MB 5INDA 4QOKA 3VXME 2RR3A 4GG6B 1J0ZA 4TNVK 1CGVA 3X1BA 2PF6A 1KTJA 3K6OA 4PJBF 4OQTA 3FOMA 2EDMA 1AQHA 1S3KH 4I48A 1T3FB 3IE4A 3IDXL 4RWHA 3K6FA 3L9RA 2B3IA 5I15H 2AEPH 2AI0H 2VZ3A 1IBGH 4I7ZC 2NZ9D 4WW2A 4PJ5B 4NC2B 1KIRA 1VADB 4XP5H 5F0MB 1F11B 5HGAB 1N2RB 4NWTH 4UZGA 2YGPA 1UD6A 5HDOA 2C7FA 4M61A 5KBDA 4JFHE 1JZ7A 1LWRA 2FX9H 3QIUD 3EOYG 1CGTA 2P46B 1E42A 3NCJL 5EIIG 5BQ7B 2CDGA 3F58H 5IP4A 3ESPA 1R3JA 3QHZL 5EEYA 4XH2A 3GXNA 2R0LL 3CC5A 4NM4H 4MZ3A 1HHJA 2NT0A 2YPLE 4HCFA 1U8QA 3BVVA 5B4MD 3ATBA 5DFVD 5IB3A 5J11C 2PTUA 3P54A 3PNWA 3LKSA 3KPRE 4FHBD 4AYFB 2GAZB 2EVHA 4X8XA 3T04D 4FXLA 2ZKYA 3RFRA 2AP2A 1HC1A 1L9TA 2AGJL 3ZE2F 3B2XA 4ZZFA 3B2DC 2APSA 4G1MB 5D1ZD 5E8DH 2FTAA 1G1OA 1T3FA 2VZVA 4WI0A 4BELD 5KVMC 3NPSC 4P48A 3GSOB 3C5ZB 4FTVE 4WSJA 5HHPB 4NCC2 1CDYA 2RB8A 4PJ5A 4U6YA 3SE3A 1IBZA 1VADA 4LNRB 4EZJA 5L2JB 5HGAA 1OARH 3UG5A 1KBVA 4Q52A 3FO1B 2FIKA 4PRPB 5DMKA 4RFOL 1SRDA 3I50L 1FNSL 5AKVA 2NY0B 3KLSA 2MPAH 3L54A 5BQ7A 1IAMA 1NANH 4OCWH 4LL1A 3OKYA 4R9HA 4A37A 2ZCKL 1V5JA 3BKMH 3VX1A 3E3QC 1ZDSA 1V7MH 2R0WL 1JHKH 3HMWH 4TUKH 4HPHA 2XN9E 5TD4A 1GZPB 2YXFA 5J89A 4P4KB 3ZYIA 4PM1A 4I8DA 4F93B 1E28A 1JERA 4MJ4A 1F13A 2GAZA 2NY3B 1RIVL 3TT3H 4QIRA 2V17L 2X40A 4ZAKD 4PRBA 4FYQA 4JFSA 4GI8A 1PZDA 2P8PA 1JZ4A 4QRSB 3MZTA 1TZIA 2AXHA 3CZSA 4LQ1A 4NO2A 3GSOA 3TEWA 2A1WL 3DX8A 3L4CA 1AE6H 1ETJA 1T7YA 5HHPA 1WYJA 5L2JA 1UFGA 4N8CL 3FO1A 4M6NL 4PRPA 3ZN6A 2P80A 3SE4C 1KACB 3D7PA 3MLRL 4FHKA 2X9YA 4HFUL 4LAQL 4NQCD 3BOVA 3JWNC 1K5WA 1MJ8L 2EILB 3CFJB 3N41F 1CDIA 4ZNEA 5FM4A 1QHPA 5I5MA 4GSDH 1DJSA 1OAXH 4AKPA 5AW7B 1MFMA 3KL3A 3NIGB 4IK7A 3D4YA 4MMXC 1M71B 5CR8A 2W60A 3RJDA 4QKTA 1MWAH 2JXMB 1FIGL 4WU5B 4IBUA 1FG2B 1NBZB 1WF5A 3BEVB 4P46C 3UAJD 3WN5C 4LIQL 5D5MF 1UD2A 2ZAHA 3G5YA 5AAMA 