3KBHE

Crystal structure of nl63 respiratory coronavirus receptor-binding domain complexed with its human receptor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
121
structure length
110
Chain Sequence
b'HTDINFTATASFGGSCYVCKPHQVNISLNGNTSVCVRTSHFSIRYIYNRVKSGSPGDSSWHIYLKSGTCPFSFICFSTVEVPGSCNFPLEATWHYTSYTIVGALYVTWSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiotensin-converting enzyme 2
publication title Crystal structure of NL63 respiratory coronavirus receptor-binding domain complexed with its human receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 110
sequence length 121
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3130 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kbhE00
4F5CE 3KBHE 4F2ME
chains in the Genus database with same CATH superfamily
5C08B 3MLRH 3EJTA 1R34A 5IFHL 3MV9E 2H3NB 5E6RB 4GG6A 1QO3A 2QR0B 1AACA 5AYUL 1AJ7H 3MOQA 4RX4D 3SYQA 4BCZA 1XMEB 3RDTB 1A25A 1INEH 43CAB 1JWSB 3GBMH 1HSAB 3MLTB 2AF2A 4I2XA 4J12A 1E8ZA 4KQ3L 5DJZA 3GSVA 4DEWA 1WG3A 5EOQL 2WM0A 2RIKA 2YXWA 1T1YA 3ILDA 5KVDH 2HMID 2PCPB 1OM3L 3WIHA 2ATPA 3RVWC 5T8IA 1G0YR 4OD1L 4YHLH 3E8UH 3QQNA 2V8MA 1UFUA 4N8VA 2AK4A 2NSMA 1KTKE 3U6RA 2J1KA 4FG6C 5FM5M 4LHQB 3H53A 1DVXA 4B50A 3T9WA 4PG2A 2G3NA 4IJ3B 4ADIA 5IZ7A 3B2VH 4PV9B 1QATA 3EH4B 3FPXA 4KMTL 3TF4A 4Z8FH 1YN6B 3HB3D 2Y72A 2JTYA 1L9TA 2EAEA 4XWOD 2AMGA 4F7PB 1T83A 3F85A 4DZ8B 3MRKB 2J55A 2PR4L 2ZXQA 2R39A 3KLAA 3T0BA 4JO2L 3WY4A 1KYOK 2YGOA 4NRYB 5AL8A 5HHVL 1P69B 2JTDA 3JSSA 3VMOA 2BRRH 2G3MA 2A6DA 4L0YA 1YJDH 4XBPA 5C07E 5KBKA 2JCCE 3UMNA 4HPYH 1NH6A 4G9FA 1Y0LB 2YPLE 5AD0A 3VG9C 1KXTA 4LDCA 2H1XA 2DKUA 3AWFA 1G43A 2VXVH 2YD5A 4KRPC 4ZW8A 2CA4A 4RSVA 4YLCA 1L9MA 1JXJA 3C8DA 4DKEH 4QYOB 2PABA 1RLBA 4I18C 4QUOA 2EVIA 4GBXA 2Y5TB 2RD0A 4HSQA 1NC2D 3CDFA 1OAQH 1WZKA 1CLZH 3MRCB 5CZKA 5T1DH 2DJMA 1NCWL 2HJFA 4HPOH 5DJZB 2J7LA 4CRPA 3MRIA 5FK9A 3DSNA 5LBVA 5IJKC 3SPVA 3TV3H 1ZT4B 2AQSA 4M61B 1HOCA 5DZAA 4LNRA 4N8VB 2AK4B 3IU4H 1MELA 2YRLA 1SLWA 4EZMA 5KEZA 3U6RB 2KERA 2VXSH 2X9ZA 4W6YB 4KRLB 4U6YB 5I74C 2DTMH 2E7LA 1B88A 4U6VL 1IGIH 4UINL 2E75C 5C0CB 4TXVB 4NUGL 1KUMA 2D9QB 3FRPA 1NCAH 3L5WA 1TCMA 1ID2A 5C0EA 2ICWI 1PZCA 2P7TA 1OAKL 1Z32X 4YUEL 5FW6A 3ZE1B 1Z3GL 5FOBB 3U4EA 2FDBP 1DEEA 4G6AD 1MFBL 2WO2B 5B4MD 4GMTH 1P7HL 1GTNA 3C6SB 4AQEB 1G9MH 4JPQA 1UOWA 5KVMC 2J8HA 2WIIB 4WFHE 4XPTH 1U8OA 4Y19B 4CNIA 5H2BB 1TYJA 5HI4C 1CFVL 3QDMA 2DL2A 2HKFL 5C0AD 4NXSA 4L3EE 5AD0B 5IVXB 4ZAKA 1KXTB 4CVZA 3NJJA 4UBDC 3FW6A 2V5YA 5HYFA 5HGGS 4FG0A 3LRLA 4U1NB 4HX1B 2FNWA 1MFAH 1DLFL 1S78D 2WLJA 4HJJL 3L9EA 4GBXB 4WWKD 5G4MA 4KO9A 4X4ME 2OAAA 5GRUH 4LPVA 5DJ2A 5EH1A 5KBMA 3P02A 1GAFH 3JBG7 1BQHA 3WN6A 1M05A 3I9PA 4JHAH 4HT1H 4N5UA 4UNTA 4H8WH 4J3OC 3WO3B 4F33A 3OAZK 3CDGA 3OPZH 4W9KC 1WWBX 3SPVB 1RLWA 1CFMA 4PLOB 4ZI8A 1HOCB 5AQ0A 4RAVA 5F9AC 4RLDA 3EUDA 3JVFC 4NYLA 1HN1A 2QQKH 3UERA 2IOIA 1FYHB 4MB1A 2XVKA 4X9YA 4MD5A 2CK0L 5FFGA 4LDOB 1KOAA 3CDZA 4ZMWA 1AKJB 3NPZB 3TEUA 4BFOA 2CM5A 4X4KA 3FRPB 1TQVA 5C0EB 1NCIA 3UZVA 3AWGA 5EU6A 2BXYA 1DEEB 1CLYL 3BUIA 1ZE3C 3ZJAA 2PPDA 2WO3B 3UAAA 5KVEL 3OKLA 4CBPA 4ERSL 5DMIL 4BFGA 3ARSA 3NIFE 2HRPH 5FYJL 4ZTEA 4OZGF 4OBSA 1PBYA 1BBDH 4AGQA 1I9RH 1U8OB 4F92B 4CNIB 1BAGA 5C0RH 4B97A 5A16B 2EP6A 1MPAL 4DGIL 5BVPH 4U1MA 2BZDA 2BNRD 2FLBT 4CVZB 3K6SA 4LMQE 5ACZB 1KBBA 2DQEL 2KLRA 4TQEL 3HNSH 4KKBD 4N3TA 2VIRA 4EKJA 4U1LA 2R4RH 4FQXB 5DJ2B 4LIQL 1FE8H 2A6JB 2WMPA 3NIDB 1RZ8A 1M05B 3GDCA 3OWEA 3Q44A 3WIIL 1JOIA 1E42A 4KK8D 1KBKA 5AKRA 1PX3A 3CDGB 1RI8A 3FFCB 3MC0A 2G30A 3MV7E 2D3NA 2IF7A 4LB8A 1GOGA 2LOEA 3MVSA 5DJXA 2NZ9D 4XI5D 3MQIA 5DHVH 1FBIL 2HPTA 2GI0A 3OAUL 4GKZA 4ZTPH 2A1WH 1QASA 1SOSA 4MD5B 1LO3H 4AV4A 4XNBA 4F7KA 2UUDK 2CPUA 4JGMA 2J1XA 3SDXE 3EYUH 2PNDA 3RI5F 1MJ7H 4L0PB 3UZVB 2EIZA 2WYIA 5HDRA 2I85A 1AGCA 1A3ZA 1R46A 4IEFA 3EYVB 3OKLB 1JPFA 3FQRA 4WY7L 2YGVA 4HCIA 4XNMA 3QK0A 4R84A 4OTXH 3RIFK 3ZLQC 5L4MA 4JM4H 1YNLL 2AJSH 2CKBA 4UF7C 3NT0A 3U1QA 1AO7D 2BVOA 4HEPG 1TOXA 1OP4A 4UT6L 5FYJD 4ZXBD 1J8KA 4U1MB 4YXHH 4WI0B 5TE4L 1I3VA 3K6SB 3IAQA 1FLTX 4J2QA 4ONOA 3QS2A 3TCXA 5B8CA 5A40E 2IANB 4OV5A 5CAYB 2OMWA 4YZWA 2CO1A 5IBLC 2EINB 3H55A 4E41A 4FJYA 4XAKD 4KVNH 2NXYB 3HZMB 4WTQA 1NM4A 2NY5L 2WYZA 3GMQA 3WJLA 1YQVL 1RZ8B 3T3ME 1R3IL 3RHWF 1OPOA 3II3A 1D2PA 3S34L 1MH5B 3Q01A 1SJVA 5EU3B 3PWPA 4LGSB 3ZUCA 4NZ8A 4DN3H 1LLAA 5D7IA 1GS7A 2R1WA 1F4WH 1PLGH 3MGTB 2ZAHA 3O6LL 4Y1AE 3RWJA 2ZKWA 2GYSA 1X9QA 4PJXF 4AUUA 3GHEL 2GAZA 4HETA 4C4KO 4DERA 2CGRL 1MF2L 3G5YA 4CUCA 3QGVA 4K9JA 4LLDA 5EU4B 3D4YA 4E68A 4AH2B 1E8WA 5EIIG 5CILL 2Y7SA 2ZYIA 4MVBC 3QG7L 3QJHB 4KDTA 3UCRA 1RVFL 3RFZC 4A04A 3KPSD 3WO4C 5T3XL 5F0PB 1IM3A 1BVNT 3BAEL 2HLFC 4YSTA 3OGOE 5KWYC 2EIZB 3GB7A 4A63A 2CWRA 4LARH 3ZTJH 1A14L 4LHUB 1QD0A 1AGCB 3ETTA 2P46B 4IEFB 1JPFB 3FQRB 1ZVHA 1HWGB 2NSQA 2VXQL 4FG4A 4HKJA 4M6NL 4Z7VE 4GG6E 4XNMB 4AITA 4KX8A 2MQ3A 5FB8A 3IJ8A 3OB0H 3CIQA 5CJXA 1MCBA 2CKBB 4ZJ9A 3BDYL 4EUPG 1HFUA 4I2XE 1WD8A 4XNYH 2KDYA 3H2WA 1MRCL 4Y2DB 2R8SL 1XCXA 1C5CL 1AIFA 2ZX7A 3NZ8B 1GZHA 5HGDA 5LDSA 1DN2A 4UMSA 