4F58L

Fab structure of a neutralizing antibody l3 from an early subtype a hiv-1 infected patient
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
QSALTQPASVSGSPGQSITISCTGTTSDVGTYNFVSWYQQHPGKAPKAIIFDVTNRPSGISNRFSGSKFGNTASLTISGLQAEDEADYYCAAYTVASTLLFGGGTKVTVLRQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Viral Escape from Neutralizing Antibodies in Early Subtype A HIV-1 Infection Drives an Increase in Autologous Neutralization Breadth.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Light chain of Fab of a neutralizing antibody L3
total genus 46
structure length 213
sequence length 213
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2012-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f58L01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f58L02
1IGFL 2VXSL 3HZVB 4KJWC 1YEIL 3QG7L 3EJJX 2HAZA 1KC5H 3WN5B 4YHOL 3PDDA 1L0QA 3KPRB 3HMXA 1EUUA 1DR9A 4HUVA 1D5BA 4OZ4B 1UZ8A 1B3JA 1FZJB 2J8UE 3E2HC 3SCMB 5IMLB 3WD5L 4NQXA 4N0RA 4C56B 1EO8H 2V6HA 5A3ID 4Y4FA 3PDGA 4GS7B 5J1AB 3MLVL 2MPAH 1KJ2A 4L8SA 1T1YA 3UJJH 1A6UL 5ICXA 4JY4B 1ZHLA 5IB1A 2ZPKL 3NCJL 1KB5B 1UH4A 4U3CA 2IALA 3EO0B 4XPBL 4OZIB 4FP8L 2Z35B 1UJ3B 1DQTA 2FECI 3SDDD 4NGHL 4OD1L 2H32B 5DVOA 4RWHA 1FSKC 1P5UA 2V7HB 4GKNB 5F1NA 2Y7QA 1N59B 2FNBA 2ORBH 3WEXA 3ARBC 2DN7A 1M7DA 4PY7A 3I50L 2OL3L 5FK9B 2XNAA 5AD0B 5J57B 3L3IA 3X13A 3G6DH 5ETUB 4MNHA 4DQOL 4JKPH 3IFPB 4PBVC 3HZKA 1QACA 1X5LA 5CMAA 5T3ZH 3EYUL 1P4IH 1RJYA 4TVPE 3U0WL 5DJ0B 4I0CC 5I8KL 1ZV5A 5F70A 1I1FB 3TIDA 3DBXB 2MOVA 4NWTH 3HAEH 1BM3H 5GJSL 3CX5K 2PN5A 5D1XC 3NCCB 5MEQA 1QO3A 4JVPA 1XIWA 5CP7B 2HG5A 3FN0L 3PJSB 2DAVA 5EOCJ 4L29B 2P5EE 5IFHL 1NCBH 5B39G 1WCQA 1FCCA 2YSSB 2HTLD 5DWUL 3WE6A 1MHPL 2V2XA 4HWEH 1MCOL 4JB9L 1DBBL 4YAQA 4OBSA 3WNKA 3FO9A 3ALWA 5EU3B 2DB8A 4X9BA 4JCLA 3STZA 2Z8SA 5E00B 5KAQG 4M61B 4L8DA 5D7JB 5KW9L 5C0DB 3SPVA 3B9KA 4YHZH 5L9DL 3TWCH 3P0GB 4FNLH 1AE6H 4CBPA 1C1EH 4N8CL 4P46A 1D5BB 1K2DA 4GG6F 4Z78A 5DEZA 1JHTB 3KR3L 3MBXL 3N50A 1D5MB 2D2OA 4ESKA 4HWBA 1UA6L 3VGHA 3ZMRA 1YEJH 3GJFH 4OM0H 1JE6A 1K8DB 2DICA 2JE8A 1Y6KR 1JZ3A 5C0BA 1N5AA 2FJHA 4M6OH 4FG6D 4UTBL 4F7TB 1RUAH 3N85L 3VWJC 1X7QB 5H2BB 3P4OA 1YPZF 4OZIF 1TJIH 1N0XL 4FFYH 1T80A 2YKLH 4LDLB 5F88B 1QRND 3QIUC 1SYSA 5E5MB 4YH6A 4QGYA 2Q6WA 1A7OL 5K9JL 3T2QA 1KYOK 3AAZB 4KHTH 1A9BB 2HP4A 4PJ9C 4PJBE 1JF1B 5DHXB 4FTVA 3N9GH 1HHHA 4LSVH 4NPYA 4PTTB 1A7NL 4ODUB 3WO4C 1DQDH 2ZCKL 2AJXH 3HI1A 3KR3H 4XMPL 3BHBB 1QSZA 3MRIB 1HXYA 2BVQB 4WI5A 4HKZA 5DFVD 1F2XK 1INDL 3FFCA 3EZ8A 2ZUQB 2IAND 1A3LH 2IADB 4J3VA 2VLKD 3NIFE 1A6ZB 3VXMB 2O5XH 5A43C 2XQYG 4OGYL 4P3DB 2J8HA 5TE6L 1YNKL 5JLZA 3VG9C 1LO0L 2B2XH 5IOPB 4ZAKB 5K9JH 3HTLX 4F7MA 4MA1B 1HXMB 2X6MA 2EDJA 1I3GH 4K3DL 3L3IB 1H5BC 1XIWC 4JO1H 1L0XA 2DS4A 3BKYL 4X6FB 1MAJA 1MIEL 2Y7QB 3OJMB 4JFYA 4PFEA 4PGEA 5KZCD 4MNQB 3S37X 5F7LB 1K6QH 1D3CA 1MJ7H 3QQ4B 1IE5A 1I75A 1NAMA 4NQVA 1EHNA 2XWJA 5HGBB 4WV1B 1S5HA 2ILLA 1ZWIA 1ZHLB 1IMHC 4FQCH 5B3JF 5EORL 2Y5TB 4Z18A 3BPCB 1FNAA 3O4OC 2GK0A 2X5PA 3GJFA 4L8BB 4PJ8B 1KCKA 1T0MA 2P4AB 4OI8A 3ULSB 2XWBB 3BP5A 2D31A 4PLJD 5HYJA 1AR1D 2YD6A 3VXOA 5BVJA 4D0BB 1SYVB 5F9WC 3KG5A 5BOZG 2VOTA 4PG2A 4D0DA 3B6SB 5DC0A 3MRDB 3VGAC 5ISZD 2DQTH 1IGMH 2W60A 2BXZA 4HK0A 4GG6E 4MJID 5D93C 1C7TA 3KJ4C 5FA3B 4X98B 8FABA 5I1IL 1MJ7L 1UCTA 1GGBL 4BZ2H 1L7TL 1IKNC 4F58L 4I3RH 1T7XA 5I6XB 4PJGF 5HGAA 3V52L 1DSFL 3ARVA 5DUBB 1U8HA 5I17A 2VDMH 3HMWL 3HZMB 4M7LH 1OSPL 2DTMH 4DJMA 4GW4B 4OIAA 1HH6B 1LO5B 4N9OB 1JGVH 2YPLB 4Y2DC 1TVHA 2AEQL 4OZHF 5DDHA 1YQVL 2HJFA 4RRPA 4UINH 5BMFH 1JYVA 2NR6D 1GL4B 5FYLD 4EOWL 5KSBF 5IG7B 1ZHKB 4EXPX 3QJHB 1IGYA 7FABL 5DD5H 1S7RA 3IYLW 3WFHB 3IDIB 3DUSB 4P59L 3ZT7A 5T3ZE 4LARH 5GRVL 5I1IH 3VXUE 5EZOH 5KTEH 3RJQB 1SEQH 4LVNC 1QYGL 4EI5C 5BS0A 3CC5B 3UTTA 3WKML 3UPRB 1TJGH 3LN4A 5TF1H 4Z7UA 5HYQB 4A2LA 5GGSA 3L7EB 3PIQA 5F7NC 4JJHA 3DTXB 5LJYH 4QHKI 3VFVB 1A47A 1KIUA 3MJ9A 4Z7QE 3Q2CA 4D8PA 1J88A 1QNZH 5IK3B 3OKNB 1NC2D 3VG9B 3RHWF 4JGUA 2B8OT 5DRXA 1IC5L 5C6TL 3MLUL 5JXAL 3NN8B 3K1DA 4GXVL 1CFBA 5GS2D 4RBPK 3V4VL 4D8PB 2NX5D 1AD9B 1B0RA 1ZT1A 1IAIH 1ZANL 1YDPA 2AXGB 1KXQE 5CJQL 5F7YC 1AKJA 1KJ2H 3VMOA 2EO9A 1YNTA 3DMMB 3L3HA 4XCEA 5CJOL 4KH2A 4MB3A 1R3HA 1CE1L 1EEYB 2ZG1A 3VFMA 3DECA 3PQYB 1WWCA 2Q3ZA 1KCVL 2D9CA 3LQMA 5FGCE 1U8NA 1HYSD 4PRIA 1TJGL 4YBLB 4X7EC 1KEMH 1EVTC 1OAZH 4X8JA 1XF2B 1HWGB 4CN6A 2VDKL 4RA0C 5L88L 1XFPA 2BY3A 1E6OL 4QHMB 5E94A 3OXRA 3NTCL 1EBPA 3FJTA 1NCWL 3H8NA 2EXYD 4ONHB 3UTQB 1P7KA 1CGSL 4PRHA 2DLHA 1UXWB 2AJVH 4HC1H 3MLUH 3MROB 1A14L 2NXYC 3KPRE 5FO7B 1UKSA 3D3VA 4GG8B 5C71A 5CZKA 3CFEB 4PJAA 4TULH 4K8RC 5JOFA 2ICES 1VFBA 2WWMD 4ODTL 1WIOA 4G6KH 3MREA 4MMZC 3OKLB 5D2LF 1QEWB 5TQ0L 4WHCA 4TVPD 2IC2A 4ODVL 4X5XA 3GJEB 1MJJA 3FHAA 3SDAB 5DD1H 1VFAB 5DVLA 2I9LA 1J1OH 3K4ZA 3BZEB 5DD3L 1YMMB 5K59E 2Y06L 4OKVA 1DVFC 1U91A 4D0DB 5D2NA 5GRWA 4PJDB 4UB0L 3FO9B 2ADJB 3VI4F 5D70L 1QSED 1BGXL 3QUZD 4ZS6D 4WCYH 1QLFA 4YBHA 4MJ4A 3PF2A 4Y1AE 3FB6B 1CT8B 1BFTA 2FO4B 1IKFL 4L8BA 4PJ8A 5I19H 4JKWA 1ZS8A 4LRIA 3ARBA 3F7VA 3PDOA 5L7XL 4I18C 