4F58L

Fab structure of a neutralizing antibody l3 from an early subtype a hiv-1 infected patient
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
QSALTQPASVSGSPGQSITISCTGTTSDVGTYNFVSWYQQHPGKAPKAIIFDVTNRPSGISNRFSGSKFGNTASLTISGLQAEDEADYYCAAYTVASTLLFGGGTKVTVLRQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Light chain of Fab of a neutralizing antibody L3
publication title Viral Escape from Neutralizing Antibodies in Early Subtype A HIV-1 Infection Drives an Increase in Autologous Neutralization Breadth.
pubmed doi rcsb
total genus 46
structure length 213
sequence length 213
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2012-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f58L01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f58L02
1RULL 1DANU 5C0JB 5T1KA 4JREB 3VWJB 1GGIH 4NFCA 4FTVA 4HW6A 3ALXA 2HT2D 1U8IB 1UWXH 5FUZH 1CXIA 5K59E 2BVQB 4MMXC 3SHSA 2W1NA 1IT9H 1S9VB 2XN9A 4X9FA 2XRAL 3C8DA 4JG0H 3NIGE 1A02N 1S7TA 3SKNA 4KDTC 1FYTD 3SOBH 4CVXB 1UYWL 4R4FL 4YNYA 3U30C 1HEZB 2VXQL 5CGYD 5FKPB 1AR1C 5I1JH 3RTQB 1CGXA 3GBLA 2A2QT 1TNNA 1DEDA 4U0RB 1MLBB 4OI8A 1KN2L 1P7QA 3CIQA 1MJ7H 3F7QA 2FYYA 5HGAB 4ORGA 2K7PA 3FO0L 4E41B 3H0TB 1N8ZA 4PRPB 3MZGB 3FQRB 4WJ5A 3W11C 3OJVC 2DIAA 2AQ1A 1IGFL 2GY5A 4P5MA 2VWEC 4LCUB 1KCLA 5I1LB 3O3EA 4P5TB 4LQFL 4LCWE 1GGTA 4B50A 3BO8A 4DN4H 2F5AL 1S9WA 2ZPKH 5HGHA 1S9YA 3IAQA 4JAMA 2AW2A 1KTKE 2COQA 4MAYD 2C26A 1T83C 4XC1H 1KC5L 1Z3GH 2EECA 2X89D 5DD6A 5FCSH 5DUML 3OKKB 1YNKL 4HFWA 3QIWA 4FQXA 5IHZB 3GRWL 1DN2A 3QDME 1AFVH 4XCYB 3RX8A 3TPUA 1S7WB 3PHQB 4ODWB 4FQHB 3FB8A 1U8LB 5D93B 5TDNA 4Z7VA 3L7FA 2IPTL 5IF0B 2DQDH 4LPXA 4NKOA 4XWGL 3SGEI 2NX5B 4BH8A 4J3SA 5C0DA 2HT3C 3I84A 2B7DT 4I0CC 5J89A 4N0UB 4G80A 4MNHB 4FHBD 3B8YA 2JK5B 3C9NB 2ZG3A 3RWJA 3U6RA 4HUUB 2F74B 5KS9E 3DX9A 3T4AA 3O4LD 3DUSB 4ZUVA 5EORL 3GZKA 3KPOB 4MDJB 2ESVA 1HDMA 1Q94B 1BQLH 3G08B 1WITA 4GW1B 4N0YL 5GGTH 4O4YH 3E6HB 1T80A 4S1RL 5EFIA 3AB0C 4PP1C 5EO9B 5BO1H 4YBQD 5HVHC 3OJDB 3U9PH 5F9OH 2HFEB 3ILQC 5DO2C 4WI4A 3ZKSD 1OAUH 5I1GH 2A73A 2AJYH 4G9FA 2VDNH 4OZFH 2YD7A 1YEIH 5C1MB 3U2SB 4NZJA 3TFKC 2IWGA 4Z7WF 1WBXA 3MROA 5D6CA 3DETC 3ARGB 2F53A 4IRJC 5GISL 3PWVB 3MV8A 1RVFL 5IVZB 3ZDYE 3MBEC 2OSLA 5C0IA 1MREL 4YHPB 1OWRM 4UZGA 5L0QC 4YHKL 5CSGA 3AMKA 4ZS7L 2ZP0T 2BRQA 3HE6C 1I75A 3ZDXF 3WYRA 1OF2B 1WT5C 5E6ZA 3FB7A 2FR4A 3SE9L 4E0RB 3UBXB 2Y7QA 3VGAB 1CXFA 3T77A 3CDFA 2DB8A 4F9LA 3VFVB 4DWHA 4YHLH 5IFJA 5C0ND 1HQ4B 1BFVH 4U6HA 4C59B 4OZHF 4Q6IC 4QXGL 5BMFL 2P8MA 4LCWD 3GMOA 4OD2B 3PV7A 3WE6B 4KKBD 4WI3A 2K9UA 5DI8B 1ORSA 4UIKL 4U1JA 4J3XA 2FGWL 1DBJL 1JPFB 1T4KA 3BDXA 1Z9SA 3NMEA 1PVHA 3T08A 1FFNA 1MUJA 3C60C 1RZJL 3RWDA 3CLFL 2OP4H 3VCLB 1AY1L 1HE7A 1CL7H 2HKHL 1T1WA 4LKCA 4LPVA 3QDMD 4UBDD 3TNNB 5C0EB 2EIZB 4OGXH 5D7KE 1U36A 4JVUA 3UAJC 3ZTNL 1DL7L 3VE0A 3D1MC 3O3UN 3QNXA 1J88A 3ZKNC 3VRJB 4U3XA 3HNVH 1KNOA 2RCSL 2EDRA 3EYVB 3TV3L 1QFWI 3X14B 5I1DA 1BIIB 2ITCB 2D4FA 5JIIA 3GSWA 5JW4R 4V1DB 5J6GA 1LEGB 1P5UA 3OG4B 3PIQB 5DGQA 2CGRH 3NTCH 5EZJB 3ZDZE 3VI3F 4N8CL 5EULV 1R3IL 3S4SA 4D0CA 4ZNEA 3ULUE 4O58H 1ZAGA 5DJXA 5MEQA 1J8HA 1L0QA 2XQBH 35C8L 3P0YH 1ORQA 2DN7A 1F5WA 4MJ6A 5DHVB 3CCHB 4ZXBC 1RZIB 1G9NC 5ANMA 2FZ3B 2O61B 4K07A 5LCVH 2R8SH 5KSBF 1QHPA 3RUGB 5CUSL 4X6DF 5JXAL 3M8OH 5HHME 1BZQK 3K2UL 5BQ7B 1MRFH 1QNZL 4OQTA 4W68A 4I8DA 5E1AB 1YZZA 3MOBL 2PYFA 43CAA 2UY7A 3O9WB 1RUKL 2D4DA 5DUBB 5LAXB 3PABB 3HS0B 3HG1E 4RWHA 4LVNB 4XPFL 3G6JB 4DKFL 5FYKL 3RQ3A 5D7IA 4Y5VA 1FNEA 5EU7C 3QUXC 1G6RA 5J1TC 5J56B 1F45A 2HT2C 2IPUK 4OLZH 4QTHB 2FEEI 3HC4H 5D70H 4XNUL 4NN5C 5HJ3A 1UVQB 4N9GA 1JF6A 4WRLA 4LASL 3GSRA 5D5MF 3AROA 4BKLA 5D7KD 1FZMA 3U36B 1D5MB 5CGYC 2AK1H 4LFHG 4P2RB 4OZFB 3UJJL 4P57A 3MRJA 3EYUL 3L3GA 3SE4A 1KTLB 3LAFA 2H32A 2XA8L 3RNQA 4EVNA 1CBVL 3LV3B 1H3PH 2DQHL 1M1SA 3IDNB 1DQDH 5GRXG 4PJGF 1B2WL 3OG6B 4JANB 1YPZF 5JDSB 1U0QA 5K9OB 4W6XB 4WW2F 1Z9LA 1OW0C 1RIHL 2F58H 4FN0A 1N3NB 1WLHA 5F7MC 4AEHH 3SBWC 4RGOH 5C07A 1JRHH 4BFEA 4MAYC 4PJFF 3ULUD 3GHBH 5I1AA 4FFWC 3FOLA 5KW9H 4WTXA 2FATL 5KSUA 2EC9T 1U8JA 2ADJB 2RBLA 3EYFB 2RR3A 2DQCH 5IB1A 1NGWA 1SQ2N 4ZTOH 3KAAA 5HHMD 4NPYA 3RWGA 2M1KA 1HSBB 2AP2A 1F3JA 4JQXA 1ZKAA 2R23A 3WFZA 1FG2B 3IETA 5IBUB 3W82A 3NCFB 5JR1H 5KN5A 5HGDB 5B21A 2X10A 3SKJL 4F3FA 4OCWH 3TPKA 2O5YL 5K9KB 2PO6D 1JGUH 3HNSL 4GSDL 3HG1D 2OJEB 4GKOA 3TEUA 4JFYA 3VXSE 3H42H 5JW4M 3FMGH 3C08L 2MHAA 4L4TB 5EBLA 5HI4D 4I0PD 4O5LL 3L3HA 2H3NA 2P43B 1TTFA 4HWZA 4YBQC 2D31B 4NRZB 2CJUL 5EO1A 3DVGB 3FQWA 5T5NF 4KVNL 5CP3H 1TXKA 3UO1H 3RKDD 1S7UB 3EZJB 5D8JH 5HHOB 5EZIL 1WAAA 4XVTH 4R9HA 5GS0C 4MJ4A 2DLTA 1NBYB 4Z76A 5DTFA 2ZSVB 2PYEB 2V7HA 4TULL 1W0VB 1RPQA 4HXAH 4XNQB 1I8IB 4QOKA 4HDIA 3WHXB 3OXRA 4LSPH 1KBGL 3D87B 4PLJD 1VGKB 1Y6NR 4CN4A 4ALAL 2NZ9C 4R97C 2WUBH 2BVPB 2UVFA 3RZCD 5C0NC 4W4OA 1BJ8A 3NPZB 3OR6B 4BZYA 4MJIB 3EO1B 4KKBC 3AS1A 3CVIH 4QHMB 3NCJL 3RX7A 4PJEE 1D9KD 1R5VB 4MSWA 3QG6B 1N7ML 3Q1SL 2V9TA 5E56A 2C3WA 2WLYA 5IP4A 1E28B 4G8GA 1GZQA 2OR9H 3EOAB 4ISVB 1E4KC 4N5ED 5DD5H 4I48B 2YR3A 3CLEH 4JFFE 4UBDC 4POYA 