1RZKL 2R83A 5B8CB 4ZTOL 5DJYA 2EE0A 2OMWB 4R83A 5KVFL 2I26N 3ULAB 2YAEA 3F7YA 2BIQA 2BSSB 5CEYB 3V6ZA 4P2RA 4Y4FA 5D1ZA 1K5WA 4EF3A 3UGUA 4ETQA 3F6LA 4PJCF 4KZ0A 5I6XB 1RAMA 4OZGA 5GJTL 2B39A 4N5ED 3RWJB 1U8MB 3VWKD 4F27A 4GS7C 4E2OA 3H56A 3CZUB 3T0EC 3GM8A 4XXDA 1O9WA 1MJ8L 1YUHA 3CVBA 4M93C 4OM1L 5CIPH 5J1AA 3GJFA 4NN5B 2ENSA 4X9GA 3SPHA 3U0WH 1YC7A 2E47A 4G9FE 1EAJA 1PPIA 3I6LD 3QFJA 4S1QH 1UB6A 1E2WA 3JWOL 4KI5C 1RURH 1ETJA 2GJ6A 1TVBA 4MJID 3FUFA 1NGXA 1IBBA 4PJ9D 1T7YA 3U6XS 1NCBL 3UDWA 2FO1A 3I2CL 4RFOH 2H1PL 2DRUA 4E9XA 4R4ND 4OV6F 5E00B 1U58A 2UX7A 1IUZA 4X4ZA 5T3XD 4B7IA 3CHOA 5HD8C 2E9IA 4DKDC 1I82A 3U7AA 1KIPA 4HKJB 4I9XA 3KDPB 3SGKA 5FB8B 2R2EA 3AGWA 3BVTA 2Y06L 4N6RB 4QHPA 3FS9A 4UIMB 2CG9X 1L7TH 3V0WH 3D0AA 3VQMA 3BN9C 4ONHA 2XN9B 1KCWA 3UTTD 4A2MA 5J56B 1J7VR 1GOFA 1PFCA 4MS8D 5HGDB 4HAGA 3BD5A 4MXWH 2Q3ZA 4H1LG 3RILA 2EUZA 4JRYE 4TULH 1VSCA 3MA9L 3FJTA 1N10A 1KCSH 5SV4A 4PRNB 4PGEB 3MUZ1 4F7MA 3DECA 2IQ9H 4OFDA 4DUWA 3D3VD 4QJ5B 3V6ZB 3SGEH 2KUTA 4U6HB 3RX8A 2H0FA 1TTUA 1P5VB 4FEIA 4MRCA 1MCOL 2PPCA 3BSZL 5I8CB 4L29A 4OZGB 3TA3C 3QUKA 4FC3E 1WBYA 2E4FA 3MRHB 1SUHA 2KPNA 4PJBE 3DX8A 4GSDH 5D71L 1WP6A 3TT3L 1DBMH 1YUHB 1Q1JH 2KDGA 4HUVA 2WXIA 1GMIA 1NBCA 1FL5B 3QDME 1J18A 4M1GL 1SEQL 2GFBA 5L9DL 3QFJB 3HR6A 1JN6A 3WGVB 3ARGD 3V5HB 1FZOA 2GJ6B 5DD3L 1NLBL 3MR9B 3A4DA 5SX4H 1MREH 5HJ3A 4Z7NE 5M95B 5E2TL 4EIUA 2WVTA 2FT8A 1KIPB 1N6VA 1Y6KR 3HI1B 3O6ML 4U1KB 2DW5A 2J44A 2X5PA 4ZPVB 4LEBA 2E7CA 3H9YA 4JHWH 4JFEA 3KLHD 4P46A 2RQEA 4ONHB 3PREA 5IHHA 3KVDD 4TUKH 2Y0SA 4IGBB 3SPIA 5JHLA 5DURB 1D9KD 3S35H 4X80H 4PD4K 2CJ3A 5GSVA 3QDAA 5F88A 3PGFH 4ISVA 1U2CA 2QPSA 4PREA 3VH8A 3QEQB 2X40A 4GP4B 2J4WL 1M9SA 2I69A 5C6WH 4F7MB 1OK0A 1J8RA 5C0JA 3TPKA 1M57B 1IKNA 1JHTA 3HFFA 3LPWA 3UTZA 1NLDL 4WKZA 4NAJA 1WPCA 4WUUA 5CD3A 1X6NA 5EU6E 3MLXH 3RP1A 5AW6B 3OJ2C 2X44D 1KBGH 1KGCD 3PHAA 1CK0L 2W80C 1WBYB 2KZKA 3N85L 1UT1A 2R0KL 3DPBA 4XPGL 5DT1H 5ESAA 5HI3D 5C0BA 5EHFA 3ILQC 1BVOA 4AMKH 3DX8B 5JIQA 1O75A 2YAHA 5MHSE 2K6ZA 4Z7UA 2AEOA 2AQQA 1TQCB 3LPOA 3T0VA 3D25A 4FFWC 3SDDB 4G72B 3RWEB 1G6RA 1N18A 4F2FA 4I7ZC 2GFBB 2F54A 4BA0A 2J6EH 2J5WA 5C7XL 2VC2H 2VLRB 5HJ3B 2NSXA 4H44C 4ODSH 1G1YA 4QHMB 5CEZH 1LO2H 4P9MH 4PJCA 5HHXL 4AT6A 3MLYL 2PF6A 3V0AC 3DX9B 2GHWB 3JUYA 4PJXB 3QR0A 4P46B 3DDGA 1GSMA 3LH2H 4P3CL 3ZKQD 2Q2EB 3WNJA 5IV2A 2MPVA 5AUMA 2R0ZL 3VM7A 1N4XL 4LHJB 4KU1A 1OGPA 4KJPD 5GSVB 1T89C 3B3IB 1UWGL 4ISVB 3DIFB 2QKSA 5E99H 4ZUSB 3U0PB 2P8PB 3QDGE 1Y07A 5DJ6B 5DHDA 1UZ6F 3MV8D 3KGSA 4BFIA 1QHQA 3HR5A 1AZCA 3KCWA 2XKSA 3FSWA 4FG6D 2GI7A 3UTZB 5DQ9A 3SB3A 3T0WA 4JY5L 4WKZB 3BZFA 5FYLL 5CD3B 3RDTC 4JJ5A 1QI4A 1ZJBA 5GGRA 2C3GA 4NGHH 4HXBH 3DPBB 5D2NC 5L2KB 5FGRA 5ESAB 4DOHB 1T5XA 3WKMH 1HL4A 3EFFA 4NHUA 1YECH 3WFEH 4BEIA 3CLWA 5C0DA 4E9RA 3ZO0A 2BIOA 4JANB 5F7DA 3SBPA 1T21A 3D25B 1SVBA 3Q8CA 1UC6A 3WXWL 3GSQB 5IBTL 3P0GB 1A4KA 1H5BC 5IHUH 5D93C 2QSCH 1CDHA 2F54B 3N5AA 5E51A 2WZ5A 4O4YL 5FA4A 5EC2A 2J5LB 5AG8A 1R3LA 1S7XA 1A7QL 3AUVA 1TITA 4KK5C 5IHWA 4D2NA 2GSGA 1B0WA 4E41E 3N6YA 1HCVA 5JHBA 2D3LA 2FATH 2WOYA 3PF2A 4KBPA 5C6TL 2WCSA 5A2CA 4AT6B 1CDYA 3KLQA 3WLWC 3WNKA 4ZFFA 2CPCA 2Z7ZA 3MJGX 2AXFB 5D7SH 1XX9C 2IGFH 3LNIA 3PWPE 2ZXBA 2BMKB 3LB6D 4R97B 3SYOA 3TYFA 4K8RC 1JGDB 1GHFL 4PLKD 5D7IE 5AUMB 1CGXA 2C9SA 3EOYG 4ZMQA 3DLQR 4YDIL 1HAWA 3GSOB 3D4ZA 3NEXA 2LFGA 1C1EL 1UFGA 4PHXA 2D9CA 4Q6IC 3N55A 4RX4A 4ZMAT 1SMAA 4BFIB 3EYQD 5LXGH 1JWUB 1MCWM 4B0MM 4J1UA 3UBHA 1DFXA 1HYSD 5DQ9B 3MTRA 2FX9L 4D94A 1X7QB 2QPEB 3R0NA 4MAUH 1F97A 3BZFB 5HPMA 2XC8A 4PS4L 4ICWA 4QRUA 2FUTA 4GSQA 4JDTL 3GMRB 2I24N 3GBDA 5GGRB 4WGVB 3LXCA 3NRPA 4XNUH 3S4SG 3W2DH 3QCVH 2Y5QA 5FYLD 1SBSH 2XZZA 5L8JB 5ETUB 5CLTA 3P4MA 4Z0XA 3LS4L 5BV7B 5F7DB 4HA1A 4FZEH 2OYMA 1T21B 4X5WB 3VYNA 4F7CB 4MCYA 4EDXA 5JLZB 4W6WB 1KB5L 2XG4A 2Z31B 3CVHB 3IDYC 2LGNA 3O6FB 3MLVL 2YEZA 5EC2B 5JIKA 1HL8A 2VQTA 4LVNB 5DEZA 2X9WA 4BFFA 3J07A 2ITCB 5A6IA 5JR1H 2YWZA 3EW3B 3X1BA 5INCA 1UZ8B 2GSGB 3V4LA 3CE1A 2LFEA 5JDJA 3N40P 5GHWL 1JHLH 2OCFD 1QMUA 4WKXA 4EOWH 4P2RE 5GS0H 3WUWG 5FR3A 4EIBA 4POYA 1B0RA 3OG6B 4LAQL 3U6XA 3DSFL 4OI9A 4E9VA 1GKOA 2VDNH 2V2XA 4XPBL 25C8H 4OZGE 2IPUK 2ZOUA 3L13A 5BW7C 4BUQA 4WFFD 3JWNE 1TZ8A 3HG1B 1B0GA 3ES6B 3GKWL 4XXCA 3VQ2C 1T04B 2XX1A 5LDUA 3IDGB 4XO5A 1M6UA 4LCIL 3S8WA 2I60L 5E5RB 3SBWC 5INDB 2R4SL 3ESVF 3PAZA 4OI7A 1R4XA 2DJSA 3QDJD 4XC3L 3VVVA 5J12B 4LL1A 2NW2B 1QFPA 2B59A 1SJEA 1HKLH 3VSTA 2K9FB 1DE4A 1XB6A 3QI9C 5HPMB 1IBFA 4QRUB 3TO4D 1K72A 1J1OL 5FC9A 5ESQA 3SOBH 5KJ4A 1ZMYA 2XVGA 1SXNA 4M03A 4KQ4H 5I15L 1NMBH 4DVRH 2BS9A 2I5YH 2FL5A 5CINL 4P3DB 4JFXA 4XMPL 4O5LL 3V79C 2OSLA 2AANA 2IADA 3QXDA 3CFTA 2YLHA 3ARDA 2YA1A 5KOMC 3Q7JA 4G43B 1TZAA 1CE6B 1ET5A 5KYNA 5SWQA 1HILA 4FL4C 4HV8B 4MSWB 1O6SA 3ZSTA 2ZUWA 3H7BB 2AERT 3HPJB 3VU2A 1S4IA 1I8KB 1UKSA 2XY1A 4OT1L 4E9TA 1EXUA 5T1MB 3QZWA 1B0RB 1SYVA 1MLBA 4L18A 2COQA 3WFCL 2CDEB 3MPCA 3UCQA 3WFBH 2NQCA 2G4EA 5TK4A 1W6WA 3PFUA 3ZDYF 3EBGA 3W9DA 4PJAF 2RHEA 1ED3A 1XGPB 4XCYA 3BRGC 1DLHA 1J5IA 1K8DB 3IGUA 3KVQA 4YDLB 4WENB 4NOBA 3INUL 1JZFA 1KGUA 