3KBHE

Crystal structure of nl63 respiratory coronavirus receptor-binding domain complexed with its human receptor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
121
structure length
110
Chain Sequence
HTDINFTATASFGGSCYVCKPHQVNISLNGNTSVCVRTSHFSIRYIYNRVKSGSPGDSSWHIYLKSGTCPFSFICFSTVEVPGSCNFPLEATWHYTSYTIVGALYVTWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiotensin-converting enzyme 2
publication title Crystal structure of NL63 respiratory coronavirus receptor-binding domain complexed with its human receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 110
sequence length 121
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3130 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kbhE00
4F2ME 3KBHE 4F5CE
chains in the Genus database with same CATH superfamily
2ATKA 2Y6SC 1WFIA 4ZZKA 3UTSD 4PJGE 1J1OH 2IC2A 3NSFA 4UU9B 5F7EH 3SO3C 4DO4A 4JZNA 2AQQA 4P3WA 4Y4KD 1GAFL 5DHYB 1KYOJ 3B3IB 3DOSB 5E5MB 2CCWA 2JLLA 1KCSL 3H7BA 3FQWB 3J07A 3KXFE 5J12C 4B9CA 1FYTB 1UA7A 4GRWH 4QRBA 1HX0A 1JPFA 2C9VA 1QHPA 4LASH 1SDAB 2O5XL 5C09B 3DX4A 3HE7A 2Q8BL 1G9MH 2R69H 8FABA 4FG2A 4O5LL 4FERA 2RBLA 1OD9A 1TT6A 4J4PD 3UJJH 1NTDA 1PQZB 3WMPA 3SYOA 3BAEH 3K1DA 4MJIA 1D5XB 1U8QA 3FT3B 4GRMA 3WY4A 2Q6WA 3TCLA 3DXAD 4M6NL 4NQED 1OOWA 2AP2A 5D2LA 2WKLA 3DX8B 2B7DT 5FS5A 2CDGA 4OT1H 3QPXL 4HMEA 1XGRA 3WIIH 4UMGA 5KSAC 5SWZA 1Q9KB 5HDBB 1HXYB 1IBFA 2YPKB 1UG9A 3B7UX 1AYOA 4XGZB 1BVLA 4PRDA 4JFZH 3OMZA 4Y8DC 4ZO9A 5ADOH 3LN5B 3EG9B 3OSKA 4MMZC 3GRWL 1RJZA 1XIWA 4H4NA 2IIJA 4HS8H 4IBWA 1GH7A 2ZXBA 3I02A 2C4XA 3QQ4A 5F44A 4Q0XH 2QHRL 3K72A 4C56D 4Y16B 4IKJA 1DQQA 4U3HA 4DPRA 1QR1A 4G8EA 4Y1AD 4KVPA 3BJLA 2C9AA 5I71C 3NQIA 4W9IC 4WHCA 5IVXF 4NJ9H 2PXYD 2UWEE 3MA7B 4BEIA 2PCPA 2KT6A 1Q9WB 5FB8B 4DW2H 1NL0L 4FQ1L 2C5DC 3H3PH 3I84A 4XB8A 3KL5A 4I77L 1XF3B 5CS7A 3O6LL 4Y5YB 5KAQF 5DJ2B 4QHLA 3SGJA 1JIBA 2LU4A 3RDTC 5ICZB 4OY9A 5E8OB 3K91A 1A7QH 3T2NL 5I6XB 5FDWA 3ARFC 5C7XH 1E4HA 1HZHL 5A3ID 1K6QL 1FZOB 1P2CA 1QBLL 2EDQA 2ZWKA 5D7LE 5AW8B 1M7DB 5JXEC 1FHGA 5BUAA 4GXUN 4WWID 1UATA 2P45B 5D5MF 3W82A 1DFBH 1SBSL 3BPCB 1SZNA 1SF3A 1YNTB 4WEMB 2Q7YB 1KLGB 5E6IA 4BCXA 2HJLA 1KENH 4JRYE 1R3KA 5DUPL 1NUDA 3SY6A 5IEKA 1AGCA 1L6PA 5GSVB 5JQ6L 3ULUH 2A0LC 4GW5B 1X7SA 3LTVA 4ZW3A 2DEWX 4L8SB 5KANG 3PAUA 3VWJB 3KWXA 5BOJA 3IF1A 3UGUA 2UV3A 4XPHH 3SJVE 5E94B 3PNRB 4ODTL 4Z3FA 3SDYH 2HRPL 4NPYB 1JF1A 2DDQH 1I7TB 4G6FD 5G2NA 4B5EA 3ZYIA 4FQ2L 3O3BB 4NQVB 5K1NA 3QUML 3ULSB 1CZ8L 3SB3A 3EH4B 2O61A 1OAZH 4KKLD 4LCCC 3SKNB 4ZFFA 2FK9A 5FYLL 3OLDA 4YAQB 1FBIH 3QHTC 1YPZA 5FGRA 5A16B 4DKTA 4KY2A 2G3NA 5EO1A 1WF5A 1CUOA 4PD4J 3FU0A 4S1QH 5I8KH 4N8CL 1E8YA 4KVCL 4PJEA 2WMPA 4X4XA 3VXQB 4TNEA 1ORQA 5CIPA 3L4WA 1YC7A 4OLEA 1V10A 4PV8B 4E9WA 1H19A 3HNVH 3QQ9D 2GTQA 3C60D 3WY3A 2WWNA 4QXGL 5C07A 2ZCHL 1ZOXA 3VRJB 2GSGA 1G7QA 4CKQA 4POZD 3RGVB 1TQTA 3NZ8B 2O5ZH 5CBAA 1JZEA 1QNZH 3FQTA 2VMDA 3PL6C 1A6WH 1D5BB 1MW3A 3VXMA 1CGUA 3FH5A 2ICCA 2BS8A 1WFNA 1MCQA 2C9UA 1O7DE 2EDMA 3VFMA 5CHNA 2VWEE 5EC1A 2XWTB 4XMTA 2H0FA 2VC2L 1PF3A 1P1VA 3W2DH 2A4CA 4PJ5A 1MVFA 5I1CL 4O51B 5DJYA 3AJ7A 3ARPA 3QS2A 1N64L 1QD0A 4UTCA 3UAEA 2NW2A 2ERJB 4JB9L 5HJGA 1PZSA 3PYCA 3DX9B 2KKQA 3IPBA 1WBXB 3BQVA 5CCKL 3T4AA 4Z8FH 5MEPA 1I4FB 1FL6B 2HCZX 3OGCA 4ZDHA 3SQOL 4LK4A 4PJXF 1QSFA 4MS8C 4MX7A 3VYOA 1TETL 1BOGB 2JCCA 2IH3A 2ZOKB 1CXKA 2LQRA 3BYYA 3HG1A 4RNRB 2PW1A 1QBMH 4I18A 3C2SA 4OCNC 1S5IL 1CIUA 3QCVL 1JG9A 1F11A 2C9PA 1H9DA 3RUGE 4EDWL 4BDVA 5L2JB 1HSBA 1NLBL 5JYLA 2ICWA 1LNUB 3BUYA 1IFGA 4MMXC 4P8QA 4LXFA 3D1MC 1WP6A 3JWNH 4XXWC 5F1NA 2IAAC 3S37L 4UZSA 4H1LG 1T6VN 4G8GA 3GSRB 2DLEA 4J3TA 1ACCA 4KFMA 4B7IA 5D1XB 4MA1B 4PJBF 4JFOA 1OCWH 4R4BB 1JHTB 3TNNA 1JTOA 5DI8B 3UMTA 1GY2A 2Y23A 1A4AA 1FFRA 1BAFL 1Z1WA 3DOHA 2WLYA 4DKDC 2GAZA 2XN9E 1G9MC 5T5FL 4UTAA 1WC7B 3CFNA 4G9FD 4EI6B 3INOA 2PO6B 4HFUH 5DRZB 3EJQA 1B6UA 4Y9CA 5TFSL 4HC1H 3EJZD 4YWGH 2W0LA 1KNOB 2G60H 2EUWA 2VGLM 4XPAH 3TBVA 4HS6B 5D96C 3BEVA 1UXWA 4MD5B 4N85A 4DFHA 1IILE 4G6JH 3BRFA 3UTPE 3TEWA 2MOQA 3TEYA 3CVBA 5D8JH 2NNFA 5IHUL 1J5OL 4IRSC 1KEMH 2P46B 1UXSB 4OF6A 1G0XA 1V7ML 4YJZL 3FOLA 5IM7B 5KTEL 2YSSB 4TL4A 1E30A 3DTXA 4CC1A 4HJGA 4JFEA 3RVVD 2WXPA 3GINA 4S0TD 4FG4A 1FORL 5AB1A 2FEEI 5D1ZA 3UXFA 2CAKA 3EDDA 4HFWB 3HAEH 5F72S 1G1YA 1BIIB 2M2DA 2G0LA 2VDQB 4YQXH 5FF6A 3CC5B 3IAQA 5D2LE 2EC9U 5EUKA 2X44D 1P1ZA 1OZTG 1LWJA 3KH3A 5BQ7A 3MXVH 4LIQL 1OGPA 4DEPB 4WFHE 1DLFL 2JQMA 3E6HA 1GVIA 1VIWA 3P9LB 1KIRB 1UXLA 4N8UA 3DSNA 3RDTA 4XNDA 4IS6B 5EZOL 3WIHL 3FKUS 1BFVL 2ZX7A 1W16A 3F7PC 4U1KB 1HCFX 1VPOL 3VFRA 1KACB 3VXTB 1WEJH 1L9NA 3WFCH 3K80A 4N28A 3T1FA 3BZEA 4JVUA 4WUKH 5F9WC 2EIZA 1LE9A 2Y25A 5FKAA 4FI8A 3OKLB 4XO9A 3QHFH 4OGXL 3NSJA 2ZP9A 1BFTA 4HHGA 4AC2A 1BF8A 4K07A 3W39A 2YUXA 2WLNA 3ZDYF 4XP4H 3LVTA 3TBSB 5J0BA 3HZMA 2RQ8A 1ONQA 1PYWA 4JFDA 3ULUC 2XG5A 2NQ3A 3DDGA 3IWUA 1T4KA 2J71A 2HT3C 4MBOA 5KJRH 4JQXA 2DI8A 2J12B 2L7QA 4GS7B 3S7GA 1KPUB 3S3SA 2WLKA 1I3RB 3MREB 4TULH 1JV5A 1K5NB 3OR6A 3U7YH 3LKSB 3DVNA 4MA8L 5ACLA 4WV1A 3KVDD 2IBGA 3G6AA 3NGBC 3P0YL 4JHAH 1QFUL 