3KBHE

Crystal structure of nl63 respiratory coronavirus receptor-binding domain complexed with its human receptor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
121
structure length
110
Chain Sequence
HTDINFTATASFGGSCYVCKPHQVNISLNGNTSVCVRTSHFSIRYIYNRVKSGSPGDSSWHIYLKSGTCPFSFICFSTVEVPGSCNFPLEATWHYTSYTIVGALYVTWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of NL63 respiratory coronavirus receptor-binding domain complexed with its human receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Angiotensin-converting enzyme 2
total genus 18
structure length 110
sequence length 121
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3130 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kbhE00
3KBHE 4F5CE 4F2ME
chains in the Genus database with same CATH superfamily
2R7EB 4ZX5A 3OGCA 1WZKA 1XIWA 4A2HA 3K6SB 2Z91B 1FORH 3WE6B 4YSTA 1D5ZB 1U6AH 5IB2A 2OR7A 2DQ6A 1RZKL 4O58L 4UYPA 3UYRL 5B3NA 5HD8C 4BKTC 3OX8B 5T3ZL 4YHYB 3KLQA 4P2QB 3QUYD 4O00A 4QI3A 5EA0H 4CKVX 4MAUL 3DK2A 3W2DL 4ZXBD 2DJ4A 3FSVA 3P0VH 1NC2B 3MV9E 4PJBE 4UILH 1XR8A 1T66D 5F3BB 3DKHA 5DYOB 4O51A 5IMLB 1IC4H 4BK4A 2CDEB 4NXKA 2ITDB 1OXYA 3TBYA 2YJQA 2PYED 3EO1B 4G9DA 1N59A 4GS7C 4MCYA 4FQLH 4OT1H 5KYWA 1VPOH 3MV9A 2ADJB 3TJHD 5D70H 3NIFE 3I74A 2D03H 1E40A 4ZMZA 1C12B 1ZT1B 3LSOB 2F18A 2NY3B 1RURL 1BD2D 1G9NH 1T7VA 1N19A 2E8YA 3REWB 4CDGC 3U82B 2PTTA 3MX0B 1MFMA 1RMFL 4QHMB 1A7RH 2ROXA 2C9UA 3LNFA 3FCBA 3IMTA 2P8LB 1UWFA 1S5HA 2DEWX 3H9HB 2CCVA 3HRPA 3JUYA 3F7VA 5KEZA 3ECBA 1FO0A 3O2DL 4DO5A 1H3XA 4KJWD 3ATEA 2MH4A 1KJMA 1QYGL 5DZAA 3IKCA 5AVRB 4AK1A 4R9HA 4W93A 2EDMA 2A4EA 4EIGB 4QOKA 3T6XA 2APXA 4UT9H 2LOEA 4JRYD 1EXGA 3DX6B 3MRBB 4ONGL 2QPSA 4N1EA 3GRWH 1CS6A 3K2UL 2BIMA 1A8ZA 3Q6GH 3QQ3A 3U9PH 1BIHA 1TTGA 2AVGA 4X4ME 5E9AA 4OLUL 2M8XA 3I6KA 1DJWA 4DNLA 2DIJA 1QBLL 2CMRL 3SDAB 4DGYH 1GL4B 5KANG 2YZ1A 3OKNB 3PPEA 3QQ3B 4XNBA 3T8VA 4DZ8A 5GS2D 4G71B 3D3VE 4S0SD 4G7YL 1FQ9C 4GUPB 4FYRA 4U1HA 4AYGA 4M6OH 3QFGA 2X2JA 3P54A 1X5KA 3C5ZD 1EV2E 1PU0A 5LO7A 4HBQA 2O6CA 2ZG3A 1CG9A 4TVSa 1VZGA 5A3ID 5CN1A 5DRWB 3D3VA 1LEKA 4OLUH 3TIDA 1CL7L 1YEGL 4FABL 2ZWNA 3CFKB 2YN3A 1MUJA 4PW4A 3RWJA 1NFIA 4HWBL 1G9HA 1P7QA 5T33H 3VD4A 1KB3A 4JFHD 2UX7A 4QHPA 5DJYA 1A2YA 2H1PL 1S7VB 2IGFH 1GGYA 4JVWA 1WIOA 3SPJA 5IP4A 1LHZA 2MMXA 3CX5K 4I0PA 2EDBA 3QQNA 1EJOH 1JZEA 1YRKA 3Q8FA 4UQIM 2I7SA 1J0YA 2GTWA 3ZE0E 5KYWB 3V8OA 3TBYB 4JCWA 5IM7A 5T1MB 1NCIA 5E7FA 4LZKA 3CX5J 2WY3B 1PZAA 3WIHH 2OS7A 4GQ9L 2W9DL 1Q38A 1Q9OA 3DYPA 3VACA 4OTXH 4UT7H 3GBMH 1K5NA 5E8OB 4YO0A 2BWQA 4YVNA 2BXYA 3E2HC 3P4NB 5JNYB 1EZVY 1T2XA 3AJ7A 3G5VB 1QWUA 2HFEA 2VZ3A 4QRFA 1ZD6A 3BH4A 2NNRA 4UZSA 4E5XA 3V6FB 3S37H 1A65A 1MW0A 1RK1B 1TLMA 3BN9D 4NFCA 4M03A 1KG0A 1TNMA 5DHMC 2YUVA 3L7EB 5IREA 3TNNA 4JMXA 3MBWA 1OAKL 3S5LB 2DMKA 3OJDA 3DYOA 2XY1A 4KVPA 4Q7DA 4JN2B 4U7KA 5TDNB 1OSPH 1FZMB 1T04A 2PP9A 3HR5A 1IVTA 4FFTA 5EIQA 2I60L 1Y0LB 5CEZL 4GO9A 1O5PA 3MRJB 4GAGL 1WZ1L 1HL9A 4NUJA 5E6YA 4NUQA 1IE5A 4IHBA 4PJXF 4YZFE 1J12A 1J05A 5E56A 1KC5H 4MGXA 1ETA1 1T2JA 1JPSL 3A67H 4NKOB 5LNEA 4MJIB 4MMXB 4L8CB 2OM5A 1LEIB 1FSKC 1LTXA 3BD4A 3F8UB 1IBGH 4U1NB 4WU5B 1I1YB 2HT4C 4YGVB 4JCMA 2ARJB 2Z34A 4P2RD 2C5DC 4P49A 4ENZA 5D1XD 5IV2A 1RI8A 3ESUF 1JF6A 2VABA 4IRZH 1S4IA 5A3IC 4XVUC 3LRKA 1ITCA 3MLWL 3NMEA 2YJLA 1P4BH 3EFOA 1RH8A 2G75B 2ZZUT 3DJ9A 5CHNA 4BIKA 5I6OA 1I3UA 3UBXA 1EIBA 3C6EA 4QJ3B 1HCFX 5HDQH 2CR3A 4PTUA 1S9YB 1KIPA 5H37H 3OKDA 3QZWG 4GB9A 2M2DA 4AH2A 5DUPL 1NCDH 3TTSA 3MYJA 3B56A 3OC8A 4FNTA 4L5FH 2VM9A 5K69A 3SQOL 1WT5A 3IDJA 1L9TA 4Z7NB 3BC9A 3UAEA 3LEYH 3C6LB 1I7UA 1URZA 3ZT7A 3TO4C 1UXWB 1WZ1H 3VSQA 1LM8V 3TZVD 1Q0YH 5C09E 4ZMOA 4EAEA 1AIFA 3SOBL 3KLLA 1SHXA 4P5KB 5GRVK 1NCCH 1A7OH 2VL5A 5FGSA 3UABA 3MDJA 1TQSA 3QG6B 1WFMA 3QQ9D 3BGFC 2DWSA 4QF1B 1XWVA 3G08A 4F9LA 5M95B 2AZAA 5B1AB 3GHBL 3SDXE 1CVSC 4FLOA 2DQUH 4JPQA 3EGSB 3UCRA 4F7CB 3EYUH 1VFBB 2WQRA 4JDEA 4EOWH 4EIUA 2ZJSL 3KWTA 3US9A 1GY2A 1YN6A 4WEBL 5EMYA 4Z7OE 4Q6KA 3VWJC 1GA2A 1AXSB 4OLYL 3B9KA 5PAZA 1S6NA 4P23C 2Q6WB 3X3FH 1RU9L 3FU9A 4AQZA 4JGJA 2VZOA 4W6WB 3QIWC 4IHOB 3D12B 2WZPA 4HPHA 1EZSA 3QFJE 1QSZA 1XMWA 3BWZA 4NGHH 5FKAB 4DN3L 1HQ4A 3QIUB 4XNDA 3LCYA 2EYTA 2YARA 3KYAA 5E1HB 3SD2A 5KSAC 1MELA 2WP3T 2Y1AA 5B3JE 1MW2A 3KYOA 3LYRA 1TPXC 1AYOA 3VD7A 4Z5RA 1NBZA 5EZOH 5DJDA 1SLXA 1GOGA 1DBKL 2NNCA 2WIMA 1FNEA 1YO4A 2OFQA 4YBHA 1PZ2A 5B22A 3ULAB 5GS2H 5MI0C 3U7YH 3VXSB 3HCVA 1J9CT 3L3OC 5DJ2A 3TBTB 4ZNCD 2AJVL 3VXOA 4WQOA 5JW3H 5D1QD 1CDIA 3D48R 3FT2B 5CGYC 4X4YB 3VQ1C 3CVCA 3VXUB 3O41B 4J39A 4LVOC 1K2DA 1KXQA 4POUB 1P5UB 1ZLEA 1PCSA 4JZOA 3RPBA 1FFQA 1J0IA 4YDNA 4LLYB 5DMKA 1BEYH 1A6AB 3MRMB 3I6GA 5IKCA 4H1LG 3MCKB 3HAEB 3R18A 5ETUA 1G5GA 5J56B 3WIFA 4AW4A 3N0AA 4JPVL 3OF6A 3RKPA 2NY5L 4LLQA 1GZHC 4MAZA 1VGEH 5KSBA 2EVFA 3VQ2C 4OAWA 2E4TA 2QDWA 4E41D 4Y9BA 3VA6A 3S4SB 1DBAL 3UAJD 4OCRH 2ZJSH 1RFDH 4LGPB 4MNQE 4Z7UF 3L4VA 2ZYIA 1T6BX 4XBEL 1PCXA 4MHHI 5ID0A 5DHVH 2WBJB 4U1GC 1WF5A 2EDYA 2IO5A 1YEWA 2Y6SD 2YRBA 4YXHL 4QRRD 5AAMA 4ZMWA 1L0YA 1NCBH 3CFUA 3DUUB 3CC5A 4MZ2A 3MRIB 1JZGA 