2WXMA 2YUZA 2Q86B 1ET8A 3COOA 2HVBA 2PTVA 1XXFC 4OD3H 3K2IA 2B59B 1SJEB 3W82A 3DNKA 4KK9D 1IVTA 5F7FA 2EADA 4P4RA 1RFDH 1XWVA 3VXMA 3FTYA 5ESQB 1JPEA 2ENPA 1MWAA 3HN5A 3HMWL 4PJ5D 4XPAL 3PP4H 5AVVB 4JO4L 5I76A 4UU9A 3FQXA 3O4LB 1CGSH 2O4EA 1HU8A 2WN2A 3LIZA 5AVYB 2ADJA 2DQFB 1ZVSA 4TRPL 4YHOH 4JFEE 3RWDA 2E3VA 2JKTM 4FHBD 3FO0H 4O51B 3TPUB 4HH9A 5GZNA 1L0QA 1AZZC 3Q1SH 5ISZA 2X4PA 5BVJB 3U30C 5EO0B 1F86A 2JQZA 3MNZA 1E3XA 1MFEL 4C57C 5TTRA 1V7NL 3R7QA 1HILB 5I30L 3B9VA 3JUZA 1CG9B 4OF0A 1SOQA 2X6MA 4AVIA 3OZ9H 5I6KA 2QVTA 2NT1A 5JHDE 2CMRL 3F00A 3DV4A 1HNGA 1RK1B 4U1GC 1XD1A 4WUUE 3D48R 1RZQA 1UQSB 3BAXA 1T5WA 5KVGL 1GPOH 2FEDC 2X4NA 4QKXB 3V0FA 4OZHF 1LMIA 1ED3B 3BPLB 4XCYB 2OBGA 2FLMA 5C0BE 1GC1C 4QRAA 1FPTH 1HZHL 4YC2B 5D4IA 4IOIA 1IQWH 4CMHB 1T1XB 4BZ2L 4NQTA 2DIJA 1H3GA 2BY3A 4JREC 4Z7UE 3HUJF 3OC5A 3OMZA 2YOCA 4G6ML 3I9GL 1KFGA 1UASA 4NQXA 5DHYA 3DTXA 4YAQB 2W0FA 3ECBA 1KTCA 1TVHA 2DM4A 2KBGA 3DOSB 5KYUB 1P7QA 4TUOB 2F54E 1X5KA 1YYML 3PQYA 2VN6A 4LP8A 3KWTA 5E1AB 4OGQC 5JOFA 2XXGA 1A7PH 3TT1H 4YDMA 3BSHA 3N0PB 4URKA 5D9SA 1MWAB 3ERXA 3WN5A 4R3SA 4QRTA 4IIQC 2GSIA 4JHBA 5I76B 2QPDB 2X6AA 4XNQB 4UU9B 4PJCE 4X42A 4ZSOA 5GIRA 4TVPL 1BF2A 2VDKL 1QTPA 3BWUC 4AL8L 3OXSA 4LCWB 2ADJB 2WINA 4XNAA 1ID5I 4GUPA 2VE6A 2AI0H 4HH9B 3OTTA 4QTHA 1DBAH 1PY0A 2OZ4L 4GINA 2X4PB 4CADB 2AK1H 4K3DL 3VRJA 5ISZB 3SQRA 1AHWA 2XXMB 1HCFX 1JXGA 4FAAB 1RIVH 4JO1L 4UQ3B 1MLCA 2CH8A 4L4JA 3GSUB 1DQQA 3NPSC 2EO1A 2UYLA 4J8RB 3IRZA 3FCTA 3L3IA 3QC6X 2EYRA 5F7AA 1I8LA 4KDVA 4PGBB 1MI5D 1Q94B 8FABA 4FQJL 3BH9A 4M43H 3DV4B 4TNFA 1EEYA 2V0AA 5CBEB 1CXIA 1N64L 2XVLA 1TNNA 5D7KE 4DKFH 1YPZF 3VD9A 3O8XC 1T5WB 2APFA 3CFJA 4NKDB 2X4NB 1IJNA 3VFPA 2Y69B 4WO0A 5B39A 2VISA 2NY4B 4HIJB 3WKPA 1RPKA 4IOIB 35C8H 5ERWB 2A0LC 3D5OF 2XZCL 4UQ2A 5J5EA 4OLXL 1GJUA 2XWZA 1LWJA 2YD0A 4JG0H 1LO4L 4MCZA 4WZ9A 2N7AA 3DTXB 4JG5A 2W0FB 4MNHB 3BMWA 3SE9L 1HH9A 1XH2A 3CBKB 1P6FA 3L95B 2WNXA 2E9JA 3MU3A 3PQYB 1JTOA 2BX5A 4RMSA 1UYWL 3FOMA 3KWVA 4N0FA 1W16A 1DZBA 1WH0A 2FNBA 3F8UB 3NAAL 1FSKC 3KPNA 1PF3A 5I8OL 4H8VA 2Z93A 2F8VA 3BDBA 3JTTA 4PWHA 1CBVL 1SGKA 3MMEA 1QBBA 4QRTB 5CCHE 4P2QD 1TFHA 1XAKA 5KJ7E 5BXFA 4UYPA 5FA3A 4QHNB 3CFDA 1RZFH 3L7EA 1NGQL 4PJAA 3UPRA 1ULVA 4BV1A 2VE6B 5DQDH 4XVSH 1ASQA 1JGLL 3X13A 3F5WA 3VFOA 3SE3A 3P4NB 2XQYG 4QTHB 4TVPD 4DAGL 4U3XA 4XT1C 4NN5C 3VRJB 5HGBB 3P9LA 1ZS8B 4WCYH 4H26B 2DBLH 1OM9A 2OMTA 3BWAA 1DJIA 4UAHA 2UYLB 4CSPA 4PVLA 2CHZA 1VHPA 3O3BA 4J8QA 4UM8A 8FABB 4YXLH 3OR6A 3QCTL 2OMXA 2WVVA 4N2GA 4M3JA 1VZIA 1G6RH 1IKOP 1U2HA 3VQLA 5LG1A 3CFJB 4NJAH 3F58H 2HA1A 5CN1A 3QRGL 2FX8H 3VFPB 1O6TA 3X3FL 2VISB 4WEBL 3TA3D 4RRPM 4V2CB 2CJUH 1KELL 4N90D 2QEJA 2CXKA 3VXSB 5LBGA 5D4QA 3C5JA 5AAWA 1IC5H 1MWOA 4UQ2B 4HIHA 1Y1DA 1IL1B 4JQVC 3U1PA 3HAEA 1MY5A 3RWCB 3ZR6A 1HH9B 3WU1A 4Y2NA 5AVZB 1BEXA 4HAKA 3LD8B 3LV3B 5IGXL 5EU7C 1ONQB 2B14A 3B2DC 3K0WA 4PP2A 3KPNB 3OV6A 3PG2A 2XKNA 2ZAGA 5EF1A 4HIEB 2J20A 3JTTB 3WJMB 2C9VA 4S0TD 3QE5A 3KPRD 1KFAL 5BXFB 1KDIA 3NJFA 3QYCA 4PB0L 5I5RA 3CFDB 4PJAB 4OZHA 2O6FA 3OAYH 5LGJB 3UPRB 1VCAA 2PW1A 2WP3T 3IKCA 3VFOB 4P4KA 2OSWA 2Q76A 5AB9A 3SCMB 3P9LB 4P49A 3OHMB 5AZ2H 1EHNA 1YEEL 5DHEA 5E03A 1E3FA 2OMTB 3BCFA 4P2OD 3RNQA 1MJUH 1X44A 5K33A 1O7DE 3ZDWA 1MHEB 5JXAH 1KCRH 3NSJA 4WI7A 3SDAB 3O3BB 1BZDA 1KY6A 4L8SB 4MXVE 4OLVL 1H8OA 3MLUH 3GXMA 4ODWA 4X8CA 1LE9B 3OR6B 1GCFA 4JZNB 3V55A 4OVUA 1S6NA 2WVVB 3PV6A 3ZYZA 5CF3A 5I1JH 1YEIL 2BJML 3M07A 4OZFH 3I9AA 3IAGC 2UZXA 2WQRA 1A7BA 1EAOA 4HUKB 4UQAA 4KKCD 2V8LA 3MROA 4HUMB 5A2FA 4PGJA 3S0PA 3P0VH 3E9TA 5BOPA 5HGHB 5JMOC 3SHSA 1KJMB 1NCUA 4IGBC 2X0WA 3QWOA 3ILQD 4N0UB 3MRNA 3C5JB 4OQTL 4JFFA 3HAEB 4U7MA 1IQDB 3QRBA 1LDPL 4XNZB 4YDZA 4FLRA 3BKJL 3OMAB 3RWHA 3SPJA 3RX5A 3AREC 3GRWA 2E56A 1MFUA 1L7IH 3DHJA 4L5FL 1E5ZA 1T66C 4PP2B 2G75A 4XVTL 2YBGA 2EZ0D 2XKNB 3FF7A 4JDVB 3I6GA 4RETB 2DQHL 2NY2B 3QUMA 1MHHA 1YPZA 5HHQB 3STLA 1FF5A 5DA4A 4FXKB 2E46A 1E6JL 1PEZA 3HJEA 4MXQC 2YBRA 3IKCB 4LDEB 5I1GL 3GSNA 4KH2A 1OF2A 2PLTA 3R1GL 4JB9L 5D1XD 5E94A 3HUJB 1XT5A 5ICXA 1FNSH 3JV4B 4GQ9L 3MODH 1AIZA 3RNQB 3D2UD 1EGJH 1EEQA 4QKTA 3D1MC 1E7VA 4NO2B 2F0CA 2PO6D 3Q3GA 2GTQA 2CHXA 3LZLA 1VGKB 2CDGB 1MCPL 3PV6B 3L4ZA 3ZRSA 1WGVA 3BPNB 1AG0A 3QIBD 3VXME 1D9KA 3HOGA 2JJSC 3UZEA 4Q9CA 1FJ1A 2RFXA 1Y6MR 2Q20A 1P4LA 4Y7OC 3IJEB 3UL4A 1E4KA 2HX7A 3HE6D 1DUYB 3RPBA 3QWOB 3MRNB 3DC0A 2VQ1A 4JFFB 4QF1A 2ODIA 4ELMA 2XYBA 2QTVA 3HMXH 4YSSA 2QTEA 1A6VH 4AEFA 3HI6L 2CLZA 4HCRH 4WV1B 2NY3D 2EH8L 2NUTA 3RWHB 4LKXA 4PR5A 3WKNA 5LLIC 4H88L 1JZ6A 4NZTL 4RGNB 2CO6B 3C2SA 3EADA 3S3DB 1VDGA 2WNKA 2FUQA 1FGNL 2IFFL 1UT2A 2OJ1A 1R33A 3TH4T 4WTWA 1PY4A 3QUMB 3EFDH 4KK5D 1MHHB 3S37X 4GIPD 4K07A 4NS0A 3ZUNC 2EH7H 3LPPA 1IGCL 4OJAA 4FI8A 4PJDF 4Y4KA 2FO8A 3MCLL 2GABA 5IFHH 3T0DA 2YBRB 1JDCA 5IBUG 3GSNB 3BIKB 1OF2B 4X6CE 4I0PA 5E94B 3DO4A 5IMLA 4HJ0D 2AEQL 2DEYX 4TPRL 4Y5XA 1ZSDA 2NOYA 3TZVA 3WTSA 1BLIA 5I2IB 4FFVD 1QYGL 4KUCF 4KQ3H 4WHYG 3C60A 1A21A 4MQXD 5EOQH 4JHZA 2MH4A 3B9DA 2M83A 2X6UA 1XL4A 4RMWA 4KAQH 4OD1H 3Q3GB 2O5NA 5AOIA 1NCHA 1CE1L 2F74A 4XC1L 1PS3A 1WJ3A 