3KBHE

Crystal structure of nl63 respiratory coronavirus receptor-binding domain complexed with its human receptor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
121
structure length
110
Chain Sequence
b'HTDINFTATASFGGSCYVCKPHQVNISLNGNTSVCVRTSHFSIRYIYNRVKSGSPGDSSWHIYLKSGTCPFSFICFSTVEVPGSCNFPLEATWHYTSYTIVGALYVTWSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiotensin-converting enzyme 2
publication title Crystal structure of NL63 respiratory coronavirus receptor-binding domain complexed with its human receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 110
sequence length 121
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3130 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3kbhE00
3KBHE 4F2ME 4F5CE
chains in the Genus database with same CATH superfamily
1WBZB 4LQFL 3U30B 3VQLA 3RKPA 1ES0B 1MW3A 4PJXE 4PRDB 2Z3FA 4HA1A 5KYYB 4AENB 1HU8A 1ZLEA 2VDML 2V7HB 3NACH 4M1CD 4MNGA 4TQPA 3UCRA 1TZOA 4DGVH 3CVHL 3AM8A 1I1YB 3W2DH 4LPCA 5ANMB 4HJJL 3AMKA 1RIUL 2C8NA 2XACC 3C5ZC 1BM3L 2HRLA 1CFQB 3UFIA 3QZNA 2X87A 1MRCH 4WTQA 3SYAA 1D5ZB 4Q6IC 3K2UH 4G43B 5I1IH 4UQBA 1QRKA 3LZQA 1OD7A 4XC1H 2GJ6B 3RVXC 1W6LA 3UZVB 2H8PA 2VQ4A 4BBWA 2OM5A 3G9AB 4Y19E 3VFWA 2GPZA 2YSSA 2WQRA 4PJXA 3JVFC 5AW4B 3Q48A 1HYSD 1NCWH 2AGJL 4PJ7F 5BVJA 3GBLA 2I25N 3CPLB 2OZNA 3FCSB 4G80B 4PJBB 5E6IC 1KY7A 3CFCH 4I48A 4OCRL 3OLIA 4OFKA 1F3DH 1BIIA 2YD8A 1QHQA 3ARGB 4UQEA 3N50A 3MKGA 4XI5C 3WIHL 4XXDA 5B7EA 5F9JA 1NCAL 1RJLB 3CXDH 4J3OF 3J7HA 5CILH 1SJMA 4CC4A 4A2EA 1IJ9A 5CR1A 1QMUA 5AWNH 5GSVB 5I76B 4FFVD 3Q1EA 4DFHA 1RJZB 4XPTL 3G6DH 1SEBB 1S7WB 3K2IA 2I9LA 4P4KA 2XA3A 3MLYL 1T1XA 3HVDA 1X5JA 4ODXA 5FW7A 4GEJA 2R1XB 4MQTB 4P48A 3VW3H 3MRRA 3M46A 4GSRA 4U1KA 3EO9H 3PQYE 2ADIA 4U0RC 4FG4A 1CXFA 1WA1X 4XMXA 4DT2A 4ETYA 1ONQB 1CJYA 3QIWC 3JWDC 2WBJD 5LG1A 5JW4Q 4M5ZH 1YECL 1HHJB 3WYRA 1T2XA 1YNTA 3QFDA 1PLGL 1M1SA 5F1KC 1J0ZA 4L48A 5A3ID 4C57C 2ZXCA 4DUXA 2VXUL 3DVGA 3V55A 3KLHC 2IH1B 2D3VA 2WNWA 1I8LA 4JO1H 2BP8A 5DGQA 5FO9B 1ZGLM 4AQAA 1PX3A 5DVKA 1CGTA 2AEPH 1RZGA 5PCYA 3HAEG 1CF8H 2A74C 4M03A 3DMMC 3BD5A 1E5UI 1NDTA 3H3PL 3MRLB 4M1DH 3WIFA 2JELH 1AHKA 4RX4A 2ZCLH 1SJVA 1AFVL 5B8CC 5CF3A 3ARFB 4G7YL 3DBXB 3HCVA 4OKVA 2KHAA 1WGVA 1E42A 2VM3A 1E5YA 1WUZA 2VLKB 4NN5C 4WTWA 4IS6B 2GAZB 3QP3A 1EK3A 2NOYA 5IT2L 3MN8A 1CQYA 2ZF9A 1XF4B 4LKCB 1R17A 5DHXB 2B9BA 3O6LL 5HVFB 1BF5A 4KVCH 1OE2A 2OL3H 4HUVA 1I1AB 2D7MA 4QCIB 1RFDH 3J2PA 1WBYB 1OW0A 4UQ3B 5EH1A 3DX2A 1OV8A 2OS7A 4MA3B 1MQKL 1XB3A 4HC1H 6TAAA 4JRYD 1NBZA 5C0DB 4U1NB 3D2UD 3QJHA 5DJDA 4UANA 4ZFGL 4QRUA 3L3KB 5JHDD 2HFFA 1RV6X 4PV9A 4F7EB 3MJWA 4JQVC 5FEBA 4AWJC 3B7UX 4G11A 4EN3D 1P84K 3MO1A 3ARBA 5ANHA 1UD8A 5B39B 1JSYA 3BP5A 3BPCB 1K8DA 3V6OE 3EFOB 4YLQT 1KTKE 2DEYX 3RX5A 1KCKA 1Z7JA 2EDDA 3V5KA 2FZ3B 1CDCA 4PI2A 2XN9A 1NPJA 4D8PA 1UXMA 3OR6B 1BBJA 1FHNA 2WXQA 1RP8A 1MPAL 5C0JB 2ED9A 1ZIBA 3RGVC 1S9XB 4Y2OB 4YSRA 2P24B 4CBZA 4ZDHB 1HSBA 3FOLB 5FGCE 1HILA 3FPYA 3WJMB 4D3CH 3D0AA 1FFQA 4U6XB 4ZFOL 2VN6A 5GPRA 4OZIA 2ZCZA 4PHZA 2A9NH 2VKWA 2X9XA 3O3UN 3VD3A 4CDHA 3P2TA 4FQXB 3ZT6A 4HP5A 4CVUA 4ZQTA 4TTGA 1G7JA 4HUXB 4AQEA 1A3LH 2BHUA 2C9PA 2DQJL 3NJLA 2WLIB 5CCJA 1CE6A 2Z93A 3S7GA 2Z0BA 2DBLL 2DQUH 2WINB 3HS9A 2ENYA 1WAEA 4RRPA 2JKWA 1N6UA 5LLIC 5E8PB 1MJ7L 5KYXB 4AYEC 4L9LA 3W57A 4MXWH 5D8JH 2DM2A 4U1MA 2YD4A 2P49B 3IMTA 1BM7A 2NNAA 2IAMA 4Q2ZA 3L4YA 2TSAA 2X3AA 1W72L 2EEXA 4IRSB 3A21A 4E42A 2AJZB 3U4EA 2ZCHL 3OF6A 4UDUB 5C3TA 3QUML 4Z0XA 5I1JH 3U83A 4PWJA 1C5CL 4JFFD 5D5MB 3WLBB 4UQCA 2QSCH 3VACA 3MV01 3HG1A 1V7ML 4MZRA 3JWNG 5IVNA 5EF3A 4BH8B 1G6RL 2WBJA 5KANI 3QJSB 1ZEAH 2COVD 2YGQA 2YC1A 4UQ2B 2FEDC 3E6FB 3WIHA 4U1JA 1HL4A 3MV8B 4P59H 1AGDA 2DLFL 3VXSB 2XKSA 2Z35A 4F3FA 1F13A 4JRYE 4I5BA 5DHMC 3W11C 3QCVH 2AEIT 2MKWA 2OMUB 3N04A 2YN3A 4M3HA 1IBBA 4OLWL 3ESVF 5JHDE 3KCPA 1FH5L 5CSBA 3L9EA 1JI2A 4CU7A 4K7PX 1JV5B 3FF7A 1U4FA 4NRZA 5I5MA 3TVMA 3U0TB 2WP3T 1BWMA 3RWEB 2WANA 2OSYA 1NFIA 2Y9RT 4Z3IA 2FHFA 1NAMB 4UAOC 2GK0A 4FZ8L 2A83A 2F54D 1BAFH 2AJ3A 2APXA 3WUWG 5HGGS 4HBQA 4JFXB 3P4NA 1W15A 4JFDD 1WWBX 4NYLA 4S10A 1F41A 2J6EH 3QISA 4N8CL 2YWYA 4GKNA 3PXLA 4MD0B 1TTGA 3HG4A 4DKAA 4NQUA 3ZGIA 2ILLA 1F3JA 2HAZA 4K23H 3VAEA 1U91A 1R5WB 2RTTA 2YXMA 3A24A 1RPUA 3IJEA 2ZUUA 3BD3A 5JQIB 2R8SL 2AV1B 3QZPA 5AYTA 3L4TA 3PDGA 4Z7WF 2C1OA 1EZSA 1IC0A 3RQ3A 4EN3A 4OGZA 3DX9A 3TOPA 3MJ6A 2FH6A 2ICES 4LSVL 3RX9A 1CTNA 1WG3A 1J8SA 3MA9L 4LSSH 2R7EB 5LBGA 2BNRA 4NQSB 4K3EL 4NNXA 2PPFA 4MQ7A 5GRUL 2C3XA 3G08A 1GGCH 2FWLB 4N2BA 4S0SD 2DLGA 3SGDI 1QKZH 1NFDB 2D4FA 4HGMA 4KBPA 3S34L 3S5ZA 1JF5A 2WXGA 1PNCA 1WA0X 4BRJA 2VDQL 4ZS6C 5DHVA 4PB0L 3QDJB 1S7UB 2X4SB 1XT5A 3TA3A 3V4VL 1GSKA 1T7XA 5DC4B 1GHFL 1A4AA 5EUOA 1KENH 2K45A 4Z78A 4N0CC 3UJJL 1B3IA 3C8KB 4AZ8B 2HFGH 3GSWB 2Y1AA 4AGQA 2CRZA 1TZHA 4G8EB 4YWGH 3EUUA 3B6SA 3F5WB 4UF7C 3MLSH 1TQSA 1BXAA 4JFFE 2XYCA 4E9RA 1MIML 2ATAA 4J6IA 4ANVA 4XR8C 3VRLE 5C3LD 1YO4A 3VFMB 3FQYA 4FNUA 5DZNA 1DQTA 5TK4A 1OF2A 3MA7A 5LO7A 3RL2B 2YAQA 5I8CB 5JW4M 2IDSA 4U6VH 1VADA 4IDJH 4HOMA 5ILTH 4HU2A 2C9UA 4W4NA 1I1CA 