1FDLL

Crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYYTTTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA D1.3 FAB (LIGHT CHAIN)
publication title Crystallographic refinement of the three-dimensional structure of the FabD1.3-lysozyme complex at 2.5-A resolution.
pubmed rcsb
source organism Mus musculus
molecule tags Complex (antibody-antigen)
total genus 52
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1990-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlL01
2CGRL 4NHUA 3CMOH 3ARFC 4FQ2L 3B8SA 3UTSA 3QUMB 4BA8A 3GNMH 3MLVH 5I8CB 2GUOA 3FB7B 4ODWB 2YK1H 2WMPA 4ZNEA 3LEYL 4Y2DA 4HJJL 3EOTL 2Y7QB 4XB8A 5DQJA 1WBZA 3BQUD 3BIKB 4RWHA 3W82A 5CJXA 3OB0K 4HIHA 1N4XL 3U83A 2Z9TA 1V3LA 4H26A 4UT9L 1YY8B 2EDYA 2EICA 4NO0D 3MOBH 4CNIA 5GRJH 4QRSA 1EBAA 1OSPL 4LLWA 5GGTA 5JHDB 5A2FA 1A9EA 4WFED 1K9TA 3IDYB 2PYEE 1SM3H 2P47B 4P2CG 4LASL 4BJLA 3TN0C 3BD3A 3LN4A 4XNMB 1JGVL 4JY4A 1FIEA 4Y4KC 4CVWA 3FB6B 4Y19D 1F02I 3RDTD 3SE4A 3MGTA 3O9WD 2CJUL 2MQ0A 1SY6H 2AK4B 2XY2A 3LMJH 4GG8B 4JZNB 1CGUA 5IMOB 5KVGH 2VRAA 3LRGA 3CFJB 1EFQA 1NCWH 5IESL 1BD2A 2VN4A 5JW3H 1H8NA 2R29H 4G6AC 4YGAB 5D72L 4L3EA 4QRRA 2KZWA 1OL0A 2APXA 4Z7UA 1A1NA 4OZHE 5IMLA 4XMKH 1XR8A 1D5ZA 4AM0A 3QUML 5K9OB 1JZ8A 1XGPA 4WJ5B 2E7LC 4EN3C 1T20B 2A74B 5B3JE 3DV6A 2WM0A 1YYMH 1NGYA 3BPNB 4EI5A 1J1OL 4OIAA 4J8RB 4J1UB 3G08B 5H2BA 2XZCL 5HGBB 2RBLA 4APQB 3WL9A 5AWNL 2VDKH 3RVUD 3KJ4B 3BD4A 3J7HA 5CEZH 1JYVA 4XPFL 4GW4B 4JRXE 1CXLA 4FFWC 2X10A 5DQDH 4JFEE 2E6QA 4JZJC 1SJXA 2VABB 2XA8H 3T4YA 1KN2H 4KKBD 5IW3A 1T83A 2XFXA 3QUZB 2DJSA 1CLOH 1YC8A 1OAXH 5T5FH 4Z7NE 4IMLB 1RUKL 2FR4A 4LPYA 5A43C 1TJIH 2ZPKL 4MJIB 4ODVL 4Q6IB 4IOIB 1A14H 1JCKA 2AABH 4TRPH 3HE7A 1T5XA 1EHLL 4JFOA 5DJ2B 1RZJC 1S7VB 2HFEB 3SEPA 3MUHL 2DQEH 4WNQB 4OUUB 1XH3B 4YDVA 3GSUB 1F97A 1HSBB 3ZT6A 4XXCA 3PWPD 4OCXH 5INCA 3TJEL 1EFXD 3IF1B 4DN3L 1OAUH 3ISWA 3TM6A 2Z93A 4GMTH 2R2EA 3U36B 4QHLA 3LD8B 3PWUB 5K9KB 4JANA 3IU3B 5EPMB 3GSXB 2A83A 5T1MA 4HUNB 2NY3D 3MRPA 1FVCB 3TWCH 4LARH 4NKIL 5I1CH 2GEEA 4WHTA 3DXAB 3BQUC 1HXMB 7CGTA 9CGTA 2NQCA 1TPXB 5DJYA 5GRUH 5KTEL 1JTPA 5C0GB 2MKWA 3FQXA 1ZLSL 3BWAA 4K9EL 4Y1AA 1BIIB 5I1IL 5JQ6L 5LGJA 4YZFF 1J5OH 1CQKA 1Y18A 3NFNA 4PYHA 2DQJH 3FQNB 1E4KC 1JFQH 4PP2B 4NQCE 1A3RH 4QCIB 3AC0A 4F9LA 1MCFA 1ORSB 3D9AL 3HC4L 4KJWD 2BOCA 5KN5B 3NPSC 2QQLH 4DKFL 4I3SL 3PP3H 3QWRA 2EKJA 4NT6B 3I3EA 4OFYD 3U4EA 3O8XB 2I07B 5ERWA 1V7MH 5EOTB 2ZCLH 1U3HC 2D3VA 3V7AG 3VGHA 3PWNA 3FN0H 2XTLA 3T0ED 1MJ8H 2JE8A 3HRZB 5F1OB 1YNKL 2R9HC 4WTZA 4QKXB 3OX8A 4XAKD 1T03H 3I9GH 4OFDA 1DVFC 1N64L 3VFSB 5D70L 1CS6A 5IB1B 5KW9L 5B4MD 1A3LL 3TZVB 4GG6B 4DGYH 1L7IH 2BCKB 3HMXL 4JM2B 5DZLA 3TA3A 1T6VN 4QWWC 2FIKA 2YWZA 3R0NA 4NBYB 4XI5D 3ULVL 1JGUH 3VG9B 3B9VA 3RL2B 4YBLC 4JR9L 1BM3L 2W91A 3CJJA 5KOMC 4RMRA 5AUMB 4L8CB 4XVJL 4YHIA 4GRMB 3SJVA 3WXWH 1RZKH 3H0TA 2IQ9H 4HXAL 1HIML 3G04B 1IAIM 2EECA 3STZB 2FNBA 3HC3H 5B22A 1MCWM 3CZFB 4HKXB 2R0LH 5C6TH 1OW0A 1FNGB 1JMXA 3F7YB 5D5MA 4Y5VC 1IM9A 3QZWA 5BXFA 4K3JL 3D18A 4HAGA 43C9A 3VXNA 1DUZB 3GJEB 3VFMA 4JCMA 4RAUB 2C3XA 1VADB 1YEGH 5J8OA 2NZ9C 3CH8A 1FV1B 3ZHKA 2MHAB 4NQDB 1B6UA 3QWQB 1QSFE 3MREA 1MCJA 3CSBA 1KCUH 5E2VL 3MJ9H 2FX9H 3MLUH 1OM3H 1BZ9B 3C6SA 1PKQB 3NIGF 2NY0C 2Q7NA 1JGDB 5GSRA 3BEWB 4LNRA 4TSBH 3MA7A 2VZSA 3LPFA 3WUZA 1F58L 4ELMA 5DFVC 4HUXA 1BZQK 1OAQL 3QIUC 3SPVA 3U9UA 3MLTB 5IGXL 4LQFH 1SQ2N 4NFCA 5IWLC 4C56B 5EA0H 5ANMA 1RK1A 3KYAA 3FOLA 1VB9A 5T3XL 4FXGA 5I76A 3KPNB 5FCSH 3GMNB 4X4ZA 5IF0B 2XA3A 5SWZD 5TH2A 2VWEE 1T66C 2AJUL 3MOAL 2UWEE 4WO4B 3K8KA 1G6RB 1PLGL 3QO1A 3D85B 3OXRB 4IRJC 2IQAB 1IGIL 1G9MC 4MXQD 3TH4T 4KTYA 2D03H 1FIGH 4H8WH 3DVNB 1WQVT 1JWSB 3S35H 4MHHI 5CGYC 1DQDL 1MFNA 2NXZB 5CIPB 5BZWB 5F3HA 1RULL 4J3SA 3BAEH 4JRYE 2QJDA 1NCAH 2M26A 3MC0A 4HLZH 4DW2L 2A6DA 1JWMB 5ID1B 3UJTH 2G60H 3FHQA 3QCVL 4X6CE 4OB5L 1INEH 3M1BB 4I77H 1EX0A 1AIFA 1F4WH 1MHEB 3EDFA 2EEAA 5EBLB 4N8VA 1VACA 5TE4H 4P3CL 3MUJA 5DA0B 1Y6KR 5L9DL 4LCWA 2I9LA 3DX6B 4WTZG 4BZ2L 4ZAKA 1KSRA 2EIZA 4KROC 2D9QB 1GOFA 4RA0C 3VE0A 4M7JH 3UTSB 2Q87A 4PTTA 5F93C 5F7DA 2GUOB 4HCRH 1O7SA 2FEDC 1KB5H 1R3KB 4Y2DB 5JDSA 3EYUH 3U9PL 1M1SA 5SWQA 1FZOB 5DQJB 2PW1A 1WBZB 4GRLA 1E0OB 4HKJA 3IKCA 4HIHB 4UTAL 2OI9C 1DDHB 1HOCA 5DMGC 2ZCHH 2VDLL 1WC7A 4QXGH 4CNIB 4Q0XL 1FAKT 4LLUA 4QRSB 4ZPTB 4LLWB 3VRIA 1G6RL 1XCQA 3MBED 3EOBA 5FYJU 1IILE 1GC1C 1MF2H 5FOJA 1ZGLP 4IJ3C 3OXSA 1RJLA 5C6WH 1BLNA 3LN4B 4JY4B 3RI5F 3C5ZC 3VFVB 6CGTA 1RUPL 3QZWG 1HINH 5E94B 3S96B 2JK5A 2BXZA 2FL5B 2X4PA 2P8MA 4DN4L 3MGTB 2AK4D 1TTFA 1DLFL 1G7HB 1AQKH 3MV7E 4UINL 5F9DC 4D9RD 1LO0L 3KXFA 4AEIL 1E6OH 4OF0A 1BD2B 2F74A 4RMUA 2VH5L 1ZK9A 2ZUXA 4S0TD 4L3EB 4HJ0C 4QRRB 3DETD 3EYFA 1H3PL 4Z7UB 2X4SA 1A1NB 1HHGA 4X5XA 5IMLB 4OLXL 1UJ3C 5AAWA 3JTSA 1AGBB 1D5ZB 4XCFL 1VFAA 1XGPB 5CWSA 2BVOA 5D96B 3R8QA 1LE5B 3STBA 4NKQB 3TYGH 5CAYB 4EI5B 2XN9E 3GSQA 4Z7VA 5ISZE 1GSMA 2GITA 2PR4L 1SJEB 43CAA 3HG1E 3CU1A 4WFHD 5H2BB 2PYFB 4KK8C 1XF4A 2GKIA 5JIKA 5LCVH 3BUTA 5MHSD 2AW2A 4QOKA 4APQD 1F00I 2H45A 