3LYRA 1NMAH 3MNZB 3CDZB 4GKOA 1IAIH 4KK5C 1KTRL 1UB6B 1BREA 4QRSA 4H0IA 5J11B 1JHLH 2BCMA 5BJTB 3SKNA 2TRHA 5I1EL 4ZFGL 2V5TA 1N68A 1OGAB 2X2HA 4W1TA 5EIQA 4C55A 3TO4D 1JXDA 3NA4A 4YHPA 3U36B 5IT2L 3W38A 2GW5A 1DBJH 3MRNB 2CHDA 4MJIA 2FE0A 3HE7C 2XZQH 5BO1H 4NBYB 4KXBA 3IPEA 4EOWL 3QWNA 3NPSB 3W5MA 1CL7I 2ZSWA 4XCNB 2ZCHH 3TNMB 2EE6A 1EV2E 2WLLA 4N68A 3CFJA 5E5LA 1EJOL 4WQOA 1IL1B 5JYLA 3NEXA 1SFHA 4I13B 2WP3O 4YAQB 3U0WH 4U1IA 1F3JB 4EI5C 2VN4A 1FLTX 4OIBA 3ZOAA 3WY2A 5CCKL 3M1BB 1M71A 1YJDC 2P5EB 5L2KD 2OTUB 4PRIE 3HN5A 4U7MA 4G6KL 3LQAC 5DHEA 2IDUA 3BEVA 2C3WA 4LLYB 3MR9B 4DO6A 3H3PL 3NCFB 3U7WL 1NFKA 3MNZA 2C3HA 2JKJA 1LO5B 1TTGA 5E6ZA 4XC1L 2OJZH 1R0AL 3FHQA 3UEQA 4YSPA 4GINA 1OGAA 1TT6A 2Z1PA 4L4VB 2JCWA 4CU6A 5IHHA 4HJEA 4POZC 4KI5E 5ID1B 5KVFL 1PD6A 3QWRA 5IEKA 3U4AA 1PEZA 2RBLA 3MRNA 4NZTL 1D5XA 3RWHA 4HKZA 2J4WH 2R1XB 4J3OH 3T8VA 5HYSA 2P8LB 1UB5B 4XCNA 5EZJB 1NWOA 3FULA 3ATFA 1YEDB 4U1NB 4HD5A 3GBNH 2K1MA 1FE8L 5I16A 1W8EA 1Q72L 4ONFL 4YAQA 1SMOA 4LLDB 4DKEH 2IAMD 3CDCA 4EDXB 4OCRL 2HRGA 2J6WA 1ES0B 1X5MA 5I0DA 1YC7A 5C71A 1NGXB 2VDPB 2P5EA 4OFDA 2OTUA 3Q2CA 3BAEH 4B60A 5DRZA 2XVKA 3U2SB 4B9PA 1CFNB 2VUYA 2Y4SA 4DJMA 3QA3B 1U8KA 1CWVA 2K6YA 4HFWA 1ZHKB 2IBBA 4HJ0D 4LLYA 4NGHH 1FV1A 2XJKA 4LPXA 4K8RC 4XOBA 4Y1SA 5FCUH 3WTYA 2LR4A 1HINH 4U49A 3STLB 4MMXB 4L4VA 3KLKA 1DVFC 3V5HB 4MBOA 1IGIH 2DQMA 2NPLX 3WKQA 4EIZC 2VDLL 1E90A 1HCFX 3CXDH 4GQPH 4F2ME 1QLEB 2EEDA 4P46B 3TV3H 3VGDA 5FUZH 3WN5B 4M4RA 2BIQA 5FHBL 4N5ED 2CXGA 2R1XA 2B39A 2F58L 3ZDZF 2V8MA 1N6VA 3V4VH 4KNTA 2PR9A 3HB3D 5EZJA 3VI4A 5F7UA 43CAB 2G3MA 4U1NA 3RPIB 1QVOB 2NNRA 3LXUX 2E8YA 1G6RH 1FN4B 1GGIL 2VDPL 4WZ9A 4KH2A 4LLDA 3AS3A 5E8NB 4E9XA 5BQDA 5EUOF 4EDXA 1ZANL 5IEHB 4J3SA 3D4GA 3HE7B 4AE1A 1ES0A 1MFBL 4NZUH 