2IOOA 3ISWA 4GQZA 35C8L 1QSEB 3BP4B 3HS0B 1KTJA 2HLFD 4NKIL 5I2IA 1CGXA 4FL4C 2FJFB 2FEEI 2ZPKL 5CHNA 3C2SA 3VI4E 1JPTL 4XCYB 3GRWH 2ERJB 5F3FA 2R59A 4P4RA 5ADOH 1SXZA 2VWEE 3T4YB 1W8EA 5IFAL 4ZD3H 4AY0A 2UXGA 3K46A 3RUGF 3X1BA 4CU6A 3M88A 1W0WB 1CO1A 3ZKMD 1JXKA 4KZCA 3FT4A 4JFFA 4JX0A 4PG2A 5GJSH 2PETA 2VXVL 1TTAA 2Y06L 1OD9A 2LE9A 2DJ4A 3CV5A 1BAWA 3QZLA 4XP6L 4B9KC 5HY9A 2J6WA 1P4IH 2NUPA 4WUKH 3F58L 3EO1B 2F54E 4JPVH 1NCNA 1Z2KA 1SM3H 1ID5I 3MRFA 5AB0A 5I1CL 5D2NB 2E4TA 4KVPA 2XRAL 5DD6A 1RIHH 4HKJB 5DJXB 4M7KH 4Y5YC 4OCSL 2C3HA 1UWEL 3BKML 1W72A 2P47B 1NKRA 3HE7D 2JQAA 4P07A 1YDPB 4QHUA 3KW7A 4XX1E 1V27A 3FCUB 4ZUTB 5IMLB 4NKOB 3W3BA 1U95A 4PW3A 1BQLL 4WI3A 2L7EA 1BPLB 2CA3A 3X12B 1JHTB 1ZPLA 1YAZA 5D6CA 4PUBH 3UGEA 4WY7L 4P5MB 4G1EB 3FFCD 4QF1A 3CHQA 3R1GL 4OCMC 2YQBA 1J5OH 2D3LA 3NRFA 5J1TC 4Q9QL 3UACA 2G5UA 3T3MB 1OF0A 2HFEB 3QPXH 1U6AL 1JPFB 4XAWH 4ERSL 3O2WL 4JN1L 2FIKB 2MPAH 3DPBA 2VSKB 2VUKA 2YSTA 5HHXL 4K2UH 5IB1B 5MENB 1KJ2H 1UJ3A 1XXDC 5HGAB 1S7VA 2DWYA 1TZIB 1C12A 4LSQL 5I28A 2KL6A 3HC0B 1OCWH 2L04A 4BD4A 2VITB 4ZSOE 1UH4A 3TO4A 1TDQA 1XGPA 3HBQA 4G9FA 4HCRH 2H2SC 4HIJA 4XH2A 1KEGH 3DVIA 3CHSA 4AJYV 3EKCA 3NIGE 1QFUH 4LCWB 5DZPA 2ED6A 3NSXA 1NANH 5TGBA 3TXAA 3GM8A 1E4XI 1WZLA 4L4VA 1OAZL 1VENA 4AL8L 3IB4A 5JIDA 4XPBL 4TXVB 2FJSA 4F33A 2ZJSH 3B9KC 4X8JB 5AKRA 2B15A 2O30A 5EHFA 1OT4A 3EUDA 1EO5A 1MAKA 5BVPH 4M6AA 3TU6A 3FT9A 3T1FB 2GUOB 3N85L 4JQXC 4W93A 3B9DA 1A1NB 4XWGL 5GXBB 3QIBC 3VDCA 4IU3B 3RWFB 4E9LA 3GJFH 5GRJH 1CICD 1U3HA 2QGCA 3D52A 4GRWE 4Z77B 3QXAA 3GB7A 3ARQA 1T0OA 4OZFH 1HDMB 4NCC2 2C9XA 2QVIA 4RESB 3PPEA 2KI6A 4Q6YA 1A9BB 4XNXL 2FYYA 1JNLH 5AOLA 5AW8B 5DO8A 4XVSH 1JP5A 3PHQA 3S3PA 4U31A 2WLLA 2YPLA 4B9ZA 4XBPA 1TCRA 5E99L 3LZRA 4LCCB 3BQVA 5GISH 3QULB 4M61A 3RHWK 5I17A 5AZ2L 3KPNA 2RIKA 4YBHA 3ARDD 4JPKL 2YQGA 2BVPA 2OCCB 4JGUA 3FO1B 3UTTB 3PXHA 1I4FB 2Q20A 1KTLB 2X4RB 4XBMA 4O4YH 4JHWH 1NGPH 4LKXB 1QFHA 4GFXA 4MAYA 3IJSA 1MWAH 4I2XE 2PTUA 4LRNH 5FYJU 3CFKB 3O0LA 5MI0B 1TKWA 4UIKH 5PAZA 4ZO8A 3RU8L 5FO7A 4H8WC 4X7EC 1V7NH 2W0FB 3AGWA 2CDFA 5IB4B 2OMTB 3FFCE 2OK0L 2OJEB 1L7IH 4MNQD 5EBMA 3QORA 4JM2F 4DVRL 1RZQA 5D4JA 1QASA 1SYSA 1CVRA 1O0VA 4X5XB 1EXUA 1UM4L 2NR6A 1BFTA 1ZV2A 4NNYA 3UTOA 4QT5A 5GGVY 4DETA 1NICA 3O4OC 2O72A 4WIQA 3S36X 4HK3N 2GTWB 2WTRB 2VDLL 4AVHA 5LXGH 1T6VN 1X6NA 1ZTMA 3Q2NA 3C87A 3H9SA 3PWPD 1I7UA 1XEUA 5GGSB 3T5WA 4B6ZA 1T0MB 5DFVD 2X4QA 3NFSH 4WKXA 1NAMH 1A6PA 4H0LC 5CO1A 3O3EB 2P5WA 4Y5VB 1MRDH 2IDUA 1CI3M 5ELIA 2F1BA 2F1AA 1KDJA 3EJJX 1DTUA 4MTMA 3TBSB 5JHLH 4ZXBB 4RGNC 5K59F 4QWWD 1BEYL 2EH8L 1A7NH 4AC4A 5FOBB 2AS5M 4E36A 3GDCA 3ETBJ 1AO7A 1BVKA 4TQIA 1SN2A 2CXKA 5T5FH 1T0NA 1EBPA 5DQJA 3HMXH 4W68A 5E5RB 1KB5L 1HH6B 4Z95H 4YXLL 4GG6E 4MMYB 4NLHA 1CDJA 1D2OA 1HX0A 1UASA 5TDPB 3NCBB 3M1CA 3VWKD 1L0YA 1I8AA 2YA1A 1LO4L 4NQDA 5TF1H 3TJEL 4R7NA 1QWNA 3WFDH 4HLZG 3UPAA 3O8XC 4B7IA 3BIKB 5DUJA 2D2CC 4OFDA 3MRMA 4B5ZA 2BSSA 2LOEA 1BD2B 1SYVB 4HIXL 3QHZL 3JT2A 3P0GB 3C6SA 1SY6A 3WDJA 2BSCA 5I66A 3QNXB 4HKZB 3O0RL 4WEUD 2HXAA 4ELME 1X5AA 2BNQD 3GMQA 1U58A 2CM6A 1MAML 5I19H 3S36H 3F7RA 5CLXA 3UBXG 5C3IA 3DGGA 4EKXA 1JZ3A 2C9SA 4W6WB 4WWID 4BINA 4G6KL 2YPKA 4MNGB 3JUYA 3UAJC 3S8WA 2DM3A 4Z8FH 1EZLA 4TN9A 4EDXB 5JHBA 2J71A 4L5FH 4MJIA 2IIJA 5D93B 3RY6C 1DJGA 4FNLH 1TTUA 3FRUA 3HLAA 1NGZB 1CXEA 1BSIA 2OMZA 4Z9KB 4UDTA 4YSOA 2BW5A 1EA9C 5TH2A 1RK1A 4X6CE 3MGOA 3UGUA 4OVUA 5ESAA 2WQVA 3MBWB 2ZKYA 1F3RB 4MNQE 3ZQ9A 3FUNA 3O41B 2NY5H 3VB8A 3DUHA 1CFTB 3VU1A 3II1A 3NUKA 5GGUB 1QSFA 2H8PB 3LAFA 4QY8A 5D71H 3VFWB 3MLTA 3ARDA 2BC4B 4PJXB 1UM5L 1U33A 2XTJC 4XRCB 1FZOA 5J1AA 2B2XH 1YJDL 2P5PA 1OP3K 5BVJB 4KKNA 3KBFA 1FGVL 3D8MA 5FYJH 4KKLC 4F20A 3RAJH 1MVUA 4TSBL 4WLCA 4I1RA 1BIIB 1IGJA 2XCMC 1KYFA 4WI6A 3H54A 2AQNA 1OVZA 4R90L 1T3FA 2O6DA 3PWPE 1RU9L 5I74C 4QAMB 3FB8A 4K5NA 1RMFL 1ZTXL 2CSPA 3IAGC 2VSMB 4EI6A 4CVWA 2ATKA 4LT7A 2MRYA 5B1KA 4HJTA 4J3OD 4P4KB 2I9LB 3LEVL 4ODUA 1T1XB 2DEWX 4ZUSB 1HI6A 5DT1H 3NCFB 4ODXB 1NC4B 1AANA 4U1KB 4Y19B 1AS7A 2C3GA 3THMH 3ULUH 1U30A 5FC9A 5MERB 3QDAA 4B9FA 4ODHL 4H40A 4ZTPH 4DEUA 5JDSA 1PLCA 1PU0A 5BQ7A 1F18A 2VRQA 3LRSB 4ENEC 4WWKC 3KW8A 4MA8H 3I6GB 2W9EH 3CH8A 1CL7I 1XAKA 4XXWA 2O61B 2WQWA 2NY3D 3D30A 4KO6A 5LB1A 1FVEA 2N4IA 3BZEA 1RZGB 1BBDL 3CDZB 2XN2A 4TNVF 3IDYC 4TTDC 1OGAE 1G9NC 1AG0A 5L8KB 3CFIC 1QBAA 3EDEA 4A39A 3BJ91 4AC2A 1WE5A 1VCBC 5DHDA 4CADA 3FN3A 3ZHLA 4IHBA 3PQYB 2BNQE 2H32B 2QADD 4OQ1A 3GXIA 2VZTA 1JUFB 1N18A 2FBOJ 5DXWA 1NZRA 1N59B 4XZUA 3BUDA 4LIQL 5EEXA 1M05A 5GS0H 2BNUB 1JZ4A 3B3BA 4IOIA 5AW1B 4PY8J 4F9PA 1ACZA 4IK6A 3MX0A 4LDCA 5JXED 3NZUA 2Y1YA 2YQ3A 3EHBD 1WD8A 4EUPG 1U8OA 1T6WA 4LOVA 2M1KA 3QJHB 5DJDB 1OGAA 2YFNA 5JPNC 2VC2H 4QRUB 3QQ4A 4B95C 1OGPA 5EN3A 4P05A 2W9DH 5CSZA 2Y22A 2CPUA 5F3HB 4MJ6B 3DNKA 1E8WA 1JGEB 5JMOC 3Q8EA 3TN0D 3I84A 4AYSA 1NKGA 5K39A 5J12B 3BP5B 1IGIH 2WAQA 4ODVH 3D51A 1JGLL 5EPMA 3AY4C 3QXDA 3FQTA 3S3DB 4Y4FA 4G7SB 1NA8A 4M7LL 4WTZA 1TITA 1ERNA 1MG3C 2WO2B 2CG9X 3VXTA 3NSDA 2IG2H 1T5XA 5GGVL 2L0DA 5I16A 1F02I 1ZK5A 1P9MA 1SOKA 3P2BA 4OFYD 3D34A 3BXNB 