5HDWA 1U42A 4YHNA 5IWLA 5HGDB 1IB5A 3ETBJ 6FABH 2KLSA 2KERA 3GHEL 4XP9L 2F7OA 5HJBA 2BO0A 3L3OB 1MJ7L 2VERN 2X9XA 3MV9A 2NY4D 3C2AH 3L7EB 1M1SA 2VMFA 4XMWA 1YMMD 3EYUL 2H2PC 1EAJA 3CDGA 3ALWA 1TYRA 1KTLA 3IDMB 3EO0A 4FQHB 5E4EC 3KPQA 2JE8A 5CINL 4LO9A 4PJIE 1IC5L 3ZU8A 1F1DA 1HWGB 3F5WA 2WXHA 3I9AA 5LN8A 4UBDC 2J55A 3L81A 3PL6A 4DGYH 3DVGA 5KS9A 1J9TA 2IXQB 4FYRA 1I31A 4V2CB 2QQKH 2YRPA 1SY6L 4LEEA 4H8WL 3MFFB 4LHUA 4MDJA 2OYPA 1JN6B 1UCBH 3Q6FB 3OAWA 3V6FA 4HBCH 1WLHA 4Q74A 1SOQA 4LPCA 3L3DA 5IMOA 2XT1B 2OSLA 4MZIA 5IB2A 2FECI 3UTZA 3U0PB 2EACA 4PRHD 2WLIA 3QXVA 2VAAB 5K93A 3WCYA 4RMUA 1ZWIA 5DQ9B 1ZY9A 6CGTA 4QRRD 4QXTA 5IK3A 1KTRL 2X41A 5EOCH 3SZKC 1AGEA 3AADB 5KVMC 2MEJB 4A6YH 1JPSL 4Y9GA 4P2OB 5ESVA 1ZS8A 3LIZL 2MTAA 3WJLA 1YEDA 4KROD 3QXUA 3VXME 3QFJD 4G70B 3RKDD 2DKSA 3C6LD 4JHWH 2QFRA 2VJXA 3LRSB 4HISA 3QI9C 1NCCH 3THMH 3VFVA 5ABZA 3ESNA 3PNWB 3VI4F 1CICB 3LPGA 4H0GA 4N8VG 5F1OB 2B20A 2B4CL 3BVNA 2JQZA 3KR3H 4LCUB 1HZLA 1Z7JA 4Z9KB 3GUFA 1MIEH 1HI6B 3JWNC 4B60A 3NA4A 4WTZG 1DR9A 2D9QB 3LH8A 3MRJB 4LLQA 5HHNB 2QKIC 1YEEH 4OFPA 2J88L 2A99A 1PZ5B 4HJ1A 1AYRA 4OUUB 4R2GC 4XCEB 2FUQA 4DQAA 2WQXA 4HHWA 1MHCB 2FVNA 2Y5TB 3F05A 2HP4A 5DUMH 5EPMB 3I9GL 3PQYD 4K23H 5E4IA 4LAJH 3V4PA 1NLDL 4MA7H 4E41D 4LMQI 1UZ8B 3UFIA 1N0LA 2YGNA 2ATKB 2CIIA 1ZLWH 5C0FA 2MPVA 4JRXA 2Y06L 3LZPA 4O00A 4WUUA 2JIXD 3VFOA 4JZNB 4JEGB 1KTDA 2PTTA 1E50A 1NMCC 2FWOA 1XGPA 4OGQC 1HHJA 1FAIL 1OAKH 4JQVC 1N10A 4YHLL 2OK0L 1UM5L 4QRAA 5E56A 5L2KE 1TQVA 8CGTA 4U7KA 3NPSB 3L4YA 4PJ9D 3D2UD 1JPFB 3IDYC 4HZLA 4R97B 5EIIB 4F7MA 1I8AA 3HE7B 2EE0A 4OM1L 4XBEL 2JKJA 1QYGL 2QADC 1NOLA 3BESR 4MJIB 3SEPA 1U8QB 4GRMB 2Q6WB 1I7RA 3TCLB 1XGRB 1NUNB 5SWZB 1CF8H 1FSKC 2IBBA 4YPJA 3MLSL 1OIOA 3MBXL 5ICXB 5D55A 4YSUA 1H6FA 1BVLB 1P4IL 5DLLA 3SDAA 2XFXA 3E9TA 5BV7L 5AAMC 4LDEB 1RJZB 1XIWB 2O6EA 3MCKA 3CHXA 3I02B 4L4VE 3QQ4B 4Z7OB 1NAML 4JY6A 4X4YB 4LEXL 5DK3A 3K72B 3EH1A 3WN5C 5FM5O 3T0EE 1K8DB 1LE5A 2XA3A 1DQQB 1QR1B 4RRPM 2Y7LA 4XP6H 3L1GA 1VGEH 2MOGA 2FGWL 1ROCA 2QZQA 2FEEL 2IEPA 2NY6D 2PCPB 2JV6A 3ECWA 2QPUA 3US1A 1INDL 3RNKA 3S96A 1JZ6A 4FABL 4QRPA 1RVFL 4HWBL 1UKSA 1WFTA 2IDFA 2ADFL 3A0OA 4QHLB 1G6VK 1M05A 3ELQA 3ZN6A 1SDDA 4X5LA 3KLAA 1BMGA 3MFGB 4P9HL 3ZZLA 1VFMA 3VSUA 4LFHG 1PLGH 4E5XG 2YK1L 2DEYX 3ZE1F 4OD1L 4ZAKA 1P2CB 2Z0BA 4JO1L 3TO4A 2IFGA 2LGNA 2MPAL 4JGUA 4ZTPH 2NY2D 1U36A 1KPVA 1I1YA 1YEIH 3CVHL 1TJGH 3OMAB 4FFVC 4PWJA 4X0NA 1KN2L 1MKFA 2C4FU 5AL8A 3ZIMA 5GRVL 2WSKA 4XMKL 1X6NA 5LLIC 2GTZB 2HJLB 1A64A 1UM4H 3UMNA 1RMFH 7PAZA 1R3KB 4WI9A 5IEKB 4HPOL 1AGCB 4CVUA 2K7QA 3TYGL 1F2QA 3O3UN 4JM4L 3V6OC 2K6ZA 4XAWL 4RZCA 5I0WA 1L0XA 3T71A 2JTDA 1OHQA 1QNIA 5CU9A 5GPRA 2DQCH 1RD6A 1T0OA 5FO2A 3S3JA 5A2FA 1F56A 3QIBB 5AKRA 2DPKA 1U4EA 4B9YA 4GW4B 1CCZA 1BVNP 1JF1B 3RJOA 4KKAD 2MHAB 3GJFA 1AS6A 4G80B 1IFHL 1NCWL 2VXVL 3APNA 3OMIB 1JVLA 2YWZA 3MV8E 4YFLF 3CVCA 4CN1A 2O61B 3KJ4B 4ZFFB 1WCBA 3FXIC 5CJXA 1O9WA 2C9RA 3MJ7A 1HWHB 2X4PB 1EUUA 1YPZB 4F93B 3MCG1 4ZX4A 3NK4A 5EO1B 2DQTH 2OX5B 3JVFC 1MFCL 3JSSA 1VEOA 3KGUA 4OCWL 5C6PB 3IT8D 5DVKA 2W60B 1XH0A 4PJEB 3CDYA 2WMPB 4X4XB 2F5AH 5EF0A 1QSED 1ORQB 4BKSC 1A7OL 1KTJA 3K5RA 4BBWA 4GP8B 4X5PA 4K3EH 2J56A 3I6GA 5HDLA 4J23A 1BVZA 5C07B 4IRZL 4R7LA 1L9SA 2GSGB 3BDYH 1G7QB 4MD4A 4BSVB 2EE2A 2ZT9C 1DJWA 1HAWA 1WUNT 4B5ZA 1ZLUK 4UB0L 1NCUA 5CBAB 2Q7AA 3FQTB 4PIBA 5K9QG 4OZGA 4JM2F 4HHAB 1Q90A 1F6LL 4D3CL 5D7JC 3P54A 4M9OA 3TBTA 4NUGH 3VFMB 5CHNB 4H0LC 5EC1B 4AV4A 3QVAA 1NM9A 5BVPH 4MCZB 4G7VL 4PJ5B 5K9JL 4HD5A 5DJYB 4F92B 1AHWA 2EZ0D 3NUKA 3HS8A 3PJSA 1WFOA 4IQHA 4NN5C 5GSRA 3HBGA 2FECL 2NW2B 2Y69B 4MAZA 5T1MA 1RZIA 2P8LA 3T4AB 3QUYA 5MEPB 3ZBMA 3OGCB 1KGYE 2GK0A 4ZDHB 2BDNL 4NQDD 1QSFB 5INDA 4CDHA 4XN7A 3T0DA 2HKFH 4MX7B 5HYSA 5C3LD 1G43A 2JCCB 5CO1A 1HIML 3F01A 4MQXC 1R3HA 3HG1B 4RRPA 3ZE2E 2AXJA 2IGFL 4M48L 2PW1B 4CILA 1IQDA 4HSQA 4BUHA 1F11B 4OJDH 4KKBD 1SOKA 5CLYA 3CVHB 4BDVB 4J6RL 1HSBB 1Y6KR 1G7PA 2VSDA 3SO3B 1OALA 1FO0H 1A4KA 4MXQD 4ZFGH 4FQJH 5F1NB 1UKTA 3TVMC 4FF9A 1HL9A 4G8GB 1MCCA 1DZ0A 5LQBL 1JZ2A 3QZWB 5J12B 1JDCA 5G4MA 3VGFA 4JFOB 5C0CA 1J9QA 1EHLL 2IDCA 2YAQA 1T0NA 2AEPH 4G6AD 4DSYA 1OTTC 3TN0C 2DL9A 3SE8L 2GAZB 3JUZA 2HTKD 2RHEA 3GSQA 1ZLDA 2X12A 1KCBA 4AYEC 4B53A 3GD1C 5GXBB 1GOFA 2Y36L 5D7HA 1GPOL 5IIEB 2E9IA 4FNRA 4L37B 4HGWA 5JQHC 1KYOK 4GLRH 4N2GA 5MEQA 1HKFA 4HU2A 2CU9A 3TBVB 1EZLA 3ZHLA 3BEVB 4LU5H 5IROC 1E6JH 2DJUA 3O4OB 3O41A 4FFZL 4S11A 4K5NA 5JHDD 2IH8A 2P42B 3O6FA 4JK0D 4HJEA 3WV0A 3QJXA 5DD3L 4KKRA 3DV4A 4JKPL 1YSOA 3E1F1 4XB7A 4KKQA 5JHLL 5JOEA 3FOLB 4NAMA 1IM9B 1N4XL 4HJUA 3DTXB 1IC0A 4QHNA 4JFEB 3W56A 2XTJE 3X12B 3AS0A 4Z7QF 3TX4A 5MEOB 3KS0J 4OCSH 4LOFA 4JHVA 5D1ZB 1KMGA 4BA8A 1MVUA 5DMKA 2V8MA 4N0UB 1KCKA 1G9NH 3DHPA 1BQHA 3MBEA 1DSFH 5IQOA 2NCMA 1NCBL 4MKTA 2IANA 5FF6B 2AEWA 5T1JA 4JFPA 4G72B 5CZVH 2ISDA 3HS0C 1P1ZB 4UM9A 3G6DL 5KYUA 4L3FA 4ANUA 3MA9L 1OWRM 2G5BB 4WW2F 3E6HB 2J1YA 1HH6A 1E9PA 1OT1A 1CURA 3DSNB 3RDTB 2BNRE 4PJAF 5FLVA 4AC4A 4GBXA 4X7DC 2QKSA 1WWBX 5AL0A 1EH9A 1V5JA 5IT2H 3NIDB 3LHPL 2DD8H 1PX3A 1XR8B 1XGUA 3T1FB 3BZEB 