3V9CA 3UP6A 1ICTA 3PP4L 4P9ML 4YXHH 4LCCC 3MV7E 5T3ZL 3EOBB 3N1FC 1CFNA 1OSZB 5LXVA 4U0QB 5CEZD 3ZO0A 2VXUL 1T04A 1CXEA 2Y23A 5HI3C 2LU5A 3L3IA 4NX0A 5CJ5A 2VIRB 4EI5B 3TZVC 4P3CH 3ULSB 1TTUA 3GK8L 5SV4A 1I3GH 3STLA 3VG0H 3D87B 4MMXA 1Z5YD 1MIEL 4HIEB 4N8UA 3V5HA 2WVVB 2V3DA 3IJ8A 4HSCX 4DN3H 5JHDB 4PG9A 1HAUA 4P46A 2VDOH 3WN5A 1Q8MA 1NWPA 4P2OC 4GRWB 2ICWA 3FU8A 4NAMA 5F7LB 1JNLL 1E3FA 4U3HA 5E2UL 2MCAA 3V79C 1JDAA 4QD2E 4GUPB 3O81A 4JRYE 1QBBA 3U7AA 4H1LG 2Z4QA 4AQEB 3NN8B 4BK8A 5I0WA 3RPIA 2C9AA 1XSIA 4H5SB 4L18A 1FN4A 1ADQL 4UILH 3UTPE 2YQBA 4FFVC 5A3ID 4AMXA 4I77H 5C0IA 5E8NA 5ACMA 3OVUB 4PY7A 2IPUG 2I07B 3FN0L 4TSCH 2GPZA 1ADQA 3HG3A 4HQQH 1BAWA 5C07D 4O58L 1F4XL 4AI7A 3EOBA 4FZ8H 1KJMB 1OSZA 5FUOL 3TEXA 3FDWA 1E8WA 1A6WH 4O5LH 3ZVVA 3QAQA 2VIRA 5FF6B 3ULSA 3LQAL 4FXKC 4OLEA 1ZLVH 3JVFC 2Q76B 2P9RA 4HIEA 2AV7A 1NGQH 2WVVA 5FYLD 1CU4H 2F7RA 3MCLH 5J3HC 5JHDA 5TE6L 1BZOA 1IFGA 4YWGH 2ZWLT 1HK6A 5IFHL 1ZE3H 1LO4H 3CZLA 2RH0A 2AZUA 1J5OH 5C7ZA 2BZ7A 4GUPA 1DVTA 1MXDA 3KGTA 1KLGA 3H55A 5GQBA 3NN8A 5GGSY 3K6DA 4L4TA 5IW1B 1DVFB 3X11A 4TUUA 3IAGC 2X87A 1IC5L 2Z8SA 4WHCA 5FYJE 2YKLH 4X6CE 4Y16A 2NY1D 1RUAL 4L2YA 1QR1A 3IXTB 4HK3J 1I8UA 1S7XB 1DJZA 1Z5LB 2FQDA 2QGEA 3DYOA 3K72B 4KITB 1KJMA 3AS0A 5FOBA 2DL9A 3SDDD 2VZSA 1PGRB 1O5PA 1HZHL 1J86A 4IRJC 4ES8A 3ZGIA 1RUML 2J5LC 2VABB 4JFDD 1WHOA 4JG1L 3ILQD 3UTTB 1ZMYA 2YPLB 3OAYH 4JFEB 4X8GA 4HCRL 5I1KH 4LCCB 1HTYA 3VFPA 2G2PA 1AIFB 3L8QA 5I1CH 4X4MA 4CADB 1G7JB 1MNUL 1BWWA 3WXWL 4UBDC 5FYKU 4HCRA 4MA1C 4X4YB 3HHMA 2IALB 1BD2B 1TQVA 4ZOBA 3NIFB 3TZVB 4QTFA 4UQEA 4H8WC 4WEBL 3S8GB 5LNEA 1DUYB 1D5MB 2HRHA 2IFFL 4ELME 1ACZA 3OAWA 5GS0H 5I6NA 5IW1A 2AQ2A 1DVFA 1YNKL 2AHIA 2L0DA 3BZ4B 3BAIA 2V2XA 4MTMA 3QG6B 4PGDB 3T8XB 5JIQA 4P2OB 2HT2D 4QGTA 4EZKA 