1FFOA 3O45A 2KKQA 3ARED 2X4TB 5DMKB 2NTSP 5BXFB 2D03L 3GJFH 1Y0LB 1WTGT 1VB9A 3ME0A 3HE7A 2XA3A 5J12B 4PJ5A 4Z0XB 4C56A 1SY6A 4Z7WB 1PKQB 4FQJH 4X4ZA 3N1GC 4HZAA 1WUNT 2AEPL 3LEVH 5EU5A 1TMCB 4DOHE 5FFLA 2DTMH 1I3RA 4PJXF 1UB6B 3DO3A 4OKDA 25C8H 5TQ2L 4X7SL 1S7VB 1NGXA 2AXFA 5F9DC 2VOTA 4Z7UF 5D9SB 2X70A 2R56H 3IDXH 4LIQH 4Z7QE 1XCQB 1A7OH 4JKPH 4HGMA 5SWSB 1Q9OA 2IANA 3RDTA 4PRBB 3NZHH 1TCRA 4NQEB 1MFDH 1JGEA 1PD6A 4YHNB 1FNLA 3DO7A 3L95A 4OZHB 4LSQL 4TNVK 4WWID 5EOTA 2VXSL 5T1MA 5L9DH 2I26N 1NUNB 3SE3A 2GFBB 1D6VL 1OAZL 4HEME 3GSQB 4Y7MA 3QEGL 2VSCA 1HXYA 1D5IH 1HI6A 3WNPA 5I8CA 5D2LE 2DLFH 3MRFB 3VGHA 1X5ZA 5AG9A 5TFSH 4PY7A 1A4KB 2I07B 4K7FB 2DWEA 4MNQA 3NFPB 3WFBL 4WHDA 2HWZH 1MH5B 1QFWL 3AS0A 3UPAA 3W9EA 3UX9B 2MMXA 1N5YL 3VWKD 1A0QH 1H15B 1OAKL 4QRPE 1ZA3B 4NQCE 1H8SA 3PWJB 2C1OB 1RZKL 1BFOB 3L6FA 4H26A 1G6RL 1NFDE 4LNRB 1RD6A 2FL5A 3VXTA 4E5XA 4GAGH 3IDYB 1H3TA 3QXAA 4NNPL 5B4MD 4XAKE 1JI1A 4P0DA 4S0SD 3P0GB 4YX2L 2WSKA 5JOEA 5CINH 4OAWB 2HVJA 4R90H 4LLYA 3KYOB 5EU6E 3WFDH 2VJXA 1A6AB 4KROB 4OCRH 3V7AG 3UXFA 1Q1JL 5KZCB 4JFFD 1WZ1L 1V8HA 1YN6A 1SBBA 1F8TH 5CJ8A 1RIVH 5L2KA 1JGVL 2XWTB 2AQ3A 5INCB 1T2JA 2PXYC 1ACYH 3WS3B 3VW3H 5DJ0A 4Z7NE 1PQZB 3EJYD 5KSBB 4I13B 4X6DB 4G6JH 1S7RA 4PB0L 3SCMA 5IBTL 1VA9A 4M7JL 4U1SB 3QO1A 4NO0A 2OQJA 3TIDA 1FNHA 3KXFB 4Y19B 4GXVL 1YECH 5MENB 1LP9F 4QHNA 4NBXB 3VFOA 2FEEL 1LILA 2NY4D 4YO0B 4RAUA 3Q6FB 5E8PB 1P7KB 5CSZB 1L9NA 2D7PA 2R4SH 4EBQH 5I66A 2MQ3A 4LSSH 1INEL 3ULUC 1UZ6F 3WBDA 1FE8L 1KT2A 5I74B 5KG9A 3ARFD 4PJ7F 2ZUSA 4ODTH 5CJOL 5C08B 2DOCA 1VFBB 2DQTH 4ZFOL 2IH1A 5DT1L 4UUJB 1XGTB 3CDGB 4JZJB 4PRHA 1JNHA 4AIXA 5D5MB 2ZOKB 4RFEB 3H9SA 2A1WH 3NIDF 3FO9B 4PJAA 3VXRE 5GGVL 1EVTC 3Q5YA 3S36L 3GJFB 3JV6A 3C09C 3DGCR 2YD8A 4L4VE 2PO6C 3WIFA 2EIEA 3P9LA 1WBYA 3K81A 2SEBA 9CGTA 2NY3B 4D0BA 4C83A 4TRPL 5FYJH 4O00A 4BK5A 4YDIL 1KIRB 1NSNH 1NC2A 2UZIL 4LBEA 5DMGD 5LGHH 1KCSL 4XAKD 1YPZB 5HI4C 2D7TH 1B3JA 1HHHA 4I0PC 1FZKA 4K7PL 2P5WD 2XWBA 4WW2B 3PQYD 1LNUB 5FYLH 2IEPA 4RFOH 1IVLA 3GMQA 5E4EB 3BSZH 1HQRB 3VGDA 5EU6D 2FD6L 5EU3A 2WW8A 1OARL 4X99A 1BVLA 4F33A 5ID0A 4YIQA 4PJFB 3BDYH 2VH5L 4Q0XL 3VXME 4MD5B 1L7IH 4PJHF 3IU3A 1JMXA 4QNPF 4X6FA 5ABDE 1H8NA 5DVKA 4UB0L 5C2BH 3T0EB 3BWAB 4RNRA 4JLRA 1J18A 2W92A 4Z5RA 3V0VB 2HN7A 1G9MC 4DGVH 2C4FT 3B9VA 5GJTH 3FRUB 1V3MA 4NOFA 4UDUB 4PLJC 1KFAH 1ZGLP 1J05B 1I3UA 2N4IA 2HT4D 3H9HA 3MV9A 2YXFA 5FKAA 3RZCC 4AIZB 1U92B 3T1FB 2H6PB 4NZRH 3W0WD 1S7QB 3PDGA 4S1QL 1ZVHA 4BSWB 5DD3L 4Q9QL 4W4NA 2HJFB 5E99L 1AQDA 1D9KC 1KPRB 1JWSA 3LKSB 4CU6A 2Z91B 1QSEB 4HWBH 4HV8B 3KPSD 3M17B 3IGAB 2CKBH 5FCUH 4FXKA 4IRSA 4N5EC 4YPGA 3IS0X 1DBKH 3NABL 3VD9A 4KHXH 3AXLB 4QRTB 5TE6L 3MLRL 3BZEA 4HH9A 1R3JB 3CMOH 1KB5A 5E2VH 2W60B 4H20H 3IU4H 4J3VA 3VXRD 3RBGA 1T0MB 1FG9C 1NCUA 1AXSA 2AJ3B 4F7TA 1SJEA 2VZ3A 3MRLB 2VQ1B 4L4VD 3REWA 2EE2A 1I4FB 4MD4A 2JLLA 3O0RH 4P2QB 4UOW1 2R1WB 1QR4A 2X1XR 3NN8B 1EX0A 4GRWE 3NIGF 2O5XL 2YSSB 4OD1H 3WXVH 5IMMB 4WY7H 3IRPX 2ZG1A 4H5SA 5I8EA 3W5NA 2XZQH 4LDEB 1ITCA 3QQ4A 1AQKH 1C12B 3MODH 3RWHB 1G7IA 4JRYB 2XZAH 2DQFB 4QHKI 2F19H 4G43B 1Q9WB 1PYWA 4OCMC 4WI9A 4Y1AB 3VXMD 2ZNXA 2R1YB 3QXTA 3KYMB 3A67L 2GW5A 2BERA 5GJSL 4ELKA 4FMFA 4HXBH 4ZFZB 2W59A 3QEHA 5LWYH 3IT8D 4MB4A 4HCRL 4APQA 4QLRA 1R3HB 3WXWH 2I25N 3FZUD 1DDHA 2A83A 3MJ8A 3QB7C 1ES0B 1EAPA 5DRNA 2LAGB 4AENA 2VDPH 1J9CT 4PJXB 4FTVE 1MAKA 2OZ4A 1OGAB 4K8RL 1TZGH 1T03L 4F37K 3VFMB 2XN9E 2YMXL 5B4MC 1GC1C 4Z7UB 1N5AB 3FTGB 3FHAA 4U31A 2DLIA 3GSOA 1U8KB 4QRRA 3AB0B 1NCWL 3OL2A 4XVUD 5DJ6A 5HVHB 4JO4H 1R24B 5F96L 4UV4H 1IGJB 1X5XA 2YPVL 2XYCA 4Y88A 4RX4D 3WNMA 1S5IH 3BGMB 5CD5D 5D6DA 3RY6C 3ZE1E 5EIIB 3V4VH 1BZ7B 1WIOA 5C09A 3I2CH 5ETUA 4PTTB 3MBEB 3ARUA 4A6YL 4HJGA 3C5SA 5L0QB 3HE6B 1N26A 3VJ6A 3EJYC 3QCVH 1AIFA 4HKBA 1XZ0A 2OMBA 4DW2L 4KK5D 3X11B 5CCKH 3SJVB 5DFVC 1ONQB 1MQ8A 3QAZC 1C8PA 3UROR 3RVWD 1FPTH 5F1NB 2Q3AA 4F2MA 2OR8A 1OP3H 3VDAA 3MOAL 2BXYA 2NY4C 3C87A 2DYPD 2YBRA 4PRDA 1KUMA 3RL1A 3SKOB 1CICA 5FO8A 3T8XB 4M1GH 4JR9H 5TDOB 2BNQE 1CTNA 2YPLA 3O6LL 4PPTA 3VDCA 1LE9A 2LU7A 5E94A 3WJLC 3C60B 5LGKA 4UIMB 1P53A 4JCLA 4OT1L 4QHLB 2VLKD 2NY5H 4Z7VE 1LO0H 4TVPL 4NFDA 1SJHA 1ZWIB 2ZSWB 4JFZL 3MLYL 1IAOB 4HUNB 2V2XB 4LPYA 1MJ8H 4NM8L 5DHYA 3JZ7A 4JJ5B 2Z8SA 3VD7A 1IM9D 5ADPH 2VITB 4X7FC 1N6QL 1NAMA 1LEKB 5TE7L 5J13C 3DYOA 1YMMB 4KZEL 4HSQA 3RY5A 1MEXL 5IW3A 2ESVE 4Q2ZB 4FTVD 5FYKD 3QUMB 4MMZC 1UM6L 3WFEH 3VFWA 3GNMH 2QQLL 3U46B 3WFCH 5B39G 2CH8A 2XN9D 1CD0A 5IJKA 4ZOEA 3RVVC 4WFGE 3SQOH 1FL6B 1MFAH 1DUYB 4HMEA 3UC0L 1GCFA 2CXKA 1DVFA 1UEMA 5DK2B 4QF1A 1LP9B 2BDNL 4JFDB 4NKQB 1VERA 3ARDA 4KK9D 5GS0H 4I18A 2Y5TB 4QO1A 2F53E 4KMTL 3QEQA 3P9WB 4KK8C 4OFPA 1NCNA 4PYGA 5IT2H 3LHPL 4ZXBB 4G9DB 1FAIH 4PJ7B 4KQ3H 1A6WH 2VIRA 3L3DB 1P7QD 4DZ8B 5JDJA 4PGDA 5DEGA 4BA8A 1PG7W 4JDVB 1RJYA 4CVUA 1JE6A 3DV4B 4GW5B 4XPGH 4RA0C 2LU3A 2FBOJ 5I6XC 4XMKH 3LN4A 2VAAA 4K55A 3G9AB 4TUJA 5FDWA 4G8EB 4BH7B 1KTRL 1U91A 1GVIA 3NIFF 3STLA 3SDYL 4FQIH 2HT4C 1MWAH 2G9HA 2BVTA 3ETBF 2LTQB 3TO2A 1AP2B 1CTOA 1MIML 3STZA 3JV0A 4XRCA 1K9TA 3V6FB 1O5DT 