1FDLL

Crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYYTTTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA D1.3 FAB (LIGHT CHAIN)
publication title Crystallographic refinement of the three-dimensional structure of the FabD1.3-lysozyme complex at 2.5-A resolution.
pubmed rcsb
source organism Mus musculus
molecule tags Complex (antibody-antigen)
total genus 52
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1990-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlL01
4WUUE 2R0WH 3NH7H 3PXJA 1MCWW 5CINL 5T1KD 5JUEH 1PEWA 4LHUG 1KYOJ 2LU7A 3IF1A 3O2DH 3QG6A 5ECJE 4PJ9A 2YD5A 2OJZH 3CFCH 1KCUL 2AAVA 2E27L 1G7IA 4OCYL 1HQRB 4JO2L 2AXJA 3DARA 3WEXA 4BSWB 3ILQC 5IBUB 1QRNB 3RJQB 3EJYD 5D2NE 2V17H 4L1DA 4M7LT 5JQ6H 2N56A 4MGXA 4BQCA 1A4KB 2WBJC 5I0DA 1J18A 3LCYA 4RAHA 3TLRA 1BWMA 5IW6B 3RWCB 4FQQA 4GKNB 3QFJA 1CFQB 5FCUL 5JLZB 1HH6A 1MELA 1U92B 4Z8FH 5FHAL 1IVLA 1Y18A 1CFVH 4WI8A 2VC2H 1A14H 5IROC 3JVGA 2XN9D 3MXVL 1EEYA 2X4UA 2P8LA 1M6OB 5EBLA 4TVPL 3LRSB 1SYSB 4F3FB 3GM0A 4WFEE 2A6IA 4M7JH 3TYGL 5BZDB 1J8HA 3MRJB 2Q1EA 1DVFB 3EKCA 4TTDC 4HUXA 1EH9A 2P7TA 4R4ND 3ES6A 3S34H 2F58H 1MCBA 1DEDA 4Z0BH 1U6AL 1IC4L 3OR6B 1RZFH 3S7GA 4PGDB 5LVEA 2WP3O 3GI8H 1AO7B 4RGMB 1SJVA 1TDQA 1UEYA 4R26L 5AUMA 3MBEB 1IEAA 4GBXD 3FQUB 1MCRA 3BXNA 4U31A 4DZ8A 3HCVA 1S7QB 8CGTA 4JKWA 1EEUA 1KT2A 3U48A 4F7EA 2I07A 4DUXA 3VMNA 5T3ZE 1CQKA 1JRHL 4QXUL 4V1DD 3WD5L 2IQ9L 3EYFA 3GRWA 1IGIH 1T0NA 3DUSA 4KGJA 2X05A 3V0WH 1ONQA 5KAQF 3N9GH 5DEZA 4O58H 3RWFB 1F42A 1N6VA 3IJSB 2M2DA 4KK6C 3RGHA 1LDPL 1MCOH 2IEPA 1BFVH 4JFFE 5E5RB 4CW1B 1JFQH 3C60A 3MJGX 1WCBB 4PRIA 2YPLA 3HE6D 2MHAB 4XCEB 5EUKA 3U36A 2PCPA 4U0RC 2BC4B 5I6XB 4DK6A 4OM0L 3IAGC 3MRBB 4PJ5E 4OKVB 1MFAH 1U8MB 1YEFL 1WBYB 1YC8A 5IJVA 2A1WL 4YEFA 5KSAC 3G5ZA 32C2A 3QUZA 3RY5A 4XNXL 4ODHH 2FX7L 5E8DH 4YH6A 1U9KA 5ADPL 1KCVH 1AGEB 3NCBB 4JVUA 3RZWA 4ETQA 3DGCR 3PJSA 2IFFH 3L3IB 5CWSA 4HMDA 1A7PL 2L0DA 1FZOB 5C0EA 1ORQB 3EOYG 4EN3C 3QEGL 2Y07L 1NCBL 4PGCB 1I1AC 3QXUA 3VI3E 1NSNL 3ARVA 4YHLH 3GI9L 3RY4A 3RDTD 3VFTB 3QIBC 4O9HH 1P9MA 1I8MB 4WNQB 1XR8A 4FQIL 1FHGA 4CADB 1OF2A 2X4SB 3ETBF 5ICYB 4FNLL 3GGWB 4OIIL 5DRWB 3FB8B 3QQ3B 1OSZB 2OR7A 3T65A 4X6DA 1MQKL 2QHRH 5KSVA 1LE9B 4NJAL 2ZSWA 3UYRH 4Q9RL 3O41A 3IFOB 5FYLH 5IESH 2GTZA 4JQIL 2H6PA 5M94B 3O3UN 5INCA 2PO6D 2X4OA 1JRHI 1Q9WA 2YD7A 3FT4A 4PRNA 5EU6A 4NNYB 1XIWB 4JHZA 1D9KB 4JFHD 3MUGB 4XCYB 1JGLL 1UCTA 4GKZB 4JZOB 4HBQA 3RPKA 4WUUB 1R5IB 2GY5A 4QRPE 4K23L 4GXVL 1N5AA 5C7XL 2EXYC 2NY6B 2Q3AA 5BVJB 5BMFH 1VADB 2R23B 4NWTH 4G8EB 1I8IA 3V79C 1S7WA 4JJHA 1HNGA 2DLFH 1BJ1H 5DJCB 3DX9A 5GHWH 4MYWB 4EBQH 2YSSA 4YHOH 1JPTH 4KHXH 1ZWIA 1FVCB 2E6PA 2R2BB 3PG2A 4GW4B 5KN5A 1AJ7H 2DYPB 1YECH 1LP9B 4CVXB 5IF0B 5DHVB 1QBAA 3F58L 3RA7H 2VAJA 1UXWA 5D7LA 4OD1H 5JHDE 2VLRA 4IIQB 4MJ5A 4RGND 3LRGA 1RVFL 4HJGB 3D18A 1UA6L 4RCAA 4QF1B 4LLDB 1KF9B 