2V9RA 1NEZA 1MCLA 4M8UA 2R29A 1BIHA 2MWCA 1M3IA 1P1ZB 3GNML 5CZRA 4XN4A 4XNMB 3EGXA 3UDWC 5I8OL 5KVEH 1JXFA 2P3YA 5CD5C 4NQQA 5ESQB 4AKPA 2Q8BL 2VN4A 4N8VB 4EZJA 3BJLA 4UU9A 1CE6B 4MA7L 1E4KA 4DEPB 4X0KA 4BH7B 2DJSA 3NESA 5EZLB 4CILA 5DRZA 1J12A 5HYJD 1O6SB 2VDMB 3GZOA 1I85A 4P23D 3WEXB 2NZ9C 4ZX5A 4GMTH 3WEOA 3CVHB 4YC2C 4P5RA 4L3CA 1MFAL 1ZJAA 3FXIC 1EJFA 1Y07A 4L9LB 3ARSA 5CSGA 2DV6A 2VE6A 3SO5A 5KOMC 4U1MB 4KJQD 5GSRB 5J06A 4LVNB 4RZCA 2HVKB 4H1LG 5B4MC 1AKPA 4U3XA 1Q0XH 2WXMA 4GUPA 4Q2ZB 1UYWL 4TNWK 1ZTXE 1U3YA 1E9QB 3HMWH 3CD4A 1SFDA 3IE9A 1ZLWH 3GIZL 4FJZA 3MRKA 1SOQA 2V4LA 5H35A 3RPBA 1HKFA 2JF1A 4RDQG 3VXQA 1OM9A 1MCOH 5EC1A 5F96H 4XP4H 1EAOA 2DQHL 4MYWB 1VHPA 5GGQL 3PRZA 3BESR 5GZOC 3STBA 1HK6A 1E7UA 3SE4A 1J0KA 3COOA 2WBJB 3VXOB 4OI8A 2BVOB 4GAGH 3WXWH 4CKQA 3WDHA 1N7ML 3SBWA 1Z9NA 2XU9A 1TQVA 4XB7A 5EBWB 1RZKH 1A4BA 4N0UE 3U30C 1YY8B 3ZT5A 5ENWA 2YPVL 3NGBB 3MV7A 1JNJA 5EU3A 5LCVH 4ZMVA 2FT8A 3MAWA 1CG9A 2Z35B 3LZLA 3FSOA 2XQYK 5KVDH 3TF7C 3LVTA 3Q06A 1P5VA 4OZ4A 1GZPB 2WVVA 2X4TA 3T6ZA 4NN7B 2BWQA 1URIA 1JYWA 3CZJA 3KCPB 5H37G 3KPLA 4ZW3A 4ZMOA 1GZHA 2CALA 3KYNA 4PCSA 4WW2B 5D55A 3VGHA 3QUXD 3STLB 3TVMB 5AW6B 1M9WA 1ZHLB 4JY5L 5AL0A 1GTNA 2QDVA 1NFIB 1ICTA 1ZWIB 2HWZL 4UAHA 5FHAL 3F12A 3LTVA 1K8IA 3NTCL 2WXPA 5JIQA 3PWLB 1FFNB 4EI0A 4PJ6A 3H2PA 4LIQE 2VLLA 2X6BA 1E7VA 1A25A 5KEZA 4N0UA 2CD0A 3WS6C 4KDTC 3BLPX 4D9LL 1OSYA 2DYPA 1KYDA 3VRIA 5JXEA 4GKNB 5DURB 1KG0B 2ZUQC 3LD8C 4FF9A 1FNHA 4JRYB 5D9SA 1ORQA 2Y6TE 1F3JB 1HNFA 1QOKA 3S96A 3TBVA 2R69L 2CWRA 3BUYB 3L48A 1NCCH 3ARGC 4GBXC 1C5BL 5DJCA 5IG7A 4WFFD 1M42A 4EN3B 3QEUB 4UTBL 1L6ZA 4UNVA 4OCXH 5LGHH 1NIEA 3DX9B 1O9VA 3WKPA 5KAQF 5DD3L 1LMIA 3HN5A 5ES4B 5I24A 3ULVC 3ECBA 2L8AA 3LPOA 1EEUA 2EE6A 1EGJL 5HYJE 4IW4C 1YEDA 4FXLA 4G72B 1JYXA 3G08B 4HHAB 2XLLA 1SNRA 1GGIL 5IBTH 1QRNA 2J88L 3ROOB 2EZ0C 4RWYH 1MN4A 4YHNA 1NINA 3VWJA 3S2CA 2EXYD 3EDFA 2JCCE 4F37F 3ZX1A 3BN9C 4N9GA 4S1SH 3ZZSA 2JMRA 3MGTA 4R83A 3RWCA 5D4QA 2XKUA 3SQRA 2IALA 3T0AA 1U8LB 1CYGA 1WWCA 3MLVH 5ERWA 4YHPA 4AT6A 1TZHB 1MCWM 5CINL 3QJUB 4LLDA 1LO0H 1JYNA 2HTLD 1MCQA 3DA0A 2ZCKH 1PLAA 2YWZA 5FUCC 1G4MA 4A2MA 4I0PD 1HCVA 5FPIA 1DFBH 3INUL 3SBQA 5HVHC 3ARPA 3BVVA 2PMZA 3DX1A 3MA7B 1BMZA 4NGHL 4BK5A 1X7QA 1CPUA 3O6KL 4Z7VA 5BCAA 5BS0D 1LNUA 4UINL 5CJQH 2AEOA 2ZXWB 3EBIA 3GMNB 3KDMB 2JCCA 1UB6A 1UTDA 3BOVA 3HAEA 3AQZA 4YK4B 1QA9A 3X1NA 1SPDA 1GGBH 2PABA 4KQ4L 3BP6B 3ZL2A 5ITFA 4ZFOB 4U1SA 4HCFA 5C0AA 5TQ0H 3QA3A 1ASPA 2AQSA 1VEPA 4ZMYA 3WXVH 2NZIA 2UYLA 4OD2A 2YZ1A 4Z7UA 4YUEL 4HH9B 3TBCA 4X9YA 2P44B 5DMKA 2PWHA 3FT4B 4JFFB 4M6NH 2I24N 3OJDB 3KJ4B 3OAWA 1T89A 3BIAX 1RUPH 3OAZK 2P4AB 3OKOB 1NAKH 3PG2A 3ZTEA 3WNLA 5HHMD 1RULH 2NUPB 3OPUA 4HK0B 2FT6A 5DVMA 3QWOA 1GGYA 4MNHA 5C8JB 2IBZX 1T2QL 3ILDA 4P9ML 2ID5A 3SYCA 1WFJA 1RAMA 1TJIL 1OM3L 2SODB 5KYWA 1IC7H 1IQWH 4G1MB 4MRCA 5AAMC 3HR5B 1T2JA 4KI5D 5CS7A 1JNHB 4G83A 2Y2TA 1TIUA 1W72B 2YOAA 2KBGA 3VI4B 2VDRL 1MWOA 4N5ED 4ODTL 3SKNA 1EPFA 3QUMB 2WXOA 4YEEA 1AHWC 2D03L 4QRRD 2J5WA 3ZQXA 4WFFE 1MHEB 2VR4A 3MVSA 1P5UB 4MMZB 4U1GC 4LBEA 1HZHL 4XWOC 4TQEH 3NN8A 1SEQL 4AGPA 2B8OT 3I9IA 5FA3A 3K5RA 1G6RB 3D0VA 2F54B 2ZSVA 3EGSA 5EZOH 1DVQA 2AV7A 1BHGA 3QJXA 5TE4L 3ARYA 1S7SA 2F19H 2VLRD 2R0WH 1SUHA 3ZDXE 1AOHA 5SWQA 2LLLA 3U1SH 4KJPC 3DPBB 1T4KB 3ILQC 3REVA 2YMXH 2WXRA 1NIDA 3T65B 3MRNA 1TR7A 1S7VB 2WOYA 5AAWA 2CJSA 4LU5L 3MRHB 4B53A 4L8CB 1XF3A 2C5DC 1SJEB 1CR9L 4NHCH 1XIWC 1TNMA 4Y1SA 2PW2A 2BY2A 4XCEA 5LG6A 1UA7A 3TTSA 1HXKA 1GMEA 4XH2B 1F86A 2GHWB 4XNYH 2P5ED 3AQXA 3JWNE 5E2VL 4FTVD 2FLMA 4MAUL 3I75A 2QVTA 2XZQL 4N2LA 2Q8AH 1AKJA 4HKBB 3NZ8A 4QXUH 5E1IA 1PG7X 2JKNA 5DR5L 4X7SH 5BS0E 4DESA 1BQHG 1FFRA 1NBVH 3B7SA 4HX1A 3V0FA 4M8QA 4RMSA 4R84A 1IGML 4KUZH 2OX5A 4HS3A 3RA7L 4Z3HA 4GRLA 4KX9A 5JPMB 1SVBA 1TPXC 5LHDA 1WISA 3AUVA 1EFQA 2E6QA 2APSA 3M8OL 5LBSL 2BSDA 4PGCA 1C08A 1QR4A 5T33H 2X42A 4ZSOB 3KEDA 4KHTL 5IVXE 2Z8WC 4ODSH 2VQUA 1FVCA 1DFXA 1U3HB 4AG4L 1DBJH 1NCIA 3PGDB 3SB3A 2AANA 3QUYC 4F24A 3GB7B 1F4WH 3QT2A 5J6GA 3CX2A 5KG9B 2NXZC 1J5CA 3NIGB 2HN7A 1SF5A 3GHEL 2CCLA 5HHME 4OGAC 5D7LD 3PHQB 3VFGH 2OP4H 2WLLB 1YQVL 4MFHA 5HVGB 4ES8A 3TFKD 4XBPB 4LPVA 4PS4H 1TCRB 1DANT 3F6IA 4YHIA 5KJRH 4G7VH 2VDQB 4M61B 3FDWA 3N40F 1JWUA 3KPNB 1MCHA 3V4VB 4PB9L 1EZVX 1ITCA 4KI5E 2BVPB 3SBPA 3E2HB 1MNUH 4LB8A 5IOPA 2WOBA 8CGTA 5LNDA 4JDZA 4QUOA 4CN1A 4MAYB 2BK8A 1ESOA 4FQJH 3SQOL 3O6FD 3BDBA 5EUKB 3BRFA 4GRWB 1FRGH 4M48L 2A6KA 1AXSB 1A1MA 2J8UA 5IESH 4JCWA 1AIZA 1AHMA 3V5DA 4YBQD 1NL0H 4KHXL 5JLZA 3WUWA 4KKRA 2CDFB 2G0KA 2HKFH 3CZFB 5EBMB 1XGZA 4IRZA 4ELKA 4GXVL 3W9EB 2B1HH 3ATBA 3LEXB 4IBWA 3X3GL 1PVHA 1SYSB 3SPJA 2VLRE 2EXSA 4FX5A 2DD8L 4NNYB 3PFQA 4JM2D 2UWEE 2ZKXA 3LCYA 3BQUD 4QT5B 2BSED 1KIQB 3HE7B 5I15L 4J8QA 2GBUA 4P2OC 2Q2EB 4NOFA 4I2XB 4E5XA 3IS0X 3QYNA 1SXNA 3SPVB 1XZWA 1XXFC 1D9KC 3LKQB 1JGUL 4E0RA 4E41D 2H0PA 2P9RA 3H9SB 4X8CA 1S7TA 3PGFH 1F58H 1I7UB 3MROA 1R5VA 2B1OA 2P5EE 4PS3A 2KC0A 4FTVE 2DQDH 4IU2B 1CS6A 4WENB 1S7QB 2D7PA 3FFCB 3D12B 1E0OB 3KE0A 1JRHL 3SOBH 8FABA 5IUCA 4LAQH 2YD9A 2XTSA 3T0EC 3ZE2F 