1JVOA 1TZGH 3IETB 1ZVNA 1LTXA 1WD8A 2EIZB 1H9VA 3WEAA 2K8MA 1LE9B 5FKAB 3ARVA 1ODUA 2F1EA 3PJNA 2JWYA 4BWUA 3S4SA 1D7FA 1TJXA 1OPOA 4M8UA 1Z5HA 3U1PA 3QDMB 3W39B 4Q7DA 4MZRA 5A2BA 4Z7VE 4X9IA 4PI2A 1U2CA 3HZMB 4U2YA 4YBQD 3RWJA 3V6OA 1ONQB 2ZX5A 4JFDB 5AVYB 4UWQB 5C08A 2XG5B 4F3FA 1T4KB 5KEZA 2R69L 4YE4H 4DJMA 2P43B 1HH9A 3Q01A 2PKDA 1Q94A 4TN9A 2HT2D 2NY3B 5DUBA 5HI5D 4PRIE 2MTPA 4Z18A 3FQNA 1YN7A 5HDBF 4PB0L 3OR6B 2V5TA 3DVNB 2IAMA 4BQ6A 4H26A 5IB4A 1WISA 4JGNA 4LCCB 2XTSA 3WIIL 4WV1B 2V2WA 4OKDA 4P2RD 3OV6A 2XWBB 3RJDA 2ATAA 1AY1H 1T4WA 3NIGB 1XAKA 4YHNB 5IB5A 2XETA 3TZVD 4JFZL 5ADOL 5B21A 3W11C 1G4MA 2ITCA 1JNJA 2COQA 3C5JB 1MCPH 1RH8A 2H2SC 3E8UL 1R5IA 4KK6C 4F1ZA 3MV9B 4I1NB 4I3RH 4FD0A 4QO1A 1TQWA 4X9FA 4Q0XL 1UJTA 5IMMA 3CDGB 1NDMA 4A6YA 3LEXA 2EILB 3DUSA 5DJ0A 3T77B 1KTLB 1WICA 3EO0B 3ZQXA 2J1KA 3M45A 3KPQB 4NJ9L 1X9LA 1F1GA 1H3UA 3F5WB 2VH5L 5KS9B 3D12B 3PL6B 4PJDE 3DVGB 1OW0C 2G30A 4PD4K 3LNEA 3IN0A 5D7JA 3L9BA 2E9GA 1OXYA 2V9UA 1BJMA 3ZDXE 3L3DB 5IMOB 2OSLB 5IB2B 5E1AA 1N68A 5AYUH 3UTZB 5I5IA 1A7QL 1AAJA 4ZPVA 4U4BA 1ZWIB 2CWRA 3LB6D 5IQ9A 4QXTB 5CILH 5IK3B 1UFGA 1BREA 1KN4H 5I74C 3VD7A 1AZZC 1RZKH 1YNTF 1U8IA 3IJSA 2D7NA 2M83A 4N25A 2FX9H 3RFZC 5ESVB 4ZNEA 1YEDB 3CAFA 4M5TA 5FYJD 1KENL 3N04A 2BW4A 2DKMA 3NP4A 1E2VA 1MCKA 1D9KC 3VFVB 4OTXL 2XV0A 1PAMA 2AEQH 5AOLA 1EGJH 4YDIH 4ZFOA 4A2DA 1JSYA 3BVNB 3H85A 4XPHL 1SDYA 4MRBA 3ZR6A 1IQWL 3S88H 2W0FA 3SDYL 2QPEB 2DDQL 1V7NL 1LO3H 4X4ME 4DPBX 4EN3D 4LLQB 4JFTA 2VR5A 3GLZA 3ZL4H 3ILDA 3QSKB 1OAZL 4ZOEA 2GJ6D 4WY7H 4X6CE 4BINA 1FBIL 2FHCA 2PMZA 4BA0A 4F7PA 3WDJA 2HG5A 4KRMB 1L6XA 2ZICA 3OXSA 1YEHH 4S1QL 2FZ3A 2X0VA 5I8KL 3V4PB 1BW8A 1UFUA 3CH8A 1MHPL 1NCOA 4PJHA 5F89A 4Q6KA 2DQEH 1N0LB 4D9LH 3FZUC 2CIIB 2J2ZA 3HNVL 3P02A 5C0FB 2O6PA 4I0PD 4JRXB 4UNIA 4WUUB 3VFOB 4ODSH 1KTDB 2DWXA 4AV5A 1HHJB 3BJ91 2YR3A 1QNZL 5C0CE 5HD8C 1S7RA 5E8DH 1A6WL 1X5KA 4LVNC 4YSCA 1P4BH 5DFVC 4EIGB 4ZOAA 1O7DC 4PRPA 4AL8H 1KGUA 1DDHA 2HJKB 3V0WH 4AG4H 2VWEC 4HZLB 5A43C 4F7MB 2OZNA 4GFXA 4JO5A 4U4IA 3TT1H 3VFTB 3W2DL 4OI7A 1G9NC 2DW5A 4U6HA 4XN4A 1I7RB 3MRFA 4I1RA 3LZQA 4BELD 4H44C 3RZCC 1FC1A 2B1OA 2ZUQC 3S5LA 5E6SB 5E95B 4FA6A 5JLZA 1KBKA 3AREC 3MC0A 3QDHA 4XI5D 4OLWH 3SDAB 1UENA 2XFXB 3ML9A 3EGXB 3QW9A 1AXSB 3S48A 1R5WA 1GSKA 1QBML 3ATFA 3MCKB 2FYYA 1S3RA 1UOKA 4PJGF 1Z9NA 5CWSA 1JZ4A 2Y1YA 2VXSL 4N8PA 4QOKD 1HWWA 2W80C 5F9WB 1KOAA 2R39A 4JW3A 1LE5B 2BWDA 1MRCL 4BRVA 4F9PC 5KUKA 5MENE 2A83A 4LZKA 4KTEH 2YXVA 3X11A 4NRZA 1EA9C 4ZO7A 3UBFA 3EGSA 4RAVA 3RNKB 3S96B 4KMLB 2AFNA 4QRPB 2I5YL 5C8JA 1LK2A 1C12A 5CEYB 4UT9L 1BVNT 4R5VA 3P40A 1AGBA 3N41B 3P11H 4XX1G 1SDDB 1U33A 1J0HA 1ZK5A 3KLAB 3MCLH 3NCYP 4HFUL 4Y4FA 1KY6A 4HC1L 4YWGL 1R6VA 1TTGA 4ZAKB 1H5BA 1SHWA 4YH6A 2P28B 3TO4B 3WO3B 5HGHA 4ETQA 2OYLA 4U6VH 3II3A 4YK4B 1KPVB 1I1YB 1RPQA 4G6JL 3FFCB 2QL1A 2YGQA 4P4KA 4PW4A 5ABDE 4PGBA 2DMHA 2H32A 2IBZX 4KK8D 3RLSA 2XQ0A 1YG9A 3MJWA 2FB4H 1KEML 3SDCD 4P2QA 1T5WB 5D4QA 3QUZA 5CBEB 2NNRA 2FDBP 3QISA 2P52A 4AJWA 3JBG7 2R1XB 2YUWA 5E08H 1E9QA 2X4UB 4B95C 1TTCA 4RZCB 2WZ0A 5E4EB 1AD0B 3VXUD 3VB9A 5IR1A 3RVUD 1B0RA 4L18A 4YQXL 5FYKE 3PWUA 2KS0A 4XCNA 1N3NA 2ZWYA 2R59A 5I1EH 3FTXA 1TSRA 4PTUB 4GAYA 4WEUD 3V52L 5IQMA 3MXVL 4XRCA 1UWGH 1Q1PA 4XMPH 5I5MA 4KI5C 2BP3A 3TYFA 1WCBB 4FTVD 2ZUWA 1CD0A 3ECQA 4I48A 3MJ7B 3HC3L 3J8F7 2A9CA 3QG6A 4KMTH 4U1NA 4F57H 4GW1A 3DK0A 4Y2DA 3TPKA 2OSXA 1L0PA 4A7QA 3WFCL 1KYAA 3D18A 1PZ3A 4Y0GA 3D85A 3QYMA 1RZKC 3RFZA 4WUKL 2AGJH 2FT7A 3I6GB 1GW6A 4BQ9A 4P5MA 4AI7A 4HCRL 5CGMA 4J3OG 3U1QA 3U9WA 4MD4B 4LLVA 1U91B 2D31A 2W88A 3CZKA 1RZFH 5C0BA 5LVEA 2HKHH 4OZGB 5DO8A 4YGVA 1OTSC 4ACPA 4QTHA 1JZJA 2KQNA 3PWVA 4XP4L 3R4RA 3AWGA 2VLLA 2JXMA 1QLEH 3ARGC 4RLDA 3TBTB 1A9EA 3L13A 3LKQA 5KJRL 1JNHA 3NVQA 1XH3A 4IKIA 4DCQB 4MJ4A 2Z31C 3QCUH 4KUZH 2ADYA 3BVUA 4GSDH 5GSRB 4TULL 3U7YL 1JGIA 2AHIA 5T1MB 1RZIB 4R2GB 1VENA 2P8LB 3UP1A 4PJ8D 4QTFA 1JZ8A 2UX7A 3QUYB 1ZKAA 3BE1L 3OQ3B 3GMNA 4AOFA 3IJHA 5INDB 5AW2B 5EBMA 3DV6B 1CDCA 4XXDB 3TIEA 1R3HB 3LOWA 3GDBA 1W8EA 5DQJB 3MACH 3VXNA 1IQDB 2QGBA 3OWEA 1DTUA 3C2AL 4CRPA 1R47A 1YEWA 4NIYE 1X44A 3EFOA 2EVIA 2X70A 1TXKA 2YEZA 3PLYA 1QRNB 3IFLH 1HNGA 2A9NH 3P73A 1G7PB 3ME0A 1S6NA 4D8PB 2CDFA 1A4KB 5IVNA 1HS6A 2TRYA 2Y6TE 3ILEA 4HH9A 4JM2D 3U1SH 2XX0A 4DVRL 4U1GC 4E9QA 1VFOA 3FUNA 1JCKA 1BQ5A 2CJSA 3P4MA 2WWMD 4P5RA 5GGQH 3HKFA 2EEFA 3GLDA 2QQKL 4P5TA 5E99H 3ZT7A 3IDYB 3NCMA 1UCBL 1AZVA 1T0NB 4HBCL 3MZGB 1XMWA 4S1DC 4AL8C 5B3JE 5HXMA 5M95B 1QA9A 5EC2A 2DJSA 2X89A 5BNXD 3HAEB 3GSQB 2WZ6A 2WIMA 4LCWD 2IDTA 4GH7B 5I23A 1OB0A 4Y5XC 4HGWB 1EHKB 1RLWA 5EOCL 5MEQB 5CSZB 3LXAA 3M8OH 4A6YL 1RJLA 4NP9A 3O6FB 3UACA 3QEQE 3GXDA 4DP9X 3OKMA 3DV4B 2LOEA 1NGQL 3L4XA 4UV4L 3ZXAC 4YFDB 2MKWA 4ICWA 1DVSA 2P5WA 3A67H 3PHSA 4JHWL 2BP8A 4AKOA 3HB3C 5KANI 4S2SA 1TZHA 2R2CA 3THML 1BA9A 3BCDA 1S78D 3CHQA 2HWZH 1BMZA 2XQYG 3BPNC 4XBPA 1YDPA 2SEBA 5H4ZA 5IOKA 4XN2A 3KR3L 2AS5M 1MVUB 5DMKB 3NCXA 3TC9A 3MBEB 1BQHB 4ZS7H 4JKMA 5JA8B 2CGRL 1MIEL 2IANB 4MNQA 3IGAA 4JFPB 3RGBA 2V5YA 4H1LA 4NN7C 4UM9B 3AS3A 3OPZL 4FS0A 3QRGH 