2MQCA 3QNZB 5E8NA 4KQ3L 5C9KA 2NY5H 4QRSA 5DS8B 1MLCB 1VFAA 2Q8AH 3LRHA 4K94H 4KRLB 4OQTL 4YHMH 3WDIA 1G9NC 3KLHD 1YN7B 5LGJA 2MKWA 1S9WB 3ZHLA 4HWZB 3BN9C 1VGKB 3C6LA 1ERNA 2CDFA 4EVNB 2NX5A 2RIKA 3D3VB 4XPAL 1T5XA 5D6CB 5CEYB 5K93A 4PJXA 5I1HH 4TUKH 3BEVA 3O11B 4QOKD 3MJ9L 2OR9L 2HKFL 1T22A 1OSPL 2Y25A 4OZGE 4XVTL 2IMMA 5CJQH 5KSAA 1QNZH 4XCCH 4JZJB 3PWUB 1URLA 5SWSE 3OKNA 3H8NA 4NNXA 1WLHA 5JW5B 1IQDA 3BESR 5IWLC 4M3JA 3DYPA 3MA7A 5HHMD 4ZNEA 1A0QL 1JGDA 1IC7L 2WANA 5DJ0A 5F9JA 3UTSD 1FZMA 2YUWA 4QHKI 1I1AA 1WZLA 4OGZA 3BD3A 4OV5A 4POUB 4GG6F 1YYMH 3HN3A 3DMMA 4OFVA 5FGCB 1SBSL 3DO7A 2DBJA 4FN0A 1I8LC 2PXYB 4NQCD 4WEBH 5LCVL 1P7QB 2UY7A 3BIAX 4XNYL 1JN6A 1KB5A 4DGIL 5TE4H 3O2WH 1ZANL 1CXEA 4HXAL 4Z5RB 1G6RL 4PJAF 5GS1A 2ED8A 1JWUA 1K5NB 1QFOA 2DI8A 5DEGA 4TOYL 2WBWB 1D5IL 1UM5L 3C8HA 4Q6YA 3CXDL 4CGTA 4U3XA 5EIVA 5HYSA 4FQLL 1EXUB 2HWZH 3EO0A 5F9AC 3WFHB 3N0PB 1UZ8B 1HN1A 3M8OL 1B2WL 4HWBL 4NO2A 4YC2C 5GPRA 4QGYA 1PYWA 4R0LB 1DQML 4XPFL 4JQXC 5ESAB 4A2LA 4Y5XC 1P4BL 4PJ7A 1VHPA 1NUGA 3NGBB 4BUGA 1ND0A 2BRRL 4ORZC 6FABL 4HXBH 3F7QA 4PLJC 5CIPH 4G43A 4P48A 4YDLC 4TVPE 4AL8L 3GMOA 4DKEH 5C0GA 4KUZL 3ARDB 3QEQA 1G9MH 3CVHL 3L5XL 2V5SA 3SDCD 4FQXD 1Z9LA 2ZP0T 5HDBE 5D5MF 4KXZI 4BH8B 4BQ9A 3QDAA 4UZGA 4YPJA 1VFBA 4HC1A 4NYLA 3RWGA 4DKDC 3JWOC 2ESVA 2NTSP 5J9PB 2P5WA 1UZ6F 5E6IC 1MFEL 1CL7L 5F7WC 1U8OB 2IAND 2QKIA 1F6AB 4Z7VF 4RRPA 1I7ZA 3RTQC 3LKQA 5LGHH 4DW2H 1EDQA 1RZ7L 2VLJE 2YR3A 3O6FA 4G5ZL 1JWMA 3N50A 4ZQKB 1IEHA 4MQTB 1I4FA 2NPLX 3QUMA 4S2SA 1IGJB 3FO2A 3MRKB 4IBLT 2QSTA 2V7NA 1CFSB 5LXGH 2R1WA 3NIFF 5T3XD 5FGBC 4WY7L 3GHEL 4LOUC 4P9ML 3PWJA 3DTXA 5DK0A 1RI8A 3ARPA 4P4KC 4YBQC 1R3KA 1HHJB 2WINA 5IWLA 1KEGH 4HSQA 2I9TA 4L3CA 3SJVD 2PYED 3CFKB 4ZXBC 5F6IC 2JKXA 5K9OA 4AG4L 3TBVA 3LV3A 3A67H 4PJIF 5I1DA 2CKBL 4UDTB 5LQBL 1LE5B 4JFEA 3U7WH 5DQJB 4YXKL 5EUOE 3ILPB 1JJUA 4M7ZC 5IHUL 2AJSL 5CHNA 2OL3B 1BFOA 3ROOA 3FQNA 1KIRB 5IB4A 5IW1B 1CR9L 3MRLA 3PNWB 4L9DA 3OJMB 4FXKA 1U91A 3QJFB 1ZT4B 2B1AL 4OAWA 4DKFH 4LSUL 5EDXA 5LWYH 1U8IA 4FQCH 4J3XA 4PJHE 3MRCA 5FYJD 3U82B 1F4WH 4X6BA 3LN4A 1VEOA 3QHFL 2YBRB 1Y6MR 3W82A 3IKCB 3ROLB 2WWKO 4F37K 1IL1A 2EE2A 2AGJH 5DK3A 4F7MA 5HHVL 5J8OA 3QULA 3FOLA 5IB1B 3OKMA 2N7BA 4D3CH 1Q0XL 1XF2B 1HHHA 1RUAH 4UOJA 1G7HB 3CH1B 3HC4H 2NNAB 5EU3B 1U58B 1N64L 1AI1H 2X1WL 3OJVC 3EJYC 1YNLH 5EU7C 3MJ6A 2B1HH 3RPIA 3RX5A 3VRLF 4WW2F 4C56D 2FHCA 2NY3B 3VFGH 4G7VL 1DUZB 3H9HA 5I71B 3TBSA 4KI5F 4KROB 2J6EA 4R3SA 4HKJB 1EVTC 2CIIA 4OF5A 4WTWA 3REWB 3GMQB 2ZZUT 4LCWA 2FYYA 4XMKH 4YNYA 1T4KA 4K9EH 5C86A 2EYTA 3KGRA 1S9VB 3KYKL 3HR5A 4JRXA 4PJGB 1DBAH 5T1DH 5IVOA 1EUUA 5ANMA 3LQAL 4JEGB 2XTJD 3MLYL 3RTQA 5HVGB 4B53A 1JTOA 1K4DB 1TTGA 1BIIB 4B5EA 1S7RA 3H6JA 3EYUL 1TQCB 5F70A 2LVEA 1INQA 3CK0L 1T7VA 1O7VA 2NY4D 3OG4B 5DR5H 2AEQL 4XPHL 2VMFA 3FAXA 2J8UE 4MAUL 5FFLA 4OFDA 4X4ME 3SKOB 1K8DB 4GBXC 3QDGE 