3IXTA 2SEBB 1S7XA 1B4JL 2OMWB 3S88H 1A6UH 3QUXB 2CM5A 5H94B 1G5AA 2WLNA 4LDEB 3HPLA 1OGTB 1KLFB 4MCYA 4WSGA 5F7HA 4HS3B 4DUWA 3QFJD 4TTDD 1DJYA 3OV6A 5F7YC 1OTUD 3QC5X 4HJSA 5IW3A 2VABA 2K3HA 1FO0L 1H5BB 2J1KA 3L2LA 2IADB 2YPLA 1TETH 4JFEA 3NCXA 3EJZD 5F1KC 2ARWA 3VXSB 2DQFB 1JIBA 4LCCA 3NUKA 1AIFA 2JI3A 2AQNA 4FFTA 1E50A 4KUZH 4OM1L 5TFSL 1FO0A 1Y0LB 3KPRA 5GZOC 5IQOA 4X4YA 3U4BH 1UKQA 1P4LA 2IALA 3TZVA 2EVGA 1EXUB 2YZ8A 2FYYB 4ZI8A 3RG1C 2BXZA 3V8CA 1IARB 2XVGA 4YDIH 3ISWA 1U3YA 3ERXA 4DGVL 5KAQG 3N43B 4PGDA 4YDLC 1F6AA 2C1PA 3QUGA 5EFIB 3NRPA 1JRHI 4P2OA 4Q4IA 2JB6A 4FTVA 5C0FB 2M83A 1FVEB 2VR4A 3I6GA 2BK8A 1JZJA 1TENA 2YRZA 2HRPH 3GF8A 2OMWA 4XI5C 2EDJA 4S10A 3U1PA 2XIIA 2DQCL 2WK2A 4PBDA 1OGTA 2A4CA 5DWPA 1RMFH 1KLFA 3BWAB 1N3NB 5F88B 4HS3A 5CKAA 5TDNA 5I82A 5LXGL 3ZT7A 2EYTA 2PPCA 2DI9A 1J0KA 4F58H 1QBLL 1WE5A 2XBTA 3NSFA 1LE9B 1T80A 1NFIB 2IADA 1ZT4B 2YGOA 1DBML 1S7QB 4RGMB 1HL5A 1KLUB 2XN9A 5CM1A 3LNHA 2CBPA 4K9EC 4NPYB 4XMPH 4KTDH 2I9LB 4NRZB 5LGKA 4M62H 4DCQB 2VOTA 2WBWB 3FONB 5JW4M 1NGZA 1Q38A 1HNYA 4IRJB 4ZG1A 5AVXB 3A24A 2WLKA 1N4XL 4FQXC 4FXKA 4H2CA 2J5LB 2W1NA 2YMOA 2GSIB 3KHQA 1FPTL 5DJ0B 3WGVB 1BP3B 2QR0B 4N4YB 5DFTA 1GC1L 4HJUA 3S36H 3VQMA 4KVNL 1T22A 3SE8H 5IHZB 5JDSB 2FNWA 2R69L 2X7LB 4M48L 4OW6A 5DVPA 3O6KH 4LP4A 3T3PB 2CUAA 5EFIA 3S37H 5C0FA 4Q56A 1NBQA 2XY2A 3B2VL 4WGWB 4AEHL 3DXAD 1FVEA 4MA1B 4Z7WB 2DWSA 2G2RB 2MPVA 2DZEA 2R69A 2XPYA 3D08A 3ZTJH 3BGAA 1QABA 2PR4H 2ZJSH 1FNHA 1QRNE 2BOBB 5JOFB 4WI7A 1C5CL 1MJUL 3BWAA 5E9AA 5F88A 2H3KA 3PWNB 1HXMB 5CZXC 3G6DL 5I17B 3V0EA 2DRUA 5AENA 5TGBB 1ILUA 3T6QC 1WCBB 3IB4A 1K72A 2X0UA 1JMZA 2WQRA 3CH8A 1N5YL 4GAFB 1KN2H 3D39D 1NFIA 4NENB 3BDYH 5DHYB 3VFMB 1S7QA 1LE9A 3RA7H 1IBBA 3IRPX 4AT6B 1ID5I 1TJHH 3KPNB 4TNVF 4NPYA 