5KYUB 4MCMA 3AABA 1YEEL 1LDSA 1ZTXH 3PWPA 1EX0A 1HH6B 1PZAA 2ARJA 1E9PB 2Y2YA 4CVXA 3GHBL 4JG5A 4GLRI 4GBXB 4I2XA 5J3HD 2WXLA 3CBRA 2F53D 3ZIYA 3IK2A 5I28A 1KCUL 5CXPA 3RWIA 5IV2A 3T09A 1WQVT 2ZKWA 3C09B 1WD9A 3BKYH 5BXFA 5KWYC 2BVOA 3H4HA 4N20A 3TU6A 1WT5A 3RILA 3FUJA 4F7TA 4H8HA 4MFHA 5JPMA 4NZTH 4G71B 5IW6A 3FJTA 3GK8L 3FB8A 5C0GA 1H3XA 3B9KC 4D8OA 3FCTA 2GY5A 1CTNA 2WV3A 5IB3A 3QFDA 4WFGD 4R84A 3RWJB 4DO6A 5J6SA 1ZSHA 4NC0B 4W9ZA 1AS7A 3KEHA 4XVUD 5C08B 4HG4K 3FS9A 4NQCD 3VD0A 3AGVA 4F3FB 3II1A 3LQZA 1HH9B 5D2LF 4YC2B 4JMNA 5DUBB 4FNTA 2VSMB 4B9IA 3FQNB 2BFVH 3CV5A 1A47A 5D1QA 1YN7B 4KO6A 5K1VA 4AJYV 4X7CC 4NUQA 3X3GL 3FUEA 2IAMB 1GGIH 4H26B 4PN6A 4HU8A 5IB4B 3UAJC 1CR9H 2GHWB 1G1OA 5IB5B 1RZQA 4Z7OF 2OV0A 1IT9H 3PABA 3AXIA 2OTUB 2K0RA 2NNCA 1OCCB 3VXRE 3IKCA 2OW7A 3PDGA 1E6OH 4R0LA 4QO1B 1BZ7A 1AQKH 3V8CA 3T0EC 1FCGA 4FE9A 5IMMB 1NDMB 1FYTD 2K3TA 5DJ0B 4A6YB 3DUSB 3GIZH 3IDIA 5C09D 1MOEA 4Y4HC 4XP6L 3EIFA 5FA4B 5EWIH 3NG5A 2ARJQ 1VGEL 2COVD 4D0DA 3DO3A 1E3XA 1KJ3H 3NCWA 2GIYA 4IMLA 2X4QA 4QKXB 5F7FA 3ZZSA 4BQ8A 1MCJA 4ONGH 3VXSA 4NNYB 4TTDC 5BJTA 4RWYH 4FKHA 1OSYA 5D7JB 3S8GB 3IRCA 1EGJA 3DYPA 5SWQA 3ESVF 5E2UH 1GC1H 1I3GH 1ZXKA 5SWSD 2DH2A 4RCAA 5E1AB 1FPTH 1SXSA 2PYEE 4ZPVB 1BZ8A 2YBRB 1SYSB 2H3KA 3FQ1A 4KV5E 2GJRA 2QPDB 3CQFA 4NN5B 1HL5A 3BD5A 5IQ9B 4L4TD 3OG4B 5I19H 1ODAA 4HEPG 2X6CA 1OP3K 1M1XA 2KBGA 1U8IB 4M7KH 1KSRA 5HBBA 3IJSB 4ZTPL 2HLAA 1YEIL 3HHSA 2JI3A 1TJGL 3DHUA 4LRIC 2ESVB 2EECA 2JKIS 2WJ7A 4Y16D 5D6DA 1MIMH 2WAHA 3QFGA 2YJQA 5C0BE 4J6IA 4E68A 5HP5A 1NBZA 1GZPB 2NT1A 2HFGL 4EUPG 2G4EA 4YXHH 3LXCA 1UM4L 3PWJA 5EF3A 1Z2KA 1RMFL 1NM4A 3BUIA 4Z3IA 2YMXL 2AMGA 3ECUA 1QLFA 3M17A 1EEUA 4ZFOB 1A6UH 2BINA 2PCFA 5DA0B 3JZ7A 3QUXC 3ZRSA 4XN8A 2VIRA 3VCLA 1JZFA 5ES4B 1J1XH 2ZCLL 4ZZFA 2ZYSA 4PGCA 3ISYA 3L95B 1FLTX 4GNKB 4NAJA 4HUUA 4M61B 1C5BH 1YPZF 5IQLA 5B1BB 3F7YA 3HJEA 4TNVK 3V9EA 3TN0B 3OWRA 4J3BA 4XE5B 3SKMA 5FUCE 3ROLA 4PJEF 4WFED 3SDDD 4ZFZA 1B90A 3ULVE 4XAKE 4TUKH 3CLFL 4F7PB 1GMEA 3US0A 2PWGA 1CDBA 4O4YH 3WKNA 2DQTL 2HG5B 4ZUSA 2F5AL 4PJHB 2CPUA 4YE0A 1ITBB 5F89B 1HINH 3S36L 3DJSA 4LLWA 1FFTB 2J2ZB 4K3EL 3VWJD 3D9AH 5ISZA 5I1JL 3KWUA 7FABH 3GFUA 4YNYA 1LK3H 2UY7A 1S7RB 3KJ6H 3P3UA 4NUPA 4P46C 2K9FB 4L2LA 1JXKA 4PRPB 2OQJA 2V6HA 1DDHB 1R3JA 35C8H 1MCDA 2CD0A 4ICXA 2XKSA 3WSQH 3AQZA 4QRSA 4I89A 2VO8A 2NYZA 4N8VA 5FX3A 5BVPL 4QHKJ 3U79A 1A66A 4EZMA 2N1KA 5ESQA 2W07A 4U6HB 5I5RA 5E9DA 4W68A 4FYSA 4HIJA 4WTZA 2VRKA 3MLZL 3J27A 2JCCF 5FXCH 2DMGA 3WHE1 3FOMA 3MODL 2ZKHH 4DZBA 3S5LB 4ATWA 4QHPA 5JLZB 3QDJA 3F04A 2EQDA 3ZKSD 3LZRA 3K8MA 4RDQF 3RGVD 5HYFA 2GHZA 2VSCA 4JJHA 2AMUA 4UANA 3U0WL 2FYYB 3D07A 4EXKA 1J8HD 2F58H 3BGMA 5CWSB 3S5ZA 3F85A 5DD6A 1RJCA 2YO3A 4XOEA 1FO0L 4CA4A 1ROWA 4ZFGL 1KBBA 4FQJL 3EO1A 4I88A 4J3XA 3X11B 5FGCE 2XG4A 4NRZB 4J3WA 4LSTH 3WTTA 3BAIA 1QATA 4BJLA 2ZSWA 3PWPE 3EGSB 4RAVB 5F7BA 6TAAA 1G94A 3TLRA 3Q13A 4AH2A 5DYOA 1PBYA 3HBPA 4TVSa 4JPWH 2AEPL 2DQDL 2D8KA 2ZXGA 4WI0A 2OSWA 1LK2B 1C12B 2R9HD 3SCMD 3IDGA 1AGBB 1WA2X 5HYJA 2I24N 1HL8A 1EDYA 2ADIA 5FOBA 2TSBA 3FQXA 4Y4FB 1HEHC 1PSKH 1OANA 4APQD 4Y89A 3IGKA 4EF3A 1EXHA 1H5BB 1HHHA 4OV6F 5HGHB 4LU5L 1E6JL 3UAJA 5LNEA 1G5GA 1SHMA 3C5XA 5AYQA 4PGBB 4FCAA 1OGTA 1DCLA 1U95A 3DX3A 4KWUA 4IIQC 3VGAC 2R0ZH 4QEGA 4NRYA 3RTLA 4P2QB 3QUZB 3HZYA 3DROA 4DGUA 2XTJC 4A67A 3CLWA 3RY4A 5D1XD 1S5HA 2OCFD 4IEFA 5FUZL 1BM3H 4KJYA 5I18H 2WQRA 1EO5A 5L4FA 5IR1B 3FQYA 3WJMB 1B0RB 1G9NL 1G7IA 1ADQA 1I9JH 1DSFL 5D1QE 3PWUB 4MAYD 3T3MB 4XCNB 1T66C 1N3NB 2PO6D 3ZTJG 5CZVL 2CKBH 4ZG1A 1F3JA 1AHKA 3KGRA 4GAYB 4XRCB 3NIFE 3VFWA 2V2TA 2HFFA 4FP8H 5AW4B 2OL3H 3SYQA 1PAZA 3DIVA 3NIDF 3O0RH 4JCLA 2BWIA 2D2CC 2KUTA 4I48B 3OR7A 1GC1C 2R2BA 4WHYH 4WU5A 2BSTA 1DBAH 4UT6A 3HPJA 2LVCA 4GW1B 5EN2A 4ZTEA 1B2WH 1MJJA 5F9JA 3WLWC 1A7RL 4Y2DB 5DFWH 5IT2L 3Q6GH 4E5XA 2W81C 2WXQA 3D18B 1LILA 3D85B 3H42H 4FOMA 1TZGL 1ZA3A 4B9JA 4LT7A 3RFZB 1JXDA 3LRGA 1NFIA 4P5MB 2EYTA 4LLVB 1GGTA 1S4IA 5LKNA 1PIGA 2W9DL 4C83A 1D2PA 4YGVB 4DK6A 4JE4B 4QTHB 3FN3A 5BW7A 3PWVB 5EU6A 2RACA 3RE0A 2P5EE 2VLLB 4XWOD 3L5IA 4JO3H 1ZV5A 3Q2LA 2JXMB 4G2AA 1A9EB 3PWLB 1NCNA 4YE4L 1FO0B 3LKQB 4NKOA 3ZUNC 4OCRH 1XH3B 1T7WA 4GQQA 4YSQA 2VISA 2MCAA 1UXMA 2V3FA 2ZNXA 4TQPA 1KT2A 2KZBA 1C7SA 3NIGF 3GM8A 2RA1A 3FB7A 4GP5B 3L1OH 1RK1A 2DQJH 4B6ZA 3GMNB 5D7LD 5KG9A 1AY1L 1HN1A 3A4EA 1IJNA 3U4BL 4PLKC 4BCZA 3QJSB 4BFJA 2KYIA 3TIEB 2ZUUA 1QI4A 4UUJA 2RTTA 1MCPL 2EH8H 3QRLA 4FXKA 1HNYA 2D03H 3VXNB 2ZJSH 4F8NA 4I3RL 5K39A 2V5MA 1RULH 4JRYD 1I9RL 3D4YA 2W92A 2X70B 2YEZB 3ETSA 3LNHA 5KS9F 3FCUB 2XN0A 3P73B 5FYKH 4Z3JA 2BIOA 3VSTA 2CDFB 2OA9A 2OCJA 4HH9B 3ASOB 3SYAA 1F90H 1ETB1 4TUJA 3GXPA 3UOAB 3P4MB 2NZ9C 4AQZA 3SJVD 2I07A 4DQOH 2K78A 1GGCH 2ZOTA 4MTMA 4P5TB 1UUNA 3CDCA 4ZPTA 4AQOA 3VYNA 3BGAA 3QORC 2FQGA 4CJ0A 3NESA 4CW1A 4JZJA 2CO6A 4JPSA 1QA9B 2CK2A 2UUDK 1ZLUH 2GW5A 3KWWA 4QHMA 5AYUL 4G42A 3T8XA 4NN6C 4MJ6A 4V1DE 4X6EA 2CHXA 3BVVA 1AMYA 1H8NA 5DMGC 5CILL 1UZ6F 3N5AA 4R7XA 4ALAH 3DMMC 3FQUA 1FL5B 1KN4L 2ALAA 5EHFA 5T5NG 2LW3A 1RZKL 2UYLA 4Q9CA 1VZGA 4ZSOA 5CKAA 3QWOA 