2UWEF 4JO3H 2FJHA 4AZ8A 5JOPD 1I85C 3I3DA 3S97C 3V4PL 1I1RA 5EPMA 4J6RL 5EU4B 1E4KA 1MIMH 4CN6A 1NGQH 2BVOB 5C2BL 4HT1L 1JIBA 2V7HA 3F5WA 5E8OB 5E95B 5CJ5A 5HI5D 3GSRB 3MJ8B 4UAOC 3TV3L 4OI8A 1NDGB 1P4IL 5DGRA 4PRHB 3L3DB 4MDJB 5IQ9B 4FQPA 5HY9A 1Q1JH 1LD9B 5ESQB 1VFUA 3HPLA 4FQ1H 4OZFA 1YY9D 4N90D 1I7TA 2CIKA 3DRTA 3MREB 4OBRA 1PBYA 3QB7C 1XGTA 4EDXB 4YAQA 1CG9A 1JCKA 1M7DA 3HE6C 2H9GA 4I77L 3U6RA 3HS0A 3ZL4H 4ZAKD 4APQD 5ALBL 4BELD 5C07E 3GRWL 2GAZB 5SX5K 2D7NA 4RAUB 3HB3D 2FZ3B 4LSPL 1L6ZA 4K3EH 1FFNA 1W0YT 1I9IL 4N0UB 5LAXB 5GISL 1CXLA 3IDXL 1XH3A 5T1KA 2H8PA 2JF1A 5C8JA 3EOAA 4AT6A 3QBTB 5GGTH 4LSVH 3UCRA 1IAKB 1UM6L 3A6CL 1QLEH 4OZHE 3G5XA 4OZIA 4K2UH 3SO3B 3WXWH 4ODBD 3RDTC 3ZE2F 3F7PC 1KGCD 4EIGB 1VDGA 3TVMA 4UIKL 3G04B 3SDYL 2W60A 3WJLC 5EUOB 1WAAA 1XF4A 5C0BB 1SM3H 2X5PA 4H1LA 4LGPB 5JPMB 5GJSL 3X11A 4PJDA 4OGYH 4WU7B 2EDWA 1IM3B 2R56L 1IAII 4AMKH 3SDDC 5IGXH 1KNOB 4HUUA 4RGOL 2PO6C 3QPXH 5D7IB 5GGQH 4YO0B 1U8JB 3X3GL 3E8UH 3KAAA 2QHLA 1FLRL 2WW8A 5DD5L 1IAOA 5ESVB 3B9EA 4WCYH 1NCWL 4X7SL 3CDYA 4XP1L 2O5YL 4RAVA 4CN4A 1K85A 4AENA 4F57L 3G6JE 1AXSA 2H32A 4EUPA 5J12C 1B4JL 1P84J 4P2QB 3OB8A 3U9PL 1DUYA 3MRDA 1PDKA 1YNKL 2GJ6D 5KBNC 3W5NA 3OGCA 5DHVH 2ID5A 3U0TB 3V52L 1PSKH 1ACYL 5D70H 4JKPH 5HGDB 1AR2A 1V05A 4P46B 4GBXA 4A2MA 2R0LL 1JHKL 3BPCA 5IHBA 1U8QB 1T21B 1WBXB 2HT4D 3MLSL 3RZCD 3WHXB 4ZPTB 5KVDL 4V1DA 3QDJA 1R3HB 4RGNC 1TIUA 5SX4I 3VXNB 2RCSL 1MCQA 5D72H 2EH8L 5F96H 4M7LH 4OLUL 1OGAE 1BM3L 3X14A 1CDCA 2D31B 3FFDA 4R7DB 4NC2B 3ZE0E 1XGQA 3DX7B 3L7FB 3PWPD 4HWNA 3PP4H 9CGTA 3KLHC 3HUJE 4GRMB 5FHBL 3IRPX 4EXKA 1SMOA 2P44B 5IEHB 2GYSA 1JK8A 1FBIL 2VSDA 4XC1H 4D8PB 4OUUA 3C5ZD 4ODWA 3SGKA 5HDOA 1SJXA 1QQDA 2A83B 3KPOA 4LKXA 4TTGA 3AXLB 3AM8C 4HIHB 3MTRA 4PJFE 3FOMA 2IPUK 4L8BB 1C5CL 1TJIH 2EYSB 3BP7B 2VWEE 2DJSA 1OAQH 2HA1A 3MCG1 3S5LA 5INDB 2DBLH 1T7ZA 4LLUB 4QTIL 4NRXB 4G42A 4X4XA 1FFOB 2X4PA 1R5VA 2BY3A 2VDQH 2H3NA 1L0YA 2OTWB 4IRSB 4JQVC 4HV8A 5TGBA 3WXVL 4HUVB 4X5XA 3RJDA 2F54D 3NAAH 2HTLD 3CFEA 1FNEA 1MRDL 3REVB 2E7BA 3BP4B 3D85B 3QO0B 4U1IB 4F9PC 4LKCB 4A6YA 2PO6A 5B39B 1P4LA 5C07B 4PBWD 1JZ5A 2AQ1A 3VJ6A 1ZT7B 5I1JL 1I9JL 4N8CH 2Q86A 1ADQL 3T77B 5I1KH 4PR5A 2AS5M 2IC2A 3CFIC 4KVNH 1GAFL 2BNQB 3DX6A 4S1DD 4C55A 1LEIB 4JVPA 4FZEL 4PS4L 4K71C 3L5JA 4XH2B 5T1LD 1PY4A 1FNGB 3N85L 3VW3H 3PE9A 3BMWA 4OV6F 1M1SA 4HAGA 2F5AH 4FG6D 3C09B 5GRUH 1H3TA 4AIXA 4HQQH 2V9TA 4Z9KB 1KFAL 2IPTH 3BKJH 1H3VA 3PWNB 5TDOA 2NY0B 5E1HB 5F7DB 3X3FH 3CLFH 1H5BA 5ENWB 2Y1VA 3DUUB 1T1ZB 1WISA 1OM3H 3SDCC 4FQXC 4M6ML 4YIQA 1CK0L 1GGIH 4CVUA 4PB0L 4GRWE 5HPMA 1BJ1J 1FAIH 5KJRH 1QSFE 3QFJE 2HJFB 4LLMB 4ONHA 1FYTB 3MLWH 5M95B 4WV1C 2C3HA 4UTBL 1NGXA 2P45B 5C0RH 3QHZH 4K3JH 5D8JH 3GJFA 2DIJA 1HHKA 4YHKL 3G6JB 3PDOB 1J8HE 1CS6A 2X7LA 1KXQE 4IDJH 1QR1B 4RISH 3CVIL 1C08B 2YA1A 2CUHA 1JF6A 3NOIA 3WNKA 2GITA 4MB5A 2IBZX 4EQ3A 1LEKB 5IVXE 