3KBHE

Crystal structure of nl63 respiratory coronavirus receptor-binding domain complexed with its human receptor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
121
structure length
110
Chain Sequence
HTDINFTATASFGGSCYVCKPHQVNISLNGNTSVCVRTSHFSIRYIYNRVKSGSPGDSSWHIYLKSGTCPFSFICFSTVEVPGSCNFPLEATWHYTSYTIVGALYVTWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Angiotensin-converting enzyme 2
publication title Crystal structure of NL63 respiratory coronavirus receptor-binding domain complexed with its human receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 110
sequence length 121
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3130 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kbhE00
3KBHE 4F2ME 4F5CE
chains in the Genus database with same CATH superfamily
5J6HB 5J1TC 1UB5B 4QJ4B 1QWUA 4UQ2A 3CZGA 4KV5F 2FB4H 4GG6B 2FEDD 1I9RL 3H4FA 4RAHA 1BOYA 3IRZA 3QFJB 4Y89A 4F7TB 1CICC 4LCVA 3UBXG 5H94B 2BNUB 1T20A 2EDTA 2HG5A 5D7JC 1NAMH 5I19H 2M2DA 3CAFA 2QKSA 5EO9A 1UEMA 4PUBH 4PJEB 2FHBA 2YD5A 4YVUA 5IB1B 2VAAB 3N0PB 5D7KE 1ZA6A 1ZVNA 2P4AB 3EZJB 3MRJA 4KXZI 3GSRA 5E8EA 3RY6A 3CSFA 2E59A 1KNOA 3KL0A 4LEEA 5JHLH 1A66A 1T6WA 2WLMA 5DMKA 3KYAA 2D3JA 5DRNA 2HKHH 3JV6A 4HT1L 2O30A 4P06A 4U1JB 1MIML 4FFYL 4GIPD 1KZYA 5IHUL 2XSKA 1VGKA 2ICEB 1JYWA 3L7FB 3KLAA 4GW1B 4X4YB 3QJHB 2V8MA 1BXUA 1IBHA 3TH4T 5KBLA 3EGSB 3OXSB 1A6VH 2F8IA 1ORSA 3NACL 1E5YA 2GITB 4Q52A 1T1ZA 3V4VH 1BZOA 3WN5C 3DUUA 1CXKA 3T6QC 2KS0A 1CYGA 1YAIA 1FQ9C 1H3PH 5H4YA 4MXWH 3TA4D 1JHLH 1BQSA 1CFMA 3C60C 4NQEE 4P2OC 4A04A 1JVKA 1OQXA 4KC3B 1XIWA 1U8CA 4HX1B 4R3SB 5C97A 3UTPD 3MX0B 5I15L 5LNEA 3S3SA 3VWJD 5IESH 4Z7QB 3LQZB 4PJAB 3C5ZA 4JG1L 1V7ML 4XNYH 3V7MA 3E2HC 4PRHE 4LSRH 4MTMA 1GH7A 1HNGA 4IKLA 4M9PA 4K8RL 4DN4L 1HFUA 3CFUA 5IEKA 1QFPA 3D69A 4JM2A 4XBGA 4XN7A 3HMWL 4ZMOA 2N59A 4R7NB 4I0PA 4G6FD 3L4UA 4H40A 4UOW0 1AG0A 2YAEA 1AAJA 1ET7A 2VLJD 1TTUA 3CK0H 3BKCH 5F7EH 5F6IC 5L88L 3LB6C 1GHFH 1F90L 3DROB 1MWAA 4WEEA 1L3WA 4CVZB 1KB5L 4NRZA 3L2NA 3MLVL 3T0EC 1YLBB 1XSJA 3EBIA 1G9NC 1U33A 1WA0X 3I74A 5I1IL 2DEXX 4XP4L 5LN8A 3CN2A 1T2QL 4JFZL 3QNYB 5D7LE 4YDJA 4IEFB 1FYTD 4ODTH 4HIXL 3F7YA 1T04A 4P49A 4AIOA 5CJ5A 1TENA 1ORQA 3WNPA 5FUZL 2XWEA 3VXPB 1U36A 2V3FA 1O0VA 5B1JC 1F6AB 4ZW3A 1I3GL 5GGRB 1AZBA 5JXAL 1K4DA 1F4YL 3QORD 5CEZL 1G0DA 5IQ7H 3OKOA 2IBZY 2YA2A 2WJ5A 3VG0H 1TVHB 5E7FA 2PXYB 1GC1L 3SDAB 2J57A 3FFDA 4JZJA 3AG1B 4PRNB 2GJ6B 1ZLWK 5B8CB 3RY4A 3B9EA 5KJRL 3QJXA 3CFIC 2DLGA 3QQ4B 1HHGA 1QKZL 2ORBH 1IVLA 3GLZA 5F1OB 4HH9A 3W3BA 4UCFA 5HDLA 1ZVYA 3KLLA 5T33H 5D4JA 4PWIA 2Y1ZA 3IPFA 4W81A 2PCPB 4XCEA 3MOBH 4P3CH 2QBWA 1FFPB 5C6WH 3FCTB 4KK6C 1MPAL 2MMXA 3NYKA 3JV0A 4JW3A 3GSOB 1E28A 5B39G 5TJWK 3V4UH 3HUJE 5EF2A 4QNPE 1YEEH 2FYYB 4Y0GA 3KCPB 2LLNA 3U4KA 4P46D 1SVZA 4CBPA 4S0SD 3GXFA 2I9LA 4P57A 4PWGA 4HU2A 4TF4A 3DGGA 3OV6A 5SX5H 5BRZE 4M6AA 3ATAA 2H47C 1M57B 3MV8A 2G5BA 5FOBA 4OZHA 5GRUH 1JYVA 2DTML 3FOMB 3BFQG 2KH2B 5EBLB 1G9NL 1XWVA 4MB5A 3MNZA 3TIEA 4BFRA 4XAWL 1KCUL 3SY0A 4AMKH 4BJLA 1LVEA 2HFFA 3GEFA 3HLAB 5C09A 4AJVA 4FTDA 1I1AB 4NAJA 1SDDA 1EUTA 3DIFA 2Y22A 1T03H 4OUOA 5AAWC 2K9UA 1IM3D 3D2UA 5D1QA 2ZG1A 4WU7B 3MRGA 1JL8A 1KBPA 5LBVA 5A16A 4ZX4A 3ULVF 1YYML 3D18B 4HF5H 1YY8A 2CIIB 1R5IB 4F9PC 1C8QA 2VLLB 3N41F 4G72B 3RI5K 5MEPB 3HW7A 3DETD 5D96C 3EW3B 4A2MA 5HSFA 3HZ3A 3SYQA 5HJDA 4EDWL 1R5VA 4YDLB 1BHGA 1GGUA 3DX4A 3BE1L 4UZSA 4BZ1L 1BA9A 5ECGA 5FO8B 1NC2A 4KRNA 3ZZQA 3WNLA 3JWNH 1IGJB 2VUYA 2WW8A 2CDFA 3QEGH 2Q86A 4K23L 1M7XA 1PZSA 4LPYA 4V1DA 3WLWC 4OZFA 3QG7H 1T5KA 1QSFD 1IX2A 3NRQA 1RFDH 4OZGE 5IBLC 4PRIA 2F7OA 2V7HA 3MRQB 5AUMB 4ZNEA 4F8TA 4Y4KB 3DRTA 4KKNA 4GKLA 5F9JA 5CINH 2MQ0A 1LNUB 4MJIE 4E41B 3UTQB 1WZKA 4UYQA 1NIBA 2F54A 2PTTB 4G8EB 2R56L 2XACC 4H0HB 4TL4A 5IFHL 5D6DA 4UTBA 2YPLA 2PW1B 3RL2B 3VRJB 3S36L 2EYRB 1CR9L 2WKGA 3BZEB 3NAAL 1SUJA 5L8JB 4GQ9H 4DP7X 3PREA 2UYLA 1RVFL 1FZKB 1E67A 4P23B 2H1PH 3TL5A 5ETUB 5JDSB 3Q8EA 2IDQA 3IXAA 2NY6D 4M4RA 4Z95H 3MCLL 3LVEA 1EDYA 4JPKL 2Z4TA 3ZIYA 3H9SB 2WLJA 4RNRA 4I3GA 1O6SB 1HWWA 1QLEH 5IW1B 3SDCA 3QIBA 4FTVE 5E8OA 1U95B 1AD0A 1MI5B 4PJHA 1PD6A 2P8MA 2X4OB 1YEHH 2FBOJ 3KDPB 2EKJA 4JFTA 2I5YL 3PXLA 2V2WA 1GYWA 1QYGH 3O9WC 2WXGA 4E9YA 3IKCB 3JTBA 2NR6A 4TNWF 4XN5A 4MAYA 1L7IH 2A5UA 5EEVA 2FK9A 3U83A 4A7UA 5SV4A 5LKNA 2OMYB 2ZXQA 4DTGL 4JCWA 2GW5A 3QGVA 4N8CH 2XCMC 3BVTA 3B1UA 1P9MA 1URLA 2OL3A 2Z8VC 4DGWC 1F56A 3MJ9H 1NCIA 4HP5A 1YHPA 4PJ5D 5DD3H 5HDQH 3RZWA 4Z8FL 3BPLB 1AQHA 4ZDHA 3W11C 5DWUL 5J06A 1N3NA 5MEQA 3W56A 4LF3A 5I26A 3CSTA 1S7XA 3EBAA 4KK5D 3GHBH 4ZSOB 2FO8A 4GW5B 2CG9X 1WK0A 3H3PL 4HGKC 2FIRT 3VXRB 1FNHA 4K7PL 4N2GA 1USQA 1QBMH 4AW7A 1RJCA 3LIZA 4U3SB 4JPSA 4U3HA 5IK3A 3ZTNH 3RPIB 4CMHB 3UBXA 5CU9A 1NLDH 4A6YB 3MGTB 2BIQA 1J9QA 2GQHA 3U4EA 1ETZA 1UJ3B 2YC1A 3H54A 3DXAA 4GMSL 1IC7H 4TUOA 5F9OH 1H3UA 1KGCD 2XU9A 4MNQB 2F08A 3OKNB 3T1WA 1HU8A 3SJVA 3MYJA 1U8MB 2RGSA 5AG9A 4HAGA 1XH0A 2UY7B 1XF2A 3BVUA 1UGKA 3RWJB 2VYRE 5JW5A 1NBQA 5CMAB 2BP5M 3V6OE 1XGQA 1HNYA 1S7QB 4Z7WA 4FKKA 4M7ZB 4W93A 4OGYH 5AOKA 5EOQL 1UFUA 