2BM3A 1RJLB 2GUOA 5CIPB 2F1AA 2C7UB 3PWJA 4GRWH 1NGYB 4LCYA 4YPGB 2VO8A 4D0BB 5F71A 1VPOL 2RFXB 1ADQL 5DJCB 5FECA 3LKNB 1P4LB 4M6OH 4FQ2H 3QNZA 4HS6A 1L0XA 2VAAA 4KMTH 2FD6L 3HS8A 4ZSOE 3VGHA 1XCQA 3NCXA 4MA3A 3QIWD 2VQ1B 1NBYA 3SO3C 2CM6A 4AKQA 3IGAA 4YO0A 3SD5A 2PR4H 1TMCB 2B7DT 2PWGA 3PL6B 3UEQA 3VWJC 1V8HA 2NUTB 3RVUD 1WFIA 2YO3A 1WEJL 3C12A 4LKXB 1VGEL 1SNRA 4F7EA 4BYHA 2XWCA 3DMMA 4U33A 1T1WA 2Y7QA 2RA1A 4XP5H 4MAYD 4Q56A 4XXWC 1NDGA 1TXKA 3EH1A 3MGOB 1EVUA 1DVFA 2E7HA 2X7LA 3GMOA 1UOKA 5KVEE 3D85A 2FJSA 2YIHA 4ZYKA 3IJYB 2VUOA 1A3RL 1F42A 4N1EA 4K15A 4R26H 3ZQWA 1FHGA 5C2BL 3NN8B 4I5BA 4OF7A 4Y4KB 3I3DA 3TCLA 3REWA 2WB7A 3S5ZA 4AY0A 1W72A 1WBXA 4OUUA 2R59A 4Q58C 4I0PB 3LJ3A 1NCWH 1UB5A 1ZSDB 3B6SB 1PNDA 3DJSA 3FT1A 4FNRA 1ETB1 4P04A 3TZVB 5FF6A 1ZANL 3X17A 2C3VA 4FEMA 1NBVL 4QHLB 6FABH 2IAMC 3N9GL 4XBGB 3JTSA 5HDBE 4GIOA 2QKIC 3ULVC 3VFVB 4N2DA 1G6VK 4J5VA 2GUOB 2WNWA 3BZEA 2HJLA 4LCYB 3P4LA 4OFQA 4LIQE 1HL5A 5E23A 4OY9A 4U6VH 4ZMYA 4UINH 2IV9A 4X5XA 5E7FA 4NUGH 1OP3H 1J05A 1J5OL 4XVUC 5IQNA 5E08L 1FVEA 1OAKH 4KKAD 4YUEH 5D8JL 4EI5A 1Z3GH 1T7XA 1A02N 3OSVA 3K74B 4YBQD 5HYEA 4HP5A 4JS7A 4LLYB 2D2OA 4IBSA 3QJQB 1JFHA 1XF3A 2P5ED 2V7NB 2OPCA 3O4OB 3X12B 1CDUA 5F7YC 1RZ7L 4UAOB 4MMZA 2ZOOA 3DMMB 1CFVH 1T1WB 2Y7QB 3BEWA 2XWJA 2PTTA 3CFEB 3PWUB 1PX8A 2BIPA 1AXSA 2W81C 1NDGB 1GGBL 4PJEF 1DVFB 2X7LB 1I7ZB 3QUZC 4RFNB 5E2JA 3TESA 5E8EB 4R4FL 2G5UA 4G8GD 1DLFH 4ZZFA 1JGVL 3MJ9L 2XXCB 4HLJA 1U3HC 3WTTA 3BWZA 1TSHA 4I5BB 4D3CL 4HJJH 1HHIA 2GBTA 3REWB 1CMOA 3QJTB 4A55A 1W72B 1WBXB 3WEMA 1BVNP 4K9EL 1GXEA 5A6MA 2C3VB 1U91A 4U6TA 1UT9A 2VL5A 4JRXD 4NO0D 3UAJD 1A9BA 1NBQA 3KLSA 1FGVL 1T22A 3PAYA 1TLKA 2EEXA 4NNYB 4R90L 1QR4A 4S1DC 1FQ9C 2HJLB 3CZFA 2J8UF 3BLPX 2FO4B 3CZJA 4X5XB 4YL9A 1N67A 4IDLA 1C7SA 5HDQH 5LCVL 4XNDA 1FVEB 1UXMA 2X09A 1A6WL 4ODUA 4OVVA 1S7WA 5DDHB 2NW3A 4CN1A 1W0VA 1TPXC 5EEYA 1ORQA 3MBEA 4AYEC 2XG5A 5KVEH 3RI5K 4OZHE 4ERSH 3AG3B 3I6LE 5DMIH 2BWQA 1NEUA 1AYRA 1XF3B 4F8QA 5FYJH 1LO5A 3TO4A 3DJRA 3BP4B 5ENWA 4MMZB 1JVLA 5AVTB 3AVEA 5T3XE 3BEWB 2OJZL 1V7ML 1FG9C 1C7TA 2XWJB 3CH1B 1MPAH 3D33A 3MXWL 2PTTB 3NCYP 5DU7A 4DGIH 4FLOA 1OAUL 2P3YA 4LLQB 1WFUA 4C56D 3S3BB 4R0LC 1JD9A 4N86A 4C58B 4ZUTA 4DJMA 5CGBA 1QSED 4TQEH 5D7LB 4FFZH 5EBMA 2CR3A 3LZQA 1N0XL 3N43F 1MIEL 3QUXD 1ZV9A 3OB8A 2VLKA 2IBGA 4TNEA 2VABA 4RA0C 3KXFA 4Y5VC 2NY0C 4M3HA 1BIIB 4W9JC 1CPUA 3V2AR 2N59A 3WIIH 1YN7B 4MMYA 2VL5B 4JNXA 2XPYA 5A2KH 1UD4A 5T1JA 2NR6D 3KPLA 3SDCD 3RHWK 4ZW3A 2E74C 3PU7A 4EJ1C 5GSRB 4UDTA 3AUWB 5KBDA 3OAUH 1BMGA 3CFKA 1PD1A 1JVKA 1R5VB 3E8VA 2OCJA 5A2JH 2HTKC 3NESA 3S37L 4G2AA 3PS6A 3CU1A 2QT6A 4JBSA 4CKVX 5JPMB 5F96L 5I0XA 4PJDB 3BP6A 1UWYA 3TNMB 1YY9D 2VRKA 4ODUB 4D0DB 2P80D 5IMOA 1YPZE 1S7WB 3KGTA 4A67A 5KAQG 1JPSL 1LEIB 3ZKXB 1OWWA 3C6LB 1O7SA 1ORQB 2GJJA 2XG5B 1HI6A 5JMRA 4WY7H 3QH3A 4YC2C 4CMHC 3GUTA 5TFSL 2DMKA 2OTWA 3WIAA 1HS6A 1LO5B 1KTDA 4IKLA 1YNLH 2QHLA 1IFGA 2F5AL 3T65B 4KNQA 2AEWA 4A6YL 3W5MA 3ZBMA 3RA7H 4UT6H 1MFVA 2V6HA 5CR8A 3I02A 2C1PB 3KBPA 3DUHA 1O6VA 4JFOA 5TE4H 2O6PA 4LQFL 1P2CA 4ZUTB 4PJ7F 5J13B 4KGJA 3OL2A 4YHYB 5T33L 1T03L 5BZXA 4PWFA 1IC0A 1PZBA 2VW6A 5C92A 5DMYA 3ZY7A 5CUSL 4KO5A 2PCFA 2NY5H 2VLKB 1XGTB 3U36A 4F57H 1YQVH 1BD2B 1ES0B 2VABB 4WK2B 4MCMA 1URIA 2DI8A 1R3IH 3QJSB 5CGYC 5E5MA 5ITFA 3S34H 3VXRD 4J3BA 3WFHA 1MCJA 4PW9A 1Y7VA 3FAWA 5T5FA 1FZMB 3EXLA 2WXFA 5E8DL 3O6LH 4ELME 3BVXA 4UDTB 4LKCA 3RGVD 4AMWA 3GHEH 2E76C 2W8CA 1KLFA 1MF2H 2CGRH 2JFCA 3QZNA 1KTBA 1FO0L 5CP7B 2XETA 1BQSA 2D31B 3ZDYB 4K73A 5CILH 3SJVD 5J9PA 4A68A 1UADC 4Y9BA 1DYZA 3EZ8A 3L3KA 1RVFH 1UH3A 3RTQB 5CBAA 2CUHA 5T3XH 3U25A 1ACZA 1PZ2A 5GGVY 2DLHA 2FQFA 2HN7A 3V6FA 5E1IA 1A14H 1HI6B 5DK2B 1K3ZA 1GGIH 1QLFA 2WO4A 2V3FA 3QH3B 2WGXA 2VXQH 1JK9B 4HK3J 4PB9H 4UWQB 2ZYRA 3GUTB 2DYSB 1KTDB 3QWNA 1Q90A 3VI4F 1NJ9A 4MJ5A 1CGYA 5ILTH 2NY6B 3CV5A 1XCTA 3LN5B 4GT0A 4N24A 4OB5L 5SWSB 1U93A 1MRCH 2R8SH 5A7EA 1J9CT 3I02B 1C5CH 1KMGA 4JFOB 1BJ1H 5I1CL 2NNFA 5JIMA 2R1XB 1P2CB 4AM0Q 2WKLA 3C8KA 1RZKH 4Z6AT 5FLVA 1I3RB 2ZJSL 1FH2A 4XMXA 1KCBA 1N7ML 3C09C 4ZTOH 2EE6A 3WXVL 5KVFH 2PCFB 4U3SA 1WA2X 5F6IB 4PLNC 2I07A 3MRMB 3TVMA 2NX5A 1X9RA 5E5MB 2HG5A 5CD5D 1V3MA 2HXAA 3MV8E 3IJ7A 1CFBA 3ZSSA 3DRQB 1QTSA 5GJTH 2H7WA 2BSTA 2DH3A 5T1KB 3T1WA 2WK2A 2Y07H 4M8VA 2W07B 1AQKH 4QRBA 4Z7WE 5L4FA 2FHCA 3KYNA 4AYGA 1P6WA 1OT1A 3MLPA 4HCFA 2ZSVB 1LP9B 4Y4HD 1AGDA 4PJEB 2BY1A 1PG7X 4BXSV 5J9PB 1I8IB 4KROD 3DPDA 5B1JA 5ACLA 2MTPA 4Z1PA 5CBAB 2CZNA 1CGTA 3JWOH 1ZKAA 5FV1L 3RZCA 3FXIC 3CVIL 2YSSB 4MYWB 4FQPA 2HN7B 1KEGL 3MUJA 2P5WD 1NCBH 3ARZA 5GGSB 3VGDA 3I2CH 5I1AA 2H1PH 3ZQ9A 1N6QL 4F37K 1B3IA 2X41A 2UVFA 3TA4D 4BZ2A 4HXAL 1HE7A 4G70B 4N0CC 3MREA 2JB5L 4UT9L 1WF5A 3BRDA 2CE6A 2Y06H 3BAJA 1NJ9B 1Q9OA 1XCTB 1KCLA 4X5LA 4X7CC 1R24A 3NSXA 1U93B 4KGLA 5AW8B 1VKXA 3PLYA 1Q9WA 3B83A 3O2VL 2J8UB 2EEFA 4YR6B 5HTSA 4NKMA 2ESVD 1DN0A 3C5ZC 5CGMA 2CRIA 3MA9H 5D70L 3V95A 1JNNL 5A2LH 1QFWI 2BVQA 3NGBC 2BSED 2E6JA 2I07B 3TVMB 2J25A 1MCCA 3E3QE 5T1LD 3VO0A 5MERA 1COBA 4OJEH 1MCOH 1HWWA 3BSZH 1IZJA 2QDWA 3L1OH 2BSTB 3DXAA 