1RJLB 2RMNA 2FX9L 3MLVH 1IBZA 3N06B 1QO3A 1A2YA 1U3ZA 1XH1A 2X10A 4Z7UB 4J3OH 3IDNA 1T0MB 5HJ3A 3ABKB 4XTRD 2P5WB 4A7SA 4KO7A 2BP8B 4NQEE 2VDLH 1PZBA 4S2SB 2IDUA 3IMVA 1UB6A 4YDIL 2E9BA 4XBPB 1YDPB 2SEBB 4X42A 4DKEL 2QGEA 2APFA 3LH2H 2IJ0C 3GI8H 4MNQB 5E6UB 3S88L 3IGAB 1ZVYA 4H1LB 3DO7A 2E7BA 1P7BA 1SRDA 4PRNA 3ZL4L 3PWPB 4RA3A 1SN2A 5I6MA 1SOXA 4HIEA 4CVXB 3E38A 4NT6A 1I85A 3FB6B 1SEBA 4WY7L 4I2XB 3QR2A 2DMKA 2DWEB 5EF1A 1AQDA 4KJQC 2KPNA 5D4JA 4TVPD 3B7SA 1AZRA 5EU3A 3K6NA 1OTUC 5IV2B 3KW7A 3RWIB 1AVAA 1VZHA 4O9HH 2DQEL 3GO1L 3T2LA 5BXFB 4D9LL 3APCA 4ONOA 3PUCA 4NWUH 4HDIA 1MREH 3HN8A 3WOVA 3ARBD 4ODHH 4F7TB 4ODSL 1DVFA 2X6UA 4TSAH 1I53A 2R83A 1CLOH 2V8LA 5IW6B 5F6IC 5T3XD 3FB8B 1NGZA 4LLAA 4TXVB 5C0GB 3KPMA 5E8DL 3VGBA 1CFVH 2NY0C 4XPFL 1S9YB 3HE6A 1K72A 2AJSH 4AL8L 3V0WL 4LL1A 4AG4L 5HYJE 2A6KA 1OPGL 2WGNB 3FW6A 3WIAA 3LQZB 1JPGA 1AP2B 3EHBB 3NN8A 3TT1L 1YC8A 4GPVA 2N7AA 4FG6D 3UJTH 3VD4A 3K2KA 2BY1A 4JCWA 2XN9D 3QIUA 1L7IL 4IBSA 2UZPA 2JKRM 4KX8A 4X6BA 1B3IA 5LCVH 15C8H 4OJEH 4XNYH 3FF8A 4DZ8A 1TJIL 1O75A 3BW9A 1M56B 1ZA6A 1JZ5A 3DX7A 4LL9A 3TA3C 1NGYA 4OLWL 4F20A 3FULA 3KNBA 5D4IA 3FAWA 3CZFA 5E24E 4HCFA 1KB3A 3IKCB 2XKUA 4A1RA 1QQDA 1FL3B 4R0LB 5ANHA 1DJXA 1BZ7B 2YXMA 3EOYG 3PP3K 4FA8A 1X9QA 4W9EC 2ZCKH 5G55A 3D3VA 4MQTB 2J5LC 4P48A 1ZAGA 5JNYB 3HE7D 2JKSA 4KTEL 3ULUF 4D0DB 1ZPLA 3QXDA 4Y1SA 1YQ2A 2LFEA 4IMLB 2VQ1A 2X4QB 4NHCL 4MJID 4WKZA 1L9MA 5FPIA 3VXSB 3JV5A 3GS7A 5BJTB 4YDNA 2BY2A 4R5TA 3QT2A 4IDJL 4WSGA 5SWQB 1F00I 2E6QA 1QTSA 2BS9A 1YNLH 4WO0A 1CU4H 1K2DA 2DLIA 2Y1VA 3GI9H 4N90D 2Y5EA 4WFHD 4N0CC 1GW0A 1CGSH 4AW7A 1VHPA 3MCLL 1GS8A 4JKWA 2AXFA 1E9OA 1T89C 1DN0A 2FYVA 5DURB 1XIWD 1M1XB 2F19H 4Z3TA 2HLAB 4U6VL 1FVEA 5EZPA 3M46A 4GAJL 2H4EA 2NR6D 2FQDA 4YN3A 1NBZB 2NY7L 4JFFA 1QOKA 1A6AA 3UBXG 4HIXH 1PY0A 3PWJB 4WGWB 3OZ9H 5FCSH 4CVZB 4UTBH 5DJ8A 1JGUL 3IPFA 1N2RA 1QLFB 1BXVA 2F54E 3DPDA 3QDAA 4M7JH 1CFTA 3N40F 2F9BT 2DBLL 5FK9A 4BM7A 1OTSD 4AJ0A 2VIRB 1Z9OA 4P06A 4U1GB 3VCLB 1SBBA 1YZZA 1ZVSA 1Q1JL 2GSIA 3PUUA 4PGCB 4ZXBC 3AQYA 4HUUB 4LESA 2AAAA 1SMOA 5IJKA 1H0DB 1QX1A 3F7YB 1OE1A 3NZHH 2VDMH 3CHSA 3ROLB 4JJ5A 1AG0A 4WAFA 3SBQA 5FCUL 3TS8A 4K3HA 3MV7A 4KMTL 4LDOB 2JJUA 3QA3A 5E6ID 4LPYA 4ZUSB 4YSDA 5MI0C 2ZG3A 4PS3A 1UT9A 3TGXA 4NKMA 4LLWB 3JV4A 4LCIH 4YX2H 3QIWA 3HN5A 4X6DE 4OZGF 5D7IA 2GI7A 3WY2A 5ISZB 5B22A 3T6QC 4G9FE 2CNZA 4YNYB 1WGOA 2Z93A 1BEYH 1RZFL 2WTOA 4J3OC 2HKHL 1H3WM 1BM7A 2UY7B 1NGXA 5F8RC 4GINA 3K1KC 1UD6A 3MR9A 2EDRA 3BPNB 4FGMA 5IEHA 3CZLA 4LNRA 3N9GH 4AT6A 1R3JB 1QLEL 3I75A 4QRSB 4N8VB 3KLKA 1JF5A 2WUCH 1EZVY 4OU3A 2DBJA 5C6TL 3ARYA 5ESQB 2QT6A 2W07B 4W9DC 4WO4A 3L5XH 2ZONA 2Z35A 1KG0A 3PXLA 1W72A 2FBJL 3QCUL 4HIJB 4KUZL 4GSDL 5E9DB 3T04D 4BZ2L 4YHZL 3ZHDA 5DZ9A 2DTMH 3X1GA 5I2IA 4PY8J 3FOMB 4DZBB 3O9WD 2QSQA 3QDJB 1F4YH 3UERA 1DBMH 1EEQA 5F7DA 3NABH 5C07D 2YLHA 4EBQH 1TVDA 2DRUA 2J3SA 3QDGA 4EUPH 3TURA 5F1IB 1O6TA 3IGFA 2R51A 4NFDA 3MACL 5CMAA 2Z9TA 4CGUB 2L4OA 3VXMD 5IFAH 3BGMB 4LOEA 4N4YB 2K4WA 1KLUA 4KZ0A 2FSEA 4DT2A 2A9NL 1BXAA 1PJ9A 4QRUB 3ZRFC 4P3CH 5LGHH 3EO1B 2PLTA 1KGIA 1JXFA 1TTAA 2B1AH 2XG4B 5IHLB 2EC9T 4K5MA 4PJ5D 3B6SA 3ZHFA 4WENB 3REVA 4KPHL 2CDEA 4AGQA 4U1MA 4AH2B 5DYOB 3BI9X 3VRIA 4WI0B 3ULVH 2H0PA 5ILTH 3OF6A 4A7VA 4E9LA 1F02I 2YIHA 3NP3A 3L45A 1CDUA 1QSFD 2ADIB 5FOBB 1V3KA 1CD1A 1NIDA 1TR7A 2DQGH 4F2FA 3P2DA 4G5ZL 2Z0UA 4JGJA 1OSZA 4RMBA 2IPUK 3RWGB 2ZOWA 4R4NC 2ZWSA 1HHHB 1O7VA 2CRYA 4KOCA 4OIIH 1UACH 2LABA 4B9PA 2HLFD 3M8OL 5CEZH 3D48R 1K3ZA 2OL3A 3L5WA 5JOFA 3EO9H 3FSZA 1OGTB 1ZSDA 4L3AA 3UYPA 1SJMA 1A6ZA 3W38A 4CU6A 1GZHA 4MHHI 2AXGA 1NMAH 4G8GD 1P4UA 2FIKA 3BDBA 5INCA 3DROB 4NBZB 3NH7H 4J27A 2HAZA 3NZSA 3GBNH 1S5HB 1UURA 1JWSA 4IEFB 5IHZB 1HSAB 1C7TA 3TPUA 4KJYB 4NC1C 3HG4A 3P3RA 3KPRA 1XWVA 2L7JA 3LDBB 3BZ4A 4NC2B 3FC8A 2IV8A 2DLTA 1G7IB 1WHOA 3DX1A 4OIFA 4ZS7L 43CAA 2IPTH 4DUWA 5C0RL 1X5XA 1DBJL 1AR1D 4E9TA 4YHYC 2LTQC 1F3JB 3VFWB 5IJCC 1RLBA 2AI0H 2V2TB 3NCJH 2W9LA 5I15L 3EBIA 4FQLH 4HOXA 2BS71 3OR7B 3C12A 2R2BB 3QYNA 3E3QE 3IM1A 1ED3B 4U1LA 5F3BA 5GZOC 5DS8A 2BSTB 3HPJB 3ORJA 5EN2B 3U82B 5F9JB 1MJJB 2VL5A 4J2XA 1UGNA 1TVHB 2BSRA 4E5XB 5AOZA 1JPST 3BKYL 4TVUA 3D3VE 4JFED 1T1WA 1ZA3B 2HB0A 1JNNH 2H47C 1YA5A 2B14A 1NFIB 5D1ZD 4ESKA 2E7MA 2QSCH 3IGLA 4M1DH 2YQ2A 2EYTB 1NC4A 3OAZK 1CTMA 4NZTL 2ED7A 4PRHE 3OJDA 3O4LA 4TMPA 4C83B 1NC2B 4ISVA 4UQDA 2AV7B 5EU6B 3Q2CA 2FH6A 1ACXA 4OJCA 2V4LA 4EVNA 1G6RH 5GZNC 4MASA 3NYKA 4HLZH 2W1NA 3H4FA 2VJ0A 1PLAA 1AKJB 4PWKA 4TTDD 2EDWA 3X17A 1HDMA 4MXVE 1F86A 3M7OA 1FFPA 3EOBA 1KT2B 1QLRA 3WI9A 1FIGH 4I4WA 4TF4A 4BH8B 4DGIL 4XVTH 4WW1A 3SDXB 3FB7B 2K6YA 4NXKA 3I2CH 1GGIL 2WB7A 1RK1B 3C87A 5L9DH 5B8CA 4JPKL 4JFFE 3MLUH 3QJHB 3CHRA 5JO5A 3GRBA 1V3LA 1I1AA 2CCVA 3MGAA 4AMKH 1MLBA 1IT9L 2YHGA 2Q76B 4UUJB 1ZIAA 4FXKB 2KHAA 4W6XB 3SBWC 3LV3A 1E6OL 4NZ8A 1AQKL 1IVLA 5DC2A 1JXJA 5I1LB 2ZAHA 1L7TH 1E4JA 4JFDD 3W37A 3D7PA 1H8LA 4NKIH 1PY9A 3KLDA 1KJ3L 4TUJB 2NY3D 3PDOA 3VNYA 4HJ0D 3PQYE 4XXCC 5JUEH 4OF7A 1Q9LA 4X6FA 2OZ4A 4ONGL 4UF7C 3EH3B 1EHXA 1KUMA 1MG3C 4RWYL 3KBFA 4ZPTB 2H9GA 2XPGA 