4CGUB 3I6SA 3FQNA 1F97A 1EO8L 1TTFA 3O4OB 1G9NC 3MN8A 2P4AB 2QGBA 2F1BA 3MV11 5HDBF 4P5RA 2WO4A 4D8PA 3IETA 4DW2H 3CIAA 1F3JA 4ERSL 3W56A 4AK2A 3R1GL 1NAMA 1UFUA 1ZLVK 4OJAA 3OTTA 3D33A 2UV3A 3AU1A 2A6JB 4CW1A 4Y4FA 1FF5A 3QHFH 2BS8A 1I4FB 2EH8L 4L3CA 4NT6B 4NOBA 2OTWB 3MJWA 1CURA 4HJGA 1MFUA 1N70A 4XO8A 3PWPE 3GLEA 1B6DA 3NRFA 4HETA 4NNPH 2F15A 1TVBA 1EJFA 2V7HB 3QBTB 3P77B 1G9MC 3U2IA 2X1OA 4JPWH 4F57H 5IOKA 4Z3EA 5IQLA 4ELMB 1BF8A 2WQUA 4HPOH 5F7DA 4KITB 1HH6B 4S10A 2A9AA 1I8IA 3JUZA 3E8UL 4XMXA 3I9GL 4X99B 2VN5A 4M1GH 5INCB 3GO1L 5CXPA 3FQYA 5DUML 3JVGA 2VCOA 4DGIL 1MWOA 5FWQA 1X9RA 2ADIB 2WNGA 3HLAA 5CUSH 3OKMA 2FB4H 3NGBC 4JRYB 4LLYA 5TE7L 2EDJA 4XO3A 3BE1L 1T03H 1H9VA 4FG4A 5IEHB 2PR4H 1CFSB 4FLHA 5KYYB 1WAAA 4UQBA 3O41A 3EZ8A 3TONA 5C9JA 2G9HB 1KTDA 3SQBA 4MJHA 5B1BB 1U4EA 3BO8A 4XNMA 1CBVH 1H6UA 2ZTBA 1NEZB 4XGZA 4HCRL 4MMYB 4BQ6A 4NQXB 3WHXB 2WAHA 6PAZA 4JFWA 2WGXA 5F8RC 4Z7NF 4UQEA 4HCIA 3VXSA 5JZ7C 2B39A 5DVNA 3QJHB 4U1KB 4R6UA 4H5SB 3DXAA 4P3CH 4M7LH 5TQ2L 4JDTH 3LKOA 2X4TA 4OCSH 2JCCB 2CNZA 2YGOA 4B9ZA 4L4VE 2EKSB 1L3NA 2BSCA 1IGTB 5D2LA 2FLMA 3QIUA 4GLRH 4JUTA 5DO2C 2C9XA 4Y4HA 1NTDA 5F1KC 1CR9L 5EWIL 1KTDB 2XYBA 3SQBB 3CQQA 5C9JB 2QQKH 5FCSH 3QDME 1AGFB 1P7QD 2FWLB 4OBSA 4Q74A 1NJ9A 3O2VL 1XF4B 5IROC 4WW1B 4P5TD 1L5GB 4OGZA 4N0UE 4XWGH 1J1XL 1NMBL 4UQAA 3QH3A 3JTTB 3RJQB 4JZJA 3QZWB 1BAWA 3O8XC 1IBDA 1AOHA 3EGSA 5I18L 2VDRL 3TBVB 4UV7H 4RAUB 1NUFA 4M7KH 2E6QA 4CN4A 1KPVA 1WAPA 2CQVA 4J8QA 1RQ5A 3TN0C 1NCAL 4POYA 2X05A 2H8PB 4U0RB 1S7RB 2KL6A 4C56A 1ORSA 4MD5A 5IJKC 2WWNA 3VD1A 1DEEB 3HPJA 1PZ3A 1I8KB 4QO1B 4M5SA 5I16B 3BPLB 3QB7C 3AXIA 4HHAB 5I9QC 3MLRL 1NCJA 1VACB 4AG4H 3IRZA 1YDPA 3NJJA 2HFGL 2DWTA 1UXWA 1Q8MA 1S9VB 4JK0D 5BW7A 3FRPG 1J5IA 3BH8A 2I60H 2ICWB 4YC2B 3SPIA 3JSSA 1PFOA 4MASA 5CCKL 2P5EE 2FH6A 3FU8A 4TUJB 3CVHA 4N5UA 5I1DA 1FZOB 5SX5K 1E5UI 3WUZA 2B4CC 3AS2A 5C0ND 3IJEA 3MLUL 4N9OB 4K7PH 4XXWC 3SDAD 3M1CA 1PLCA 4Q9BA 1FYTA 3N43B 3FQNB 1G7QA 3F83A 1SLUA 1CLYH 5TE7H 1UCBL 1R5IA 3IEAA 3U2SA 4JFTA 5ANMB 4N90E 5ESQB 3WFDH 3PWJA 4XMKL 1KLGA 1U8MA 1EZVX 2HVJB 3EADA 4H88L 4G42B 4DP7X 1VFUA 3C09B 1EAPA 4M8VA 4RGMB 4WU5A 5HPMA 4KX7A 4HJTA 2GB2A 4NS0A 4RIRB 4MTMA 4X6DE 5EZJA 2ZOLA 4PJAE 4B41A 3GIVA 3QAZB 4JJ5B 1NMBH 1E9QA 3ZHFA 4I9WD 4N2CA 2BVUA 3K0WA 3NN8A 2K3HA 5F97E 3PWPB 4LP8A 3HNSL 3MRJA 1PW3A 4RDBA 4AQAB 1GJIA 5DCCA 2EE0A 2VRAA 1MHEA 4HH9B 3MRPB 1MIEH 1XGTB 2QZQA 3KWVA 3WIFB 3RVXC 5DGRA 5BZDA 5IEKB 3ZE2E 1XCTB 4X0KA 1FE8L 2AANA 3H0TB 1AE6L 4JN2A 3CMOH 4JLRA 3T5WA 3WFHB 2OX5A 5B8CB 2RHEA 1NCHA 2IEPA 5IROD 2D7TL 1BZQK 4PG2A 3IMUA 4YE4H 4MB1A 1ULVA 3S5LA 3KS0J 4K7FA 3WO3B 3UTPE 4XNQA 2KQMA 2PABA 2ZX9A 3C5JB 5DRNB 1ODUA 3P4OA 1FBIL 1T5KA 2BNQE 2ZKXA 1U3HB 3UZQB 5EEYA 4GKSA 3DJTA 3KPQA 4AEHH 4UQCA 3PXHA 3RVUC 4L1HA 2E27H 3AC0A 5JA8B 3OWEA 1CBVL 2FUTA 4NM8L 1FNEB 1RUML 4W9KC 4LSUH 2YUWA 5DDHA 4YEEA 1JZ6A 3CFJB 4Z5RB 5DA4A 4PGBB 1OM3H 4Y9EA 3HG0A 4PW3A 1MXDA 1HQ4B 1PG7H 2NMSA 3TYFB 1TTBA 4KJYB 5J4MA 1OSEA 3G5WA 3RI5F 1IC1A 4BUQA 1U0QA 2DWDA 1Q4NX 2VXVH 3W37A 4HDIB 2JK5A 4AKQA 4XVJL 3AQXA 2Z9TA 4PWGA 3ZKMD 3E3QE 4JKWA 4JY4B 1HAUA 1KGIA 2LW3A 3SJVD 1G7HB 2G0LA 2H6PB 2PCFA 4UBDC 4X9HA 4NJAL 7PAZA 1R0AL 1J8HD 1FFPB 3WNOA 3LQZB 3WFCL 1NIDA 2OZNA 4NJAH 4W9ZA 1VFBA 1NLDL 1LMKA 4BEIA 5HY9A 1L9QA 3D3VB 4KDWA 4YE4L 3HC2A 3BZ5A 4NERA 4QF1A 1JGEB 2CBMA 5KVFL 1EJ8A 1J0ZA 1P2CB 3H6AA 3VFSA 1T2QH 2E6JA 4U1HB 5D5ME 3OV6A 4OV5A 1CDYA 4OUUA 3CFDA 2Z4QA 2A6KB 1SXAA 3PY9A 3L6FA 4DZ8B 1DQVA 1Y7VA 5FK9A 4UT9L 3EJUA 5F72S 4WY7L 4JL2A 2ESVB 5IB5B 2Y23A 3V4UL 1JXFA 2VITB 3Q5YA 1MREH 5JOPD 3CK0H 3OSKA 5DJCA 3Q2NA 1FZKB 1X4XA 3EH4B 4ODWB 1HI6A 3U2JA 1G0DA 4PLKD 5DURD 2GIYA 5E4OA 4C59B 4AMXA 2IWGA 2VDNB 5CKAA 1WFTA 3OKDB 4QOKB 5ABAA 3RVXD 5EF2A 2CHDA 4M7ZC 4JN1L 5TK2A 3VXSD 1Z32X 3A23A 5IWLA 4XCCH 3UBGA 2EIJB 4KUCF 5EBMA 3MLYL 1VAHA 4IRSB 4WW2A 4OLYH 4RIRA 1B9KA 4GH7B 4PEEA 4DUVA 2YPVH 3VI4A 1AQDB 4ENEC 1AXIB 1L0PA 1JWSB 3L1FA 4G42A 4IM8A 3O8XA 4FXGC 3DXAE 4S1DC 5HYQA 4U1NA 2ED9A 4LCCB 4Y9GA 5B7FA 1UACL 4OFQA 2Q8AL 1YYML 3HZMB 1MJ8H 3T0XA 2R0ZL 5JHDA 4I48B 4LHUD 3L4UA 4FZ8L 4F8LA 2YFNA 4Y8AA 3O2DA 2OMWA 3LZNA 3H2QA 2GCYA 2PYFA 3T2OA 4AYSA 4LKCB 3ZXAC 3QWNA 5EU3B 3S34H 1WAAE 4A55A 3GXTA 2BWDA 1F4XL 1OD7A 3L3IB 2LHAA 2E9WA 2XPYA 4PGJA 3GMPB 3GZQA 3F05A 1M1SA 3QJVB 4HAFA 3KPPB 4LOFA 5DFVC 4DN4H 5EO1B 4YHOH 5IW1B 4L1DA 3T8XB 3CH8A 2C9SA 3BH8B 5CCKH 4NM4H 4M4PA 1MG3C 3DPBA 4XC3L 4OKDA 4UBDD 4L3EA 2LLNA 4KK6D 3IS1X 4L8DA 4FCHA 2VN6A 2J2ZA 3LN4B 4P59L 5CIPB 4NN5C 4YQXL 2X4PB 1HHGA 3B37A 1I8KA 2O6EA 2WLIB 4L4VA 3X1EA 2H6OA 5IJKA 4PHZA 3NFPB 2X6BA 4P2OB 2NY0D 3O6LH 2LVEA 3GTNA 4OM0L 3RJOA 4MA3B 3GZPA 4U4IA 1AR1B 4P46C 1XH2A 1ZHNB 3FCTB 4K9EC 1DL7L 5F9AC 2XN9A 3HMXH 4EDWL 4Q2ZB 4X6CB 5SV4A 1LK2B 3TNMA 4D94A 4NENA 5I5MA 3EYVA 4N4YB 4W81A 4ABUA 2YN5A 3BZDA 2ZUUA 3FUNA 3FQTB 4I18B 4MQTB 4QHLA 1EWHA 2KERA 2XU9A 2YPKA 1MCWW 1NJ9B 4WI7A 1JHTB 1T1ZB 3DNKA 2B1OA 3J07A 4AQ1A 3E6HB 3ZHDA 2HKFL 1O6SA 1UB5A 4H4NA 1OP5H 5JW5A 3VI3F 1C7SA 1NC4B 5KSAB 1MI5B 5CP7B 2QQLL 2BJMH 3TEUA 3WIHL 3H4FA 5DJXA 