2EEDA 1LO0H 3K3QA 2GJZB 2ATKB 4HU8A 5D71H 3SBQA 2E6PA 1H3UA 2E9GA 3BH4A 3O3UN 5KZCB 4PTTB 1DJGA 4ZD3L 3US1A 4YMPA 4KTYA 3IETA 4PJ7A 3VJ6A 5FYLE 2EDRA 5L9DH 2OK0H 3GLEA 4PU2A 4PGDB 2DWEA 4ZUWB 3N43B 2PXYD 1NLBH 5DD3H 1F6LL 2O93L 4QRPA 1U8KA 4WO4D 5C09A 4A2GA 5E2TH 4JJOA 4JZJA 3T6WA 2ZUTA 3O6MH 3D8MA 1S9XA 2VKWA 3FTGA 5DJ8B 1TTGA 4MXQD 3EJRA 5EZJB 1BA9A 3MREB 4JM2C 1DO5A 4PRPD 3UYRL 4ABWA 4DP2X 4Z9KB 1EA9C 4W4OC 3K7UA 4DEPB 2NY1D 5E9DB 3CG8A 4WHDA 3NFSL 1SF5A 3QJZA 3W56A 4H4NA 4HFWA 1VKXB 3EH2A 2VDPH 4FQQA 5J11C 2EABA 3RL2A 1DN0B 4ZMOA 1BHGA 2VDLL 12E8H 3KBHE 1CWVA 3H3BC 5D2LA 2BVQB 2IC2A 3US0A 2JKLA 1ZDQA 3QORD 2X4TB 5GGUA 3WS3B 3QAZB 1JAEA 3VFSA 4TNWK 1LK3L 1SN0A 2ZX8A 4JFPB 1NLDH 4P2OA 1FFPA 5F9WB 5G4OA 2H2PD 4P5TC 3WDIA 2BCMA 3BHBB 3HVNA 3AQDA 3LH8A 2E7DA 1R5WA 3BDXA 4PGCB 3MNMA 1CVSC 3N85H 3P2DA 2FZ3A 2R0KH 4F58L 2YJLA 1ZLVH 1CT8A 1CXKA 1IC4L 3KWXA 1HXYB 3V4PL 2VT0A 1DCLA 2XKUA 4F2EA 1OTTC 2ZWZA 5I73B 1VFAB 4XPFL 1FG2A 4YIQA 2V9UA 1T7VA 2ADIA 4J3UA 2DLFH 3ZTEA 1IRAY 2ZP8A 3BQUB 3FMGL 3Q8AA 3O9WC 1XF4A 4X99A 3UJIL 1HIML 1RIHL 4BRJA 5H94B 3VSUA 3VTAA 1PU0A 5C09B 5E6IC 3DURA 1J5HA 3FULA 4K2UL 4LRIC 4LVOC 2ZYHA 2VLKE 4LCVA 2HRGA 5HHXH 4BFBD 5KN5B 3MLYH 4MQ7A 3KXFE 3U48A 3MRDA 3E1F1 4NQSB 3L1FA 4U0RB 4DHLA 4XZUB 4JFZL 1UATA 3L4TA 4P3CH 4N8UA 3AG1B 4HFWB 1TJIL 4CVXA 2AFNA 1N4XH 4TSCL 3LX9A 4NN7B 4R96B 1XQ4A 2XBDA 2KHAA 2XOTA 5HDLA 1UWGH 2F8IA 3AC0A 1HNYA 1MHPL 1Q9LA 5IEHB 3HRZB 1JD7A 2IWEA 1OGSA 1SJHA 1EH9A 3F84A 4GOSA 2K6WA 4AZ8B 1KT2A 5D1XA 3HZKA 1BAWA 2CIIA 4OLWL 3VFSB 3B9KC 5HJDA 4WFGE 3B1TA 5LVEA 2J1WA 2EKSB 4JY5H 5FYLH 3QG6A 5IVOA 1JI1A 4OCNC 2PO6A 2FEJA 5KSAD 3LKQB 2JSFA 2PN5A 3M7OA 4MZ2A 1WFTA 3EBIA 2H6PA 4RGMB 3TIDA 4FABL 4U1HB 3VI4B 4RQQA 1ZA3B 1CT8B 3RVVC 2YAPA 3PDGA 2PYFB 3VWJD 5IHBA 3CN1A 4LSUL 1YUKB 5MI0B 5DGQA 2XI9A 4OSUL 1K4CA 4C59B 1A1OA 3LVEA 3EYFB 1WV7T 2XIDA 3R18A 3P77A 3ARXA 2OYLA 3WXWH 1ZGLA 4YIQB 2J6WA 2JKJA 1FNHA 2Q1EA 2ADIB 1BZ9A 3AT0A 4O4YH 4XOAA 5TQ2L 4NQCD 2IPKA 4Q8BA 3Q6GL 4X99B 7PAZA 2JWYA 1MNUL 4XCFL 1MDAA 4X6FA 3JVGA 4OQTA 4MD0A 3FZUC 2VTFA 5C6TH 1KJ2H 3EJUA 3VFTA 3HCVA 1R5IA 4OFVA 1H3PL 2XWRA 1DJXA 3PL6C 4Z3HA 3QUYC 5IQ7L 3U7WL 2OMUA 3FUEA 3VA6A 1EQWA 4NFDA 1C16A 1GHFH 1GGTA 3RUGF 1PG7L 1CICB 4BQ6A 5C71A 2GY7B 4YDIH 1QHPA 2ALWA 2H6OA 1S3RA 3ULVD 4I0KA 3MAWA 4AYFA 3MCKB 2DMHA 1C1EH 3KNBA 5EUOE 4KUZL 5CKAA 3AAZA 1RP9A 3NJHA 2CIIB 2FX9H 1THAA 1U8CA 2EDNA 2ED8A 4KOCA 4FTVB 2BCKB 2ZTBA 4X6BA 3UPCA 3Q9PA 3QG6B 4PS4H 1JP5A 1AANA 2Q2LA 4JDTH 1ASOA 3N44F 1OB1A 4HOMA 3ULUL 3TIDB 4GRLC 3HE7C 3SGJA 2AXJA 2BERA 4LU5L 4U0QB 2EIMB 3LS4H 1IGJB 5JW4M 4OJCA 1A1OB 2K6YA 3H3PL 2JKSA 4NNXA 4ZBJA 4HHGA 1ZGLB 5IG7A 2NXZD 5DQJA 1KB5H 3EJQA 3IPBA 4B6ZA 1G87A 3QUZD 5JYMA 4A7GF 2WXGA 3M1BA 4PYGA 4MNQA 1KGJA 3EAKA 2YQ3A 4X6FB 5TPWH 4I77L 5GHWH 2MCPL 1BMZA 1EUTA 2OR7A 1GS6X 5JO5A 3HN8A 3QZBA 4KRMB 2CCLA 1CI5A 3UG3A 4OZFB 2NX5E 3NSCA 5FS5A 2WLKA 3ZDZE 2WC7A 4QGTA 1VIWA 2OSYA 3DSFH 2XPZA 3GZKA 4PG2C 3EHBB 3A22A 4XPBH 1MI5E 1NEPA 4AX3A 1C16B 4EUPH 1QWUA 4NC1E 4GW4A 3MRRA 1EERB 4L4VB 3L9RA 2BSRA 4M8QB 3QJUB 4AYFB 3NCFB 1KBWA 5A1AA 2Z4TA 3HG2A 3KNBB 4LCIH 4GT7A 4WW2A 3EOAA 2XNAA 2IQAA 3AAZB 1SY6L 2R4SH 3KL0A 4G5AA 3VQ1C 1OPGL 2RACA 4XC3H 4XCNA 1FN4A 4J4PA 5FGSA 1XF2A 4GUOA 4C83A 4QXUL 5ICYB 4X6BB 3ZE2E 1NAMA 3CFNA 2X1XR 5LBSH 3NCJL 4HJTA 5IROC 3IJHA 1YEJL 3ZL4L 3TN0C 3VFNA 5EO9A 5TDNB 3IDNA 5I15H 1DBBL 2B8OT 3QCUL 3DETD 1JV2B 3ULUD 5CINH 3OJMB 4XMPH 2FHBA 2IPTL 1TQWA 4E5XA 1PGRB 1P7BA 2KC0A 3DVIA 3D52A 3H9SD 4RWHA 5DQJB 1YCSA 4P2QE 1C8PA 4WJ5A 1CCZA 2IFGA 3VXQB 2VCOA 1ADQA 5D7JB 5C0GB 2B2XL 4S1SL 4CC4C 1QSFD 2CR6A 3H42L 2FBJL 3M1BB 4MNQB 3WE6A 1KENL 4Q0XL 4AGLA 4I13B 2WXPA 2MQCA 4TVPE 4LPTA 4L1LA 5G4NA 3SKUD 1D6VH 4QTFA 1S9YA 3CC1A 4OT1H 4FERA 2BH0A 2R9HC 3AMLA 4LLWB 4ZUVA 5G5DB 5PAZA 5BRPA 1ZXKA 4M48L 1BWWA 4LBEA 3UTSA 3X1GA 3LY6A 3WFCH 5JYLA 2VUYA 5LNDA 2E7LC 3ECQA 5D1ZI 3SODB 4PYHA 4G8GA 3DXAE 3MRRB 1KLGA 2EEAA 3VB9A 3VGFA 2B77A 2BSRB 4GO8A 3MRFA 3PWNB 4LSQL 4YJZL 4H1LH 5C2UB 2EUVA 1D5ZB 2F2HA 3INUH 4KNSA 5I1IL 3NSYA 1UM6L 1DJWA 3IN2A 4PJ7E 5E6YA 1H9VA 4XCNB 1FN4B 5K1NA 1XF2B 3IT8D 4B3EA 2V4LA 4LOEA 4N90E 4LPXA 1FV1A 4JRXA 1NAMB 2YN5A 3ABGA 5KTEL 4BIKA 2DQ6A 4N8VG 4HMEA 1IJ9A 2SEBA 4FP8H 4MDIA 4QRPE 2ED7A 5FUZH 2OJEA 2QGEA 3HMWH 4XPAH 3VFNB 4UNVA 5KYWA 4JO4H 1I9EA 1FFTB 1DP0A 1SHSA 4ORGA 1A5FH 4IRSC 3E6FB 4FXTA 1RULL 3RUGA 1A6ZA 3H2QA 4NPJA 4E5XB 3AY2A 3KM2A 5FYJU 4TRPH 2X89A 3KR3L 1WT5A 4HK0A 3IMBA 2L04A 3DUSB 4MMXA 3KPRE 4Y5YC 4IKIA 2WVSA 3QXTA 2XWTB 5K9OB 4GEIA 4E0RA 3V8CA 4M5YL 1MFEH 1E7UA 1V7NH 3EDFA 3S8FB 2BVPB 3A4AA 1BREA 3ATFA 1PAMA 5I30H 5D2LE 1X5MA 4FOMA 3OB0K 5DUML 1J8HA 1S9YB 3HG5A 4ZW6A 2CMRH 3BESR 3BAWA 4QRRD 1UA6L 3P69A 4JFDD 3UTSB 3T4AA 4K23L 1XVSA 4IOFD 4PP1D 4BBWA 3IU3B 2YR3A 2ZOTA 3NFNA 3WHE0 5KVGH 1XIWD 1QSEA 2X3BA 3RU8L 2VR5A 4GAFB 1V05A 3AU0A 5MEPA 2OP4L 4KJWC 1HZHH 2QVMA 1KC5H 3SKMB 4Q7DA 2ZICA 4QDGA 3MJ9A 4JQIA 1FCCA 3I9GH 3D39B 4YHYC 5C0AB 4EPSA 4U4IA 4A7GA 5EEZA 3BPCA 1FNLA 3QQ3B 1FV1B 1YYMH 4PCYA 1CTMA 5SWZD 1CD9B 2JI2A 2A77L 4KV5E 3MBXL 