3NGBC 3UO1H 4P23A 5GGTL 4L8SC 4XVSH 1B2WH 3MNVB 2VLJE 3QHZH 5BOPA 1MFEL 1MRFL 4MQXC 5TFSL 3WFDH 4HH9A 2FJFB 3NN8A 4Y4HC 3ESVF 4GXVL 4DOHB 3MLPA 4XC3H 2W9LA 4YK4B 2EYTA 3HMWH 1DQTA 4X8JA 1DSFH 3PE9A 4WW2A 3FO0L 3QUZD 5GPRA 3RWCA 4PJ7E 5D1XD 1O7VA 4MMZC 2N4IA 1A6TA 3PP3K 2FR4B 1YY9D 1DEDA 2VITB 4AQOA 2V17L 3K2UL 2DQDL 3AFLA 4UOW1 2X70B 1Q9LB 1ONQA 1CFTA 3HE7B 1CLYH 1T5XB 4JFOB 4ZFFA 2GAZA 4W68A 2WWKT 4X6EA 4L4TD 4YDVB 2O93L 4F3FA 3MMEA 4DVRL 1IC7H 5DFWH 4N8VG 4JREB 1GGTA 5C0BA 4PV8A 3RIAF 4LVHB 5J1SC 1QP1A 3NZ8A 35C8L 4PJEA 1BJ1H 1FFOA 1CZ8H 3CK0L 4QHLB 2ZSVA 4G9FB 1ACYL 2CO7B 4IRZH 4UV7L 3VD3A 5T1MB 3RVVD 5BV7B 6FABH 4JFDE 1I85A 4R90H 3SO3C 1X7QB 3AU1A 4G6ML 2JELL 2QR0B 5IB3A 5DJYB 3D3VE 4N9GA 4KKCD 3BDXA 4Y5XB 5DZNA 3BMWA 4R96A 2J7LA 4AG4H 3BWAB 3QXDA 4NQXB 2Y36H 5F9OH 3SDYL 4FXKA 2XQBL 5LGJB 3TO4A 1G1CA 1TCMA 4LAJH 3L3GA 1BFSA 5T33H 4NUJA 3WE6B 4LRIA 3VW3H 2NY2D 3NFNB 2EH8L 2BFVH 4KQ4L 3QDME 4AQ1B 4MVBD 4ETYA 4C4KT 4OZGE 3O81A 3VXTB 3TJHC 3H3PL 1NCNA 3LPGA 3EJYC 3ZYOA 2R2BA 3EKCA 2OQJA 4D9QD 4XPGL 2DD8L 1Q0YH 3O8XD 3PGDA 3V4VH 1FNSH 3MRKA 3ARBD 4GRWE 2QTEA 4G3YL 3PWNB 4L4JA 4OBSA 5KSAD 5DJZA 3BPLB 3QJFA 3LH2L 2UY7A 4LHUB 1N7MH 3RY5A 2X4NA 3DSFH 4HMEA 3OX8B 4M43L 3CVHH 4Y4FD 4F37K 2RFXA 3GHBH 5BV7L 4KJPD 2OJZL 3E6FA 3HNVH 2C4XA 1YMME 1MQ8A 4Z7WE 4RWYL 3IU4L 5D7IF 3GMMB 5HDLA 5L7XH 3TA3B 1IT9H 5HHXL 5C07A 1JK8B 1NMBL 3T3PE 4PJFA 3D69B 1FLRH 4UB0L 2AV1A 1QFWI 5SX5H 4LFHG 1RIUL 4LSUH 3VGAB 1KCKA 5T3XD 3PF2A 1FNEB 1CGSL 1S8DA 1BWWA 3I75A 3IDJA 3G5YB 5IVXF 3G6JE 4TVPL 3UX9B 3SJVB 1S9YA 3H0TB 2J2ZA 4HBQA 2ATKA 3MROA 4DK3A 2ZUVA 3EBAA 1ZA6B 5FKPA 3GBNH 3VFTA 4F7MB 1U95A 1SY6A 1AO7E 2NXYC 5D5MB 3HB3D 1IM9B 4GXUN 3QZWB 3KLHC 1S7RA 3MUGB 1T7VA 5BJTA 3SE3C 3D18B 5BS0D 5DUMH 2XV6B 4GKZA 2VLME 2Y07L 1RJZA 3VFMB 3QT2A 5KBNC 1OTTC 1MREH 4M9OA 4NQDD 4HUVB 1CF8H 5AZ2H 1BPVA 3MREB 1UWGL 4ODTH 4WFGE 4Z0BL 3TGXA 2A6KB 3C6SB 3NH7L 5E95B 3BPCA 1DN0A 2OTUB 3ARZA 3EFDL 2HJKA 4LNRB 4ENEC 1DBMH 2CMRL 2C26A 3F6LA 5T1LD 2XZZA 1FYTE 3MA7B 4R7DA 1UB5A 5HD8D 4ELMB 3T8XA 5I1JH 4HUXB 1QFUL 1T7ZA 3U9UB 1FDLH 2DQTL 1CE1L 2H41A 3JUZA 4OM0H 1N2RA 5KAQF 1NCCH 1RK1B 3MLWH 5DEFA 3FOLB 5D7JA 1V3MA 4GSDL 5I76B 3SDDD 5C2BH 2JKXA 3GSVA 3QEHA 4GXUM 1V3KA 4KK6C 3WLWD 1I9JH 5H35A 2W9EH 2IFGA 4OTXL 5TH2B 4X9BA 3K0WA 2YKLH 4P2OC 1MCRA 1C1EH 3O3DB 2MJWA 1G9EA 2ZZUT 1WIUA 3U6RB 3D85D 3GRWA 3QO1B 4HQQH 2VJXA 3QCTH 2OJEA 1WLHA 4XPHL 1LD9A 5HDBE 4LLMB 2F58H 2F9BT 5E9DE 1I1AC 1Z9SA 4YHZH 3L3KB 2PW2A 2HT4C 2CXGA 5F3HB 3C6LA 5CCKH 5CGMA 5EORL 1F90L 2A6DB 5BRZA 3IFPA 1NLBH 2QADD 3G5VB 3IXAA 2LAAA 5E2WH 3RWEA 5KS9E 1TJGH 4G8GD 4Q9BA 4N8VB 5EO0A 1EBPA 4LCWB 2I9LB 1AKJA 3BE1H 5K93A 4ZAKB 4PJBE 1ZXQA 2EIZB 4J2XA 1FHGA 2A6IA 1JPGA 1PX4A 1WFOA 3L3OA 4C57C 4PTTB 4JDTH 5F7DB 1VKXA 5DWUH 4R2GB 4KZEH 4K3DH 5JW5A 5IR1A 4NO3A 5SWQB 2BDNL 2PW1B 2DWEB 3ZE1F 4QXTB 3U7WL 4GRLB 5DD5L 4HKJB 4P9HC 1F4YH 1HOCB 4MQ7A 3OJMB 3VCLA 3O6FC 5JLZA 1WC7B 2X41A 1A1OA 5FKAA 1XCQB 4OFVA 5FUZH 4MS8D 3NZHL 2VXVH 1FNLA 1OAYH 3OKNA 4LIQE 4H25A 1PW3A 1RMFL 3OXSB 1BLNB 1NAMH 2PTVA 1EIBA 1TJHH 1KELH 1L7TL 2NY7H 5I15H 1UM4H 2X4PB 4PJGE 3IFLL 2FGZA 2P8MB 1AQDA 1LDSA 4MA8L 1MJ7H 1YNLL 4P5MA 2J3SA 1SEQH 3ULVF 1D9KC 1MAML 2CR6A 4MCZA 3CPLA 2ZOLA 1QEWA 1BD2D 1I9IH 2F74B 4L3ED 4W70A 4YPGA 3EYFB 4N0UA 2X4SB 4X5XB 3OR7A 5FHAH 3LHPL 1VFAB 2DQCL 2BVOB 4PJIB 1BECA 4EI5D 4NO5A 1X4XA 3GSQB 2GITB 2I9TA 3KS0J 3PXHA 43CAB 3VXRA 3NFSL 1CG9A 4N5ED 3DLQR 4OGXL 1UM5H 1H5BC 3O4LB 1GGYA 2QHRL 4QOKB 3LKPA 5GIRA 3T3ME 4P23B 1MPAL 5HHOE 4OKVA 2YC1A 5IBLD 1HSAA 5CP3H 3WLWC 1UXWB 4HH9B 4IIQC 5F9WB 5C3TA 4IOFC 3SCMA 3QEQA 4EIZC 4TUKL 3NN8B 4PB0H 3ULSA 1DQML 4ZTPH 4HC1H 4KV5E 2ADIA 4FZ8H 2EYTB 4X8JB 2B39A 3BP7B 1QRKA 4WW2B 5IV2A 3WHE1 2YOCA 3RWCB 1M7IA 3LQMA 3KPSA 1FGVL 2WUBL 3SDAA 4HXBH 1A6TB 3GJFH 1UWEL 3O2DH 3UJIL 5HYIA 5DGQA 1C12A 4FQ1H 3MJ9A 1ONQB 1CFTB 3HE7D 3QFJE 3RWFB 3SBWA 2MNUA 4X6EB 1LVEA 1ODAA 2Z8RA 4DKEL 4N1HB 3MMEB 1JBJA 2JJSA 1OLZA 5DURB 4JY5L 4M5ZH 5C0BB 3RVWD 4PV8B 2DAVA 4J3XA 2IWGA 3MNWA 4PJEB 4MA1C 2Q6WA 3RPKA 3U2SA 2HTLD 1S7UA 2EXYD 2J8HA 1MCOH 2HRPH 3DI3B 4N0RA 2NTSP 5AAMA 3TT3L 5L88H 3AVEA 3KPTA 1J8HE 4OZFH 5K9JL 3WFEL 4PRPB 4M6ML 4RFOL 4PJ8C 3W2DL 5IW1A 4N9GB 3GGWA 4HMCA 5DHXB 1F2XK 1X5KA 2DMCA 4PYGA 4Y1AD 5F72S 3GSNA 4IRSB 4FXKB 3RU8L 3VWJD 4TVPD 3VXQA 4YBQD 3NA9L 4G6KH 4XPAH 4NUJB 4EI6A 4WI7A 4N0CD 2KZ1B 2NW2B 2ZUYA 1EMTH 1WJ3A 1LEKA 2EDWA 3GSWA 2OR9H 1RPQA 1KIQA 3AMLA 2B0SH 5D8JH 1KENL 5I30L 2YEZA 2Z8VC 4YLQT 3QWRD 4LEXL 4FMKA 2OQJB 2H26A 3R0MA 1D5IH 1ZA3A 3ARDC 2YD4A 2O5XH 2V9QA 3DROA 3FO9A 3MRKB 5E99H 1T1XA 2HLFD 2X89A 4EBQL 1GHFL 5DJZB 4HCRA 3QJFB 3BO8A 3MV9E 3A6BH 5DD0L 1KB5A 2X4NB 5B38A 3GIVB 1EJOH 4BQCA 1IGCH 2ZUSA 5MENA 1IAMA 4XVTH 5I1KH 5B8CB 4HPYL 1AD9B 1MY7A 2RFXB 5JQHC 3HE6D 1NDGA 5TE6L 1MUJA 2XI9A 5IG7A 1ZSDA 4LVOB 5FFLA 3THML 5F70A 4ODUA 4NKDA 3JXAA 3IFNH 3BRDA 5DJ6A 3NABH 2JJVA 4NYLB 3ZKMD 4PJFB 2AV1B 2J8OA 3F62A 3HUJE 3SGEH 2OXHA 2N56A 3MRQA 1S8DB 3I75B 1IGJA 3RY4A 1FFQA 1Q9KB 4TULL 1S9YB 3LKRA 2ATKB 