4HUVB 1YAIA 5DZJA 3ASNB 5C0EB 2GJPA 1MCOL 2P80D 2QV4A 4RRPA 5EOQH 4KI5F 4YR6A 1IX2A 5I30L 5I6NA 1OT2A 3DV6B 1MUJB 5E8PB 2PTUA 3ARED 4I77L 4N6QA 1JF1B 3V6OC 3QNZA 1OAXL 1UJ3B 2QGCA 1TZHB 3NCFB 3RHWF 1I9JH 3PUCA 4JPKH 4P4KA 3ULUE 1N7MH 4QRSA 5IGXH 5KSBE 4AQEA 1UXMA 5FIEA 5LJYH 5HPOA 4IGBC 3UTPD 3B2DC 4FG2A 4P46B 3OMIB 2RFXA 4G1MB 4KVCL 4OLXH 3QS3A 4HGMA 3RA7L 2WB7A 4OZHA 3OKNA 3QORA 4RLDA 1TZ8A 2J88H 2VLJD 3UPRA 2A3TA 5IB3B 3U7AA 1Z9MA 4G11A 2D2CC 3ZRFC 4PJFE 5E1GA 1KB9J 2V2WB 1CWVA 1ZT7A 1A6ZB 4F57L 3CHXA 2QPFA 4YHLH 1VJSA 3L3HA 4OZGA 3X11A 5C0EA 3KNBA 1IKFH 1INDL 4ZMAT 4Y16B 3RVTD 4WW2F 2YFOA 4TSBL 4TSCH 1AH1A 4HJEA 5E6IB 3HG1E 5IT2L 3L5IA 1KXVC 3J2PA 1FO0B 3OLGA 5AB0A 3OJ2C 4BFGA 4NM4L 2PWFA 3B8SA 3CN2A 3NPSB 4WI4A 1D9KA 2XFGB 3A4FA 3ROLA 1SEQH 2OLDA 3FUEA 2RALA 5C07A 4ERSH 4ZUVB 4H1LB 4F8PA 1XGPB 3ARBA 4Y1AE 1DQML 1BWMA 1PMYA 1QBML 1PLGH 5IHUH 3PPSA 3FXIC 1A47A 2IADA 4E9YA 1RSYA 1AGEA 1MJUL 1UM4L 3D6GA 1SY6H 4GT0A 3ZKQD 1A4CA 2NZ9C 4TTDC 4Z7WE 2YD4A 4LASL 3U1SH 1UH4A 3D85B 1OHZA 5GGQL 3ALPA 3TVMD 3P2TA 4FNRA 5GHWL 1Z9SA 4JQIH 2CXGA 3CC5B 5D96C 1C16B 5TH2A 1IM9B 1MDTA 3ILPB 4GSDL 4OCRL 5FO9A 4KQ3L 3LPOA 5C0JB 2EE2A 3MOBL 4M6NL 5BOJA 2GC4C 3N50A 5HJBA 5C08A 4YMPA 2X6AA 5IJCC 3IGLA 2XOTA 1UM5L 4CNIA 1TPXB 1N9PA 1AGCB 3DIFB 4OGYH 5BRZA 4UDUB 3QNXA 1MCSA 4Z3HA 2VDKB 3SKOA 4PJBA 3OGCB 3O9WB 3L5XH 4K71C 5FGCB 4M6MH 3SDDB 1KIQA 1WK0A 4AL8C 5C2BL 3IDXH 4J2XA 5CLTA 2FX9H 3VG9B 4C83A 1EVUA 1DDHB 1G1YA 1O7DE 1QSEE 2CLZB 3I3DA 3KM1A 4HIIB 3SPCA 3WDHA 3DJRA 3RVVC 2LTQC 3MLPA 3ZZSA 1M6OA 4PWJA 2XQBL 3NFSL 3CU1A 1W6LA 1GMIA 3BRFA 4Z8FL 1JXDA 3QG7L 3L3JA 4YBQC 2HWZH 3ZL2A 1ZLWK 2UZIL 3TOPA 4F27A 1Z5YD 2DBLH 3P40A 1BVOA 1JPFB 2Y7QA 3DX7B 1ZLUH 1L4IA 4WFEE 3P0YH 4WV1C 4YNYA 5KBNC 4FFVC 2Z92B 4PWKA 1T1XB 3ROOB 4IRJA 5M7QA 1KV7A 2Z8WC 3L9EA 4B6ZA 2EDRA 4YUEL 4HKJA 3UBXI 4GFTB 4BZYA 5F7FA 1NA8A 5HYEA 3ABMB 3WJMA 5JO5B 4E68A 4QHUA 4R4BB 5AVVB 3UTOA 3BVNB 1C5DA 4ELMF 2EIKB 5C3LD 2YSSB 4FXGB 1L9SA 5FAAA 1DLFH 1AG0A 1HSAB 1RU9H 1AHWA 2B1AH 4I4WB 1HJBC 4PJEA 1W72B 1UUNA 4DUXA 2CK0L 1AACA 4IJ3C 2EYTB 4HJUA 1TQBC 4P2RB 1AGBA 5BQ7A 4MWFB 2PUQT 1H19A 2XWJA 1NGQL 2NYYC 4NRXA 1WGOA 4PVMA 1BYOA 1R6VA 5TDPB 2J56A 4XXCC 2E0PA 4BBWA 4L9LA 2E3VA 3ETTA 5I23A 1SM3H 4HW6A 1OAXH 5E1AA 2BXZA 1F4AA 1R5VB 4U31A 5AW2B 1FZJB 1MFVA 4LP4A 4XZ4A 1MOEA 4Y9FA 2IWKA 1ORQA 1ACYH 1FFTB 1OTSD 1N6QL 2FZ3A 3TVMC 4OQTA 3WKQA 1WHPA 5IHZA 3CSYA 2Z0BA 3ET9F 1RERA 3AW5A 2DYRB 4JZNB 2PWHA 4C47A 1ASPA 3QAQA 4R90H 2X4RB 3HZYB 2BZCA 5HHQA 3FRPB 1HL4A 3VYOA 5DMGD 4P5KA 1MHPH 3TCXA 1OAJA 5AVUB 4AKPA 1Z9NA 5MEOA 3S8FB 2QVKA 2IPTL 3ARFC 2DQFB 4CN1A 5DA0B 5LGYA 3EO9H 2VXUL 4KX8A 3K6IA 5EBLA 3VTAA 2V37A 4GSQA 3EJPA 3HB3D 4JHWL 1QRKA 3H1ZA 4U1JA 3RDJA 3SYQA 3S5LG 1E5AA 2HN7B 4OLZH 3ECVA 3LH8A 4MS8D 4FFWC 2P24A 1TU2B 2VQUA 1WWBX 3EZJB 3RG1C 3V0WL 3ZIYA 4DPRA 2Y7LA 2ATKB 2ED6A 5CS7A 3ISWA 1NGZB 4UZUA 3SOTA 3UTTB 3D3VD 5IHUL 4YBQD 1BD2B 4M5TA 3IFPA 2BOCB 1QFUH 5T1KD 1AMXA 4HS8L 4JRLA 4MAYC 1KXQE 4TMPA 4ZS6D 2G75A 4BWTA 2IAMC 3KH4A 3LZFL 4NHCL 1LO2L 2XCMC 4KO5A 4R2GB 4U3HA 4PJFA 3H3KA 5HVWA 4OU3A 5IV2B 3TPUB 2R8SL 2OMNA 3GXFA 2CO3A 5BQDA 3ARTA 1HS6A 4KH2A 3V0GA 2AITA 3W0WA 4WJ5A 1QPKA 4WTZG 3DX0A 2FBOJ 1X9UA 1LP9A 3ILEA 1LNUA 5A7BA 4FHJA 5EUOE 3DO7A 4QRQB 5EZLA 3W0WB 3TURA 1SYSA 5FO8B 2WXIA 1QI3A 3QUYC 4QJ5B 5CO1A 2P8PA 4D0CB 2JSFA 2WQSA 2AQPA 3RNQB 4JY6B 2FEDC 5I66B 3ULUL 2F58L 1IE4A 2NYYD 2EQDA 3LQAL 4X4MA 4Z76A 3FQUB 3GXMA 2CLZA 3HR5B 3DROB 2XDHA 1AO7D 1YEIH 1ZOXA 1AD0A 1QRNB 4I1NB 3WFEH 1VADB 4MJIE 4A7GA 2AS5M 1JSYA 4LLUA 3UZEA 1JMZA 3CQPA 5JTWA 2WBWB 3L5JA 5LWYH 3CH1B 1OTSC 4AM0A 1KN4H 3QPQD 4FQHA 3PRZA 1F4XH 2EUVA 4R0LC 3CV5A 3RX9A 5EFIA 1GGCL 4MX7A 1OQOA 2ENJA 2G60L 4OF5A 2EACA 2DQFA 4NEHB 4RGNC 4R3SB 5DEGA 4XWGL 3QULB 1FIGL 1OCWL 2PMZA 4MLIA 4HC1L 4ORGB 1U58B 2TAAA 1KNOA 4LBAA 2R29A 3GJEA 4X8JB 1F5WA 2YD2A 2OSLB 3EDDA 4TLUA 3V9FA 2A9NH 4A7QA 3S3PA 4LCUB 4XH2B 3ZDWA 3WU1A 4FABH 2FIKB 2APWA 4WI0A 3T2PA 1HXKA 3GSOA 2C7FA 3T0DA 2JKNA 2JV6A 4NYLA 3MUHL 3ILDA 3DX3A 2VDLB 4K73A 4Y2OA 1I9IL 2NW2B 4OF8A 3TV3L 2WKOA 4ZUVA 4CADB 3S96B 4ZZKA 3EUUA 5DK2B 4JPWL 4CVUA 3DBSA 2NY0B 5IIEB 2FR4A 4TQ8A 1AR1D 3INOA 3RDTB 2AJYH 5J11C 1ZV9A 5ICUA 3D39A 1T0MA 4HCRH 4TQIA 2X9WA 4R4ND 4C4KO 5ENWB 5CD5D 2R0LH 2QVFB 2O4EA 2DTSA 4NPJA 2MQGA 4I4WA 3ZE1E 2ITFA 1QATA 4FXGA 4FXKC 4HX1B 4QTHA 3MACL 3Q13A 1CYWA 2WP3O 5E5LA 4Z3FA 4LESA 3SDAA 4PJCE 5GISH 4X2UA 1U8OB 3S4SG 3WJMB 3KGRA 3MUZ1 5I1EL 3VAEA 3R19A 1U8PA 3V0EA 4PRAB 2ZG2A 4PRIB 2W5PA 4N2AA 1DVXA 2X89D 2WANA 2XN9E 3MRBA 5DEJA 2V9RA 1BVLB 4EN3B 3M86A 3H8NA 4YWGL 3HAEG 3GS4A 1E28A 1EA9C 2ED8A 1NFDA 4GUOA 3CDYA 3OKKB 4PU2A 1FA4A 3KGUA 4Y16D 3MC0A 2E46A 1T83A 1IGIL 4L3EE 4X4ZA 2DI8A 1JF1A 4EUPA 4LDEB 4KRNA 4QKXB 1MAJA 4KKNA 3ECQA 4OJDH 3EYUL 3CLFH 3HI1B 5HHME 2OV0A 4BZ1A 4OQTH 2XZQL 1P1VA 1WZAA 4ZO7A 1XGQA 4IS6B 4NB7A 2RQEA 3L3KB 5JW5B 4OBRA 5L9DL 4LT7A 3E6HA 1CDUA 4LDLB 3U25A 1EERB 1U2YA 5EC2A 5SX4H 3LMJH 3WEAA 4G9DB 5C08B 2Y7OA 4OIBA 2Q87A 3PU7A 4DKAA 4PJ7E 4AGNA 3LMJL 3E1F1 1YN7B 4LSRH 5AW3B 3U6XA 5TH2B 