7FABL 1ODUA 2IWKA 5F3BB 1KTDB 3TBWB 2YUXA 2G2RB 1OP3K 1KB3A 1JD9A 2I85A 3CX5K 3ZR6A 1NFDE 5ACZA 3FU9A 4EQ3A 5JW4R 2NY5H 4F2ME 3BHBB 2BERA 3ARFD 3E3QC 1EHNA 5EC2B 1P6WA 1J18A 2AJXL 4JFDD 4XNXL 4EI5B 3VXSE 1JV2B 1MFAL 4FFWC 4FZEL 3BAEH 3QDME 4IGBA 5I76B 3SODB 4FXKC 3FQYA 2P24A 1OZUA 5T3ZH 4LCYA 1TKWA 4DOHE 2JB6A 3BQUD 2NY4C 1EEQA 1E90A 1ZSDA 4N0FA 3TYFB 2C3HA 3IJHA 3BP4A 2BCMA 1T7VA 4CC4A 2WNXA 4X80H 3UADA 1SMAA 2LVCA 4L1BA 3ARGA 3ZKXB 3UPRA 1KJ3L 5TDPB 4Y4HC 2OTUA 5E4AA 3QO1B 5DLMH 2XVLA 3RX7A 4E68A 4JHAL 3MRFA 4P4KB 3EFDH 3S48A 1QWNA 1XXDC 4QLWA 3TA3C 3VG9B 3EDKA 3S8FB 3RX9A 4KDVA 3ARBB 2DWDA 3O8XC 1OT4A 2GJPA 3WE6B 3M6DA 4OIBA 3H2PA 4EPSA 1NPJA 1M56B 2WQAA 3KWWA 3FU7B 3TBTB 4N26A 3N1MC 2N01B 1EV2E 3CSYA 5GPRA 3Q2NA 1EUUA 3K5SA 4LFHG 1H19A 2A4ZA 3RVTD 5CHNA 3MI6A 3CHRA 3MVSA 4GEJA 3X2QB 2OR7A 5HGGS 1UWEL 2AXFA 5FPIA 1SYSA 4HOWA 4NBYB 3M17B 4UNTA 2GG1A 3KPOB 3L45A 1B6DA 1RJLB 5BJTB 4TVPL 4ZO7A 3PRZA 5HDBB 1W0WA 8FABA 5I73C 1GVIA 2CIKA 1U8LA 3K74B 3UTSD 4WFFE 3L3HB 4XVUC 1CGSH 5DUJA 3UCRA 5HHOE 3T3PE 1QACA 4TNGA 2WSPA 2V9RA 2BVPB 3JBG7 2C8NA 5M94B 1DUYA 2WQRA 1SPDA 3I85A 2ZYRA 4OZ4A 1D5ZA 3DVNA 1BZ7A 1R34A 4ZW8A 4FQLH 3A5VA 4PJIE 4AZ8B 4NKMB 4ODUA 3KEDA 1MFNA 4PD4J 4C4KT 2XG5A 2B2XL 4RH4A 1A7OL 3N3EA 5E00A 4URTB 4KK9D 1S5HB 3RPKA 2J1KA 4Z77B 4IRSC 1SOSA 1IC0A 5D6CB 1WYJA 4PY8J 4GJTB 4J3SA 3T3MB 3V55A 5GGSY 2YWZA 5I82A 5HYSA 3ZKQD 2J12B 2F61A 3JZYA 4WHDA 2FGWL 1PZUB 4WJ5A 4QJ5B 2ZUQB 3EF4A 3LH8A 5FV2A 4GW4A 3X3GL 5LAXB 3ULUD 3X12A 2HT2D 1KN2L 1QA9B 5F0LB 1EO8H 4W1TA 1OE2A 2XNAA 3D33A 4LSPL 4D2NA 3S35H 2WHVA 1JUFA 5I75C 4HG4J 1UD4A 4K9EC 1TT6A 3TNMB 5AVXB 3F3HA 3FQXB 2UWEB 4J3OD 3S88L 4KZEL 5J9PB 2R83A 2ENQA 4CDHA 3QWRA 3AQZA 2ZZUT 5HVHB 1P7QD 2HJKA 4YBQC 3NCMA 2WYHA 3NZ8A 4N0RA 3UG3A 1KCRH 1GY1A 5HGHA 4JHBA 3MNDA 5J11C 3IDIA 3C08H 4N22A 3S4SB 2NLJA 4BQ6A 1ERNA 4P5TB 1KJMB 5E6UB 1OTTC 2JQAA 1KPUA 4GG8B 5CJ8A 5L8LB 4HZLB 4I18B 1AGBB 3FN0H 2WKLA 4N8VB 5F8RC 4NUPA 4NCC1 4JR9H 3WKYA 1SJMA 4JHWL 3N06B 5IHHA 2Y06H 4BBWA 1J1XL 2EDQA 3EJUA 4L8DB 1KEML 2C9SA 3BMVA 3RDTC 2V5YA 4TNVF 1GZHC 4NIKB 3ERXA 4GQPH 4TSCL 3OJDB 1FGVH 1FL6B 2KHAA 3LKQA 5CS7A 1RLBA 1U8OA 2ZWLT 3QFDB 5CJOL 1JGIA 3PWLB 5EZJB 4Z76B 1MRFL 1QI5A 4PPTA 1EAOA 3T0EE 3HPLA 4ENEC 3LN5B 4I0CC 3A67L 5TH2A 4A2GA 4O5LH 1AY1L 3WS3A 4Z3IA 4Z7IA 5FGCE 1CZ8H 3IETB 3OM3B 4A63A 4OAWB 3FTYA 5DHVA 3NCFB 2CZNA 3DMMB 3HG0A 4JFWA 3QZNA 5I6XC 1EGJH 4NKDA 2HN7A 4D3CH 1IBYA 3LKNB 1P7BA 4HPYH 1PZBA 2MCMA 1OAZH 2QPSA 4JFFE 4FDWA 3RTQB 3SPIA 3VWKC 3VFNA 5C2BL 1BPLB 1MCJA 3MXWH 1UA7A 3GYRA 5AVYB 3CFCH 1ECYA 4AJ0A 3BSZL 5TF1L 4ZD3H 3K6SB 3O6KL 4P2CG 4PRDB 3WHXB 3VSUA 3D0AA 3GKWH 2CO2A 4IRZH 1FNAA 1XZ0A 4PGJA 4RWYL 1NDTA 2WWKT 3GHEL 1Z3GH 3Q44A 2H45A 1WAPA 3HZVA 3MNWB 3OXRB 3A6OA 4K5NA 3QS3A 2FYVA 3FPYA 4J12A 3FU6A 2AJSH 4L2LA 2BM3A 3PL6A 3MFFB 4PLKC 1FG2A 1UH3A 3FMGL 2HVKA 4FQJH 4ENZA 3VWJA 3CXHJ 3IU3A 5FYKU 4GI8A 4DVBA 4ZFOB 3QXUA 3BT2H 4I13B 4LCIH 2ZCZA 3PNWB 4UDUB 2EXSA 1KELL 4N8PA 3T08A 3SE8H 4XXWC 4A7GA 2DKMA 2YD4A 3NPZB 2WO4A 4U6YB 1MUJB 3LN9A 2P45B 2C3GA 2YMOA 4L8CA 4KXDA 1PU0A 4DKDC 1YECH 4G80A 4H8WL 3T0VA 1MFEH 1JNHA 3E80A 2XTJB 2JCCA 2QPUA 4PMFA 2VLJA 1AR2A 4AGPA 2X0WA 4P59H 4NERA 1XCTB 2X9WA 2ITCA 4YE4H 4L3CB 1BYOA 4WGVB 2CH8A 3BZDA 3BO8B 2AK4D 4CADA 2IAMD 3RVUC 2QZ5A 1KCLA 4PVMA 4JN2B 4KKCC 4TLUA 4IM8A 4WRLA 2R29H 2KPNA 5FEBA 4LEXH 1C12A 4G6KH 4JVPA 2OS7A 1ZLSH 3QUZA 5FK9A 2BDNH 3HNVH 5F7UA 1JZ8A 2F19H 5C08E 3GSUB 2A74A 3KXFB 1BQLH 1EAJA 3HC2A 1FYTA 1N8OE 1ADQL 2UVEA 3Q0HA 2O93L 4NNPL 3CDZB 3CXFA 5ISZD 3EJPA 3MHZA 3LRKA 4ZPTA 4LESA 4IBZA 4U1HA 5AW5B 2EECA 2NQDA 3ZYJA 2FQGA 3IDGB 4G1MB 4AL8L 3QORA 2BNQE 1FO0H 1KGJA 5CN3A 4POZD 2EIBA 3I6SA 2BZ7A 4PFEA 4G6AD 2YGPA 3AS3A 2ATKB 4FFZH 2VXVH 2QQNH 3TCXA 5JIMA 3V4PH 2YAPA 5IVXE 4MHHG 1I85C 4MASA 4ZUVB 3FB7B 5CJXC 1ZEAH 3OPZH 2WLLB 5GGUA 1HHJB 2ZYHA 1ZHKB 4ZFZB 3HZMB 4G3YH 4M1CD 3MLWH 1LEIA 5D1ZB 1ZGLB 3KPNB 3BKYL 3WS6C 5ALBL 5E8PA 4XNZC 4EUPB 1DFBL 5ESAB 2YSSB 1G6RH 5HBBA 2VIRA 2Q8BH 4KGLA 5TF0A 3V7AE 5IV2B 3BUYB 3P2BA 3B9AA 1U91A 3KPLB 4PHXA 3T1FB 3F7VB 3VNZA 4F93B 1W80A 3W0WE 4UZUA 3EJZD 1WJ3A 4U3XA 4ZUTA 1NBCA 2NTFA 1NFIA 4DKFH 4UOJA 4G8FB 2Q76B 2ZE0A 1C5CL 3GIVB 3QJFB 4YK4C 5ES4B 2PO6D 3T0WA 2DAVA 4YNYB 2AP2A 1RXLA 2MQCA 2Y07L 4YIQB 3ZDXB 3IU4L 3Q8AA 4QLRA 5BMFL 4X42A 2Z7UA 2DQEH 3QEHB 2E7MA 3A4EA 5ID0A 2EXWD 2XWTA 5AAMA 2WOYA 1XCXA 4BUHA 4RA0C 2DD8H 4Z3HA 1LP9B 1IGFL 4PB9L 4X8JA 4IOFD 4A55A 1CDUA 5CKAA 5CJBA 4TLSA 3KPSB 4ONGH 2YMXL 1S3KL 3GS4A 5IEHB 2WWMD 3QDJE 3LH2H 3NCJH 2B5IC 3MC0A 3C75A 2HMIC 2CXKA 1AR1B 4GSDH 3ENEA 3RHWF 4LSTL 1QFOA 2JCCF 2HRLA 3BXNA 1PCXA 1MJ7H 4PGEA 7TAAA 4Y4FD 2I9TA 3K4ZA 5AWNH 4QNPF 5KW9H 3HIZA 5GZOC 3RQ3A 1HHIA 2PCYA 1SXZA 5CIPB 4HWEH 5AFAA 3S5LG 3X13B 4AIZB 1RZFH 4DCQB 1XGYH 3FTUA 1G7JA 4LARL 2EZ0D 3FSVA 4TUKH 3RRQA 3PS6A 3MJ7A 4FKHA 1GIGL 3WEBA 4OIAA 1EANA 3IGAA 3KMDA 4RGMC 3GM0A 3GZKA 1ETJA 4X5PA 4G82A 5IFAL 1VACB 4OBSA 2UZPA 2IFGA 4LB8A 1R3LA 2CU9A 3O6FC 4PP2A 4OFQA 1FIGH 1S78C 2Z34A 2LE9A 3HHSB 1GCYA 2GT9B 4MWFB 2A7BA 1L9RA 3ROLA 2B4CC 2O5ZL 4ETQB 