1XCQA 4G8IB 1HZHL 1CD9B 2R0WL 2BSTA 5CGYD 4MS8D 4J7RA 5SWZA 1QFPA 4V1DE 4OLUH 4F7CB 4KVCH 5SWZE 1BVLB 5F9DC 4G43A 2E8ZA 4HS3A 3DV6B 3HB3D 3BGFB 2NYYC 1YPZB 2YUZA 4PJ5B 2AK4E 4HUWB 5L0QB 2K7QA 1OWWA 4FFVD 1PLGH 5D7LE 5TDPB 1FNFA 2BC4A 1INEH 4U1NB 5HJ3B 3PWVB 3F62A 3X3FH 5TGBB 1HHGB 3FB5B 3PWPE 5L8KB 4Z77B 4MDIA 4NQDE 1JRHL 4EBQL 4MAYC 1JF5A 5F9OH 3QIUD 3RP1A 1A6PA 1WTLA 4XNUH 5SWZB 5D7SL 1F13A 2H26A 1MCRA 1PEZA 3B2VH 3MRIA 4BH8B 4L3ED 3F12B 2X89A 1FNGA 1D5IL 5J3HC 1TNNA 3FB7B 2WW8A 3DRTA 5FECA 4W6YB 4OZFB 1NFDA 4S10A 3OAYK 1VESA 1HCFX 3OJVC 5ICYA 2HFGL 1VFBB 1Z6JT 2DLFH 2NY3D 3KYOA 4Z6AT 3QO0B 5C0RH 1I8KB 1W72B 3HRZB 3D18B 1IM9D 1S8DA 4NQSA 2EDRA 4F2MA 4MB4A 1P4LA 1QFOA 4HLZG 1J0ZA 3KPQB 1KIQA 1JK8B 2DJSA 1OT1A 3VWKD 4MZ2A 2NQCA 3EOTL 5E56A 4YHPB 3E6FA 4P2QA 1IFHL 4OQTH 4HIEA 4YX2H 2X4QB 3HZYB 5CCKH 1KIQB 2FECL 5EUOF 5AYQA 3TA3D 3O81A 4XMLH 4IDLA 4ORGA 2BRRH 3TBTA 1KACB 1A7QL 2DQFA 4LRIC 1DBKL 5DEGA 2C4FT 4NGHH 2GUOA 2NY4C 1GGIH 2VXVH 1AY1H 1YNTB 1I8LC 1OAQL 1W72A 1HQRB 3O41A 3W39A 4WUUA 2IJ0C 3R06A 4LSSH 2HT4C 2APXA 2X4PB 1J05A 5IB4B 3FQTA 3WIHL 2VSCA 2I26N 3QPQD 3BIBX 3RRQA 3AS3A 3EJZC 4KZEH 4IMLB 4QRUB 4GRLC 5ILTH 4ZUUA 2A6DB 2Q8AH 4KHXL 1F3DJ 2A1WL 1HOCA 2EDWA 2BVPA 5DUML 4Z95L 3CFJA 5FGCB 2Y6SC 4P46D 2KKQA 2VXQL 3O9WD 5GRUH 1DFBH 1SHMA 3G08B 5EUOA 4N1CA 3RDTD 2P46B 2ZOKB 4JO2L 4XCNA 2VDPL 5EZJB 3J7HA 3ILQC 1HQ4A 1EERB 4J4PA 1Z9SA 3VXUA 2DTSA 3DBXA 4U3HA 3ZE2E 4HJ0D 2H9GB 4NHUB 5EBWB 5AZ2H 4IOFC 4O2FB 2EC8A 1RIVH 3IDYB 4KZDH 5D72L 1Z9LA 4XPHL 2D4FA 4UNVA 3S4SA 2GITB 1HH6A 1K8IA 1UH2A 3JSSA 5D7JC 4U0RB 3T0VA 1M7IA 2BSRA 1OTUC 5HSFA 3KLHC 5IHZA 1NDMB 1BD2B 3BWAA 4LCIL 4YHZL 3D0LB 5GJTH 2ATKA 3L95A 3QEUB 2Z9TA 1GRWA 4WFFD 4HWEL 3WDJA 1YEHL 2BJMH 3L3GB 5JOFB 3WNNA 3GSOA 3TYFA 4ENEC 4HULB 3VD3A 2XOTA 4ZSOA 1P1ZA 4PRNB 3CLEH 4LHUG 5I8CB 2PW2A 4XVSL 5ESVA 3SE9H 5EFIA 4Y16D 4KKLD 3CFDB 2HJFB 2FHBA 2M8XA 4KTDL 4M3JA 2Q20A 1DQML 2AJYL 4UOW1 5JHLH 4N5UA 1I9JL 3VXRB 2QL1A 1CVRA 4ERSH 3SCMA 1MY5A 3SEPA 1AXSA 4RMUA 4O02L 2FGWL 2HRLA 5E03A 3RWHB 4IM8A 4E0RA 5HGAB 1EEYA 2X4RB 4JFZH 4KMLB 1MWAB 3FAXA 4KUCD 1F3RB 3SKNA 3MCLL 2F8OA 1DP0A 1WBZB 1KENH 5HI4C 3RZWA 1MCWW 3BZ4B 2PKDA 2XZZA 3AMLA 1MAML 4QNPE 5CJBA 5E6YA 1JK8A 3FRPG 3MLWL 5MEND 5EBLB 4P48A 4DN3H 4X6FA 1A7OH 3SE9L 4JM4L 4N0UE 3K3QA 1PKQE 1CICD 3CFBB 4LLMA 2P8PA 5HDOA 3CNKA 4M7ZC 3U7YL 5IWLC 5JW5A 4DWHA 3IKCA 3NPSB 3DHMA 4MD0A 4NZTH 5JXEA 2EIZB 1MOEA 5HHPB 5IMOA 1ROWA 5C6WH 1A4KA 3MV9D 2GEEA 2BHZA 4NRXB 4XCEB 2BVPB 3O9WA 2HFTA 2MQ0A 1A6ZA 1SY6L 4X7SH 3AROA 1HHJA 4JO1L 1T0NA 3TBSB 4GKOA 4OFVA 3T04D 3U83A 4JREB 2VR4A 2YA1A 2NY1C 1M6OB 3WIIL 3KPMA 1DE4B 5FYLE 5I1DB 5EDXA 3MLWH 4CRPA 1T2QH 4PGDA 2HKFL 1QVOB 2YPLE 3CU1A 3FAWA 2ESVB 4KV5E 4LKXB 1UKTA 1N7ML 1S7VB 1WCBA 3LN5B 3MUGB 4RQQB 1L9NA 5GPRA 3GUTB 3AUVA 5DJCA 4BFGA 2YWZA 2YUXA 1J0KA 1E4WH 4RMWA 4TTGA 4K3EH 4X7TB 1QLRB 3IRPX 2V5TA 3QJFA 4I4WB 1YNLL 1J12A 4JN1L 3CH1A 5JQ6L 4Q9CA 1VENA 5HDQL 4HX1B 1B6DA 5C3LD 1AI1L 3DWTA 3WIIH 5J11C 4KI5F 1FLTX 1ZA3B 1PG7H 3P11H 2X2YA 3K2MC 3OJ2C 1RZKC 4OCXH 4CVXB 1QZ1A 4Y1AA 1CK0L 2R8SH 5FHBH 4HKXA 5E8PA 1AGCB 2EE9A 5BQ7A 4LNRB 3UJTH 5EU6D 1QRNB 1Z9OA 2K9UA 4QXGL 2VNCA 3MLTA 2P43B 4R3SA 2QJDA 4W68A 2KBGA 2D7OA 5EU3A 1JGLL 1RZGA 4Z7OF 1LE9B 4OCSH 1ZWIB 5BMFL 2CDEB 3C2AH 1JZ2A 4JHBA 3QH3A 1KJ3L 4D2NA 4RDQG 3QIBA 4KGLA 2IAMB 3THML 4D0CB 4K3JH 1PKOA 3V7MA 2NW2A 5HHOE 1DVFA 1T1WB 1CWVA 3A6BL 1MCCA 1GH7A 1DBJH 5GHWL 1KCUH 2IFFL 5CEZE 2CLRB 2FSEB 2C3XA 2Z0BA 1U3YA 3BX7C 4CNIB 3HRPA 5CZXD 3QXUA 3WHXB 1FPTL 1FP5A 3QEHB 4JFPA 3SQOL 1G7HA 1BQHB 2XKUA 5IHUH 3NN8A 1FO0H 4WNQB 1A0QH 2WUBH 4JY5L 3FRUA 1E27B 1WBXB 2NY5C 5EZOL 5HHMD 5KS9B 2XXMB 3MV7B 3QUMB 1XZ0A 4KRPB 3RL1B 2L0DA 1XGTA 1CDGA 3K8LA 1DANT 3EYVA 4IRSB 2ZUUA 2R2BB 4MD0B 3FOLA 1U92A 1T03H 3MLSH 1AKJB 4FXLA 3GMPB 5I0ZA 5E2WH 4PJ8D 5JXEC 3FRUB 2XN9E 3CU7A 4JQXC 2B0SH 4X6DB 4MQXD 4OUOA 4JO4L 3RVWD 3SQOH 4ZPVA 3P4OB 5IFAL 2DBLL 2WSKA 2ZUTA 1NUGA 4J23A 4HIXH 3F8UB 4QO1A 2BCKA 3RHWK 3GSNL 2KUTA 1QPPA 2YD4A 4MJIB 2FHFA 5LCVL 3C5ZC 4ONFL 2EDEA 1AGBB 4LSQH 1U95A 3MLXL 4MXWH 1SJHB 2O5YL 2PXYB 5DI8B 1ORQA 2W07A 3MREB 4KQ4L 5I2IB 3QULB 4JLRA 1OP3K 1WIUA 4FXGB 1DQJA 1MIML 3BYYA 5IB1B 2G75B 2ENYA 4KPHL 2VDOL 3C5SA 3LZFH 4DKFL 4RNRB 4OSUH 2J2ZA 3HA0A 4MZ3A 1GGCL 2CRIA 3L5HA 2CKBB 4WJ5A 2BVEA 4RRPG 5FA4B 1I9RL 2YSSA 3KHOA 2Q76B 3BISA 3C08L 2QSCH 4X8JB 2JCCA 4HK3J 2XRAL 4Y88A 4MMXC 3AXLA 1C8PA 2FYYB 2C3GA 1IKFH 1TVBB 5AUMA 5DD1L 4HLJA 1NDMA 3BWAB 3GSRB 2ZUYA 5AYUL 1QR1B 3OKMA 4LF3B 4M9OA 4G42B 1M7IB 1L0YA 8FABB 3I6GB 1NAMB 4NQVB 4OLXH 1BZ7B 4OGXL 2DWEA 2KQNA 5FO7A 4Z0XB 2EDDA 3GI8L 1Q9WB 1XCTA 4KVCL 3BGFC 4U0QB 5C09E 4MA1C 3IU4H 4HUUA 4KJWD 3BPNC 3DIFB 3SDCA 3BKCH 3C6LB 4IRJC 1OTSC 4HIHB 2HN7A 1XAUA 5C09D 3VFVA 4PJCE 4NFBA 4F57L 3QXDA 2XV6B 3M45A 1U6AL 3D2UA 1NANI 1KBGH 4E42B 4U6HA 4OD3L 4OB5H 1I3VA 3S5LG 1YC7A 5GSRB 2JCCF 3H0TB 4ODXA 3WFDH 3LRGA 3G6JA 2FWOA 3T3PE 1SM3L 2BNQD 4NQTA 4P2QD 3QG7H 3PG2A 2YPKA 5IFJB 1I8MB 4AK1A 1TZIA 2MFNA 1G7PA 4LLDB 3RTQB 4LHQB 3QXDB 4Y5VC 3WHE0 2QSQA 3QWOA 5JZ7D 2VDLL 