3QB7C 3P30L 3O6ML 3MROB 3LOWA 2VXUH 4WY7H 5FKPB 3ZDZE 5HPMA 3VXOA 3VFTB 5I66A 4MXWH 3TH2T 3MLYL 1NFDA 3MRDA 1IM9D 2RHEA 5K33A 4GKOA 5E7BA 1QYGH 1U93A 4MJ6B 1R3IL 1BEYH 5F89B 5BZDB 2BSTA 1S7RB 5BJTB 3ZE0E 4B7LA 4CJ1A 5EIQA 1WBXA 4XWOC 1QPPA 4GKZB 1IQDA 3MRGA 3EUUA 5C6PB 1RJZB 3V8OA 1A6UH 2NR6D 4JN2A 2BNRE 1MSPA 4ORGA 2XRAH 3CMOL 4G42A 3QDAA 2PF6A 3QNYA 5E6IC 3VI3F 1I7TA 1TLKA 5EUKA 1EEYA 3GNML 3MLVL 2QQQA 4QGTA 5ITBH 1P7KA 2YK1L 4S10A 1FC1A 5DSCA 1XT5A 5JTWA 2FJGB 4LRNH 2BHUA 3BPCB 1DN0B 1A21A 1IQWH 5C0DA 1I1FB 4N8CH 4G5ZH 4KAQH 4E9LA 2F53D 3MOBL 3T8XB 5KSBA 1TQBC 4JN1H 2AGJH 1QHPA 3EGSB 1CIUA 3LEVH 3MJ8A 3ZKQD 1BAFH 1N2RB 5GGSY 3D39A 3HI6H 5JOPD 2YN3A 2CUMA 3FFCE 1S9WA 5DEFB 3KPOB 1UFUA 5D7JB 1SM3L 2UV3A 4X99A 5EU4A 4IDJH 1PGRB 3DECA 5CZVH 3MO1A 4I0KA 4Z7UF 2ICEA 3FQTA 3HI5H 1VA9A 4J23A 5H35B 1WUNT 4QRPA 3INUH 2Q20A 4NQEA 2ORBH 3FB5A 1SY6L 3LMJL 5KVGL 1NC2A 4NM8H 4PRIA 1IZKA 1TNNA 5GISH 4L1HA 3U30B 2OJEB 1NCWL 1EERB 2DI8A 4HLZG 3SKUD 5JW3L 2R29L 1IEAA 2VUYA 2G9HA 2PW2B 4OD2B 3SKJH 4XMKL 3LKQA 4LSTH 4UV4H 5GS2D 3FT2B 5HYJE 3CSYA 1TNMA 4MD5A 4OFIA 1WFUA 4NN7B 5L8LB 5BRZB 3IFPB 3FFDA 2XACC 3H42H 3IXAB 1YYML 3MXVH 2VISB 4F7TA 3RWEB 4EOWH 1FVDA 5CZXD 4MNGE 2VKXA 5EO0B 4LCWD 4LK4A 5B38G 3EZ8A 3MRBB 4Z77B 2WWKO 3ZDXE 1JPGB 2X1WL 1KGCE 1XGUB 3ILQD 2VDKL 1EA9C 1U8IA 4R2GD 5CEZL 4Y8AA 3QPQD 5IUSA 2ZOKA 5D2NA 1ZANH 3RIFK 4N0FB 5JW5B 2N1KA 5IR1B 3ZKSD 4NO3B 5LQBH 5DQDL 5C0AA 4WWKC 3OKKB 2J4WH 2X42A 2XA8L 4MQ7B 4WHYH 1KN2L 3KPQA 5JLZB 1U3JA 1CLOL 4M3KB 2F54B 3C09B 5FKAB 5T5FL 1OAXL 1WZLA 4XTRD 1TJIL 5HHNA 2CPCA 2DJ4A 4OCLC 5FM5M 3OKNB 4F9PC 1CBVH 2WANA 2BNQE 3L5IA 4P2RA 1A14L 2AABL 4KFZC 4TRPL 1CE6A 3GJFK 2CIIB 2EXWC 4RCAA 2DQEL 1A4KA 2VLKE 3ZT5A 1KJMB 4Y7MA 3KWWA 3L6FA 3NAAH 1RZIB 5HGGS 4S1SH 4FTVE 3U7YH 2FBJH 5JW4R 4OCXL 5FYKH 2VZVA 5T1DH 4KGJA 4P5MB 1OAUL 4NRYB 3LQAC 4GMTL 3KXFD 4MCZB 4XCYA 2ZOLB 1QEWB 3P0GB 3B6SA 5EU3A 1HWGB 3CVHA 1VGEH 5CJBA 4MXVF 3I85A 1KIRA 4U4BA 3WJLC 3L1OH 3TWCL 4LARL 1G7LA 3OR7B 1K4CA 5JDJA 2VAJA 5GRUL 3ARXA 1WTGT 4NZDA 3PQYA 4C58B 1QSEE 1LK2B 3QXAA 1FCCA 4NO5B 3K4ZA 2I9TB 4XCEA 5CJOH 4YZFE 4YDLB 1FZJA 3VXRB 5L2JB 1CG9B 4R6UA 4DVBA 1J5OL 2AQ3A 4QOKD 2UZIH 3RVTC 3LKPB 3QEGH 5GIRB 5ICYB 5IJKC 4P23D 2DQJL 4JKWA 1JFQL 4OCSH 4OKVB 1A3RL 3DV4A 2YC1B 3RHWK 3AB0C 3OKDA 1UH4A 2VZTA 3SGKC 3SCMB 4H0IA 4M1GH 3QEQB 4PRDA 2QQLL 5B21A 3ULSB 1HYRC 4KRPD 3QISA 1HYSD 4WCYH 2J5LC 5IV2B 4R97C 5JZ7C 4UAOC 1M7IB 1V7ML 3KPSB 2ZCLL 4KK9C 3SDAB 2XWBA 4MAYC 4POZD 4X0KA 1MJ8L 1LMKA 4ZPVA 4RSVA 1C12B 2ICCA 3PIQA 3CXHJ 1BX2A 3VXPA 1T03L 3QULA 3VWKD 5E2UH 3RKDD 5MEQA 1F3JA 1EO5A 1WISA 4DGYL 1PBYA 5DURD 4XHJD 1FP5A 4HDIB 1W8OA 2P46B 5C0BD 2I5YH 4HUMB 2E8YA 5F7LB 3MNWB 5D5MF 1JGUL 4OZIA 2FSEB 3K1KC 4OLZH 1XGYH 2Q6WB 3U2SB 4UTBH 1LO3H 1S7UB 3QPQC 3FAXA 1R5VA 1G7JA 3WXWL 1RZKL 1VGKA 4K7FA 2IQ9L 3BUYB 3K8LA 4OFKA 4U1IA 1S9XA 4F8TA 1UADC 2OM5A 3WDIA 1WT5C 1Q9OB 3HC3L 5ALBH 4AT6B 2R0LL 4JJHA 3RWDA 3BESR 5C6TL 2NTFA 3D2UD 1MLBA 4F2MA 5K9QI 4KXZH 3GSNB 3RX7A 5HHME 5D2LA 3TO4D 1QLRA 4PJAA 4XTRC 3BI9X 4I3RH 3V6OA 4XCNB 3VXQB 4EI6B 5J4MA 4LCUA 4ELMF 1YEGL 4IEFB 5DJDA 1MCIA 1LEKB 4WFEE 2WBJC 3GSWB 2MOVA 4JFYA 5FUOH 4TTDC 1KCUL 3DGCR 3MJ9L 2FX9L 1Y6MR 4OF3A 1CDJA 3MLUL 3NIGE 1OM3L 1EHNA 2YPLA 2H26B 4TSBL 5TDOB 3K8MA 4MJ4A 4PJ9A 3OB8A 1JPSH 3DROB 1SEBA 1AXTH 1AHWC 3ET9F 4LQFL 1RZJH 3MLSH 1KB5B 5DC0A 4Q6YA 5EA0L 5KSVA 5MENB 3SKOA 3KYNA 2P8LA 1F6AB 1MUJB 4PJXE 1ZSDB 2JCCA 3Q6GH 1RFDH 4NRXA 4NKDB 2AV7A 1LHZA 2R4SH 4M9PA 2F8XC 5C07D 1I9EA 3D48R 1EO8H 1HXYA 4PRHA 1DE4A 1EZVY 3DHMA 4XCCH 5C9JB 4FQXC 3GSNL 4JPWH 2VDMH 4RNRA 1IGJB 2D03L 3SHSA 1CICB 1FIGL 1OAKH 1NAMA 4YEEA 4H8WL 5GS3A 3QHFH 5IJVA 3LKRB 4BKLA 3TBSA 3ZKND 3MRFB 3S35L 4K23H 4UQ2A 3SOBH 1ROWA 3VXOB 1I75A 5I66B 3BAEL 5I74C 1FSKB 1NCAL 3U82B 1MFDH 1QRND 1HYSC 3UJTL 2G60L 3MRDB 2VLRA 2OCFD 1INEL 5TF0A 5D1ZC 2AI0H 4I77L 2A0LC 1U93B 5LBSL 2BSTB 1T22A 4N90D 1F4WL 5DUBA 3QFDB 1XF5A 2DQGH 5TE4L 3DPBA 5IB4A 1JRHH 4XP4H 1PQZB 4ORGB 3VWKC 4AEHH 4G42B 4J3VA 3QNYB 5CSGA 2Z8SA 4M7JL 1NANI 5EUKB 5C09E 1EEYB 1JHTA 4HCRL 1P7KB 1MHHA 5CD5C 1KB5L 5DSCB 3EYUL 4NCC1 4HAFA 4WDIA 3W11C 2D2OA 5F7MC 3N85H 4L4VE 3W0WD 5C0DB 2A73A 2J8UB 2OS7A 2ZCHL 4GBXA 4QXGL 5J11B 5D1QC 2XYCA 2ATPA 3Q0HA 2VMFA 3MJ8B 4ZS6C 5CEZD 1DBBH 2WUCH 5DJ0A 3MCKB 5CP3A 1GGCH 3RX5A 1P7QA 1IZJA 1NUNB 1QO3A 1QFWM 1S9WB 5D7JD 1MF2L 4M93C 5EU4B 4QTHA 2BSRA 2W60A 4HC1A 5DFTA 1CDYA 3MO1B 2LTQB 1SMAA 1HINL 1A6VH 3FQTB 1F42A 4QRPB 1J0HA 1CD1B 1X4ZA 4NQEB 2FZ3A 3FB5B 4HK3J 3GJFA 1AQKL 5IKCA 1NC2B 5C08A 1HHJA 2HAZA 4YHPA 4FP8H 4MGXA 1HKFA 4NZUH 4Z7VF 1E6OL 1VEMA 4JFHE 4OAWA 3U0TA 1A6WH 4TSAH 2G9HB 4U6HA 3IFOA 4R8WH 3C6LD 2C4FU 5J3HC 3E2HB 4LSSL 3RY6C 3FFDB 3G5ZA 3IB4A 1PG7W 4WHDA 3TYGL 3QQ9C 4MA3A 1CDBA 4F7TB 5EULV 1FVDB 2X4TA 4CKVX 1N6QH 4IS6A 1AKJD 1B6DA 5LCVL 1BOGA 1KTLA 1YN7B 3KYOA 4WW2F 2EE3A 3ZSTA 3OL2A 4OZFA 3UO1L 3RGHA 1CLZH 3MV8A 4XVSL 1B2WL 3T0EE 3QHZL 1T7WA 2ZOKB 3WFDL 1OGTA 4XAKE 3JUYA 3TYFA 1CN4A 3NCFB 3KPPB 4HF5H 1FC2D 4I1NB 4XC3L 3KPQB 1MELA 