2F53B 3O2WL 3E3QE 5HDOA 3D3VD 3I50L 1ED3A 1AGCA 3NTCL 1NCUA 2FBRA 2ROYA 1DEDA 2EXYD 3B2XA 4BA0A 3SO5A 1JWSA 3BH8A 3ECBB 2CQVA 3FSAA 4B96A 3FQTA 1CXHA 3MGOB 4GRLD 3CVHA 3AITA 3ZN6A 4LL1A 1H8OA 4X4ME 4LQ1A 2L0DA 3NACH 3CUPB 3KGSA 4PJ5A 2BJML 5FV1L 3NSXA 5DO2D 5EU6A 2ALWA 5FYJU 4FI7A 2Y7LA 4P2RA 5FF6A 1CDIA 5HJBA 4ONFL 1KCKA 2NW2B 1WG3A 3LNIA 2EDNA 1N10A 2ZOKB 3KPRA 1D5IL 4XPTH 4U1GC 2E9BA 3JQOB 5E51A 4EI6A 2IANB 5IB5B 3HI6H 1MCIA 4BWTA 3T8XA 3UBGA 2X6VA 5LWYL 3BAIA 3PGFH 4UU9B 1F58L 1RD6A 4W9HC 3FNKA 3RGVD 2EDEA 2WBJA 4WWPA 2QMJA 4H20L 4K9JA 1EHLL 1OP4A 4DN4H 1RUMH 1E8YA 5C6PB 4PM1A 4Y16B 4KNTA 4NQVA 5EWIH 3L1OL 3HMWH 4OFIA 3BFOA 2X6UA 1W0VB 3LNHA 2YPVH 3N1GC 1FFQA 2EO1A 1HXMB 4CGTA 4NN6B 4OUUB 5JA9A 4FQCH 2DYRB 1BZDA 3RUGA 2JVUA 5EEXA 2Q3XA 1TITA 4YSUA 3G5XA 2ZONA 3LIUA 4WDIB 5BPPA 1SYVB 1UH4A 5I16A 1I8IA 2I24N 2M26A 3LV3A 2VZUA 4MQTB 4UB0H 3V5DA 3QA3B 1TZ8A 4NRXB 1KB5H 1JWMB 5D2LE 3G5YB 4G8AC 3PQYD 3MLVH 4JG5A 5FGBC 4LLMB 1E4KA 2X28A 4PJ9D 4U1SB 3JV4A 1XF3B 5G4NA 3M1OA 1WC7B 3L9EA 4ZK8A 1ZK9A 4XP4H 1G7HA 4PJCA 3SBPA 3FO1A 3A0OA 4OCYL 5KBDA 2LU5A 3MRDB 4JFZH 2DBLL 1P6FA 2VRAA 3WJJC 2JKJA 1L0QA 5FYLE 4JFQB 3QEUA 4FG6D 4D0CB 4HIXH 4R8WL 2BY3A 4N87A 3ARFA 3NJFA 3Q1EA 2ZWZA 5FUZH 2BH0A 2Z9TA 5DYOB 4Q6IC 1F02I 4JFED 4KX7A 3DKHA 3U2IA 1LK3H 1ZA3A 1I3GH 3CVBA 1PDKA 2R2CA 1F4YH 4U1IA 5IFJB 1I75A 1XSOA 1EDQA 2VW6A 2ZKXA 3C5XA 4OGAC 1LO3H 2VZTA 1A7PL 4PW3A 4WU5A 1CUOA 3C2SA 4Y2DB 5TE4H 1DLFL 1M3JA 4R4FL 5GQBA 3VFVA 2BSTA 4E9RA 5A6IA 1RY7B 1XL6A 2ZPKL 2HKFH 1QKZH 2DQHL 4FNQA 4NRYB 3E38A 1F18A 1BF5A 4YHIB 4ZW7A 3IJ7A 3GEWB 1TVBA 2YBGA 1N59A 3ARUA 2EEAA 3MLYL 4MD5A 1AO7D 4JFYB 1U8NA 3IDNA 1T5XA 4MQ7B 1IEAA 3GT6A 2HRGA 2WAQA 1CFVL 2VM9A 1CG9A 1HEZB 5CLYA 3BH9B 3S35X 3ABZA 3IFPB 1YMHA 4K94C 2WTRB 5IW6A 3VFSA 1Y0LB 3SKNB 1YPZB 1G1KA 4GUCA 1U3NA 4AENB 1PEZA 4PRBB 1G9NH 1UASA 4EQ2A 1PLCA 3NJNA 5DMGC 4XAWH 1KCUH 1SLVA 1VPOL 1NFDF 1TJGL 2K0RA 2AJVH 3FCBA 2LVEA 3CFJB 4L23A 2CJSA 2AK1L 4W70A 3RWIA 5J1SC 3HMXA 1R75A 1KDIA 3EOTL 1I8UA 4ATWA 1JZ4A 2X3BA 3B2VL 5SWZB 4DZBB 4XN1A 3GMMB 3EYFB 1NBYB 4NPKA 1JZEA 3IS0X 4OFKA 1V54B 1G7MB 1IBDA 4GOSA 2J8OA 1A6ZA 5T5FH 5LVEA 4HV8B 4S2SA 1OHZA 1MCQA 2XN0A 2A6KA 4EDWH 4BZ1H 3BE1H 1CBVL 5K9QG 2IQ9L 4ISVA 2P52A 1KPRA 3IFNL 3E6FB 4FG0A 3OC8A 5D5ME 1NDMA 1QSED 3GMLB 3VTTA 3ZHLA 4LCWB 4Q9CA 3DGDA 3M46A 1JF1B 1SM3L 3K46A 4U6VL 3S3DB 1DN2A 2I7SA 4AQAA 3D8MA 4BWWA 1YNTB 2ICEC 4J3UA 4OW6A 3MLSL 3MV7E 1YN7A 3BW9B 3HVDA 3RWFB 5D7IB 1K4CB 5DQJA 2Q6WB 3QCUL 3RUGF 3ZPDA 1LJMA 3QIWB 3VM7A 2V3DA 4LOEA 5DUPL 2OYMA 5KSVB 3O2DL 4GRWE 3QB7C 3GSQA 3TBYA 4C8XA 5IFHH 5L4JA 1UADC 4XO5A 3WI9A 4LSSH 1CR9H 1OZTG 3NAAH 2DLHA 4LVOB 1PZ3A 5IBTH 4P9HC 5C92A 4JN1L 3SQBA 1RSFA 43C9A 1RZJL 5ESVB 4G5AA 4P9ML 3MCLH 3SOBL 5L7XL 4MZ2A 3MRPB 2CDEB 5EOCJ 1PYWB 3CIQA 1R0AH 3P9WB 1P7QA 2NUPA 3H4HA 3NCYS 4JZOB 4UQBA 2DQTL 5F93C 4P2AA 3T3PF 2L7EA 3IMWA 1A7QH 4OZIA 4LLDA 4PG9B 3FH5A 5EF0A 3FUNA 1OVZA 4XBPB 5IJVA 3DX2A 1XR9B 2I5YH 3D39E 3QZPA 2WCPA 2H32H 4PJIF 4F20A 2EE2A 2GAZB 1ZKAA 4Y1AB 2XKNB 3VH8A 1WTLA 4HK3N 5T3ZD 4DTGH 2DYSB 3MBED 3VXMB 4RZCA 4KJQC 5BRQA 4UAHA 4DKEL 1MFCH 1XF1A 5DZPA 5IQNA 3TCTA 1N12A 2CR3A 2ADYA 5EBMA 4L9LA 1FE8L 3VQMA 2VE6B 5DLLA 5JMOC 2Z31D 3J27A 4NBXB 3EJSA 2DJUA 1O5PA 2DYPB 4LQFL 1TJHL 3WJMA 3S5LA 3M8OH 5D7SH 2ITFA 4FLHA 1L9SA 1E7UA 3R06A 5IHWA 1SXCA 3UYOD 3UO8B 1A7RH 5SWQA 4BH7A 3HZYA 5KVGL 1CE1L 2AV7A 1KZQA 2J2ZA 3H3PH 1M2OA 1RZIB 3MA9L 3BP7B 4H25A 1Q9WB 2IBZX 3VGFA 2NUTA 1JE6A 2GUOA 3ETTA 3U2SA 2PXYC 2DQJL 2IG2H 2QADB 3FTGA 4WFED 3SDAC 3GBEA 2BFGA 3QJQB 3VACA 4QCIA 1Y6NR 1N7ML 4WFHD 5JPNB 2IV9A 4OV6F 5GS1A 5B8CC 4K3JL 3F83A 1YY9C 3P0GB 4L4VE 4OQTA 4A68A 4HCFA 4D9LL 2CD0A 4L8SA 2V9UA 1JHKL 2QT6A 2MTPA 3KPQA 1IRAY 3PNRB 5E5UB 5K1VA 1K6QL 2QL1A 2F7IA 2P5WD 3S37X 4ZMYA 2AKRA 5ADOH 4N0CD 1AMYA 5I28A 2H7WA 3HG4A 3KAAA 4UQ2B 1WITA 1H5BA 2HTLD 4XAKD 4G8GD 2ZX6A 3MCG1 2WBXA 2OMUA 2QVMA 2HCZX 2JQZA 3QHTC 1N70A 1T20B 2P8LA 2HG5B 4CRPA 3P73B 2IEPA 3EFOA 4NZTL 5T8IA 4YJZL 2YRPA 5EO9B 3U7YH 4FKEA 3PHOA 2FE0A 1PFOA 1CTOA 1X5XA 1ZA6B 5E8EB 3UZVA 2WSDA 3MRJB 3GSRB 5CP7A 1KNOB 2A77L 5DMKB 4PS3A 3OAUL 4L3AA 2ICWA 2XFXA 3JV6B 1AQKL 4Y9EA 3S3JA 4BFJA 3IFLL 2KL6A 3FCGA 4MDIA 1BJ1H 3GMRA 1I1AC 3KLAB 3V0VA 4LGRB 4RQQA 4XNXH 4FQ1H 1ORSB 5E0FA 1AXIB 4NQED 5F21B 4N0UE 3DUUB 2XWCA 4AGMA 2J72A 4X6EA 3L3IA 3NCYP 2UXVA 2D0FA 3L2MA 3BLPX 4YDLC 5B3NA 3E8VA 4A2LA 4KMTL 1XIWB 3BAWA 3N41B 1U8CB 2BNRA 4PRHD 5BZWB 3QUMA 5KG9A 4H0GA 4JQIA 1MIEL 3D09A 3C5ZB 1KJ3H 2MKWA 5ELIA 1QLFA 5FUOL 2JJWA 5I74B 43CAA 2PPCA 1D6EB 1J8HA 5DZ9A 3A6CL 2Y4SA 4Y4KC 4QRPE 5IEKB 3D69B 1CI5A 1SF3A 4JM2B 4XBGB 3GINA 4JZNB 2IOIA 1U0QA 2W5PA 5EEZA 1SMDA 4JM4L 2IH8A 1IE5A 1FF5A 1WAAE 4OCNC 1F2QA 5IJDC 3JWDC 2P26A 1FVCB 4I0PB 3LMJH 3WXVL 4FQHA 5CP3H 4F8NA 5JR1H 3MZGB 1S7UA 2OP4L 4HIIA 2B8OT 3VQ1C 3SGDH 3TZVD 3HE7D 4OF8A 2MQ3A 3A6BH 2K3TA 1B3IA 3BKML 3OR6A 1MKFA 1MWAB 1MCKA 3E1ZA 5K9JL 5D7EA 1HK6A 4NRZB 4P23C 4LU5H 1MCWM 1SDYA 4N2EA 4HBQA 5D7LD 5FKAA 5LGYA 5LGHH 1OF2A 1ZLVH 3PFUA 4UBDC 1BSIA 1QQDA 2EYSA 3VQ2C 1E8ZA 1MHPL 4ZAKA 2MPVA 