4CW1B 1QI3A 4LGPB 2ORBL 2CO6B 4JZJB 4H2CA 1IARB 1CQKA 4PJXA 5DRWA 5JORA 1GC1L 3MKGA 2I32A 3KWWB 3L3GA 3AU0A 4ELME 4ZX6A 5KBDA 1ESOA 1MFVA 4G42B 1FPTL 2FQFA 2YPVL 3LS4H 4MJ6B 5IHHA 4X6EB 4ZX5A 3DX0A 4OJFH 4Z3HA 2ROYA 4A66A 3T0VA 3FT2A 3MRCA 1KBGL 3VWKA 5ERWB 4W9LC 2UYLB 1DANU 1K3IA 2NYYD 3MV9D 4ZSOB 3BWAB 2VR3A 5C0AA 4TV3A 1OGAA 1D5IH 2Z7UA 3BP5A 5CJQH 3BAWA 3LNDA 4YHKH 1IAIH 1MIML 1X5FA 1X3DA 2G5UA 3U4AA 4Y7MA 3IDNB 1BAWA 1IMHC 4PREB 2XTLA 3ISRA 5HJ3B 1X5AA 4OGZA 2NSXA 4QXVA 2FQEA 2C9QA 4UQBA 1R0AH 4YBLB 3N40P 2ZKXA 5J06A 4LSPL 1IKFH 4RGNE 4LHUD 3RWHA 2VR4A 2OMVA 3GEWB 3QZPA 4HAFA 4OGAC 2NNAB 2Y24A 4CC4C 2I26N 4FQXA 4N5ED 5EDXA 5E2WH 3ILQC 2E7DA 2LV4A 3F7KA 3QH3A 4PW9A 1VKXA 3DO7B 3PGDB 2ZXAA 1C5BL 4LOUC 1JZ3A 1MXGA 4PRNB 2YUZA 2YAMA 1QAWA 3HNSH 4AE1A 3ULVC 1XSJA 4NT6B 1SEBB 4PJHF 5BUPA 2ZF9A 5I0VA 4TUKL 4JDEB 1AQDB 1MCWW 4U1HA 4O4YL 4PJ7B 5BVJA 4PWHA 3TCXA 5EU3B 5IGXH 2DYSB 4S0SD 2E4FA 3CE1A 2WXIA 1HINL 4QJ4B 1QFOA 4KJWC 5DD5H 1XF4A 3W9DB 3G7TA 4HDIB 2P5PA 4G5AA 3D9AL 1X7TA 5C2BH 3APMA 1I75A 2J43A 1DVFB 1TEYA 4MCYA 3TXAA 2RCSL 1LK3L 4L29A 2F8OA 4NFCA 1E8XA 3CBKB 2BCKA 4FJZA 3KPMB 4QDGA 1CXEA 3KJ6L 1OAYL 3HE6B 2CR6A 1U8LA 4GSQA 4KK9C 3HZVA 4XPTH 1KB9J 2N0KA 4MNGA 5T1DL 3WSQL 4GOSA 2XQYA 1JPGB 1E90A 3NN8B 2PNDA 1TTUA 1ACYH 2WNKA 1AZUA 5HVHC 1QW9A 1F4XL 1X5YA 4QHUB 4JHBA 1FFNA 3QIUB 2YKKA 2C9XA 2NX5E 1P7QA 1OB1A 3SE3A 2AAVA 4X6BB 3P77A 4P57A 5GRJH 3WFBH 4ES8A 1KC5H 2BNQA 4UYQA 5IVXE 4AGPA 2EABA 3CMOH 4B3EA 4EQ3A 1OAJA 2WQVA 1SJHA 2C4FT 1WAAA 2VABA 2ZKHL 3CH1B 3ZE0B 4DZ8B 2CHWA 3BW9B 1A7PH 1R33A 4KQ4L 1ZA6B 5C0ND 2VLRA 4JRXD 4E42B 4WUUD 2X1WL 3GSXA 1NGYB 4YEFA 4FHKA 4L23A 3CZFB 3LAFA 4OZFG 2DM4A 5FA3B 1A8ZA 1UEMA 1QQDB 1RJYA 3IS0X 3QNXA 2F58L 3FQ4A 4MYWB 1GXEA 1UQSB 4AXWA 3CN1A 1P9MA 1URZA 3DKHA 1DUYA 3KPNB 4NPKA 4A2GA 4HJSA 4PV9A 4AX3A 3KM2A 5E8NB 5TF0A 3QXDB 4LSTL 2VQ1B 2WKOA 1BQLH 1UJ3C 3MRGA 4WKZB 3I50H 1QTPA 3MMEB 1EAOA 5JMOC 4JPWL 2BIQA 1U8KB 3AAZA 5GZNA 2KMWA 3BT2H 4Z76A 3BP6A 4ZW8A 4OQTH 2OMTB 3WS3A 3AXLB 3SYPA 1FDLH 1M4KA 2VDNB 2Z7ZA 3BQUC 4OFIA 3SDAD 5JZ7D 5JA9A 2AXFB 1E9OB 1QUNA 1DN0B 1OF2A 3CFMA 5HI4D 1UH4A 5AAWC 2BZ7A 4HLEA 4HF5H 5I6OA 4DP5X 5DD0H 1GYVA 1FVEB 2WCSA 32C2B 5HVWA 5AVXB 1M7IB 1XB6A 5LXGL 2R0ZL 3ILPA 3ZOAA 2WTRA 3OHXC 1A6AB 3LNFA 1HK6A 5DHMC 4HUVA 2EUXA 3Q2NA 1PKQA 2B5IC 1KJ2L 3R06A 1RUQH 1N2RB 1ETA1 3T3MF 3K2UH 1BM3L 3ZJAA 1QEWA 1CFTB 2ZWNA 3G5ZB 1W15A 4TSBL 5I18L 4ODUA 4ZMZA 3IJYB 4MZ2A 2FLRT 1U9KA 1ZVSB 2GSIB 4BQBA 2I60H 1IVTA 2UXVA 2D0FA 2BNUA 1CFSA 2CKBL 1NKOA 1KBPA 1E43A 3KLHD 3IU4H 4ZAKD 3QORB 4N9GA 3TO4D 3I85A 4FP8L 5C70A 1GGBL 3BEWB 3O0RL 5DC9B 1DYZA 1V3MA 3V5KA 2LU3A 4JJ5B 2EIDA 3UBHA 3I9PA 1BYOA 3WENA 1HKLH 1BG9A 3MV7B 2LE9A 3TCTA 1DBAL 2WCGA 2VDOH 1COBA 3QA3B 5K5YA 1WZ1L 4H88H 2ZX9A 3GLEA 2F0CA 5LAXA 4HEPA 2VLMD 4NKMB 3JV4B 2LU5A 2E8ZA 3QIWB 4HPYH 4XWGL 4ENED 1SHXA 5D7IB 2EDKA 1RZJH 5A7BA 2VRAA 4P23A 2R2HA 4C4KO 4G9DA 2Z93B 5C71A 1T0PB 3EYQC 5AB2A 1OP3H 1FJ1A 3U2IA 4EUPA 5TE6H 4G1MB 2AXHA 1NGXB 1W0WA 4XO8A 3BN9C 3W3BA 3C5ZC 4PJXE 2ZSVA 3MR9B 3CFEA 4JO3L 4RAUA 4AT6B 4FNLH 5JHDE 4G8FA 5I0XA 4RGNB 3UG5A 3I75B 4XN9A 1QHOA 4CSSA 1XD0A 3O45B 4OCRL 5K9KA 2XPZA 2EE9A 3PU7A 2H1XA 2ENQA 1UC6A 2MWCA 4NP4L 4WO4B 1KG0B 4EDXA 1W72B 1U3HC 1GAFH 2XNAA 4MB1A 5C0AE 4K71C 1KB5H 4I0KA 2WWKT 2IOMA 4PLJD 3L1OL 2DQJL 2P9RA 1RI8A 1TSHA 2WVSA 5I2IB 4GRLA 3V7AG 2B08A 2DICA 4X80H 4OBRA 2IQ9L 5F7DB 2O5XH 1A4BA 4PJBE 4IOSA 2YZ1A 1MCSA 3QDGB 4WNJA 2XBDA 2Q1EA 2VMJA 4FQCH 3RIAF 2EH8L 2EE6A 4K7FA 5CMAB 2ZJSL 1JRHI 1GHFH 3OC8A 5TK4A 5K59E 4LVEA 5JQIB 3RY6C 1RY7B 4M6NH 4KI1A 5FYKL 2F8XC 4L5FE 3ECBA 1UT2A 4TSCL 1RSYA 3WUZA 1F90L 3DI2B 5CZXD 5F6IB 3LPFA 4A63A 1JJUA 3FU7A 4HBQA 4KHXL 5C7ZA 4DQOL 4M93B 5E1GA 3REVB 1GGCL 2WBXA 1IAIM 4U1MB 3MYJA 3VRIB 2Z7YA 4FQQA 3QQXA 2X6BA 4Y4KC 3QUYD 3AMLA 1FYHB 3DURA 1XDTT 4JHUA 4WLCA 3G5XA 4P04A 1CD1B 1JUFB 1NPNA 1QTYT 1OSZB 1IGYA 1QFWI 2CKBB 3KYOB 5CLZA 3IPEA 5IVOA 3L3KA 4IMKC 4OZHA 2CLVB 1UM6H 4Z7UF 3CFKA 1JD7A 4W9CC 1A9VA 4FQ1H 2OL3B 3L5WB 5JOFB 1SJXA 2ZOUA 2GFBA 4J4PC 3MLVL 5AG8A 1KIPA 3UYPB 1ZSDB 1YEGL 3F6JA 4ORZC 3U4EA 2ZOOA 2AQPA 4N6RB 1OQOA 2FJHA 3FT4A 4QI3A 2AXGB 3VM5A 5INCB 4BXVA 2FIKB 2HYMA 2VDLL 4MNGE 4U3XA 1JWSB 2PTUA 2VLJE 2YAHA 3KS0H 5AUMA 5C0CD 3TPUB 5E51A 2J5LB 4NBYB 1QBLH 3UIYA 3KPRB 3MRMA 3LH2L 4LDLB 4WVRA 4BZ1L 3GI8L 3UTTE 3NJVA 5C97A 4TOYL 3P0VH 1SBSH 4PJCB 3WU1A 2BNQE 3L3JA 2X4RA 5AW9B 3T2QA 3S35X 2KDGA 4H2AA 3RX8A 2ICEA 2AQRA 2FAUA 2NNXA 3UDWA 3HFMH 1DLHA 5DHVH 2HPTA 2YKLL 3O6FD 2PXYC 4Y8AA 1CBVH 3ZDYE 4U1LB 5F3BB 1S7VA 2VW6A 3WNLA 3IU3A 3ZSTA 4QY8A 4ZBJA 4EMZA 1ND0A 3FQRB 2VL5B 3T6ZA 2YD6A 2ZPKH 1N0XH 1P53A 2WXRA 4O9HL 4B9GA 3V8OA 4FLQA 2ZX6A 1OSPH 3DBSA 1G1KA 2I27N 3QAZC 4FQ2H 4U1JB 4NWUL 3VA6A 1MREL 3BD3A 4LRNH 4DOHE 3CFCL 3HI5L 3L48A 3NTCL 4ODHL 4PRBA 1YYLH 1I7ZA 3OHXA 5A3IC 1NC4B 2VN6A 3MBED 4UAOC 3QEHA 2IAND 3O4LB 4E9RA 1DVZA 2F6AA 3S37X 1ZTMA 1CFVL 4UM9D 1DQMH 2XVGA 3JVGA 2AJSL 4NYLA 5TPWL 2OLDA 2AJUH 4KVCH 2DWSA 1EO7A 4EN2A 4DVBA 3C8DA 4KI5F 3PWNB 2OI9C 4IYKA 2Z3FA 4GBXD 1HDMB 4ZXBB 3UJTL 1ET7A 4QXGH 