5FYJD 3HMWL 5E70A 1DSFL 4BK5A 3KG5A 4K71B 5KJRH 5HVHB 4LPCA 3AREC 3C60C 4F8QA 4JQXC 4V1DA 3K4AA 3QI9C 1NJ9A 3BP6A 2EYRA 2P5WE 3QDGA 5HHNB 4PJEF 5EZJB 1CVSC 1W72H 4P2RB 3B8YA 5DTFA 1CLYL 1CE6B 2YPVH 3MBXH 4I8DA 3UDWA 2DM3A 4AK1A 1A4KB 1E28A 3L6FB 3VFWA 5F7WC 4ODHH 1IC7L 2VUOA 5D7KD 1G9MH 5DGRA 1HZHH 1QACA 1N3NA 2NMSA 5CP7A 1G7QA 2DBLH 2ERJB 3OKOA 4AIZA 1G7PA 3ZDYE 4XCYB 1CZ8L 1WFTA 3HNTH 4DK6A 3B6SB 2I25N 5EU3B 3CVHB 4IRZL 4OKDA 1KIRB 6FABL 4R90L 3T2QA 2ZG3A 1G7LB 1K4CB 1IGMH 1BFVH 1OY3B 5JA9A 1ZVHA 4PJHA 2DLEA 2GHWB 3QXAB 3MJ6A 1KJVA 4AG4L 1I8LA 2BVTA 3BN9C 4XCEB 3VXRD 5F9OL 1FZJB 2ZJSH 2NY6B 2BJMH 2A38A 5T33L 3S6CA 2P8PA 4HHAA 3WS6A 3GMOA 3VW3L 5CHNB 3VH8A 4M62H 2BFVL 3DV4B 2Z31C 3OKDB 4MJ2A 4HUUB 3GSOB 2IH1A 1AP2A 1JTTA 3X3FH 4LPWA 5C0ND 4PRDB 2Y6SC 1OT1A 4FRWA 1Q0YL 2UZYB 3C2SA 3E8UH 3V4VL 1B4JH 1FNSL 1GC1H 2XWBB 2ITCA 3DO7A 1CXEA 4X0KB 4EJ1C 4KH2A 4PJFF 4K8RC 4ZPVB 1N7ML 3MPCA 4R4FH 4JZOB 3DSFL 4ZUTA 1BX2B 4CDHA 3QULB 3CVHL 3BJ91 3GHBL 5MEQB 1M4KA 1HILB 2D7TH 5D7IE 3HNVL 1HI6A 1I7RA 5HI4D 3JWNC 2P43B 1BVZA 5L7XL 2FCBA 4KVCH 1IT9L 5HI5D 3VFGH 4KGLA 1FLRL 4OZFG 4OZIB 2R0ZH 1MWAH 4LSUL 2R1YA 4WU5A 5IB5A 3AY4C 1CT8B 1R5VB 2Z91A 1G7JB 3BN3B 1VGKB 4K7FB 1X5YA 3ORJA 1LK3L 4U1IB 1S9XB 3OHXB 3S5LA 3WN5A 4FNLH 3BPNC 3GBNL 3RWDB 1YEFH 2NTFB 4L9DA 2WAHA 2G75A 2I60H 2CLVB 2H32H 4OIIH 3ROLB 5DA4A 1MLBB 4F2MB 4KQ3H 3BZFB 5D2LB 3QUYA 4FFVD 3MRJA 3S37H 1QLRB 1E4WH 4PJAB 1CDUA 1JHKL 5DUML 1F13A 5DT1H 1QKZH 5T1KA 3ZO0A 1FFNA 4LCUB 1EEUA 5JHDE 4DQOH 3V6FA 2ZUWA 1MREL 3UAJD 1CF8L 2BNUB 5AZ2L 4BFIB 2LFGA 4JFYB 4ODTL 3PP4H 4LPVA 3ARGA 5DHYB 5DRNA 3ZMRA 4JCLA 1H8OA 2YPLB 1IC5L 2YD1A 3ROOA 1DBML 1K8IA 3BZEA 1B0RA 1ADQH 1HQRA 2WNGA 3DUSA 1SEBB 2X89D 5I1JL 2AK4E 1UH3A 1FDLL 2R1XA 4OM0L 2MCG1 3P4MB 1HH9A 5KSVB 1NCCL 3BDYL 3MLWL 3V5KB 3SKOB 4N1EA 3Q1SH 3KYNB 4KPHH 2P8LB 4LAQH 2KH2B 4FABH 5C2BL 5I16A 3ZL4H 2JCCB 1I9JL 1GOHA 1RK0A 2W9EL 4NRXB 2AV7B 4Y16B 5L8JB 2YKLL 1N0LA 1C1EL 1VERA 5JMOC 1LNUA 3H2WA 4YDIH 3T4AA 4L8BA 1DE4B 5FUCE 4RMWA 1IGFH 5D6DC 5I75B 3VH8G 3VXME 2XKSA 1KF9B 3P4NA 4RNRB 5EBWA 3S36H 2YA2A 1NAMB 2NCMA 4GLRI 2F58L 1MJJA 3IXTB 4O9HH 4PJDA 4YHZL 4BKLB 3TBSB 2DKUA 4UQ2B 3MJ7A 4NN6B 3WLBA 4GH7B 5EG6C 1MFCH 5SX4I 5CCKL 5JHLL 4UOJA 1AR1C 4MNQD 1NLBL 4QHMA 2VLRB 1RZ7H 4Y0GA 2Y1VA 1OSZA 5E2WL 4PS4H 1TJGL 3A67H 1T22B 5DUBB 1XF5B 4ZXBC 4X7FC 2NY4D 1V5JA 3ZYJA 3BE1L 5IB4B 1TTUA 2D7MA 4ZTOH 4ZO7A 1ZEAH 3OGCA 4ZYKA 1AXSA 4JDTL 4PY8I 4MJIE 5DWUL 1PZ5B 1MHHB 1PSKH 4OZHA 4K3DL 1M71B 4WDIB 3ARFA 3QIWD 4JGMA 1F4YL 4D0CA 2E6PA 3VG0H 4WEBH 3FZUC 4KK5D 4GBXB 1SBBA 1GGIH 2ATPB 1QTYT 1OTUD 4BELD 3HZMB 3U1SH 5FUZL 4C83B 4MQTB 3X11A 2VXVL 3L9RA 5DJ0B 3D39D 3S5LG 1OAYL 3O45B 1V3JA 1DLHA 3NVQA 1QO3B 3TZVC 4OF7A 4JM2C 1NAML 1EXUA 4QTHB 2BSRB 2W60B 1TJHL 3D1MC 4JRXA 3DXAE 4GAGH 4GJTB 4HUWA 5AEAA 1KELL 4QRPD 2NY7L 3WFZA 5I15L 1UM4L 4HK3N 3VG9C 1P4LA 1AH1A 3HZYA 4PP1C 5CSZA 1NC2D 3EFFB 1MJ7L 3GJFB 2RCSH 4L3CA 4M3JA 4UUJB 3TN0A 4B5EA 3ULVE 4P5TD 5IKCB 4W6XB 1HHJB 1M7XA 1SEQL 3ABZA 4PRID 1KC5H 3T2NH 1PYWA 3WIHA 4WU7B 1I9IL 2CKNA 1T21A 3U0TB 2MKLC 3NIDF 4JFFD 4U6HB 1QNZH 4OSUH 5FHAL 1NLDH 2V5MA 2GJ6D 5E03A 5ESAB 2EDEA 3ULUF 2P44B 2M1KA 4NHCH 4HS6A 2EDHA 3G5ZB 4JVPA 4MA3B 2X4TB 4LF3A 1OLLA 2BVYA 4F15B 4IS6B 4ZFGH 1UM5L 2AEIT 3OQ3B 1BOGB 2E7LA 1B0GA 4XNUH 3KYOB 1JJUA 1DJSA 4EN3A 1MRCH 4OZFB 2X6MA 3MV8B 1P1ZB 4WHYG 4IDLA 1KEML 4FS0A 4CBPA 1ZE3C 3CUPA 2P7TA 3VRLF 1OGTB 4KDTC 3TYFB 5C0AD 4NNXA 4DGIH 1A6ZB 4Y5YC 4PB0L 4U33A 4ZTPL 4HC1L 2DYPA 4GG6E 4U1GB 4FZ8L 2WQRA 4S1RH 3BHBA 3UTTA 5EIVA 4M1CC 3HR5B 5F1KC 1OGAA 1J18A 3GUTA 2DTSA 2Y72A 4HXBL 4UU9B 2QSCH 4F37F 1NJ9B 3BP6B 2EYRB 5FGBC 4JZJA 3QDGB 5F3BA 4Z8FH 4MJ5B 4FQ1L 4K7PX 5HYEA 1NBQA 5DTFB 1REIA 5GS1A 4NWTH 4JFQA 1E28B 3OKMA 2HLAA 4WO4C 1XF2B 3ALXA 3WMSA 3RA7H 2NY4C 2FLBT 4M5ZL 5CP7B 1OP5K 5EOCJ 1G7QB 3MFFB 4UNVA 3OKOB 4AIZB 4Q97A 1G7PB 1F45A 1JF5A 4PGCA 5DRZA 2R8SH 3FCTA 4CUCA 1BREA 5GSVB 2NXZC 1IGYA 4L8DA 2HRPL 4ZS7H 2VR4A 1NSNH 2P5EE 5L88L 4J4PA 5HDOA 3QIWC 3BX7C 4PY7A 2AEPH 4XPBH 4XWGH 2VXSH 3PQYD 4PJHB 3QQ4A 4J3OC 2IG2H 1AI1H 1KJVB 1PKQE 3VXUA 2PXYD 2YUXA 4OV5B 1OTUC 1Y0LA 3BQUA 1KG0A 2DMBA 4G6KL 2P8PB 4HHAB 3FOMB 2EDLA 4XPAL 3GMOB 4U6XA 3AUVA 3JV6A 3VH8B 1EMTL 5JXED 1QLFB 2P45B 4YHYB 3CFDA 4P9HH 4KDWA 4C56E 2OR9L 3MRCA 1AP2B 2B0SL 5D8JL 1LEIA 1F8TH 5CBAA 3C8KB 1FQ9C 1E4KA 4P5TC 1TETH 5IFAH 5TGBA 5ALCH 1D5IL 1DTUA 2O5XL 5HVGB 3RJDA 3QUXB 1QPXA 3RDTA 1T89C 4G8FA 2ESVB 2ITCB 4TUJA 5EU6D 3DO7B 1CXKA 2V2TA 1HHIB 1KUMA 3A6BL 1DEEA 3BPOB 4XMLL 1EJOL 4ZUTB 1IGCL 5I1KL 4XVTL 4HEPG 1CGTA 4J3TA 1IBGH 1QSFA 3QDHA 5DXWA 1U3HA 3CX5J 1I7RB 4PBXA 2HJLB 5EUOA 1EPFA 3IFNL 1AE6L 2IBBA 3NABL 1ETZA 3EO9H 5BQ7B 1NFDF 2FEEI 4YFEA 2R1YB 5DHVH 1KACB 3WS3B 5DJ8A 4FG6D 1KTDA 1QHOA 4PGBA 1QR1B 3UTSE 3S5LB 3WN5B 2VXUL 1I8IB 4WY7L 4PG2C 4YAQA 3ECBA 4KKLD 4ZNEE 4MXWL 4ZOAA 2G75B 4DEPB 3U7AA 2HFGH 3D25A 4FQHA 1QYGL 1BEYL 3QUYB 3MRJB 1JNHA 3GDBA 1ITBB 3MCG1 2IH3A 3RBSA 5T1KB 3VI3E 1A6UL 4Y5VA 1XMWA 2XRAL 5KSBF 3V6FB 1W0WA 5ITBL 3HNSH 3DMMB 