3FSZA 2WCGA 4C58B 3NAAH 5DGQA 1A7RL 5KYXB 4R2GC 2YGNA 2PTVA 1ZLSL 5JW4N 2NY1C 1X6LA 2QKIC 3D85A 4JGNA 2V8LA 2FL5A 4P2OA 1X5YA 2EECA 4PRPB 4XAWL 5FO7B 4J27A 1RIUH 3BW9A 4OZ4B 1I7RA 3I3EA 2IADB 3EDFA 1DUZA 4BZ1H 1YEKH 4F8QA 3UTTD 4M61B 1RKRA 3DX9B 2EXTA 1XIWC 5HVHB 1IMHC 5D7LE 3JTSB 2EDFA 4F91B 3WN5C 4R4NC 5F88B 2GT9A 2AMGA 2CBTA 5I1KL 2N1KA 4YSRA 4NUGH 1D9KB 1C8QA 4ORZC 4QKTA 2K7QA 3RWHA 4PJGF 1KWKA 3H9SD 3CE1A 3ZDXB 4MMZB 4TQEH 1H3TA 1E5BA 1K6QH 2CO6B 3I02A 1NQBA 1VZIA 2DQTH 3Q1EA 2AXFB 4XVOA 1RZKC 4ZPVA 3I50L 2CNYA 2BZ7A 2A83B 3GJFK 2AQQA 5CJQL 1DUYA 4N28A 4E41E 1BAFL 4M5YL 2XLLA 3UO1L 3I2CL 3W0WD 3IMBA 3VH8A 5BOPA 3UACA 2R2CA 4KKLC 1K3ZA 3X12B 1DBKH 1S3KL 1FPTL 3AQDA 4PBDA 5D55A 1LXMA 1XSKA 4BXVA 1A7OL 4YSPA 3QI9B 4C4UA 2DICA 1X5GA 1A8JH 1M53A 4YSQA 4K15A 3OD3A 1MCPL 3MO1B 4OVUA 3WAKA 3QQ9C 4M9OA 4MNQA 5CCHE 5EWIH 2BSTB 1BGXL 2X2UA 4Q0XL 1TZHA 3NZHH 4PR5B 2L3BA 3ZUNC 2Y24A 3HS9A 2AI0H 5GGTA 4KRPB 4X50A 3KLSA 5ISZA 1H3VA 3DUHA 2H32B 2F08A 3FFCE 2JKRM 3QWQB 2WWKT 1UA7A 4P23D 2EIBA 1QWNA 3FL7A 1E4KA 3GMMA 1UG9A 3NFNA 4WNQB 4E41B 3ULVL 5D1XE 3L6FB 3PWPD 1I9EA 3D18B 3IDGB 2EUWA 3IWVA 3L1OL 4UQ3A 1H5BC 1CE1H 2F53A 4PTTB 5C8JA 4YFLI 2P26A 1I75A 3OZKA 3VFSB 3A4EA 2AQRA 1IGJB 1JPST 4R2GD 5JHMA 4YQXH 4BSJA 4J3OG 1S7UB 2FX8H 4O4YH 1E7UA 3FQTA 5EF0A 3EYSH 5DS8A 4TULL 5FO2A 3WFZA 4KC3B 4HWBH 3A24A 3VXQA 4JO3L 2ITEA 3GSXB 3U30C 5DS1A 5E2UL 1RP9A 2ENSA 1FFPA 4PW9A 3LVEA 5GRVL 4PJHA 4JFPA 3DV4A 4YZWA 3PAVA 5D1QC 3T3MF 4BFNA 1UZ6F 2KMWA 4UIKH 4GAGH 3KYMB 4JVUA 2X4PA 2YBRB 4EPSA 1S7SB 4BE5A 5DJAA 5JIPA 4X80H 2HKHH 4L8DB 3T71A 4WDIB 4X5WA 3FF7A 4KHTH 3VWKA 3UZVA 4IBZA 2WW8A 4QRTA 3MFFA 8FABA 4JJOA 1S5IH 3DOHA 2YWYA 5TDOB 3Q43A 5DZOA 4PGBA 3WY2A 4HUMB 2QPDB 4U6VL 2IXQB 4K3DL 3MLVL 5FGCE 4YHIA 3N41B 4W70A 3SCMD 1J9RA 4YFEA 4I87A 3FO2A 2WXGA 3RWCB 4XC3H 4LSQH 2XXGA 2HTKD 1YPZA 4RGNE 3WS3B 2MPVA 3SO5A 3UAJC 5KW9L 4R97C 1YYLH 1ZLSH 4Z8FH 5FWRA 3GMQA 4FQXB 4FG6C 3GMRA 1EBPA 1FNGB 3MODH 4LU5L 2MCPH 1U9KA 4AEEA 5IBLD 1RK0A 2ITCA 2VN3A 1U8NA 3FHQA 4WO0A 1JZHA 1EX0A 2Y6SC 3QDJD 5AYQA 3TV8A 5I6KA 4G8GD 3K81A 2UZYB 2OBGA 5AKSA 5F7EH 5HHOE 1W2KT 3FYIB 3WFBH 5IEKA 2DLIA 1A7PL 1IGMH 5CJ5A 2EADA 1DBJL 5L2KB 4NNPL 2CJSA 3FN0L 3CHQA 3ARYA 1GW6A 5I26A 2AQ3A 3HE7A 3V55A 2D4DA 3NVQA 2XWBA 2C3WA 3P2DA 4NO3A 4JJ5A 2PLTA 1TVHB 2HZHA 1K8IB 3LDBC 3BD3A 3AQZA 1P0SE 1ZSDB 3CXHK 4HIHA 5HGDA 4NC1C 1T1WB 1PZUB 2ICES 4NZJA 1KJ2B 4D0BA 2Q1EA 5TQ2H 3LHAA 3RAJH 3A4DA 3NJHA 1AXTH 3MNWA 1EXUB 5J06A 5D7SH 1EDQA 2V17H 1Z9OA 4JFDA 4LCWA 1PZCA 2VDRB 3QR1A 5T3ZH 1Z5HA 4YHML 1QD0A 3TZVA 2OW7A 3EH2A 2XA8L 3PAYA 1CLOH 5LNGA 1KLFA 1BAGA 3LN5A 4Y19E 2A9ML 2GQHA 3B7SA 4AYEC 1J5HA 1R3HB 3Q6FB 5AUMB 5HHMB 3DRTB 5IHBA 3BFOA 25C8L 5HY9B 4ZUSB 1WHOA 1ZLVH 5T3XH 3CVHB 3KG5A 3VB8A 3VGBA 4A6YL 4F5CA 3GKWH 4WV1A 1ASQA 3QR2A 4HS6A 1NBYB 2A74C 1N3NB 1E8YA 3BVXA 2K1MA 3QXTA 5IQNA 3T4YA 5DQDH 4IRJC 1IGIH 1P9MA 4CVXB 3IDIB 2N01B 4JY4A 3GNMH 5C0AD 1FO0H 4HBCL 4ZMYA 1XSIA 4GMSH 4HPOL 4I85A 1U8JA 4LCVA 2YOAA 2BSRA 4L37A 1OE2A 1YJDH 4QO1A 4IKKA 2BS9A 2CALA 3O45A 1Y6KR 2DQIH 3N42F 4FYSA 3ZQ9A 2HCZX 2HTKC 5ITFB 1VFAA 5LCVA 3ZZQA 5GGVY 1BSIA 1ZEAL 1XDTT 4CSZA 2ZYRA 4N2MA 3TBVA 1MJJA 5GISL 3AG3B 5GGSY 4YPGA 4OZIE 3NIDE 4AGQA 5C0BA 3PWNA 3DSNA 2ZUYA 4YHKL 5IJVA 4ACPA 1HKFA 3K46A 2OMTB 3RRQA 5KJRH 2ZXGA 4P05A 4AE1A 3WV0A 3QXVA 4OVVA 4ZJ9A 5DFWH 5GPRA 3VW3H 3RIFK 4XNQB 2XETA 3FO9B 4GIOA 3GXUB 3MRGB 3TIEB 4FX5A 4NSKB 1K85A 4FD0A 1PKQA 1MRCL 2AV7A 2R4SH 5LLIC 1Q1JH 3QEHB 4JLRB 3ZZ1A 1RZKH 3AAZB 3O8XD 4K5OA 5EO9A 3F7KA 3LKOB 1A14H 4UV4L 5GS0D 3B2VL 3IFLH 3GWJA 5DF0A 4HEMA 2DQHL 5D1XA 1NEUA 3DMMA 2B4CL 3ZGHA 4KBPA 4GEJA 5HGHA 4FOMA 4AITA 2XIBA 4EOWL 3OKLB 1JPGB 1XV8A 2RB8A 1FGVH 5D6DC 1ZCRA 1EAPB 3RB5A 2OMYA 2JKTM 5AOMA 3WJJA 1TSRA 1BMWA 4JPVH 2ADIA 3HLAB 1INQB 3NTCH 4FNLL 5DD5L 3PWNB 1QFWM 2DWEB 3PP4L 2DM7A 2J1XA 3VFTA 2G2RB 2Q8BH 3SJVE 1QFWL 1BEYL 5DZNA 3NJKA 3T3MB 3JZ7A 1A0QH 3ZO9A 3L4XA 4NNXA 3T6VA 1I31A 2LTQB 3INUH 1M3IA 1FNHA 1SLVA 4JO4L 5C0GA 2B16A 3P11L 5JQ6L 3TBWA 2R8SH 1MHCB 3VWKC 4A7VA 3P02A 2BY2A 1Z0NA 2V7HA 1IO4C 4YHKH 4YSEA 1JV2B 2N59A 3OMZA 3IJSA 4AI7A 1PNDA 1BJ1J 3MCLH 4JFED 4R0LA 2DMGA 5T5NF 5L4MA 4M3KB 3D08A 4LMQI 3MV7B 3ASOB 4ZMXA 3BXNA 3OSVA 2ZUQC 3VXPA 2BHFA 3GYRA 1MHCA 1KJVB 4JO5A 1QQDB 1RLBA 2R69L 1UADC 4QT5B 5ESAA 1S7RA 1R33A 2W91A 3V6OA 3L81A 1BMGA 2QEJA 2D3NA 4WAFA 1X7QA 3EKCA 4E36A 4P4KC 3F84A 4B3VA 2X7LB 2YPLE 5K1JA 3MNZB 2E7DA 5LHDA 5HHXH 5I71B 4AKOA 2WN3A 1TYRA 4JZJB 2FE0A 2Y3AA 4NQCA 4ADIA 2DWEA 1ND0A 3GBDA 4J2QA 4X7DC 2YAFA 5EG6C 3U79A 1QZNA 4OJYA 3VXRD 4LAQH 3AY4C 5B7MA 1PS3A 5C6TL 2XQYG 1T89C 3C8HA 4ATTA 4WO4B 5IQ9A 3GDBA 3ZL4L 1Z2KA 4EBQH 4W9FC 4ZMQA 3IJHB 2QSCH 5CZKA 2NW3A 2UUDH 3GB7B 5D2LB 4LPTA 1A02N 2HT2C 3LRSB 5KVGH 2WLZA 1ZK5A 4EO5A 4UM9A 2Q10A 3NA9L 2X4TB 1BA9A 4U3SA 1ECYA 2PO6B 1FH2A 1I1RA 3D4YA 4YHYC 2HKFH 1XD1A 1OOWA 3AWGA 2X89A 4X7TB 2GFBA 1GCYA 4FFYL 4QAMB 1JHKH 3QQ4A 1JVKA 2HVBA 3N04A 4JZOB 2VDML 4JO1H 4LCCC 2BVEA 2NR6C 3DPDA 1Y1DA 5A2LH 4ZAKA 2F54A 5KYYA 4JZJC 1U93B 3TYGH 1ILSA 5MHSE 1YG9A 5BXFA 1BDYA 3ARRA 