3TN0C 3QUXB 1A3RL 3CVHL 4I1NB 3L3OA 2Q86B 3DMMA 2V7NB 1ADQA 4M6OL 3QIWD 4MXQD 2BNQD 4FQXD 5C0BA 1U8QB 1F02I 1KTDB 3DSFL 3ES6B 1SEQL 2J6EA 3O6KL 1FYTB 5EOCH 3VXUB 4UOJA 4YWGL 3W9DB 1JWUA 1UWEL 5D2NC 5DR5L 3HAEB 4DVRH 1KB5L 5FGCE 4P9MH 4X9HA 1CGYA 2CR3A 4PUBH 3MJGX 4KJQC 1GZPA 4HIEA 4PJHB 1KOAA 1DBBH 3MLSH 4JM2A 2X4SB 3VFUA 4LLDB 1IKNA 2ESVD 3SDAD 1IEAA 3K1KC 3O81A 3V52L 1D3CA 5JA8B 2YWYA 1DQLH 5C0CB 4WFGD 1AGEB 1CK0L 3S88L 1B4RA 4HX1B 4ZNEE 2ZUQB 4G9FD 5I8KH 3IDMB 4XBEH 1J8HE 2GT9A 3FT3A 4OJFL 1UJ3C 1GXEA 2A6IA 1SYVA 5HVWA 5ANME 1WWCA 4BSVA 2CUMA 2F53D 3DYPA 4MAYB 5GGSA 3KWWA 2WIIA 1EHLH 5IG7A 1K85A 1XF2A 4LCCB 4XP4H 5I30H 4NUJB 3AY4A 1FVCA 5GGQH 3B8SA 5AZEH 1DFBH 1P84J 5DC0A 1T21A 3LB6C 1H8OA 3LOWA 3O6MH 5FGSA 3SDXE 2R2HA 5CEZH 2FJGA 2IFFH 2OL3B 5J7CC 1V7MH 2RFXA 4CU8A 1C5CH 4PJ9A 3KPRA 3MRKA 1UM5L 3GSNH 3U0WH 2HRPL 3FZUC 5D7IE 4KWUA 2OZ4L 5D4QA 3VGGA 4AG4H 1M4KA 4UTAH 4PTUA 3TNMA 4KPHL 5L88L 2BNRA 3FO2B 4PFEA 5KSVA 4NGHL 2VAJA 3O4LB 1AXIB 5DJZB 4WFFD 3LPWA 1ZS8A 4OM0H 3EYSL 5HYEA 1QA9A 4JFHE 2HVKB 4XVUC 1RZJC 4LSTH 3RJDA 4WVRA 1KULA 4P99A 4JFXA 5HYIA 3VFPA 4JCMA 5CD5C 3O2VL 3DROB 1QEWA 4WEUD 4OZ4B 4KI5E 4IEFB 5FB8B 4X8JA 1FRGL 4HS6A 5TF1H 4XCCL 5I2IA 2DD8L 2B1HH 1EK3A 1Y6MR 5H2BA 1LDPL 5GGRY 5F1IA 3QI9C 1C5DA 3D69A 2JB5H 4OF6A 2F5BH 4M62L 2CK0L 1A3LH 1WQVT 4MJ5B 1HOCA 5DDHB 1HXMB 3FCTA 5JQ6H 4LQ1A 3BH8B 2EE9A 4YXHH 3RVWC 5C07E 1VGEL 4LCWB 4Y2DA 5B3JF 1ZK9A 1FDLL 3DXAA 4RGNE 4Z77B 2VZTA 1MRDH 3JBG7 2V2TB 4YXKL 1K4CB 1J8HD 2E27L 2DQJL 1HZHL 3IJYB 4WFHE 5IR1A 4NDMA 1T7XA 5LVEA 5C86A 5ICXA 3U4BH 1MNUL 1T6VN 4EUPB 4LHQB 2QQNH 3MRMB 3QDMB 4NRYA 5BRZA 3FQNA 2ILLA 3QNYB 1H3VA 4LLQA 1MHHB 1LD9A 1KXVC 1NAML 4I9WE 1XF3A 4IRZL 2VDRH 2Q76B 3HLAB 1XGRB 3E3QE 3CJJA 2W9EH 2DTSA 3PGFL 3SGKC 4Q74A 4H0HB 4X7CC 5GRVK 5IQ7H 3UPRB 4K3JH 4GQPH 4JHWH 2RB8A 3G04A 1UXWB 1FC2D 1OGTB 4AY0A 4FZEH 4M03A 3KPMA 1FHGA 5BV7L 5T5FH 1R3KA 5ALBH 1FC1A 1JTTA 2EKSA 2OTUA 3GKWL 2IAMA 4XNYL 1EUUA 1BQHA 1AO7B 2DS4A 4XNXH 3QPQD 5C92A 4JFHD 1ND0A 3PDDA 1NEZB 4KK9C 1WAAE 3MRPB 4ZUUB 4ZTPH 4R7NA 1HYSD 1KG0A 1HYRC 5ILTL 4YH6A 1OB1B 4NJAH 4BZ1H 3B5GA 1YJDH 4ETQA 3VH8B 4NQXA 3CXDL 4BYHA 2Q7YB 1TQCC 4KI5D 3NFNB 1KF9B 1T3FB 3ARZA 1DLFL 3OHXA 2YEZB 4PJDF 3BGFB 2GTWA 4QOKE 5D72L 2NLJB 2VDMH 1A1MA 4IHOB 4G6MH 1HCVA 3TC9A 2VE6B 4PLNC 3MJ9A 2AV1A 4Z7QF 3UTPE 3RI5F 4YAQA 2AABL 4JHZA 4K94C 4NBYB 3TZVB 3T0DA 1AGFB 3GSNB 1RK0A 1QLFA 3QQNA 5C07D 4NT6B 1ADQL 1WBZB 1WWAX 1ZEAL 4G8GE 3TBVA 3R1GL 3HC3H 1W0WB 2YA1A 1BZ9A 1P2CA 2B8OT 4KKCC 4R26L 5EA0L 5JHLH 4KQ4H 3P73B 1HNFA 1JYNA 3QIWC 4X6CE 2J6EL 4FQXC 4WFHD 1KPUA 1MCIA 1JF1A 4A2LA 1ZTXH 4L3CB 4OKVA 1D5ZA 1PAMA 4NO3A 4C56E 1PBYA 3LIZL 3GO1L 4TQEH 4LPTA 3NZ8B 4I9WD 3RA7L 5GRYA 3K8LA 2FB4L 2PXYB 4N8VA 1QVOB 3WKML 4AT6A 3KPPB 5AAMA 4EI6A 3AAZB 2F8OA 1K6QH 3CFDB 4U1IB 3FQXA 5TE4L 2EYTB 3BVNA 1FL5A 2IANE 1A6ZB 1U93A 1A64A 1JK8A 1I9RH 1JPSL 2W9DL 2Y25A 2R1XB 5JXED 4PREA 2ARWA 4IOSD 1BIHA 1EV2E 2UUDH 4IJ3C 5ITBH 4Y16B 4G6FD 4XXCA 3O11B 1GGBL 1QBAA 1FGVL 1FVDB 1WC7A 4LLUB 4M43H 1BD2E 3B5TA 3MR9B 2IH3B 4YHIA 2CMRH 2HFGL 3P4OB 3LQAL 3ARTA 4RQQB 2YK1H 3CFBA 1XF5B 1QP1A 1NDMA 5CIPB 4L3EA 2DMKA 2EDQA 2P1YA 1T7YA 3S3SA 3C6SB 4PP2A 3MLPA 4XXDA 1I7ZA 3J8F7 4BQ9A 4QHKJ 4M9PA 1ERNA 2WINB 4QOKD 1BX2B 1FZOB 2PCPB 4H1LG 2EH8H 2CLRA 5IB3B 4K3DL 2DMCA 4GKSB 5GSRB 1P4LB 2PN5A 4LF3B 1CGTA 3BP7B 2LE9A 1U8OA 5D71H 3NA9L 4OCYH 3S97C 4F9LC 5BOZG 5JUEH 1QFUH 3LH2L 2BFVH 3C09B 4WHTA 4UDTB 3UTPD 5J0BA 1XF1A 3T3ME 1GC1H 4U1NB 5EH1A 2DDQL 3DRTA 3P4MA 4HZLB 4KKNA 2XV6B 3IXAA 5E2WH 5B3NA 2FX7H 4M6ML 4XPAH 4ONHA 2ARJB 4G8GD 1S8DA 4I0PB 4PR5B 3PWPB 3ARYA 3MA7A 5HHQB 4JRWA 3NAAL 1AC6A 3INUL 4OF7A 3FT4A 4P59L 3MLUH 1JNNH 4WI2A 2E6PA 1GGCL 3ULSA 3HE7D 5I1EH 5CKAA 4NJ9H 4C56D 1NMAL 5F71A 5I17A 1JHKH 3UTZB 1K5NA 1OAQH 3WD5H 3H7BA 1GSMA 5JA9A 1QRNE 1M6OA 2AJZB 1RQ5A 4LLVB 2X42A 1Z2KA 4HKXA 3KLAA 1URLA 2YKLL 1HNGA 4DEPC 5LQBL 1AGBB 1U6AH 4FRWA 4KVCH 4GG6F 4PJBA 4AJ0A 4X5XA 2IAND 3RDTD 4YDVB 5LKNA 2CQVA 3MRHB 2VN7A 4HC1A 3ZYJA 2D0GA 1KJ2H 3U7YH 5MP6L 3BPNC 3RZCB 2X1PA 3GBMH 3HMXA 3BEWA 3VD3A 3TYFB 4U1LA 2X4OA 1NUFA 4PRAA 3VA6A 1MCPL 3NCYP 5FM5O 1D9KB 2FX8L 3R8QA 3HPJA 3BT2L 3DURB 2CSPA 4FP8L 5JW4N 4XBGA 2A9MH 4MD0A 3MUGA 1SM3L 2D7OA 1YEEH 5SWZA 3IXTA 4PRHE 1NGYB 2BC4B 4MNQD 2BRRH 2GJ6A 2ZCLL 3H9SE 5HHNB 4X6BA 5ESAB 3QFJE 2Q8AL 3MFFB 5GRJL 1DE4B 1K8IB 1E27A 1OD7A 5F70A 2EDEA 5CAYB 3BN3B 1F6FB 5ICYB 3U0PB 3N9GH 1HILA 1RULH 5IEHB 4Y5VC 4MB3A 4G42B 5GS1B 2R0WL 3JUYA 4U6XB 3DBXA 4P5KB 4U1KB 5IB5A 3P9MA 3U7WL 2BJML 2X9YA 4X4XA 4FS0A 2DQUL 4I2XB 5HPOA 4P3DB 4MLIA 2NY6C 1MAML 1UYWH 2Y07L 4R4FH 2Q87A 3H7LA 3OF6A 3K80A 2NW3A 1NGQL 2DAVA 1HYSC 5E8DL 4LU5L 2ADIA 5B38B 4N0FB 4G8IB 4HKZA 2NTFB 2YA0A 2AERT 2L0DA 4EDXA 3SE4C 3Q0HA 4KI5C 5IM7B 1BBDL 1F3DJ 1OOAA 1QRND 2KUTA 5DMIL 3SCMD 3VG0L 3FO0H 3OX8B 3JWDL 3QQ3B 3MX0A 3V5HB 4NO0D 1G7JB 3HNTL 2OCFD 1IGFH 1KJ3L 5FAAA 1YN7A 4ODHL 1HN1A 1YUHB 1HK6A 1ZV5A 2CLZB 4LQFH 4X7TB 4WUUA 2F5AH 2GSIB 1EZVY 3HI1A 2G2RA 3MNVA 3QRFM 4HIHB 3WSQL 4B41A 5CEXB 3TGXA 1X6LA 4S0TD 4KAQL 4LP4A 1KC5H 