3ARGB 4KMTH 1TZIA 4YK4C 5DRNB 4LRNL 4BM7A 4ZG1A 2YPLD 4QYOA 3REVA 2Z4QA 4YHMH 4HIIA 2KKQA 3ROOB 5CD3B 4X6CA 1IQWL 3VXSD 4N8CL 4G5ZL 4PJ9D 3BZEB 4KAQL 1V7NH 4GFTB 1NEUA 3DUSB 5J13C 4JN1L 2AGJL 5GZND 2C3GA 3LEVL 1UB6B 2BOBA 4I48B 3DO3A 1QFPA 1EFXA 3HI1A 1R0AH 1RIVH 4MQSB 1A7OH 3HI6L 4OJFH 3IJSB 1MI5E 4MZ3A 4WI2A 3H9SE 4QRRE 4MD4B 3V7AE 4IDJL 2AJXH 4Z7UE 4HFUH 3QIUA 5CZVL 1X6NA 3HI5L 1RK0B 2J1KA 1U8JB 3INUL 4U1MA 3EYOB 5IWLA 2ORBL 3QH3A 4WI4A 1LNUB 4PRHD 2XPGA 1S7TA 3KPLB 4NM8L 5MEPA 5BV7C 4FFZL 1W72A 5GISL 4OGAC 5JXEC 3P4NB 5FGSA 1MJJB 4PJDB 4P2QD 4JO1H 1CGYA 3C5SA 5HGAA 2APFA 5JOFA 4Y5XC 1JIBA 3SKJL 3MJ7B 1DQLH 4IRJA 2R23A 1GZPB 4LSTL 4UV4L 3B2VH 4ZQKA 2YWYA 3C08H 2VLRD 4QHMB 4AL8H 3H42L 5E6YA 4AY0A 1OSZB 3MXVL 4EOWL 3BH9A 1RAMA 2NY5C 4DOHE 3MV7A 1NC4D 1FBIH 2GT9A 1Y6NR 5FYLE 4OFYA 2E8ZA 1U3ZA 1J10A 3OGCB 4ZYKB 3B4NA 1ZANL 5DD6A 1X5LA 2CDGA 5LQBL 1N59A 5EZOH 5IM7A 3QSKB 1MHCA 4J6RH 2J4WL 4D0CB 3TVMD 3EOAA 1T5WA 3IDNA 1C16A 2XN9A 4IOSD 5I9QC 4Q9RH 3QDJD 5ISZA 3BPLC 5H94B 3KYMA 4JFPA 3QG6A 3IETA 1QBBA 3V7MA 5D6CA 2F5BH 4RX4D 3X11B 3L9RB 1L6ZA 1P7QD 1DLHB 1CBVL 4XGZA 4G9FE 1P6AB 3L7FA 3F58H 2EZ0C 3P9LA 1EXUB 4BYHA 2APBA 3DX7A 5IEKA 4PJCA 1UJTA 3MACH 2X4OA 3B43A 4HUWB 3DTXA 4CMHB 3CC5A 3NAAL 3U7YL 2FBJL 2JB6B 4HFWB 2CKBH 5FYKL 5CSZB 5TDPA 3RVXC 3VGAC 1Z2KA 5DK2A 5C08D 5T1DL 3TN0B 3F7PC 3C5ZA 2OMBA 4PJ7A 2XKUA 3RZWA 4JHBA 3F5WA 1T21B 1U42A 2D7NA 1VGEL 2PKDA 2APTA 1YEJH 3L1OL 2E7MA 4QHUB 4NCDA 3GMRA 4LCYA 5C7XH 4U6VH 1J0ZA 3EO1A 4Q58C 3ARTA 1WWAX 1FPTH 1S7QA 2IPKA 1TZHA 4WI8A 4JO3L 4HS6B 3SE8H 3TO2A 3S88H 5JORA 2HJFA 1MWAA 4LF3B 5CJOL 4KRLB 2EDQA 1UWXH 1MCEA 2E7BA 5IQ7H 4FMFA 4WFFD 1PEWA 1OP9A 2UZIL 4EN3B 3QEGL 4PLJD 1OTSC 3N1FC 5KANG 4OCSL 4XB7A 4K07A 1EDQA 2PO6B 3O4OB 1CL7I 4JFDA 3EYSH 2P7TB 4LSQH 2H32A 1IL1A 2EIDA 2VL5A 4QRQB 4M1GL 1NGPL 4L8SA 5CLWA 3DRQB 3UTTB 4WCYL 1OGAB 5CINH 3GUTB 4LOUC 4F7PA 1A5FH 4V1DD 3QAZC 4X7SH 3IJYA 4HIJB 3W5NA 4Y4HA 4E41D 4OZIF 3NIFF 3KLSA 5GS1B 4Q74A 3ARWA 3QDMA 4JFQB 3SJVE 5E2UL 2UVEA 3OKMB 2HLAB 3P4OA 5DDHB 1ADQA 4P46B 5FGCB 4M4PA 3T0DA 2AEWA 2W38A 1X3DA 2I5YL 2H2PC 5D5ME 3NCMA 4UOW0 3LRSA 3TBVA 3S35X 3VDAA 2LVEA 4PGCB 3VGDA 4OLZL 1JYXA 5DRZB 1XGYL 5GGUA 3FCTB 4UTBL 5TF1H 1LO3L 2ICWJ 1J7VR 5D2LF 4O51B 1B9ZA 4PJAF 3C8DA 3QO0A 3QQ3A 2XTJD 1INQB 1U0QA 4NOBA 5E2JA 4PY7B 5ALBL 3QXTA 3MRHA 1YMMA 3GMPA 3AM8C 4Z7WA 3QQ4B 1FNFA 4M7ZC 1MLCB 3VXUB 5FIEA 5IW6A 1KLGA 1Y0LB 3BQUB 1J05B 3B9KD 4I3RL 1KG0B 4H1LH 3BD5A 4XP9H 4ELME 4P3DB 4U6XB 4NNPH 4X6BA 4NO0B 2B7DT 3ARUA 3JV6B 1EVUA 1CDIA 3G6JA 5IK3B 5C70A 4GRLC 3KPMA 5EU5B 3MRCB 5FUOL 5GS0C 1VCAA 4FQCH 2OMNA 3CFEB 5D9SB 1LEIB 2R2CA 3KLDA 5CBAB 4N0YH 4BZ1H 1AO7A 5F7NC 1T1WA 2J6EH 4UIMA 5TGBB 2JCCF 4KRMB 4F7EA 3QA3A 2D31A 1NUFA 4O02H 1JPSL 4Y19B 5DO2C 3RDTB 4G8FB 3O9WB 4MB3A 1AXTL 4PGEB 2V2TB 5DMKA 4LCIH 1RZJL 1DEEB 1QFHA 3MLSL 1JP5A 4KY1H 3UEZA 3EYQD 3G9AB 3M8OH 1OB1B 1QSFB 4ZFZA 1U3HB 2YD5A 4ESKA 1GGUA 3Q6GL 2H2SC 1RFDL 5EUOB 4DZBA 3N9GH 2R4SL 3PABA 4RQQB 3B9DA 3ZSSA 1KPRA 5EU7E 1EO8L 2DICA 3FAWA 4ODXA 5EOQH 4XCCL 4PD4J 1AJ7H 4JPWL 2VDML 1OAKL 4XVUD 1Q9WA 5DJ8B 3QHFL 1KTDB 5F1IA 1D5BA 4PGBB 4K23L 1JF1A 1X5GA 3SOBL 3V0WL 3L7EB 4YAQB 4YBLB 2CDEA 1MFDL 4FQHB 3V0VA 2AI0L 2OL3H 1H9VA 5JW4Q 5GGSA 2FWOA 2BERA 2DQGL 2IMMA 1OPGL 3ESUF 2N7BA 4K3HA 2IH3B 1JRHL 2VE6B 4XP4L 3RIFF 5SWSD 2H6PA 2HMIC 4Y5VB 4AEHL 3V52H 1C5DA 2W0PA 5D1XA 5F9WC 3SKMA 2ARJQ 5E9DA 1W0WB 4D0DA 3SE3A 2NY1C 1PFCA 3B2UC 5INDA 4U1NA 3X12A 5E7FA 3ES6A 4QYOB 3H8NA 3REVB 2Z4QB 3N85L 4ERSH 1XIWD 3P9WB 4HIIB 5KG9A 2BY0A 4L4TA 5KS9A 1G9NC 1V05A 2VR9A 4WUUD 4WTXA 1OF2A 4CL7A 1AFVH 2GCYB 1F6FB 3MRRB 2XTJC 5DR5H 1DBBL 5F7EH 2WUCL 4AMKH 1EFXB 2LE9A 3HI1B 4PJBA 1GGCL 2L0DA 1J86A 3I6GA 2W9DH 5J7CC 1RURH 1RUMH 1EUUA 2EDOA 3QIUB 3CNKA 1UKSA 2LABA 1A6VL 4BZYA 4XBGA 5LKNA 4ZUUA 4U1MB 5FOBB 4PJIE 2I27N 1FORH 5ETUA 3MZGB 1KB9K 1S7TB 5MEPB 4FP8L 1VEPA 4NZUL 5KVFL 1I85C 5GJSH 4HGWA 4E5XA 4P2OA 3O4LE 1A6WL 5KZCD 3C5SB 4RA3A 4TSAL 1U8NB 2PYED 5HGAB 4D8PA 8FABA 5JOFB 2YRZA 4R8WL 2R23B 4ZQKB 3HZVA 5CEYA 1DBKH 1X5AA 3HAEA 4IRSC 5JPMA 3BP4A 5GGVH 1I1AA 4HWZA 4PJGA 4QNPF 1A4JA 3BH9B 4YXKH 2YRPA 1N6QL 5IFHH 1FL6A 5C0JA 1XF3A 2GT9B 4DGVH 5F7YC 3RHWF 4OI7A 3H9HA 4OLUH 5CMAB 3WO3B 4LKCA 1CLZL 1UWXK 2QSTA 3G6DL 4P4KD 1F3DJ 4TUOA 3ZT7A 2CDGB 5E5RB 4AEEA 2V5TA 4KUZH 1N59B 3L5XH 4QY8B 3TFKC 5IM7B 3ARFD 4HF5L 4Y4FA 1G1YA 3ARRA 4LDEB 2DI7A 5DRXA 1T5WB 3IDNB 3CX2A 1PG7H 1JUFB 1WGOA 3V5HA 3BH8A 4KJQC 3IETB 5D6CB 1JZ3A 5MI0B 4PJEE 5B8CC 1P84J 2OI9B 4QTIH 1W72L 2AJSH 4Y88A 3O6FA 3L7FB 4LVOC 3SKNA 2FO1A 5HHOA 4RIRB 1BFOB 3P9LB 3WFHA 2YPVL 1U58A 2HKFH 3MBXL 5EC1A 4JRXD 4PJCB 3NCJH 2X4OB 3HN3A 3VJ6A 5CJ5A 1Z0NA 3CC5B 4ODHL 2VB5A 4PRPE 4JFED 4EUPA 1G9ML 3H9ZA 1PY9A 1HZHL 1DP0A 4I2XA 4IJ3B 5TDPB 3TN0D 4F58L 2DBLL 3U0WH 4MCYA 4PJHF 4PR5B 3WV0A 4GAYA 5ICZA 3C5ZB 4X5LA 4Y4KD 3HNTL 4ELKA 1OCWH 3F5WB 4PGZA 5BS0A 5HSFA 3RTQC 2BVEA 5HYFA 2D7OA 5C0CE 1HWHB 3GMRB 3KPRE 3QFJA 1GAFH 4LCYB 4NQVA 5LGHH 1ZTXL 3EO1B 1IGML 2E3VA 1ZVYA 1WZKA 1BFVL 1S7QB 2IPKB 