3JZ7A 4V33A 2E9IA 3IFNL 2I9LA 4NRZA 3RU8H 4DCQA 2BNRE 4MA3B 2HLAB 4NIYE 3FONA 3LS4L 4R5TA 2CLRB 2PTVA 2VWEE 2ZOKB 1O7VA 3JTSB 1E5YA 2NYKA 5ITBL 4XMUA 1SDYA 2QR0A 4GEJA 3WJMB 3QPXH 1XEUA 4PYGA 4WW2F 2YD0A 4K7PX 2OTWB 3UEZA 4DVRH 2AW2A 4RLDA 2AK1L 2GT9B 5E5MB 3TURA 2G2RA 1R33A 3P4MB 1KPVB 1MHEB 3PFUA 1B6UA 3WY1A 3M7OA 4JFFD 1L6XA 2VO8A 2YAQA 3MRGB 4BE6A 3HHSB 2BOBA 1IMHC 3O3AA 4MZIA 5HVHC 1I82A 1RXLA 5T1MB 3TP4A 4L3AA 2Z31D 3ZHNA 4YDLB 1HXMA 2FEEI 1WZ1L 4D0DB 5I17A 2Y07H 3Q2LA 4NZRL 1XGRB 4JO8A 2HH0H 1ZA6A 1OGSA 5HI4D 2BWIA 1X6LA 4IRZH 5D96C 5DHYA 3A67L 2XKUA 5FUCE 2VDKB 4AT6A 4XP9L 2MKWA 2X9WA 4KZEH 3AT0A 2QQKL 3AQXA 4MA3A 2HLAA 1MRFL 4PRIA 3BZDA 2CO7B 3QFGA 3DUUB 1NEZB 3AVEA 3T4YB 3JTSA 2BRRL 1O5DT 1ZPUA 2VRAA 1TJIL 3S0PA 3WJMA 3GJEB 3DX4A 2OTWA 3M46A 3T3MF 4BZ2A 4BHUA 2D9QB 3QYMA 2ZKXA 5GZOA 5DSCB 5AKTA 1CVSC 1VHPA 4G8FA 4CDGC 2NTSP 3FT3B 1EMTH 3P4MA 1KPVA 4FQXB 4FHJA 2KQNA 1JZDC 1RULL 2EDLA 2EH7H 3M45A 3MLTB 4OJFH 4JZNB 3HHSA 2Y7NA 3VMPA 3QG7L 1U8IB 1NUFA 4Y2OA 5T1MA 5HHOD 5EU7E 5ACLA 1BSIA 1IV8A 2JB5L 4JQIH 1TLKA 1XGRA 3HC4H 1SDDA 2L7UA 4N25A 4IW4C 1OF0A 4M7KH 3SQRA 1IIIA 5BMFL 5KWYC 3L7EA 1RPUA 2R29H 3EF4A 4FFYA 5AQ0A 2EXYD 1DQDH 2QKSA 4L3EE 1A4CA 4AEIH 1ET5A 1MFDH 5E5UB 2GJ6D 4JO1L 1QSEE 1I9JH 4Q8BA 5CINH 3BSHA 2CO7A 5IUCA 4TM9A 2NXZD 4HLJA 3T0EE 4XPAH 3LPPA 2ALWA 2VC2B 3GJEA 3B3BA 2AEQL 3VXNB 1ACYL 2O61B 5A2AA 5DRXB 1J1PH 2DWDB 4I3RH 1NPJA 4PS3A 5B1AB 2X10A 3BUQA 5EEWA 4Y2DD 2B16A 4K2UL 4FQXA 1CBJA 2YA1A 1HL4A 3MLTA 4U4IA 4F2MA 1AXSB 4HWBA 1KF9B 1MVFA 1J5IA 4JZNA 3BP4B 1E6JH 2G60H 3DECA 3FKUS 4R26L 2JV6A 1UJ3B 1IKFH 1FVDB 1YHPA 2B0SL 4DFIA 3FAWA 3ZTJG 2WZPD 4TPRL 1I9IL 3OKNB 2HN7B 3NIDF 1UWXH 2B20A 4HYTB 4KOBA 4N87A 1PNDA 2ZKHH 1M57B 2D0GA 4ZMAT 3TT1H 3PGFH 2XQBH 1GPOH 1LDPL 