5EBGA 2Z31C 5E5MA 4MB5A 2P42B 1KLUB 3L3JB 4OD2B 3MJ9H 4WW2B 2BDNH 3MACH 1BF8A 5D4QA 5JW4N 4U1SB 3U0TB 1UM4H 4NOBA 1SJEB 5D7IE 2PO6D 2YA2A 4O2EB 2BNUA 1DVFD 4IDJH 4GBXC 4Y0GA 3GNML 3ARBD 3IDIA 3KVQA 1MWAA 4YHPA 4L3EA 3BPLC 4R0LB 4Q6IA 4TQEL 4FFZH 3VWKA 1EHLH 4DW2H 3SGDI 3HNTL 1ED3A 3NGBB 4PJIB 4X4ME 2HMID 1RI8A 4XBEH 2GTZA 4WJ5B 2YD7A 3TN0B 2AJ3B 1SVZA 2AKRB 4I5BA 4LGRB 5E4EC 3EOTH 4G8FB 2DQIH 2XYCA 1LP9A 1C08B 2EXWD 2Y5TA 3A0OA 4NQDA 1ND0B 35C8L 4DGVH 4I3SH 5SWSD 3GMOA 5BS0E 1WUNT 1AQDA 4Z8FL 4NKDA 5ILTL 1AY1L 1CDJA 2AJSL 1FN4A 4RFOL 1CDUA 2ZCLH 1JNHB 2WINB 3T77A 1NCBL 3CJJA 3LKPA 4UV7L 2HG5B 4LCWB 2WIIB 1KEGL 5DJZB 5E1AB 4I2XB 5EA0H 2PO6C 4IRJA 5SX4H 2V2TA 3U30C 5L6YH 1XH3B 1GCFA 3SO5A 2CXKA 3K4DA 4MCYA 3STZB 3TYGH 4U1GB 3O6KL 4PJ5A 2OCFD 5C08B 2V5RA 1LO2L 4HJGB 4UUJB 1U9KA 1EXUA 1HSBB 4QOKB 5ESQB 4DKDC 1C1EL 2VXQH 3DUUB 3WLWD 4QRRB 3OKDA 3OGOE 3BN9C 5F96L 3GK8L 2WINA 4JPIB 1MREH 5HVWA 1R3JA 3D39E 2H8PB 5EO9A 2NXZB 5ERWA 1JWMB 2IAMA 4LEXL 4C56D 1GIGH 4S1DC 2HKHH 3DRQB 3SGDH 5FB8B 1Q1JL 1VGEH 5A16A 2NY3B 5E8NA 4PB0H 1CLYH 4JM2D 4BSWA 4GKSA 2RB8A 4RGOH 1S9XB 2IH3A 4FFYL 4GRWE 1KXTB 4JFPB 1WAAF 2DWEB 3P4MB 4PV9B 4L9LC 1LO2H 2FJHB 2NY4D 3NIGE 1AR2A 5E0QA 4Z7VE 2X4TB 3PQYE 5CLWA 4PS4L 3SE8L 3CFKB 5CP3A 4RAVB 1U8PB 3ZSTA 5GGRA 5KBNC 3NA9H 1IGTB 4ZNEA 3C8KA 4JQIL 5IESL 5HHME 3SDAC 4TRPL 1Z3GL 1JNJA 1JP5A 5DD6A 1MCQA 1ZA6A 4QWWC 1QSEE 4PV8A 3I75A 5DJ2B 4NZDA 2WP3O 4KV5F 3ZE1E 2QEJA 1IEHA 4QRSA 3K2UH 1OP5K 2D7TH 4NYLB 1WIPA 2VN7A 2E7MA 4U7SA 5EN2A 5GZOD 4JY6A 1KULA 4RIRB 1NANH 1QVOA 3G5VA 1YJDC 4MJ2A 5E4EB 1I3UA 4HWBH 1B90A 5C9JA 3ARDC 4XP9L 3SDDA 4AG4H 5T1DH 2HFFA 3RPIA 1LK3H 5SV3A 4HMDA 4A2MA 3EDEA 5JIKA 4DN3L 4TRPH 1KTKE 3T0EE 4MQXC 4MNGA 1BOYA 1IZKA 4KK8C 1QD0A 2PO6A 3WNOA 1WFUA 3EYQC 1KELL 3LB6C 4J2XA 3F5WB 4N8VG 5TDNB 3E0GA 5FGBA 3I3BA 4XNZC 3IDUA 3U0PB 4GG6A 1WCBB 3MUGA 4E5XB 5HXMA 2I07B 2ZP0T 2KL6A 3O2WL 1NPUA 5E7BA 1FV1B 2DQDL 2YA0A 1S9KC 3LQZA 1FNHA 1L7IH 3KYAA 3U30B 3HNVH 3N1QC 3MYJB 2FX9L 4P2YA 2DMCA 1C5DA 2B4CL 3B9KC 5L2KA 1QR1A 4Q74A 4JFOA 5TF0A 3H3PH 5E2UL 4ODSH 3X12B 3SKMB 2A6KA 1G6RL 2R0KH 3HAEA 2A6JB 5ISZA 3JV6B 3HZKB 3X3GH 3L3KB 4X5LA 2OZ4H 3LKNA 4NQEE 3V5DB 1RZ7H 3FQNB 3LEYH 1AE6L 2RFXB 5IEHB 3BP6B 2VLKA 2SEBA 4JFFD 5HHQA 1F3DH 1ADQH 4S1RH 4ZS7H 3MRMB 1U8HB 5I17B 3UJTL 2X4OA 4KK5D 3MV01 4JFFE 2R9HD 3AB0C 1NLDH 2DM3A 1YY8B 1AI1H 3BMVA 1IVLA 4Z0BH 4NHCL 3TZVA 3MLRL 4EDWH 3DSFH 3Q3GB 4OF6A 3C2SA 4M93B 1RJZA 1YY8A 1ZGLB 3WS3B 1MRCL 3EW3B 4M00A 3NFSL 4QRPB 4WO4D 5D7IA 5B38G 4S0SD 1TCRA 1OAXH 3IF1A 5ELIA 5TQ2L 3QI9B 3X3GL 5KSAA 3EYOA 2BOCB 2DJ4A 1EEZB 4NN6B 2B5IB 4U6VH 2X4UA 1E4XH 4K94H 2AABL 1G7PB 2E6QA 3L3OA 4O2FA 1TQCC 2DQUL 5KSBB 5LGJB 2XZCL 1KTDA 4MNQD 3VXQA 4U33A 1J10A 5BZDB 3UTPE 1CFNB 1GOFA 1YZZA 1ZHBB 1INDH 2FEDD 2XWTB 4KDVA 2IBZY 1FNEB 2RQ8A 4BELD 5GZND 4N5EC 5C07D 5FKAA 1W8OA 3DVNA 3EOBA 3E8UH 2IFFH 1BD2A 2A2QT 1I1AA 4XVJH 1D5ZA 5IW6B 2B2XL 3I85A 5IKCB 3VG0H 4OJFL 4GBXB 5B4MD 4HLZH 2P5ED 4UT6H 1MLCB 1RIHH 4ZYKB 1KTLA 2NY6D 1FVCA 3B5GA 4P5KA 5D8JL 4BSVB 3RGVC 1MIEH 1HCVA 1IBGH 3RWEA 4EDXB 5DLMH 4HF5L 4ZFGL 1N64L 4F9LC 1MFEL 1U8OA 3KPNA 4X4ZA 4XNMB 5C07A 3BHBA 1EAPB 3TBYA 3ZDYE 3BP7A 4Z7VB 4ONFH 5E2WL 4ORGB 5F7FA 3OTTA 4NN7B 4PGZA 4PJXE 3D3VD 2VDRL 3LRHA 3P4LA 3RKPA 3U4BH 1IZJA 4ZXBD 5IFAH 3GIVA 3EO1A 3NIDF 1BFOA 2P5EA 4UT6L 1CGYA 2PCPB 1J7VR 4UB0H 3CDCA 5TJWK 5D8JH 2PYEA 3O0RH 1AGEA 2HJLA 4JREC 3O3DA 3WL9B 4R4BA 5SX5K 4BZ2L 5AG9A 2OQJA 2NY1D 5DLML 3V7AE 5ALCH 5DO2C 3WS6C 5BV7C 3FT2A 2GUOB 1J0YA 1XR9B 2CD0A 2X7LB 1QFUL 4LAQH 1OLZA 4MD4B 5F93C 1G9MC 3T0WA 2MCPL 2B20A 3PWPB 5DR5H 4UDUB 5L2KE 2NNAA 2V9TA 3MNZB 5D7LA 3BVNB 4X4YB 1TQBC 4MJ6B 2P44B 3CUPB 5ID1B 1KIRA 3LQAC 1AIFA 1KF9B 5HYEA 4HT1L 2HA1A 3ECBB 5F72S 1I9RH 1I7RA 2VIRB 5FCUH 4F7PA 2FBJH 1EMTH 1G6VK 4K23L 5F6HJ 2QSCL 5D1XD 1NFIB 3GSOB 2M2DA 3LN5A 4RGNE 3X3FL 3QULA 1EAJA 3ZKXB 5FXCH 5KG9B 1I4FB 5A40E 4GJTB 4JHAH 3BXNA 3PHSA 4Z7OE 1J18A 1UADC 3OKDB 4GAGH 4KKCC 3CVIL 3GSVB 3MA7A 3RVWC 3NA4A 4OLWH 4WENB 2ZUSA 2BCKB 2MSPA 3MV7A 5BS0D 5ICZB 4I0KA 1XF4B 2XKNB 4OZGB 5LAXA 3RIFF 3IXTA 3TJHC 1AKJD 5CINL 1WWBX 3PDOB 4UIKH 2W65B 5KVDH 2ZZUT 3EO9L 1JGUH 4MCYB 5KG9A 3FO2B 4A6YB 4CVZB 1A5FL 1G1YA 3S96A 5CJ8A 3O45A 4X4XA 5D5MA 4JKMA 3LKOB 2WM0A 2EYSB 2E6JA 1YPZA 3RWIB 3V6ZA 4DEPC 2AGJH 2BFVH 2VN4A 2IPTL 2XKNA 3IJHB 4OZGA 2V7HA 5F1NB 1Q9WA 1U3HD 5J0BA 5HY9B 3EFDH 1M6OA 3SDAD 4LPXA 4YHNA 3BZ4A 4JQVC 5JIHA 4P2RB 5JA8B 3KPSB 2ZKHH 3TJEH 3TP4A 3FFCE 2FIRT 4OAWB 5EU5B 3UTTE 4NNPL 2OJEA 3NFPA 1L6XA 2OL3A 3RY6A 3TIEA 5KVDL 5T1MB 2W0KA 4C4KO 1EO5A 3H9ZA 4M5YL 1EJ6A 1KIPA 4MQSB 4FQXB 2Z92A 1WGOA 4KRPC 1K4CA 2F19L 4NP4H 1TDQA 4NZRL 2CLRA 3R8QA 3CFBA 3UTSE 5ADPL 2I60L 2XZQL 4LVHC 1WBYB 2H2SC 4IDJL 4ELKA 1OGTB 3NCEB 5TQ0H 3IRZA 1TETH 3P77B 4MCZA 2DQIL 3SDAA 4WY7L 3DETD 4PJ8C 1T1ZB 1MCPH 1HKLH 3KGRA 2D03H 5BV7H 4NNXA 4CUCA 3OXSB 4DCQB 1KTRL 4XXDB 4JFEB 3CXDL 3AU1B 1LP9B 1QLEH 3IDXL 3V79C 5JPMB 1U3ZA 2VZ1A 3SDXE 2C7UA 3SJVB 3AS1A 3SY0B 2ZCLL 4Y2OA 1IM3A 2QR0A 3O2DH 4K2UH 3WL9A 2FR4A 4LKXA 3MROA 2BMKA 3FQUA 5IT2L 3Q6GL 