2C26A 4RFEA 3VH8B 1FFPB 3EOBB 1QLRB 2WQWA 2OMBA 4I4WB 3ARQA 2Y7NA 5L0QC 1XXDC 3FUDA 4WW1B 3EJRA 5LCVL 15C8L 1EHNA 3K2IA 4XNYL 5HHQA 4CNIA 2X88A 1GL4B 1IRAY 5B8CB 3CK0L 5I8OH 3RAJH 4U6TA 2GJPA 5JO5B 3ZRCC 3LXBA 1I1AB 3L9YA 1SXCA 3U25A 1MLBB 4OR1A 1PKQE 5DU7A 4HW6A 5MI0B 5DJAA 1DQKA 2VC2H 3S35H 2SODB 5I6KA 3LV3B 3K0WA 4KKLC 4ADJA 3T6WA 2LAAA 5DQDH 2ZCKL 2DOCA 4JB9H 5C08D 3EYVA 1GY1A 3NEEA 1H6EA 4Z78B 1T03H 2VQTA 5KVFE 1RZJC 3NJXA 4P2YA 2GITA 1MFDL 2APBA 3JTBA 3SQOH 3PDOB 1D6VH 3N85L 4NNPL 2N0MA 2VDLB 3MJGX 3APFA 3QQ9C 5C1MB 3C60C 2WW8A 1PD6A 2H9GB 2IAMD 5J5EA 5BS0A 1AC6A 5JORB 2LFGA 4M56A 2WBJD 5DRWB 3RQ3A 1B2YA 1TQUA 1CU4L 3H7LA 3QCVH 3GGWA 4NQSA 4POZC 1NANI 1ICTA 5D6CA 3VI4E 2AVFA 4ONFH 3S37H 2WNGA 4NZUH 3FT2B 4PG9A 3SQRA 3VWKB 1IKOP 5CJBA 5JIQA 2F19L 1GJWA 1OGAB 5ENWA 3BP5B 4BK8A 1XL4A 5F9OH 3STLA 4WGKA 1BAFH 5DHEA 4A55A 4F9LA 4JO8A 5FLUA 1GCYA 2ZCZA 3G5YA 4HIXL 5T5FH 3OZ9L 3R0MA 2W65A 4UTBL 1AGDA 3NCCB 2XZCH 1AH1A 2FRGP 1F3DJ 5AALA 2NXYB 5TFSH 1B4LA 3RWHB 2OMVB 4JR9L 4M7JL 3BIAX 1KWGA 1NBQA 3P4OA 4B97A 4DKFH 4GIAA 3D0VA 1J5IA 3NJGA 4FQXB 4DK3A 3B9EA 5CGYD 2XPYA 1VKXB 1EFXB 2WTPA 1SJVA 3LPPA 1J5OH 1OO2A 5AVVB 5KSBA 1V7MH 1M7UA 2CRMA 2GK2A 4QOKE 4JDVA 3NZHL 2VDML 2VR9A 4GXFA 4U49A 4XC3H 5LJYH 2X05A 5J4MA 1RIUL 3FSWA 4U1HB 3RVXD 5BVJB 2ITDA 3Q05A 3SBRA 2AJZA 5T8IA 4GUCA 3TEUA 2FJFA 5LBVA 3HR6A 4MGXA 3GSNA 3R18A 1MG2C 1XF4B 2UUDH 4YX2L 3PGFL 4LKXA 2VXQA 4C4BA 3HCVB 2DYRB 3KPSA 1JRHL 2UVFA 4HCIA 3ZK0A 1NIBA 4MCYB 3NMEA 1AJ7H 5HHOA 3DXAA 1BEYL 3EJZC 2HFEA 4L29B 1YY8B 2P24A 5CJOH 4O2EA 4WHTA 4L9LA 5LUMA 5SX4I 5CR1A 1DN2A 4AQ1C 2NY1B 1U8LB 3D30A 5DVMA 3HUJA 1U93A 2HN7A 3N9GL 3HZVB 3AG4B 5IB1A 4QUOA 2G3MA 2WUCL 5I9QB 3FN0H 3NJFA 4P5KA 1AGFA 2AK4E 1UD3A 3RVVC 1P7QB 3KEDA 4Z7NB 3FB5A 3D39A 3B3IA 1OT2A 2WYTA 5IFHL 5E5MA 5GJTH 1W8NA 2XI9A 3KBPA 1QFWL 1SJHB 5B7MA 3FQWA 3BSZA 3DIDA 4ODVH 1QABA 1F4YL 2VLRB 1DBML 3RWEA 4OLZH 2AJYH 2V3DA 3GSXB 4EBQL 4JN1H 1P5VB 2HRGA 4JQIH 4LAQH 4X9HA 1RJYB 1VFUA 2WZAA 3QNXB 4RIRA 2KLTA 5IFAL 1GJUA 3FT3A 4ZMTA 1P7KA 4QRQA 2YEVB 4PRPD 1EPFA 2CIKA 5H37G 1BPLB 1QZ1A 4FTVE 1YHPA 3JYBA 3V0GA 4HOMA 1NCDH 3RX5A 4P3CL 3ZE1E 1BYNA 5LGHL 1UOVA 4PV9B 1QFUH 2B1AL 2E86A 2YQBA 4M02A 1T7ZA 4AEHL 1RIHL 3MRGB 3GHEH 5E23A 4F5CA 4LVOC 4OFQA 3QWRA 2VLKB 3AAZB 3ULVL 1GGYA 3ZR5A 4Z76B 3BP6B 5EO9B 1Y1UA 3WS3B 3K4AA 3MN8A 2V9TA 1JFHA 3Q44A 1EEZA 5SV3A 2RALA 2XWZA 4BQCA 1MCBA 5DJZA 3O6MH 1OF2B 1R3IH 1E28A 4OAWB 5CEZL 1UACL 3WMSA 1XSIA 4PWFA 2VZUA 5KW9H 1AACA 3EO9L 4LB8A 5FO7B 2CBTA 2W94A 3ILPB 2WTRB 3ABMB 3TEXA 5IJDC 3UC0L 5HHMB 4X4KA 5ICZA 5E8OA 3NH7L 2VXUL 3R06B 2DL2A 4LARL 3H2QA 3GBNL 4F15C 4M8QA 3SOTA 4S1RH 1K4CA 1FZOA 1QEWB 2EEDA 4Z0BH 3AZUA 5IREA 1ZHBA 2HLEB 2OR9H 3KL3A 5KVEE 1NEZG 2IPTL 4IBTA 5DZPA 2ZXDA 4O2CA 3LIZH 3PP3H 4Y4FD 2NY4C 1CFSB 4K94L 1KLGA 1CO1A 1MW2A 3GPSA 5E2JA 4NZRH 4N9GB 3HRZA 3MUUA 4LLUB 2WK2A 4H13C 2EH7L 3NCJL 4D9QE 5GSVA 5JIDA 1LEIA 3Q48A 5KVGE 3OKNA 2Z65C 4P4KD 4GW5A 1P5UC 3RWDA 1DBBH 1I8LC 3BVDB 4WWKA 1G84A 3OX8A 5EEVA 4P2QD 1N5YH 3QUZD 1LMIA 1Q8MA 2B3RA 2B39A 5D93C 2JFCA 5IJVA 1JYNA 1SVCP 1KB5A 5LAXB 5J11C 4NPYA 1QRKA 3BP4A 2OMYA 3VXRD 1JNNL 1M2OA 3BISA 4BFNA 4FN0A 5AB0A 2EVHA 3O3BA 1A25A 2E9JA 1MZZA 1URIA 3G6JA 4M3JA 3ULSA 4AQEA 2QSCL 5E9NA 4HD9A 1DUZA 4M1DL 4P23B 2NMSA 2GC7C 4G9DB 4LCWE 3FYEB 4J8RA 4RX4A 1FJ1B 1HVXA 4EUPB 3UBXA 5CJ5A 1W0WB 3LS5L 2J8UB 4N2BA 2ZSVB 3SGKA 3DLQR 3I9GH 4YFEA 4RAUB 1G6RL 1NLDH 4KDTC 3VXQA 4G8FB 2UXTA 4KROC 4TQ8A 4DPCX 1UWYA 4R8WL 5K9KB 3RKDC 3C6LC 1JK8B 4HX1A 4EDXB 3DECA 2FEDD 4B9KC 1FIGL 4Y2DD 1FAIH 3GZKA 1GMIA 4GXVH 4RFNB 3I2CL 2WXFA 1LYQA 3PJLA 1IKNC 3GRWA 3D85D 4EPSA 4GRLB 1SUHA 3VU2A 3A6CL 4KU1A 3MLUL 4S0HA 5H8DA 4UDUB 3ZHNA 4AMKL 3BFQG 3QP3A 1RKRA 4OI9A 3CSPA 2CLZA 4YPGA 4OM1H 3UZEA 5C0BD 2WAQA 3BWUC 5TH2A 4HP5A 4K7FB 5BMFH 3SO5A 1IC4H 3OGOE 3ATDA 2QVKA 3QJUB 5GRXG 3ARTA 1USZA 4CAGA 4DESA 1RFDL 4TPRL 1WBXA 3ECBB 2CQVA 5HDOA 2EEBA 3P4LA 1FL6A 3QXAA 4LCYA 4NKIL 2F53E 3MLSH 1G0DA 3DTUB 4R7DA 2VN4A 5JUEL 4A2EA 3RTQA 2QV4A 1BOGA 2GBUA 4I7ZC 2ZOKA 3NSCA 5TQ0L 1AO7A 3O2DH 5BV7H 4FQQB 1NZRA 2WM0A 3ASWA 2XJKA 3MRNA 4N24A 4LBAA 1NAMH 1DVUA 4GI8A 4GI9A 2UZXA 3DURB 2R4RL 5L2JA 3POHA 3K8KA 2AKRA 2JB5H 3G5XB 3LS4L 4HLJA 3BIBX 1IEHA 2H6OA 4Z7QE 1IGYB 4PJ9C 4XAKD 2WLHA 4UIKL 4WFGE 3L3KB 3WIFA 4OFYD 4OZHB 1IE4A 2OBGA 4ZMOA 3D6GA 3AG2B 4FL4B 3KPSE 2QVMA 3CFKB 1INDH 4K2UH 1T3FA 4NQCE 3RWFA 4TLSA 2J7LA 2JJTA 1D5IL 3BH8A 5CJQL 1EFQA 1RVFH 4HWBH 2GFBB 4R4BA 2DJMA 1KIPB 4BV1A 5DI8A 1KB9K 3EH5B 2VDRH 1ASOA 3OPUA 2IF7A 5CZKA 3CC1A 3U4EB 3UTOA 3FT4B 2FJHB 4QTIH 1HFUA 3QBTB 1R0AL 3HUJE 1TPXB 2KZKA 4HETA 1IKFL 1SMDA 1U30A 4P5TD 2A6DB 3AT9A 4PJAE 5DRZA 4JY4A 4Z7WB 3ZUCA 2VDKH 4W4OC 3MRMB 5EU7E 3QUMA 3UTQA 3TM6A 2X89D 4OZIA 3BFOA 3IDUA 4Q9QH 1MRFH 4N2AA 1EIBA 3L3JB 2X4RB 1ID2A 1UXSA 2HZHA 2FTAA 2ICEB 5IM7A 1T83A 1FYTE 3C5SA 1DLHB 3HNSL 1G6RB 5C09E 1R4XA 4DEWA 3EXJA 3PF2A 2MQCA 3VI3A 3FCBA 1X5GA 2NY6C 4XAWH 5DRXA 5JHBA 2E6PA 5EH1A 3BQUB 1S7VB 1MWAH 4KRPB 3IU3B 1ND0B 4PGEB 3GMOA 4Y19A 5CP3A 5IGXL 1BPVA 4NI6A 4U7MA 4W93A 4HUKB 3ZO9A 1Z9LA 