1QBBA 4U6XA 4NC0B 4DW2L 4GBXA 4YDJB 4HCRA 1QHPA 3REWB 1QASA 4WNJA 1E7VA 1ZIAA 4M7LT 5F1KC 3F7YB 5KZCB 1T04B 4NUQA 2VR7A 3SDXA 4YLCA 4QUOA 1ORQB 5CUSH 5HHMB 2CPUA 4RLDA 3CH1A 2X4SA 4WO4D 1HIML 2BW5A 1TZOA 3ARWA 1NAMA 1QTYT 4ZQTA 2XHNA 3BUQA 1ET8A 1K4DB 2F8XC 1A7OH 5DD0L 1MH5A 2HRPH 1TLKA 3MMEA 3T4AA 2WXFA 3ARTA 1M7IA 5JHLA 3FFDB 4JZJB 4KMQA 1WBZA 2WQVA 2XWZA 1NC4A 1HHGB 3ARPA 3H9ZA 4XH2A 4HH9B 3VXOA 4H8UA 2FGWH 2I60L 3BPLC 4MA8H 3ILEA 2V5SA 2VDRB 4DAGH 4XCEB 3X3GH 3UYRH 3EUUA 1KN2H 1R3HA 3IMVA 1R3KA 3CLFH 1HCZA 4KRPD 5BRZD 1T0NB 3CHPA 1E28B 4EO5A 5GS3A 3WV0A 4LSPH 3MRCA 3UJJL 3VFUA 4M43L 2I9LB 1A7NH 4P57B 3GRBA 1YMMA 1WCQA 3DGGB 1XD1A 4KFMA 4KI5D 4XC3L 4YC2B 5FB8A 1C16A 4ZUSA 2HPTA 1JAEA 1P5UA 5IVXF 3MV8B 3TIDA 3S88H 2G5BB 4KZEH 1YG9A 4LEOA 4OZHB 5FOBB 3RJQB 3MU3A 3TS8A 2QLYA 4CMHC 3MNZB 4UV7H 3TIEB 1LE5A 3CDYA 2DOCA 3SY0B 1VZIA 1ES0A 3RWGA 2HFFB 2EDBA 5C09B 3EIFA 1UJ3C 5KVDL 4XP9L 1SDDB 3DIFB 1VZGA 4PG2C 3D2UB 5D1QB 5HXMA 4HEPA 3MRGB 4NJ9L 5A16B 3VNYA 2NCEA 1YQ2A 1T1WA 2FJHA 4X0KA 5F70A 1YY8B 4CDGC 1NANH 4JANA 2Q7YA 5IWLC 4FYSA 4W9ZA 1KEMH 3VGEA 2F15A 4M7ZC 2XT1B 1R5VB 5BO0D 4TSCH 5F3HA 4XBEL 3QI9D 3AS2A 1NC2B 1F0LA 5CJOH 2YQGA 2CDFB 4HSQA 2Q86B 4JB9L 4J6IA 1MRFH 2YA0A 4NM8H 4V1DB 1NINA 4OZFB 4YPGA 4R9HA 5C07D 4XHJD 2HFTA 2ZXCA 2JJTA 1KB9K 5TFSH 5L9DH 4MJID 3A67H 4PRIB 3FB5B 5KVFE 1BJ8A 3HR6A 3ZE2E 2V7HB 1A47A 1Z9LA 4AQOA 1AY1H 2QJDA 4A2EA 3DRTB 4EN3D 5DVOA 3F04A 5E1HB 4EI5C 3DV6A 3KBHE 3MDJA 5F9JB 1IBGH 2J8UA 4UYPA 1HYRC 5E5RB 3QHZH 2F54B 4I77L 2X4TA 4JFPA 4IKIA 3GSNH 4TXVB 1G9EA 2GI0A 2YPLB 1MHEA 1DQLL 2X4UA 4Y2LA 4Z7UA 4C56A 3C6EA 2IFFL 3BEVA 4K9EH 1Z2KA 4AKQA 3UIYA 2JH2A 2UYLB 5KSUA 3BSZH 4M29A 2IH1A 3ZKXC 3O6KH 3IXAB 4FTVD 4M4RB 1Y6MR 2EE3A 2WPGA 4P4KC 1OK8A 5E70A 1VF5C 5H8DA 4QXUH 3VG9C 2E6QA 1NLBH 3ARBC 3C6LD 1V05A 3SDCB 3QIBB 2RD0A 2WM0A 3X11A 2PR4L 4PWKA 1YNKL 4RBPH 5E8OB 3VI4E 4PJHB 1AD0B 2MSPA 2P8MB 4DFIA 3GXDA 4FMFA 4JKLA 3FMGH 4K5OA 3NCCB 1UUSA 3QJTB 4YFEA 2H6PA 3D2TA 2OJEA 2V2WB 4DO6A 2X4NA 1WA2X 1DJIA 3GZOA 3P0YL 5F72S 4MAYB 5DEJA 5E2WH 3SGDI 1JVOA 4L3EE 3I9PA 4UTAA 1N6VA 3I2CL 1EXGA 3V6BR 2NX5D 3WMPA 4RMRA 5MP6H 2OCFD 1EX0A 2VZ3A 1PNCA 2OL3B 4QHPA 3VD9A 4DGIH 4H8WH 3EG9B 4AYSA 2PKDA 5EH1A 3FZUC 2QMKA 5CM1A 1DQJA 4D9RE 4GKZA 4NWTL 4ORGA 2V9QA 2XXMB 3AW5A 4WK4B 1N3NB 5C70A 3O41A 3EF7A 5GZNA 1EFQA 4FNUA 5MEQB 5JHDD 3CMGA 4LF3B 1Z7JA 4GG6E 1S7XB 4Z7OF 3QFJE 2XTLA 3WKPA 1N68A 3PQYA 3LOWA 1FFTB 3ZSSA 1AOHA 3FJTA 3FAWA 3NN8A 4GAGL 2X0UA 3ZO0A 5DS1A 4ELMA 1JXDA 2VDKH 3SDDD 4PJEE 5M7QA 1CLZH 1RZQA 5IOPA 4JKNA 4NZUL 4GRWH 4TTDD 1A9EA 3Q7JA 4ABQA 4Z0XA 5IB4A 5IK3B 3WJLA 5K39A 4XCNA 3ZBMA 3ZSTA 2NY3D 4OU3A 3UBXB 1UQSA 1OCRB 1OV8A 4L4TA 5I0WA 1B4JL 1RK7A 3U4EB 1ETZB 4ZMAT 1OTUD 2YC1B 4KZDL 1TTGA 3DXAB 3H6AA 3KW8A 4TUOB 1U92A 1I9JL 2AVFA 2ZUQC 4YUEH 5GGRY 3TXAA 5KWYC 4XT1C 2R2HA 2AQPA 4X4ZA 1LM8V 1HSAA 3SJVB 4AL8H 1XZWA 1T7ZA 3KYOA 4ZS7L 2O5YH 2ICWJ 3QE5A 1XF2B 4HLJA 1ZANH 5JW5B 4CN1A 5KVGE 3WFHA 1XGQB 4AE1A 5I30H 4UINH 4Z7WB 3LNGA 4AGNA 1W8NA 1Q0XL 1SN5A 3OHXA 1X4YA 4LT7A 2FR4A 4Z7QE 4OLVH 5HVHC 4PJAE 4A39A 4ANXA 4ZO6A 3VXSD 5ACZB 1KBKA 2J8UF 3QDMD 3QZBA 1AO7A 4O2EA 3BKYH 3WNNA 2NY1B 1JG9A 1MLBA 3CN0A 3K72A 4OJFH 5C7ZA 3BI9X 4U0RB 5TQ0H 2APBA 4P5TC 3IN2A 3A4DA 3P4MA 1E3XA 4KTGA 5D2LF 3ALXA 9CGTA 4I18C 3B83A 1PAMA 4WUUA 1OSEA 2W80C 1KDJA 4Z7UF 4IGBB 3MUUA 3PV6A 6PAZA 3GPSA 4LCYB 1AKJA 1TKWB 3T2NL 1ROCA 2JB6B 2EJ1A 1CGVA 4TQEL 1NANI 1ULVA 1ZSDB 2BP3A 3LDBB 4N0FB 3U7WL 3OSKA 4KKAC 3IJHB 5JLZA 1C5CH 3BP4B 4P2QA 1BAGA 3APCA 3ARGB 3TO4A 3UPRB 4U6HA 2OTUB 3I9GL 1DQDL 2QFPA 4FQQA 2CBTA 2AABH 2G0LA 5J6SA 1N64H 3MRFB 2VLKD 2HRHA 4XXDA 1E8XA 3NZHL 2DWDB 3T6ZA 4B60A 1A3RH 2PP8A 3DMMC 1IGFH 4W9IC 5JXED 4LKXA 3WEMA 1QW8A 3KWWB 3BDYL 3QRGH 4FX5A 4JDTH 2W0PA 3CSYB 2YMXH 1S3KH 5FECA 3ABKB 3MQIA 4MZ3A 1LEKA 2JXMA 5CHNB 3H7LA 3RTQC 3RIAK 4M03A 4RZKA 1NGZA 1MCPH 3PP3K 2AXFB 5LCVA 3RG1C 1J9CT 1SYSB 4WFFD 4K8RD 3LN4A 1UWGL 2GJ6E 5HHOD 3MV01 3MRMA 3AGWA 4N25A 1W0WB 8FABB 2CIKB 2XQ0A 4LSQL 4B0MM 1U8LB 1SOXA 1BAFL 1T0OA 1CPUA 1KGYE 2EICA 1UZ6E 2AEIT 2C1PA 3RJOA 1CICD 2HT3C 1YZZA 4FCHA 4AVIA 5IBUG 4HBCH 5D7JD 4KKLC 1DUYB 1JMXA 3V6ZA 5E6ZA 5A40E 5I8KH 2EIDA 1D5ZB 4OZ4B 3DVNB 1BZ7B 3D87B 1F86A 3IMUA 2Y0SA 4PWEA 2PTVA 1GIGH 3WEAA 2AEQL 5CBAA 5BUAA 2ZXWB 4ODUB 1JK8A 2CK0L 3LJ3A 5IFAH 4ES9A 4Y5XA 1J12A 4MRBA 4B9FA 4AQEA 1JDAA 3AWEA 5E00B 5C7XH 1JXKA 4ESKA 3B5HA 2QVKA 1IM9D 2AC0A 1CK0H 4U1KA 2B1OA 4NWUL 3WFDL 2R59A 1SHMA 3GJFH 5LAPA 2WB7A 2XTJC 1W6WA 1AZZC 2KT6A 5HYSB 2O5ZH 4FQXA 1JXJA 3TEXA 4RGNB 3O2WH 4WJ5B 5C71A 3OKKA 3UYPA 3WIHA 4JFSA 4GW4B 2C3WA 3C60D 5C0FA 1V55B 2H2PC 3HFML 4UT9H 4LZKA 4TYUA 4NUGL 1H3XA 4HLZG 4QHKJ 4EKJA 2GEQA 4HSCX 1IU1A 4X7SL 5DURD 2XNAB 1LO4H 3R1GH 1BX2A 1JUFB 3T0XA 1J9TA 1LO0H 3TWCH 1ZJAA 3CDFA 5I1HH 2Z31A 3QUGA 2BJMH 5AL8A 4AVJA 1A6TA 4KKBD 2HJKB 2JJSC 4NQXA 5K33A 1A4JA 1II4E 1Q9LA 3NZ8B 4M1DL 2EIZA 4PWHA 3VDCA 5HGHB 3DX9A 2FQFA 3X1EA 3HR5A 3IDIB 1B4TA 4W68A 4DT2A 4XNAA 1N4XH 1Z5HA 2NLJB 4S0HA 3TOPA 4JEGB 5AYUL 1KPUB 1BEYL 5ADPH 1F3RB 4E41E 2VMFA 1NSNL 2CRMA 3S2AA 