5D1QC 4I3SL 1TQCB 3MBEA 4R0LA 2G5BB 3ZE2F 4OFIA 5F89A 3VXTB 3VXUB 5FDYA 1U93B 1NCAL 2V9QA 5GSVB 2WP3T 2D0GA 1CE6B 5A3IC 5DMIL 3H9HA 1N3NA 2ATKB 5GJTL 3BEVA 2VLRE 4DKEH 4OCYH 3UXFA 1ETZA 5I66B 4UQ2A 5L6YL 4NQCD 3TYGL 1B0RB 2NZ9C 4MQTB 5H35A 2VZOA 4LEXH 4X6EA 2QHRH 5EU6E 2I9TB 5ITFA 4KDWA 3VXSB 1I8MA 4HUXA 3HE7A 4PLKD 1YEIH 2X4UB 3MC0A 2FEEL 3CMOH 1GJIA 4XNUL 4U49A 4WFED 3QRFM 2FL5B 2F9BT 2X70B 4QY8A 4HUKB 3UC0L 1V7NH 4UQ2B 5GSRA 1DL7H 4O02H 4M4RA 3EJYC 5C2BH 1K5NA 2HRPH 2VDQL 3CSYA 4NO0D 3DVNB 2PYFB 1A8JH 3BJLA 5FKAB 1KB5L 3IKCB 4HV8A 1MJUH 3MLVH 5DD0H 3O3AA 4LQFH 3GB7B 4TPRH 1LK2A 5CZVL 2EEAA 4FQXC 1DQLH 3T4YB 2DDQL 4X0KB 1PSKH 3FQWB 4TNVF 3CFDA 1BIHA 3EOYG 1XCTB 4M7JL 1RUAL 3SE4C 1I8LA 1GHFH 1LO5A 5I6XC 4BFEA 2DQHH 4NNYB 3TZVC 1EIBA 1JZ4A 4WO4A 2A73A 5F7DA 3TH4T 3KJ4B 5E2VL 1JTTA 4EQ3A 4HG4J 1YEKH 1IC4L 1AC0A 4PJEF 1EH9A 2A73B 3ZDXF 1KCSH 3IDMB 5I1LB 2BSSA 2GI7A 3QHFL 5KSAC 2G60H 1A7BA 5C0FB 4LCWD 3P0YL 1ZT7A 2VQUA 4UU9B 4FQPA 3M8OH 5IVOA 5LGHH 3HC3H 2BP3A 2AK1H 2V5MA 5LKNA 1OM3L 1J5OL 2ID5A 3HI5H 4PJCA 1NFKA 5HYJB 2Q8AL 4U1KA 4E5XA 3WFEL 5JW3L 5C08D 2CGRH 3OAZH 4GRLA 4AL8L 3ARED 4R6UA 4BQBA 2BNRE 2JK5A 2ZSVA 3EDDA 3D0VB 3X12A 3MLYH 3F7PC 4OF0A 3MRQB 1N3NB 1UWGH 1NCCL 5KOVC 5JA9A 4LCCC 4MNGB 5F7EH 4ZTPH 4QRRD 2UWEE 3VXNB 1CF8H 1CFQB 3FQRB 3OF6A 4QT5A 5F3BB 4PRPD 2G5RA 3HE6B 4U1MB 2X42A 4YDLC 1FL5B 4UV4H 3IJHA 4PLJC 4G8IA 4Y16B 3MBEC 5HYSB 4XP6H 2X44D 3MRCB 3DVIA 2UZIH 1OW0C 4JM2B 1A22B 4YC2C 2JK5B 1F4HA 2XTJE 1CFVL 5HHNA 5JW4R 3W5MA 5LQBH 4QTIH 4AEEA 2DM4A 4YDJB 2Q7YA 4LMQE 1ITBB 3V8CA 3U36B 4C55A 5EOTA 5MERB 1PZUB 3NACL 1KNOB 2F74B 5HPMA 3NZHH 3VGAB 1RJLB 4R4ND 3QDMD 3OR7A 5J6GB 5EBMA 1ZLVK 2YWYA 4GOSA 3UPAA 3TVMA 5EG6C 4EI6B 2B1HL 3KYNB 1PYWA 1JJUA 4J3SA 1E27A 2UY7A 1QHPA 4XI5C 4MD4A 4KHTL 1WZ1H 3GMQA 4LNVA 3BKMH 1CICB 1U8JB 3EJZD 3AM8C 3QRGH 4X4MA 3MZGB 3MCKB 4HWNA 4LNRA 5EIIB 2XA8H 1MY7A 1TCRB 4MAYD 4JFDB 4LLYA 3P4MA 4XAKE 1WWAX 1NLDL 3HUJA 1HILA 1ZAGA 3O8XB 1ORSA 3RKDD 1A3LL 1H5BB 1R3LB 3DX7B 2RGSA 3W9EA 4AJ0A 2XI9A 1RZJL 3QWRD 2IBZX 1K8DA 3BDYL 2DKUA 3RIAF 1HE7A 4LU5L 3L3GA 1RUML 1YEEH 5KANI 4OQ1A 3CVHH 3QUYD 3BP4B 4YWGH 3FONB 4F2MB 3BP6A 4JPWH 1GZQB 3MV8D 4KI1A 4Z77A 3TBVB 5I1HL 1SBSH 1U8LB 2ZUQC 1O0VA 3JBG7 5DEFA 3HC4H 4OLEA 3IXAB 2EDFA 4FMKA 2UZYB 2CIIB 5TF1L 3G5YB 4R9HA 4A6YA 3HS0A 3O4LD 1ZT1B 3AREA 4HCRA 3ULUE 2X09A 3GMRA 1OGAE 4XP1H 3EGSB 3FT3B 4NJ9H 2P7TA 1MPAL 4NZJA 1FC2D 5C0BD 3QDJD 4X7SL 3W11C 1HNGA 4JFDE 4ZYKA 5DURB 2FIKB 1II4E 4YBQC 2X4NA 1H15B 1G9EA 1XF2A 1VEOA 1RQ5A 5IKCA 2RAMA 4X7TA 4YBLC 1HHJB 1K85A 3QFJE 1MFNA 1D5XA 2PW1A 1A21A 4W70A 1RHFA 3UJIL 1D6EB 4GS7C 4XNMA 2GJ6B 4U7KA 1KLGB 1M1SA 2JJSA 5JW5B 4U1KB 3TV3L 3QXTA 2ADFL 1UWEH 3O4OB 5IGXL 4DKAA 2ESVA 3L5WB 4DFIA 2KQMA 4GW5B 3KWWB 4POZD 4XP1L 5D2NB 5JORB 1PD6A 5GXBB 1ES0A 3CCHB 3FZUD 3CXHJ 1J05B 1JI1A 5IB4A 2IAMD 3QNYA 4XPGL 2FR4B 4LCWA 4CN1A 2L7UA 4NSKB 3K8MA 2NTSP 3EYOB 5CJ5A 2HVJA 3O6LL 5K9KB 1JNHA 4OCXL 3KYKH 4GKNA 3NIDE 2VDRH 1CK0H 1T04B 4XXDA 2PNDA 4NN5B 4XTRD 2WBKA 5F7DB 4K71B 1TNMA 2FZ3B 1R5IA 5JNYA 1T1ZA 1SMOA 3EAKA 2R56L 2HJLB 2GK2A 1S78D 4G7VL 1MF2L 5F9JA 4S2SA 3STLA 5H2BA 1PEWA 1PAMA 1YMMA 3V4PL 5C0FA 2X4SB 1FNSH 2R1YB 2X1WL 5FKPA 3V5DA 4XPGH 3CSBA 4XWGL 2BZDA 3D25B 2B1AL 1EZVY 1V3KA 2AJZB 3JWOH 4JAMA 1KB9K 1SEBB 3S35X 5CAYB 3VRIA 1RJZB 3O8XC 3SPVB 1PZ5B 5EUKA 4UIMB 4YO0A 2DMBA 3PHQA 4ZOEA 4ZOCA 1JRHI 5GGTL 4R2GB 5C70A 5FYKL 1WT5C 5FO9B 4WWKD 1SJVA 1FL3B 1FIEA 3ROOA 5E8NB 4BYHA 1VEPA 4O2CA 1S3KL 1R5WA 1BLNB 4NFCA 1CE1H 1GC1C 1RIUH 1Y0LB 1A6TB 2NY6B 4ZTOH 2LQRA 3RNQA 4GQ9H 1KC5L 1U2HA 4YHKL 5FYJU 4DN4H 2NY7H 2X1QA 3S36X 3KLDA 5BO1H 3P0VH 4IRZH 1MHEA 4XC1L 3HR6A 2PXYD 3VFMB 4P4KB 4P5TC 1D5XB 2PW1B 1NEZA 3H9HB 5DFWH 4MA3B 3OB0H 3VFUA 1ZK9A 1WK0A 5CD3A 5H37H 2GSIA 4NN6C 3NZ8B 4XAWH 4Q0XH 4LCCB 4YUEL 1NEZB 4XC3H 5EZLA 2HT2D 1DBMH 1XF5B 2VLJE 1JGEB 2VKXA 1Q9OA 4NDMB 4XVTH 1UT9A 3QCTL 3QCUL 5F7KC 4X6EB 2I9TA 3MXWH 2CLVB 1ZLUH 3FQTB 4P4RA 1MRDH 2NY5L 4F9PA 2MHAB 3TCXA 4G9DA 4XBEL 4NQCE 2F5BL 3UDWA 3DI2B 2O61B 1W0VB 5CBAB 3LKPB 1IAMA 4RMRA 2Z93A 1TZGL 5ACLA 3DNKA 4XZUA 5I1AB 2EKSA 3AMKA 3C5ZA 4LSDA 4H0HB 4U1IA 2LU4A 3T8XB 4P9MH 5IUSA 35C8H 4ODWB 4YE4L 3IDGB 5D5ME 3SQBA 4LSUL 2R29L 5INDA 3D5OF 4TVSa 1QFWL 5T5FH 4NQDB 3WSQH 1S7XA 3VDCA 4YUEH 3LZFL 4EUPA 4PR5B 3LVEA 4GH7B 2CRYA 1G6RA 2HT4D 3ZDZF 4EN3C 5FF6B 2DQGH 3MOAL 3HN3A 2EDQA 4XHJD 3S35H 2AS5M 2R2EA 5D5MF 5E99H 1NQBA 2EDNA 2NLJB 5I8OL 4JRYB 2JJVA 5D1QB 3SDCC 2ICWA 1OP9A 1HKLL 1P6AB 3VW3L 4BZ1L 4ZD3H 1N5AB 3H6JA 4X98A 1QQDA 4MD5B 3UX9B 5I0DA 5B38A 2MQCA 5FOJA 4LLUB 5DI8A 1FBIL 3O2VL 3INUH 1BFVL 5EO0B 5CS7A 3SBWA 5DVKA 3BP7B 5HDBF 3PJSA 3BH8B 3Q48A 3ULVD 3HNSH 1CIDA 4N90E 2C9AA 3LMJH 4S1QH 5DWUH 5GS1A 3PNWA 2I07A 2NY3C 4QTHA 3IFNH 1MQKH 1LHZA 2H1PH 5C3TA 5KVGL 3MRKB 4TUOA 2HLAB 5MI0B 3U9UA 3ZHKA 2EYTB 5F71A 3ZDYF 4FQHA 2VUOA 1NCAH 3T1FB 1EHAA 3LSOA 4TUOB 2VRAA 3VWKC 3WHXA 4NZUH 1CYGA 4KXZH 1D9KC 2XPGA 2R2BA 3D85B 2WZPD 5I76A 3V6BR 3FQRA 4QT5B 5F3BA 5KOMC 5HGHB 3RWGA 1P9MC 5A1AA 3ZDXE 4PJEA 3V6ZB 1NFDE 3UTTB 1BX2A 4WU5A 1BAFH 