5JIQA 1TJIL 5J5EA 1OP9A 2GYSA 1KN2L 2HJFB 5C7XH 1R3LA 3HJ0A 3ETBF 1GPOL 4E9XA 1OCRB 3W5NA 3GMNB 3HMWL 2E8ZA 3U4EB 1A7NH 1A3RL 1IQWL 1A9BA 3CDCA 4WGVB 4BCYA 5ADOH 4X99A 2H1PH 2IGFL 3R0NA 1CLZH 2NPLX 3PWLA 1OB1B 4HK3N 2PNDA 2LFGA 2WBKA 3MFFB 8FABB 4HH8A 1P53A 5I75B 3Q06A 2CO2A 3CN0A 4DGIH 1WV7T 5FW6A 4KX9A 1NGXA 4PLJD 5IJBC 1N0XH 1P84J 3FFCD 3B5TA 3KYMA 1HE7A 4G83A 2EEAA 3Q2LA 2OTWA 4PJHB 3MA7A 5F7MC 3ZE2F 1QAWA 1KTKE 4MNHA 5C0BE 3RAJL 5JDJA 4Y2LA 4ZUSA 1DQIA 3DJZA 4KTEL 4WWKB 4HA1A 4XBPB 4YHZH 3WKYA 2WPGA 3D52A 4X7EC 1N5YH 1ZVNA 2Z65C 2W07A 1YLBB 1SOSA 5E9DD 4JFFB 4A2EA 3WMSA 1Q9WA 2DEXX 3QHFL 1AJ7H 35C8L 4NKMA 2OMUA 2D8KA 4UQ3B 1CYXA 2CGRL 2JJSC 3ZHKA 4OIFA 4LHQB 2WC7A 3ML9A 2QADB 1U42A 1MEXL 3MNWB 4N0CD 3QO1A 1A7PH 1L9PA 1UENA 3NAAL 4FZEL 4OQ1A 4F7MB 1SY6L 1L0QA 4Z77A 4FNUA 1EO8H 2VUKA 3OAUH 3PIQA 3CFBB 3IDJB 32C2A 2KZKA 5ISZB 1ZSDA 3CU7A 3G3LA 3SGEI 4NZFA 4U2ZA 5I1AA 2EYSB 3LKQB 1F86A 4X7SH 4YDZA 2VLJE 3AACA 4G1EB 4HT1L 3CFMA 4XP4H 3DVNB 3S4SA 2XWBB 4F7PB 2BSTA 4AYDC 4GNKB 4MA1B 4TQHA 2LQRA 4F2FA 2MRYA 3IU4H 2GY7B 5I19L 1YEEL 1KYDA 1NBQA 1OSYA 4ODHH 4PG9A 5KVDH 2JKXA 4OZHE 2BC4B 1KDIA 5D6CB 1PSKL 4PB9H 5DFVD 1J5OL 3FU6A 5IKCB 4O02B 3LS4H 2IG2H 1UGNA 2EIMB 1J88A 1X5XA 1BZ9A 2Y1ZA 2QPUA 3PQYD 1OLLA 2UWEE 4L9LC 4BQ8A 4Q4IA 1I85A 1OQXA 5ANHA 2ERJC 3EYFA 2WQWA 2NXZC 3GMQB 4L2YA 1PZDA 2GAZB 2VAAA 3F58L 3PS6A 5BZWB 1QHPA 5KBPA 1DE4B 4QXGH 1FYHB 3JXAA 1JV5A 1FV1B 1G6RH 4NUJB 3LV3A 1OOAA 4YHPA 1GC1L 4OLWL 1TETL 2VLRB 4LEEA 2VH5L 2BSSA 3L54A 3U46B 3HPLB 5HDLA 1B3IA 1SOQA 1TJXA 1J0JA 1AKJB 4GMTH 1FFOB 1IGFH 4MMZC 4PLJC 5FYJL 2ZCLL 2MIZA 5DJ0B 3ZQWA 3TT3H 3KAAA 2XBDA 4TL4A 1K4CA 3LZLA 5DHDA 1JXKA 2BVYA 5HHNB 4KI1A 1T5WB 4KMTL 4WDIA 3QUZB 2H0JA 4ZT1A 2KC0A 3MV8B 2B3RA 1JTPA 2VE6B 3WEMA 5LQBH 1DUZB 3JV4B 2HVKA 4E5XB 3DV4B 3NSFA 4PRPA 5AOLA 4F7KA 4EI6B 1IAKA 2HG5B 2YPLD 2OZ4A 3WNMA 1RJCA 2ATPA 2EEBA 2ZX6A 3TYGL 1TTAA 4GSRA 5F93C 2W60B 1OP4A 1GRWA 2CBQA 4LB8A 1K5NB 1RMFH 4GS7B 5F9OH 3FHEA 1GH7A 3U30B 4KK8C 5DS8B 3X3FL 4PCKA 4LEOB 1QPXA 2V0AA 2ED7A 3UERA 3ML8A 5FYJD 4N0CC 4HQQH 2GTWB 1SY6A 4X8GA 4OCSL 3RPIA 4XAWH 3WNKA 4P2RE 2GUOA 4DP2X 5IG7A 1WEJL 2BDNH 2X70B 4JRXE 2D2OA 3HNSH 1A2YB 1OCWH 5AG9A 1I7UB 5LBSH 4KNTA 4XI5D 3C6LA 4IRZA 4ODSL 3BZFA 3FKUS 3Q7JA 2VZVA 2NT1A 3ZX1A 4R4FH 3ULSB 4K23H 1FRGH 5DRXB 1WH0A 3EJQA 2AK1L 3R8BB 3LPFA 3AS1A 4H8WH 1RL1A 3EJYC 5BUGA 1KTLA 5DZ9A 4XCFL 1LEKB 3ZTCC 1WAAF 1A66A 4PR5A 1WA0X 4QGYA 4KRLB 2CIKB 5D2NC 1ZSHA 1G0XA 4JFQB 4YZFF 1RZFH 1OGAE 4GP8B 3FQXB 3HE6D 3ELAT 1P6WA 2Q76A 4R96A 3EFOB 4LSPH 2G2PA 1GHFH 4PRNA 5IOPA 3UJTH 2VWEC 1W0WB 1U8PB 2ZCHH 1S2EA 3E8UH 3S36X 2VR6A 2ZKHH 4KVNH 3IFNL 2PO6C 2ARJA 3II3A 4FNSA 1NIEA 5D1ZI 5F9JA 3QFJB 2EEFA 1FN4A 5D7JA 3RZCA 1L7IH 3C6SB 5HVGB 4HFUH 2WXPA 3BEWA 3RUGB 1TQCC 5FX3A 1D5MA 2GJ6D 2K9FB 3ZTDC 1KGYE 4NX0A 2QTEA 4F8OA 1Z7JA 1O75A 4PD4J 1DSFL 3D30A 4RX4A 2WO2B 3KPSA 3MRLA 3KXFB 4YDMA 1CDJA 2B2XH 5C0CE 4KK5C 3TO4A 3FCSB 4F8TA 4HCRA 5K9JL 2YGQA 4S1RL 1REIA 2EILB 1CMOA 1A6UL 2VXSH 5C97A 5F7YC 4JRFA 1ZTMA 2F54E 3T0ED 2K45A 4XNAA 3B3IA 2NNXA 1QBAA 3S0PA 1T21A 3GSNA 1YNTA 1FZMA 2VMFA 2YMXH 3S96A 3VUAA 4PMFA 1DQLL 2QVIA 1KPRA 2MPAL 2IAMB 5BZZA 4FEMA 1QEXA 4A7GF 3N43F 4MDIA 4M5ZL 4KHXH 2DH2A 2FHBA 3LSOA 1MCDA 2NY4C 3ULUF 1UWGH 4NO0D 2WXJA 1BLIA 1LD9B 3BFQG 3HR6A 2E56A 4K23L 3NTCL 3MBEA 3ZL4H 5C07D 3RURA 3SKJL 1TR7A 4IDJL 3FRUB 1UURA 2FCBA 3G5VA 2UXFA 1TZAA 3G5XB 5DK3A 5D7KE 4BXSV 3KCPB 1ICTA 4S11A 2L04A 2GITB 2OMXB 1JGLH 2VLRD 1X3DA 5AOKA 1IUZA 4DK5A 2R83A 3X13B 4AGMA 1CF8L 3HC3H 5KBLA 1PD1A 4Z9KB 3MLYH 5C08D 2XFXB 4FFVD 3VYNA 3D69A 3TJEL 5HI5D 3OF6D 4X6EB 1D5ZA 5TTRA 1AANA 4DFHA 1Y6NR 5DYFA 3CH1A 3L3KA 3WE6A 1HKLL 5F8QC 5HHPA 4AQ1C 4RQQB 4LLUB 1AZZC 3U0TA 4DEPB 3C2AH 4GAYA 3G6JA 3MJ9L 4K5NA 5ACZB 2CJUH 3BX7C 3GMOB 5KZCB 3GBNL 4CRPA 5EIVA 1MRDL 4G7VL 3TIDB 4FI8A 1E4HA 4H1LH 2YLHA 1A1MB 2MHAA 1WA1X 2P43B 2BIIA 1ZMYA 1X5HA 3DDFA 5FECA 5JW3L 2FDBP 2OJZL 2WBJC 2YGVA 5JQIB 1F4HA 2WYIA 3I2CH 4CILA 1CE6B 1RHHA 3VMOA 4NQVB 2PO6D 4Y1AA 5DQ9B 3J8F7 1F2QA 4XE5B 5I73C 2QLYA 1DQTA 2WM0A 3O3BB 2P80A 4M7LT 1KLUB 4GIAA 2JVUA 4MA8L 3NQKA 3VXTA 4XMTA 2H26A 3H9SE 3EGXB 4ONHB 2GSIB 3GSQA 4PIRF 1MVYA 4PV1C 4QXGL 4C8XA 3V4VH 1KBKA 4HIQA 4FMFA 3HVNA 1T20A 1TG8A 2OI9C 5CWSB 4D3CH 5JIKA 4H0LC 2I9LA 1UACH 2WVVB 4BSWB 4WUKL 3FDWA 4JHAH 2Y07L 1ZJAA 2LT9A 3WBDA 3IFPB 1OP3K 4MFHA 3HC4H 5L6YH 5CEYA 1ODAA 2IC2A 3GGWA 1HNFA 4WFED 1T0MB 2VLJA 3H9HA 1K4DA 4HCGA 3FQ1A 4NBXB 1OAUH 4XOBA 4HS3A 2AJSL 1X9LA 2Q3XA 3QRBA 3VDBA 4OCWH 2NCEA 3IE9A 1HDMA 3OQ3B 5IESL 2XTJB 4UM8B 4AV5A 3D7PA 5JYLA 4ZTEA 3QUZD 3V4VA 5CM1A 5IVXB 1DP0A 3CZLA 4NCC2 2OSXA 1XTLA 3P9LA 3EAKA 2GJZB 3V4VB 1WTLA 4XP6L 2B9AA 1J0HA 2H2SD 3KE0A 4OQTL 4EN2A 1E2ZA 4AT6B 1UKSA 2ZPKH 5HI5C 1YEIL 4Z95L 1DBAH 1VPOL 3U0PA 1JYVA 1EFQA 3HI5L 4LPCA 2EO1A 1G7JB 5MENE 3OX8A 1HINL 3ETSA 3REVA 3GUTA 3TP4A 1YAZA 3RPKA 4JANB 4HIXH 2A73B 5F9DC 1AQ8A 4ELKB 4LEXH 5GJTL 5EA0L 4PG2C 2JI3A 5LUMA 1Z3RA 2CRYA 3CLEL 4RFOH 4E9SA 2WLJA 4TRPL 3C8DA 1E7VA 3KPRE 2O5YH 2XN9D 4M4RB 1AKJD 4PWEA 3V6ZB 3X1GA 3N1PC 4XZUB 3JV6A 