3FT9A 4R2GB 1UM5H 3AZUA 4YDMA 4H20H 1EHLH 2ZX9A 3QO0A 4YSOA 1IC4L 1LDSA 3V0IA 2AS5M 2Y2TA 3KLSA 5INCA 3QEQD 5CZXC 3LKQB 4TULL 1U8OB 1KTRL 2P5WA 3ECVA 3ZTDC 2VLRA 4N2NA 2QHLA 2O5XL 2DWSA 3QDGE 3L9RA 1O75A 3TWYA 1E3ZA 2GKIA 4DK5A 2ZX7A 3HPLB 3LKSA 1S9YA 2G2PA 5D1ZC 2K6WA 4OH2A 3H9SE 5I17A 3EH2A 5TH2B 4G8GA 4DP9X 4XN4A 3O11A 3WS3B 4IBYA 5ICZA 5KVDE 3F5WA 2Z8RA 4L29A 5CLZA 5IZ7A 4JQVA 1MI5E 4N5ED 4F7CA 4JFFD 5DHVB 4LGPB 4XGZA 3TN0A 1NAKH 1S7RA 3R4RA 2DM4A 4KJWC 2D31A 4NDMA 4B9JA 4N2LA 2YKLH 4BCYA 3DX3A 1KWKA 1QBAA 1XBDA 2HN7B 4NKDB 4OCYH 3MUJA 4L9DA 4MS8C 5IB3A 3BCFA 2AMUA 5BS0B 1KXVC 4LBAA 3VFNB 4L1LA 3I6LE 1CD1B 3OGOE 4R8WH 4B27A 4A66A 2IH9A 4KQ0A 5TK2A 2J6EL 1HINL 5EIVA 1C5BL 4EXPX 1PCSA 2LAAA 3CC5A 3GLDA 1MVUA 1U6AL 1D5MA 3L95A 3NJGA 4J1UA 3ZUNC 1XZ0B 3GBNH 2XQYA 2CCWA 4C54A 1BF2A 1IJ9A 3RBSA 3HZVB 5IGXH 3NSJA 2ZAGA 1ASOA 2OSYA 4PS4L 4CU7A 4XPHL 1A7PH 1VGEL 3PL6B 4J2XA 1DLFH 2CRIA 3NZUA 1FG2B 4ZRGA 2CKBL 3QJSB 5HHVL 2CKNA 2HVKB 4RSVA 2ZPKH 3VWJB 3U1QA 2DQHH 3IU3B 4ZSOE 4DP5X 4DVBB 5LQBL 2HLEB 3BP6A 4Q7DA 3NFNA 4PGBA 1PEWA 3QYNA 2JK5A 4PLNC 4P5KA 3VXRE 4HFUH 5CZKA 4AIEA 2WXIA 3U7AA 1AR1C 2NXZB 3L5WA 1U3JA 2EUZA 4JL2A 4MX7A 35C8H 4L8CB 5EOTA 5CGYC 2NY2B 2QSCL 4K3HA 4G9FD 1ZIBA 3CHQA 1JNHB 1N6UA 3HCVA 2JCCB 1DBMH 2VLJB 2B08A 4OF5A 3SPCA 2X1WL 2H2SC 2ZP9A 1P2CA 2JMRA 5GHWH 1AXSA 4MNQE 3TZVA 8PAZA 4M8VA 3M1CA 1AS7A 2IVFC 2ZXDA 1JIBA 3WFEH 2ITCB 4LP4A 5DC0A 5C3TA 3WAJA 3G5VA 2G9HB 4Q9RL 1VPOH 5KVFH 2WXMA 3DX7A 4DWHA 1TJGH 4CADB 4U0QB 4JPWL 3QULA 3V10A 2AK1H 2Z65C 2BHFA 4R6UA 4M00A 1TTAA 4PTTA 3S5ZA 4V33A 5EZIL 1CI3M 4AZUA 4BRJA 3WLWD 1CFNA 4N9GA 3EOTH 4FHJA 5C0AD 3ECQA 1C12B 3B2VH 2Y5TA 3QUZB 5FK9B 5IBLD 4E0RA 1W72L 1QWHA 2SEBB 2A74B 3LPFA 4KJPC 3UTTA 4NB7A 1FYTB 3OQ3B 3TFKC 5T1MA 2C9AA 4IW4C 2ARWA 4O9HL 5C0RH 1XEUA 2VDML 3JWOC 2LHAA 4ZPTB 4PJ7A 3HZKA 3IFNH 4MMYB 4U1HB 4U6VH 1SM3H 3QORB 5FGSA 3X1FA 1DANT 4Z7NB 1IGYA 2DKSA 5GJSH 4V11A 1TSRA 4LDOB 3LHAA 4TTGA 5ESQA 4JJHA 1N8ZA 4JKKA 2OZ4L 4MA7L 3BESR 5AVRB 5HGDA 3QCTL 2A6DA 1O6VA 1K8IA 3MKGA 4PHZA 2BSSA 1G9ML 2J7LA 1A1OA 1OW0A 4Y8DC 1X5GA 3QCUH 2YGOA 2EVFA 1WAAF 1XAKA 2UUDH 2F6AA 5DUPH 1LO5A 3LKRA 1ND0A 4X9IA 5GGUB 1DVZA 4OKVA 3NJKA 2VN6A 3WXWL 3VYNA 4YR6A 3UG4A 2E27H 1IQWL 1VEOA 4JY6B 3P2DA 3ZL4L 1M71A 3FRUA 4OD1L 4K94H 5E8PB 4B9YA 4FLRA 4OFYD 5J1AA 3ARDA 2YRBA 3W0WD 3TVMD 2VIRB 5EU3A 5TDNA 3O9WD 1YEFL 4WTXA 4K71B 4P9MH 4KBPA 4TQPA 4L2YA 3UJTL 1U91B 5L7XH 3LRLA 2ERJB 1MY7A 4UOQA 4O2CA 5J12B 1BBDL 3AS0A 4XPBL 4ZUTB 4Y16C 2NTFB 1NFIB 4NBZB 4IU2A 4NZFA 1TZIA 2DQTH 3KJ6H 4MA1B 4KTEL 3DO7A 4EOWH 1NCBL 5B1AB 4Z7AA 4NN6C 1VA9A 2QVFB 2VZ1A 1NBZA 3V9CA 2ZOWA 1NKOA 2XIIA 4YSPA 3UC2A 1GYCA 5D4IA 5HDBE 3W11D 4AYEC 3HBPA 3MLPA 1HL5A 2ZF9A 3JWOL 5ID0B 2XWTB 5CFHA 4WFGE 1VB9A 1UEYA 2Y6TE 3V9EA 5HHPA 1HWGB 4X8JB 3APDA 3U46A 4AT6A 4EMZA 3LXBA 3QI9A 4RAUA 1FE8H 1IT9H 3BEWB 5EN2A 1WZAA 1OGTA 2E7DA 2VN3A 1FRGH 2Y1VA 5C07A 2NY7L 2ITDA 5IJCC 4LQFH 1TJHH 2OZNA 2R29A 3GIZL 2PTUA 1QNIA 3IFOA 4N6QA 3CFEA 4NHUA 4PJXA 1TUPA 1WVZA 3RNQA 1ZV9A 3FTXA 3BXNB 4PGEB 2I9TB 1A7BA 3V0WH 5KVGH 4HKXA 1CE1H 1VFBA 3BT0A 1HHIB 1KXQA 3MA9H 5DRWA 3T3ME 4DN3L 4P9HH 4LSUH 4ABUA 4F2EA 1A2YA 4IK7A 2FSDA 4G11A 4O58L 1YEDA 4Y2DC 4X7FC 1KEGH 1N7MH 3ZKSD 2Y3AA 2CMRL 4ELKA 4K3JH 3OHMB 1G7JB 1INDL 4BFKA 4Q14A 1ONQA 1J1OL 3DO4A 3EJRA 3MJ7B 1JGDA 5AOLA 1MCLA 2E46A 1JHKH 4HJJH 5IROA 1X5YA 3IGAB 1KJVA 4ONHA 4JGMA 4OGXH 4XB7A 4WNQA 3RWEA 1XTLA 2AERT 3V4PA 3IMSA 1R3LB 2JNZA 2UWEE 4PP2B 2FZ3A 3B56A 1KLGA 3AC0A 3ZRFC 4HS3A 3WKML 5ACMA 3GZQA 5J6GA 2N1KA 3AQYA 1DEEA 4PJ7F 2Y2YA 3KWXA 5E8NA 5KTEL 3QNXA 3ROLB 4FFWD 4NZTH 4CVXA 4G43A 2B3IA 3US9A 4XMUA 1HHKA 3CD4A 1G6RA 3QZWA 1M1XA 3BPNB 1ED3B 1AGCB 2NY4D 3D06A 3WNKA 1BQHA 2W94A 1AQKH 5BW7A 2VL4A 3IFLH 4JO1L 1JWSB 2FX8L 1AE6H 2AQTA 3BH8B 2NX5A 5DEFA 5EUOA 3FQTB 3ZE2F 4EBQL 3UZEA 4OD3H 1A3LH 2UXGA 1TJMA 4QHLA 2ZXGA 3GRWH 2VKXA 2XZCL 4YS4A 5E08H 4O02A 3TA3D 2B39A 2Y7NA 5EU6B 1N9PA 5I0VA 4TVSa 5FYJL 1HZHH 4P2RB 5FF6B 4QOKA 2GTQA 3O8XD 2J4WL 4P04A 4DP6X 2JFCA 4XC1H 3SBWC 1KPVA 5JHDA 3F8UB 1MG2C 3QH3A 2VR4A 5FOJA 2VDOB 4JUTA 3KPRB 2VDLB 4J3VA 5T3XL 4IS6A 4EI6B 2UVFA 3N85L 4PGDA 5LUMA 3T8XB 3ETBF 1I1CA 1J8SA 3IKKA 4JPVH 5FUOH 4PCTA 4OVVA 3SDDA 5CEXA 1O7VA 1QABA 2X4PA 1RZ7L 5ICXA 2ADJA 2WBJB 5SWSD 2BRRL 5CCKL 1Z5LA 4GXUM 3D07A 4IOIA 5AZEH 4NQVB 1JZFA 3IAPA 4XX1G 5HVFB 3VI4F 1DDHA 3QIWC 4LAQL 3WXVH 5HPOA 5LDUA 2OP4H 3QCVL 1FZOA 5DJZA 3RUGB 4FYTA 4JCMA 3IAGC 2X70A 1N18A 3M86A 1J7VR 2JIXD 1UHVA 3K3QA 4LVOC 5F89A 3V2AR 3PWNA 5I16B 3THMH 4C4UA 1I8IB 3V5DB 3LV3B 1MG3C 4ADGA 3D7PA 1D7BA 5K9JH 3L5XL 1TTRA 2VW7A 3ZQWA 3ULUL 1UD5A 1OD9A 2WANA 1XVSA 3F58H 3L4WA 3JV4B 4KOBA 1ITCA 1XHHA 4MDJA 3FTWA 1DO6A 3IDXL 4H2AA 4IBTA 5G4MA 4PJCB 2V9TA 3FO1B 4HUNB 2IDTA 4UMSA 3PUCA 3VD4A 2YZ8A 4H2CA 3SE3A 3QARA 3HG3A 1RUAH 4IRSD 3WELA 4S1SL 5HYQA 5J56B 1NCAH 2ALAA 1OAXL 4X9GA 4KUZL 4R90H 1F4WL 3ARFB 3GMOA 4GG6F 4A67A 2X7LB 2Y7SA 4WI8A 2VH5H 3T3PB 1A1MA 1HIMH 2F58H 2EIEA 3TPUA 2CE6A 5F44A 1ZA3B 3QIUD 2BS8A 1PDKB 5T1LD 1OT1A 4U1IB 1CXIA 3T8VA 3HPJB 3L17A 4M5ZL 5DD0H 3BRDA 