2OJZH 1OCWL 4M6OL 4QOKA 2QHRL 5B8CC 3E3QE 5TDPA 5KS9A 3OPZH 3VRLE 3LSOB 4HUUB 5KN5A 2BVOA 4WHDA 1IFHH 1X3DA 4H26A 5GGSY 1FFNA 4JPVL 4HWUA 4QRSB 5CEZL 3GMRB 5ESAA 5C07E 5IG7A 2VZ3A 2IPUK 5FUZL 2AJ3A 3MV8E 5SWSB 2CIIA 4X6DE 2HT3C 4KROB 3CLFH 1YMHB 3CDGA 5DRWB 3I6LE 5KSAB 4NKOA 2FRGP 4M62H 5C8JA 4CW1A 3L7FB 5AEAA 4XMPH 4YXLH 4UT7H 3ILPA 4PLKC 3QDJE 4XT1C 2H45A 1NMCC 4OBRA 3AAZA 3LD8B 3HG1D 3G9VA 2IALB 5J12B 4QHKJ 3PXJA 2VLJA 4JFZL 2AEWA 4OLVL 3K8KA 4JY4A 2A38A 4N0UA 5E8DH 3WUWA 4AZ8A 2BHUA 3C8DA 1H8NA 3S34H 3C5ZB 4LEOB 4NT6A 5J1AA 4QLRA 5TDOB 2Q8BH 3VMNA 3OXRB 1G7MA 3ULUH 3RUGB 1RZKH 4KAQH 3N0PB 3BOVA 2YBRB 3PL6D 2ORBL 1A1NB 3GJFB 1T7VA 2C4XA 4K9EH 4F15C 4EUPB 1OTTC 3HNVL 5DJDA 3TESA 5BZWB 2WNGA 3OHXA 4MJIA 3DUUA 1WJ3A 3CFCH 1JBJA 3UZQA 2UUDK 1AO7A 5IBLD 3OKKB 2QQLH 5HTSA 4EDXA 2AJUH 5GS1C 1H3WM 1H3XA 4ODWA 3C60C 1BZQK 1IM9A 1MH5B 2CXGA 2FJGA 3C9NA 3HI5L 4PGEB 4Z5RA 2HT3D 2YZ1A 2UY6A 3B5HA 3G6AA 2GT9A 2JKXA 2EIZA 3RBSA 3S98A 1DN0B 5B8CA 3RWDA 4JFQB 3T0BA 2OMNA 1VGKB 1QRNE 4AIZA 7CGTA 2IQ9H 4N1EA 2ADGA 3HKFA 1N7MH 1ADQL 3QUYA 4JG0L 1BVZA 3UZVB 1NGZB 1MI5B 3F58H 5T3XL 3CFCL 1BJ8A 4OZIA 4Y8AA 2R4RH 1L7TH 1PZ5A 5TE4L 2LU3A 3T1FA 3MJ7B 3GSRA 2FATL 5ALBL 4YHIA 3MO1A 4G9FD 3OQ3B 5CEYA 3SGEI 1EGJH 3GDBA 4M6MH 3VA6A 4M7LL 1EX0A 4EIGB 1YYLL 2EIBA 3EIFA 3S37H 3DO3A 1RV6X 4CNIA 3H7BB 3H42L 3IDJB 1OTTD 2VQTA 1IM3B 2R8SL 4U6VL 1RZJC 3IF1B 1Q72L 2AABH 1G1CA 3LN4B 3NA9L 2E7BA 4QRPA 3RI5K 1RZ8A 4MQ7B 4EIZC 3HZVA 1RK1A 3IDNA 1A9EA 1FNEA 3ARZA 3Q3GA 4L4VE 3O11B 2MQ3A 4O00A 3OL2A 1NMBH 1RUKL 1TVDA 1R0AL 2VKWA 3QRGL 4Y5XA 1T66D 2GTWB 3VJ6B 4XXCC 2X4OB 5E9DE 3UTSA 2OR9H 3MRHA 1XGUA 1KJMA 1Q8MA 4I0PA 2E7HA 3G6JF 4S1SH 5HVHB 4PLOB 3IDJA 3TNMA 2MHAA 4YFEA 4QHUB 1A1OB 3GO1H 5HYJD 2EDTA 3IFOA 1JPGB 1NJ9B 5MENE 2VZVA 3KPRA 2ZCKH 4P2OC 1JV5A 4BK4A 4K3HA 2FBOJ 1U8MA 3RJDA 1BIIA 4NRZA 4XP4H 4ZOBA 1FZKB 3QHZL 3G04B 4ONGH 5EC1A 1EFQA 4Y19D 5CJOH 1NBZA 4YHNB 2QHLA 2BHYA 1BECA 3RZCB 4PRPB 2ZJSH 3HE6D 4U1IB 3CAFA 1A6VH 5JXED 4KRLB 4TULL 3FN9A 3DGGA 3PL6A 3MRBB 2ATPA 1CXFA 4OT1L 3PGFL 5GGTA 3U4BL 5FGBC 4Y4KC 1A3RH 2F58H 4V2CB 1QBLH 1FO0B 2UVEA 2VXUH 4JFFB 3D39D 2PTUA 5IV2B 4A6YH 1RVFL 3MRGB 2AJVL 1MHCB 1J8HE 3KWWA 4G5ZL 2W91A 4K7FB 4OFDA 5DXWA 4HGWB 5EBWA 5GRYA 3QUYC 2CH8A 3L5WA 3KPMB 2B0SL 2IEPA 1CU4L 2WBJA 2ENSA 3MX0A 4C54A 4YK4C 2WIIA 4XWOD 4JVWA 1F4YL 4TNWF 3BUYB 5AWNL 1S7WB 2DD8L 4JANB 4KC3B 4QXGH 4OZHA 3QQ3A 1UWEL 4K7PH 3I9GH 4G7YH 2R2HA 1B0WA 1DJSA 3QDGE 1JPSL 4FG6C 3EO0A 3RWDB 3QT2A 4FQ1L 4Y5XC 4KKCD 1RUPL 3D39A 4BFIB 4PJEE 3STLB 1JZ6A 3CPLA 4MAYB 5C0NC 4MYWB 3TT1L 4FN0A 4P3CH 5ACMA 3D69B 5DFVC 4BZYA 1U3JA 4JFEE 1LILA 2EH8H 2IBBA 2ERJB 3SY0A 5IHBA 4NRYA 1S9YB 3OX8B 1RURL 2VH5L 4JLRB 3QG6B 2OK0L 3PP4H 3KXFD 5CGYC 3VH8A 3OJDB 1D5MA 5L7XH 4JAMB 5BRZA 2DQFB 5IVXE 3LEVL 5H94A 1HZHH 5EO0A 4DVRL 5JPNB 1OAXL 1PQZA 2CK2A 2VITB 3JTTB 5CIPB 2A9NL 2VE6A 2ITDA 4MD5A 5DRNB 2J12B 3MV8B 2FH6A 2Z8WC 2FDBP 2HH0L 3QJFB 4FFVC 4I4WA 4X9GA 3D69A 1E4XL 1PGRB 1X5KA 4GFTB 4J8RB 3TT3H 5IBUB 3EO9H 1FFNB 5M7QA 1I8IA 4LLYB 4M8QA 5FYKH 5CGMA 1ZA6B 5A16B 1D5IH 2CJUH 5C0BB 3MCKA 1D9KB 4RZCA 3HPLA 3SE3C 3MFGB 4ZFFB 3PP4L 3BDXA 3WKMH 3WKNA 3L9RB 1V05A 5J56B 4ODHL 4QKXB 3R0MA 4PJIF 2AEPH 5BO1L 4MSWB 4M03A 3QNXA 4P2RA 1T7YA 2GAZB 1QBML 2GSIB 3RNKB 2FJFB 4XPBH 5CD3B 1RU9H 1I85A 5BJTA 5JOEA 2BRQA 4NHUA 3TT3L 5I1CL 1NGWA 3SGJA 1CQKA 1MHCA 1NGPL 2NY7L 3MZTA 3I50H 5MI0C 2B7DT 5C0RL 2YRZA 3RWFA 4GRLB 1DBAL 1XEDA 2NY1B 4WW2F 1DBKH 1MCEA 2F5AL 2WWMC 3DX8A 3VWJA 5HI3D 4Y1AD 3CFJB 4FA8A 2W9EH 4KJPD 1KCVH 3OGCB 1UACH 2IPKA 4Y89A 4KPHH 1BJ1H 5ID0B 5EOQH 2XACC 3QIUA 4U1MA 4YX2L 2W0LA 4FQQA 1Q9KA 4OIIH 4YFLF 5EZIH 4NWTL 1BJMA 5GJSH 4OCRL 1KCRL 5DVMA 3J8F7 2F53B 3LS4H 4RDQF 3T4AB 3V6FA 2E27L 4M43H 1I9IL 1EEQA 1EJOH 3ZYZA 2AV1A 1XH3A 4PBWD 3NCMA 4U6YA 2QADB 3MRRB 2JF1A 4L9LA 1ACZA 3KPRD 4WFEE 4XCFL 3IXAA 4QHLB 1VFOA 5C08E 1I7RB 2VIRA 3WIHH 4L4JA 2F5AH 3MRLA 2IANA 3AY4C 4PRHB 1H0DB 1G6RB 4CADA 3TBTB 2EYRA 2X1PA 4PJ7F 1S7UA 4CMHB 1JHLL 4PGCA 4JO3L 1WBZA 5DD3H 4FXGA 5ACZA 4X8XA 4EI5D 1V7ML 3M1BA 5D72H 5L9DH 2I24N 4DVBB 1EJOL 2F74A 2QBWA 3B5TA 2IPUG 3INUL 5DMGD 3ARGC 4YDJA 1EEUA 2BSRB 5DJ8B 1JVKA 2FB4L 5IB3B 4UOJA 3HNSL 3PGDB 1JNLH 3RY4A 3IFLL 3H7BA 3IDYC 3D9AL 2PYEB 1A6AB 5I73B 2AV7A 3O3BB 1BJ1J 2H1PL 3SGJC 4S2SB 4R90H 4Y16A 5JORA 1U3HB 5T3ZL 4XB7A 5GGQL 5GS0L 4K8RD 2H6PB 3CK0H 4OFYD 1X9QA 4CAGA 3VH8G 4P2RD 5B22A 4TOYH 3UC0H 1JHLH 3VGGA 4OGAC 4H1LH 5C9KA 4PRIB 4JZOB 1G9NL 4Z7UB 5IR1B 5JZ7C 2HRPL 3CSYB 2EKSB 4LBEA 3HMXL 2QQQA 4FQXD 3EFFA 4KK9C 4PJGB 4LQFL 4WI7A 3MGOB 3GKZA 2X70A 3X11B 4HIHA 5T1LB 5CSZA 1U8KA 2APWA 3MRNB 3GEWB 2A77H 1JUFB 1Y18B 1VKXB 1I7UA 1BPVA 3MCLH 1INQB 1DTUA 2VABB 3VDBA 3I3EA 3C6SB 1NKOA 2Z31B 3QZWA 4PRPE 2XY1A 2FWOB 3G6JB 4ZUVA 4B7LA 5IW6A 3HNTH 4H20H 4M48H 4AEFA 3RPIB 5KVFL 2FGWH 4GSDH 5IF0A 1MHHB 1YUHA 1NSNH 2FX8L 4UTAH 1OCWH 1VFMA 2G2RA 1FE8L 1OT2A 1S7TB 4OI9A 1FZKA 1K3ZA 5KANG 5I1JH 1S9WA 3NMEA 2FIKA 4POYA 2G9HB 2Y1VA 5LGHL 2BY0A 1LEIB 2C5DC 4PJXA 5FO9A 4EVNB 1P4LB 5C0BE 1EEZA 1N4XH 4OQTL 1CD0A 1KLFA 1N0XH 4WUUB 