2DWDA 4OCXL 1GGBH 3RVUC 2B5IB 2ILLA 5MENB 1K3IA 4NHUB 4OF6A 2R1XA 5IM7B 3QFDA 3TYFB 4CMMB 4TUOB 4JO4H 2D4FA 4LRIA 1RIUH 5C71A 3OAZH 2DLTA 3PABB 1NBYA 3W9EA 2DQGL 3LEXB 3H7LA 1CT8A 1QKZH 5EOTB 5D4QA 4Y4FD 3BPNB 4QRTA 2AKRA 1P7KB 4UIMA 2OL3H 4WHCA 4PIRF 5I16A 1FIGL 3QUML 1FFPB 5EA0H 2V2TA 1P5UA 2Y5TA 1MREH 1HXYA 4G8GB 3HAEG 4XNMA 4LU5L 2CMRH 1NBVH 5IVZB 4TRPH 4NQCA 1DZBA 3PQYB 5I73B 3U7YH 2ZUUA 1UWGL 3BE1L 3MMEB 4NN7C 4ZO6A 5HYSG 3T0ED 2LABA 5EBMB 4PJEA 5A2JH 3WUWB 1BQUA 2V6HA 3ARFA 5ICZA 4XCFL 1DN2A 1YEKH 1PJ9A 4ZFGH 5DK2A 4HFUH 1CWVA 4XNZC 5GGRY 4U3HA 1KPVA 4X6CF 4PJFB 1LK3L 4PRIE 4YQXH 2GFBB 4DEPC 2YPLE 4NDMB 4WI3A 2P47B 4WW2C 1TETL 4PRPD 4JFYB 2AV7A 2GUOA 3OR7B 4JFPB 4OLXL 1FL3B 3K3QA 4EDWL 2EO9A 1B0RA 4P59H 2AK4D 3K2UH 3OKKB 3HFMH 2Q6WA 2R2HB 1QPPA 3QUYD 1R0AH 2MMXA 2FH6A 4N0YL 4W4OC 3I9GL 4JN2B 5C0DB 1KPRB 3QH3B 2R1YB 3WMSA 3CDCA 1S9KC 3KPLA 4RRPG 3TPUB 1FNFA 1N3NA 3DVGB 3SDCA 4FQXA 4CU7A 4HH8A 1ZEAL 5CP3A 3T3MF 5AG9A 1MWAL 2NR6C 1MF2H 3I3BA 4X6DE 1UKSA 3P3YA 1S78C 4HKBA 4UT9L 1IRAY 1MJ8H 1IQWL 4CUCA 5E00B 2XTJC 1RJLB 1NC4D 1DANT 5EU6E 2J6EL 3FJTA 4S11A 1DLFL 5AAMA 1T04A 1M7IB 4JCLA 2NY4C 3H9SB 2VDRL 2YEZB 5I66A 3HC3H 2VR4A 5D7SL 1FGNH 4D9LH 3SDXF 1JZ4A 5DJXA 5AAWA 3LKRB 4PY7B 1KPUA 2ZPKH 1OHQA 4RDQG 4JO1L 1ZAGA 2CDEB 4P3DA 2BVEA 2BDNH 3EOBB 5KSBF 3QCUL 2NW2A 1QSED 1ZHKB 2R0KH 4I5BA 1LK2B 1BBDL 1J5OL 3T0DA 1I8KA 3R8QA 4M1DL 4J3TA 3SJVA 4KMTH 5I15L 5DUBB 3UTPE 5HI5C 3HG1D 1QSFB 4U6YA 4FFVC 1YA5A 1YMHB 2LV4A 5SX5H 2NXYB 2J88H 4U7KA 1FE8L 4WDIB 4F15C 2QSCL 3D0LB 2D7MA 3SOBL 2PUQT 4UQ2A 5D7LE 4B7LA 3MLTA 2VLRE 1CXKA 3ZZ1A 1NFDA 1FV1B 1EEYB 1J1PL 1YY9C 4Z77B 5FEBA 2FATH 2ADIB 4DQOH 5F8RC 4E5XA 4HHAB 1G0DA 4MNQB 1KIQB 4APQC 1TVBA 1MCPL 3HZVB 3S4SG 2SEBB 3MXWL 2DQEL 5ACMA 4JM2B 3V0VB 4K7FB 5FKPB 3HB3C 1B3JA 2YN3A 3P4MB 5AYUH 2NX5E 3DUHA 5IVXB 5D1ZA 4OCRL 2HTKD 4WGWB 4MNGA 4PJXE 3DSNA 1QTYT 3OHXA 4PTTB 4ZUVA 4JFXB 3P4OA 2R0ZH 4MHHI 1UKTA 4F7CB 1A22B 4ZDHB 5J56B 5F7EL 1KB9K 1S7VB 1QRND 4PP1C 4U1HA 2R39A 2BSSA 2ED7A 5FGSA 1N0XH 5DJ8B 1KCRL 5FUZL 4F7EB 2I07B 3QA3A 5MEPA 1MHHA 1QBLL 1NJ9A 2I5YH 3SGEH 4HAFA 2H41A 2VZOA 5DZNA 1BBJA 4ZNEE 3VGAC 2O5XH 3SY0B 4PLNC 5CUSL 1TITA 4HUNB 3JTSA 4XVUD 1PLGH 1YEDB 2OSLB 4QXGH 3FN9A 3TO2B 3JUZA 3T3PF 2VAAA 4MB3A 4XPTL 4P5KB 2C1PB 1LO4L 5GGSY 1BEYH 2VISB 4ZUWA 3UTTB 5DQ9B 2R2CA 2Y7QA 3WE6A 4D9QD 1T20B 5TQ0L 4P23A 3GNML 3WLBA 4HKXB 1AXTL 3SQOH 1DVFD 1IM9B 2DD8L 5EUKB 5FUCC 4DCQB 1MEXL 3IXTA 4MXWL 3IDIB 4ENED 1F11A 3L3JB 1ZSDB 3LEVH 1A7NH 5FF6A 2YD9A 4NKOA 1BGXH 3GMMB 4WTXA 4O4YL 3QRGL 1PZ5A 1AO7D 3QUZB 5FO8B 1KJ2A 4IOSD 5CEZH 5KVFL 5L9DL 5I74C 1RUKH 3U83A 2YKLL 4ZFFB 3MBED 4Z7WA 5DF0A 5EU5B 2J2ZA 1IZJA 5T5NF 3L3GA 1R24B 4NM4L 3L9RB 2FGZA 1B90A 3L3KA 1GYAA 1NCTA 1JGUH 2IALA 3BUYB 4PJ7E 3O81A 4HBCL 4YPGA 3S36L 3MRFA 3RZCC 2AQ2A 4JREB 3BYTA 4LSDA 4MWFA 1NAML 4G3YH 5DURB 3T4AA 4H8WH 3PUCA 