2XKNB 4JRXD 4QRTB 5HVHB 3RDTA 4WNQA 4RISH 1F02I 3BYYA 5BRZD 3M1CA 2W0PA 3FOLB 4GAJH 1LEGB 1F8TH 4E9WA 3VH8B 2QSTA 1N12A 1AYOA 2QL1A 4EKJA 3NDZE 4E41E 5AVQB 5C1MB 1JPGB 1SN5A 1NKOA 1P7QB 4K3JH 5D96B 1QO3A 1ZHBB 3HZMB 3AXHA 4EIBA 3X3GH 1LWJA 3A4FA 1KTBA 2DYPD 3MKGA 2WWMD 5DRXA 4L2LA 2EXTA 2DWDA 3LEXB 4DT2A 2IWGA 5FO7A 2BNQE 3CZUB 3TWCL 4JCWA 1J8KA 3DOHA 5FFGA 2WLJA 1AXSA 1MJ7L 1AMYA 1NSNL 4WI5A 4ZFOB 5E7FA 4X5XB 5DD0H 4S1SH 2OXHB 1JPFA 3KCPB 4JRYA 3CLFH 3OKNA 4LEBA 1EZLA 4TTGA 2HN7A 2PYED 4X6EA 1GGCL 3GMPA 4KBPA 1KT2A 4Z0BL 1U2HA 2XV0A 2XKNA 4QRPD 1G1CA 2X6CA 1BZ7B 4QRTA 3V2AR 4HMDA 2AV1B 2XIDA 4R5VA 2C9XA 1YN6B 4FQCL 3HKFA 2R7EA 3LB6D 1DVZA 1N7ML 1MFCL 2Z0BA 3VH8A 3QCVH 3AREC 4XNXH 5D70L 5C2BL 1L9PA 1JPGA 4HS8L 4XCCH 1BLNB 12E8H 1E4HA 1NLBH 4JY5H 2KZWA 4N24A 1P7QA 5FAAA 3UTQB 1KXQE 3EJTA 3F7RA 4NO5A 3UYRH 1ZA3A 3HZMA 4NLHA 1R3HB 4A2EA 4DAGL 1MCDA 3DK2A 1BFTA 2ESVE 4H13C 1GYUA 4UB0H 4Z3TA 2YQGA 5D71H 2NUTB 5IJKC 4XVUD 3FFCD 2JLLA 5HYJD 1XF3B 1IAIM 5F1NA 3LS5H 4NBZB 4NN7C 2KYIA 3BH4A 4PWEA 1U6AH 5CGYD 3CIQA 4HUUB 4PV9B 1TLMA 1ZSDA 4X5XA 3Q6FA 2OXHA 1CF8H 1ZTMA 2GUOB 4Y19B 3KCPA 5FYJL 1KCVL 4JBSA 4ODWB 1V7NL 3QPKA 3FRPG 3RDJA 4WRLA 4MQ7B 4FEIA 2O6FA 5DUBA 1R1CA 2Q86B 2CGZA 4HWEH 4PJXE 3EKCA 4K7PY 4X6CA 1BZ7A 3AADB 1JS4A 2AV1A 4X42A 5DTFB 1F56A 3NCCB 1U8JB 1YN6A 1OQXA 2OV0A 3B5HA 4GW1B 2EEXA 5CO1A 4DOHE 1INEL 1WJ3A 2BVTA 1PVHA 3C75A 3PP3K 1BLNA 1ODAA 4PTUA 4C57C 4NKQB 1PPIA 2OMXA 3WS6C 3G04B 4ACPA 3Q3GB 3VXOA 1R3HA 1A7QH 2BLFA 4GAGL 1BYNA 1P53A 1Q94A 3DTXB 2VWEC 3QQ4B 5CEXB 1YYML 1AIZA 2NUTA 3SDXB 3D3VB 3WL9A 3FT1A 3K91A 1XF3A 3B7YA 3ILPB 4JN1L 1JK9B 1OAUH 1IZKA 8FABA 2F15A 1KN4H 4MRBA 3P4OB 4HUUA 4PV9A 4XVTL 3VI4F 2VT0A 5H37H 4HEMA 1JFQH 4OI7A 1KTLB 3MLZL 2R9HD 2GUOA 2VLJD 4H0HB 4ELMA 4ODW<