5F6IB 4NQCA 2OL3H 1FGVL 5GZNC 1CXLA 3HR5A 2XWBA 4KJYB 2H41A 2LVCA 3W5NA 5JHDB 3FONA 2OR7A 5LVEA 1RZKL 3TIEB 3OKOA 2IGFH 1GGIL 2VXVL 4JRXD 2XQBH 1O5DT 5E6ID 1WWWX 2GHWB 4AT6A 5E8DL 4PJAB 4UAOC 3S3PA 2V7NB 3QNYB 4Y5YB 1C16A 4AG4L 3ES6A 2Q86B 4HW6A 4P2OA 3OAYH 2IANB 3HC0B 4WI3A 4YZFE 3MRLB 1QKZH 1UENA 2VLKB 3S6CA 4FQJH 3S36H 3VXMD 1UJ3C 2CK0H 3FQXA 5DUPL 5H35B 2VR5A 5BVJB 3MLZL 3WV0A 3WUZA 4XBGA 4DGYL 1S7VA 2GJ6E 4GAYB 1LO0H 1UCBL 2WV3A 1U8NB 4U6YB 5EUOB 3UZEA 4I13B 3PV6B 4PREA 4S1DD 1MHPH 3MRCA 2AERT 4UMGA 2VC2L 1XGTB 1HOCB 5DGQA 3MRPA 1F2QA 2NX5E 4WV1C 3F12A 5MP6H 4KY1H 5F1OB 7FABH 1K8IB 1FFOB 3UTTD 1BEYH 5CD5D 4CU8A 3ARRA 1MI5A 4S0TD 1G0YR 3O4LE 3ULUD 4PJFA 2HFEB 2R1WA 3MFFA 3RVUD 4M5ZL 3OMZA 1IGIL 3KXFE 3MRQA 5GISH 4M9PA 1DLFL 5C6PB 2IANE 4ZUTB 3WFCH 1AO7E 1UM6L 4G3YH 3JWDC 3K46A 1I7ZB 5IJVA 3ZT6A 4X6CA 1U8LA 4TNVK 1KCLA 1CLZL 4HXBL 2BERA 5I1EH 1RZ7L 5IR1A 1NDGB 1AGFB 1NAML 1DQQB 2CLZB 1QFWM 5IEKA 5CKGA 1RD6A 1UQSB 4S1RL 3HZYA 5FYKU 1ZKAA 1P2CA 4JHWL 3QNXB 4YFLI 1BBDH 2VE6B 3HLAB 2NXYB 1CGVA 3QA3B 4KUZL 3CVHL 5DFTA 5IW3A 1LE9A 1H5BA 1R3LA 3DX7A 5C0CB 4E0RB 5GGUA 4OUUB 4YDIL 3SGEH 4ETQB 4RIRA 2GJZA 4JM2F 4N8VB 1QBBA 1QFHA 3CD4A 3QAZB 2C26A 3CMGA 1X6LA 3UCRA 1W72L 3UYRH 1MLBB 5F1KC 1YEKL 2D7QA 3LQAL 2C1OA 4NNXB 4J12A 1T21B 2J8UF 1P6FA 1YQVH 2OJEB 4UINL 2DL9A 1KPRA 4RISH 5H37G 1C16B 4PLNC 4LLVB 3C09C 3P9WB 3GGWA 3DX9B 4I9WE 5EH1A 1ZHNB 4F8QA 3FHQA 1G9ML 5FUCC 4HJ0C 1KPRB 1UVQB 5DTFA 3M07A 4FRWA 4HV8B 4K8RL 4I3GA 1SJEA 5IQ7L 4J3XA 1D6VH 1PDKA 3ZE0E 1R3HB 4J1UA 3GSNB 3RDTC 4LVHB 4PJDF 5EIQA 4MX7A 3ZL4L 5C0EA 1YJDH 3MRRA 3RA7L 1K6QL 4CU7A 3SDYH 4JM2A 4UOW0 1ZLWK 3IB4A 1OW0A 4K7FA 1VSCA 2YD3A 2CO6B 4LHUB 1WC7A 3ARWA 5F7EL 4NDMA 3D87B 2R9HC 5EORH 3A6CL 4QHMA 3HUJF 1A02N 4J3UA 4LCCA 4Z76A 3NOIA 1XF3A 2UWEB 2NX5B 1MI5D 3P4NB 4UV4L 5E6IA 1F4WH 2ATPB 3BSZH 5IB5B 3K1KC 5D1ZA 1FRGH 2E7LA 2P47B 4QRRA 5I15H 3ABZA 1FVDB 4R97C 1U8OB 3KPNB 2XKSA 2A0LD 4Q6YA 4TSCH 1JL8A 1QSFD 3BZDA 3PQYD 5DRZA 1ZLSH 3TFKC 1EV2E 4YHLL 4MA7H 1V3JA 1MF2H 4I2XE 4X83A 4AMKL 4Z0BL 2F54D 3GKWL 4PJDA 1UJTA 4PGJA 1B2WH 1X5YA 5C7XL 4E9LA 2AV7B 1T20A 5DDHB 4PJFB 2EEBA 2JIXD 3GMNB 4XWGH 5GS1B 3MRBA 2ERJC 3P73A 3HPJB 3JWOL 4UILH 4PJGE 4HDIB 2ED7A 2O5ZH 2VXTH 1BOGB 5AUMB 4G6FD 4X6BB 4K7PX 5DMGC 5HGDA 5E8OB 5B39B 4GAYA 3UAJD 4KJYA 3FB6A 3LD8C 4HS8H 3HCVA 1S7RB 3B2VL 4Z7UF 4P59H 3EZJB 3UROR 4Q97A 4F7TA 1SEQL 1OB1A 3I3DA 5DURD 2L4OA 3HE6C 2MWCA 2P5WB 1NCNA 4X6CE 3BDYH 1P7QB 3KYMA 4U1JB 2YHGA 3V0WL 1M4KA 4JFHE 3QUZB 4DVRH 1IGCH 3RX7A 1UM5H 2IG2L 4HFUL 5LXGH 4UILL 4YWGL 3UBXI 3WS3A 3WN5A 4LASH 2O5ZL 2VXTL 2IH1A 2W9DL 1MHHA 4OLZL 4W81A 1IGJB 2YC1A 2BOBA 3TPKA 2NZ9D 3KPSA 4L8DB 5D7JA 1MCDA 1LO3L 4PPTA 1Z2KA 1ODAA 1UM4L 2WAHA 3H9YA 1H9VA 2DI7A 4XMLL 4ZFGH 4XWOC 1JUFA 1VKXA 2JJSC 1FAIH 1PY4A 4S11A 4KI5C 5HGGS 2VDLH 4LVNB 3VGFA 3ROLB 4YHOH 5J11B 4R8WH 1JGUL 2WQ8A 3JZ7A 4FQXA 3RY5A 1WLHA 5T5NF 2HLFC 1EAPA 1NGWB 5HHXH 4PRIE 1NUDA 2V17H 4XNYH 3M17B 3GM0A 3W82A 1IQWH 3OSKA 1WTGT 3MOBL 5C0ND 2XXCB 1Q9KB 3RL1A 3RAJH 3TV3H 3LKSB 2MKWA 4LLWA 3QIUB 5EOQL 1CFNA 4MNQA 4U2YA 1XGPA 4NKMA 1ZE3C 2YMXL 3OGCA 1FVCB 4P5KB 4PP1D 4PTTA 4WU7B 2BMKB 4FQ2L 4AIZB 3G9AB 4OD1H 3O45B 4PG9B 1KFAL 3PABB 2VDPH 3KPPA 1DUYB 4XCNB 5FHAH 3GZKA 2C7UB 1NUNB 1IM9B 1MH5A 2FJGB 3C9NB 1NEZG 1JWSA 4Z5RB 2BNQE 3WUWB 4JFXA 3OXSA 4YR6A 3ZKND 3S5LB 1KIRB 4OKDA 1CL7H 4RFEB 3OKKA 2VLJB 1ZVYA 1EFXA 5DHYB 2I9LB 3ARGB 1BF2A 4PGCB 2HFFB 3MOBH 3X14A 3TBWA 4B41A 4AT6B 2WMPA 4JKKA 2VLRB 4GXUN 3UTPD 1ZVHA 4IOFD 2CO7B 5BRZB 3WBDA 2PTTA 4N1HB 1HILB 3O8XA 5KVEL 1KEGH 4R26H 4P5TA 3VFGH 2BXYA 1QRNA 2BJML 3LKNB 1GOGA 5IROA 3HZMA 1BBJB 1LE5A 4J1UB 3TGXA 1YN7B 9CGTA 4PRDA 2DBJA 4LLQB 2LAAA 5DHVH 5ID1A 5KN5B 4K7PY 1N8ZA 3HG1A 4Q9BA 3WN5C 3O11A 4JGJA 4Y5VA 3NGBC 4G6ML 4HS6A 2DLTA 3U46A 4XPFL 5CIPA 2RJMA 4DUXA 4DOHE 1OF2A 3MMEB 1R6VA 1MREL 4WTZA 2I5YL 1S7WA 1BAFL 5F1IB 2A1WH 4OV6F 1KNOA 3BKCL 4APQA 3MQIA 3VCLA 3TWCL 2YRLA 4R26L 1JRHH 4EBQH 3PWVA 1DFBL 3L3KA 3OPZL 5TE7H 4LFHG 4N8VA 3RDTB 1X4XA 5ICYB 1Q0XL 4LIQH 2ZUXA 1H3UA 4OB5L 1T1XA 4BSWB 1T4KB 3D3VE 3FB7A 4OAWA 1Y18A 3T0AA 5FM5O 3ME0A 4BH8A 4HKZB 1HKFA 2W38A 4ISVA 3VCLB 3EYVB 4IRSA 4MSWA 1J1PL 1HINH 1MFCH 1MEXL 1NDGA 4M1DL 1HHHB 3NABL 5DK0A 6FABL 4KWUA 5SWQA 5HHPA 1I4FA 5IMOB 5GRVK 5ADPH 4HJJH 2H2SD 2K1MA 3A6OA 1XMWA 1JGDB 1A7RL 4LDEB 5C92A 2QADD 1WZMA 5ANMB 3MJ9L 4WY7H 2WBJD 5CZVH 1MCPL 1KTLB 1T2QL 3CDYA 3ZYJA 4Z7NF 5EBLA 3G5YA 3L6FB 4OM1H 5KSUB 1MVUB 3ULUL 5KVFH 1M05B 2R29H 1I1CA 4AM0A 2FSEA 4Q9QL 2BVQA 1OHQA 2YD1A 2N1KA 3C8KB 2DRUA 1FZJA 3DURB 2AXFB 5CUSL 4KKNA 5HI4D 1MWAH 1J1PH 2NY2B 3OKOB 4PJHF 4ELMF 3EYFA 4Q6IB 1S9VB 4E41D 2D7PA 3QWRA 1S7XB 3O2WH 3ESUF 4V1DA 2JB6B 1IAIM 2Q6WB 3GRWH 4N9GB 1TCMA 3NVQA 4WW1B 1IAKA 1AXIB 4JZNA 4P2OB 1AIFB 2QSVA 3CZJA 4M1CD 2BK8A 5MENB 2P8LA 5DMIH 4PP2A 4HHAB 2WBWB 5IB2A 1F97A 3HC3L 1MNUH 2V2XB 5TH2B 3QPXL 1IAOB 3BGAA 3ULVH 3PWNB 4ZG1A 3ULSA 1L7IL 2A6JA 5E9DD 3O6FB 2VLRA 1U8QA 2WANA 1VPOL 3BUYA 4QHNB 3L3HB 1HH9A 3MV9B 2WBJC 4JKPL 3VRJA 3RVXD 1HWHB 1WAAA 3CFEA 1IEAB 3BD3A 3TZVD 3CZFB 4JFXB 3S4SB 