3L95B 2I27N 2FJFB 4M61B 3NCJL 3LPGA 4MD5A 3ZYOA 5KS9A 1FNHA 2XIDA 3EOTL 5EH1A 3QEQE 3O8XB 5ICXB 5ILTL 3T65B 4Y5VC 4WEMB 4WI6A 3DBXB 4ONGL 3KVQA 5IK3B 3O3DA 2CK0H 3GSNB 3V5KB 1DBJL 1X5IA 3C5ZC 4YDJB 4JFOB 4R2GB 3G5VA 4L29A 2ESVE 3EO1A 2EIZB 2P5WE 3FO0H 2GJZA 4ZAKA 3KYMA 1H3PL 4NZUH 5DRNA 5CILH 1FN4A 4OTXH 5DMJB 1H8SA 5H37H 1T1YB 1KCKA 1A1MB 4AY0A 5F9WC 5L88H 4LSTL 4BSVA 4XVSL 3ULUF 1YUHA 5E08H 1MRCL 3PHQA 1S5HB 1A6VL 2A74A 4XPGH 3QJHB 5IHZB 1I8IB 3SKNA 5I19H 4H1LG 2ZCKL 1ZGLB 4MCZA 5JXED 3O2DA 5EN2B 4JM4H 1WBZA 3IDJB 4KUCD 4FXGB 5K9QI 1CTNA 3QXVA 5DJZB 2BY1A 4HS8L 1P6FA 1KULA 4YK4B 3LD8C 4TQEH 2DB8A 4UNUA 1OCWH 2HTLC 1GGCL 3T8XB 2YK1H 4JFEE 5EZLA 1CE1L 1LEGA 2CO6B 2JJTC 3BW9B 3IFPA 3MLRH 5F88A 1UXSB 2J4WL 4NO5B 3RY6C 3MOAL 5KTEH 2BVUA 4G9DA 3RUGA 2A9ML 2ZUYA 4QRQA 3EO9L 1XIWD 4NN6C 5B38G 3X13A 4Y16B 1GC1H 5BZWA 5LGJB 3PL6A 1U3ZA 5DMKB 1IARB 4TSAH 2CDFB 4WUUD 2NX5B 3QG7H 1WTGT 1UJ3C 4S1DC 2DQFB 5C0IA 4W81A 4NFBA 2NY6D 3EYVA 1V7MH 2ZOKB 2H26A 3N1FC 4LDLB 3WV0A 4X99A 3B5TA 4JAMB 3STZB 1SJEB 3CX5K 1U0QA 4LBEB 5I1LA 4FP8H 2G60L 1AGBB 4NT6B 3RAJL 4FG6C 4DGYL 4ZTOH 5I1EL 5I1IL 3QZWB 1IC1A 2X70A 3WNPA 4A6YL 4NNXB 3QPQD 2WNGA 5HHPB 1IQDB 1UADC 5C3LD 3CFJA 1JYWA 5DO2C 3O6ML 1F4XL 2DYPD 2BRQA 5I30L 3K81A 1FNLA 3MA7B 4LLVA 1DFBL 1NGPH 4GMTL 2OCFD 1KENH 3D9AL 3RZCA 3K8LA 2EDNA 3PHSA 5JXAL 1FRGH 3FB7A 4PG2A 1J8KA 3FQXA 2VDOL 4I3GA 3TN0B 1IMHC 2EE9A 2EZ0D 1PKQA 2ITCB 4XHQA 4AIZA 4LCWE 3ZKXB 3IDUA 2FJGA 4U1LA 3SGDI 1KB5B 2XKUA 1KTLA 3PXHA 3PWPA 2HFGL 4NOFA 4RFNC 5C3TA 4C83B 7CGTA 1UEMA 1BVLA 3BZ4A 2NY5C 3FRPA 3D3VD 1JWUB 3C5ZA 4ZO7A 7FABH 3VFOB 4JRXE 1FC2D 3BKYH 2NY1B 3S5LG 2ZWLT 1JI1A 4OLYH 5ANME 5CJ8A 1LO2L 1CFNA 1N59A 1NCUA 5ABDE 1P2CB 1EO5A 3HZMA 1OGTB 3OJDA 1JNHB 5HGHA 1CXFA 3O2VH 4E0RB 3LPWA 4NBZB 1I7UB 2FX9H 3R0NA 2Q87A 5ALCH 1OD9A 4PJ7B 5IIEA 1BZ9B 1ND0B 2XZQH 4F58L 4LRNL 1MPAH 1RJYB 4LLWB 2LAAA 4QT5B 2FR4A 1A6WL 1E4XL 5CBAB 4G43B 4LQFH 5MI0B 4O5LH 4CN1A 1RZKC 2F8VA 4OI9A 3BWUC 1YC7A 3BPOC 2X4TB 3RU8H 2PXYD 5KOVC 1P7QD 5IR1A 1A3LH 1GH7A 2F54A 3PGFL 4HCRH 5IHLB 1MCFA 1VFBB 1SEQH 1JL8A 1J0JA 2JJTA 4WEUD 3UYPA 3FN0L 5IV2B 5DEFA 3RY6A 4MX7B 2Z91A 4JY6A 5BS0E 4ISVB 1GPOL 4PFEA 3NFPB 4KKAD 5F1NB 3O9WB 4N9OB 2VKWA 3QXAB 4M7KH 2DQHH 2OK0L 4YDKH 3VXQB 5D6DA 1J88A 1UYWL 4LCUB 3E2HB 3QIWB 2IH3A 5DA0B 3JTTA 1I4FB 3MOBH 1A6ZA 3S37X 3L3OB 4NCC1 1UJ3A 3ARXA 3F65A 2Z31B 2PTVA 3UZVB 1KCLA 2R1WB 3TA3A 5T1LA 4Q0XL 3QUYC 3FTGB 2RHEA 3ARBB 1BD2B 2GTWA 5EO0A 5CCKH 4NQTA 3G6AB 5BXFA 4OZIE 2O5ZH 4WU5A 4L3CB 1V7NL 1AR1D 1IEBA 4PRBA 3ARDD 1VSCA 3W0WB 3BSZH 1E27A 5EU7E 3DJ9A 5ETUB 3TBWA 1I3GH 4MQ7A 3I6KB 1U8HA 3VI3F 4O2EB 5L2KA 1TMCB 1WAAE 4UNVA 3MGTA 1CXIA 2VXSH 4MXQD 1G9MC 3QO1A 4HPYH 3TP4A 5CHNB 5GIRA 2YUVA 1D6VL 4PJDE 4IHOB 4NIKB 1KJMA 2UUDK 1E4XI 3V4VH 3O0RH 4FXKB 4L9LB 4PJCA 1ES0B 5BW7C 1QFUH 2C7UA 3GB7A 4U6XA 5MHSD 2G5BB 3OGOE 5JW4M 1D7FA 3BDYL 