3PUUA 2P44B 4N0YH 4PV1C 3VXTA 1FI8C 4MDIB 2HFGL 3INOA 2DM3A 2OJEB 5GISH 3LNDA 5KYWB 4PRAB 4ORGB 3VFUA 3GBLA 4TVPH 3FRPG 2RBLA 2VDKH 3GZPA 4LF3A 5TK2A 4AL8H 1USQA 2BFVL 4PRBA 2HT3D 2UWEA 2CIKA 4WI3A 1NC4D 4MMXB 3A6CL 4HALA 3T8VA 4ZX3A 2OZ4H 4MZIA 3CQPA 4MAZA 4K3DH 4YFEA 4XMTA 4LSVH 1U3ZA 2FWOB 2K45A 1AG6A 1AQDA 2ZUXA 4EN3D 4JO1H 4X6DA 3C87A 1KG0B 2CALA 1MFCH 5H35B 5LCVA 2JJTA 2OQJA 1F5WA 4FLQA 2YAFA 5EDXA 2R0LH 5I18L 4BSVA 5D1XE 5GQBA 2Z7YA 5EO1A 2A83A 3UXFA 1LTXA 4FQJH 3V0HA 4M5TA 3N44B 5GS0C 1N64H 2R1YB 3ARBC 3T4AB 2HJKA 4MJ6A 1HEJC 1EO8L 1I75A 3NFNB 3FBKA 2WZPA 4OZ4A 3FO2A 2VKXA 1P6AB 4EVNA 5MEPB 2AVFA 2XACC 2IDUA 1OV8A 5JDSA 1VENA 2XZCH 3EGDA 3KJ4B 1WYJA 4X6EB 1KXVC 2O6DA 5JXEC 3CZNA 1LO4H 4LSTL 3ZYIA 1AZNA 2BNRB 5C9JA 4JK0D 3BPCB 3VXRA 1UH4A 3UC0L 5F6IC 1UYWH 5EPMA 4AYID 1T0MA 3NAAH 4UM9A 5C07D 2BZCA 2H8PB 3MV11 2VR4A 3QYMA 5CN2A 1CBVH 2PETA 3KDMA 1E30A 2IALB 4OZIF 3VFUB 1KIUA 1OAXH 2M8XA 4JG1L 3ZKMD 2D0HA 4LF3B 4WWNA 1NGQH 4BWUA 1D5RA 4PRBB 1NPNA 2BY2A 2LU3A 3QDHA 5C7ZA 4DVBB 2GBAA 1U8NB 1JGLH 1S9WA 1UJ3B 4HWBL 3WJLC 1A4JB 4L5FE 4DAGH 1TZIA 2DMBA 5DWPA 4JFHE 4KXAA 4IRZL 5L6YL 4BK5A 1A6UL 3ZXAC 4H20L 3PGCA 5CZVL 1O9ZA 4CN6A 5BUAA 2FX7L 4BSVB 4PRIA 2A83B 2C34A 1G84A 4JKPL 3QCTH 4XN7A 3EGSA 3OJVC 4N1CA 1MCNA 1FZJA 1U8JA 4O9HL 1PL3A 5DMGC 4KDTC 3TCTA 4Z78B 4A6YA 1PKQA 4Z77A 5HYIA 3G6JF 3QRGH 4QXWA 3EF7A 1VACA 4BA8A 3X3FH 3KBFA 4PJ8B 5EU5A 4GKLA 3CSTA 1OQOA 2WBJC 3ISYA 2B1HL 2HUEA 4K94L 3IDJB 1UJTA 3AM8A 4Q4EA 3ME0B 3V10A 2WQUA 1AO7B 1HE8A 1UEMA 1MVUB 4ZXBB 4DIXA 4C4UA 5HYSA 2P24A 4QOKD 2BS71 4FI6A 1QZ1A 1QWNA 4K7PY 5EUKA 1YEHH 3L7FA 5F3FA 4XP4L 5I17A 1SN2A 4WFHD 2XUWA 1IEBA 4AJVA 5HYJB 5E24E 1FAIL 5IGXH 2CGYA 2OLDA 3RIFF 5EPMB 1T0MB 4BWWA 3HHSB 4MNGA 4KFMA 3CGTA 1IX2A 3SE4C 2NLJB 2EVGA 5HDOA 4K71C 4OLUL 1QACA 4MB4A 1KFAH 3GMPB 1SDDA 2VZ1A 3OM3B 5EORH 4PB0H 5JHAA 3QVAA 3SY0B 4M4RA 1H0DB 1WS7A 4UTBA 4RDQF 4X98B 4AJYV 1W0WA 3GXFA 2YQ2A 4Y4FC 1TZIB 2P5WA 3LHAA 5D1ZC 5IB4A 3RKDC 2MOGA 2W59A 3FU7A 3VB8A 5H8DA 2A3TA 3ZL2A 1YEEH 1VRSA 5IESL 4LEOB 1I1AA 4OCWL 1DVTA 4YPJA 3DGDA 3F83A 4AI7A 4RDBA 3HS0A 1G9EA 3QP3A 4KXBA 4WF7A 5JPNA 3KPSB 4HFUL 5TQ0L 1JYNA 1KXQE 3EGSB 3F05A 3QRLA 1L9PA 4GAGH 1WIOA 4K7FA 4KXDA 2BJMH 4RNRB 3KPMA 5A43C 1U8JB 2JI3A 2X9XA 2DQDL 1D7DA 3V6BR 4XPHL 4NZRL 2IBZY 4P5TD 4KZDL 4Y16D 1VACB 1YC8A 2VN5A 1MG2C 2WYHA 3UDWC 4OGAC 4YDVB 3CN2A 5MEQB 1IM9D 4LPWA 1QBLL 5F0LB 2BSEA 1CYWA 4WEEA 5GZOD 5DD0L 1CFTB 5HYSB 2A4EA 4PJFA 4B95C 5T1LA 5LN4A 1LDPH 4FRWA 3JZYA 5EUKB 3BGAA 3WTWA 3BKJH 1XR9A 3WFDL 3L3DA 5I17B 3HKFA 1B9ZA 1MFMA 2OTUA 4TTDD 4L5FH 3EJYD 4OCRH 1TJGH 4YN3A 2WKGA 3O9WD 2MFNA 1QRND 4P2YA 3UBXB 3E0GA 4DETA 5ID0B 3WOVA 1TZHA 2XU9A 2N1KA 5G55A 4XCEB 3W39A 4MLSA 5I9QB 3ZPDA 1KV7A 2HFEB 3MRLA 3NUKA 1MCDA 3UTSE 4DKAA 1E6JH 4JRLA 5I66B 2B08A 4AQ1A 4LPYA 4G71B 2P8LA 3OKOB 4JB9H 5IB4B 4G8GE 3FU7B 1HQ4B 2Z1PA 3BGMA 2WKOA 3TBWA 1L6XA 3RIKA 4EI0A 3BQUC 4XO9A 4AXWA 1AQMA 1FVDB 3SQOL 4NBZB 3WNLA 4NQED 1E6OH 3SO5A 3S2AA 3F12B 5JPNB 4BCYA 5D1QA 3ILEA 1UWXH 4YSCA 3JZ7A 4XODA 3EJZD 3F3HA 3GO1L 1J10A 3KPMB 4JRXE 4EIGB 2Z91A 4OZIA 5CP3H 1XSJA 2Y3AA 5KBPA 3N1MC 4HJGB 1PJ9A 4ANXA 5L2JA 1PY9A 3KPOB 3T2PA 4DK3A 3UOAB 5I0ZA 4GP8B 3TNNA 1OP5H 4BUGA 4Q2ZB 1USZA 5DK3A 3RVVD 4IRJC 3RUGE 3F7RA 2HZHA 5KSUA 5C08D 4GEJA 1DQLH 1QPPA 4DPCX 1Z9LA 4KX7A 5BQDA 3REVA 4KTEL 3JWNG 4B9PA 2XJLA 4YS4A 1C8QA 5HHOB 1U8HB 2OTUB 3CMOL 4TQPA 4H88H 5KS9E 4NZTH 3T1FA 4NNPL 1TEYA 3WIHL 4DH2A 1ZHKA 1ZT7B 2IFFH 4NAMA 1HEZB 4G8FA 3WNPA 1TZHB 2AV1A 3UYPB 1LQBC 1UG9A 2QMJA 5D96C 3AACA 2X0UA 3D3VB 1J8HE 2Z0BA 1KGYE 3V4VH 1HH6B 3VXUA 1IGCH 2GY5A 1ASPA 3B4NA 3F7QA 5AW3B 1ZHBA 2VZOA 3KYKL 1IC7L 1X5XA 4FNLH 4TLTA 2VERA 4I48B 32C2A 1AZRA 2H0JA 3QUYD 2P8LB 2G0LA 1J88A 3VMNA 2WLIA 4AW4A 1QSEE 5GS2D 2AEQH 4TPRH 4NM8L 1F6FB 1KF9B 1C5BH 2A2QT 2AJ3A 1A0QL 1QYGH 2WXRA 4BM7A 4LBAA 2CBMA 4J3OF 2YPKA 3PCYA 4QGYA 4G6KL 1PEWA 1P5UA 4APQB 3QSKB 2VSMB 2X6CA 1RL1A 1JZ5A 4XZ4A 1CE1H 3S97C 5D1QB 2YQBA 3SE8L 3PHQB 2VWEE 1E5AA 1WSST 5F6HJ 2VERN 4HJEA 2EXSA 2Z91B 4OZIB 1LL1A 2CO7A 1F4HA 1MIML 5L2JB 5JIHA 3CDYA 2B16A 1VZHA 5D6CA 1FDLL 4GRLD 4LPCA 1XSIA 2YA2A 3HE7D 3TNNB 3HC2A 4H0HB 1EDQA 2C5DC 1TCRA 4POUB 1U21A 1EBAA 4L1BA 1HHKA 1X5YA 1EHLH 1B4JH 1GOHA 3IDIB 5IB1A 4Z76B 2PKDA 3OD3A 5HVHC 5KSUB 3DVNB 2BHYA 5K1JA 3G6DL 2UWEE 3MOBH 3UP6A 3H6JA 1HNFA 4EBQL 2W65B 1WEJH 2QMKA 4R7DB 1ZTXL 3V0GA 4L3AA 5FXCH 4X6DE 1I7TA 4NZUL 3GI9L 2UY6A 3S3JA 2AZUA 3CBRA 5J3HD 3NP3A 4NERA 4QI3A 1QFHA 3DVGA 3PJSA 3WEAA 1FH5H 3D69B 3D9AL 5EEWA 5CN3A 2ZCHL 5I71C 3CZKA 3VXUB 1A3RH 1JZGA 3G6JB 5C2BH 3WY2A 2AK4D 5DUPH 1GYAA 4NENA 1ZPLA 5KYXB 2IDFA 3NQIA 3ROOA 4AYSA 1JUFA 4DK6A 5CLYA 1SUJA 4WDIB 4PV8A 4V33A 3K2UL 4JN1L 4KKQA 1MRFL 3TJPA 5C0CD 1AC6A 1ZANH 3A0OA 5DO2C 1ZT1A 1NBVH 3BPOC 3IWUA 1OSZB 1RUAL 3NZHL 3C5SA 5BO0D 3L2LA 2VOTA 5ID1A 1AR1B 1UACH 4YHIA 4FULA 1QEWA 5TDPB 3GZOA 3VXRE 2XSKA 4XB3A 1RK7A 5E2UL 3VH8G 3MKKA 2F15A 1X5AA 3B56A 3FT9A 2BP8A 4G9FD 4NDMB 5D6CB 5EOCH 4R2GC 3HS9A 5GXBB 1Q9KB 2OM5A 1TCRB 4LCUA 4XCCL 4YGVA 1XHHA 3PFQA 1SLVA 1HHKB 5IB1B 3KHOA 1YAZA 