1S9KC 1TNMA 1YNKH 5JZ7D 3T2NL 1P1ZA 4LLMB 4X4YB 4DCQB 1XGUB 1MIEL 2L7JA 5IFAL 4Q9BA 3TBSA 4O2EA 2Z35B 2IPTH 4PRHD 1CLOH 2X1OA 2GUOA 3CPLA 3PUCA 4XWGH 3WFHA 3TWCL 3H9SD 5IEKA 1OTTD 1T7WA 4ODBD 4JQXC 2UWEA 1ZGLB 1A1OA 1U58A 1I9IL 1UKQA 4OLVH 1SMAA 3E3QC 1CDBA 1L4IA 4GBXA 4NKMB 3KPLB 3MYJB 2A6JB 2NXYB 3H9ZA 4DOHB 3LKRB 2PW1B 4PJDB 1WIPA 2PETA 3C5ZA 3RIFF 3BP5B 3F12B 4XT1C 2E6QA 5EORH 1IGCH 1NC2D 3WJJA 4HIIA 4JZOA 4GT7A 4S1RH 2X40A 3K0WA 4N90E 3QAZB 3HPLA 1C7SA 1EVUA 4FXGA 4WTZG 5IWLA 2NY4B 1YQVL 2BOCB 3HZMB 1E4WH 5HPMA 1T6WA 1KJ2B 4JPKL 1A4JB 4N1CA 1Q0YH 4XC3L 1TVDA 1EEUA 1WEJL 4ONGL 3HZKB 1RVFH 1XGPB 1QLEL 1MREH 4X98A 4YHKH 2ZUUA 1BBJB 4PJ8B 5HHVH 2V9QA 4XB8A 4CMMA 2GEEA 3I3EA 3V6ZA 3PV6A 4NP4L 3SE9H 1XF4B 2GJZA 1TVBA 1YEDA 1I1AA 2EKJA 3PWNB 4PGCA 3ULVL 1C7TA 5H8DA 3D39B 1T22B 3IJSB 3V5KA 5J13B 3NFSL 3G6AA 3L3KB 5BMFH 1A47A 4QXGH 3MMEA 4W4OC 4XP1L 3TA3A 5DJ2B 4HUXB 5E8OA 2FSEA 2NW2B 2J4WL 2PTTA 4UIKH 1G6VK 2UYLB 2FGWH 1DBJH 3FRPA 3OKNA 3QXUA 1F11A 1CFVL 1DCLA 1KEML 2X4QA 3ARBA 2ZCHL 3U1SL 1RZJH 4R2GC 3DVNB 4I3RL 3CLFH 2P5WB 4IRSD 2HKHH 3PQYB 2YD4A 1FVEA 1XFPA 3OZ9L 1ZT7B 1EEZA 2OTPA 5C09E 1KJVA 4S11A 3ZTNH 1DL7H 3HE7C 5LGJA 1TJIL 2BVEA 4F80A 2CRYA 4XCFL 3U82B 1L9MA 5J06A 3ZYIA 2RCSH 43C9B 1E4JA 1JBJA 5JMOC 1OPGH 3QO0B 1G7QB 5I6XB 3LY6A 4CN6A 3F58L 3EJZD 3VRLF 4PGEA 1T1YB 3SGDI 4HC1L 1ZT1A 4ZFGL 5T3XL 1KYOJ 1ZLUK 1J86A 4PRNA 4KJWC 4N8CH 3RDTC 2BSRB 3QA3B 4LKXA 1T2XA 3HMXL 4N90D 1R3IH 1CDJA 1HHKB 5CEYB 2EC9U 3W0WB 1DQML 4WI6A 2YXMA 3TN0B 1DUZB 2YPLE 3MA9L 3OXSB 3SE3C 35C8H 1GIGL 4E9LA 3BHBA 1MVUA 1A21A 1F4YL 1WWWX 5H94B 3KYNB 3KPSB 3E1F1 1OTSC 1VFUA 4I0KA 4FFVD 2Z92A 5JXAH 1JHTA 3LKPA 2FJFB 5D7LB 3K2UH 3ECBB 4O51A 1QNZH 2YA2A 1YY9D 5D2NB 4Y8DC 3MOBH 4APQD 2BY1A 4BFBD 1RUKH 4KMLB 2Z8VC 3QWRA 3T2OA 1CLZL 4YFLI 3BP4B 3VXRB 1AGDA 4DKFH 4HK0A 5EUOA 1I7UB 4WW1A 3BKMH 4M6NL 2XKNA 4L4VB 3SE8L 3HRZA 1H5BC 4NKDB 4AL8L 3TO4A 2I9LA 4ELMA 3L7EA 1PY4A 4K8RC 3AM8A 5I1KH 5CD3B 4GG6B 1X7QB 4XNUH 4LSDA 3TVMA 4UT7L 5I1HL 2MFNA 1OD9A 3SDCB 1A6TA 4BK4A 3L5XL 2BVUA 4LASH 2WUCL 1FNSL 1ACZA 3LPGA 3H8NA 1UJ3B 2OR7A 3HZYA 5C09D 3UJJH 1P7HL 3EYUH 1T5WB 4YC2C 4ZYKB 2JCCA 3CK0L 3HCVB 5GGVY 3OKDB 4NN7C 3V4PL 4UQ2A 1N2RA 1INDL 2N56A 2ITDB 3SCMC 4GKNB 1G0XA 2QSTA 5CSBA 3RVTD 4Z7OE 2Y72A 3BPOC 4TNWK 2ZKHL 2XTJD 1RIHH 1CDCA 4LEOA 2R2EB 3T2QA 1I85A 2F54A 4HEPG 4OGYL 4YXLL 4HK3N 1SVZA 2P5EA 2X4NB 4YZFF 4DTGL 4P4RA 3ROLA 1UXSA 1RK1A 1W72A 2YPLD 3CFCL 2BK8A 2VLRA 1E6OL 4KHTL 4XX1G 3EAKA 5EUKA 4BUGA 1FFPA 4LCYB 5CILL 2FATH 5CZXD 5ACZB 4R7DB 5SX5H 3RRQA 4YHZL 3T3PE 5JQHC 2G5BB 2WWKO 4NNYB 5A2FA 1B0GB 1V7NH 1O0VA 5IGXH 4S1SH 3JTSB 3UTSB 1OTTC 1IL1B 1BGXL 4MCYB 3QZWB 2HA1A 2IADA 4N1EA 5A2KH 2VL5A 3G9VA 1KENH 1OCWL 1KIQB 1TVHB 5EU4B 2O5YH 2RJMA 3CH1A 1GYAA 4GSDH 1OP5H 5HDQL 5KVFL 3QJFB 3B6SB 4NNXA 3QI9B 5JPMA 5GIRB 4IOIB 5D1ZA 3ARVA 3R0NA 3W5MA 3C08H 4G6AD 1S9XB 4NQUA 4KKAD 2AQ2A 4O5LH 1DVFD 2ZUXA 1RSFA 3L3IA 3CFKA 2CJUH 1O7VA 5EC1A 3VG9B 3I3DA 3QIBA 2X89A 3ARDD 3GMRB 5JO5B 4KVNH 3NCBB 3BQUB 3TH3T 3C6LB 5HGBB 3O41A 2B1AH 5EZIH 1CFSA 2ERJC 5JHDB 3QEQD 3HUJE 4H1LH 5DK3A 3ROOB 1YEGL 5I19L 4NHCL 4NHUA 3JV5A 3SGEH 4KI5F 1IEBB 5EO0A 3GHEH 1UCTA 4TULH 4ZFFB 2H2SD 1PSKL 2VLKB 2LFGA 1XGQA 5IMOA 2DJ4A 3NACL 1KELL 3WUWG 4M8QB 2VDQH 1RJLB 4ALAH 1IM9B 1JUFB 3MO1B 5TQ0H 2YZ8A 2FH8A 4PV9A 4HIXH 1YEJH 5DJ8B 4JEGB 3RNKA 1JMZA 5T1KB 5GS2D 4RMQA 4FTVB 5KAQF 5ESQB 4EXKA 1HIML 4LHJB 2XZCL 2E7CA 1N7MH 3Q1SH 3DMMD 3I3BA 3S36X 2E7MA 2XN9B 3FQRA 4NUGL 1NDGB 5E2TL 3QJHB 1S7TB 4IRSC 3SKNB 2D0HA 5K9QI 3H3KA 3PNWA 1JHLH 4YNYB 4ZOAA 2D03H 2NQCA 5KJRL 3T0VA 4PY8I 5C9JB 4KRNA 4P23A 3MRRA 4R4ND 4FFZL 3HMWH 4XWOD 5DD1L 2AEPH 4K7PX 4L8SA 4LPCA 1I8LA 2WV3A 1UT9A 2FYYB 4JM2D 4X7SH 5TQ2H 1MCEA 1REIA 3C5JB 3PHQA 1U3HA 1MCCA 4FQHA 4ORGB 1PZUB 1N8ZB 2C5DC 3QEUA 4WJ5B 3FFCE 5IF0A 3EJZC 5DVLA 4EOWL 4F57H 4YK4C 4P3CL 4P5MB 3VGFA 2VLJA 4L9LA 3O3EB 5J3HD 3D2UB 3L3JA 4XBPA 2X9XA 3NVQA 1S9WB 4LSQH 5SWQA 2VXSH 4LHUG 5HGHB 2JK5A 4JAMB 3ZT5A 3MUZ1 2QHRL 4HUUA 2F74A 1D6VH 1OAZH 1JFQL 3B4NA 4MDJA 2X6MA 5HYSG 3BIKA 3QEGH 4M8VA 2JJTA 4HFWB 1Q94A 3QIWB 1OT1A 2O5ZL 4FQXB 5I71C 2I9TA 5BRZE 4P46D 1GAFL 4HJ0C 5EO9A 1CIDA 2D9QB 4FFVC 3FB8B 5K93A 3WFBH 5CFHA 4XPHL 1QFWH 5TDNB 3L7FB 5TJWK 3BZFA 3QUML 4NKOB 2IGFL 1N5YH 4ONOA 5IOPB 2WWMD 2OI9C 4APQC 2CK2A 4BH8B 3MJ6A 4PJ9D 1OAKH 3H6JA 5C0DB 1V3LA 1VFMA 1RZKH 5KS9A 2XWJA 2NXZD 1R6VA 4G80B 3PWVA 1G6RH 5IVZA 2BY3A 1S7SA 2BNRD 4YHPA 3RWJB 3U6RB 5F7LB 3DX9B 3T4AB 4MAUL 3UTQA 1PG7X 4ZUVB 2FDBP 2ESVB 4FQ1H 1HDMB 4YX2H 4E0RA 1T0NA 2A9NL 3EYQD 5EFIB 1G9NL 3A0OA 4EJ1C 2V5MA 5GSVA 3BYYA 3FB6A 1CDUA 1KB9J 4WUKL 4IJ3B 2OK0L 3C2AL 2A73B 4G9FB 4JDTL 4GRMA 3KHOA 5D6DC 5C0GB 1WBXB 3MROB 1JGVH 3IDGA 2F53B 3TCLA 4U6YB 3NCMA 4QCIB 3MV8B 4H1LB 2IMNA 2OSLB 3THML 2VKWA 5B22A 4GO6B 7FABL 4PB0H 3LQZA 3FB7B 4R96A 5IBTH 4M7JH 3KGRA 1QSFB 3EYOA 2FR4B 5C0EA 5DS8B 3BOVA 5EZOL 4MA3A 5F3BA 4GXVH 3T77B 2VR5A 1CU4L 4PB9L 3TBWB 4BQCA 1UCBL 2XTJC 3BUYB 5IFJB 1EFXD 5E1HB 3RWCA 5F9AC 2P8MB 5T1DL 4Y2DD 3GMOB 4KUZL 5HXMA 3DXAD 4M3KB 2WQ8A 1ORSB 3F5WA 