2UUDK 1TZHB 4G6AD 4OIBA 3T1FA 1HKLH 3TO2B 3UJJH 5JORB 4CAGA 2HJFB 4ZUWB 1MWAB 2K3TA 5J6GA 1NFIA 5I73C 5DHVA 5IIEA 2ZJSL 2BJML 3TIDA 3MJGX 3QEUB 4EN3D 4RGOL 2X4RA 4HK0A 3O2VH 4M62L 4NNYA 2ADGA 2NPLX 2H32B 1H5BA 1IL1B 3LEXA 5M94B 2VL5B 5C8JB 1EGJH 2XWJA 1AGDA 4U7MA 1ZHKA 2EC8A 2DYPD 4L8SB 1N0XH 3O41A 4LCCA 3SDDA 2CQVA 3K74B 3E8UL 1OGAD 1B4JL 4AENA 5SWZB 4FFWD 2LVCA 3IDXH 4IIQA 8CGTA 1GC1L 4RMTA 4M00A 3IJYB 2CXKA 2XXMB 4Y4HB 1CFNA 2M2DA 4R4FL 4LKXA 5C3LD 1UZ6E 3HAEG 4HLJA 4M1DH 3S3PA 1A1MA 4WVRA 2D7TL 3P4OB 4NM4H 4ZUSA 5F97E 2AK1H 1OQOA 2HP4A 2NYYC 3MLXH 3U30C 4HJGA 1FFPB 5I71C 3KJ6H 4KVCL 2APWA 3VFGL 3LRSB 3J8F7 1U8QA 1S78C 2DL9A 2R0ZL 2MPAH 1KPUB 1MWAL 5GGQH 3G5XA 4U2YA 4X4MA 4Z7OF 1K5NA 5IVXB 1INDH 3QO0B 5FK9B 5GRXG 4NN7C 3DRTA 3KAAA 4PTUB 2HT3C 1C7SA 4FNLL 5D7LA 4I0CC 1AD0B 3MRHB 1YEFL 3EDJA 3W9DB 1FG9C 1YMMB 2I60L 5E08H 3V6ZA 4Z7WB 4OIIL 4OF5A 1JE6A 3VXUD 4KQ3L 5DD3H 5IW6B 3I3BA 1ORQA 1KLGB 1E4WL 1CD8A 1MCPH 5DI8A 2W0FA 2ADJA 4PJ8A 1QKZL 3HUJA 3I2CH 1FZMA 2PNDA 3TBTA 4X7TB 4X6BB 4R7NA 4ZNCD 1IM3A 1IAOB 3OKEA 3K3QA 3IKKA 3G6JB 4GW1A 4DQOL 4JPVH 1Q72H 1K8DA 4TNWK 3KPMB 3MBEB 3O11A 1YEKH 4XRCA 4EUPG 3PP4L 4NZRH 4X6DA 1CTNA 2DLHA 1T1WB 4GOSA 1JHLH 1YPZA 2CRMA 2AXFA 4JG1H 4UIMB 1NQBA 3U48A 2FJHA 4F7EB 3DUHA 3QA3B 2D31B 1ADQL 3Q6FB 3LS4H 2IALA 2G5RA 2Q1EA 3IRZA 5DMKB 3OSKA 3SY0B 3GM0A 3ARDA 4DAGH 3Q1SL 1JN6A 4KPHL 3WBDA 1QSFD 1CU4H 1I8MB 1U3HD 4FABL 4PJDF 1E4XH 4ZODA 4ZFZB 2R2HB 3ZL4L 4CVXA 3LIZL 5I1GH 3HC0B 1NUGA 1AGCA 5EFIB 4DZBB 1A7RH 2R9HD 1PVHA 2B1AH 1U41A 3PABB 5BRZE 1R5WB 1DVFD 2A9NH 1KPRB 4YDIL 4PGJA 4ODXB 1IGFL 4JPKH 1VPOH 4WV1C 1UZ8B 3CLFH 3S36L 3V6BR 3VFNA 4JRWA 4O9HL 4QWWD 1D5MB 2GTZB 2EH7H 5F1IB 5I17A 1JF1B 3VD4A 1H0DA 4XX1G 2DLIA 1MFCL 4ZUVA 3V2AR 2CKBA 4YDLC 4B53A 1YJDC 3O3AA 4BSVB 4FQPA 1RZ7L 5CBEA 5J89A 3V0VB 2FYYA 2VKWA 2W1NA 5GGSB 4PS4L 2FWOB 3A67L 4NUGH 1ZS8B 1KIUA 5B3JF 3CMGA 5T5NG 3ULUC 2NXYB 4ZTOL 1ZT1B 2H6PB 4BUHA 2F54E 1ZEAL 1C5DB 1ZHNA 2ITDA 5D1XB 3SKMB 3SCMC 5E9DB 3SGJA 2XIDA 3V5DA 5CUSH 1PY4A 5DVOA 4CU7A 1PD6A 3X12B 4U1NB 4JRYD 2LU7A 3ES6B 3SGDI 4MLIA 3HZKA 5E6IA 2NZ9D 3VG0L 1U8HA 4WEBL 3SDAC 5KG9B 4L4TB 1OT2A 4MNHB 4I0PC 4K8RH 5DK0A 5KS9B 3TCXA 1GGIL 1KXQE 2AJZA 1OF2B 5FCUH 2PETA 2OLDA 3FN9A 5T3ZE 5LGKA 3U1SL 2NY0D 4PJBB 3SBWC 4TQEH 4UILH 4EVNA 3I6GB 1N8ZA 2JJSC 1YEIH 5JXAH 4Z7NF 5DFVD 5I8KH 3QIUD 4Z18A 3L3JA 1JV5B 3L3IA 4GAGL 3VA2C 3TBWB 2R69H 4JKPH 3KHQA 1EHLH 1HH6A 3OAUH 4NQSB 2RCSL 5ETUB 3OR6A 1KC5L 2DQIH 3T2NL 5IVNA 3VXRE 2FATH 2IBZY 3CH1B 3OJVC 3L5HA 3NIDE 2E7CA 4E5XB 1T66D 4P2OB 3VWJA 3R4DA 3H7BA 4D8PB 1JNNH 5FYJH 3HS0B 1QNZL 2C5DC 1TQCB 2NY2B 4IRJD 4OSUL 4X98A 1NLDL 1QBAA 3HZVB 5CEYB 1JZ6A 3ULUE 5ESQA 3AGVA 4MD0A 3HAEB 1YYLH 4NHCL 4NGHH 4TYUA 5JPMB 4RGNC 3QEQE 1I1AB 5HYSA 4HWZB 4FTVA 4PBWD 4PJGB 2X9XA 5CGYD 4D94A 3MV7D 4LSPH 3HPLA 4ZFGL 5FV2A 3T09A 3WJJC 4XNUL 2WK2A 3H9HB 3KPSE 1MRCL 4LKCB 3O3UN 1JL8A 2X4QA 1S5HA 3ARBB 1KYOJ 1RJYA 4G7YH 3VRLE 5KSAB 1WBYA 4TUOB 2QQNH 2QQKH 1OWWA 4JFXA 4KROD 4DGIL 2EYSA 3X14A 3RRQA 4Y4FB 3UC0H 3D9AH 4DWHA 5DRXB 3HE6A 4D0BA 2XN9D 4H1LA 1QSEA 2FEDD 5ISZD 4S1RL 3NCYS 4M7LH 3UPCA 3V5HB 3R8BB 4J7RA 3LY6A 2VTFA 5GXBB 3FJTA 2JJTC 5JO5B 4WWKA 2QSCL 3BYTA 2ED8A 5DMGD 4Z8FL 4P59H 3O6FB 5FO8A 3SKNB 4NWTL 2VLJD 2GY5A 3DOSA 3WFHB 4R4BA 3MZTA 5DQ9B 4F33A 1VFOA 5EC1B 2J6EA 1BBJA 2VWEC 3RWIA 2GI7A 1VHPA 3AROA 5HY9A 4EUPB 3RA7L 4F9PA 1A2YB 2VC2H 4I2XB 3EDEA 4MCYB 1CICC 3ZE2E 1U8KA 3BW9B 3C5ZD 5ICZB 2VNCA 4NFBA 4HT1H 5IB2A 1W8NA 2R8SL 3OAZH 4ELKB 1EAJA 5F8RC 4RGNE 1VFBA 3BEVA 1U8LA 4ZS7L 1ZLWH 3UMTA 5BS0B 1NSNL 1FSKC 4ZO8A 4YEFA 4FQQA 5EOCH 1IFHH 4NQVB 1Z0MA 1R3LA 4B50A 2YD3A 4RGMB 3LRHA 1QVOA 2AEPL 3GI9H 3B9AA 2HG5A 4XPBL 4XWGL 2VXSL 3LN5A 4HJ0D 5E8EA 1J0YA 2IG2L 5FF6B 3PDGA 3WJLA 5J1TC 1AI1L 2L7UA 1NFIB 4HZLA 5IIEB 5DHVB 1MVUA 3BWUC 3VD5A 3TIDB 4EDXA 2Q76A 4JM4L 4IBLT 3BDBA 4UMGA 2YA0A 4K3JH 5E5UB 3VRJA 5TQ2H 2R39A 3R1GH 5T1LB 4HK0B 2F53A 5EH1A 2J88H 3CDGA 4NNYB 4JFDD 5ENWA 4P9HL 5KVEH 4R26L 4KK8D 2X1QA 4C59B 1H5BB 4M6NH 5MENE 3LEXB 1F8TL 3WNKA 3D3VD 1A7PH 3N50A 5IJKA 3E3QC 1ZHKB 5HYQA 1E6JH 4NC1C 3O41B 4LCCB 3SDDB 1TETL 1YA5A 1H3UA 4ZD3H 2X1PA 5IFAL 5ALCL 5TJWK 1RSFA 4MQXD 5MEOA 5EUOF 2W59A 4AENB 3SGKA 4IIQB 4YR6B 4V2BA 1J0KA 5E2TH 1WFNA 4Z7QF 4Y4HD 4KHTH 2DLGA 1OQXA 5HGHB 4LKXB 3QDMD 2GTWA 1IBGL 1KXVC 2EDJA 3QP3A 5HYSG 4MAYA 2B5IB 4AZ8A 4O00A 5E8DH 4U1HA 2P48B 4NCC2 4EIGB 2P24B 1LWRA 4HJGB 1V8HA 3EO9L 4LLAA 2QADB 4HPOH 3AS0A 2WV3A 3G5XB 3HPJA 4GKNB 2AEQH 4G8GB 1K5NB 2WBWB 2R4RH 1M05A 3E2HC 3C5JA 3DRTB 4KTDH 5IQ9A 3T0AA 5A16A 1BJMA 4NHUB 5C0EA 1I3GH 5D7LB 1S3KL 4YH6A 5AZEH 1YMMD 4PJXA 4YUEH 1XGQA 3RZCC 4LLQA 5A3IC 5B3NA 1T0MA 5EO1A 4MB4A 1ORQB 1WT5A 5DJCA 1A9BA 5AD0A 2J8UE 3DNKA 2W0FB 2ADJB 3PGFH 4PJ8B 2X7LA 4X6CF 5DC4B 3E3QE 1FZMB 4H26B 4NC1E 3TBTB 1WWWX 4R7NB 4P3CH 4UT6H 4GW1B 2CUIA 1DUYA 1K8DB 5I6XC 1A9EB 2HFFA 3HNSL 3NPZB 4O5LH 4X6DB 4FFYH 4EDWH 5DJAA 2RGSA 5DZOA 1AO7D 4JB9H 4YHML 1YPZB 2AXFB 5HVHC 3WO4C 3P73A 2FJHB 3RUGA 4EKXA 2WBJA 1TVBA 2KL6A 3IVKA 4NQEE 1V7NL 