1GA2A 4RAHA 3UG5A 3BLBA 2BOBB 4J3XA 3U83A 3C2AL 4GBXD 1UD2A 2L7JA 3CZGA 1OGAA 4LEXL 4OW6A 4P5SA 5HHPB 5KSBF 2EE2A 2R69L 4E42B 1RZ7H 4IU2A 4UTAA 1R6VA 3B5HA 1YNTF 4GG8A 2UY6B 2HVJA 3S5LA 3GMLB 1TMQA 4UILH 2VDPB 3VI3B 3ARFA 3DVGB 3V52L 2DBJA 4PRIE 4WU7B 3PWVA 4OKVA 4HLZG 1CYGA 2UZIL 3BT2H 5AKTA 3MSPA 3CLFL 2YZ8A 4XMVA 1M2VA 2J88L 2BSBA 2FQDA 4X83A 5LGYA 4NENB 4D3CH 2BNQB 4G42B 4YHKL 1JUFB 2G5BB 4AEHL 1T0NA 3Q06A 1GC1H 1PKQE 4F5CE 5KW9L 4PUBL 2J57A 4OIIL 1IT9H 2J56A 3MJ8B 4J28A 1IGTB 4K9EH 2K3TA 4EZJA 3W37A 1QNIA 2JELL 1ZT1B 3BD4A 4H0LC 5I1KL 1NGPL 3K6FA 1ZGLP 4BGDA 3ZGHA 3R19A 1FGVH 3VYPA 3G5ZB 3GSXA 4DT2A 5FO7B 3TBYA 4GYBA 3N42F 2AQRA 1QEWB 1K2DA 3CN4A 4AJWA 4DZBA 3VG9B 1HDMA 3K72A 2M1KA 4X8XA 5DJAA 5FYKE 5HHNB 4AIZA 4JGNA 2X2HA 1PVHA 4AIOA 3I75A 1CU4L 3PIQA 4MNGE 2Q10A 1EZSA 2BP8B 3QDMD 2FSEB 4B0MB 3HB3C 5TJWK 2ZSWB 4I18B 4X4XB 3KPPA 3QARA 4ZAKD 5E1GA 1R17A 4JHUA 1AFVL 4XWOC 5LCVH 3F01A 3CBJB 3GI8H 3KWUA 4UQBA 5E5UB 4QLRA 2YK1L 5F9OL 3RY4A 2A9ML 3EJCA 4NUJB 4TVSa 2P5WE 1SMOA 4IU2B 1E3ZA 3U79A 4HUUB 4IW4C 1V7MH 2OJZH 3S5LB 5HDWA 3X11B 1N70A 4Q6YA 1OAUH 4B5ZA 3S96A 3KL3A 5E5LA 1BVZA 1G7IA 3LN9A 3PWVB 3BVDB 3FU6A 4OKVB 1O5DT 3DOHA 3RJQB 1N0LA 3BWSA 4NCC2 3GZQA 1O7DC 4YXKL 1M2VB 2YEVB 4OFPA 1N0XH 2ZUQC 3UH8A 4EE2A 1MIEH 3T4YB 5IQ9B 1CD1A 1QSFA 5EZIL 5ALBL 1PQZA 2DQUL 3IB4A 2APVA 2DYPB 3WNMA 4PJHA 4Z95L 4URTB 5EU6D 2FBRA 3RAJL 3SPGA 4MA8L 1JNHA 4WW1B 2CKBL 1YY8A 4PJFE 3TBYB 5D5MF 1NWPA 4A2HA 5ADOH 3IXAA 4ILDA 5DJDA 4DZBB 1HDMB 3K72B 4AE1A 2XPGA 5MHSD 3ORJA 2EC9T 1EJFA 3ATEA 3EFOA 3HNTL 3S37H 4KRNA 3WELA 5F3BA 1E9QB 3PIQB 5F96H 3ARDC 1B2WH 1RCYA 4G5ZL 4PCKA 2FH8A 4KI5F 3VGAC 1E28A 1E4HA 1NSNL 3KPPB 2PUQT 5F1KC 5B4MC 2ILLA 2IWKA 3KEDA 1JPSH 4HDIB 3O3EA 3OJDA 5C0NC 2F9BT 2H32H 5DEFA 2A74C 3CXFA 1KJ2B 2FECI 5TFSH 4CW1A 2NXYD 5BUGA 2BIMA 2BIHA 3MO1A 4JCWA 3FO1A 1KLUA 4HJSA 5F89A 1GMEA 1SY6A 3N04A 4KO6A 4AWJC 1UWEL 2G2NA 4PHZA 2BS8A 3L48A 4PW3A 1X4YA 2F5AH 4L9LA 4W9IC 2AJZB 3FU9A 4X2UA 3KCPA 4A6YH 1IB5A 1SBBA 5E2VH 4QLWA 2EXWD 2HKHL 3HG0A 3S96B 5BRZA 2AQPA 4GKSA 3WY3A 1G7QA 5JIDA 4LQFH 1G7IB 3ROLB 2W95A 2R29A 1S78C 1T1ZA 4C4KT 2MCG1 3VNZA 1N0LB 4WWKC 5T33H 2F6AA 4DTGL 3GNMH 1T03H 5BS0A 4NB7A 3D09A 5AKSA 1TENA 2IH1A 4N28A 5CUSH 1PFOA 2PYEA 4HBQA 1F45A 1JV5B 1CD1B 2DS4A 5TGBA 3UBFA 3KYOA 2Q5BA 1FYTA 5E6SB 3P40A 2Z65C 3A4FA 4MX7B 3RJOA 4F2ME 1P1ZA 2X12A 2ICWJ 4YSPA 2YAMA 5KSBA 3P54A 4P5MB 5E8DH 4QRRA 1YNTA 1YY8B 5DLLA 4N2LA 3TURA 4H5SA 3CIAA 2IOOA 1KPRA 1FO0H 3OKDA 4ZQKA 5KANI 2XPGB 2KT6A 3EFOB 3FC8A 1XIWA 3TWCL 2JK5A 5F3BB 5LWYH 3QJOA 1TT6A 5KUKA 4ICXA 4Y2DD 3QO1B 4OCSL 2VM4A 1ZXQA 3G04B 2GK0A 3FQNA 3VD1A 3O3EB 3OJDB 1K6QL 3NIGE 5D4HA 1JZ4A 3HIZA 5DEFB 2JCWA 4GW1B 4L3CB 3L3HB 4E41D 3W3BA 4JPKH 3MO1B 2V5SA 1JDAA 5F89B 5HY9A 1BMWA 1CI3M 3D6GA 1TJMA 4KO7A 3X3GL 1EJ6A 3IXTA 3AZUA 4DNLA 2B1OA 4EUPB 5IHZA 3IF1A 1A6PA 1T6BX 1FCGA 1WFOA 3PWPD 5DSCB 4HEMA 5I1CH 4KKBC 2OMVA 1JF6A 1J0JA 1DBKL 1EMTL 4P23A 4QD2E 2ZJSH 5T3ZL 3UZQA 4ENED 3RFZA 5BS0B 3VDAA 1NC4A 2FE0A 3QQDA 4FMFA 2IH1B 2A9NL 2RR3A 3WXVH 2WZAA 2PYEB 3K5SA 3N06B 5TGBB 5DMGD 3NACL 2VLMD 1XGUB 4PJ5B 3KYOB 1ZHLA 4KK8C 1FYTB 3OKNB 2WLYA 4GXVL 1NDMB 1IM3D 3PV7A 1BECA 3QZWG 4FNQA 3DO3A 2NZ9C 4WHYH 4XI5C 1CQKA 2PW2B 4FFYL 2AJUL 1KIRA 3LMJL 4ZQTA 4K3GA 1NMCB 3APMA 3OKDB 4ZQKB 4QRSA 4R4BA 4TS6A 3SN6N 2YD9A 3VFRB 3LEXA 3CWGA 3VSVA 2JK5B 4NO3B 2DY2A 5AVRB 2MKLC 3UTQA 2VDQB 3ARTA 3DIVA 1AHWC 4HWEL 3CVIH 2C4FU 1KEGH 3LXBA 5B7MA 2Z9TA 4HSCX 3LXAA 2EC9U 1N6QH 4UB0H 2XTLA 2XTJE 1TQSA 4EDWL 4NQCE 1AXTL 1L5GA 1G7MA 4MCNA 4UT9H 1P7KB 3BO8A 2OMYB 4LQ1A 3FQTB 3FNKA 5D1ZD 1N5YL 5JOPE 2ZKYA 3LQMA 3N42B 4DW2L 4PTUA 1MFNA 5IHZB 3IF1B 5HYQA 3T0EA 2ERJC 2HB0A 3Q6FB 1G0DA 4CJ1A 2ZE0A 1RHHB 1XZ0A 2VXTL 3WNIA 4WWID 4DP7X 3BAYA 3K2MC 1FFNA 1JGUL 3O2VH 3RRQA 5B3JF 4YE0A 1BFOA 3RWIB 4H1LB 3UZQB 1AXIB 4UQDA 4NQQA 2W0PA 5D70H 2CDFB 3DUUA 3L3OA 1K4DA 3LRMA 3MA7B 5TH2B 5IFAL 4JRFA 2WVUA 4NWTL 5GS1C 3ALXA 3CPLB 5EIQA 3BVNA 2GSMB 2YPVL 3QFJD 2K3HA 2X9YA 2B4CL 2E9BA 2GJ6D 3SQBB 4OBRA 2Z4QA 4OGAD 1CFQA 4Z3GA 3ECVA 3S36X 3LZFL 1CTOA 1KIRB 5DJ0B 2JXMA 3GXTA 1IBGL 4IBLT 5AVUB 2YRBA 1OGAE 2F53A 1MQKH 4RRPA 4X9FA 3VD4A 2NY7H 1ADWA 2HX9A 2VNCA 5JHLL 1X5ZA 1CN4A 3SE3C 2VLLA 4LRNH 4QIRA 4DO6A 2HLAB 4A2EA 2YAOA 2BFGA 5DURD 1AMYA 1J0HA 4AENA 1QA9A 1CDGA 3B7TA 1W15A 4QOKA 4MD4B 4HW6A 1K8IA 4WEMB 3IGLA 1CYXA 2BNUA 3WTUA 3HBQA 4HBCL 4Y2LA 4MA7L 5L88H 3QEQD 5DK0B 4KFZC 2ARJA 2BWDA 4H13C 1SF3A 5F1OB 1CB4A 1I9IL 3S5YA 2ICWB 5KG9A 1M6OB 4HWZA 1G7MB 4G7VL 2VN3A 3UYRH 1F90L 2Z8VC 3BO8B 3N3EA 5HHMB 4NCDA 5BZDB 1OHZA 5D5MB 4NLHA 1BFSA 1F6AB 4GS7B 1XGRA 4PTUB 3T0EB 5HYQB 1DQDL 3GM0A 3NFSH 1I7RA 4CBZA 1CLVA 2VRQA 4M93B 4M7ZC 4QRFA 5GRVL 1DQMH 1SM3L 4FDWA 1GGUA 3PPSA 4JFWA 1BFOB 2V5TA 4L1SA 4J23A 5DVKA 2VDLH 4Q9QL 3FU0A 4JR9L 2LVEA 1AQ8A 1I53A 3SDDD 3OAWA 3BVNB 2NY5C 1G1OA 4OFIA 2X05A 3IJSA 4AIXA 2VLJB 4BGLA 3CFUA 3L4XA 1Z9PA 2BP0A 4O58L 4N5EC 1HJBC 3O2WL 5C0IA 5AVQB 5K69A 3VWKC 1CFQB 3LRGA 5EN2B 3ZT7A 2BSCA 5IF0A 2QADC 1OTUD 3LS5L 4G6JL 3ZIMA 4F58H 1ETZA 3ESNA 2H5UA 2XA8H 3DHPA 4I1RA 5LN8A 