1F13A 4U1JB 2EH7L 1CICC 1G7PA 1PX4A 4I3SL 4U05A 1T4KB 4U7KA 4V1DA 1LEGA 3QWOA 1WVZA 1MUJB 4J2XA 5CJOH 4JPVL 1JJUA 3RWDB 1MFEL 5CZXC 5EZJA 4JRXB 1ZVYA 1T1WB 4LKCB 3MGOA 4LEXL 1FJ1A 5BRZD 5IV2A 4YFDB 2VABA 5GGVH 2Q6WA 3VE0B 3S36H 3CZJA 4ZDHB 5FGCB 3QIUA 2DI9A 4P9HL 1MHEA 2QBWA 2FNBA 4BELD 5I1DB 3EIFA 3ZT6A 1A7NL 4TRPH 3GSWB 1BHGA 4RCAA 5J6GB 2BMKA 3OGOE 4YDIH 3N85L 2UZIH 1KCSH 5IJKC 4KKAC 5BV7C 2IAMD 1KYOK 3BI9X 4K7PH 5A2IH 4RAHA 1DVFC 1HH9B 3EUUA 3D9AL 2I24N 3DVFA 3ARDC 3HS0A 1J1OL 4I18C 2FD6H 2AKRA 1OARH 4D0CB 5JPNA 4XB7A 5DJXB 5MEQB 4L3EE 1J8HB 2VO5A 2OL3L 1ORQB 4JO3L 4MJ6B 5E5MA 5INDB 2VH5H 4Q0XH 5HYJE 3LZFL 3MRNA 2H2SC 4QHUA 4UB0H 3WIIL 5F8QC 1AKJA 2HKFL 5DGRA 5GGTA 1CD1A 4RMRA 1U8MA 3UBXG 2QR0A 4RWYL 3HG1A 3VXQB 2PYFB 43CAB 1D5MA 4I77L 3KLHD 4GS7C 1FNGA 3N0PB 4OIIL 1BP3B 4KI1A 3HHRB 4Y5VB 4L8DA 1FNEB 3IFPA 3AS2A 1X9QA 3Q48A 1MCKA 4S1QH 5DD3H 4Q9QH 1G6RB 1U3JA 1D6EA 5E99H 1F58L 4UQ3A 1NAKH 3VI4E 5CLWA 3BH9A 2X1QA 4NWUL 3DMMC 3RY4A 2C3GA 1IAMA 5D7JA 1ZHLA 1J1XL 5JDSA 3V4UL 2Q8BL 5HJ3B 1VPOL 4N9GB 3DVIA 4JY4A 4NZDA 4RFNB 2NY6B 3NABH 4OTXL 4KU1A 1FL3A 5DZOA 4YQXL 4OSUL 1PG7H 2KDGA 4BKLB 1FZMB 5TE6H 3MLRH 4R4NC 1DZBA 4PJAF 2FIKB 2KL6A 4HUWA 4P57B 4XWOC 3L3GB 3MLVL 5BVJA 2BOBA 4GMSL 5ISZB 1IGYA 2IMMA 2VDLL 4OZIA 4Y8AA 2H32B 4JM2C 5A2LH 4EVNB 2AGJL 4PJBE 1IKNC 3R0MA 3EYFA 5EBMA 5HY9B 4DUXA 4CADB 1HSBA 3EO0A 2NNAA 4Y4FA 5F97E 1QFPA 2O5XH 5BVPL 1FGNL 5JNYA 1JL8A 5E08H 2OJEA 3UTTB 5C07B 4UINL 4LSRH 1V05A 4UV7L 4XNZC 3CGTA 3QNZB 4ZAKC 3V5DA 3AREA 5I1AB 3RX5A 4L3ED 3KPNA 4OGAD 3FOLB 3WMSA 4D0DA 3QDJE 3LQAC 5KSUB 3AY4C 1U8JB 4D3CL 4WDIA 2JJSA 4RA3A 4OFDA 3CNKA 5GJSH 5F3HA 4NRZA 5IB1B 4R0LB 3P11L 4HCRH 4NPYB 1TITA 2WWMC 3RWGB 2EDTA 1JNLL 4NCC2 2YN5A 1F3JB 1F4AA 4PJ9C 5HHOA 2R23B 4FNLL 3IETB 3VXSA 5KN5B 2GQHA 1SVCP 2B2XL 2NXZC 3NCEB 5HTSA 2CUIA 4J1UA 4G3YL 1CD8A 1U95B 2O26U 4K8RH 4JFYB 1W0VA 3LEXA 5A16B 3KPQA 2JE8A 3MNZA 2MHAB 4XNQA 1CE6A 5EBLB 1X5FA 3BKJH 1TZIB 3U83A 3WHXA 5L8KB 3L3HB 1EEYA 1NCWH 3EYQC 4DQOH 2Z0BA 1X5YA 32C2B 4HWZB 5DURD 5T33L 1AD9A 1OLLA 3UYRL 1M7DA 2YPVH 3FQWB 4LMQE 4IDJH 1CR9L 4Q7DA 2FHFA 4OZFG 4CDGC 1R3LB 3ZLQC 4Z76B 4MVBC 4A6YH 5DTFB 3GSUA 3MLWH 3VWKA 2V7HB 5E6IA 4LCIL 2EDJA 4ISVA 1NMCB 1CCZA 1P69B 4JFPA 3QRGL 4HFUL 4PRIB 1CXHA 1DJSA 1JRHI 4OQ1A 3ARWA 1PKOA 4HDIB 5DMKA 3ZTJG 2X4TA 3OXRB 3T4YB 1VESA 1KACB 4WUUE 3OR7A 5C8JA 3OKOA 2AJVH 4NQSB 2P24A 3L1OH 5T3XD 2EYRA 4PJEA 3MOAH 3DPBA 5AUMB 4DK6A 4Y2DC 1S7XA 2CKNA 1MJ7L 5F9JA 5GZOC 3O6LH 4G7VL 1JZ8A 4PS4L 4JFFA 1GZQB 4R2GB 4OT1H 5DVOA 1XCQA 4MDIA 3LCYA 1XH3A 3GMLB 4H0IA 4TVPH 2EDHA 3QDJD 4PRBA 4EKXA 5EOQL 3SKMA 2P8PB 4Y5XC 3MLYH 1FFOB 4NKIH 1EMTH 4QRUA 4NM8H 1AD0A 2ADGA 2BNUA 3HE7B 4PJ5B 1N6QH 1BVKA 5C7XL 5FIEA 5IBUG 5TE7H 5EU5B 4ONFH 3LKOB 1I3RB 3GJFK 4KZEH 1QPXA 5E00A 1M7IA 1M7XA 1NGXB 2AXFB 1UM6H 5F8RC 2QQLH 3RHWF 5LJYH 3NH7L 2X70B 1KEGL 3T1WA 4PIRF 2P44B 4RDQG 3ULUL 2IAMC 4FFYL 1JYVA 2IANB 3RDTB 2B0SL 4KH2A 1JZ6A 1JGEB 4TSCL 5HHXL 3PWJA 3OQ3B 3OTTA 4PJIF 1JTPA 4LVOC 3DO7B 3L95B 2APBA 3ARFA 3OF6D 3KJ6L 5EOTB 5T1MB 4Y0GA 4KMTH 1DQJA 5D2LA 3VMPA 1YEHL 4ERSL 3H3BC 3LHPH 3GKZA 2GK0A 1FNAA 3B3IB 3L9RB 2R69L 2ZOLA 1HXYB 1HI6B 1BQLL 4NFBA 3PP4L 4O4YL 2IC2A 3O8XB 4PY7B 5CP7A 5DJYA 2JIXA 2DWEB 4MNQB 4QRPA 1IQWH 4NQCA 3U9PL 2IQ9L 3W9EB 5CZKA 2NPLX 5I1GL 4NCC1 3HR6A 1MCQA 4N0CD 3SDYH 4BQBA 4HWUA 5CP3A 3KLHC 1MCFA 4WUUD 3IB4A 3GMNA 2XPGB 4WI5A 4HT1L 4H26B 1MIMH 2EDDA 3A6OA 3L6FB 3VDBA 2FL5B 3VD5A 3UZQA 3VXTB 4E5XB 1RU9H 4JO2L 1A3RH 3CVHH 1H5BB 3QXAB 2VZSA 2VLME 3KDMA 4M6OH 2YD9A 4U1SA 3ZKXC 2GY7B 4FQ2L 4Y19A 1WZMA 2HVJB 3LKNA 4LLYB 4M1DL 4DVBA 2A77L 1KB9K 3DSFH 1SEQH 3O6KH 4DGYH 3IJHA 2G5RA 3PHOB 5DR5H 1CDHA 1KB5H 1TFHA 1KCVL 2H2PD 3GDBA 4YO0A 4Z78B 3Q6FA 5EC2A 1F6AA 2IBZX 5CSZA 5L2KB 1RURH 5I76A 4XX1E 4GBXD 4PY8J 3WKNA 2P7TB 4KUCD 4DUWA 3S5LA 4R3SA 3MTRA 1S3KL 5DJ0B 3C5ZD 1IBGL 5C08A 1JZ7A 1XR8B 1S7RB 3SCMB 1UA6L 3F62A 1L7TL 4UUJA 4TVSa 3V52H 4JZJA 4OGXL 3QO1B 2OQJB 3TIDB 2VXTL 3LEYL 1WSST 5FECA 3BPOB 2OMNA 3FO9A 1IQDB 5E7FA 1CK0H 3IS1X 4QHNB 3S88H 3VFOB 3GJFA 2ADFL 1F4XL 4XXCC 3HNVL 4RAUB 3JV4A 4QXTA 2V2WA 4OJFH 3KYKL 4G8FA 5ESVA 4KRLB 1I8MA 5E70A 5I66B 1KT2B 2AAVA 4Z6AT 5KG9B 4O9HL 4RMVA 4OGAC 4PJGA 3PF2A 2I60H 3DGGA 2IH1B 1LNUA 3AU1A 2ZNWA 1JNHB 1I1AD 3FOMA 1HQRA 2BSTA 4GAJL 3UCRA 4AH2A 5J9PA 4PJAB 2EEDA 1PGRB 2J88L 2HLAB 2HRPH 2VZ1A 4O58L 1PEZA 5EUOE 2VXUH 5TH2B 3ULVC 4PJFA 3WIFB 4X5LA 5F7FA 2SEBB 4ELME 5LCVL 4XTRC 4NGHH 3ZMRA 4D0BB 4C83B 1NC2B 1N0XL 3ARBD 3EYSH 1FAKT 2AXGB 1HHHB 2VLMD 2XFXA 4QYOB 1FZKB 2XWBB 3FRUA 4YGAB 5EBWA 3UP1A 3LN9A 3GMQB 3ZE0E 5C3LD 2VZUA 1U92A 5EU3B 2H6PA 5AEAA 3K7UA 3O2VH 4U4BA 4X99B 2JCCE 1BVLB 4F33B 1FRGH 5ID0B 4YIQB 2HJFA 3ILPA 1NCDL 4XCCH 1KPRA 2DD8H 1QTYT 2VTFA 1X3DA 3WUWB 5ENWA 1LDPH 3IU3B 1QSEA 4JZNB 4X6FB 5D96C 4OZGE 1MOEA 3V0AC 4RNRB 4JLRB 4M62H 2CK0H 3TBTA 3P40A 2HN7B 3I85A 4PBXA 4ZMAT 2AK4B 1LE5A 3OBAA 3D25A 1FCCA 1JPTL 2EEAA 2FIRT 3MACL 2F54E 2AK1L 5ECJE 5JOPE 1R3JA 3NPSC 3H9HB 3MV9B 5FKAB 1XT5A 5AG8A 2P5EE 3IDJA 2FX9H 5FHAL 1FDLH 5DRZA 4P4KA 1UQSA 2AJ3A 4YXKH 1JZ4A 