3O45A 3EW3B 2VR6A 5AKTA 5ECGA 5I1KH 1ACCA 1SLXA 2VN5A 1YNLH 4YSQA 1ILUA 2VXTL 3LNDA 4JG1H 4F15B 2QZ5A 1ZS8A 2UWEA 1VDGA 2L7JA 3IDUA 2EC8A 3SJVD 4U2YA 3P9LA 2NY5C 1DVSA 1LO2H 1OLLA 2AXGB 1JZIA 4R7NB 4HU8A 1UG9A 3AACA 5JOFA 3N42F 4FXTA 5CEXA 1S9YA 3N43B 2CK0H 4BIKA 1E9PB 3MRMB 4HALA 5EDSA 3QZWB 1BJ1J 2E27H 4EPSA 1UM6L 1P6AB 3WFBL 5D7LE 2Y6SC 3HC4L 1D5IH 1WAPA 1DBMH 2E9BA 3QFJA 1RCYA 4RRPM 3DJTA 4AI7A 4KJWC 3GMQB 1U58B 2NY4D 3MUY1 3QXWA 5BW7A 5DHVH 2XFGB 4RFOH 5I1DA 2W9LA 3KYKL 3NJMA 1W6WA 5KSAD 2G4EA 3CFDA 4GG6B 4NC0B 1J86A 4B41A 1UACL 2YPKB 4JM4H 1U93A 2I5YL 5KYNA 5MEOA 3ULUC 1XGRA 3SD5A 4JPWL 1CICB 5C0CA 1YYCA 4MJIB 4HOWA 1Q9LA 4XZ4A 1WFNA 2Y07L 2OMZB 4QRPD 3IFLH 4AMKL 5TH2B 2DQIL 3HFML 3P02A 1Q0YL 2CR0A 2IPTH 5TPWL 5AZEH 3G6AA 1NSNH 2CKBL 4YHOL 5DD0L 3LXUX 3CQQA 2Q7AA 3Q8CA 4ELMB 3U9UA 5SX4H 1I9JL 5IMKB 2OR9L 2A6IB 2VMCA 4PYGA 3EAKA 3C8HA 2A99A 3ARDB 1B4JH 3CMOH 3PAVA 5DJ0B 5LBSA 1KPVA 1DJXA 2W65A 4UOQA 3S4SG 1RZJH 3WY2A 3HI6H 4EDWH 3LQZA 2HRHA 1S46A 4I8DA 2GIMA 4OLZH 4KKZA 3OPZL 3M6DA 2PTTA 2NMSA 3DOSB 2X3CA 3TPUA 4KXBA 1MVUB 1UXSA 4KPHH 5I1HH 4MCMA 2AABL 4TRPH 3MLPA 1N2RA 4L37A 5LGKA 4HIEB 2DQEH 2CK2A 4MMXB 4X6CB 1NKOA 4K9EL 4PTUA 5EA0L 1NJ9A 4EI6B 5GS0C 2ATKB 3MV9D 4MNQB 4PJIA 1R3HA 2HKHH 5B1CA 4L29A 3K6SA 1ND0A 5I5JA 4EI5D 1FN4A 5BJTA 3CPUA 5E0FA 3RBSA 3V0IA 5JZ7C 4LP4A 2YD2A 1NCHA 3K2KA 3SJVE 1VFBA 3KHOA 3L3GA 3V0WL 3VQ2C 1ZVSB 1M7UA 3AC0A 5BQ7B 1FF5A 2BLFA 3LZFL 4WK2B 2JJTA 3Q6FA 2BSTA 4MDJA 3V9EA 5INDA 4L8SB 1DQLH 2YD0A 2O5NA 4F7TB 3NSJA 1CFBA 5F7AA 1LXMA 1ZPUA 2P7TA 4FHJA 1C8QA 1N9PA 1FFOB 3S0PA 3DXAD 3BZEB 1ODUA 2C7FA 4TSAL 1JYVA 1G1KA 3QWRA 1UT1A 2DIBA 2FAUA 4M5YH 3DOHA 1CGYA 5JYLA 2KLSA 4PJDE 3TIEA 1UWGL 4XOCA 5I6PA 3SCMD 2ATPA 1XTMA 4P2RA 5HYQA 4XGZA 1YN6B 5CBAB 1WAAE 3MCYA 3C60A 3GI9H 3EG9A 1BXUA 2AZAA 2M8XA 4WV1B 1AGEA 2VDLB 3VWKB 5CLTA 1EJOH 1M05B 4PY7A 4PWKA 4IOIB 3BP7B 4JFHE 3OV6A 1DQVA 5KSBF 3N1MC 1HWGB 1U8IB 3MX0B 4OF5A 2VXSH 5EB9A 1YMMD 3BEVB 4BQCA 5DC0A 3MZTA 4DTGL 2WLNA 4AQ1C 3I9GH 1U8OB 4AH2B 3U6XA 4X4KA 1OGAB 1T1ZB 3L3OB 1PW3A 3QQ4B 5G55A 5D7SH 2FL5A 1KACB 1MLCA 3QWNA 4PJDA 3LV3A 2ZUWA 5G2NA 5CSZB 1DQMH 1A0QH 1FLRH 4XCCL 4XOEA 5LNGA 3SGKA 2W0PA 2BNQB 3SO3B 4AQOA 4JRXD 1HL5A 2J25A 3C5ZD 5K39B 2ALAA 1INDL 5AG8A 1KB5B 3ZTJH 1BZOA 4FXGA 1G1CA 3ZY7A 3TH4T 2ICWA 4LOFA 3MYZA 3QEGH 3FQTB 3OMZA 4XN2A 5KBNC 3VFRB 3U7WL 2GCYB 1AXTH 2WTOA 5DS8A 3WJLC 3MUUA 4U3CA 5E94B 3RVXD 3S35H 3MRBA 3TEXA 3VXTB 5EEUA 1BZ8A 5FB8B 4JHAL 3L45A 4XPFL 4GSQA 4Z3JA 2PWDA 1MW1A 5CU9A 1NEZB 1XEDA 3KMDA 2BCKB 2EDLA 2VDPH 3JWDL 3MV9E 5C09D 3MOBL 1MFEL 1RZKC 5E6ID 4XXCA 1JCVA 1F5WA 2WQAA 2QPDB 1MJUL 4UZGA 4FD0A 4JFYA 4KNQA 3C5JA 2H0JA 1AJ7L 4ZOBA 2AJYL 4XI5D 5BMFL 4JM0A 1DL7H 3Q3GB 4UU9B 1H3TA 2R2BB 5ALBL 1OP9A 3VXMD 1H3VA 2EO1A 3MR9A 4I3SH 3HC2A 1ZRUA 2RD0A 4F1SA 3L5WA 2L7QA 4A6YH 4YHMH 2G2RA 2Z31A 4HSAC 3FQNA 4KC3B 3HKFA 2OI9B 3MYJA 2VE6B 1YY9C 3WL9B 3DK0A 2C9QA 5TFSL 4IRJC 4W9ZA 3V6BR 3FRPG 4RZCB 1KCWA 3VQ1C 5AOZA 4FEMA 4GUPB 1A7PH 4OJAA 3DXAE 1E43A 4UM9A 3MLUH 3SYQA 4UZSA 3MV9A 2B0SH 3MRKB 5C08E 1JZ6A 3QVAA 4XB8A 4KK8C 3ESUF 4G8AC 2VJ8A 4N9OB 5E4AA 3KLHD 1U92A 2WNGA 3BUPA 4Y16C 3DSFH 4OZGA 3V4UL 2IGFH 1L9PA 1U8KA 1OCRB 4PR5B 3ZMRA 1E4WL 4F80A 3OKKB 3EIFA 2QQKH 4Z1PA 3DMMD 5DJZA 4P3WA 2ORBL 1DLHA 3CHRA 3LY6A 3MJ8A 4I7ZC 2CU9A 1BWWA 3T3PE 4LLMB 1EAPA 1HXMA 2A9ML 1QLRA 5EV7A 5FCUH 1IBZA 3TWCL 3D25A 5E8NA 3ZUNC 1AR2A 3MV7B 4KK6C 5EU3B 2WYTA 2NY3B 4PIBA 5HGDB 1YMME 1UEMA 3OSKA 5ETUB 3UADA 4LZKA 3GLZA 2NY1C 4PJHE 4EXKA 2VL5B 1K4DA 1QACA 3AM8C 4OZ4B 3MNVA 4JB9H 4NLAA 2XWZA 4P2CG 4NHUA 3FU7B 5C08A 5BZWA 4AW7A 3KPLB 4DH2A 1E6JH 1VESA 2HFTA 3KYNB 3RIAK 3ZKQD 3O81A 1YEKH 4Z5RA 1VRSA 1DBAL 2V6HA 3D3VA 1RURH 2QADB 3HS8A 4JRXE 4PGDA 5DU7A 4GIOA 2OMXB 5HGBB 1IC4H 1K8IB 4H88L 3QNZB 4PJAF 3CFTA 5GGTL 2OPCA 1CUOA 2WXFA 1BJ1H 3P3RA 4IYKA 1NBYB 5CP7A 3KGUA 1JPGA 4N0UB 5JR1L 4RISH 4Q58C 4JVPA 4Z6AT 4AK2A 3VRIB 4KV5F 1Y1UA 1MCDA 1YMMA 3BDYH 1IE5A 1WZKA 5E51A 4CMMB 3ZHNA 1ORQB 2XYBA 2YGVA 4U3SA 5FFOA 4HHWA 3VX1A 3TBVB 3WO4C 2E9WA 1SY6H 5ALCL 5C09E 2FJGA 3VYPA 4GT7A 1Y6KR 3KD4A 2NX5D 3QQ3A 5IG7B 1IGFH 3SDAC 1JPSH 5CMAA 1LD9B 3RGVD 4DVBB 4X4MA 3TN0B 3SSGA 4CC4C 2A4EA 4XP9L 1C8PA 4HH8A 3VXME 3KBHE 2Q0ZX 1W0YT 2LV4A 3MV11 5I75C 1YEDB 3RDJA 4P4KC 4JN2B 3Q05A 3BAIA 1BEXA 3RHWF 3A4FA 1IAIH 4L1BA 3UYPB 5E24E 1A6UL 3EYQC 2NY0C 4H4NA 2XUWA 4OIAA 2E3VA 4NO3B 1W8NA 4RMUA 3QSKB 4Y5XB 1TUPA 2F53D 3TYFA 4NKDA 2IV8A 1QP1A 3V95A 3QNFA 3RVUC 1LO3H 1PZBA 5DSCB 4KNSA 3R7QA 3VCLB 5ERWB 5I23A 2L7UA 4K8RH 4YHPB 1I3GL 4C59B 2BP5M 1DE4A 4LLDB 2H26B 2EINB 1I8LC 3BAYA 3GMPB 1ORSB 1UD3A 1V3MA 2C3WA 4A68A 5I9QC 4KTYA 1P4BL 3HUJE 4QTIH 1JF6A 1CLYL 1L9MA 1JK9A 3CSGA 4ZX3A 2AJVH 1LNUB 4UOW1 5E9DD 3DDFA 2ICCA 2IVFC 1OZUA 1R3LB 3D05A 1KTCA 5CGBA 4OD3H 1OP3H 2JCCB 1UB6B 3HC3L 4MDRA 3HAEB 4F7PA 1QA9B 3G6JA 4UILH 4TULH 3LKRB 4L1HA 5ITFB 1ETB1 2NQCA 1J1PH 4HD5A 4U1SB 1DBKH 5DK2B 2BDNH 3RFRA 2UYLB 3RP1A 4Z7UB 5E5MB 2EE2A 3GLEA 4Z3FA 4YDJA 3LZPA 1K5WA 1OW0C 2FEDD 4WEBL 2YMTA 3D6GA 4JKWA 3V7AG 4OUUA 2F8VA 2XIBA 5CN3A 4JFTA 1LGVA 5J1SC 