1E4WL 2Z31B 4PJDA 1BX2A 2FEDD 2YK1H 1HSAA 4XVJH 1I1CA 1X4ZA 2XI9A 4MA1C 4HWZB 4L4VD 4XVSH 4LRNH 5DQDL 2ISDA 4DIXA 1B0RA 2C9PA 1U33A 2WXFA 5HYIA 1YC7A 3D8MA 4M7JL 5D1ZC 4WEMB 5KW9H 2BOBA 2Z35B 3VFWB 3RILA 3NT0A 3UDWA 2UXVA 3OGOE 4AMKH 3U7YL 1XH3B 3X14A 4HG4K 3O3BA 1LNUB 4BFJA 1IFHL 3RP1A 3EBHA 1GC1H 4OLWH 4OJEH 1U8QA 3QXUA 5DJ6A 1UHVA 1ZLDA 2BRQA 4JY5H 3APCA 1Q90A 4LMQE 4X0NA 4KHTL 3PHAA 5KG9A 1I9IH 3TV3H 2MHAB 4HWZA 2AXHA 4JG5A 3S88L 1XGYH 3S3SA 5ILTH 4NQEB 1UASA 2C8NA 4PS4L 4JRWA 3BPOC 1HHHA 4ZMNA 2EINB 2I32A 1EH9A 2JI1A 4Y5VA 3AM8A 3VM7A 1MFBL 4GAYB 2ATKA 3QDJB 3UTTA 5CEZE 5T3ZD 1RUKH 1ZJBA 1GIGH 1J5OH 1RJLB 3BQUA 5J6HB 3ATFA 4FG0A 4R90L 4RZCA 3KYNB 5JORA 4G5ZL 1A4AA 4JM0A 3WLWC 2H0EA 3D69B 1J5CA 3RGVD 4FTVA 5DTFA 5KVGL 4D9RE 3VGEA 3QUZC 1VCBC 4U6XA 3KDMA 4OZIB 4BK5A 1MFAH 4D0DA 1VLXA 2VWEE 4MNGB 1CLOL 3WD5H 1AAJA 1RULL 3CC1A 3K71A 1C16A 5EORH 5IB4A 2GK0B 2XTLA 3UG5A 5C2BH 2AEPH 2B3IA 1Q0YL 2GSMB 3KHQA 1JYWA 1B0WA 4BQBA 1Z0MA 1FVEA 3HNVL 2CHXA 1R3JB 1E90A 5D7IA 2I85A 4PJXE 3KWUA 4DFIA 1UOWA 5B1KA 3RBSA 3LN9A 5I1GL 1YSOA 1JGDB 5FOJA 1IEBA 3VXNB 4MJID 5HJ3B 2BVQB 5JHDD 2MTAA 1HDMB 3EOAB 4HKBA 1GOHA 4QCIB 3RX7A 2EVHA 1FJ1A 3W1ZA 2FHFA 5DMYA 3KL0A 5HJGA 3UADA 4U6VH 4H1LA 5FLUA 4L8SA 1I8LA 3F5WB 2AQTA 2NY6D 3QWRA 5AWNH 4L0YA 1SXBA 4NRXB 2VLJB 2F8OA 4HIJA 3BAIA 1L7IL 4FADA 4FGMA 5F7EL 3GF8A 2CKNA 2PN5A 1QW8A 1F3DH 4Q89A 4MSWB 3FULA 1UWGL 3PQYB 4ZTOL 2PYEA 4F33A 2GJRA 1DJGA 3IGAB 4N0FB 2ZCHL 4Y2DB 1EFXD 4LU5H 3B34A 2FQEA 4ZSOA 2E74C 5GIRA 5A2IH 2NRDA 1JZ2A 5IB1B 1A6VH 4O02H 3BUIA 3AT8A 5DUMH 2GSIA 4TPRL 1I9RL 3EG9B 1EVTC 1YEHH 5IB3A 4PLNC 3TWYA 2WLHA 3PJLA 3V5KA 1V27A 3VSTA 4W9IC 5BJTB 4Y1AB 3ZJAA 3ZTJH 5E9DA 4X83A 3QZLA 2P7TB 1Z5LA 2Y7QB 3DX7A 4I3RL 2X87A 5BOZG 2G3XA 1KFGA 1HXMB 3C8KB 5FYKH 3MSPA 1JNHA 3K8MA 4P4KB 5FUCE 1OAKH 1NSNH 2YWZA 4O2CA 1HK6A 1OSZB 1UT1A 3GZKA 3OXRB 1Q0XH 4J1UA 3WLWD 1HOEA 4OIIL 5SWSD 3TL5A 1JZ3A 1J8RA 1J7VR 4LSPL 5GHWH 1ZGLP 4AC4A 1KIRB 1N67A 4PS4H 3AADB 4UDUA 2F5BL 3RPIB 3DIFA 4ZD3H 2DQJH 1JP5A 4ZFOL 5HYSG 2AXGB 2KI6A 3D0LB 3EOBA 4UM9D 1G7LA 2DV6A 1V7NL 5KN5B 3X13A 2VMDA 1UWXH 4HSAC 4FQJH 2NUPA 1NIFA 5LNDA 4LVNB 1XT5A 4X6CA 3G04B 3NCMA 3AUVA 5T1DH 5MEND 1WRFA 1BFOB 2DKSA 4U05A 5C0CD 3L45A 3SDXB 3FN9A 1PX8A 2O5XL 3P0GB 3V0AC 5I1CH 4IBUA 3DGGB 5L88L 6PCYA 2F54D 4Z7OF 3LNHA 5E23A 5FGRA 4BWUA 1MJ7L 1TTCA 3VDAA 3LX9A 2FJGB 3VNYA 5A2FA 3TEWA 2GHZA 3CFQA 1YQVL 4WHDA 3FB8B 3ARBB 4J3OF 4KDVA 1W8EA 2R15A 1E2WA 4PVLA 1MSPA 3OKEB 1H5BA 2DLTA 3THML 3BAWA 4XP9H 1DVFA 5A16A 3NJIA 1D5BB 1N5AB 1GVIA 1FV1A 1F56A 4OLXL 2BX5A 4XTRC 4MQXC 3TO4B 5ECJE 1B90A 3KJ4C 4BH7A 2GAZA 2VAAB 3KNBB 2GJ6B 3RL2A 5JHDB 4N85A 1GY1A 1A6ZA 2VSKB 3TA4D 3NJMA 5FCUL 2I7OA 5T1DL 4A7TA 5AZEL 3O0LA 2JLPA 5JR1H 4BJLA 1KB5H 4N0YH 1M7DA 5MEPB 1L0XA 5HGAB 4J12A 3OR6B 1OALA 3QEGL 3FTUA 3CGTA 4OZHF 3GLAA 4G43B 3PWVB 4TSAL 4ODVH 5DHYA 3ZT6A 1U3JA 4OCWL 5EBMB 4FCAA 3PP4H 4Y4KD 1JVOA 3H3BC 2P9RA 3L2LA 2PKDA 1X6NA 4QXUL 4F15C 5CD3B 1HCYA 2WXKA 2Y4SA 3S37X 2D7PA 3J7HA 4JPSA 5L4JA 1QABA 3K5SA 1EUTA 3RGVA 3ABLB 1SOXA 1XO8A 2AQSA 1J1OH 1YNKH 1VKXA 1B2WH 4L5FL 2PPEA 3AZUA 5GS0L 3AG1B 3BQUD 4A2GA 1GC1C 4KZDL 2VITA 1U8IA 5G2NA 1RAMA 4XO9A 3F7QA 4XPHL 2OZ4L 1C08B 1TEFA 2AJXL 2ESVA 1XGUA 3BT2H 3EGDB 3EOTH 2YQ3A 3X1BA 5C0CA 5IB5A 5IVOA 5D2LE 2JJTC 5EU4B 1MI5A 2IPKA 2DEYX 1MKFA 4FQJL 1PEWA 1WA2X 5KBKA 1RVFH 1IAOA 1SJEB 1V3KA 5DC2A 2AMUA 4BCXA 1DQJB 4OB5H 4X9IA 4GT7A 1ZHLB 3WY4A 4QHLB 4I3SH 3UGUA 2VIRB 3EDKA 3OXSB 3VO0A 1YEHL 3KLAB 5DZVA 4WKZB 3BKJH 2CK2A 3NIGE 2AEIT 4EI5A 1G9MH 4CVWA 4GW5A 1IEAA 2WIIB 5B4MD 4X4XB 1X5FA 4TUOA 3O6ML 5DWUH 1I8MB 4U1IB 1Z6JT 1A4JA 3BDXA 3BP5A 3HS0B 4G6FB 1X4YA 4MXVE 2PP8A 2L7EA 3VE0A 1SJXA 5I1JL 4XCYB 5EOCH 4EUPG 2EXWD 2VZSA 1F8TL 3THMH 3O4LB 1I1FA 1TZOA 4D9QD 4TF4A 3WNIA 3NCWA 1BP3B 2MSPA 3O6FA 4GBXA 4NCDA 2J55A 4U6YA 4OJFH 1YQVH 4ZX6A 2GPZA 2VXTH 1FO0L 3BVWA 3O2WL 4Q4EA 1FDLH 1IM3A 4U1MB 1SZNA 4AYFB 4BUGA 2OMWB 2CJ3A 1JPTL 5INDA 3BSZL 3DECA 5E4AA 2O5XH 3NIDB 3FO1A 4LP5A 3QIBD 4WUUA 3SBPA 1KCBA 5D7IE 5DC9B 4FERA 1UT9A 5FC9A 4Y4KC 4J6RH 2VDRH 4LSUL 3WFHA 2PCPB 4KI5E 3H0TA 5CINH 3H54A 1JXGA 1PJWA 3EFFA 4Z7VF 1HESA 3WL9B 4ZDHB 5C7XL 2PO6A 4WW2B 2BIQA 1EANA 4U3SB 3QXDB 4Y88A 2NXYD 3VGHA 3GFUA 4PG9B 4M00A 4WGWB 4OD1H 5A6MA 2AEWA 3L2MA 2IMMA 1OHQA 2OSWA 3BSZH 2XRAL 3GIVB 3GBLA 4Q9CA 1SHSA 4B50A 1KFAH 5KVMC 2VDQL 3CMOL 3MAWA 3F6JA 3V7AE 2GK2A 2VXSL 4LSTL 2ZONA 1XBRA 3GI8L 2PCPA 3AVEA 4OJFL 4QOKE 4XODA 3FTVA 1MLCB 4R26H 3M1OA 3PWJB 1TQVA 3HE7D 4HLZH 3UFIA 43CAA 3LEXB 3KDPB 4G8GE 5GZOA 5AD0B 5AB9A 2VQTA 1IRAY 3O3EA 1F8TH 1NH6A 1UATA 4H0IA 4JY5L 2W9EL 2CDGA 4KH9A 5DC4B 3WFBL 5I0ZA 2NY2C 2WMPA 3U7WL 4EQ2A 3L08A 5K9KA 1MLBA 2WUBH 5E2JA 2GBAA 3GZOA 1MW1A 3C60A 2VR9A 5JMOC 3I9PA 3BAXA 4QRPD 5G4MA 1EHNA 1QLRB 3AS0A 4F2MA 1KSRA 4KRMB 2ZYHA 3MODL 2BW5A 3OB8A 2PXYC 5FDWB 4HIEB 3RKDC 1BOGA 4KKAC 2ZXDA 5E4EC 1YMMA 3F6IA 5F7LB 5HHXL 2BVTA 3PGDA 3C12A 1G7HA 2H6PA 2VOTA 3NCJH 3IJSB 3P9MA 2DIBA 1WBXB 1CD8A 1T7WA 1U91A 4NO0A 4AL8L 2F7OA 3FONB 1JV2A 4P5TB 6FABH 4L23A 1NGXB 1DANU 5IF0B 3PGFH 3VXRE 3MROA 