2E27H 2VZOA 1AQDB 1HZHH 1CLYL 1H3PL 3EGSA 3CVHB 1MNUH 3DIFA 2DICA 3U48A 1T20B 4FXKB 3IYLW 4IRSB 3IKKA 4YPGB 5DZLA 3KG5A 5AD0A 5AWNL 1MELA 4EEEA 1NAMH 5BJTB 2F58L 4IRZH 1IILE 2R2BB 3DYMA 8FABA 1RHFA 5C6WH 4OD3H 3BZEB 3PGFH 3DLQR 1KB5B 4OB5L 1JRHL 1JWMB 1C12A 4FA8A 1MI5E 3WS6A 2E3VA 2MWCA 1AXSB 4G43A 4F7TB 1SJEB 4G6KL 3EFFB 1RFDL 3RZWA 4Y1AA 5J6HA 3REWB 2R1YA 5FOBB 5BV7H 3TO4D 2CDFA 4F9PA 4MD4B 1AH1A 2DYPA 2BSSA 3GKWH 5C6TH 4ZTOL 3SGJA 4XNYH 1MCWW 2DKUA 4PV8B 3TVMD 1UH4A 4XVSL 5ILTH 1ED3A 4YGVA 3WDIA 2XNAB 4MWFA 1OGAA 3PWLB 4FQCL 1G7IB 1VADB 1A9BA 4YHOL 5TGBA 1Z0MA 5I15L 3ARSA 1DLFH 5FUOL 5I71B 2OXGA 5TPWL 3RL2A 4ETYA 1XMWA 2IBGA 3OGCA 4HUMB 1QRKA 1RUAL 5D72H 5C0RL 2ARJQ 5DJCB 3U79A 4JDZA 5I0DA 1ZLVK 2OI9B 2C9AA 2VZVA 2XG5A 4NC1E 5DXWA 5D8JL 3WLBA 3TH4T 4GKZA 4N0CC 1DDHB 2QSVA 3BKCL 3MJ8B 1EAPB 5DRNB 2M26A 2AABH 2F54D 5CMAA 4AENB 4MJ2A 5JOPD 2APVA 1U2CA 1YQ2A 2FLBT 2Y06L 2P5ED 3MRBA 2V9RA 3BW9A 1RHHA 4K23L 2CIKA 1ZEAH 4PRPE 3R1GH 5DFWH 2DRUA 4R26H 5EA0H 5E8NB 2VLRD 1R5IA 3X11A 4JGJA 1F3DH 3GSOB 3SJVA 2J6EH 1UG9A 4QRRB 4XMLL 4L8BA 5LXGH 1EO5A 3OB0K 5CLTA 4PGJA 3IKCA 5ERWA 5DJ6B 4WIQA 1LMKA 3KS0J 5T5NG 4PJIB 2WUBL 2HG5A 3LIZH 1QSVA 2H2PC 1BF2A 3GO1H 1CGSL 4URTB 3RA7H 5C09B 5ETUB 3U7AA 5TDOA 4GBXC 2FB4H 5CJBA 4HJGB 4RDQF 1M71B 2ATPA 4UIMA 4DKEL 2OR9L 3VJ6B 2FEDD 4PD4J 3MCKA 1AIFB 4QHLA 3UZVB 4HKBB 4PLOB 5D1ZD 5TE4H 2AJSL 1K4DA 1ZWIA 2CKBA 2VLJE 3WJJC 2W9DH 1IAOA 1JPSH 3CFJA 2V2XA 3CFEA 5DHVH 2F8VA 5MERA 2BVYA 4N0UE 4FZ8L 4KTDL 1UB5A 2XTJB 2H1PL 3QIBD 3IFNL 1GGBH 1FGVH 2BNQA 1YMMA 3GJEA 2ZUYA 2J3SA 3AS3A 3RL1B 2NY0D 5FO8B 1CICB 5CHNA 25C8L 3EFDL 1OP3K 4ENED 1JI2A 1U8NA 2MQ0A 3LQAH 3STBA 1AHWA 2YPLB 1J1PL 3U9UB 3REVB 2NY7H 1LE9B 5E94B 4M5YL 4DAGL 1NBVL 1BOGB 4WNQB 4UAOC 2JKXA 2VLLA 2DBJA 2GAZB 3DI2B 2F15A 4XCEA 1FO0A 4CBPA 6CGTA 3EHBD 5E2UL 1I3GL 5AZ2L 1I1AC 4K3DH 2K7QA 4OI7A 4JKMA 3X17A 5DHYB 5KVEL 2F9BT 3NA9H 5IW1A 5F7NC 1NAMB 3LH2H 2G75A 3D0LA 4K9EC 3SDAA 3DRQA 3QULA 3U4EA 3TA3C 2DDQH 1IAIM 3MV01 2Z31A 2JJVA 3I6LE 3X12A 3JTTA 4F7EA 4M6MH 3VFWB 3GFUA 3DV4A 1HWHB 3ARBC 5HSFA 4M5ZH 3VXPA 5BV7B 4OFKA 1A0QL 1DVFB 4KXZI 3NAAH 3ARDB 4K2UL 2HH0L 3INUH 4I18B 1ZLWK 3SN6N 1GGCH 2ICEA 2KPNA 3MRCB 2IJ0C 1EFQA 4P23D 1HSAB 1NMAH 3QEQB 1PDKA 3ZTJH 4S2SA 2P47B 3S35L 5JORA 4TUKL 3AGVA 4BQ8A 2VIRB 3VD4A 3CD4A 4LVHC 4PGDB 5DEGB 2YKLH 1RJYB 1U3HD 3ELAT 3GMPA 4QXUL 1CG9A 1KTDA 3ES6A 5LQBH 4MXVE 3S37X 2VAAB 3VXUA 3WFDL 1QR1A 4LSUL 4OCNC 5FDWB 1MF2L 5F7DA 2VLJD 1U91B 4L3AA 5DQDL 1F8TL 3STLB 4RIRA 3QHZL 4GS7B 1RIVL 1YNLL 5MP6H 2G9HB 3BKYL 3TO2B 3STZB 4Q6YA 4XRCB 3F7YB 4PJHA 1T04A 4V1DE 3GMMA 5F6HJ 2FX8H 4HHAA 3BT2H 3L3OB 4KY1L 4FP8H 3PE9A 3DMMB 2H9GA 1BEYH 1SM3H 2UY6A 3BD4A 5F6IC 2CRMA 3VFGL 5C0BB 1SYSA 3HI5L 3V0WL 1TTUA 5C0CA 2ZCLH 4GMTL 5JOFA 5MEPA 3O3AA 1KCUL 1JWUB 2Q8AH 2EDKA 4POZD 1FYHB 2IQAB 4XP5L 3IDMA 3VU2A 4Z9KB 3R06A 2GCYB 3ARGD 2R4SL 3ULVF 4UMGA 3OAZH 1GZPB 4KKLC 4HIEB 5CBAA 1I1FB 4LCCA 2G60L 5AYUH 3RUGE 5MI0C 4YFEA 2R0WH 2IALB 3VFUB 1C16A 2NY1D 4Q97A 3TO4C 4IOFD 3I6LD 3U7WH 1IEAB 3DTXB 5E95B 3AM8C 2BJMH 4Y5YA 5HHPB 3F7PC 1P9MA 1G0YR 3MXWL 2DQUH 3TVMC 3FT2A 1QG3A 1MAMH 2Y07H 1NCCH 4IMLA 3IDUA 3DUUB 1LEIA 1I9JL 5E8DH 2GT9B 3FT3B 4YUEL 5ALCL 1IC4L 4LU5H 2A6IB 2C1PA 1SYVB 3F65A 4XNZB 4BSVB 1F4HA 15C8L 4ZAKB 1MCNA 5GGSB 3KWWB 2R9HC 5IG7B 3D18A 2APTA 1BBDH 1U3ZA 2FHBA 1FVCB 3SDXA 3GBNL 2D7TL 1NL0H 2I5YL 2W0PA 3VG0H 3JWDH 1TTGA 5FYLL 2ICWI 1Z9OA 3HNTH 2R2HB 4PJBF 2FJGB 4XP6H 1KJ3H 2RFXB 3A6CL 4PJ9B 4ODHH 2D0FA 3KPRB 3MRKB 1IGIL 1I85C 2NXZB 3TNMB 2BNRB 4QGYA 2WLZA 3WSQH 3S6CA 1F97A 4KAQH 5IB2A 1VCAA 2NCMA 5TF0A 1J11A 3PHSA 4V1DD 1CYGA 1MFBH 2VDKL 4N9OB 3S34L 4MLSA 5DDHA 3T2NH 1NH6A 3P30L 4DGVL 3LKQA 1MIEH 1QA9B 1WJ3A 5IFAH 1HHJA 1KFAL 1IC5L 1DR9A 1CFTA 4JFXB 4WV1A 3HAEG 3TWCH 4ZSOA 3VFPB 1X5LA 3QQ9D 4Y89A 5KVDL 1QEWB 1MWAA 4IM8A 1I9IH 4X8JB 3QIUD 4HS6B 1GRWA 1PY9A 1AR2A 5I2IB 4OLYH 3VXNA 3LRSA 4OZIE 1YDPA 5H2BB 2ICWA 5AAWA 2C7UA 1UC6A 4P9HC 2ZUWA 4K94L 1W8NA 3HRPA 1C5DB 2FEDC 5FCUL 3D69B 4UNVA 1BFSA 2OYPA 4LPWA 5D1ZC 4ZO9A 3LN5A 3JSSA 1DBKL 3T0BA 1Z9MA 3X3FL 1A7QL 3G5YA 1JIBA 1KSRA 1J0JA 3CMOL 4U2ZA 2H41A 3QIBC 5E2VL 5KOMC 4JPKH 3DXAB 1QPPA 4XC3H 3S37H 1BFTA 1OY3B 4JREC 2NY0C 3OKMA 1OGTA 1WEJH 4ONGH 3VGEA 4L4TE 4ENEC 3QPXL 4GQ9H 1QLEH 1D5XA 1G7MA 3M07A 1FO0L 3RWEA 2GTZA 1AKJD 2A6KA 3OAUL 4NP4H 4Y5XB 5BRZB 3FQNB 2OX5A 2UV3A 3O6FB 4LLQB 5HHOE 1LD9B 1KLUA 4C57C 1FLRL 4OD1L 1XF3B 3ULVH 4NN6C 1OB1A 2HJLA 4ZPTA 3EDEA 2EDLA 3HI6L 1AQKL 3VH8A 2GITA 2Q7YA 4XP1H 5EIVA 5JXEA 2J4WH 5BCAA 3G04B 3Q6GL 1EGJH 3BZ4B 1CFVH 1KEMH 3DX6A 1BJMA 1NLDH 2DWDA 5E2JA 2LVEA 1R3KB 2ZCHH 5C0AB 5D7JD 3U1SH 1R0AL 2OTUB 4I3RH 2VE6A 2IAMB 1HHIB 1BQHB 3DJ9A 1EHXA 3KLSA 3MQIA 3OZ9H 1ND0B 1PLGL 4N0RA 4LVOB 5H37H 3OWEA 2OTWA 3TZVA 4R7NB 4WU5B 1ZHKA 3GSNA 5HGGS 4P23C 1TJIH 3H9YA 2UWEF 3ABZA 3CX5J 4RZCA 4ETQB 4NQXB 1LK3L 2RIKA 2Y36L 4L8SC 2C3VA 4KUCF 1MJJA 1I8LC 3OHXB 3F7RA 4N5UA 1A9EA 1MLCA 2GTWB 1U3HC 1A1MB 3F58H 3WNLA 5I73C 4UV4L 4ZFGH 2XY1A 4Z7WE 5T3XH 5KVMC 1PKQE 2AV1B 4L9LC 4Y4FD 5T1LA 1VEMA 1CN4A 1MCLA 1I7RA 