1IL1A 5TJWK 5HGHB 5KS9A 2QQLH 4X7DC 4EE2A 4NM4L 3W11D 2AJUL 2A74A 3KBPA 3DMMA 2V7NA 1TQTA 5IQ7H 5B3JE 1KJVB 3LKOB 3WDIA 1OT2A 1XH2A 1KF9B 2FX7L 2H3KA 4KMTH 5CZXC 3ARBC 3UYRL 3NP3A 3ZT7A 2I9TA 1SFHA 2ZWZA 4EUPA 3QR2A 1TETL 4B0MM 5I1EH 3DYOA 2BH0A 1YEWA 1F8TL 2JI2A 5CCKL 4LVOC 2BZCA 5EO9A 4YXHH 1UFUA 3RI5F 3QYMA 2ZOLA 3C6LA 3O2DH 5E4EC 5JIKA 4PJBF 2NX5E 1G7LA 3U6RB 2WBXA 4O51B 1FG2A 3HNTH 3LPPA 4LBEB 3V4PA 3LQAH 3PWJB 4K94H 4PD4K 1P53A 3SIKA 3ZMNA 1T7YA 5KJ4A 3NMEA 4UV7L 4NUMA 3MXVH 5IJBC 1E4XH 5HI3D 1INEL 4B9YA 3RYMA 1EHXA 1G9MC 5I6NA 2YJQA 4H25B 1IAIM 4R8WH 3WD5L 1RUAL 3RWGA 1WFTA 4DEPC 1BF8A 3HHMA 5DWUL 5I0WA 1O75A 2K8QA 4Y8AA 4G6AC 4MJ5A 1KXQE 3T6XA 1KBGL 5AUMA 3REVB 5DYFA 3VD4A 2F53E 3MRNB 3SEPA 2DAVA 2V5YA 5F7DA 1XGYL 5DA0B 3LN5A 4XO4A 1ZHBB 4RFEB 4L9LC 4TOYL 4BZ1L 1HWHB 1A1OB 1XF3B 4Y9GA 4M43H 4TNGA 3VD7A 1IAOA 2XJLA 2OA9A 1GGUA 3OG6B 2A2QT 2IAMC 3P30L 4ZS6D 2YA2A 4H2AA 1SXSA 3C75A 4OZFG 3MCLH 5HPMB 3OWEA 3KNBA 1K85A 4JY6A 1N70A 1FORL 1CGUA 1IT9H 2JJWA 2D0GA 4N0CD 4F7KA 5I5IA 2F74A 4ZUWB 2DIEA 5E9DE 4H1LA 4HX1B 3ZDXB 5EF2A 3A6BH 4ECNA 4ELDA 5IMOB 4OLYH 3HG0A 2OX5B 1T04A 2J57A 2X1OA 1WYJA 4G6JL 3WKML 2F53A 4PGCB 1C08B 3T2QA 4N0YL 1EUUA 1M1XA 2JB6A 4HWUA 5E2WH 3PABA 2VXQL 1I8UA 4R26L 4BFJA 2OSXA 1FVCB 5FHBL 3P54A 4N2AA 7PAZA 1BGXH 3PP4L 5DF0A 1FSKC 1M4KA 4K3JL 3I6KA 1YZZA 3DV4A 2YD7A 1E8ZA 4I0PB 4YPGA 5ITBH 1RZ7H 2AXJA 3BFWA 1OTSC 2E86A 4MX7A 1EIBA 5BS0B 3U0WH 2ED8A 5F0MB 4DUVA 3HPLA 3Q9PA 5EEZA 3GMMA 4YH6A 3LH2L 2E75C 3TVMC 4DOHE 2EH7H 2X70B 2PP7A 4NJAL 4YDZA 5E6SB 3ZYZA 3PJSA 2OMWA 3IGAA 3L1EA 4X8GA 3V8OA 3II2A 3MMEA 3ZK0A 5H37A 3CVCA 4LHUA 5JUEL 5T1DL 4F2ME 3OKNA 4L4TA 4W6XB 3QDMD 5C6TH 5J9PA 1EWHA 2ZP8A 4PN6A 1DVZA 4AEFA 5L9DL 3BWZA 2R2HA 2A6KB 2PYEA 5KVFH 5F1NB 4CJ0A 3QUGA 3IGKA 1QLEH 4AM0A 5CBEA 5JLZB 3WUWB 3O2VL 3AU1A 3I6LD 1S5IL 5HHMB 4MZIA 1NMAH 4HMEA 3HJ0A 4PTTB 5EMYA 3QI9A 4OTXL 1T7WA 4TYUA 4QOKD 3TNNA 1NMCB 1HKLL 4BRVA 1QBBA 4WWPA 2O26U 4FNRA 4OR1A 3ZL1A 2H4EA 5HJGA 2E7DA 2ZOKA 3RVWC 3K8LA 2BOCA 4ZNEA 2JV6A 1WZAA 3JVGA 3D18A 5DZJA 2A0LC 2O6CA 3FQUA 4IQHA 4F2MA 5EFIB 4AMXA 3IBEA 4M7LT 2DICA 1XH0A 2FR4A 1THCA 2YBRA 4M8VA 4FQPA 2FGWL 2OLDA 5E2UL 3JV0A 3RPIA 3TA3C 4NQXA 3VGDA 1S7TB 2XV0A 4UT6A 1I7ZB 4O02L 5CLWA 5LN4A 5BXFA 1NCGA 4TUKH 3MUJA 3UBHA 5HI5C 1D7CA 4HDIA 5JW3H 1PCSA 2DTML 2EIEA 3O45B 2MQ0A 4XMZA 4FKKA 2R1WA 2JKLA 1HOEA 3EJZC 2OTPA 4PBWD 5CU5A 4ZAKA 2DRUA 2H2SD 1HH9B 4NDMB 4OW6A 3ECVA 2RCSL 2UWEB 5D5MF 5L0QB 4ZBJA 2VDRB 2VAJA 1XR8B 1U8NB 4JFOA 4ONFL 1F56A 2ODIA 2E6JA 3OBAA 3KPPA 3EYFA 1BVZA 4L8DA 3EOTL 1AVAA 3HA0A 3IXAA 4YL9A 3MRIA 4NJ9H 4M5TA 4R4BA 2BWIA 3B9KD 3ILPA 4YK4C 3T1WA 1YUHA 2VH5H 1OQXA 3BEWA 5F7WC 5CEXB 1H5BA 2ZZUT 3Q5OA 1RZJC 2OTUA 4MD5A 4C83A 2P5EB 3UJTH 3LOWA 3MLXH 4FTVB 5B38A 1U42A 2WQUA 3QIBD 3PXJA 4JFQA 2IMNA 3L5JA 2WY3B 2CJTA 4FMVA 4PG2C 2DS4A 3QUKA 1RZPA 5F9AC 4H5SB 3QFJB 1P0SE 3S37H 3FT2A 1L9NA 4JR9L 4HXAL 1L0QA 2YD1A 2HT4C 4GKSB 1DEEB 5LQBL 2IPUG 4LPUA 4H8WL 1EERB 2QSQA 5CNHA 5GS1B 2P8PA 4FYTA 3VFSA 4DO4A 2XICA 3HPJA 1XL6A 3BO8B 3QDME 5DMYA 2E0PA 2ZNWA 5I0DA 4HJIA 1FYHB 5KOVC 3RTQA 3CC5B 3H7BB 1Q9LB 3BRDA 5F9WB 3QWQB 2J3SA 4I3RH 4GQ9L 3V7MA 4M93C 2XHNA 3I6LE 4PJGE 1GAFL 5BUPA 3FSZA 5D7LB 3TONA 1LWHA 2JFCA 3G6AB 3MOAH 4XPGH 4BZ2A 4GAJL 4QOKE 5I6XB 1OPGL 1VLXA 4M29A 3NA9H 1FFTB 3X13B 3QB7C 2VMJA 4K3DH 3TJPA 2IO5A 1B4RA 4ORZC 3NACL 1YPZE 1ADQA 4WO4A 3T04D 1KGWA 1ZSHA 2PTTB 1NC2D 2CJUH 3QAZB 5HDBE 4DGVL 5KUMA 3W2DL 2BOBA 1CL7H 1UXSB 1VPOH 4HVBA 3VUAA 3DIVA 4OAWB 1WH0A 4LLWA 5GZNA 1NFDF 8PAZA 3GXTA 5A2AA 1UJ3C 4CW1A 7TAAA 2MOVA 1MRCL 1I1FA 1BLNB 3A23A 3L6FA 4PTUB 1NJ9B 2X44D 2W60A 4JFZH 1J87A 1MELA 5I1IL 3TO4C 3EXLA 4NXSA 1R3HB 3OAZH 5KUKA 5B21A 2GT9B 3K6SB 1F2XK 5IHUH 2AJXH 1FN4B 5EOQH 3GEFA 4U7SA 1HQ4A 1M3JA 3P4LA 1NCWL 4IOFC 3GSUA 3HI1A 4J6RH 3BQUB 2NCEA 1KLGB 4NZFA 4OLUL 3S48A 2CDGB 2F9BT 1GZQA 3CFCL 2CO2A 3HG2A 4H26B 5DJ6B 5INDB 2FUQA 2OJZH 1E3ZA 4RGND 2Z7WA 2CBTA 1Q1JH 3ZO0A 3CXDL 4DW2L 2XSKA 1GCYA 2APFA 2VW7A 3Q2LA 2BRRH 2H47C 3FH8A 1ZLVK 1L9TA 5AWNL 3QC6X 4U7MA 2PR4L 4RSVA 2CO6A 2H9GA 4S1RH 3G6DL 4F57H 5EOTA 5HHOA 1AC0A 1U3HC 2XWBA 4OJFH 3LS5H 2EDQA 2WZPA 1WCBB 1W9XA 3VW3L 2P80D 1UENA 2ATPB 3EO9L 3O8XD 3LRLA 4NO0D 2ADFL 4E9WA 3BH8A 5HYQB 3P2DA 4XGZB 2N56A 2WXJA 3SJVB 4NQCE 3BKYH 3GSNA 2RALA 5D96B 4I85A 4M5ZL 3SQBB 2RFXA 1KLFA 2FIRT 3MFFB 1FQ9C 2HT2C 1K6QH 3GHPA 4A38A 4PY7B 1P2CA 1F4XH 3RWDB 4JO1L 5D6DA 3E2HC 1Q4NX 2ARJA 5DEJA 3T09A 2AEPL 1CF8L 3ESPA 1PZAA 1UJTA 3PPSA 4JS7A 4QRAA 4MAYC 4M1DL 3DX7B 1UVQA 4P9HH 4AVJA 4H8QA 3APMA 2ZCLL 3F7LA 4X2UA 4WJKB 3UAJD 2BCMA 4A2GA 2Z7UA 4BJLA 1MLCB 4PJDB 2WJ7A 3HHSA 5I71C 1FLTX 1N4XH 1G9EA 3U7AA 1IEAA 4UI2A 5IBLC 1U21A 2XPGA 4NQCA 1V10A 2QV4A 2VNCA 1S7RA 5ADPH 1GYVA 1A5FH 3QORC 1KCRH 2GY5A 5DHYA 4KVCL 3KPOA 1RKRA 2IQAA 3U2IA 1UCBH 2OL3L 5F0LB 1MFDH 4OV5A 1RFDL 2NR6C 5DS8B 3ZKXC 3POCA 1DSFH 2ADJB 1L4IA 3FFDB 3C09C 4LNVA 2WWMC 5IV2A 3T3MF 1ZLSH 4HC1L 2ADGA 5I73B 3IFNH 4KZEL 3II3A 2XTJD 2B3RA 1M56B 2ICWJ 2EO9A 2XFXB 4G5ZL 5BQDA 1IE4A 1AD9A 3DTUB 1MFCH 5HHPA 4JZJC 3MGAA 3BZFA 5EO1A 4KKLD 