5FFGA 2DL9A 1J0YA 4JGUA 4PJIB 3DV4A 4WU5B 3SGJA 3VFVB 2BSTB 5EFIA 4FFYA 4DGVL 1NA8A 4UT6H 3IRCA 2YQ3A 1A1NA 4ZMNA 2I60H 3V52L 4FFVD 1SBSL 2R4SH 4AEHL 1EXUA 2GTZA 4FFTA 2EDHA 2DMHA 4V2CB 4XXCC 1MRCH 2VLKA 4OLYH 2OXHA 3KZ8A 1O9ZA 4XNUL 1FL3A 1TVBB 1N59B 3DDFA 4PWJA 4ZMVA 2NDFA 4MD5B 4XPAL 4OV5A 3WHE0 3KXFE 3FPXA 1U8NB 3IDNB 4UI2A 1R6VA 1T5XB 1YUKB 2E4FA 1IEAB 4YHNA 1IGMH 3LQAL 1J1PL 5EEUA 1OTTD 5JXEA 1CG9B 3G6DL 5K9KA 3SE4C 3K81A 1PG7H 3UJJH 1GJIA 2PUQT 2R1XA 4MQXD 1JMZA 5PAZA 3ZZSA 1YMHB 4MJ2A 1IARB 2QADC 4CNIA 3VSQA 5F6HJ 3VFSB 1GGCH 1Q1PA 4M1GL 4QMEA 1DBAH 4YFLF 5EUOF 5JPNC 4PJAF 5EF3A 1OM3H 3NDZE 3VJ6A 4FABH 1BFVL 3RDTD 3S4SG 3SDYL 1JZ3A 1DE4A 3JZ7A 4ANKA 3TJPA 5CD3A 1FYHB 3ZE1B 2BFVL 1KYOK 5KVDH 5FYKE 1A22B 3LEXA 3RWIB 4N8VG 1EDHA 3ZT5A 4NJ9H 4IU3A 2IDCA 4HUUA 2H0PA 3DTXA 2EQDA 5IQMA 4ENED 2B1HL 3SCMA 1TJXA 5FCUH 1ZWIA 1OM9A 3P3RA 3APNA 5E9DA 3VM5A 1CICA 1A6ZB 3L3JB 4S2SB 4BFIA 4MD0A 3V0FA 2A6KB 1JPEA 3D4GA 4JLRA 1MCWW 1ZSHA 2CR0A 4ISVB 3RY6C 1KPRB 4EIZC 3FXIC 1KB5A 1NDMB 3LRGA 1J5HA 4JB9H 4UT7H 1NJ9A 2XWJA 2ZUXA 5DO8A 2X0VA 1WS7A 3VWKD 3B6SA 3QYCA 2WD0A 4AQAB 2XV2A 4F7KA 1JNNL 2XV3A 4ADJA 4NZJA 1IM9A 1WTGT 2NRDA 2BMKA 3H42L 4LPVA 1YN7B 2GVYA 3U9PL 3BD5A 1DVQA 5DQJB 2VXTL 1M7UA 2X38A 5F7WC 1JGLL 4JUSA 3B7YA 1JRHL 5FGCB 5DVPA 2D03L 3TBYB 4C83A 3L08A 2B0SL 4QWWD 1DQLH 2JB5H 1JFQL 3BYYA 3HLKA 4U1LA 2IFFH 3ETBJ 3VU2A 1XIWC 1D5BA 3PV7A 4Q4EA 2X6CA 3L16A 5C0IA 5E9AA 4MS6A 1FNFA 3SQBB 3QC5X 3TCLA 3IBEA 3C5ZC 3LNEA 1LO2L 4XNMA 43C9B 2YD2A 5I74C 5HVWA 3X1GA 2FEJA 2DDQL 3VMPA 1JDCA 2X6BA 4A6YH 3K8LA 2FUQA 2J3SA 3KPSE 3JTSA 2RFXA 2DIEA 1P7QB 5I0DA 2NUPB 3P11L 4JM2C 1B0WA 1JZJA 5KEZA 4ECNA 4HVBA 3NK3A 1OCOB 2NCMA 3D39D 4AI7A 4FYQA 1YDPA 4HJ1A 1M6OB 3V6FB 4I0PC 4OZIB 4LLDB 1A3QA 3JT0A 4CJ0A 3VA2C 2OXGA 4G59C 1J11A 1Q0EA 1R3IL 1SLWA 4G7VH 2F1EA 1JCKA 2P8PB 4XVSL 1IEHA 1MCHA 4RX4A 1EJOH 3HA0A 5E99L 3VH8B 1NQBA 3EOBA 4Q74A 4GO8A 3KYNA 4X5LA 1OPGL 3WOVA 1AHWA 1RUKL 4G1EA 4KKCD 3D25A 4HJIA 4RZCB 3W37A 5D70L 2J25A 2Z1KA 4LLQA 5E1AA 5HY9A 3QEQA 4R7LA 4W9JC 5EBMB 4B50A 4L9LB 4N6RA 4F8QA 1CC3A 3HS0A 1WZLA 3WJMB 3S5LB 2EE0A 3LS5L 4HPOH 1NUNB 4FJZA 5B4MC 3ULVL 5SWQB 4BH7B 2R9HC 1U3HD 3HZYB 3QUYD 1BZQK 2AV7B 3QT2A 2J2ZB 1DR9A 2BOBA 3T71A 4H25B 1UZ8A 2YS4A 2EACA 2WP3O 2IXQA 3KS0H 4BZ1A 2NUTB 2GUOB 4L4VD 2WBWB 3CBJB 3U2SB 5DD1L 5C0GA 3FTGB 4ZPVA 4QHNA 1KTBA 3D51A 3GDCA 4JZJC 3M07A 4LIQL 4QCIB 5I19L 5DMIH 2JTDA 1UZGA 5GS1B 4PUBL 1UWFA 1FH2A 3BVDB 4IRJD 2WNGA 2V17L 1UT2A 2CUIA 1QFHA 1MF2L 2HJFA 3FQWA 4N5UA 3W81A 3UFIA 4L8SB 3KPQB 5C08B 4OVUA 3UPAA 2AKRB 2YO3A 1I9JH 4JDVB 2GC4C 2DV6A 2HKHL 2VUOA 4P5RA 3NCBB 4JJOA 1Q9OA 5K9OA 4KDWA 3HRPA 4FHBD 3MRHA 4NENA 3F00A 1A65A 3O4LA 1ZHBA 4LGSB 1H5BB 1B3JA 4ZS7H 4JGJA 5EORH 4LVNB 4KITB 2OMUB 1OSPH 1A6VL 3WTYA 2P8LB 1SJHA 3DVGA 3EFOB 3V4VL 1ZHLA 2LLLA 4YC2C 3ZKNC 3PHOB 2VB5A 3QK0A 3UZVB 1DZ0A 2XI9A 4EVNA 1JHLL 5CP7B 2IANE 2PCXA 4HU8A 3Q5TA 5SX5K 3M45A 4X7TA 1BVLA 4CKVX 5AD0A 5ANMA 4AJWA 2ICWB 2XFXB 1XGTA 4GKNA 2NNAA 4GAAA 4Y7OC 4J28A 3SGKA 4MDIB 3GMRB 2BK8A 2GSGA 1T1YA 2DQIL 3V0VB 4XVOA 1N0XL 2UV3A 3HC3H 4XNYL 5D1QC 5E0QA 4G9FA 4RQQB 3D9AH 4CU8A 4LSRL 4I3SH 1GMEA 4AG4H 4XPGL 4N90E 4HS8L 4L1HA 5E6SB 4PV8A 3ZTJH 2CWRA 5I5IA 3VRIA 2AQ3A 1TLMA 4X6EB 1VADA 1IZKA 3L3IB 4BGDA 5EZOL 4TQEH 2H32A 3PP4L 2EXTA 4YHZL 2CPCA 2BNRB 4JMNA 2NT1A 4Y1TA 1ZS8A 3QUMB 5KG9B 5DC2A 1N6QH 5F7EL 3BKCL 4QRPD 2EUVA 5B38A 1CBJA 3PAZA 1QLFB 5C0AA 3C8HA 3GSXA 3ZX1A 4N2FA 43CAB 2E7LA 3JVFC 5GJTH 3GLEA 2HMID 1J8HB 1PKQA 3SBQA 3JTTA 4QXGL 4YH6A 4XTRC 1WD9A 3NZHH 1JNJA 2LFEA 5HTSA 3KVQA 4HZAA 5GZOD 1G7PB 2OAAA 4FQHB 2GIYA 3BDYH 2KZKA 2Y7OA 3CTTA 5D6DC 3ARZA 4HIIB 4UIKL 1UD8A 5I6PA 4F80A 4XODA 4Y5YA 5FYJE 3N1PC 1ICTA 4ODTL 2MQGA 2OM5A 3ZDWA 3RIKA 4G7QB 3QVAA 1ZPLA 1I53A 3ESPA 3OR6B 2Z0BA 3K6FA 3CXHK 5B21A 1ZK5A 3MRBA 3FW6A 4LHUA 4LSDA 2DQCL 3BOVA 2HXAA 5E1IA 5FKAB 3U6RA 1I3RA 4R84A 1OF2B 1EH9A 5IQ7L 5GS0C 1QQDB 2BY0A 3VG0L 2EYSB 3O6FD 2ZAHA 4HGMA 5T1KA 4ZAKB 4BEIA 3TFBA 1HT6A 2OI9B 3SDCC 4U6XB 3QIBC 2BWIA 5MEND 4IHBA 5IOKA 4GBXB 5JTWA 3W57A 1AYRA 5FM8A 2ORBL 1BZ9A 4JRXE 4YHMH 3OMZA 1L6ZA 3QR2A 3IE4A 4OFYA 3SDXB 4YX2L 2PCFA 1NOAA 1QPKA 4DP0X 5T33L 3CH1B 3TVMA 3W9EA 2X4SB 5AOMA 4P3CL 1I1YA 2BSEA 2NR6C 1NAMB 2V2TA 2CK0H 4MAYC 1Q4NX 4WVRA 3SZKC 2OMNA 3QUXA 1NEPA 1JPGA 2UY6A 2BRQA 5JIQA 1LEGA 3ZYIA 1MH5B 3MMEB 3T4AB 3HN5A 3X3FL 1M7IB 2YOCA 1YPZE 2V5MA 1WBZB 1P9MC 4XR8C 2EEFA 4XMTA 3DVFA 3CDGA 4NWUH 5EO1A 1U41A 2A4EA 1NC4B 2OCJA 5C6TL 2O6CA 4XH2B 1QRNE 3GUTA 3VXOB 2IGLA 3LZFH 4JFUA 2CGRH 2FDBP 1LD9A 4AMKL 5SWZE 1SOQA 4WKZA 1R3HB 3EBGA 3P69A 1R3KB 3ECWA 3QQ9C 1KGIA 3QWNA 3FTSA 3WMQA 2IAAC 3LYRA 1XGUA 5JO5A 25C8H 4F24A 1HH9A 1UGNA 3VGDA 4JNXA 3MRCB 1KCBA 2PN5A 5EU4A 4QO1A 4H4NA 4HF5L 3RNKA 3VFUB 5C0BA 3NCXA 1YMMB 4Z7OB 5FB8B 1I1RA 3CU1A 5JZ7D 2UXFA 1C16B 1E5BA 4ODBD 4ZUSB 2DS4A 1P5UB 1TQVA 1XT5A 3TIDB 3L4YA 4LEOB 3BPCA 4LCWE 5IIEA 1IAMA 2X3AA 1LE5B 1E43A 3TJEH 1ES0B 2CA4A 3RWGB 2L7QA 4FL4B 1BWMA 1PX3A 3GPEA 4HWNA 3U0PA 1F42A 3FQNA 3QEGL 1PMYA 2FWSA 1XX9C 4WI4A 1CQYA 4ONOA 5D7IE 5AYUH 1RFDL 1BEYH 