4XPTL 4GRLA 3BIBX 3ZDXE 1DQMH 2PXYA 1RK0B 3LS4L 1QLFB 3MA9H 1L0XA 1QVOA 4X6CA 3TBVB 2AEQL 3S98A 4ZUSA 3MV7B 1BZ9B 1P2CB 5DJDA 3RPIB 2HYMA 1Q72L 2JJTC 5ACLA 4EUPG 3ZKXB 1B4JL 1ETZA 3QUKA 1WZKA 2YOCA 2R1XA 3GSXA 1X4YA 1JF1B 2V5SA 1T1ZA 1IMHC 1X44A 4OZHE 4OKVB 1FPTL 1D5ZB 5K9QG 2WMPA 4Y16A 3RJQB 3O11A 4POZC 1FVDA 1NEUA 1T2QL 4XZUB 5HHOD 3X3GL 4MYWB 1OWWA 3OKLA 3VXSD 1CLZH 2IH3A 2XXCB 3P4OA 4JR9L 1D5BB 4AM0B 3MLTA 5LBSL 4N8VB 4P3WA 1YC8A 4M6NH 4PD4K 4AT6B 3SE8H 1FN4A 3I9GL 1C08A 2BX5A 2YS4A 4AL8H 3TJEH 2NY1C 3FQXB 4IOFC 3BVNB 1FL5B 5J8OA 1U93B 1RZ8A 1JK8B 3GM0A 1FZOA 1UENA 1P4LA 3BP7A 4PBWD 4UT7H 4TUOA 5ADPL 1BD2A 3L5XH 1BJ1J 3ZE2E 1NEZG 4U7MA 1KIPA 4UDTA 1FNSH 1RUML 1KPVA 5EPMA 3DX7B 1WC7B 1GGUA 1CZ8H 1BVZA 2EYSA 4OQTL 2UUDK 3VH8G 4YHIB 4MNGB 2X4PA 1BQUA 1J0HA 4U49A 2ATKB 3CFBB 3QDGA 1NDMB 3CK0H 4L3EB 3VI3E 3WFCL 4JQIL 4H25A 5E6ID 4PLKD 3V4PH 1FIGL 1INDH 4PP2B 3PWPA 3MSPA 1I7ZB 2X9WA 4C4KO 4ZD3L 3ZT7A 4RAVB 2CLRB 3QUZB 1TJHL 3CZFA 3LRHA 3JUZA 1B9ZA 1U8OB 5CGMA 1B6DA 1MHCA 2J7LA 4WHTB 4UU9A 3SKUD 2X7LA 2ENSA 3K4ZA 2WNGA 4OGYH 4YXLH 5KSBE 5L6YH 4K71C 4Z8FH 3FFDA 3DRTB 4X6DE 4DTGH 3P4MB 3IXAB 1IGML 4F7CB 3V8CA 3CFCH 3KXFE 5DRWA 4Y19E 4ONHB 1E6OH 4GH7B 4KHTH 1XCTA 1DN0A 5CILH 1S8DB 3EDDA 3VXOA 2P42B 1UEYA 3V6OE 1P4BL 4RBPK 1H0DA 4YHZH 3P3YA 3FQTA 3MA7B 3QR2A 5DURB 2X05A 3VMNA 2V5RA 4DN3L 2J8UA 2F8XC 1FFRA 3FT4B 3F6IA 4NO2A 2CDEB 1OSZA 2MTPA 3QQ9C 3TYFA 1BGXH 1QRNA 4KZDL 4U6VL 4QRSA 5I17B 2CRZA 3QIUC 1WFOA 1K5NB 5F7YC 4GG8B 4KV5F 5C08E 3H7BB 5HDQH 3QXDA 5KVFH 1M6OB 1UH2A 5D96B 4L8CB 4CMHC 4KJPD 1M05A 3KLAB 4ELMF 3QCTL 5KVGL 2E8YA 2AEWA 4PJBB 3K2MC 5IJVA 5KSAA 4JG1L 5T3ZH 4X5XB 1CWVA 4DVRL 1X5GA 1K3ZA 2EIDA 3NPSB 5DEZA 4PUBL 3RI5K 1A7RL 2YC1A 1NC4A 4L5FL 4U1LB 1KJMA 2X4OB 4PRAB 1YEGH 3B9KB 5I19H 4NHCH 5GS1A 3MLSL 2FO1A 5DD0L 3HPJB 4PJGE 1IZJA 3OKEA 1YPZE 4U1KA 4MD0B 1Q0XL 3G5ZA 3MUGB 1GOGA 1A14L 5A2JH 4LIQE 1PSKH 3QFJA 5SWZB 3IXTB 2JIXD 3NACH 4QRPD 4I2XA 2GJ6B 4XP9L 5IMLB 4NQCD 4D94A 1ROWA 4KROD 5EB9A 4YFLF 3TIEB 4P2YA 5F7KC 3BMVA 3X13A 5I8KL 1E27B 4PJFE 2WK2A 1MJUL 4M3JA 4N1HB 5BS0A 3TESA 1T7VA 1IE5A 5CJXA 3VFRA 1HILB 3A6BL 5IM7A 3PXJA 3DBXB 3Q5TA 5IHUL 1HIMH 3P4LA 5BZDB 4MS8D 1EXUA 3HB3D 2VC2H 5IB5B 3P9MB 4NM4H 1FORH 4MA7L 4K3HA 4NUGH 3O6ML 5D7JC 5E2TH 3RIAF 3RKDC 3KXFD 4Y19D 1I9EA 4X4XB 3ZL4H 3DX8A 1UADC 4MGXA 1QLRA 2W65A 3BESR 5EN2A 5HDBF 1UFUA 3CU1A 4NQDA 1AXTL 4UTAL 5KJRH 2NW3B 1P4IL 5MEOA 4LAQL 1Q9LA 2ADIB 4HKZB 5DD1H 1MFCL 1QSEE 4BM7A 5IMKA 4LLMA 5C08D 3DSNA 4DCQA 4LRIA 2WBWB 1YYLL 3T65A 1EHAA 2JF1A 4OLUL 5IBLD 12E8L 4JPWH 3HKFA 2DLGA 4EOWH 4P3CH 3VFNB 4JY6A 1YN7B 2AI0L 3G5VA 1TENA 3DWTA 4Y4FC 4RMWA 3MGTA 4K3GA 4AYFA 3HI1B 2G2RB 1OHQA 3FO1A 3KPLA 3MNVB 2GI7A 3L5JA 2QHRH 4PJDA 2NY3D 1TPXC 3BP5A 3BPCA 1Q38A 1JFQH 1JPGA 4P2QE 3F12A 3LS5H 3BN9D 3AREC 3U30B 1SY6L 5F72S 3S96B 2R0ZL 1GAFH 5C6PB 2IF7A 4OCXL 2JJSC 5F89B 3TBSB 1MRCH 4XPHH 4O2EB 2H26B 1A7PL 3QUMH 2GUOB 3CPLB 3WFHB 2B4CL 5IEKB 1KJ2A 3SY0A 3QG7L 5ACMA 2UWEB 5T3ZE 1A1OB 1U58B 4M7KL 1CFNA 4D9RE 3HZVA 1HINL 3SGDH 4GBXB 3EW3B 3HZKA 1VSCA 4Y1AE 5K59F 1EO7A 3KHQA 1N6UA 1CIUA 1BBJA 4PJ8A 3J7HA 4GW4B 3PL6A 4ZODA 1MCOL 1NFIA 4HIIB 5H35A 1VDGA 4L29B 4JZOB 2A9NH 1G9NH 3FAXA 3HPLB 2VDRL 3RGVA 3RFZC 4WUKH 4FXGB 4ODSL 4PJXE 2OK0H 1DTUA 3C2AH 5B39A 1OGAE 4G5ZL 5HPMB 4HF5L 1ZLVH 5GGRA 5F1SA 4HUXA 3IFLL 5IQ7L 5B38G 4Z7UE 4JHWL 1LQSR 5FYJE 3B9EA 2P8LB 1DEEA 5I1IH 3LRGA 3THMH 3VWKC 1QSED 5T5FL 5E6IC 2BY2A 1H9VA 4PLKC 3MRGB 5DEFA 4FQLL 3GIVA 7FABH 2V6HA 3HN3A 4CMMB 3BDBA 4XNXL 4EI5A 4NSKA 5GHWH 3PV6B 3V6ZB 5FYLE 2GJZB 1TVBB 2A38A 1I1AB 1TJGL 5E24E 5EZOH 1LO5B 2DL2A 2YD2A 4PGCB 4KRPD 1CU4H 4M7LH 2X44D 5D1QA 3OB0H 3I75A 1UCBH 4D8PA 1DLHA 4LP5A 1MQKH 3V5KB 4NBZB 3MMEB 5T1DH 2UZXB 4KUZH 3TA3B 1J5OL 5E8OB 1EERB 4P4KD 4OM1H 2EH7H 3QSKB 3HAEH 4I3SH 3QO0A 1G7LA 1G7QA 3SJVE 1F11B 4IIQA 2VDML 1EH9A 2X4QB 3ARBB 3T04D 2ZG2A 3BMWA 5KOVC 2MOVA 3FN0H 3D3VA 4JPVH 1MFEH 3SPVA 1WWBX 2ED9A 5DVNA 4IRJB 4LEXH 1FVEB 1EEZB 2J8HA 4Z95L 4PG9B 3BFOA 3WNKA 5FHBL 1KJVB 1B0WA 3O3DA 5DYOA 5IKCA 5M7QA 4XVJH 5LGJB 4KMQA 1DUZA 3CX5K 5ID1A 3OXSA 3FB5A 2HFFA 5EIQA 3JWOL 5KS9F 1DP0A 5JHLL 4HKJB 2PKDA 1CQYA 4OBSA 1NKOA 3FQUB 4KQ4L 4D9RD 4PBVC 4U1HA 1A7NH 4LVHB 4UT9L 2E7HA 3CC5A 4Y1AD 2XI9A 4KJPC 2FBJL 3N85H 4Q6IB 3ECBA 4PGEB 1NJ9A 1ZT1B 4E42B 4OV5A 2EDYA 4WTWA 4PRNB 4TOYL 4TQEL 4LKXB 3D9AH 1YMME 1LHZA 5DQ9A 1J1OH 4DUVA 3ARFC 5D7SL 3WN5A 2BHZA 1IM3A 3ZDYF 1OGAD 1HHGB 3MBXL 2OL3H 3H3PL 4JO3H 2AS5M 4NKDA 3BHBB 3V6BR 1MVUB 4H8WL 4PGBB 3S3JA 1VACA 1QUNA 2DQIL 4GG6A 3LZFH 5FYJD 5F6IB 1LP9E 5FO9A 4JFDE 3PJSA 2HKFH 1PW3A 5B8CA 2VB5A 1ZANL 3UYPA 1BM3L 2Z92B 1JHTB 3EBAA 4P48A 3SDCA 4O51B 1C5BL 3MCLL 4RWYH 4FQQA 3QHTC 3K8KA 5FYLD 1ZA6A 1CDGA 2VISB 3DV6A 2M2DA 4MXVF 3TBYA 1LO2L 4W81A 4I77H 4FABH 4L4JA 1UZ6E 2H8PA 3DETD 1CGVA 2V17H 4UI2A 5DMGC 1QO3B 4OIIH 4ZYKA 3MRQA 4HK0B 5MI0B 1ZLWH 4WW1B 2VSDA 3TP4A 3QHFL 4CNIA 5F1OB 2XKNB 3HE6D 3HRZB 3MYZA 1F58H 2H45A 3RIFK 3GM8A 2W38A 3MGAA 1WK0A 4TYUA 3TO4B 2I9LB 4MS8C 4ELMB 3L7EB 4NWUH 2ITDA 3HB3C 3NIDE 1HKLL 2LVCA 2JB6A 3P0VL 