2E74C 4JFYB 5C0EA 4F5CE 3MRDA 1JV2B 2Z7ZA 3H2QA 5T1JA 1QNZH 4HOZA 4JNXA 3AB0C 1O7DE 3CSYA 5KVGH 2XY2A 3MR9B 5AW7B 4OD1H 1KIRA 5L8JB 1QPKA 4JO5A 4ESKA 1G9NL 2G2RB 2Z31B 3A6OA 2YXVA 4FLQA 4BK8A 4JFEA 3VX0A 3S8GB 3VE0A 4XBEH 2Q86A 1QATA 1W16A 2A9BA 4G9DB 3KXFA 1GJUA 3K6NA 4W9FC 3CFBA 2H7WA 1TQWA 3BUBA 5A16B 2COQA 3N3EA 2A9NL 2RR3A 2CKBB 3MV9B 5C0FA 2WXNA 4ZUUA 4ENED 1N6VA 4WWKD 1A3LL 4YDLB 3EXJA 4RBPK 1WWWX 1HIMH 4EI5B 1KY6A 3FUJA 4R4NC 1U92B 4F8NA 2W0KA 3D33A 4KXZI 1H8LA 3SGEH 3GYRA 1TQUA 2DQUL 2DIJA 3QDGD 1U8KB 3QQDB 3I50H 4TTDD 5FYKH 1IZJA 1DLHB 2GY7B 1TVHB 3ES6A 3FB7A 4MXWL 4RNRA 1QQDB 1KBWA 4YBLB 5D8JL 1XF5A 1QLRB 3P11H 4G6FD 3QPQC 4M4RB 1REIA 3JQOB 5E8NB 5C0BD 4UIMA 2KZ1B 4YS4A 1AXIB 2G5BA 2X1QA 3GZKA 3PUCA 1A9EA 1J0YA 2R0KH 2WKLA 3DXAB 4BWWA 3A67H 2ETWA 3E9TA 1WA2X 2VZVA 1SDDA 1FPTH 3AG2B 3MNVB 2XY1A 4KK5C 2CRIA 2CNZA 3BPLC 1SDAB 3EZJB 4P2QD 5I1JL 1S9WB 5C08B 1LO5A 4ZT1A 4ES9A 5DTFB 1GR7A 3GKWH 2JH2A 2QSCL 3D1MC 2DY2A 4R97C 3SCMB 2J20A 1CGSH 4WI0A 3T8XB 4NO0A 5T5NF 3UBXB 3D3VB 2IFFH 3G5WA 2V8LA 1L9SA 1RZFH 1MDAA 2DN7A 2HVJA 4K8RC 5E8DH 1ZEAL 4I0KA 4EIBA 1BAGA 4YZWA 4ZMQA 1MEXL 4N6QA 2VZ3A 5C0NC 1USZA 1JVKA 3EH4B 3T3PB 1A3QA 2Z34A 3FN9A 4ONHB 1WHPA 3QS2A 4NQVA 1S8DA 1SQMA 4M8RA 5CP3A 3STZB 1HQRB 2VZUA 4P59L 5F71A 4NKQB 1YMMB 4HIHA 1BJ8A 4HS8L 3L4CA 4MCZA 2WZAA 2XTJE 3QCVL 2ESVA 1A4JA 4U3SB 2RHEA 4WRLA 4PJHB 4EZKA 4LSPH 4YGVA 3LJ3A 1BOGB 2ITFA 2Y5TB 1F45A 5DJAA 1MF2H 3C9NA 3QO1A 4FFTA 1JD9A 2FJGB 4NUJB 3OX8A 4TUOB 4G8GD 3LB6C 5C86A 3AWEA 3IU3B 5DRWB 4QRSB 1FNFA 3S4SA 1KB3A 5IW1A 1EO8L 4JRXB 1E5BA 3JV4A 3C5ZB 4Q74A 1DN0B 1V54B 3D85D 2FJUB 4GY4A 4ICXA 1L9OA 1BAFL 2YUWA 2EIJB 1YEFH 1ZT1B 4Q89A 1LTXA 2V3DA 3IN2A 2MSPA 3VTAA 2VDNH 4JVUA 2J6EL 1GOHA 3MLWH 3G7TA 3L1OH 5CD5D 3K81A 4CAGA 3VFUA 4QDGA 5D7JA 4MGXA 4K23L 4XNZB 1QSZA 4D9QD 2D31A 2PYFA 4PU2A 2VSCA 1SF3A 4J4PA 2V3FA 5F70A 1KSRA 2NZ9D 4HPYH 3VFVA 5C09B 2UZYB 2B3IA 3QEHB 4OZHE 3AT0A 4QO1B 4PRHD 5E6IB 3ZSTA 4XXWC 4BFGA 3KYMA 4Z7IA 4HW6A 2Q76A 4LSSL 1RLWA 5HPOA 5EBLA 5B4MD 3DROB 1Q0EA 4FNQA 2UZXB 4NC1C 4IKNA 3QDGE 3L95A 4YDVA 1GGCL 4KJYA 1QKZL 5L2JA 4POZC 3CZGA 2X10A 5FF6A 1O6VA 4AKQA 4V1DD 5F7BA 1C16A 1DDHA 4YVNA 1BZDA 4NI6A 4F7PB 5C0BE 4FQ1L 1UH2A 3K1KC 4U0RB 4N1CA 2KZBA 4Z3TA 5GZOD 4FG2A 1KENL 4HJSA 4C4KT 3QFGA 1OSPH 4YSAA 3KGRA 2J1YA 2HFGL 2J1ZA 2PN5A 4X6DA 5F1SA 1PZCA 1BX2A 2K0RA 3DVNA 3IF1A 3NDYE 4GP5B 4OZHA 4YWGL 4ORGB 4YDJB 4P2QE 4F9PC 3R7RA 5A40E 4X42A 2W1NA 4DPCX 3AREA 2K8MA 3R06B 3WFZA 2NY6C 4QGTA 3ABLB 4JUTA 1IL1B 3PGCB 1BVLA 3Q8FA 1KCUH 4JREB 4KKBC 3LMJH 3HUJB 3K71A 2A74B 4HF5H 2X9WA 2HVBA 3DMMB 4LARH 2V7NB 3VFTB 4U4IA 4OB5H 1MHPH 1I8KB 3FT1A 4U6VL 5ILTL 5B8CB 3WY4A 3ZL4H 3SO3C 1UXWA 4LEOB 3F64A 4GPVA 4DN4H 2I9TB 1R5IA 4EUPB 5I1GL 3PYCA 1LYQA 4NN5B 2GBTA 5ABZA 3ULVL 2B4CC 4HUMB 3GRWL 4HT1H 4Z7WA 4DP5X 1Z9LA 4Y4FC 5EO9B 5ADOL 4PJXF 4ZD3L 3GBEA 3MTXA 2ZOLB 4P2QA 2GJ6D 2WPGA 2GFBA 2FJHB 5GJSL 4G8GE 1G7LB 3OQRA 1P9MC 4F58H 4Y9BA 4CRPA 4PRBA 3V4PB 1T03H 1XSOA 3KLAA 3V52H 2YQ2A 1P4IL 4WUKL 5J3HC 1GTFA 1B0IA 1CTMA 1XAUA 3DJZA 1FNAA 3DHUA 1X3DA 4DZBA 3ARGD 4GBXD 4BSVA 4B97A 1RIHL 4M7KL 4NZUH 2NLJB 1E4KC 3ZMEA 4LQFH 1RH8A 4S2SB 1X5IA 3ULVD 1JVLA 5AUMB 4DQOH 1ZOXA 4WKZB 1I85C 3UCQA 4D9QE 3BUTA 1AACA 3UZQA 5F7DB 2G60H 3G5VB 4LDEB 4PD4J 3KPQA 1AI1L 5ICZB 3L13A 1Z32X 1Z9MA 2EZ0D 2DWDA 2X7LA 3GUFA 4PRHE 1G7PA 1N19A 1IAOB 3ZHFA 3RGVB 4PUBL 5DEGB 3BN9D 5GIRA 3FPXA 3Q6GL 5MEQB 4XP5H 3RDTA 3KNBB 1PG7W 3D85A 1XD0A 1OTUC 5AD0A 2BP0A 1S9VB 5F7MC 1J5OL 1D6EA 2IC2A 3IFOA 4RMTA 4KXAA 2DW5A 3GLDA 4XAWL 2QVFB 3M17B 4RRPG 4H1LB 1AGFB 4HJ0C 1G7HB 1X4YA 4KROC 5IVZB 2M26A 3SDCA 3FYIB 4V1DE 3WY1A 2EDKA 1FZMB 4KZDH 1M57B 4BK4A 4K2UL 1KJ2L 5DUMH 2IGTA 3RUGA 2F53B 3CHOA 1VSCA 2EABA 4WUUE 4X4XB 1RZIA 2EVGA 4GB9A 5E1AA 5EZJB 2IH8A 5F9OH 2Z8SA 3UPRA 3SBWC 3PABB 3ZYIA 3DUUB 4PRHA 4XE5B 4OQTA 2CGRH 4HCRL 1KEGL 1KXVA 5D2LE 4N68A 1T21A 2Y1ZA 3F84A 4WHYH 5BRZA 3TC9A 4N86A 2H3XC 1J5IA 3X11A 2J4WH 1QFUL 1JZ8A 4HV8A 1ZANH 2JNZA 3HN8A 4ZTOL 4UCFA 4MX7B 4TUUA 1GZHC 3M1BA 3SKMB 4A7UA 2ZJSL 2J6EA 2LAGB 4HFUH 4E9YA 4JY4A 4F8QA 3SD2A 5IEKA 1KELH 2MHAB 2N0KA 5D1QA 5BVPL 3VD2A 4ZZKA 1F11B 1SMDA 1X5HA 2ZG2A 1OAYH 4ZMNA 3TM6A 3BUIA 3QO0B 4UBDC 4WUUA 5EC2A 3MMEB 5CIPH 1FV1A 1URLA 1DDTA 1XR9A 4GNKB 3PHOB 3OKNB 4FA8A 1A4KB 3ABKB 4RH4A 5F8QC 5GRJL 2VQTA 3BPOB 1S7XB 5D2LA 3WSQH 4GKZA 3P3YA 2R2HB 3HNVH 3GTVA 3ROLA 1LL1A 1PF3A 4R0LA 1JNLL 4TVPH 4XVSL 3K4ZA 4MLSA 2N3JA 4CC1A 3V0VA 4U1LA 5AW0B 5GISL 2ZF8A 4XMLH 4DOHB 3AMLA 1WO2A 4JFSA 5AYUH 2UVEA 3NIFB 4KRLB 4NM8H 3LRKA 1D5BB 2XV2A 2QDWA 2LHAA 2A6DB 3IPFA 4XWOD 2ZOKB 3W9DB 3UBXI 3ULVE 5FDWA 2BOCB 4O4YL 4JHWL 4IBVA 1NGPL 1Z0MA 1A6VH 2IOMA 3D18B 4GLRI 5IGXH 3O11A 4KAQH 1MCJA 3FQUB 4F2MB 4LRNL 3RWHA 5FV1L 3VWJC 1MJJB 4KTEH 4UIKL 4IBYA 5H4ZA 4EIZC 4PJFE 4NO2A 2PXYA 1XGUA 4P5SA 4X9HA 3TWYA 4NQXB 3QJVB 2X9YA 1V7NL 2ZIDA 4N0RA 4KJPD 3ILQD 1A47A 1PEZA 2OMVA 4K71C 4HGKC 2E7HA 5BXFB 1L7IL 1I9RH 2HJFB 1AY1H 1F1AA 4HDIB 5FR3A 1UKSA 1IQDB 2JXMA 1CLZH 3KWUA 1G7MA 2CIIB 1XIWD 4XVJH 4PAZA 3JV5A 4DP8X 1M7XA 5GRXG 5FUCE 3UTZB 1Q8MA 