3HI1A 5EULV 3CBKB 1G5GA 1T1WB 5E94A 1G84A 1NSNH 1R19A 2FJHB 4X0KB 1NGPL 2Q1EA 3NH7L 4JANB 2Q7YB 3DHPA 2AITA 4YLBA 5F3HB 3U1PA 3ZHDA 1GYAA 4GRMA 1W9XA 2DRUA 4TULH 5HI3C 1WBXA 1GYUA 1LGVA 2XIDA 3B9KD 1A8ZA 2YJQA 4YPGB 3RB7A 3OD3A 2CUAA 2IO5A 3RBGA 4QHUA 2DN7A 1UOVA 2NY1C 3FU0A 2XRAH 4I4WA 4U0RC 5GGVY 5D1XE 3NFSL 5EMYA 5DA4A 4Z95L 3DV6B 1IFHH 2J8UB 1X9UA 2HX8A 3O81A 3V0JA 1OGSA 2IADA 3BZFB 4KU1A 3L3KA 4IGBC 1DVFA 3RI5F 1P4UA 2YFNA 2X4TB 1BFTA 1WFOA 2G75A 1Q38A 2HTKC 4JFPB 1GS8A 4P3DA 3B7UX 4B6ZA 1MHEB 4GT0A 1KMGA 2X4UB 3LDBC 4OGAD 4Z7UB 2AI0H 3NSFA 4C56B 3BEVB 1YEHL 2L4OA 5B7MA 4Y1AE 2JLPA 3LXUX 2FJFA 4CC4C 1ETA1 4IJTA 2X89D 3RVWC 2VOTA 1E9PA 2FIKA 2IH1B 3ARGC 1HINH 4O2FA 3VXME 2X4QA 4HK3J 1NPNA 1YCSA 3UAJC 2MHAA 1U6AH 4NUMA 3BIBX 1ACZA 1L7IL 5L4IA 3KBFA 4HXAL 2ZP8A 4GI9A 1MREH 2BIIA 4FS0A 4U1NA 4AYFB 4PJDA 4TQIA 3T3MF 2R8SL 5C0CD 2CALA 3X11B 2NYKA 3D0LA 1IIKA 4XPHH 2VDQB 3MJ9L 1K2DA 4AXWA 3QJVB 2CKBH 5HDQL 5FLVA 2C4XA 1PJ9A 1L5GA 2JKXA 4PBVC 4X6BA 2H6PB 5LQBH 4MNGA 2X4NB 2NXYB 4UILL 4DK6A 4UWQB 4BFOA 2Y3NA 2BINA 1FA4A 5DMGD 1GJUA 3BP5A 1E9QA 4PLJC 2UWEF 3SE9L 3RAJL 3U25A 3TGXA 4WWKA 5DJAA 4Y2NA 1O9VA 4L0PB 4D9RD 4N2DA 3RFZA 3WUZA 1QATA 3UMTA 1JZ6A 1FLTX 3LZPA 1ZMYA 5AKVA 2ZOLA 1S7VA 1QBML 1BQUA 1UCTA 4FERA 4HC1L 4EUPH 4I48A 1JGVL 3PGDA 5LBSH 4ACTA 4Z7VA 1MCEA 1PG7X 3ZTNL 3EFFA 3A4AA 1BQRA 1DQJB 2W9DH 3AABA 4GKZB 1UD6A 1TCRA 4ORGB 2JIXA 5DMJB 1XL4A 1NLDL 4HJEA 3KWVA 4Q9RH 3O41B 4KO5A 1TMQA 1IC7L 3QR1A 4M6NH 3B5GA 1IEBA 4JPWH 3NMEA 3PQYB 1A4CA 3T65A 1S46A 1N5YL 2WN3A 5EZIH 3NN8B 1WFMA 4Y9FA 4ELMB 5A2JH 2D0HA 4BK5C 2HFEA 5B22A 4W6WB 2I26N 1QI4A 5IOPB 1W72H 3A21A 4JHZA 1A9EB 4PRPA 5IB4B 3F01A 1E3FA 2OW7A 5K39B 2CJUH 5DEGA 3ZE0B 4KKZA 3TONA 3U30B 1UQSB 4OCSH 5ICYA 2FEEL 2QHRL 4L4TB 4DP2X 1HQRA 4NNXA 4RGNC 4O9HH 2BOCA 1WLHA 5E1GA 4YQXL 1U92B 5G2NA 2R2HB 3QIUA 1HSAB 5G55A 1FUNA 2KZ1B 3KYOB 3BDXA 3QZOA 4HIPA 3MNMA 4OCLC 2OZ4H 4MA7H 3BAEL 3WFHB 5BXFA 1L0XA 1QP1A 4QXWA 3OHXB 2FR4B 3IE9A 2APXA 1SJVA 4ZI8A 5FA3A 4BSVA 1RK0A 4R96A 3FH8A 3S3PA 1H6UA 4S11A 1C1EL 2ZNWA 3IPBA 3AJ7A 2Q8AH 3WXWH 4ZXBA 1JZGA 1H8LA 2VW4A 4KTDH 4X80L 4O2EB 5CIPH 3Q3GA 4F5CA 2FECI 4FNPA 3ZL4H 3K72B 1MLBB 4OD1H 4N2AA 2VN7A 3P4MB 4NI6A 4B5EA 1YEFH 3EFDL 4WUUB 1HESA 4GSXA 3VVWA 3PV6B 4R2GC 2GIMA 1Z0NA 3NIGB 1AKJB 4WGKA 5B7EA 4WK0B 3U6XA 2YUWA 4XPBH 1ASPA 1RZGA 3FCUB 3CFTA 1MXGA 2IALA 1I8LA 4KJQD 4ZZKA 1Y07A 5JLZB 4KKPA 1L6PA 3NA9H 4AQ1B 1Z9PA 4P2QB 1G1YA 4H0IA 3TO4B 4K07A 4L5FE 4U6HB 5SX4H 2W8CA 2Q20A 3MO1A 3NEOA 2P28B 3AXLA 3ULSA 2UZXA 1WUNT 3JWOH 4F7EA 4XXDB 4F8PA 5F96L 5F1NA 2A2QT 1HHHA 4LKXB 4W6YB 1RIVL 3OX8A 3T09A 2VKWA 3LHPL 3MRIA 2MFNA 3CZSA 1CGSL 5HHME 1CVRA 2KQNA 2PXYD 2DWYA 1LEKB 5F0PB 3SDAD 2JXMB 3DGCR 4EZMA 2NY7H 1OCCB 2GJ6D 3TM6A 3VWKA 3DJTA 3GIZH 1NGZB 2CGZA 4KXBA 3DA0A 3FUIA 4FEIA 3F7PC 4JHUA 3BPOB 3S36X 3RHWK 2E76C 4YEEA 2N3JA 1J05A 4Z7VF 3LN4B 1AHKA 2D73A 4FXTA 3MRMB 1ADQA 1JTOA 5FW7A 3BUTA 4MVBC 3CQFA 4J3XA 1I8MA 2C1PB 3GXIA 2HLFD 1YYLL 2Z35A 5CN2A 3C8DA 1BLIA 3PL6C 2NSMA 1QLRA 2BZDA 2CMRH 2AJUH 3KW7A 1IGIL 3V6ZB 4JJ5A 1INDH 3VWJC 1KN4H 4L37A 4PCYA 1J1OH 3FTVA 4LHJB 2Z4QA 4K3GA 2R1YB 3LPWA 5CBAB 2VISA 4FP8L 3OF6A 1EO8L 3JYCA 1JK8B 4QRAA 3WTTA 3NIDF 4IOSA 2NXZC 4OSUL 4W9CC 4Y5XB 1MY5A 4N9OB 4G9DA 4AEIL 4AQEB 4GSQA 1I1AD 3MV8E 4I1NB 4OZHE 3F6JA 3S35L 3HKFA 2NY2C 4U1KB 4WQOA 4YWGH 2BVQA 4WF7A 4HIJB 3V0DA 4KHXL 3Q5OA 2WIIA 5C09E 3CJJA 4FQXB 5I6OA 2XJLA 5D1ZI 1TPXB 5F7KC 1KCSL 5D1QE 3ESOA 3OKKB 3UYPB 1AI1L 4QTIL 4XVTL 1HXYA 4F2FA 1PD1A 2V4LA 1FNEB 5C0FB 3C08L 2KI6A 2IV8A 4EI0A 2XYCA 4JMXA 2AXWA 3Q6FA 2VMEA 3NJVA 5IW3A 1X6NA 4JFHE 1BX2B 4YSSA 3VU1A 3DVIA 2Q2LA 1E5CA 4MMXA 4JR9L 3S3CB 1IQDA 1WSST 2Y06L 3B8SA 3GJEA 2XZCH 3QUZC 4POYA 1HJCA 4LOVA 2BVYA 2A74C 3BIKA 1S9WA 4R4NC 4Y4KD 1A6TB 1R5WA 1QSVA 5FYJH 4V1DE 3IJ8A 4K7PX 3UEZA 1QRKA 1KIRA 2A83A 2E3VA 4NQXB 4TMPA 1FGVL 1A4JB 4AJYV 3FT1A 2EIZB 2R7EA 3DX9B 4PRIE 4WSKA 3HR5B 4ZO9A 4FNTA 4ZNEE 1TFHA 1GR7A 4XX5A 1U3HA 3QUYA 2XWXA 2W81C 1MCOH 5T3XH 2LAGB 4XCFH 3OZ9H 4FF9A 1F6LL 4OLWH 1OP9A 3QORC 4PRAA 2WV3A 4ANWA 3N04A 2F54E 2WNWA 1RZ7H 5AVTB 4XN8A 2A9DA 4NEHB 2YPLE 4L1SA 5KN5A 3L3DA 1JF5A 4P23D 3ZO9A 1DQML 3WTUA 4IRJA 5F7YC 4WI3A 2WXNA 2KKQA 5INCB 4UBDD 4D3CL 3H9SD 4HIEA 4LAQH 4HPYL 3MYZA 2VLRB 2ICES 2KQMA 3SKOA 2YAOA 1RURL 3L9RB 4QTFA 1MI5D 2BVTA 3MXWL 3LKSB 1S9YB 4ZD3L 5I17B 5I5MA 3WS6A 4G8GB 2DW5A 1JZ2A 3O11B 5IVZA 5ICZB 1VCAA 1HEJC 3GKWL 2X41A 1NH6A 4PJHE 2Q87A 4F7CB 3DX8A 4K71C 4XGZB 3TN0B 1S7RB 2JKIS 1Z3GL 2MCPH 2D31B 4NDMB 5EBWA 1R3JA 1WS8A 2ERJC 3OLEA 2B1AH 3IDXH 4P8QA 5J12C 1A02N 4OGZA 4UOW1 1F4XH 3CX5J 1OCWL 5IB3B 2C7UA 4N1EA 4S1SH 4ZODA 4FQJL 4MA1C 1C8PA 1OAXH 4U05A 5I1KL 3BT2L 4LCIL 4DFHA 1CTMA 1X44A 2EO7A 3SE8L 2W0KA 3CC5B 1C9SA 5AYTA 5DHDA 3TBVA 3DOIA 5KVEE 3CZJA 3L95B 4BQBA 4J1UB 4ZT1A 5SX4I 5JMRA 5JQIB 2R0LH 1MAKA 2XOTA 5AAMC 4U2ZA 4FMVA 3DETC 1YECL 3WKNA 1XGPA 2H6OA 4GSUA 1W91A 3VXRD 4C47A 2ZWNA 4G5ZL 2Z64C 3UAEA 4XMXA 3BP6B 3NFNB 4PGBB 4YE4L 2JK5B 1JZ7A 3U1SH 4P5KB 1SBSH 1I3VA 3H55A 3A47A 3NK4A 1ZV5A 3SPJA 2RALA 3L5WB 4X4XA 1FPTL 4MX7B 