2NDGA 1IE5A 2C3XA 5DD5L 3JT2A 2KZWA 4HWNA 1A3QA 4I5BA 4JFHE 3RVWD 4R26H 5HDBE 1L3WA 1TENA 3IMUA 4UQ3B 1I7ZB 2CSPA 3OHXB 4YDVA 1WTGT 1KIRA 1L6ZA 5CLWA 3KE0A 4X7FC 3SE4A 2B5IB 2Z92A 2ZX8A 2X4TB 5CN1A 2NY2C 4YR6A 1MFCH 4NYLB 1Z0MA 3N43B 1WSST 4XPTL 3PWPD 3AWEA 3AY4C 4GQ9H 4NO2A 3CN3A 4ACTA 1OAXH 2CO7A 2YQGA 4DVBB 4KNSA 4C57C 3ARRA 12E8H 3U30C 1I9IH 1ACYL 1Z6JT 5DEZA 3ZE0F 4RFEB 5GGVY 1YMMA 3QQ3B 3WFBL 1BG1A 4ZD3H 1KC5L 5HHQB 4CNIB 4PAZA 1E27B 3BO8B 2VYRE 1BBJA 5GS3A 1A7PL 3PAZA 3SOBH 3X14A 4YSEA 2XCMC 4KKAC 1LGVA 4KRNA 4W70A 4NO0A 5DJAB 1F18A 4ODBD 5IQNA 5J13C 5K9JH 1MJ8L 1A7BA 2BSEA 3JUYA 1F45A 3VB8A 2ZXQA 3I6SA 3EYVB 5SV4A 4QNPF 1S3KH 2G2PA 3EHBD 1PZ2A 2GITB 1MQKH 4UMSA 3UADA 5L8KB 2E59A 4MAUH 1BQLL 1DFXA 5T5FA 4BGLA 1S9VB 5D1QD 1RK7A 2VNCA 2QR0A 4HKJA 3V6BR 1CDGA 1E7VA 1JL8A 2APWA 2BVUA 2HJFB 2F7IA 2XHNA 3OAZH 5BS0B 2UZYA 3CVIH 5KBMA 3L7EA 4OQTL 4NQSB 1NBYA 3GGWB 4GKSB 4QIRA 1FDLL 2AANA 1E3ZA 2DI9A 3ZDZB 5D6CB 3IDMA 3FT9A 1Y6MR 2R7EB 2XWXA 1KTKE 3CPLB 3EJPA 4RAHA 4ZOCA 4PG9B 2YJLA 4BWTA 1IKNA 4HF5L 2RIKA 5DD0L 5TGBB 2Z34A 5ENWB 5A6IA 4FDWA 3MNMA 3MRQA 3INUH 3Q6FA 1T5XA 1YN6B 2EZ0C 2IWKA 1OP5H 5DK0A 5CZRA 2B15A 3G5YB 3IBOA 3KGTA 4H20H 4L3EA 4NCDA 5AYTA 4BFBD 2W65B 4L1BA 1AGDB 3HBQA 1RUQL 4AV0A 3JT0A 1UWXK 3K2UL 1KWKA 4G7RB 2GEQA 1YEFL 4WWPA 2LR4A 3I3DA 2IV9A 3DSFH 3BVXA 3ZO0A 5FYJH 2EYRA 2BIIA 1CYWA 3P4OB 2WYZA 3QHZH 1FVDA 3PG2A 1E5UI 1RURH 3BT0A 2I60L 5LXVA 5LNGA 4NIKB 3WIHA 4JKPH 2P3YA 5H35A 1R3LA 4KKBC 1A9BA 4XCCH 4YLBA 5KSBB 1N4XH 2CH8A 3FU3A 4AK1A 4JDVB 4MWFA 4MXQC 5BV7C 3AQDA 4IKNA 2H5UA 2VTFA 5JOPE 5C0JA 3RHWF 4JREB 1CICA 1HKLL 4LCUA 4ZMXA 1H6TA 2ITDB 2AJZB 5D7IF 2FJFB 1NCBH 5E5UB 2FSDA 4G6AC 3NCEB 3GSNB 4Q6YA 2XWJA 5TK2A 5ITBH 2H6UA 4M00A 3MRJA 4BUGA 4LKXB 4OVVA 5KVFH 3U6RA 3ZW3A 2HTKC 5IBTH 1NFKA 1RZJL 1DQIA 3MA9H 4EOWH 3ARZA 4XCEA 3FRPG 1XHHA 2FWUA 3QG7H 3DXAB 5AZEL 3TBYA 1VERA 2HFEB 5HHOB 2OXGA 4UIMB 5TE6L 2L04A 1MHCA 1HYRC 2CMRH 4O2EB 4U1IB 4WHTB 4L9LB 4JE0A 3EFDH 3BH9A 5FW6A 5BZXA 3FSOA 4UILH 2HN7B 1EBPA 5IB1B 1GYAA 2HVJA 3B2VL 3B34A 3MQIA 5AOMA 2C7UA 3HMXH 3PHOB 4J2QA 4NCC1 2YQ3A 2OW6A 1ET8A 1U2HA 4FC3E 4P5KB 5GRZA 3BAXA 1AGFB 1JZGA 2F74A 3E2HC 4V1DD 4C56B 2ENJA 3FB5B 1KB5L 3FU5A 4IRJA 5D1XE 3D39B 5GS0D 1RZGB 4Y1AB 3V79C 1EJOH 3T0XA 5FV1L 2ZAGA 3QS3A 1BAGA 4X80L 5ISZD 5F1KC 3RWEB 3VSQA 5EIIA 4NENA 1IU1A 5I6NA 5BRQA 4FQCL 1OCOB 5TJWK 4DPAX 4PGDB 3MTRA 4RIRB 2DIJA 3CCHA 1GHFL 4N9OB 3O8XA 3C75A 2VDPL 3H9YA 3QAZB 1JFQH 1P7KB 4QRQB 4PB0H 1FFOB 2CIKB 4QR7A 5ACZB 1SY6A 5CJ8A 4EZKA 2X09A 2V7HA 3C9NA 1AZCA 5FYLE 2R29H 2UXGA 4UAOB 1IM3D 2BRQA 1KCRH 4X5QA 5ICXA 1WWWX 8PAZA 2A74C 4KUCF 5E5RB 2D7PA 5E9DD 2EEAA 4RGMB 3UBGA 4XP5H 1E67A 2HMID 4HWEH 3G08B 5LBGA 5I73B 2X2IA 3FCGA 3VI3E 3E8UH 4LLDA 4TTGA 3T3PB 3WTVA 4BCYA 4KH9A 4X4YA 1FNFA 1EJ8A 1K8DA 1XGTA 3BKCH 1EEZB 2JKWA 3GHPA 3S2CA 3LIZA 4JS7A 5B1JA 5DJZB 3RVTC 3T4YA 4YBQC 3DRTA 2C3HA 1ZV2A 1E28B 1UM6L 2VH5H 4KXDA 4OM0H 3GMQA 4PSPA 5DLMH 4GUQA 2F15A 4FFWD 2DQHH 2HT2C 2WLLA 5EB9A 1A6TA 3ZKQD 5HI5C 4GG6A 1XH2A 3N91A 1Y0LA 2VDOB 2DI7A 2QLYA 2FWLB 2PPAA 1XCXA 2E7HA 1OLLA 4K8RD 1TVBA 3AW5A 1WHPA 4YDLC 4OZFA 3MLWH 4MNHA 4HZ1A 4M8QB 4JDZA 1P0SE 1K4CB 4UOW1 2Z91B 2R15A 2PW2A 2AERT 5H94A 3TZVC 4LSQH 2QTVA 1ZHBB 3Q0HA 2EDEA 4PFEA 2XWCA 1JNLH 5HYJD 4JZOA 1VJSA 5AW3B 4EEEA 4I9WE 4TQEL 1HNFA 3P0VL 4O2CB 1WA0X 5LBSL 3I3EA 4PG2A 3JXAA 4OD3L 4DAGL 1PLCA 4MD0A 2GTZA 3HRZB 3HFML 5CAYB 2A6JA 1LEIB 4N87A 4OTXH 3OKNB 4ABUA 2DQIH 1KCVL 1ZT1B 3RWDB 2HRHA 1CBVL 4WWKB 5BO1H 2X5PA 1QSZA 4UQ2A 4CSZA 2G9HA 3OX8B 3BKML 3QIBA 3TIDA 1DCEA 2ZPKL 4FLRA 1IQWH 5IJVB 1N0XL 4GW4A 4MB5A 1KB5B 3NRFA 3FYIB 5C0EA 1UHVA 1OSPL 1V7NH 2MHAA 2OMYB 3BP4B 3IMWA 2NXZB 4G80A 4LRNL 1S2EA 3G6JB 4D7BA 5H37H 3IBEA 4Q2ZA 4AQEB 1YYLL 3QEUA 3ARSA 1DUZB 2E75C 3LB6C 4HUXA 5K33A 2D3LA 4PP2A 4J8RB 3FHEA 3AM8C 2X4PA 3F64A 2JKXA 3UBXB 3B83A 5F96H 3HJ0A 2MCG1 2OX5A 1DQML 5IMLA 2X4NB 3HTLX 2AJUL 2W60A 2Y7QA 1MHPH 2J72A 3AB0C 1A6VL 3JTTA 4OFDA 3S3BB 3G5VA 2WVVA 1AANA 3Q1EA 3BD4A 5IF0A 4PY7A 3W1ZA 4HX1B 3RX9A 4GSUA 4K55A 4BSVA 4KMQA 1VFAA 4ZMPA 2RJMA 5JPNA 1K5WA 4Z1PA 4HHAA 3PREA 1EEYA 3VUAA 5I8OL 3RAJL 3TJHD 1NAMA 1FUNA 3IN2A 4L3EE 5AW0B 2BIMA 2W9EH 1U8HB 4EN3C 3GMRA 3ARDA 2CLZB 4IU3A 4JN2B 4MCZA 4MQSB 4YPGB 5E6RB 3S35L 2BHFA 5TH2B 1S9WA 2XY1A 3BGFC 4TLKA 4LIQE 5EU6D 4J3OF 1E40A 2CBQA 5DQDL 1CB4A 4Y5VA 4IGBA 4YVNA 4NQUA 3IJ9A 4HWBA 3QPQD 1T03L 3RB5A 4FEIA 2F54D 3HI6H 3QXAB 1CGTA 4KXZH 3GBDA 3ARUA 4LCYB 4MSWA 3T8MA 4ERSH 4TVPE 1D6VL 3MOBH 2RB8A 4R7DB 5BZZA 3RTQB 4EKJA 3NSXA 1JHLL 3BYTA 1AO7B 3WKYA 4I0PC 4RMTA 4XVSH 2XKNB 4MDIA 3MRNB 5EF2A 4FMFA 2VXSH 5FO9A 2UZXB 3CVHA 1MCLA 2AKRB 3I6LD 1VEPA 3NFPA 5T3XE 1MRCH 4GKNA 4NO5A 1LMKA 5DZOA 4ONFL 1JXGA 4NZUL 3N44B 3WIFB 3IJ7A 3QZWA 1CGXA 1ZJBA 1BGXH 3FH7A 1T3FB 3RWFB 1ZEAL 1I3UA 4X99B 3BH8B 3WJJA 1U58A 1YEJH 3CZGA 2I5YH 2BSCA 3FMGH 5F9OL 4GI6A 2EO7A 1ETZA 4UT9H 3U46A 5GGTH 1BQUA 1ZT7A 5K59F 4IDLA 1J0KA 1ZPUA 4NUMA 5KOMC 3UC2A 5F97E 2XZCL 5IIEA 4L37A 4JBSA 4JY4B 3KYNA 3CFIC 4UDTA 3QUMB 4XI5C 3UTQB 4DKFL 5KSAA 2HPOA 2J20A 4IOFD 4QKTA 1AC0A