1S3KH 4BK5C 2C7UB 1DP0A 2KUTA 3IDNA 5CGYC 2KDGA 3C12A 1RY7B 3V7AE 3G5ZA 2WUBH 5HJ3B 5LXGL 3ZYOA 3L08A 1MPAH 2D4DA 2HPTA 4PJFA 4R4BB 4TVUA 1SMAA 5TQ2H 5CJXA 2F5BL 1NLBH 4C83B 3NFSL 4NX0A 2DMCA 1NAML 5K9OB 1MRDL 4D7BA 2ZXAA 3OGCB 2LTQC 4PVNA 5JHLL 3JXAA 3P40A 2QFRA 5C9KA 2G3MA 1TZ8A 1B2YA 2HRPH 2OTWB 3QUKB 3MV8D 4TQHA 1T89C 2DQJH 2R83A 4H0IA 1A7NL 1EAQA 3FT2B 3QUYD 1THAA 1G84A 1KB9K 4WW2F 3WFEL 2NXZD 5T5FL 3RZWA 4JANA 3HMXL 4BUHA 4Z95L 1K72A 1DHKA 3OB0H 4N90D 4OGAD 4GRMA 4MDIA 5TF1L 5A7BA 3GMOB 5FWRA 3HPJB 5D1ZI 3OZ9H 4F8TA 4NPKA 2CDEA 5A2IH 4Y89A 4JZNA 4PCYA 2K9FB 3NEOA 5L4FA 4KOBA 2EXTA 3DTDA 3N41B 4MQXC 4ZK8A 1BZEA 2UVFA 4WNSA 4JKLA 5BUGA 4UNUA 2P8LA 3OXSA 4OGQC 1BW8A 2WVSA 4H13C 3LS4L 3X3FH 1AD0B 4PRPD 2AKRB 1EAJA 4YHKH 4BKLA 3EFFA 4P2YA 2QR0A 3GHBH 5L2KD 2J7LA 4KUCD 2EKSB 5I19L 1KJ2A 4FZEH 3S36L 4PPTA 3DK2A 1T80A 2CGZA 3CU7A 3PHAA 5IB5A 1ZA3B 2F7RA 3PJNA 3Q13A 4PVMA 3GO1H 4FI6A 3EOBA 4WO4B 3O9WA 2E7LA 1G0XA 3R0MA 1CXIA 3QDMB 4M3JA 4L5FL 4FNLL 1SLUA 1HEZB 2D9QB 4MB5A 4Y5YB 5EU7C 3CXFA 4CW1B 4AM0Q 3LXAA 3FT0A 5AAWC 3Q2CA 4PJGB 3BWUC 2NW2B 2V2XB 4P2OD 3WLWC 5BV7H 2W60B 3UX9B 5E7FA 2NY5L 5HYIA 5KSUA 2WN2A 2IV9A 1D9KD 5D71L 4XHQA 4K5PA 1U8JA 5FECA 4XHJD 4FA6A 3P4MA 1HQ4B 2QHRH 2BMKA 2B2XL 4P9HC 3GSUB 2HCZX 4NT6A 5E23A 2F15A 1YPZB 1GZQB 5AVWB 3UEZA 3GJFA 1FCGA 3LH8A 5FYJL 3T0ED 2B59B 2IBBA 2X4NA 4OZFA 3N1PC 4GRLC 3SDDA 4WSKA 3B2DC 1NM4A 4I4WA 3O3AA 3UTPD 1MUJB 3I74A 1KXHA 2H0FA 2W07A 1HL8A 1R46A 2UXFA 2QVMA 3P73A 4HSQA 4JDEA 5AYQA 1BQHB 2CO6B 2Y5EA 5DZVA 4WSGA 5EOTB 3IETA 5IVOA 1VJSA 4ZRGA 4GSXA 3VXRA 5DT1L 2EC9U 3MDJA 4ZNCD 1YEGH 1QSED 2FHBA 3THML 3ULUL 4NO5A 2EDYA 5FGRA 1GYWA 3RILA 3RBGA 3TBTB 4BM7A 2ZUYA 5CEZH 1HJCA 1A66A 3MRGB 2WWOA 4ZTPL 1ZLUK 1EX0A 2OV0A 2E7CA 1MWAA 5CN1A 3ZTJG 1BFSA 4KO5A 4P57A 5FYJD 3VRLF 3W39B 4N90E 1TVBB 4MA8L 1CE1H 4A7GA 2W9EL 2Y6SD 3DUSA 1AQ8A 2WVTA 1SXCA 3U46B 1P2CB 2AQ3A 1FZJA 2QBWA 3B9KB 3WNOA 3K74B 4KJWD 4NAMA 1T1YA 3OKEB 4O02B 1FG9C 4XAKD 3UO8B 3SY0A 1YEIH 1DQQA 3CN3A 4FXKA 3VD1A 1UVQB 1WT5A 3QIBB 1DQJB 3VI4F 3WEBA 5TE7H 3WJJA 4YSEA 4KKQA 4PRPE 3ULUD 2A9DA 5L2KE 2MCPH 5IJVA 1A6ZA 1UB5B 1XH3A 1FE8H 5IFJA 1MZZA 4NQCB 3MRQB 1KGUA 1INQA 1GPOH 3RX8A 3MREB 1K2DA 1TTBA 3KPOB 5GS0L 2DWSA 2XG5A 4O2EA 3EJQA 4IBSA 3EYOA 4LXFA 4ZMXA 5MHSE 3WGVB 1YHPA 1TO4A 2XQBH 1DVTA 5AW3B 4HEPA 4K7FA 5EEWA 5IV2B 2C4FU 4KY1H 4TS6A 4V2BA 3L54A 2ADGB 3UPCA 2JB5H 2RACA 4YDNA 4HXBL 2FTAA 4AMWA 2VC2L 3DRQB 3DX6B 1NCDH 3AXLB 2HJLB 1Q9OB 3AAZA 3BZFB 3T2OA 2CZNA 2W9DL 1E5ZA 1LDPH 2YBGA 3HZKA 4O2CA 2ZICA 3QHFH 1MCSA 1MCIA 1IGIL 2I27N 5SWZD 3HMXA 1F6AA 4ODVL 1EVTC 1H15A 2OULB 2RGSA 3B1UA 2NNRA 4JJ5A 3L2NA 1KIRB 4LCYA 4TVSa 4TNVK 1FIGH 5GS0D 3IMBA 3PP3K 1PEWA 4C56D 1NC2B 4PJ9C 1D5RA 4Y4KC 3T0EE 5E9AA 4YNYA 4L5FE 1ZGLB 3VE0B 1FJ1B 5I26A 4G3YH 2IG2L 1I3RA 2Q86B 2JK5A 3M7OA 2ZD0A 1YCSA 2IBGA 5L0QC 4MBOA 5JZ7D 2C9AA 1VEMA 4FFYH 3UTPE 2XJKA 3CFBB 2K70A 3LXBA 1B6DA 2ZE0A 3K6DA 3MZGB 1N6QL 3F7YB 4F91B 1SMOA 4QR7A 4D0CA 5C0FB 4HS6B 4ZUUB 1TJHH 3TBWB 1I8IA 4AIXA 3L3JA 1BQLH 4ANUA 3H4FA 1NCBH 2O5YH 4LASH 5MP6H 1C7SA 3C2AH 4DAGL 3UC0L 1BOYA 2CMRH 3LPWA 4GMTL 3SPGA 4PEEA 3VNYA 5FYJE 3WKNA 3NIGF 4FQQA 4OF8A 2H3NA 1UD5A 3LKNA 4JZOA 4ZQKA 2Z4TA 3RZCA 2CO7B 1XF5B 1GRWA 3T0VA 4JN1H 5BW7C 1HS6A 4P5KA 3IGLA 1AP2B 2YZ8A 4S1QH 1ZT7A 1B2WH 4UT6H 1A9EB 3HMWL 1QO3B 3Q0HA 4NNPH 2G9HB 4KU1A 1QPXA 1G0YR 5JO5B 2NXYB 3DLQR 5HI4C 3IFPB 3UXFA 3ARZA 4DZ8A 1GS8A 2CO3A 2GBVA 1HOCA 5J7CC 1OB1B 3WS3A 1ZHNB 3PV7A 1LP9E 2FO4B 3Q2VA 1UXLA 4AIOA 3ULUE 4ZI8A 3B83A 5F9WC 1MCOL 5F96L 4XP4L 1YMHA 1G7QB 4NO0B 2MCMA 1Q72H 4GRWF 1P4LA 2AJSH 5EO0A 4CSPA 3QJRB 2WLYA 3RG1C 3BYYA 4GAGL 4QNPE 1LK3H 4XC3H 4AL8H 4ZODA 3TV3L 4HIIB 1RZKL 4I77L 2WW8A 4NQVB 1S8DB 1UWFA 3QEQD 2QLVB 1W80A 5F72S 2Q6WB 2ARJQ 4WNQA 4DK5A 5EZIH 1FL6A 4HIHB 4UQ9A 3WO3B 2CBOA 5FUZH 5H4YA 2I7SA 3OMNB 2NY7H 3AJ7A 4AUUA 5DEFA 2FQFA 2LLNA 5D1ZA 3AG4B 2EYSA 1B9ZA 3C9NB 3FO0H 4QD2E 3IK2A 1MXGA 2Q87A 4C8XA 4DEWA 5BZZA 3S4SB 2PW1B 5IW1B 4APXB 5SWZE 5I18H 4AIZA 3OJMB 3FQRB 4X9GA 1J11A 1U36A 4LO9A 3P9MA 4NC2B 5K9JH 1RD6A 3TIDA 3K6FA 3EYVA 4C56E 5KYUB 2R23A 4R96B 3GZQA 4JGMA 2D9CA 2X40A 4AE0A 2FATH 4NRYA 2EADA 2MTAA 1J9CT 3UG4A 3PREA 1FO0A 3SOTA 4YHLH 3RGHA 2AW2A 2XTJB 3LH9A 3GBDA 1GC1H 2D31B 1F6FB 1KLUB 2ITCA 1MH5A 1DJHA 2JJTC 3WENA 4AJWA 3NCEB 1I7TB 2FO1A 3WN6A 3LN4A 4FS0A 4LOUC 2CO4A 4BZ2H 4R2GB 3V0DA 1YY9D 4R5VA 5LGHL 3KYMB 1O6TA 1Z5LA 3MRPA 4IRJD 1C5DA 2YD3A 5EBLB 3PNRB 1QZNA 7FABH 2Q7NA 2IQ9H 2EKJA 2XA8H 2WO4A 3ECUA 5I74B 3N43F 4YDMA 2MNJB 2OMNA 2XBZA 3ZJAA 2GC7C 1ADQH 2OL3B 3IRZA 4KJYB 2YOCA 1OSZA 4RWYL 1L5GA 2LU7A 1GVIA 4WEEA 5FF6B 4ZFQA 1CD0A 5KZCD 5ACZA 5IIEA 1DDHB 3L17A 2YK1H 4S1SL 4KK8D 4OU3A 5EU6E 1TZGH 3GSRA 4Y16D 1J5HA 3C60C 3L9BA 3MUGA 3VO0A 3MLVL 2VLJA 2OKMA 3RIKA 2OCFD 4X6DB 1A6AA 5E70A 2MEJB 1GIGH 4OZHB 3IDJA 4WWKB 1KEMH 1PD1A 4GG6F 3FO2B 1LO0L 3ESOA 2BVQA 1QHPA 3AREB 5F89A 4ZFZB 2ZCKL 1JZHA 3AABA 3JV6B 4KK6D 1IM3A 3DECA 5G4NA 1ZAGA 2HG5A 1DFBL 1TO5A 3QDGB 2Q9OA 5HYFA 2NY1D 3M07A 2K78A 3PWUA 3IDYB 4HJGB 4XB3A 5CJQL 3VI3E 3BVXA 3OR7B 2VDOH 3SGKC 