4HJ0C 2BXYA 4D0BA 3BH8A 3LN4B 1MOEA 1AHWC 3KYAA 2J5LC 2Y06H 1WFTA 1A4JB 4JE4B 1A1NA 3BDXA 3KPSA 3VGGA 1U93A 3FB5A 3LEYH 4GS7B 2XPGB 1RUQL 3I75A 1RHFA 1N6QL 4PGBB 3BJ91 1A7BA 1DN0A 1NH6A 2IMNA 4MA3A 2QSQA 4OCWH 5IQ7L 3OAYK 4UB0H 3VWJB 5CJOL 1L7TL 4PV9B 3HC0B 2EICA 1DJSA 2DTSA 3U4EB 3HI1B 4Y4FA 4TSBL 1OAKL 4YHIA 1Z6JT 4KTEH 3GJEB 5BJTB 2VXVH 5I8KH 1I7RA 5E6YA 5M7QA 4QHNB 5HGAB 2GK0A 3CDFA 2QV2A 1OTSC 5FM8A 3EYOA 4V1DE 1N7MH 2HRLA 3QDJE 5T3XL 1K6QH 5IMOB 4N0FB 4RZCA 3CDGA 3HZYB 2JJSA 4HG4K 2C3VB 1X5LA 1QBMH 4ONFL 2ADFL 4DVBB 3T0EA 2DRUA 1C16A 1J9CT 4P5MB 3VI4E 3U30B 4OFYA 4RX4D 1BLNB 3LH2H 43CAB 4LPCA 2QTEA 4UILL 1EA9C 2HVJA 5DQDL 5ITFA 2FL5B 5FK9B 2HTKC 3HPJB 4GFTB 4PRPA 3HMXH 3VWKA 4PRAB 4LCIH 1H0DA 1CZ8L 1X5YA 5GSVA 5SWSD 5DD1H 1F58H 5L0QB 3OZ9H 5T1MA 1QUNA 4YXHH 2CLRA 3WSQH 2AK4A 1B88A 3ZKMD 4IJ3C 3QUYA 4OZGF 2BK8A 4MSWB 5IG7B 4CNIB 1AD0A 3W9DB 5JQHC 1AC6A 1EHNA 2NY3D 5FYJL 5EOQL 1AQKL 1YPZA 5TFSH 5TE7L 5AZ2L 5JO5B 1VKXA 4Y7MA 3X17A 1HKLL 3HNTH 1SJHB 1KBGH 4YWGL 2OP4H 4KROD 4XVUC 2NTFA 4JFZL 5CIPA 2ZG1A 3WS6C 2VDMH 3UPAA 3GMPA 4U49A 3T08A 2J7LA 4XMPH 1JHLH 3U1SL 2W0PA 1NBQA 4EI5B 4X7DC 4URTB 4L8SB 3P9MA 5BS0B 2NW3B 3UTQB 1OQXA 5DC9B 3N1GC 2DAVA 3KYNA 1T3FA 1DVFC 3H3KA 4YAQB 4LF3B 3NN8A 5FUOL 3ET9F 4ENEC 1ROWA 4NKMA 3AVEA 2BJMH 5BW7A 2VH5H 3ARSA 1KSRA 4LVEA 1NC4A 2ZCLL 1CQYA 1MFCL 4JCMA 2XFXB 5CSGA 4UV7L 2B0SH 1HINL 2CR6A 1K8IA 4PY8J 4JFHE 1AHWA 2F19L 3PGCA 1XCQA 4U6HA 4ORGB 3ZLQC 3D69A 1LNUB 5C8JB 4HFWB 1KV3A 3CC5B 3EOAB 3RFZC 1NCDH 4K8RH 1WT5C 4JFQB 1DE4B 3GIZH 2A73B 4P9HH 4Z7OE 5HYQB 2ZOLA 5B3JE 4NN5B 4XNUH 1QSEA 3WFCH 4QWWD 4D0DA 4Q58C 3ULUH 4S1RL 1AFVL 3WIFA 5TDPA 1MHPL 4P3CL 2B4CC 4WFFD 4ZOCA 3TVMB 2IGFH 1EMTH 3QSKB 1P6AB 1N4XH 4PRHD 4X7TB 1KJ2L 3RBGA 1IBGH 3GSNH 1CLZH 4P2RA 3UPCA 4OIAA 3NFSH 3RHWK 3VFSA 12E8L 1JF5A 4KDTC 4XAWL 3SE9L 3V4UH 4QTHA 4EEEA 5HDBF 1CLYH 3P11H 4U2YA 3VD3A 1CLOH 4J3SA 4FRWA 1A47A 4NKIL 5E24E 1IKFH 4KAQH 4XBEH 4LVNC 5DUPL 2QQLH 5C08B 1UWXK 3C9NA 4IMKC 2HLFD 5TH2B 1WITA 1F2XK 4GW1A 4F9LA 2DN7A 2P43B 5C1MB 2R8SL 4GMSL 2QQNL 4JLRB 1WWBX 4EUPB 4O2FB 4Y4KB 1U41A 5E7FA 3MRDB 1HQRA 2Z9TA 4P2OD 5DT1H 2APTA 3HLAB 4NRZB 1NCCL 1QRNA 3TESA 2YOCA 1NEZB 4YHNB 5KW9H 1MI5B 1C5BL 1YQVL 1A4KA 4PJBB 1GRWA 1EZVY 5C0BD 1Q0YL 3RWCA 2C4XA 3MODL 2VYRE 2MQ3A 1CFQA 3T0VA 3KJ4C 4YE4L 5DD3L 5JLZA 5JR1L 5DZLA 2MQ0A 2EE3A 2EDYA 2J1KA 3WS6A 1OAUH 1M6OA 3AMKA 3NH7L 5JUEL 2ICES 3LRSA 5F44A 1SYSA 4NQCE 4F3FA 3QNYB 5EORL 2X44D 3O2DL 1ZLWK 3TH2T 2OJZL 3CFCL 1FL6A 3A6BH 3MRJA 5K9JH 4PG9B 4OUUB 4PJEE 4YHZH 1T7WA 3V7AG 4LLQB 1NDMB 2EECA 1A21A 2DLHA 3QWRD 2I24N 3EIFA 3AY4A 4LKXB 2V17L 3OR6A 5J89A 5JQ6L 1K2DB 4PJHF 4J4PD 4PGDA 4P2QD 4KTDH 1WCQA 4WENB 5DJ6B 1CD1B 1AO7A 3VH8B 5KSUB 1ZLUH 2GSIB 4HS3B 5D2NC 4Z8FL 5SWZE 2QBWA 4PGJA 2BVQB 1CFVL 1QLRB 1WUNT 3QPQC 4P46D 2VC2L 4FABH 3MBEA 1A14L 3VFRB 3FQUA 2APBA 5BV7B 5CEZD 1R3JB 