5DK2A 1T1XA 5EOTB 4NCDA 4LEXL 1J1PH 5E95B 3G6DH 4YSEA 3HCVB 2ED8A 4WNSA 2R2BA 1I31A 3DXAE 5TE7L 1BM7A 3PWPA 1P2CB 2AHIA 1AXSB 4XP6H 1MW1A 3HOGA 3P4OA 3B8YA 2FCBA 3G5VB 3SJVE 3VXNA 1BFVH 3SDYH 2ESVD 5CSZA 3DX7B 5IUCA 3SE6A 5E7BA 4KQ3H 4CC1A 2BFVH 3QULB 3ZT7A 4PTTB 4DERA 4QYAA 2XDHA 2K3HA 2VDNB 2Z0UA 4LL4A 2VC2L 2DLFH 4Z7WE 1CFNB 1FP5A 2E0PA 3EO0A 4HEMA 4N9GB 2IQAA 2CNYA 2UZIL 3F65A 3MRKA 3P54A 2Y5TB 5I6NA 4E0RB 3GXPA 4FZ8L 5BUGA 4FFZL 5MENA 2VXVL 2QQNL 3UTTB 4B3VA 3D48R 4MJJA 3H7BA 1YNLH 1AGFA 4EI5D 2WLNA 2DLEA 3Q13A 5T1MB 5DQDL 1E4JA 1ZEAL 2D7OA 3OPZL 1B2YA 4OZFG 4PJ7B 1HS6A 3HZKB 3BPNC 5IMOA 4FQIL 1RZ8A 4MD4A 3WCYA 3MLWL 4MXVF 2YN5A 3ME0A 3DX0A 2D2CC 2ODIA 1OGAD 3BGFB 2WIMA 1IGYB 2E8ZA 5EHFA 4LASL 1IILE 1BIIA 1OKEA 1N8ZB 5ESQB 3H42H 5GRWA 2FUTA 3U9PH 5HGDB 2A6DB 1K8IB 2BSSB 4KUCD 1A1OB 1SXBA 4HUVA 1SFHA 1OAKL 1VESA 2VXTH 2XICA 1S5IL 4P4KD 3RLSA 5EC1A 1JGLH 3ZE2B 1JRHH 4AKOA 1LO5B 3LKRB 1ND0B 2HJLA 3EDEA 4DKFL 3G6JA 4OKVB 4AC2A 4TM9A 4DEPB 4YR6B 5ILTH 2CXGA 1H3GA 3VI3A 1MFDL 5CR8A 1M71B 3MLRL 3CC1A 3FRUB 4JVUA 4Z0BL 3UJIH 4BA8A 1BM3L 5J1AB 1QG3A 3ARDB 4WTQA 1LO2H 5EU3B 3DX6A 3WDIA 3CVIH 1QNZH 1MJUL 4OCRL 3SKJH 5FC9A 4DO5A 5D71H 1U8QA 2WBJC 1TZGH 2MWCA 1KLUA 2PPEA 2DD8L 4O2CB 3OSVA 1NMAL 1NKRA 3TASA 2ADIA 3EO1A 4FNRA 4JE4B 4BFBD 4IU2B 1TZIB 3IK2A 4MXQD 3CV5A 4PP1C 4OLUL 3DO7B 3V8OA 4HXBL 2YD3A 4S1RH 4ZMTA 2FO1A 2EP6A 1R3IH 5F7LB 1NBZB 1DSFH 4JRYD 2JWYA 5GGVH 5AZ2H 4WFGD 4W4OA 4XVSH 1QI3A 3P9LA 4F3FA 4L18A 4IDJH 3VW3H 1QPXA 1V27A 1BFSA 1UM6L 5DCCA 2GYSA 4HKJA 1BD2A 1OPGH 3UROR 5AWNL 5KW9L 1RHFA 1RUKH 2R0WH 1E4KC 4CGUB 3DOHA 3FYIB 1NCCL 1L3NA 1UD2A 3U46B 4AT6B 3QI9B 2B16A 4RAUB 4U2YA 5B3JE 5EN2B 5GIRA 1OGTB 3B9KA 1RZKL 3CLEL 3KBEA 4H5SA 1VENA 3GDBA 2XBZA 1RZFL 5C07B 3AG2B 5F0MB 2ITDB 1AQ8A 2VDPL 3IFOB 1ITBB 2R51A 4TUKL 5DF0A 3INOA 3T6WA 1SY6L 3CFEB 1H9VA 4KX8A 1LK2B 2IH3A 3II1A 4NHUB 4PJXB 2WMPA 3ULVH 3ARFC 3RNQB 4M8UA 1QTPA 4L0YA 5A7BA 1IC5L 4HKXB 1VFBB 2X6AA 2BSRA 3H9HA 5DRWB 1P1ZA 3TESA 2G3NA 3MUZ1 3AT9A 2VDLL 1FIGL 4RGNE 4UIMA 1A2YB 5DD1H 3FSOA 1YEDB 2C1OA 4LIQH 2EVGA 1Z5YD 4R5XA 1A6WH 4YN3A 3ZHNA 1ZDQA 2J73A 5DGQA 2OK0H 2V17H 1ONQB 5ACLA 1KULA 4I9WE 1MF2H 5HYJD 1JGDB 5F3FA 1YNTF 3APMA 3D30A 3G3LA 4ONHB 1KJVB 5LBGA 4K3DL 2XVKA 4WNQB 3RWEB 3SPVA 3V4PB 5D7IF 1PQZA 3EO9L 3QAQA 5C0CA 2FZ3B 3SYOA 1KLGB 4HS3B 3HG1A 3L3GB 3O2DA 5J6GB 3L5JA 3UMNA 1D2PA 4P5TD 4PJ8D 3UG5A 1Z9SB 1QVOA 5E8NB 4I85A 3QNXB 5CNHA 4APQA 4ICXA 4CVXB 3TURA 4G43B 1MWAH 2IWFA 3QDAA 1HHKB 1ML0A 4UQ9A 3I9AA 4BE6A 2VZOA 1XH3A 1G6RB 1U58A 1M1XB 3CMOL 32C2A 3QZWB 5KSBA 2HX7A 3AY2A 1BQHB 4GKOA 2VERN 4XPTL 4MBRA 4E5XA 5DEFB 2NX5B 5EUOB 2J1XA 1XTMA 2VZSA 2KYIA 2DQIH 3HI6L 4ODWA 1N0XH 4WHTA 2LGNA 3PGFL 2P49B 1CDBA 1KBVA 4EIUA 1KT2A 3MV9A 4QHLB 4XPGH 3K1DA 2B59A 4YSQA 4HS8H 5HHXH 4O02B 3VI3F 1RUML 4F58H 1HJBC 3VD3A 2BNUA 3D85D 5EWIL 1DO5A 4QOKB 5EZOH 1WF5A 3ATBA 5IF0A 1MFMA 3CE1A 3DMMD 2YPVL 1KPVB 3GXTA 3PP4H 4YHZH 3VX0A 4NP4H 4YDKL 3QH3B 5JHDB 3AY4A 4FQCL 4IS6B 4GAJL 2XQBH 2J8HA 5DHMC 2DBJA 1J87A 2K78A 3GB7A 4PGDB 5LN4A 3RTQD 3DDGA 1E4WL 1NPUA 3AG4B 5BQ7A 5CEXB 4UB0L 3DTDA 2X4PB 2GHWB 4IBQA 5ICXB 2DZEA 2ZXAA 3JYBA 2AQRA 3L7FA 1FAIL 3FU8A 4MSWA 1Z5LB 2ADGA 5E6IA 1NBVH 4QXGH 3BJ91 4YGAB 3WKQA 2VDRH 4IOIB 5KJ7E 1CTNA 2NY3B 3VD7A 1NCOA 4XMPH 3KDMA 5JW3H 1DDHB 4XVJH 1IFGA 3C2AL 3LZQA 4RFOL 5DJCA 2F1BA 1OY3B 3F7KA 3KD4A 1FZOB 4UIKH 1AZNA 5DJZB 3GHPA 2AJYL 1EBAA 2X70B 2HT3D 1JRHI 3RIFK 2X1PA 3FT3A 5F89B 5GRZA 2VXQA 2RQEA 4L48A 2H3KA 3IM1A 2DQCH 2ID5A 5JQHC 1OWWA 1LK3L 3GTVA 4MDJB 3MODH 3ILPA 1U2YA 1SRDA 3WFZA 3HMXL 1Z9MA 1LO3L 1E2VA 4C57C 1TQTA 2EVHA 5TE4L 1H0DA 5HYQB 5CD5C 5J5EA 1PW3A 1KSRA 2HKFL 3FU5A 3HVNA 2ATPA 3KPPA 1KJ2A 3Q8FA 5JPMA 2XTJD 5DJDA 1OK0A 3K7UA 3GMOB 2E5EA 3GMPA 4YX2H 4YL9A 3PCYA 1GZPA 1A1MB 1KYUA 2AZUA 5G5DA 2H8PA 1IUZA 3TPUB 2H0FA 3O2VH 2JCCE 2H2PD 1NOLA 2VLJE 4P99A 4NFBA 3ML8A 5A2LH 3KBPA 3KM2A 3EYQD 3X3FH 3LZOA 3DV4B 4OZFH 4OLZH 2WUCL 4NC1C 5HYSG 1EEZA 4L9LC 3EZ8A 3RKDC 1EIBA 3DSNA 4ADIA 2ED6A 3FULA 3NJMA 5C6TH 3QJOA 3BUDA 2B14A 3KXFD 4M9OA 2RBLA 4N20A 1A1NB 2YGVA 3RU8H 3VAEA 5A2IH 2BC4A 1EXUB 2EDOA 2GTZB 4QGYA 2AJVL 2VLKB 3D6GA 2OXHB 1J5CA 1FL3B 3RKPA 4CN6A 4OV5B 4XB3A 1C08A 4UTBH 2FLRT 3BGMA 4YHNB 1H3TA 1Y7VA 1H3VA 4X6FA 4GS7B 5L2JA 1FYTE 1QUNA 4G8IA 5K9KB 2YD7A 1T4KA 3GXNA 2R1XB 1NKGA 2A9NL 4TSAL 2J5LB 4Y88A 3FTZA 3B3BA 2PXYA 4CNIB 3VGHA 3DPBA 4W9FC 5T5FL 3SDAA 5CGBA 5GS1C 3VJ6B 5D55A 2WQWA 5B7FA 2HG0A 4NOFA 1EO5A 5GS0H 1YN6A 3SKMA 1DE4B 1A6AA 4Z7NE 5DMYA 4N4YB 4L8SC 5CD3B 5E8DL 3IJSA 4JK0D 5FDWA 3LEXB 4AYGA 2EYTA 4BK4A 4IU3B 4HUUB 1NFAA 4JM2F 4KTYA 3TH3T 1MW3A 3ISWA 2O5NA 5D1ZD 3SCMB 1H5BC 4FMKA 1ZWIB 2JI3A 3CCHA 2Z1PA 5AYQA 2YD9A 1NGPH 4LVNC 3NH7H 4NNYA 4M3HA 5E9DB 2JKNA 2YKKA 3L1FA 4CW1A 2ZUVA 4F1ZA 5EEYA 3SD5A 3PJNA 4MD0B 5I1EH 2BXZA 4KJWD 2ENJA 2NT0A 2R69A 4JLRB 4JO3L 3OKLA 1HAWA 1KB5B 1U4EA 1FH5L 4LSSL 2GK0A 4YSTA 4HUXA 1NJ9B 1VHPA 2XWJB 3AUWB 4MS8D 5I0XA 1QZNA 3L9YA 4JO8A 5E5MA 5IBTL 3CXDL 3HLAA 3B6SB 3VRLF 5BZDA 2J1YA 3AAZA 4FYRA 2R0ZH 1IM9B 2BMKB 3HAEH 4Q58C 1EFXA 2N56A 3NFSH 3QDGB