3SJVD 1S5HB 1T89A 2C3HA 5C3TA 1J1XH 2UVEA 1GJIA 2Q8BH 4BSJA 1KN4L 1VPOH 4P2OA 1A6TB 1NUDA 4ODUA 4OTXH 4CKVX 5A3ID 3MNWA 4KK6D 4YQXH 4PG2A 4ODXB 4HPYL 3SQBA 3HZYB 1U8HB 4I5BA 2JCCB 3B5HA 2FX7L 4GMSH 1Q9KA 4EN3A 4TSAL 2X4UA 1CT8A 4LCYA 2VDLH 2QADD 1A2YA 1FYTE 1LO4H 3VXUE 4Z0BL 1N2RB 2AGJH 3ZDZF 3V8OA 2CLVA 2YN3A 1MFNA 4JZJC 4ESKA 3TM6A 2ICCA 1K2DA 3QH3A 4OLWH 1BECA 3UTSA 4JFEA 5I1EL 4K3EL 4EUPH 2EC8A 4LEOB 3ULUF 1YMHA 4PJHE 5JIPA 2F54B 1JHKL 5BVPH 1FGNH 1YMMD 2YPKA 3MREA 5EU4A 2QQQA 4HLJA 3HR5A 2P5EB 4NN5B 1DSFL 4UINH 4AQOA 4UV7H 2HLFD 6FABL 3ROLB 1UXSB 1RK1B 1W72B 1CS6A 5J11C 1IZKA 3BN9C 2PW2A 4W6YB 1CVRA 2VLRB 5EUKB 4HJJL 3R8BB 4OUOA 1S9XA 5C0CE 1YY8B 1YNTA 4RRPG 1F90H 1KIUA 2AEIT 1ITBB 1JCKA 2WBKA 5J57B 3K1DA 4JFDD 3V2AR 1ZLSL 5HYFA 3FONA 3P11H 2I27N 3BQUA 3I6KA 3C6LA 1FH5L 3UZEA 1JNLH 3BEVA 4Q9RH 5SX5K 4U7SA 4JQVA 2IADB 4FNLH 4PJCA 5I1CH 4OV6F 1EJOL 2DQGL 2HRLA 2VL5B 2B2XH 4OCSL 4OFIA 1IGTA 1IEBA 4G3YH 1G7HB 1SJXA 3WNOA 4ZFFA 4AZ8A 2Z31D 5JPMB 3MUJA 5ITFA 3FL7A 3MLZL 5D1ZB 1EIBA 1EDQA 4C4KT 1A1NA 1OP5K 5E7BA 3IVKA 1F2QA 2LABA 1OQOA 3M45A 5T33H 3L3IB 3CFKB 3HUJA 3UYRH 3PGCA 1T5XA 5DJ8A 3O41B 5DQJB 4F8TA 1CR9H 1CFSB 4P46A 1KXTB 2NY0B 2GHWB 5IB4A 3CX2A 3QUXD 1CDIA 2KBGA 3BIAX 5ESQA 4WGVB 1RJCA 4NHUB 4LNVA 5EO0B 3WEXA 4HS3A 4LCIH 2JJWA 2Y9RT 1NDGA 4XCNA 4OZIF 3QJHA 4LFHD 1XGQB 5IMOB 3QRGH 4HFUH 3VXUD 3RAJL 4ZOCA 3MV11 4XNMA 4NN6B 5GS3A 5FA3A 2QEJA 4KRPC 5C9JA 2VRAA 4QY8B 4U1MA 4PV9B 3RNKB 1RZGB 2A6DA 2Q3ZA 1I7TA 5CBEA 3GI9L 4P4KC 2CIIA 4NQTA 4AMKL 4TN9A 3C5JA 4JFOA 4G7VH 5FUCE 2FCBA 4PS4H 1E4XI 3BP6A 2FHCA 1RV6X 3NGBC 1WCQA 1QSZA 5EOQH 1BQSA 2EEBA 3KR3L 4ZSOE 5C0CD 3PNWB 3D2UA 1LVEA 4S10A 1JV5A 4P23B 3MRRB 3QZWG 5C7XH 5FF6A 1UWGL 4KK5C 3WS6C 5FO7A 4L8SB 1TETL 4FFWD 4HWEL 1IAII 1NCTA 1I1CA 3FFCA 4MB5A 4R97B 4XAWL 4KJYA 1U3HB 4RMUA 3NH7H 1EFXA 4F9PC 3MUHL 3QEUB 1UZ8A 5I73B 1KEGH 1CLOL 2J5LC 3ULUH 3SGJC 4FFYH 4XGZB 5IOPA 5CIPH 1QBLL 2B0SH 2VLJB 2ENYA 4L9LB 4HH8A 2WZPD 3B2UD 1PX3A 3OAYH 4TSCH 5HHXH 2BHYA 3L3JB 4OLVL 4XBPB 5SWQB 3KJ6H 2HFTA 3GSVA 4NO5A 5I16A 5IHBA 5JW3L 3RWFB 5GGUA 5ADOL 1YEHH 1KLGB 4CJ0A 4ERSH 2R69H 4AQ1B 4FQPA 3BIKB 2FWOA 1IGCL 2W0LA 1AO7E 3EO9L 3PP4H 3WHE1 1YEKH 3VA2C 2I9TB 5GRWA 4Y4HA 4ZQKA 3ZO0A 4NYLA 2QL1A 4RISL 2MCG1 2XICA 3BZFB 2IQ9H 3MOQA 4W6WB 1E4WL 5GS0D 1II4E 5C0GA 1Q0YL 2KH2B 4AEIL 5KS9B 3TT3L 4PJEF 2XWJB 4HT1H 4U6YA 5F7EL 4QCIA 3GUTA 5JW5A 3CH8A 4H1LA 1S7SB 4OUUA 5A43C 4JO2H 4QGTA 1TZHB 5HHVL 3UTQB 2NY1B 4MA8H 1QSFA 3WDHA 1GH7A 5DS8A 1T0NB 2X4RA 4FQ2H 2VR9A 5CEZE 4DZBA 4M1DH 5GSVB 2A77H 4QT5A 3FB6B 2NZ9D 1FZJA 3TBWA 3BUYA 5A3IC 4KK6C 4GRMB 1KCVH 4HLZH 3O2WH 2ZWLT 3MXVL 1G9MH 1UACL 2VUYA 3V7AE 3IDGB 3I50L 3TCLB 4WHCA 4F7MB 2YD1A 1PZ5B 3HC0A 1S3KH 2DKMA 1IBGH 2QADC 2WM0A 1ZT4A 4JRXA 3QUYA 5ELIA 1UA6H 3LQZB 3FHQA 4R96B 1CVSC 1L7TH 3EYOB 4MA3B 2VXTH 3LEYH 3T2PA 5F3BB 3ALPA 4M48L 4ZUTA 2YRPA 4RGND 4ZDHA 3KS0H 2ADFH 1F4XH 4LPUA 3RWCB 4MXQC 1J87A 4UNUA 3ZE2F 4K71B 3KYKH 2MKWA 1Z5LB 3F5WB 2BCKA 5D2LF 1G7PB 2HLFC 3BXNA 4HUKB 1OPGL 1RIUL 1AHWC 3CXHJ 2FJHB 4EZMA 3QWOB 4O9HH 1VKXA 1NANH 2DI7A 2P46B 3NIFE 2WP3O 1AO7D 3MGOB 1HH9A 1FJ1B 5FK9B 5IV2B 3MRIB 1F2XK 3GK8L 4ZPVB 4GAJH 4M7LT 1SEBA 1A6PA 2W0FA 2VABB 1NFDF 2Q6WB 2J88H 2DQEL 3NBNA 2RQ8A 3QIUB 3SDAC 1MHEB 3QXWA 1AGCA 1TQBC 5INDA 2WBJA 2DLHA 1P6FA 5DVMA 3G5XA 1OP9A 2Z31C 4CMHB 5C70A 3LDBC 3GGWA 4HQQH 2FO4A 2BMKB 1N0XH 5DUPL 3VXQA 1N4XL 1JGDA 3PWUB 1I1YA 5CEZD 3S7GA 1OSPH 5CJQH 2LTQC 5GPRA 3TZVD 4D2NA 5HI3D 2AKRB 5HYJA 5JPNB 3BKML 4JE4B 3QDGE 4Z7NF 4CW1A 2OJZL 1IAKB 1NCDH 5E5MB 5IW6A 1A8JH 5HHMB 5I1KL 3PWPE 2QSCL 3MRNB 4QHUB 1AKJB 3TT1L 3F7VB 1CD1B 3DHMA 1U8MB 2PO6B 2QR0B 3HG1B 5F21B 1JPTH 3MACH 4RBPH 5F1KC 4M02A 2FIKA 5T1LD 3PP3H 1FNGB 4G7YL 4GRLD 1QKZH 5FHAH 5ISZA 4L8DB 2PXYD 3IFPB 4Y4KA 5DJAA 3D0VA 1D6EB 4S1DD 1WGOA 4UQ3B 4WENB 1CLYH 1NKRA 3BH9B 3T09A 3SDDA 5D7JB 1ZHLB 5HY9A 4EIZC 4CADA 3U0TA 2J8UE 1OQXA 4FXLA 5AWNH 4JY4B 2CPCA 1Y6KR 1FL3B 1CE1L 4M61A 4Y16D 2DIBA 2NZIA 2ZUQC 4CVWA 4J8RA 3G6DH 4B53A 3UTTA 4OB5H 4HUWB 1BWWA 3CSYA 3MZTA 3QNZA 5BVJB 2BOBB 5SX4I 1IGYB 2PTVA 4LCCC 3F6LA 1J0YA 2OXHA 1NCAL 4G6KH 5F88A 4OZIB 1BAFL 1RFDH 3GEWB 1CFQA 1ZHNB 5EBMB 2NY5C 4MXWL 4ZFOA 4Y5YC 4O2CA 4R0LA 2N1KA 4HG4J 5C9KA 3S35X 1V7NL 1P9MC 5IGXL 4S1SL 1IFHL 3EO0B 3MJ7A 1NCBL 1UM4L 2NNAB 1BD2D 3B2UC 4Y4FB 3DARA 2J8OA 3H2WA 4X6EA 1E4XL 3RPKA 4XVSH 1JYXA 1Y18A 1KENL 1NMBL 5FGRA 1J0IA 3S4SG 5JNYB 3I6GB 4LMQI 1U95A 4OLXL 1TPXB 3QDJA 5A16A 4FQCH 1JNJA 4WWKA 4WEBL 1CD9B 4YHOH 4WTZA 3V5DB 3AREB 5I15H 3QDGD 2CXGA 4GXUN 3KPNB 5FUOH 4D0DB 5TPWH 4BFGA 1TZIA 4I2XE 3UJTL 1BF8A 1H3GA 4WDIB 1BMGA 1RUAH 5DSCA 5C0RH 4WU7A 1G0DA 2GSGA 3PWPD 32C2A 1N64L 5F3HB 4EQ2A 5B3JE 1IAIL 5EZLA 2ED8A 1JVKA 3LMJL 3OJ2C 4CRPA 5BS0E 3RVUD 1ZHBA 2B1AL 1QBML 2IG2L 3BKCH 3VXSB 5IROA 1R3LA 1INQA 2XRAH 4J1UB 3GHEL 2Y06H 4WHYH 4K23H 3LEXB 3KPQB 1LGVA 4M6AA 3QPQC 5DRXB 5IFHL 4AIOA 4PRIA 3MNZB 4MQTB 1CE6B 2Q1EA 1V3JA 1XIWA 2VXQH 4XMLH 1CQKA 5FUCC 1EEYB 2B5IC 3T4YA 5EG6C 3MUY1 2VDQL 4MA1C 1WCBA 1AD9B 4NQDE 4NQSA 1D7FA 1M7DB 5TQ0L 4MHHI 1KLFA 4WV1C