1KPUA 4CDHA 4AQ1B 3U6RB 1J9CT 1NCTA 5EPMA 3RGVB 5C86A 4BSVA 2AXHA 1GGBH 3HE7C 4I9WD 3N1PC 1HXMA 3KNBA 4IOIA 1KT2B 4W6XB 5KSAD 5JOPE 2ESVD 5E70A 4WEBL 3GI9H 3TO2B 2YD2A 3OV6A 5IMMA 3EFFB 4JPIA 3HAEB 5ISZB 1LDSA 3KJ6H 5CEYB 5FM5M 1CGWA 3VD5A 3BIAX 4JDTL 3ZKMD 4KK6D 3QDGB 3IJSA 3BEWA 3QCVH 5I18L 2BNRB 2FJFA 1IEAA 5EUOE 4F58H 4RX4D 1Q9LA 2AJYH 3BPOB 5DZOA 1IGJA 2YC1B 5CLTA 4ODBD 4PRAB 3V52H 3VWJD 5JDSB 3K0WA 3OR6A 1TZHA 4JPVH 2VABA 5IVZB 5CHNB 1F11B 5JQ6H 4E42A 3CIQA 2N4IA 4PJ7E 2AJZA 5FUZH 1IL1A 4S1SL 32C2A 3P11L 1SBBA 2Y23A 3F6LA 3VA2C 1KT2A 3BAEH 3QFDB 1A9BA 4G6JH 3WLBA 1G9NC 2YPLD 3ARDA 3SCMC 2P5WA 1V5JA 3DGGB 3PL6B 1HDMB 4FZEL 4L1DA 4GRWF 2OP4H 5GGSB 4LPCA 2XTJB 1CLOL 5D7KE 3Q5TA 2VLLB 3C60A 3Q5OA 5DEGB 2DLIA 2UYLB 1Q0YH 5IESH 4LARL 5EC1B 1KB5A 3ZT5A 3VFNB 2OTWA 3C2AL 3REWB 1RZJH 2P45B 1LVEA 2CMRH 4ZUSA 1VHPA 3MLXH 3P9LA 3EHBD 3TN0A 4V2BA 3S88H 1IAOA 2AXFA 2CDFB 2R0LL 4U05A 1CDYA 2J88L 4NJAH 4L4TD 3BAEL 4AM0B 3CCHA 2AAVA 3ET9F 3JWOC 4I77H 4G5ZH 4P5MB 4GXVH 2GK0B 2M1KA 4Q58C 4TSBH 1NFDB 5FUOH 1ZANH 3GBNL 4F9PC 1NC4D 1FYTB 5MHSE 3EBAA 3WIFA 3H9SA 2XWJB 4E41A 4RFEA 3DROB 3S5LA 2A74A 4BH7B 3VFOA 3ILPB 4FZ8H 1SJHA 2PXYA 3VFRB 4X80L 1VFUA 2W60B 5GGRB 4XH2B 4KRPD 4YDKL 1MCHA 4IEFB 4F80A 5K9KA 4K7PL 5J3HD 5E2TL 3QWQB 3NACH 1JMXA 4FQIL 4ISVB 1TITA 4FOMA 4KROC 1E6OH 4F7MB 3S8WA 3BQUB 3QIBC 4GG6B 2X41A 1QG3A 3DI3B 3BKYH 3H7LA 4DZ8A 4DEPB 5DJ0A 4JG0H 4KTYA 4TSBL 4H8WH 4KJQC 4LDOB 3CZFA 3IT8D 4U6XA 5CMAB 4DOHB 4PJHB 4ELMB 5ICZA 1AO7B 4XX1E 5D7IF 1CN4A 2BVUA 4R7NA 3MA9L 3MYJA 3PNWB 4QTHB 1JZ8A 4PJ7B 1S7SB 3H3PL 5BZWA 2FBJL 1UC6A 1XCQB 4JHZA 1B9ZA 4WCYL 3B8YA 4JRYE 4YHLH 4QEGA 1MCNA 5GSVA 3WXWL 3DGCR 3MTRA 3VFTB 3ZKSD 1HSBA 1MJ8H 2J7LA 1B2WL 4ZODA 5GGVH 5LG1A 2X9XA 5C08A 1ND0A 2CKBL 2BY1A 1FL3A 1IGML 3HG1E 3SKOB 5JUEH 1QSEB 1RZFH 2DIAA 2X4PA 1I1AC 1A1OA 2CDGA 4H1LG 4NC1E 5E5RB 5CINH 5DJZA 4QRTA 1DBJL 3U9PL 4KKAD 4C57C 4J6RL 4ETQA 1IGTA 1MJJB 1RMFH 4JQXA 4HUVB 4CVXA 4H88L 3EYQD 4DCQA 1JHTA 4XB8A 2CQVA 2VL5A 1MCSA 3CVIH 2DTML 4ZFFA 5IM7B 1MUJB 3T0EA 1MPAH 1D9KA 4OLUL 5C0AB 1S9YA 3OX8A 1P2CB 4WDIB 2CUIA 3FKUS 2DQEH 4RA3A 4Y4HC 4ELKB 4R2GC 1CXEA 5IMKB 2EO1A 1RZIA 5ITBL 3GBML 3KLHD 4XZUB 1NL0L 1V3MA 3EJYD 4G8GA 4PJBA 5EU4B 1J1XL 3MV8A 3REVB 4LHUD 2RCSL 4LLAA 2LE9A 1I7ZA 1NCDL 4HXAH 2ZNXA 3QWOB 1U3HC 5IM7A 4U1HA 4APQD 4PRBA 4GQ9L 1GXEA 2FX7L 4H88H 1N6UA 4NP4L 4NZRH 4OZGF 4L9DA 3QEQB 1YMHA 2EDKA 3OKEA 4LCUA 4PB9H 1J0JA 3RX5A 2W92A 4XNYL 1VADB 5SWSA 1EFXD 2AXGA 3FO1B 3GSNH 4ZFOB 2HTLC 3AC0A 4U1SA 4WNQA 3RAJL 1F6AB 3U0TA 4GW5A 3V4VH 4HGWA 3WS6A 2EYSA 5LWYL 1A4KB 4R8WL 2F54B 5EWIL 1CFSA 1QOKA 1FFQA 2QQKH 43C9B 1J1XH 1N64H 1WZLA 4OZGE 4ZPTA 5FGSA 3P9MB 1MRDL 4FQ2H 1OD7A 2JIXB 2DF3A 5J06A 4BA8A 1BREA 2ZUWA 4JZJA 3QEQE 4O4YH 4P9HC 4XH2A 2VDOH 1GGTA 3UTOA 1QQDB 1CFQA 1BM3L 5IT2H 2BSSB 2LTQB 3TA3B 4B0MM 25C8L 3KPSE 3VRJB 3HFMH 2X4RA 3OHXB 3ARBB 3F7VB 3IDXH 5DJ6B 4J3WA 4LLQA 3PV6A 2IWGA 4YGVB 4DZ8B 1T1YB 3ZKQD 2XRAH 3N1GC 4JFFA 1IQDB 4PJCB 2R1YA 4YQXH 2UUDH 4G6KL 2HKHL 1YECH 2RIKA 4MWFA 4N5ED 3SDCB 2CKBA 2XNAB 1ACYL 3T77B 5JR1H 3DXAE 1JN6B 2ITCA 1V3LA 1CFTA 2XZAL 4F15B 4MJ6A 2YEZB 5HHOA 3LEXA 5I8OH 5L2KD 1M7XA 3BW9A 5T3XD 4DZBB 3PWPA 3V6OC 2WWKO 4V1DB 1F4XH 1LDPL 1NGQL 4D9LH 4DGVL 1LP9E 2FLRT 4OFKA 4Z95H 4HT1H 4DN4L 1A7PL 5T3XE 4HDIA 1LO4L 3BH9A 4F57H 1JPGA 3IAQA 1BFVH 3DVFA 5MEPA 3ELAT 2GY7B 2CJUL 2WK2A 1V7NL 5F7WC 4ZO7A 1MFBH 4PTUA 3SN6N 4JQIH 5C2BL 4OCMC 2X4SA 3VXOB 4UV7H 1IC7H 1GVIA 4JQVA 4Y1AB 3QUXB 1J0IA 5J4MA 1INQA 5EA0L 4KZDL 5I9QB 5ESAB 2AEPL 4G6MH 3MRNA 3DV4B 4ALAH 2W9LA 4LSRL 1UB6B 2X9WA 2C1PA 5IVNA 3GMPA 2F53D 1UQSA 4O2EA 4NIKB 4MQ7A 4PJHE 4ELME 4X7CC 3MXVL 2F53E 4LSVL 5DQDL 3QUKA 4H0GA 4UQ3A 4OD2A 1CTNA 1E0OB 3BWUC 5CEXA 3UMTA 5F96H 3SOBH 3TPUA 5IJVB 1P5VA 4QY8B 5IP4A 3SCMD 2VMFA 2D0FA 5I75B 1WEJL 3LH2L 5DJXA 4EQ2A 1U36A 1AGDB 2ARJA 3O6ML 2Y25A 4R4FH 1WC7B 3FRPA 3BRGC 3DPBA 4LP4A 4KTDH 4R97B 3I84A 1UXSB 4HAFA 1A6WL 2P7TB 1CLYL 4MHHG 3DHJA 1FQ9C 3B9EA 1KV3A 4TQEH 5DMYA 5TE6H 3X11A 1EHLL 2J6EH 2QR0B 2OR8A 4N90D 3SDXF 4C4KT 3TBSA 3FOLB 3NCJH 3EDKA 4PJ9D 2Q7NA 3IJSB 5CEXB 1WITA 1OPGH 6FABH 2VLJD 1I7TB 5DZLA 4O5LH 4QYOA 4YXKL 3IAGC 5CZXC 5F8RC 3G5XB 1LEKA 3VFWB 4QCIA 1A7RH 5E99L 2VLRD 1CXKA 3HHRB 1MRFL 3BPLB 4R0LC 1MCBA 3FOMB 5FA4A 3MLYL 2B4CH 2PYED 1DN0A 4X6DF 2I60H 2XZQH 1NCCH 3TNNB 2AI0L 4LHUA 2XA3A 4FP8H 2CKNA 3G6AB 4KDTA 4FQJL 3S36L 1ORSB 3A67H 4Z8FH 1TETL 5AG8A 3C5SB 1OGAB 3WFEH 5JW3H 4XBPB 1T3FB 4B53A 3B9DA 4R96B 3IDMA 4LMQI 5CEZD 2E9JA 2BRRL 4LKCA 4OF5A 1NKRA 2W0PA 2YN3A 2Z8RA 1OPGL 5E8OA 3QPQC 4X6BA 1WISA 4XXCA 3V6OA 3QPXH 4HWZB 1AHWC 3GHEL 3P30H 4ZS7L 5LQBL 2JJTA 2BVTA 2R69L 3GRWL 5C0AE 5BW7A 3IETA 3BRFA 3U1SH 5TH2A 2P8MB 3QAZC 3ARGA 1BQSA 4OFYA 1OY3B 2DL2A 5DHVB 5T1DL 1FYHB 1OWRM 1DSFH 3IJYB 3WFCL 4N0FB 3OZ9H 1OAYH 4WUKL 3FQNA 4KKAC 3ULVL 3TYFB 1A64A 2E9WA 5DRZB 1KSRA 5EU7C 1JGVL 1N2RA 2Z4QB 5LBSL 1UEYA 3EUUA 3WHE1 3MR9A 4PGDB 5C0CE 4TNWK 4M1GL 4L4TE 1XF4A 1H3VA 2VQ1B 1DE4A 2XTLA 1TTFA 4EI6A 1UA6H 3W2DL 1TMCB 2EDBA 4LRNH 4MDJA 3B4NA 4HD9A 5EBMB 4U0RC 5I1GH 3ARQA 