1XF5A 1U8KB 1JZ2A 1S7QA 3L7EB 1SY6H 1R5VB 3WDHA 1I75A 3TBYB 2FWOA 4BSJA 2H3NB 4PJ8B 2DM4A 4I8DA 1X9QA 5CD3B 4Z78A 2UV3A 4MJ4A 1IILE 3G08B 1F13A 3S34L 5BQ7A 3U2SB 3OJ2C 1HZHH 1FNEB 2NY2C 3RWFA 3MA9H 4Z0BL 3UJIH 3IJSA 4HDIB 5DUMH 4QHKJ 3QXDB 5KOMC 1G7QA 1QACA 3GI8L 2JB5H 3VXSB 4CVWA 1C5DB 1LQSR 4WTZG 4KDTA 4Z6AT 1WCBA 2HLAB 2MHAA 2KZWA 2BC4A 4CJ1A 4AQ1B 3MRBA 1DBBH 4OKVA 2R29H 1G84A 1FCGA 4LCYB 3IRZA 2I60H 1WZ1H 1GIGH 2BHYA 3MGOB 4OKDA 4JZJC 1AGEA 1WWWX 4M4RA 1F3DH 3L3IA 4R90L 2A6KB 1IGIL 1FZOA 1ORQA 2DDQL 3WNLA 3R0MA 3VFPB 2A9NH 4PGCA 4O58L 5F7UA 3HI5H 2J8UF 2AP2A 4YBHA 5JXEA 5GGTA 1B4RA 1MCOL 3VFTA 4WO4C 1A2YB 2EKSB 1BFVL 5I9QB 1I8MA 3UTOA 1JFQL 1FVEB 3MV8B 4CADA 2X4SA 2OTUA 1XR9B 5EULV 2PXYC 5ICYA 1MFNA 3SJVE 3B9KA 1YN6B 3GGWA 5DRWA 1KG0A 3Q2CA 3QQ3A 1BECA 1OSZA 4P3WA 1DBML 1LE9A 1MJ7H 5AZEL 1EO7A 1MFAL 3D85D 3S3PA 3MRIA 5KVGH 3IFOA 3V95A 2E5EA 3S37H 2W07A 5FYJU 4ODHL 5E8DL 4NC0B 1NFDE 2XXMB 4LIQL 5C07D 4NNYA 1XIWA 2IFFL 1K4CB 4P4RB 1D9KA 4KKAC 4H20L 2WWKT 3DYMA 3GMRB 3MUGA 4XCYA 4F7PA 4ZNCD 3O3EB 4GKZA 4JZOA 2CRZA 2VLLB 3IFLH 4NWUH 1R5IA 5HVHC 4Z95H 5JW3H 3V9FA 2BNQD 2QL1A 3BPLB 3P4NA 2LFGA 4YHLL 2V9QA 1VACB 4JY5H 3D5OF 2G75B 5BVJA 3NTCH 4X5LA 4M3KB 2DWDB 1VADA 2R23A 1INDH 4HMEA 4UBDD 2HRPH 2CGRL 3NGBC 4G8EA 3B5HA 2WWMC 4MNGE 1I9RH 3WO4C 5DJCA 1LDSA 3O6LL 2QHRL 1QFWH 1EHLH 1AP2B 1FVCA 2R2BA 3FQTA 4GW4A 2FLRT 5IESL 5JDSB 2CRIA 2DICA 2DYPA 5DVOA 1AR1C 1LP9A 2NY0D 3VRJB 4CVXA 3ARDC 5IF0A 4OZHF 5DHVA 4GOSA 2Q7NA 2DF3A 2UZIL 2EIEA 3MNWB 2A6DB 4IIQA 3FRPG 3DPBA 3OPZH 2ICEB 5HHXL 3U79A 4QF1A 4LLDA 1FYTD 3LDBC 3QNZA 3P0GB 8FABB 5DS8A 2VZ3A 4AEEA 1L0QA 5EO9B 1INEH 3SCMB 3TZVB 5C70A 5BMFL 3AREB 3OAYH 5K59F 4ZOBA 4HWZA 1VGKA 5EO1A 4DFIA 2DLFL 3GUTB 4EVNA 1ZGLM 5GHWL 3D3VA 5CEXB 5D6CA 2QQKH 5CEYA 4YHOL 3TGXA 1JPTL 3U0WH 4HGMA 3HHRB 4KHXL 1JPFB 3O11A 3FKUS 4FQJL 3VFVB 1YECL 2XTJE 1GVIA 4RBPK 3V8OA 2CRMA 5SWZB 3RA7L 3NCMA 5MEND 4OD1L 2EH7H 3PWUA 4NNPH 4ELKB 4XP9L 2Q6WB 3QT2A 3QAZC 5JW5A 1HIMH 2DI7A 3NPSB 4YEEA 4MJIB 4Z7WE 2NY5L 2Q8AL 3NFNB 2DQIH 2ICWB 3DOSA 1UH3A 1Q72L 1IGCH 4RMRA 4RIRB 4G8GD 2A0LC 1AY1H 2HP4A 4OM1H 4I9WE 5GRJH 1E0OB 2PXYA 1X5JA 3PQYD 4XWGH 1P7QA 4TUKL 5KS9E 3KJ6H 2E7LC 2ADJB 5CJQL 2KQNA 3QI9B 1QNZL 2DQJH 3IT8D 1K5NA 1RV6X 4NKQB 4KK5D 4WIQA 3ZE0F 4AQOA 3C2AL 3VE0B 4HEPG 3HUJF 1GGUA 4WHYH 1RZKL 1F8TH 3HZKB 4YXLL 4G6KH 1EXUA 1W2KT 2DM2A 3WFHA 1J05B 2UVFA 1UZ8A 2Z4QB 3BD5A 3HI6H 3WO3B 4M1GH 4R0LA 1HWHB 1RFDL 2IBZY 3O4OB 5ESAA 5CINH 1Z9OA 4BZ2H 4U6TA 4N5EC 1HKFA 1Y6KR 1KCUH 1QRKA 2BXZA 5HVWA 4ZSOB 2VDNL 1BVKB 3NIGE 4HK3J 4ZG1A 4NQDE 4U1MB 3SBWC 3O2WL 5I71C 4KROC 2ARWA 5F3HB 2VERN 4HLZH 1CLCA 3ARDA 4ELMB 3LB6C 2VDPL 4Y1AB 3J7HA 4BH8A 4WI7A 3JBG7 2D7PA 3SDAC 5FHAH 1MCCA 3DSFH 4J23A 1CGXA 2HWZL 3D39A 4G8FB 3UJTH 5J9PA 5GRXG 1U8OA 4KJPD 5D7JB 4XNQB 1F6AA 1OP5K 1J1OL 3H9YA 2ZUXA 3RUGE 3ZE1E 5D7KE 5JTWA 4I0PB 1ZHLB 1X5ZA 