5E4EC 5CLTA 3TJHD 1CR9H 1MFAH 1U9KA 4RFNB 5ADOH 5DYOA 1L0XA 2VLMD 3EJYD 1MCLA 2XNAA 1R0AL 1RIVL 4NSKA 1A7OL 4OJFL 1T0NA 1N26A 5CILH 2D0GA 4U1SA 2O61A 3V4UH 4BQBA 4DTGH 2CDFA 3LAFA 4WIQA 2AJXL 4WFGD 4HFUL 4CVXB 4ZDHA 2CRYA 1AHWA 1AGCB 2MQ3A 1XR8B 4AM0B 1P6FA 4L4VA 4N8PA 1NBYA 5CIPH 2A6JA 3TNMA 2X05A 3DV6B 3N1PC 1NGYB 3PXJA 3VFNB 1FGNH 1LQSR 3JTTA 4JO1L 5I17B 5FECA 3UPAA 1H0DB 1DQLL 5CSBA 4FQXA 4Q2ZA 3WL9B 3B2VL 4ZUVB 1S7WA 5HHPA 3C08L 3AS2A 5J57B 1J9CT 3O3AB 4AL8L 2NY6C 4GW5A 5CBEB 4M8VA 2FYYB 1HCVA 1UM6H 2DTMH 1D5XA 4CMMA 2R0WH 3LSOA 1FBIL 2HT2C 3WDJA 3T4YB 2NXYD 1TVDA 2AJVH 2XFXB 2YXMA 4JO4H 5D1ZA 2ITDB 5E9DD 3KLHD 4HS3A 3L3HA 4P2RE 5I1LA 2GW5A 1KULA 5JPNA 2XG4A 5EZOL 1CFSA 1Q8MA 4ZFOL 3HZKB 4NKOA 3VWKA 5A1AA 5E6IB 3UYPA 4J6RL 1OTTD 4PJCF 5SX4H 4ETQA 3SDXE 4Q9RL 5DK0B 5E8PA 4CDGC 3FT4A 3MRMA 2LQRA 5INCB 2BC4A 2F5BL 4ENED 1R3HA 1LDPH 2Z93B 2R2EB 1N8ZB 4PJ7F 4U49A 3F58L 1M6OA 1EGJA 1AY1H 4JANB 2CLRA 2A83B 1TQBB 4JY6A 3MRPB 1WSST 1BFTA 3MACL 3L3JB 3L3IB 2YMXH 1BJ1J 4WHTB 1HH6B 2Q3AA 1XAUA 1U8MA 2BVUA 3EHBC 2CKBL 3OR6B 3OG4B 1IEHA 3BT2H 3D2UA 3FQXB 4KK6D 3CU7A 4Y1AB 4PBVC 4I5BA 4P2OD 2P5WA 3VWJB 2VXQH 3H7BB 1YEJL 1Y18B 1JPTH 3OAZK 3QPXH 5C7XL 4U6VL 4LVNC 2CH8A 4X98B 2Q8BH 3QCUH 1O5DT 1FPTL 3N1QC 4MD0B 1JWUA 3QQNA 3T65A 1JZ7A 5IMMA 1I1AD 5HYSB 3WIFA 3S88L 2BOCB 2HT4D 3HPLB 5LJYH 5IQ7L 3U4EB 3RY6A 3OWEA 1PEZA 5ERWB 4XP5H 2X4QB 1S5HB 2AS5M 4OD3H 1DBJH 1RJYB 3KGRA 4F58H 5FYLH 4W6YB 4LSQL 1EEQA 5FDYA 4CJ0A 4JFXB 1J1PH 2EYSB 4D9LH 3X14B 2EKSA 2BX5A 3H3PH 3HE6B 4D0BB 4NRZA 4XZUA 5CINL 3SGEI 2DD8H 1A5FL 3NA4A 2FIKB 2ZSWA 2BVPA 4X7SL 4OZIE 2ED7A 2HRLA 3BXNA 3O6FD 5HHOD 4Q9QH 4OM1H 1ES0A 3DVFA 4R4BB 4Y16C 4YHIB 4F33B 3Q5OA 3AREA 1IRAY 3QI9A 5HGDA 1T80A 5HY9B 1WZ1L 3B5HA 3P11H 1L4IA 4RWYH 3P0VH 1TIUA 5C0RH 4Z7WF 1QRNA 1U8KB 1ZGLA 5D2LE 5TF1L 3CDCA 4X5WA 5BXFB 1OARH 3V6OE 2O26U 1VFBB 4NN6C 3BEVB 1U8LB 5TE7H 3T3PF 5HHVH 43C9B 1RD6A 4H0GA 1H3GA 2XY1A 3QFJD 3VXNB 4FQQB 3JWDC 1X9QA 1D9KD 1R3LB 1MQKH 1QVOB 3G6JF 4XNZB 1LE9A 2NY5H 2VXTH 2HG5B 5I18H 1FNHA 5E8EB 1F4XH 1IE5A 4LU5H 1JGEA 2BHYA 4QT5A 4EDXB 2Q76B 5GSRB 1JYNA 3W0WA 2AJ3A 4XP9L 3VRJB 15C8H 4NNPL 4PJ5A 2F53B 3L95A 3CDGB 3SPVB 4HEME 1N6UA 1J8HD 4FQCL 4YXHH 3RFZC 1MCSA 5ANMB 4G6JH 4GBXC 3KR3H 2ZUQB 4N0YL 4BZ1L 5HYQB 4FXGB 2JCCE 2J6EL 4DJMA 2Y7QA 3TV3H 2BP3A 3PL6C 2Z31A 2BRRH 3AB0B 4R0LC 2B2XH 2NZIA 25C8H 5HDQH 1MH5A 3U0PA 4IOFD 3MUZ1 1YY8A 4LCIL 4KY1L 5I1DA 3VGBA 3P40A 3ZYZA 2J5LB 3TEUA 2GTWB 2BMKA 3M8OL 3OKYA 4UAOB 4MAYB 2WQ8A 2RAMA 2IPUK 4MB5A 4U1HB 3TH3T 3N9GL 2HTKD 4GQ9L 2VLRE 2D9CA 4HUKB 3DWTA 5F6IB 5EOQL 5GZOC 1HQ4A 3QRGH 1AJ7L 4JZNA 3HPJB 1AIFB 2A77H 1OOAA 2DMKA 4MSWA 4KUCD 3MV9D 1VACB 2QHLA 1M05B 1BGXH 3GB7A 3KYKH 1CWVA 4RFEA 5D7LD 5C0EB 3VE0B 4PJXB 1X5IA 2GK0A 2V5YA 4LLQB 1T0MB 5JDSB 5EO1B 3NBNA 1OD7A 4WJ5A 1DR9A 1I7ZA 3BKML 3IKCB 1MEXH 5E0QA 5DJCB 2YPKA 5AD0B 4PJ8D 2X7LB 5GRZA 3VXMA 5KS9F 1BZ7A 4J1UA 3FN3A 3G08A 4LLUB 3V52L 3VRIB 2EDDA 1DUYB 3BKJH 3EOBB 4KRNA 2MFNA 2HFFB 2AJYH 4PJBF 2AQ2A 4U1GC 4M7KH 1HN1A 1RJLB 1NMCC 2YHGA 4S11A 4PLKD 4ERSL 1KJ3H 1IKFH 3P73B 3RUGB 2WBJB 3IVKB 3DARA 2JK5B 4LMQI 1I1RA 3IDGA 1AFVL 1LEGA 1X4YA 5DYOB 4NBXB 5DR5L 5MP6H 5ABDE 4AMKL 5F7EL 3UDWC 2GSIA 2BNRD 4NSKB 4UDTA 1UEYA 2BY1A 4NN5B 1T0NB 3ARDD 5E00A 3KXFB 2W9DL 4U1SB 5L0QB 1RURL 2CDFB 4MJIA 1RUML 4ZDHB 1AHWB 1MCDA 1HHGB 2ENYA 2HFEA 4JEGB 3JTSB 3E0GA 3RWHA 1ITCA 3EJZC 3GSUA 3B5TA 2VQTA 5CWSB 1U91A 1FORL 4LHQB 4YO0A 3RGVC 3DHJA 4H88H 3IFLH 2KDGA 1WWCA 4Z7VB 4PJGF 5GJSL 4H0HB 3MX0A 3SQBA 3JVGA 2OP4H 3I84A 5ESVA 1XF4B 5EO9A 2EDNA 3JTTB 1RVFH 3NOIA 4I9WE 2EO1A 5EPMA 2FO4A 3MV8E 5D6DA 1QBMH 4FQXB 3KVQA 1FVCA 5HHPB 1UA6H 1DBKL 3DXAA 5JOEA 2ZUUA 4GW5B 4LGSB 4QNPE 1R5IA 5GGVL 4UDUA 4BSWA 3JWOC 3I6KA 1D5XB 4CMMB 3LSOB 4YXKL 5IFHL 3TC9A 4AJ0A 4KWUA 4DGVL 1BIIA 4KRPB 4OLUL 5FM4A 1H3TA 2ILLA 5GS0H 3CFBA 5D1ZB 3QDGE 1G0YR 4HS3B 4K94C 3L3HB 4ZXBA 4XWOD 3FQNA 4PP2A 2HTKC 3T3MF 4KUZL 4PV9A 5HYJD 1IEBA 1CFSB 5SV3A 1IAIH 1VSCA 4NKOB 5E6ID 3VWKB 4ZFFB 2GAZB 3QUXC 2VDQH 4S1QL 4DUXA 4ETQB 5FV1L 4F3FB 1PG7L 1F3DH 5E1AA 1LO2H 1DQMH 3FT4B 4QRTA 3MRMB 2F15A 1U2HA 4PRAA 4NZJA 4KI5C 2BC4B 1X6LA 5EWIH 1ZLUH 4N9OB 3NZ8B 1ERNA 1R3HB 4QTIL 1KGCD 2AJSL 1FFOB 1M6OB 1OHQA 2ZSVB 2CLRB 2HKFL 4JY6B 3BKCH 3NCJL 3RNKA 5SX5K 3QBTB 3AU1B 3LB6D 4GAJH 4R4NC 1VFUA 4KXZI 4ODSH 5IB3B 2XICA 3TZVA 3NMEA 4PJHE 4GG6A 2BCKA 4JM2A 1CI5A 4RISH 3U0WL 4HGMA 4R96B 3D2UB 4Z6AT 3QXDB 1OCWL 1DBAH 4I5BB 1ND0A 4OLVH 5IBUG 3TO4B 2P5WB 3L3GB 3RL2A 1FLTX 1J11A 2BNQD 5AUMA 4L8CA 1GAFL 4DEPC 5LGHL 3IJHA 4PLKC 4HD9A 4A6YH 2DI9A 2VLKD 3G04A 4HWEH 1JWUB 2H1PH 3T65B 5IMMB 1HKLL 1VESA 3CZFA 4FTVD 1WIPA 1OP3H 3UJJL 3WIFB 2GYSA 1WAAE 4ONGH 3S34H 4LSRH 5DUPL 2R2BB 3MLRH 2YSSA 4TNVK 3QIBC 3VI4F 3PGDB 3DMMC 5HPOA 2ESVE 3NA9H 3ARGC 3O2VL 4HWBH 1YN6A 2DLFH 3LDBB 3GJEA 4RZCA 2P5EA 2VDOH 4KI5E 4MAUL 5T5NF 2V9RA 4U6YA 1EGJL 1G9NH 4L9LC 3CLEH 2EKSB 1N0XL 3E6FB 1QSED 4NRZB 1BZ9A 4XZUB 1BWMA 1PKQA 1WWBX 1UCBL 3TPUA 5CKAA 1JGDA 4KDTA 3IDXL 4QEGA 2LAGB 4WWKD 2BVPB 2VZ1A 4D3CL 