1I7UB 2R4SL 1B88A 2J5LC 5MERA 5FHBL 4BQ9A 1WAAE 5CSZB 1N2RB 3RBGA 4X4XB 1W0YT 4LU5H 3MYZA 4WUUD 4QRQA 1SMAA 4ZOAA 4GLRI 5TPWH 4PJFE 2ZOKA 2Y07H 3S37L 1ZGLP 4YHYB 5JHDD 4NQEB 4OM0L 4R7DB 2CSPA 5DK3A 5JIIA 4O2CB 2W65A 1FE8H 2BVYA 4PUBL 4HMCA 4B5EA 1FG2B 5HI5C 3CUPA 3THMH 4NBXB 1DEEA 3IGAA 3TVMD 5HVGB 1CL7I 5CILH 4AEHL 5D96C 4Y4HD 3KDMB 4NHCH 5JPNA 3EDFA 5I1GL 3MJGX 4NRXA 1WVZA 3QFJB 3HB3C 5ICXB 3LN9A 4JPWL 2HTKD 1FG9C 4WWID 5KSVA 3NCBB 1SVCP 3KPLA 2CMRL 2VDNL 5F7HA 1FYTE 4TUKH 3ZL4H 5C0EB 3NFSH 4HC1A 4QRPD 3D18A 4WO4B 4RGNC 4HPYH 1SYSB 2VDKH 5DEFB 3GMMB 5TPWL 3UBXA 1TTGA 1ED3B 5C0GB 4IHOA 2GSGB 4RGMC 1HHIB 1R3IL 3P9LB 1IEBB 5DJYB 4DVBA 1T03L 2LABA 1GAFH 1OTUD 4OF3A 4RAUB 4D0CA 5FV2A 5KZCB 1DUZB 5I74B 3O6FD 4HIEB 1AXTH 2QLVB 2V7NA 3E6FB 2BSED 3IGAB 2H26B 1CI5A 5BW7C 3T0EB 3G6JE 3QDMA 4RAHA 5F7UA 1VB9A 4OCLC 3MLPA 1MCLA 2PYFA 4MAUH 5J6HB 2C4FU 3ARFD 5C07B 1I3GL 2D0HA 2ZJSL 4KTEH 3PP3K 3RGVD 1NBQA 5DJCB 4NM8H 4XX1G 4M61A 2O5YH 1MAKA 4GBXD 3K7UA 3CXHK 2ADIB 2DBLH 1F8TH 4WI2A 3V6FB 1BFOB 2P5EB 2OSLA 4GKZB 2PUQT 3U4EA 1B6UA 5E2UH 5E94B 2DYPD 1U41A 3WE6B 3TBWB 3WCYA 4FZ8L 4M6ML 4EEEA 3V9FA 1Z5LB 1ADQA 4H8WL 2DQJL 1FAKT 4RMVA 5T1KB 2DKMA 2IPKB 4Q9RH 1F02I 2YK1L 3D0LA 1VACA 1FL6A 2UZIL 4MJ5A 4WI9A 1CDHA 2E3VA 4HKBA 2IF7A 4QF1A 2OZ4A 1S7SA 4Z7NE 4I48B 2CIKB 4O9HL 1J87A 3U36A 2FGZA 1PW3A 5C2UB 2DQTL 2NX5A 1VDGA 4QRQB 3I9GL 1LEGA 2VLKE 1OARH 4G7YL 3TIDB 2JTDA 5CIPH 4NQUA 1JWUA 4OSUL 1JPSH 5HYSA 2K3TA 3VE0B 4OKVB 4ZXBB 5T33L 5I1DA 4YGAB 4HMEA 2V2TB 4YDVB 2DM7A 5DHVA 5HYSG 1FIGH 3BZEA 3NZ8A 3S9DB 4L5FL 3OKMB 4LF3A 4E41E 3ULVF 5ADOH 4FS0A 4F7EA 1RIUL 4MJ5B 1KPVA 1U8QB 4J6RH 1MJ8L 2FO4A 5ACZB 1BZ9B 3JVGC 4KVNH 5L8JB 2C1PB 4DZBA 2HVKA 4Z7WA 2F15A 1QLFB 3WJLA 4JRXE 3UYRL 4OD3H 4MVBC 1Q94B 3BZFA 3QJHA 4MGXA 5DC4B 2V9RA 3KPQA 4U7MA 4Y4FD 2UWEF 1S5IH 5EC2A 5JXAH 2K7PA 1QYGH 3HUJB 4XAWL 3OG6B 1OAKH 5F3HB 3ALXA 3PHQB 1LK2B 2OTUA 1KG0A 1UZ8B 1PKQB 3B9VA 1I8KA 4XVTL 5EUKB 2Z92B 5E8EA 5D1XB 1FDLL 4IOSD 1S9VA 3A6BH 1BD2E 2DWDB 3RWHA 2GTWA 1NCDH 4W4OC 1HK6A 3QFJA 5GHWH 1SBSL 4D9RE 1QSFB 4JHAL 5E8EB 2O26U 3V4UH 2RBLA 1KEML 4NSKA 2FL5A 3MUJA 4P2QB 2BNUB 3WYRA 1AD9A 3ZHLA 3BN3B 3NAAH 4PB9L 1ZXQA 5EOCH 1LMKA 4LSPL 1TPXB 1VCAA 4HK3N 3MBED 5CJQH 2MCG1 5IHUL 1CBVH 3BQUD 4EKXA 1CD1B 5DRXB 3TNNA 2GSGA 1F5WA 2GYSA 1U8KB 1KFAH 1OAQH 1LQSR 2OXHA 3GB7A 1NGPH 43C9A 3UBXG 3UTSD 4G9FA 4OZHB 5FM8A 1CFSB 4C56E 3RWFB 1C5BH 3TEUA 1FNLA 3ETBF 5E6IC 1FDLH 4G6FB 4YEFA 4OF8A 1F6LL 3UJIH 3LS5H 2XY2A 2PO6B 4YE4H 4I1NB 2MNUA 2EDHA 1RUPH 4TSCL 1NCWH 1EO8L 3FO1A 4ZFOA 1S5HB 5L2JB 1XGQB 1IAII 4G80B 1CZ8L 1FL5A 1CGSH 3SKJL 5T5FL 5FYJE 5DC9B 2V2WB 2ADFH 4AEIL 3UJJL 3EFDL 4EN3B 3GKWH 1ES0B 3WDHA 5DA0B 5EU7E 4OIIL 3MRPB 2CRMA 1J8HD 3MCG1 1URLA 4KMTL 5EZIL 5KJRL 3VW3H 4TN9A 4LL9A 2OK0H 4HIXL 1A6AA 2E27H 4M43L 4PREB 2P5WD 3QBTB 1BGXH 4P23A 5IB3A 4H25A 5D2LA 5EZJA 4JFQA 3OAZK 4AENA 5K9OA 2CIKA 4BSJA 4MXWL 2XTJC 5DUBA 3GIZL 3NCYP 3IJYA 4KQ4H 3IFNL 5IBLC 2YPVH 2Y06H 3P4NA 5IB5A 1AQKL 2NR6C 3BQUC 4K94C 3BVNA 3EYUH 4KMQA 1EMTL 4QHNA 4UDUA 3TC9A 4HAGA 4X5XB 4KDTC 4D9LL 4GUPA 3PXHA 1B0GB 5I9QC 5MEOB 1FZMA 4JFED 3T1WA 5M95B 1LO4H 4RGNB 4U4BA 3QDAA 3U7AA 3KYOB 3SE3A 1ERNA 3PHOA 1X5HA 5JMOC 4WI4A 2NY2C 3GIZH 2MKLC 4GKSB 1YYMH 4W4OA 1NGXB 1VGEL 3ZKXC 3LHPH 3G5ZB 5J12C 3QXAA 3WJLC 3U7WL 5D7LD 3CH1B 1JWMA 5D7SH 5D6DA 1HINL 4OI7A 1INEL 3MPCA 5HHVL 1MFBL 1K2DB 3CFKA 1UZ6E 5E2JA 1FAIL 5TGBA 2NXZD 3CLFL 5FV1L 5IF0B 4JFDA 2DLGA 1TTUA 1CS6A 3L1OH 1JZ5A 2F54E 2IBGA 1KIPB 4NCC1 3QZWB 4JKLA 2XG4A 1YPZE 4ZUTA 5CEZH 2GIYA 2EEDA 1AR1C 4YPGB 4IIQC 2A77L 3O6MH 1MLCA 3UEZA 3ISWA 4EN3A 3ARGD 3LHPL 3AB0B 5ERWB 2GAZA 4NM4L 1DEDA 2HJKA 4IBLT 3RWJB 3GSVA 3QEQA 3K2UL 2CGRL 5M94B 4YFDB 5IEKB 3KS0H 5J9PA 5F6HI 4JRXA 5ABDE 5BRZD 5CSGA 1Y6NR 4GSDL 3DX8B 4KAQL 2EDLA 4NUJB 4NFDA 4ZFZA 4K55A 5GRXG 3U0PA 3RGHA 3WIFB 2XWTA 4H5SB 4MA8H 3FO2A 1QRKA 4GMTH 4JE4B 2ZOLB 5DQJA 1F45A 3MGAA 2R0ZL 4YPGA 2FEDC 5I1KL 4XCYA 1C08A 4BQ8A 4OGZA 1OTSD 5IMKA 3MRGA 3SDCD 2D7TL 3ORJA 3PWUA 3EYSH 1A2YA 1RHHA 3MV11 1RULL 3CGTA 4O5LL 1WFTA 4PTUB 3NFNB 2IMMA 1FORH 3TPUB 1VA9A 1YNKH 5IFHH 4K2UL 5JPMA 4HWZA 2ZSVB 2IGFL 3VXPB 2EE3A 4W4NA 4LVEA 1P7QA 2B1HH 4GAJL 5L0QC 3QHFH 2E6PA 1XT5A 3S3JA 4WI6A 1RZ8B 1F4AA 1H0DA 4CADB 3P0YH 3QUXD 4AQOA 1CDBA 3BT2H 2ZPKH 3GIVB 1FZOA 2P8MA 2FATH 2W1NA 3OZ9L 4WEBH 2NNAB 1RULH 1IJ9A 3Q0HA 3VFTA 2DQDH 1CD8A 1ZEAL 1UH3A 4KK6C 2R69H 1CG9B 2VL5B 4XPAL 4L29A 1PFCA 3TO4A 3CDFA 1RK0B 3OJDA 4QXTB 4F7EB 1OLLA 4M6AA 3P73B 3VGEA 3RX8A 3BO8B 3FN3A 5INDB 4GQPH 1BQLH 3C6LC 4PJHA 4ELMA 1KN4L 2PTVA 3FB8A 3RQ3A 4JM2C 4K3JL 4YC2B 1S9XA 2IH3B 3QDME 1RUMH 3HI6H 4HQQL 1DL7L 5BV7B 4LHJB 1RUKH 1WFNA 5A2JH 1I9JH 2CPCA 2HN7B 3V5HB 1A7NH 1JPFB 4GW1A 4PJEB 4BM7A 3OG4B 3BJ91 1H8SA 3ARFA 1XGPB 1E4XI 1K4DB 3DOSA 3LAFA 5A2LH 4POUB 5DO2D 2OJZL 5EO1A 2XPGB 1I3RA 1NMBL 4G42A 2DOCA 2WLZA 4HJGA 1GHFL 3DUSA 5JHLL 1ZHBA 2OMBA 1GPOH 4HUXB 1TJHL 1MHEB 4BFBD 2J6EA 1SEBA 3L5IA 3LOWA 43CAB 4NPYB 4JPKH 5DA4A 1IT9H 4DFHA 3P9MA 4ZPTB 4FHBD 4PY8I 3VFPB 2VDNH 1OGAD 3S97C 4DK3A 5HYQA 5MENA 5E9DB 1XGUB 3F5WA