5FDYA 1C5BH 1YMME 3V52L 4MRCA 2Y0SA 4D9RD 5DD0L 2YEZA 2VMCA 3A0OA 1ORSB 2V33A 1HSBB 4AIZA 5I1LB 3JWNG 3ESMA 4TUOB 3RTQB 3PWLB 1FGNL 3VRLE 4LLMB 1KPVB 2C4FT 3FTGB 1WDAA 1JZ8A 4UT6L 2ALAA 4WKZA 4QY8A 2DS4A 5SX5H 3ILQC 5F2FA 2ZAIA 5JA9A 2IWFA 2E9IA 2XICA 1IGYB 1RIUL 2EDTA 4FQLL 1KJ3H 3DURA 1QSFE 1IJ9A 3MLRH 2FHCA 1FL5B 1XXDC 3KPQB 2R23A 4EDXB 2YKKA 1HC1A 2AGJL 4BYHA 1DVFC 3OMAB 2HX9A 4OF3A 3NCBB 1VDGA 3AREA 4LQ1A 1G43A 1E50A 3A21A 4H8PA 1QVOB 3UIYA 4P5MB 3N9GL 4XWOC 3EGDA 5C0CB 2DRUA 2EKSA 3F01A 1T7YA 4X7TA 3IU3B 2E86A 4PS8A 3HUJA 1DVTA 5C3TA 1XGTA 1LO0H 4QXWA 3DWTA 3QRFM 3MXWL 1BQLH 1ZLUK 2FT8A 2BM3A 4NJ9L 2VR8A 4ZPTB 1PQZA 4NBYB 4AGOA 3MJ8B 3MREA 3WHXA 2ZSVB 1A6TA 2BRRH 4WWKC 1MG2C 1JGVH 1CZ8L 3AXHA 3CHPA 1TKWB 5D1ZA 1Y18A 4JFFD 4GRLC 2JB6B 4OJCA 3MRGA 3NIFF 3TIEA 4PAZA 2J6EL 1XB8A 4G43A 5CU9A 3MLUH 3QORD 4GG8B 4AQ8C 4N9GA 3PXLA 3MJGX 5HPMB 5IEHA 1M7DB 4ZUTA 3C9NA 1C5CL 3LQMA 4YDJB 5E2VH 2XX1A 4BH8B 3OKYA 3CVHH 3NSJA 3RDTC 3W11D 3F85A 4JFYB 4FNQA 4Y7OC 4AIEA 5KBMA 4OW6A 3RQ3A 4KO9A 3TESA 4LSSL 4PWIA 3BKCL 1QNZH 1YY9D 5E24E 2X7LA 2PXYD 3MPCA 1P7HL 2R2HA 5D2LF 1FFNB 5ITFA 3V0HA 1T0PB 2VXVL 1FVCA 4WU7B 1E0OB 3MU3A 2J6EH 1JUFA 2WZ6A 1B4LA 2H1XA 3B4NA 1KJVA 4JKKA 2H4EA 3P73A 2QHLA 4RGNB 3U9PL 4HOXA 3P77A 1FZOA 1MFEL 1U8JB 4K55A 1IAMA 3ZDXF 2XZCL 4NQSA 1H5BB 4PJGB 3GC3A 3RIFF 2RH0A 4NDMB 2UYLB 4UU9A 2GI7A 3MXWH 4WRLA 1A3RH 2Y5EA 2VM3A 1NFAA 2G3MA 3V79C 3LIZL 4PJGA 4NQDB 4OSUH 3SZKC 5M94B 1TJIH 4N8UA 3U48A 4M1DH 3ILQD 1L7TL 3LKNA 3N85L 4IYKA 2HT2D 3IETB 4MD5B 4UT9A 2WJ5A 1JUFB 2XG5A 3BPLC 3DGGA 1ADQH 2ERJB 3LNGA 2ZXCA 2FJUB 3W5MA 1KLFB 3C6LD 1F1GA 1CGXA 3IMVA 3CNKA 1NZRA 4NPYB 1DVFD 4LARL 5IMKA 2ARWA 2IPUK 4S1SL 3QDGD 1CZ8H 4CL7A 1Q72L 3V95A 1PSKH 4PB9L 1SXZA 3ZBMA 3UYOD 4N2EA 4YDIL 2Y1VA 3QUXD 4YDJA 4BH8A 4D0BB 5ICYA 4NKDA 2Q5BA 2BVOA 2LAGB 3RFZB 1EQWA 3HW7A 1F1AA 1Y18B 1MRDH 3UO8B 3WTVA 5TQ0H 5D1ZB 4CAGA 1UB6B 5CJ8A 5D1XB 2WYTA 2IFFL 2QADD 4X6FB 2W0FA 3QT2A 4QHNB 4FKEA 1T66C 3VA2C 1RZJL 3CG8A 5G5DA 3ZYOA 4QOKD 2X4SB 1BZEA 4TKWA 1OV8A 5EO9B 3U36A 1ETJA 4A68A 3MCKA 3VXUE 1JVLA 2Z64C 1T0NB 1UM5H 2XZQH 3CFCH 4M3HA 4EIBA 7CGTA 5K9QG 4EI0A 1DO5A 1IBFA 4N3TA 2AQNA 5H4ZA 2G0KA 3GLDA 4XVTL 4K3EH 2ESVD 2MJWA 4OGXL 4GQRA 3BISA 5KSVB 1BYPA 1CDCA 3BSZA 1K2DB 1KZQA 4H26A 4DTGH 2R51A 4IOIA 2O72A 4W9DC 2B2XL 2X2IA 2Y25A 3GK8L 5CBEB 4IIQA 3APFA 4PJ7B 4DVBB 1DL7H 6CGTA 4TVUA 1D5IH 2HRLA 2HMIC 4PJ9C 3W0WE 4ZG1A 1JNJA 1N4XH 4JRYA 5DURB 5A2AA 3WS3A 1YPZB 1SN5A 4WSKA 2VDOH 4ADJA 5FHBH 1E43A 2EO7A 2Q20A 2X4SA 4L2LA 3U36B 3PDOB 5DJDB 3WUWG 4ODBD 4Y4HC 2Q7YA 3T9WA 1EBAA 2FSDA 3KYOB 4PRPD 4QHNA 1EEYA 4YBLB 1OARH 1HSBA 4R7XA 2X5PA 4DP8X 1A6VL 2B14A 3V6OE 4XO5A 2EABA 4IK7A 1SLWA 1T4WA 3M1BA 3N3EA 4L4JA 5FYJE 3VWKB 3ZVVA 1GYUA 3MROB 5IF0A 1OGAB 5GZND 1B4RA 3MRHA 2D0FA 2X6MA 1ZA6B 3L5WB 3B9KB 4NZTH 2CUMA 1TJGL 3FB7A 2FATL 3PP3H 1J1PL 1CXIA 2CRIA 5T3XD 5DD3H 3BGMA 3X2QB 3TN0A 4P2OC 1IAIH 5GS1B 2DKUA 3BAEH 3KW8A 3V5DA 4HOZA 2IOIA 4YSCA 3ZR5A 1IEBB 2CCWA 2QQLH 2ZP8A 1OCOB 4M8UA 4YDLC 3AABA 5C86A 1D5XB 4DHLA 1OF2B 2WMPB 2WBXA 2J88L 1CGSL 4PTTA 4KKCD 4CN6A 1F11A 5IB4B 5AD0A 3HE6A 1JRHI 3NFNB 2XN0A 5E6SB 1DVQA 1A9EB 3LD8C 2A9NL 4GW1A 1KULA 1XGYL 1XGRA 4I0PC 2Q0ZX 1D6VH 4OTXL 1FVDB 1SF3A 5CJBA 1D2PA 4XMVA 2RGSA 3KBHE 4BE6A 4CGTA 5IFJB 5AOIA 5J13C 3HRZB 5J6HA 5IROA 5JLZB 1DCEA 5AW4B 4JB9H 4NO3B 4O2FA 5I1HL 2WINB 4WF7A 1JK8A 1USZA 2VR4A 3SDYH 4HJJH 5AW0B 5CZRA 4B9PA 1AR2A 1PDKB 4LL4A 5KSBB 2H9GA 5DWUL 3WN5A 2J12B 5I17B 2VABB 4HKZB 1QBBA 3E6FA 5JXAH 3FQWA 3HAEA 1T22B 1RIHH 2QMKA 2CUHA 3QUMH 2MTPA 3GO1H 5DMKB 4NAJA 1UYWL 2FO8A 3AWFA 4PB0L 4P04A 1JG9A 3SGJA 1LEIA 1WZMA 4NZUL 3BP6A 2A83A 2ZKWA 2ZXWB 1WJ3A 4LE8A 4Y4HD 1GR7A 1EHXA 3LAFA 4GMSL 1IVLA 3VGFA 5DVMA 3GK8H 1MY5A 4N20A 3FFDA 4KMTH 1DBBL 1AGDB 5F89B 3U6RB 3TGXA 1I1FB 3T0BA 5DD1H 4KZEH 1QSEA 4M4RA 4YHOL 2R0WL 3HAEH 3HHSB 5I75C 1A9VA 5CBAB 4K3GA 3PQYE 4N2FA 4JO4H 1CICB 1JD9A 1EGJL 1UQSB 1S7SA 4YIQA 3BKYH 5DMJB 4QHKI 4NQED 4Q6IB 1HHKA 5IFHH 2EE9A 3L8QA 4X42A 4OD3L 3QVAA 2WOBA 4ODVL 5CJOL 1PL3A 4ZUUA 4WWOA 3DURB 4WWNA 5IFHL 3FFOA 4O2EA 3EJYD 2ZICA 2DD8L 2CIIA 3CVHL 4F7CA 4M93B 4ODTL 1G6RB 1ZV2A 3BP4A 2R1WA 3U83A 3O4LE 3FTGA 3WOVA 3G08B 2FAUA 2F8XC 2X44D 3QI9C 3P9LB 2FH8A 3WNLA 3SQOH 2KLRA 1LILA 2C7UB 2E76C 4IBTA 3QJFB 1DYZA 3MJ6A 3MUGB 5DC0A 4GW4B 5C8JB 2BRRL 4JDZA 2B08A 4Z7UE 4PP2B 3BMVA 3BD5A 4X4KA 3UDWC 5BNXD 2CWRA 4HVBA 5KVFH 1TYEB 2A6IB 2VJXA 4FTVD 5I8EB 4M8QB 5I15H 2DYPB 3GBML 3D06A 5J12B 3KLHC 1YMMB 4J3OC 3NACH 4A37A 2F2HA 4ELME 2A0LC 2UWEA 1Q1JL 5EC1B 2WQVA 3PLYA 5L8JB 4KXCA 1BFVL 4UB0H 3OLDA 1KIPB 5EUOA 5BS0B 4F7TA 1S7TA 4B5ZA 3FOLB 1P4LA 3N1GC 5FOBB 1I3VA 5CD3A 1NUGA 1MJ7H 4LVOB 1BHGA 3CHOA 3DX4A 15C8L 3IT8D 4KXZI 4PY7B 4XHJD 2EE3A 3DXAD 1BZOA 2XN2A 5HGBB 2I24N 4UTAH 5BMFL 3O3EB 2QHRH 1HIMH 4GI9A 4PJEF 3CCHB 2V2TA 2XWRA 1CLZL 4PRAA 4OZGE 5DI8B 5E6RB 1AJ7L 35C8H 3VXRA 5HGAA 2WO3B 1OAYH 1LO3H 4TUUA 3V9EA 43CAB 1MZZA 3F6LA 4ZW5A 1GZHA 4FQQB 3QJZA 4MYPA 2BP0A 1A7NL 1IQWH 4ONHA 3ESOA 2VYRE 4IIZA 4QMEA 3VXTB 5F1IB 3RL2B 3BAYA 5EBWA 1AQHA 1B4TA 1INEL 3ZYIA 