1U95A 1IC4H 5I6LA 4UMGA 3W11D 2RTTA 5B39G 1MHCA 3V4PH 5I28A 3U82B 1BX2A 1K9TA 1JI2A 2V2WA 5A2AA 4Y16A 1FC1A 4DCQA 4XPFH 3ZU8A 4PJ9C 4P46D 1TQTA 1IM9A 1FORL 3BC9A 3BJ91 2QLVB 3C5XA 1WCBA 3FMGH 4R4NC 1JZ7A 1FNEA 5IFJB 4QNPE 4NC2B 4S1RL 1HIMH 1RIHH 4JCLA 4AENB 4PM1A 1G7JB 3H9SE 3OHXC 1OAZL 5BQ7B 4HQQL 4HD5A 3PY9A 3QPXL 2E9WA 2DLTA 3NYKA 4D0CA 4DPAX 5KG9B 2R7EB 2CGZA 1QSFE 3TA3B 4K55A 1ZWIA 3TOPA 1W6LA 2OX5A 1FAKT 4MS8C 3M46A 4PJHE 2Y1ZA 3PHSA 4QHKI 4WUUD 1JSYA 5F93C 4JFZH 4KNUA 3ULVH 4Y2OA 3H9HA 5AW7B 1TJIH 2Q7AA 1IO4C 5BV7L 1J48A 1DQVA 3KH4A 3QEGL 1IVLA 5L2KD 1QSVA 3RGHA 1RZKC 3LZRA 2VDRB 1CJYA 4M4PA 3CVHL 2IOMA 1CL7L 1LHZA 1U30A 4JO5A 2X4UA 4OLWH 3W0WA 4FADA 1FVCA 2BRQA 2EILB 2K78A 4MQTB 4TYUA 2EYSA 2F54D 2F7QA 4TLSA 2I32A 2XZQL 1RUPL 2H9GA 5C0IB 4NQEA 3O0RL 3PP3H 4B41A 5IF0B 4FABH 1NMAL 5DFVD 4OFKA 1A7NL 1LQSR 5CS7A 3TBBA 1X9LA 3I6KA 4LE8A 4DEUA 5DRZA 5LHDA 1QHOA 1GVIA 1QUNA 4P07A 4DFHA 1BX2B 3TBTA 3O6KL 4P05A 1T89A 3ARGC 3D87B 1WUNT 1ZSHA 2HKAA 4JUSA 1OP3K 4WLCA 2I9TA 2UY7B 3P73B 3HAEG 5BRZE 5TQ2H 1NAKL 1FNEB 5T5NG 2IWGA 3JWOC 3OKKB 3Q6GH 1PZAA 1F3JA 1RJCA 2AKRA 2ARWA 3AXIA 5C08A 5IW6A 1MNUH 2H3NA 4XCFH 3PXHA 5DF0A 5FPIA 3RDTA 3ZYJA 3RWGB 4AEIL 4D0CB 2GPZA 1H8SA 2B5IC 4JFTA 1RUKL 3WMPA 3MYJA 3MLTA 4ALAC 1HSAA 1H3PH 1FYTE 4EI6A 1ZWIB 4H0IA 2OX5B 3EBHA 2WANA 3OVUB 4QCIB 1D9KC 3U7WH 3HEIB 3V4UH 2PCPA 1FLRH 2AHIA 5KSBE 1PG7H 1DFBL 1D3CA 1E4KC 3QULB 4QRRE 2ZF9A 2VN4A 2EYTA 1Z1WA 4YWGL 3CFCH 4KUZH 1Q0EA 1TG8A 3F7VA 3OG4B 3W0WB 3MNVB 1FVCB 3L5JA 4YHNB 2Z31D 3TO2B 2EYSB 3RZWA 3KD4A 2WXOA 2H9GB 5EN3A 1ZGLM 2HLEB 3R0MA 4DZ8A 4YVUA 3ULUH 4ZFOA 1MFDL 2IV8A 3W9EB 2WQXA 4JPIA 3U2IA 4FYSA 3I6KB 4NRYA 1JNLL 5DRZB 1Z5HA 4FKEA 4OF6A 4LU5H 5DZPA 2A9BA 1TTCA 3UO1L 3H3PH 3TBTB 2LE9A 2TRHA 3D2UB 1ZEAL 3O2DL 1Y0LA 2W9DL 3KLKA 1GYVA 2R2CA 4PBWD 4CN4A 5ITBL 2W0KA 1KCKA 4HIPA 4Y5XC 4Q6IA 4HEME 2NNAB 3RVTD 5MENA 3AQZA 2OMBA 4QYOA 2AKRB 2D0FA 3ARUA 3HG1D 4XVOA 5IW6B 5J6GA 2V9QA 3QIBB 5ECGA 3H2PA 2Y5TA 3CHSA 4YSOA 4F9LA 3ASNB 1M4KA 2MCPH 3HJ0A 2ZCLH 3MRCA 4M62L 5FFLA 2P47B 2O5ZH 2GUYA 3MYJB 3S36L 4DWHA 4PWJA 1DCEA 3AFLA 3D07A 5D2NB 3WUWB 4EI6B 1F56A 2EDOA 2XXFA 1Q0XL 2C9PA 1SLUA 2WJ5A 4YBHA 3LIUA 1YEFL 4KJPC 3BH8B 3CC5B 2F19H 5DLML 1S9VA 2F58L 3GHBL 4IU3A 3SKNB 1ZT4A 4PAZA 4HLEA 4M61A 4FLSA 1B6UA 1BW8A 5F7KC 2IBBA 4LNVA 1H5BB 2VITB 1E65A 4Z7OE 1TO4A 5D93B 2EYTB 4ZO9A 2WCPA 1Q0YL 4ZS6D 5JOEA 4U6YA 1KIQA 1UTDA 3FH8A 1SY6H 5AZUA 5AOMA 2YKLL 3F7VB 5C0CA 3NJIA 1OPGH 1JPST 5MP6H 1GSKA 5CCGE 4QXUH 2H3XC 2YD4A 3LNFA 4TQHA 5FOBA 2QQNL 2ZXEB 1YO4A 3TC9A 2X6BA 3TJEL 1AGBA 3NCJH 4PY8I 4MLIA 4EQ3A 1ML0A 3C6SA 3BFOA 4AQEA 4B3VA 3CXDL 3ZTCC 2JE8A 3T8MA 4ZFOB 5FCUL 4IHOA 4JPIB 4X9HA 2WIIA 1SEBB 1A66A 3OX8B 1MEXL 1A8JH 4LL4A 4NRXB 1DBBH 4Y19A 2WWKO 2P4AB 5H2BA 2VR7A 3CUPA 3BWUF 2K9UA 4P57A 3QBTB 4GXUN 2NCEA 5CLXA 5EOCJ 3VVWA 5BW7A 5DEJA 3BX7C 3FQWB 3MRGA 5IWLA 5IVXA 1SJMA 1A6AB 3T0EE 1XEUA 4BZ1L 1RZGB 5F70A 4DP1X 5LGHL 4Q6IB 4U1NA 4HX1A 4S1SH 4UNUA 5MENB 1CDIA 4XP6H 3M7FB 1BQ5A 4ZW5A 3H42H 3MBWB 4KDWA 2FBJH 4UUJA 4V1DB 5J6GB 4EIZC 1C5DA 1KENH 4Q0XH 2BRRL 2NNXA 4KI5E 4K3JL 1YJDL 4PI0A 3QI9A 3ZDXF 4CU8A 3OZKA 2CLRA 5B1CA 1JPGB 3LB6C 2Q3XA 5H37A 4PLKC 3BRFA 1MWAL 5DVOA 5LAXB 4MA1C 1BJMA 3QIWB 5DD6B 1VAHA 2DI9A 1S9VB 1AI1L 3E3QC 4IU3B 4V11A 3SKJH 1VFMA 3LIZL 3L5XL 2ENYA 4EI5C 4EXPX 1F41A 3EYQC 3DHMA 1HTYA 2F53E 2VZUA 3IDYB 3MOAL 4O2FA 3O4LD 3SYCA 2FVNA 1HYSC 2X42A 1OD7A 5I1IH 1OE3A 1KIQB 1UM6H 1AKJA 3RDJA 1HK6A 2VDOL 4OGXL 3RIAF 2FQEA 3IEAA 1PMYA 1DQIA 3ARDD 3TV3L 2GC4C 5IMKB 3G5XA 5FKPB 4ZS7L 1U8PA 3FN0L 1AGBB 5KTEH 1AY1L 4QOKE 3DX6A 3IU4L 3VFMB 5C0ND 1BXXA 1BZ7A 4GUQA 2AVGA 4IHOB 1M7IB 2VXSL 4NXKA 4W9GC 2VDML 4TKWA 4DPRA 1XMWA 4JDEB 3V4VB 1GJIA 1LEKB 3UADA 5BCAA 5F3HA 1SVCP 3CUPB 3T71A 4P57B 1XR8B 5FGCE 5A16A 3G08A 3MRGB 1F2XK 3KR3H 1IBYA 3AABA 3OF6A 3UACA 4IOSA 4GMTL 5ACZA 4WFED 2J71A 3GHPA 1G9ML 3L8QA 4M5YH 4ODHH 4UUJB 5JIPA 2DMCA 1C5DB 5KBLA 4XX5A 1CDJA 4FQXA 4KXZH 3QI9B 2SODB 4TQIA 2EUXA 2A6JA 3A6BL 1LK2A 4WWPA 1V55B 2CLRB 4LCCB 5IQMA 2EDXA 3PGDB 2VW7A 1FIGH 1DSWA 3IDXL 4K23H 2R69A 1G7LB 5TE6L 5AOKA 3FFCA 2HUHA 3VXMD 1IC1A 1QLRB 3W38A 2Z0UA 1NOLA 2P5EB 4HSAC 2QGCA 5BUPA 2ITEA 3K46A 5GRWA 5M94B 5HVFB 1TTBA 4MRBA 3HG4A 2E27L 3FF8A 3MBEC 2ZKXA 4O2FB 1GAFL 3Q8EA 4JHAL 3BP7B 4N26A 1T2QL 4QWWD 3QWQB 2P8MA 4YVNA 3F7KA 4H8WL 2OXHB 3D7PA 3TO4C 4FL4B 5GZND 3VG0L 5ISZD 4I0CC 2XRAL 3G5XB 1CDBA 3FONA 1U8PB 4BFEA 3NJKA 4X7EC 2QQKL 3EYVA 1WTGT 3DX6B 4NX0A 1EVTC 3C9NA 5F7MC 4U1SA 3RE0A 4DP5X 4MJ4A 1BZ7B 1I1YB 2MCAA 2DICA 1MCQA 4APXB 2J2ZB 3MV01 2O6EA 5F3HB 2IIJA 3BUYB 1G7HA 3P11L 3PJLA 2BPBA 4BQBA 2VSKB 3ARPA 1QRNE 3JTBA 3G08B 4NO0B 4WI0A 1SHMA 1UCTA 4YSAA 3A6CH 2A9AA 2VR6A 5GGQH 4KWUA 2H4EA 3TJHD 2IANA 2D4FA 1JJUA 2PP7A 4LK4A 2DQIL 4NQDB 2K0RA 3HZMA 3O11B 4XNXH 5HBBA 5I18H 4PGZA 5BRQA 3WSQH 2EDKA 1EEZB 1UD8A 1LK2B 2EICA 1P7QD 1G4MA 1MH5A 4IIQA 4D9RD 5EU3A 3T09A 3PQYD 2AS5M 1EO8H 2WXQA 4NQEE 5CMAA 1E2ZA 3MGTA 3A24A 3CSYA 1T2XA 2ZD0A 3GYRA 1FFRA 1KY7A 1B0IA 5DVPA 5EU4A 4XP1H 4AH2A 4AQOA 1YQ2A 2H41A 2O30A 1FE8L 2XX0A 3KS0H