4G6FB 3VGAB 1UXWB 2EH8H 4XOBA 1HHKA 3QEQE 3S3BB 4N2HA 1V5JA 2JWYA 5C0BB 4ELMF 5EU6A 5GS2H 2ENQA 2X38A 4FXGC 4A55A 4X5WB 5TQ0L 4IOSA 3VD9A 4LEXH 1JMZA 1ASOA 3TGXA 3WXVL 3FL7A 3F6JA 5AZUA 1IJNA 3CXHK 4P2QB 2X9ZA 4IEFA 1ZLVH 2CHDA 3RNQA 1JFQH 4M6NL 2WSDA 3AITA 2NDFA 2KPNA 4NENA 1NAKL 3WTTA 1RULL 5IHZB 4AQ1A 3GSNH 1PIFA 1E3FA 2FK9A 4XXCC 5JPNB 1FFPA 3LSOB 4X6CF 3K6IA 3TCTA 4DZBB 1MI5A 1IC7L 1IQWL 4G42A 2VABB 5GRWA 3QEQA 3SDAD 4WTZG 5JNYA 5B7MA 1J05B 1OE1A 2FDBP 1UOLA 5L4MA 2NYKA 1RUQH 1W2KT 5KVDE 4PLKC 2Y7LA 5F2FA 4PLNC 1B4LA 3UZQB 5HHQB 2W59A 2Z31C 3HRZA 1N5AA 4LDLB 4LSUH 1OAUH 1T0PB 4I3GA 3TS8A 1NDMA 1OO2A 4JO2H 3K0YA 3FW6A 4FDWA 4UQDA 3O6MH 2X7LB 3EYQD 1G7PB 4G8GB 1IBYA 2NY0D 4N6RA 4BKTC 5LWYH 5I6OA 2OR8A 1TCMA 3MI6A 3D85B 4JMXA 3TPKA 2R9HC 5AALA 3U0PA 3RVUD 4RDBA 1D6EB 4A7VA 3GT6A 3NSCA 4G8FA 3V0EA 4NS0A 1J0HA 4YDLC 4J3OH 3GSOB 2F19L 2QQNH 1CXHA 2R0WL 2AK4D 3FRPB 15C8H 5LCVA 3SDCB 4IMLB 1UT9A 2VMDA 3CLFH 3PLYA 4MWFB 3BLKA 3NZHH 3B8YA 3MBEA 2YMXL 4FAAB 3N1FC 3GM0A 3GUTA 1UD4A 5B3NA 4XMTA 1PZUB 4FG0A 4RX4D 3E1F1 4E9XA 4YC2B 4NHCL 5FA4A 1YEEL 4PRHB 2FYVA 3DJ9A 3HFFA 3QNYB 1T21B 4NIKB 4XNYL 2WKGA 3LZOA 1FCCA 1KCVL 3NQKA 3PV6B 3LPFA 2Q8AL 4QXUL 3WCYA 1D5XA 3F85A 4HV8B 4Y8DC 4MNGE 4X7SL 1TMCB 5GHWH 1JZGA 1NBVL 3H3BC 3M1BB 4WZ9A 3VGGA 3ZE1E 4KUZL 4V1DB 5IEHA 1PZDA 4YO0A 3IJ7A 1YQ2A 1UGNA 2G3ZA 4QRBA 5C0RH 1IO4C 3AW5A 1HN1A 3DX8A 4WUUB 5F88A 5IWLC 1FV1B 4CVXA 2NRDA 2WIMA 4U6HA 4ZW6A 1E8XA 4XP1H 3RB7A 3ME0B 3TL5A 5CCHE 5H2BB 4ODSL 4WU7A 3ESMA 2WV3A 3S98A 2Y3NA 1DBJL 1G9ML 4J7RA 2ZXGA 5CZXD 3ULSA 3ARBD 4AYID 3VFNB 5D2LB 3VU2A 2EACA 4GKZB 3T6QC 2WQSA 2ZOOA 3NIDB 4ODWA 4OJYA 5FK9A 1Z66A 2JJSA 1UOVA 2DJMA 3ROLB 1FVDA 1M2VB 3HRPA 2XN9D 1QEWA 5CUSH 2OP4L 4WFED 3VFGL 1R75A 3SHSA 2MOQA 3KAAA 3V0VB 5EN2B 5L7XH 4PS4L 4OF3A 2M2DA 5KJRL 4ANWA 2HZHA 3BAEH 3T0BA 2P8MA 4PWGA 3CDCA 4GOSA 3EH3B 1MNUL 3NT0A 2DQFA 2GSGA 4OCYL 5DUBA 5FDWB 1DVFA 3IJ9A 3HBZA 3B5HA 1J0IA 1NWPA 1WBXA 3BX7C 4J8RB 4HG4K 1UKQA 2IPKA 3VFPA 4FQJL 3RWHB 2L4OA 3RJOA 4AW4A 1FRGL 3RNKA 4PG9B 4LLAA 1HAUA 4B7LA 3AQYA 1LVEA 3VYOA 4QHPA 1NL0L 4X83A 2BVEA 1L0XA 1PG7L 2X1XR 4G6AD 4XNZC 1MRFH 2OMVB 2ZUQB 3LD8B 4NWTH 2HKFL 1NGXB 2FQDA 2FQGA 1X5ZA 5IKCA 2ZYIA 2B1HL 5BZDA 5C9JA 2MQGA 1QTSA 3RX7A 4GBXB 4NPYB 2AK4E 3BAXA 4G70B 3SDAA 5AFAA 5JORA 5CP3H 1MLBA 4X6FA 1WFUA 2IAMD 5CEYA 3TO2B 3WTXA 1IGCH 5ISZA 1CMOA 5EIQA 4JBSA 4CL7A 5HHVH 4PQXA 3KVQA 3ILEA 3P3TA 3H9YA 3OF6D 1DQIA 1KN4L 2IADA 5C0GB 1PQZB 2HRGA 4M7LH 3EJTA 4HK3J 4BQ8A 2EDWA 4PJFB 3PGFL 3H0TA 3HG1D 4MKTA 2D73A 3QZBA 4GS7C 4EXPX 4U0QB 2DQDL 3DOIA 1P7BA 1TQCB 1AGBB 5DYOA 3SOBL 4J3WA 3FHAA 5IREA 4LAQL 3MNWA 4GXUN 1KTBA 2XKNA 4HMDA 5I1KL 2A4ZA 3WY3A 3GSVB 2AK4A 1XX9C 2DL2A 1YNLL 4YR6B 3HE6A 4JG1L 5IK3A 3E8UH 4PJ5D 4JREC 4QHLA 5EIIA 2CLZA 4I18A 2F8IA 3O4LA 5FCSH 5BV7C 5CM1A 3WAJA 1WZMA 2HJKA 4P46A 5HVHB 4LLYA 1OTSD 2H0EA 1J8HA 4GRMB 2WYIA 3V5HB 1MAJA 4HWZA 4EEEA 1FZKA 4IHOB 3TVMD 1JTTA 2CK0L 4N0FA 5IMMA 1NCTA 3NCMA 2NY2C 2ZAIA 4K15A 4QI3A 4UB0H 2E27L 1KB9J 4YAQA 1O5PA 2XN9E 3C6LC 3GIZH 4WFEE 1D5IL 2QEJA 4RZKA 1CIUA 4MXVE 1N67A 4Y9EA 3T4AA 1DBML 2XZAH 4BKLB 4DGIH 3NPSB 2AEWA 2FX8H 3EFFB 4WW1A 2WSPA 5FO8B 3LKSA 4FNPA 5DURD 2D8KA 4FN0A 5ICXB 4KKPA 4NQEA 5ICYA 2D3JA 1KJ2B 2GJJA 4P49A 3GMLA 2A73A 1M7DB 1FIEA 3FTSA 4OZIE 4JM4L 3IMVA 3S3SA 4G6MH 3O9WB 4JKPH 1IFHL 3DJRA 2EAEA 1ZV5A 4U4BA 4L3ED 4AXWA 2YPVH 3VXUA 4U3HA 2XWCA 4UM8A 4PHXA 3IFLL 4JKNA 3UIYA 2BNRD 3RVWD 4Y9FA 2IPTL 5AZEL 2A0LD 1NSNL 1CLCA 3AZUA 1E3XA 1UKTA 3MLRH 3SGJA 4AEHH 1AHWB 5AKSA 5KSUB 1QFWH 5IR1A 2ZWSA 1DJWA 4B96A 1KV7A 3BKJH 2WMPA 3TA3D 3DYMA 2WC7A 1QFPA 2C3VA 1B4JL 4U1GB 3P4MB 2BY0A 4JKKA 43CAA 5AW5B 1RZJL 3HI6L 1A8JH 4EDWL 4OLEA 4OLZL 4UOW0 4HHGA 5HI5D 2YEVB 5SWSA 1HZKA 3GJFB 4PGZA 2WKOF 4HKXA 4D2NA 4KPHL 4DIXA 5I1HL 2X4NB 4MCYA 4TRPL 4OZFB 3EJZD 3T0WA 5D4HA 2VR8A 3N2JA 1WS7A 4ZX6A 2DQEL 3HG1E 4MSWA 3B37A 4A63A 2JCCF 2W07B 4W6YB 5F44A 5IFHH 5J4MA 1VFAA 3L7FA 5C0IA 1N8ZB 1M71A 4LPWA 2HKHL 12E8L 3S88H 4HUWB 4YSCA 3X1FA 3HTLX 2VR3A 5AVQB 1L7TH 1XIWB 4Z7UF 5H8DA 3Q5TA 5L6YH 3S2AA 4PJ5E 3VA6A 5HYSA 3H9HA 4QXGH 1HZLA 1BQSA 1NMBH 3SKJH 1MWAB 4E9SA 5J6HA 2J88H 3DUSB 1DQLL 4NSKA 3CHPA 3IXTA 4BGLA 1JOIA 1J10A 1FZJB 5FKAA 3RL1A 4E68A 1NGQH 2P1YA 2ZUTA 1TPXB 2HT4D 2F0CA 5HDQH 4MJ2A 5IROA 4HLJA 4Y4HA 3NAAL 1DQQB 3SY0B 4PGEA 4IKJA 4JG0H 5TTRA 1PYWA 3H42H 1SZNA 2R4RH 3BPOC 3QRLA 2CHXA 2K3TA 4NWUH 3FB5A 1JNNH 1YN7B 3QUYB 3N5AA 3NFNB 5DDHB 5IJVB 4PJ5A 4L1LA 1KXTA 4BHUI 2NXZB 3NJIA 4HISA 4FFZA 3INUH 3GRGA 3S3JA 3NDZE 3QI9C 3GI9L 4F7MB 1IGTA 2PWGA 3TEYA 4ZW7A 1EJOL 3CX5J 2XG5B 4O2EB 4PLOB 1RIVH 2Q7YB 3EYOB 1ZJBA 3NJFA 3KPMA 4JO3H 3KCWA 4OQTH 4L3EE 2VXSL 3S9DB 3KG5A 5IJKA 1MJ8H 4AZUA 5JXAH 4LNRA 3JVGC 3I9GL 3IMRA 1MOEA 2BNRE 2XIDA 1MCFA 3QH3A 1BLIA 1R3JA 3DIFB 5D7SL 3Q9QA 4YUEH 3IAPA 4HQQH 2GYSA 1T20A 3REWB 1BMGA 3AAZB 4PRPB 1A0QL 1FLRL 4O2CB 3ZBMA 5DZAA 5L2KB 1QFWM 1OEZW 4PP2A 3RTLA 1USQA 1F6AB 4BDVB 4IMKA 4WCYH 3D07A 3MRJB 4Y2DA 5EUOE 5HI3C 1GXEA 2DJUA 3QEGL 1R3KA 3MJ9A 3FJTA 1W0VA 2YGPA 3TO4D 3IDGB 3PAYA 1AXTL 3HW7A 1A7QH 5MEPA 2NTSP