1SBSL 3ARGB 1T80A 3C2AL 5D1QB 5K9KB 5DQ9A 2AJ3A 3QEQB 4CUCA 1GYCA 2HKHL 3T1FA 3I02B 1D5BA 1V3LA 2I69A 1UH2A 1CJYA 3WTTA 4IU3B 1OGAD 5PCYA 1ERNA 5IMOB 3BIBX 3F7VB 1JHKL 1MH5A 3B9DA 4KO6A 3ZUCA 4K9EL 4WFHD 1JGVL 1HXYA 1AFVH 2VLLB 2DQUL 4MXQD 4BFOA 3G6JB 5CGYD 1G7MB 3REWA 4LOEA 2WXRA 3D9AH 4EKJA 3OJDB 2AEPL 1DZBA 3DX9A 2A9MH 3TASA 1L6PA 2FT6A 2KZBA 2YXWA 4R8WH 4LCUA 4XH2A 2WVUA 2CM6A 1TVDA 5I30H 3PGCB 4QXVA 4KV5E 4AX3A 4U1MA 1KGUA 4YXLL 5SWSB 2L4OA 4JM2A 3SN6N 2CDEA 4J5VA 4R83A 3L5XL 4HJ1A 4PJ8A 2WVSA 3EJSA 3GI8H 5SWZE 4JO1L 1XF2B 1B4JL 2O6DA 3FUHA 3WN6A 2EIZB 3KWXA 4OFYA 1MF2H 2VDQH 3NP4A 3WKML 1E9PA 3OBAA 4L29A 1HNGA 1FE8H 3ATBA 3GIZH 3MBEB 2R29H 5EC2B 4ZS7L 5IUCA 2IANB 1SF5A 1VA9A 1WGVA 3LQAH 3EXLA 1E3ZA 4OY9A 4HMDA 4AM0B 2ZKYA 4YDLB 3MRKA 3RVWD 5GGQH 3BLKA 5CZVL 1S7QB 4PYGA 1P7QB 3Q9PA 5LXVA 4IRZL 3RWJB 4J1UB 4GW5B 2QLVB 2GTZA 2X0UA 3BKML 4LEBA 5FA4B 2DMCA 1T21B 4EUPB 4E0RB 2PW1B 4QIRA 4KUCD 2PR4L 5DRWA 2F9BT 4LIQH 4ZUWA 5ELIA 3QEQA 3ARBD 1G7IB 4DVRH 1SEQL 2YO3A 1OARL 3CN4A 2OTUB 1BZ7B 1U92B 5BRZD 4M7ZB 1CD1B 2WZ0A 1XQ4A 3NIFB 3BQVA 2YAQA 3FT3A 1XD0A 3BYTA 2XTJC 2YMOA 4PJIE 2E4FA 3TFKD 1QFWH 4HHWA 3BRDA 1RJZA 3K1KC 3H56A 3MUUA 5GJTH 2WZPD 1AP2B 3TEZA 1HEJC 3QHTC 3SGDI 2FX7L 1S5IL 4Q58C 3LEVL 4Z7UA 5C0DA 1NFKA 5L7XH 4XR8C 4DO6A 4RFNC 5HI4D 1DZ0A 4YAQB 5BS0D 3IKCB 4RBPH 1NGZA 4K2UL 2H2SC 3TX4A 2B1HL 4LAJH 1LK3L 3JWDH 3KYKH 1F6AB 1OTUD 4HIJB 3DHUA 2X1QA 2FR4B 2A38A 1HHIA 3HG5A 2P8LA 3G5ZB 4WHTA 3OR6A 3RYMA 2JTYA 3BZFB 3CTTA 4QR7A 3ZO0A 1SYVA 3QEUA 4HAGA 4YK4C 3FQ4A 1JTOA 4YOKA 1A0QL 4KGLA 5T1LA 4ONFL 4PP1C 4DEUA 1MFNA 4YN3A 3T3PB 2FJHA 5EF3A 3VJ6B 1PAMA 1N6QH 1DVSA 5C70A 2Y36H 5CMAB 5JPNA 2DLFH 1R3KA 5L9DH 5EEVA 1FORL 3KJ6H 2G5UA 1DN0B 3VFUB 4JCLA 3K4ZA 1RUAL 5K59F 5DFTA 2X1XR 2XA3A 2AF2A 5KYUB 2AJXH 2GK0A 3EOTL 4PCSA 2B5IC 4R7DB 3I9IA 2Y7MA 2VXUH 5D1ZD 3II2A 1LE5A 3DMMD 1AO7E 2P8MA 1OL0A 5DO2D 4KMLB 1ET8A 3RVWC 1NC2D 3WSQL 4EI6A 4U6XB 2OCCB 1A1NB 1SVBA 2X3CA 3FAWA 3ZTNH 2JFCA 2UX6A 2CCLA 3HEIB 1TIUA 5LN4A 4QRRE 4Y1SA 3FN3A 3QUZA 2C1PA 2X0VA 3FT0A 2V7NA 1K4CB 2WTOA 5AVSB 4TSAH 3TO2A 1NMCB 2IFGA 3UYPA 3L3GB 4FULA 1FFOA 1AHWB 2P5WB 1DDTA 2IBZX 2YD0A 1OLZA 4PBVC 2J8OA 4ZFZA 5DRZA 1D6EB 4B7IA 4Z76B 4OFIA 5FCUH 2BSSB 3HJEA 4P3WA 2FGWL 4G6FD 3WEBA 1ZY9A 2NUPB 1EEZB 3CVBA 2E5EA 5MENB 1KY6A 1GGBL 2P8PB 3MHZA 5KN5A 4LVNC 5LGJB 4XPAL 4M5YH 3G9VA 5L2JB 3KM2A 4HKJB 1NGPH 4NJ9H 3KBEA 4ABQA 3K8KA 1IAII 1OGTA 2IAAC 5E9DE 2YA0A 2ADYA 1KCSH 4CU8A 3UAFA 3ULVE 2JIXD 2XG4B 1CC3A 2WHVA 5BO1L 3RE0A 4Z18A 4KQ4H 4UV4H 3RWDA 2ADGA 5MHSD 5D71H 3PF2A 5IBUB 2Z35A 1RUQH 2BOBB 2BNUB 2RQ8A 1NCBL 1G87A 4PJ7F 5F70A 3SE8H 3HG3A 1RVFL 2QKIA 4RFOL 2G5BB 1NGYA 1MQKL 2EVIA 3CSPA 3H42H 4HKZA 1B0RB 5I15L 4R7NB 1SGKA 4K4KA 4L4TE 5CSBA 2OJ1A 3D0VA 1JNHB 3NK3A 1ED3B 2Y5QA 3QJUB 1TT6A 2UZPA 3DRQA 3TCLA 3MXVH 5TF0A 1KCLA 5J8OA 1CU4L 4D7BA 3B6SA 4UDTA 4G1EA 3MXVL 1GJWA 2P24B 5JLZA 1JYXA 2J43A 2K78A 5BRZB 4LHUA 3ARSA 3FT4B 5L8KB 2DIEA 5J1SC 4Z7OB 2EC9T 1VENA 3EG9A 2WXOA 3SY0B 1VCAA 5DK0A 1UZ8B 4GW1B 1QNIA 1MJUH 1UM4H 5EOTB 1WAEA 1DLHB 4N2NA 5D6DA 4UYQA 2BO0A 2NTFB 5C0FB 2BP8B 3STZB 2ZP0T 3OAUL 1CQYA 1GAFL 2CPUA 3OJVC 4C57C 1NICA 3M7OA 3BFWA 2CLVA 2F53E 2EDNA 4U33A 3PHOB 1FFRA 2IDCA 4HGWA 5IVXA 5E08H 3ZQXA 5T3ZE 4RDQG 3CSYB 4URKA 3FB5A 3TN0B 5GS1A 1YUHB 3KZ8A 1IQDA 4RESB 3US1A 2KPNA 5CP3H 5GRJL 2VZTA 3C5SA 3OHXC 4X6CF 3TU6A 4BQ9A 1J5DA 4L8SB 1KJ2H 1M6UA 4XCEA 1H15B 2F58H 2VR7A 4ZFGH 1XGPA 4PJ8C 2CRZA 5FXCH 1A7BA 4LL1A 4IRSD 1N5YL 4HKBB 1BG1A 2DQDH 2EAEA 2ZSWA 3HI6H 3KPNA 3SE3C 2XVKA 2BVQA 3QUYB 3MRCB 5ES4B 3G6JF 2QR0A 1V3JA 4U1GB 3HNTL 4LOUC 3IRPX 3PHOA 3L95B 4JQXC 2D9CA 4G8EB 4LK4A 2FECI 1DQDH 1BIIB 1PX4A 3M8OL 3MRNB 4LL9A 5LBVA 1NCGA 3FF8A 4LLDA 1GYWA 4Y16A 2V2XA 1I9RH 1A9BB 2OMBA 1DCLA 3UIZA 1WE5A 1F6FB 2HUHA 1F4YL 2IDQA 1T20B 1K5WA 2XZAH 3LKSB 2E9JA 1WUZA 4M29A 4GKNA 4HWBA 1I7ZA 5J57B 3IF1A 3STBA 5J11B 2JH2A 2X1WL 1VF5C 1Q0EA 2IVFC 4RGOL 4KTDH 1QKZH 5IBTH 3D85D 4BA0A 5AW9B 1M2OA 1T1XA 4JO8A 2XN1A 3DI3B 1BM3L 4YDVA 1P5VB 4HXAH 4KJPD 3OVUB 4UNIA 5I28A 3SOBH 1EDYA 2ZNXA 2RIKA 3L3JB 3OC5A 1PVHA 3EBGA 4HF5L 2AW2A 4RSVA 2B8OT 1UJ3A 5EU7E 3SE4C 1A1OB 4R7NA 3MOQA 3UTQA 1BBDH 5EU6E 3LEYL 1S9KC 2F6AA 1JPTH 2VDMH 4UIKL 4Z23A 2AABL 4C83B 4WFGD 4YR6B 3LRSA 2CA3A 5F71A 3ES6B 2YQGA 5GRUL 4JFVA 2FNBA 1KIQB 3RWDB 4NRYA 4KROD 3K6FA 1Q0XL 2GUYA 1ROCA 4WO4A 4BSVA 4UF7C 4PRHB 1M7UA 2YUXA 4AOFA 9CGTA 3NSYA 2C3HA 2YIHA 5ICYB 4G8FA 5FM8A 3LDBB 1J48A 4ALAL 3VFWA 2YPKB 1A5FL 4OSUL 5A7EA 4I18A 1NM4A 1ND0B 3FTXA 5FO9B 3QPXL 4I2XA 3B1TA 3QIUC 1LK2A 3TNMB 1TJGH 3IFNH 4MCZB 2VO8A 2CKBB 5L4IA 4KTDL 1KB9K 2XTJE 1PKOA 2P5WA 1X44A 3EFDL 4ZFZB 4APQC 3T6ZA 4EE2A 3FW6A 3BSHA 4XTRD 2IANE 3QSKB 1HIML 2ICEA 4XZUA 4NN5B 3NH7H 3V6ZA 3L9RA 4ZW3A 3CVIL 1DSWA 1IT9H 5JOFB 5JHBA 3WGVB 2J2ZB 3LN4A 5CIPA 3ZTEA 4Z3JA 3QJQB 1JCVA 1H8SA 1O7SA 1CFVL 3MV7A 3T3ME 3E2HB 4GXFA 1A6UH 2XXFA 4L1BA 2NT0A 3DOSA 1TQTA 2IAMA 1SVZA 4LKXB 4C4BA 1MI5E 3PDGA 5K9OA 3QO0B 4YL4A 4KNSA 4ETQA 3DBXA 2XKNB 5FFGA 4EZLA 4O9HH 1CPUA 5ERWB 1RZGA 4PRDB 2DY2A 4ZXBA 4CMHC 5E6IA 1YEKL 3VFNB