5C07B 4Y5YA 4U0RC 3BXNB 4FZEH 1S7SA 3QNZA 3IDJB 4M1DL 4KUCF 4C56A 3WCYA 3GEWB 4X7DC 4NM4L 3SDCD 5HGDB 5FGBA 4Z78A 1CL7H 3S36X 1NKRA 4KMLB 1NEZA 3MLXL 4OCMC 3GMNA 1NGWA 1U95B 4I18A 3KJ6L 4K7PH 2EXWD 4MNQA 1QRNB 5AG8A 3DX8A 4G6FD 4BSJA 1ZGLB 1Q38A 2MPAL 4WO4A 4Z7OE 5GGQL 4OCWH 4X5WB 1U36A 4JHAH 4JE4B 4XT1C 4GO6B 2IQAA 4BFBD 3U4BH 3HUJF 2KUTA 1JWSA 2WP3T 5ACZA 3MQIA 2P1YA 1LE9B 4P99A 1YMHA 5CIPA 5E08L 1JGLH 2WWMC 2B8OT 2MMXA 4X6DF 3CGTA 5DD3L 1L9MA 1JGEB 5ID1A 4QT5B 2A9MH 1MCPL 4CN6A 1C5BH 3QIWA 1YPZF 2HJKB 5GGRY 1J8KA 3W0WB 3I2CL 5DEZA 1YC7A 4PJ5B 3QXWA 4R7DB 1UB5B 2DQFA 4EXPX 5GRJL 1P69B 3L95B 4PUBH 3ZE0F 1Q72L 5TQ0H 4YHNA 1YEKL 4NZRL 2X40A 3LB6C 4LEOA 3RVTD 3C8HA 4O2CA 3VD7A 1R3KA 3M17A 2NX5E 1JHLL 3GSVB 3PUCA 1FZOA 1EAPA 3QEHB 4JG1L 2IFFH 1VENA 2Z31B 1NCUA 5JW4N 5HHMD 4F57H 1DDHA 3LS4L 1MH5B 3U0PB 1ACZA 1BIHA 1YECH 2GJZA 5TPWH 3PV7A 4P5TA 4ZPTA 5I1DB 3VFPA 3JV0A 4CMHC 1LD9B 4RAHA 4PJDE 2BMKB 4YC2B 4DAGL 5JZ7D 1GCFA 4KK9D 1CU4L 2YA1A 1E4XL 1T89A 4MAYD 5I1GL 3GK8H 1ZHBA 4JFFA 1LP9A 4OQTH 5JIIA 1A7RL 4W4NA 2APVA 2B1AL 5FYKE 5DMIH 3VFVA 3CVIH 3C6LB 2A9NL 2GJ6A 2UY6A 3MV01 1KXTB 5E94A 3S96A 5HI3C 4LMQE 1F4AA 2FL5A 3HLAA 4S1DC 4JPKL 2FHFA 1VPOL 1HQ4B 1E4JA 1G7HA 3OAYH 3CLFL 4CADA 3K81A 4MSWB 3W81A 2WIMA 1AKJB 4OGYH 2EH7L 3GB7B 1JZ4A 4EQ3A 2D0HA 1MI5A 4J12A 2A6IB 3H9SA 4RFEB 4UIKH 3L3OB 5JNYA 5JW4M 5KANI 1VKXB 2F5AH 2GK0B 1HE7A 1AGBA 2FH8A 3QJHA 1DFBH 2Z8WC 2Y25A 1FYHB 3CDFA 4A2LA 1I7ZB 3WKMH 1LE5A 1S7XA 4NUGL 4TSCH 3UTPE 3UYOD 4PG2A 2NW3A 2LU4A 1BF8A 2YPKB 3VCLB 4UBDC 3VXMB 1SJEA 2PO6C 5CFHA 3O4OC 3UTZA 4WTWA 1BZ7B 2PYFA 1WVZA 3I6LE 1A1OB 1KPVA 3SDCC 5IBUB 5CUSL 3ZDXF 1NEZG 4H25B 3MNVA 4W81A 1RIHH 4W6WB 2IPUG 3NACH 2V2WA 2WBJD 2FJFA 3DBXA 4K8RL 4TTDD 3IDGB 5FCUL 1NPUA 3VGFA 1BF2A 1LEGB 5GS1C 1AQDB 1RU9H 5ID0A 2UZXB 2GSIB 4TQEL 1B3JA 2EDRA 4UILL 4UDTB 1A7NH 5TDNA 1BBDH 4HULB 5F6HI 1MAJA 3IAGC 5E00B 3CPLB 5C09D 4ZMAT 3GRWH 1YEIL 4HMDA 5JXAL 2VITA 5IT2H 1DN2A 4P46C 1UYWH 5I8KL 1ZLUK 2X70A 1Q9LA 3NTCH 4YPGB 5DK3A 1FFRA 2QLVB 4N0UB 2R69L 4JKPL 5F1NA 5I1CL 2Z0BA 3V4PH 3RWHB 3OAUL 4L4VD 3TCLA 3L3DA 1U91B 3G6AA 3C2AH 4YO0B 1BJ8A 2J12B 2IPTH 1DL7H 2DQIL 1P84K 2FATL 4YFDB 2PXYA 3A0OA 1QA9A 4J4PC 4OD1H 5ESVB 5K59F 4IM8A 5EO9B 1BMGA 1JNNL 5JA8B 4G9FA 5FYJL 2FO4B 1K4DA 3Q5TA 4FQXD 1W0YT 3CCHA 5DVKA 5JXEA 4IHOA 1X7QA 1HSAB 1YYLL 3FL7A 4NGHL 1Q0XH 2E27H 1R5IB 2QR0A 4UDUB 4BSWB 3I6KB 3DUUA 4KTEH 3CFIC 2YD2A 4Y5XA 4LSPL 4A2MA 2FECL 3UTTE 2ADIB 1OGAE 4NQXA 1OP3K 2ZNWA 5D1ZD 3CFBB 4JFHD 4ODBD 2A0LD 2XWTA 3HTLX 3RAJH 3K7UA 3WE6A 3O3EA 4G7YL 5EU6A 3FN0L 3RP1A 4ZXBB 2ICWA 2QQNL 3MYZA 4CW1A 2QQKL 4PV9B 3U46A 1IEBB 3I9GL 1RZ8A 1YEDA 3UC0L 3VXTA 3RDTC 1UKQA 2C3VA 3O9WC 1NBVH 2VDRH 5FGCE 5CD5D 4M7LL 1L7IL 2HKHH 1FJ1A 5E1AB 4QRTB 3CFCH 4PRAB 4RMQA 3W11D 1KV3A 4U0QB 1MCNA 2XZQH 3V95A 4LBEA 4P59L 2CD0A 5T3ZH 2IAMD 5FB8A 3IDUA 4LHUA 5D1QD 1CVRA 5AG9A 1IC4H 4OV6F 5LWYH 4ZS6D 3RNKB 4BH8A 4URTB 2VC2L 1K6QH 2HYMA 4E0RA 5IW1B 3GMMA 3GGWB 2PUQT 2X2YA 3VXUE 4HT1L 1JK8A 2BSSA 5J6HA 3D69A 1ND0B 3DJ9A 5I2IA 2P5WD 5IOPA 2D7PA 3BOVA 2DKSA 4MWFA 3K1DA 1GZQA 3BGFB 3RVUC 1YJDH 1FNEA 5EOCL 1IFHL 3G5YA 2QSQA 3IJHB 2DM2A 1BQUA 3GI9L 1ZA6A 2FX7H 4RBPH 5IHZA 1KIQB 4F7MA 3ULUH 4KKBC 2YEZB 3I50H 4L1DA 5I19H 5J3HD 4TNWF 2YSSB 5C71A 1ZA3B 3MUGA 4Y19E 5TQ2L 3VXSA 3R1GL 3GBMH 3FO9B 3H6JA 3M45A 3QQ9D 1P4IH 2J88L 1T1XB 1YN6B 2FRGP 4U3HA 1CXIA 2EIEA 5KVEL 4RZCB 5FO7A 3BO8B 2P5EB 5B38B 4M6NL 5IHLB 2YUVA 5CGTA 1K85A 4HUVA 4U6YB 3X17A 1A7PL 1E6JL 5EBGA 5MERA 1NDGB 4RMVA 2A6KA 4ZD3L 5EUOE 5IG7B 4ODUB 3TPUB 2OTUA 4Z7QE 5DJ6B 5E2TL 3ETBF 4Y5YB 4KHTL 2B4CC 2NY3C 3F65A 2V6HA 1S7SB 3MRQB 3QNZB 3OPZH 3S3JA 1CTOA 1U2CA 2WINA 3ARED 3C60D 3PNWA 3QI9D 5HHQA 3N06B 4P2QA 3X3GH 5E8DL 4Z78B 2EC9U 5F7FA 4UT7H 5HPMB 5SV4A 4GAFB 1NEZB 4Z76A 1NGWB 4I18B 1EH9A 2E9BA 4PJXF 4MNQB 1NFDB 1YEHH 5CZKA 3DX8B 4HPOL 1CD9B 3O3DA 3LKSA 3CSPA 2AEQL 3U6RA 4WENB 1UG9A 1TENA 1NC4A 1WBXB 3NCCB 1GL4B 2NY4B 2XT1B 2R4RL 3GSNH 1IQDB 3MRGB 3S98A 4DFIA 1EZVX 2FB4H 4KTDL 4LLMA 4JN2B 3OAYK 1I3GL 4W4OC 3SE9H 1I7TB 3P0YH 2ED9A 5ACZB 5AZEL 3L3KA 4KJWC 2H8PA 3VA6A 3P9MA 4YUEL 1YMHB 2R1WA 2F8VA 1FRGH 3N1MC 1EK3A 4ZSOA 1GIGH 4MA7H 2EO9A 3G5VA 3QIWB 1DANU 3PGFL 5LBSH 3TVMA 3RUGF 1G0XA 3MRLA 4PJ5D 3AM8A 3QDJA 2IAMC 2DQFB 4LHUG 3T0EC 4UT6L 3WEXA 3PWPE 3W9EA 5KSBB 3BN9D 1MCKA 2D7QA 4JFZH 3AAZA 4RX4A 3B83A 5FM5O 4YHNB 4KVNH 1U6AH 3D39B 4LEOB 4O5LL 4FFYL 4EDWL 5B4MC 4O2CB 4JB9L 4X99B 1RQ5A 3M17B 1KCSH 1EAPB 2DWEA 5MI0C 2Z31D 4QXTA 2ICEB 3CAFA 2OZ4H 4XI5C 1CR9L 3UXFA 1MFAL 1WZMA 2DKMA 1CD0A 5ADOL 5J56B 2QV2A 2Y6SD 2GJZB 3O2DA 4ONHA 4P5TB 1ZT7A 5JHDD 4PRIB 4JQVC 3VFPB 2BY2A 1II4E 3EDDA 5CILL 5IEHA 3V4UL 4DTGL 4HS8H 1IEAB 1C5CH 2EDKA 4I4WA 4LPTA 1ZHBB 4JFFB 1LP9B 4K8RD 4IMKA 3LKQB 1GYAA 3CSYB 2GJ6B 4MD5B 3Q2CA 2YRLA 2X1OA 3HLAB 3F7QA 1KEGH 4CADB 1F11A 2N7AA 1FGNL 5IVOA 3H9YA 5GHWH 1MI5B 4OBRA 3H9SB 4Z95H 2Q86A 2EDBA 3LCYA 1Z9LA 2WLZA 2P42B 1U8IB 5JNYB 3OZ9H 4XPTH 5D2NB 3QJHB 4UI2A 1G0DA 4LSSH 4PJIA 1UM6L 2DTML 5C0AB 3GBLA 2R0WL 1S7XB 1BP3B