2HG5A 1HQ4B 3WNMA 4ZQKA 1EJOH 1T1WA 3IAPA 2CLZB 5BRZB 4BH7B 4LASH 1OW0A 3H9SD 2K9UA 3CJJA 1IGJA 3S8WA 1VESA 1BOGA 3LHPL 1CFSA 3OHXB 1IC4H 4KTYA 4LNRB 3QEUB 2JIXB 1G9ML 1P69B 1Z3GL 1KOAA 4GXUN 4BK4A 1FORH 2YD8A 1F90H 3K46A 1HHJA 2FH8A 4O02L 5CD5D 5FECA 4JFDB 4QWWC 3CFKA 1YY8B 2YMXH 1KELH 3ARTA 3QA3B 1UWXH 1QSFD 4UDTA 1LE5A 2NXYD 6CGTA 3BKCL 5DQJA 4XC3H 4DW2L 5LGHL 3O6KL 2JCCB 3ILPA 4OF0A 4XHJD 1J0KA 2D7TH 2AEPL 2OL3A 5FM5M 3OXSB 2A77H 4KDWA 4XP6H 2OLDA 5IW1A 1KXTB 2WIMA 1HDMB 2BNRB 5CSBA 4GRWF 5J13B 1PKQE 4R8WH 4MNQD 2E7LA 5LXGL 3CU1A 1ZT4A 3QJFA 4ZUWB 1QHPA 3WE6B 1LGVA 1D5XB 1ZHNB 1GJIA 3JWNC 4M8QB 5CSZB 2BFVH 3IDMB 2JK5B 3PWPE 2KQMA 2P24B 2YWZA 3ARYA 4N0CD 2HLFC 4LPVA 4U1KB 1AGCB 2YBRA 3SN6N 3IKCA 3OXRB 3DIFB 3UYOD 3M1BB 1MFBL 4OM0H 1PQZA 3BOVA 5IB1A 3OKLB 1V3JA 1YEFH 4K3HA 1XF2A 3MLXL 3A67L 2L7JA 3U7WL 2QADB 2X41A 4P2OC 5FA4B 1G7HA 4QLRA 4XNXH 3SO3C 4POYA 2R2EB 3CH1A 4HEME 1FH5L 2NNAA 5I76B 1U58A 4ODSH 3MLUH 3HKFA 4I18B 3QYCA 1CICB 1J12A 2X89A 4XVJH 1NCBH 1X5FA 1DUZA 1K3ZA 3SHSA 3SBWA 4JGMA 4R96B 3UBXA 3GI9H 4G6MH 3NZHL 1F4WL 5IVNA 1OP3K 3REWA 3GMQA 1QVOB 1AE6H 1UWEH 2ENSA 2BVYA 3KXFB 4MD4B 5DA4A 2F54E 3UTTD 4NJAH 4D3CL 1EK3A 1S9VA 5JPNB 4MAYB 3VDAA 3IDYB 3GSXB 2EO1A 5FO7B 4PJGA 3IKKA 4L29B 2R9HD 5E5MB 3HC4L 2Z0BA 4TN9A 3E3QE 1K4DA 3QEHB 1BIIA 3BZDA 5DRNB 1JNNH 1FN4B 2B1HL 2OI9B 5FYLE 1ULVA 4J4PC 1HH9B 1QHOA 3QQ4B 3QUZD 5BV7H 3MGAA 1WIOA 3TO4A 2V5YA 3ZKQD 4GXVH 3SKOA 5C7XH 1K8DA 3PDDA 1FSKB 4P46C 5HYJB 4NQDB 2WBJB 1QO3B 4HUMB 5I75B 3ARUA 4IRZH 1KIPB 4QGTA 2VDKH 4EI6B 3BP5B 5EU4A 5JNYB 4K9EL 4Z7UB 4K8RD 1TVHB 2BVOA 5DURD 2I25N 5E8OA 4WI2A 3GSRA 1OT1A 3MJ8A 1KLFA 4ZFOB 2IH1B 1NDGA 3O8XD 4PRHA 1BWWA 3KWWB 3L3DA 5EZLB 4MDJA 1BPVA 4NOBA 5E1AB 5IQ9A 5L2KE 1RVFH 4OD2B 1LD9A 4JVWA 5ESQA 3MRRB 3MREA 3WFDL 5DR5L 2CXGA 4EDXA 3LN5B 4R2GD 5EU6D 4P2YA 3X13B 3SKMB 3PL6B 4PUBL 4OQTH 1BFSA 1F00I 4X6DF 3K7UA 3GKZA 2B4CL 2GAZA 2HMID 4RAUA 1JZ3A 4WW1A 2FZ3A 3Q1SH 5B8CC 4XPAH 1MIML 4X5WB 4N0UA 5LAXA 3UZQA 4I2XB 1NGQL 1RK1B 1X5AA 4R97B 4NGHH 5TDNB 1JI2A 3KPSE 3S88L 4I0CC 1OSPH 5J1AB 1FO0L 1IAKA 5I1LB 5TE6L 1IKNA 4YZFF 3FQWB 1NCAH 3PV7A 5HPOA 2IG2L 3C08H 2GCYB 5FAAA 5IMKB 1Q1JL 4FQ1L 5K9KB 2OQJB 4Z7NE 5D7LD 5IFHH 5C0BA 2DKMA 5GJTL 1MCLA 3ZL4L 3TH3T 5JPMA 1O5DT 1RZJH 3FB7B 2HYMA 4P57B 4KKNA 4WU7A 4KK9D 4K3DH 1E4WH 1XGPB 1SBSH 4K3EL 3QWQB 1S7UB 3CFBB 3PHOB 1KNOA 1N6UA 3KPMB 5D7IA 5GGVY 4YO0A 3UC0H 4Y16D 1DQJB 1X4YA 4XNYH 5GGTL 5ESVA 1ZANH 3LS5H 2FHBA 4GW5B 2VUOA 2NX5D 1QLEL 3T0EE 3T2QA 5EWIH 2IJ0C 2X4NB 5EFIB 1KTDB 3GSQB 2VIRB 2WBKA 4GLRH 4RMUA 3T2PA 3TIDB 1LHZA 4ODUB 4EN3B 3LS4H 4P2QA 2A6JB 3EGSB 4FQLH 4PRPE 5HGHB 4OLZH 1SM3L 4BJLA 2C1OA 4K7PX 3M8OH 1B2WH 2BOBB 1OLLA 3U0TA 4ALAH 5HGDA 2KH2B 4P46A 1S8DB 4XPFH 4PJXF 2AI0L 5C0AB 4YBLB 2AK4E 2K1MA 1U8QA 5BO1H 2D0HA 2OJEB 3BP6A 4AMKL 2NY0C 1L0XA 1WBXA 2BRRH 6FABH 5GGQL 3QPXL 1U3HA 3E8UL 4TSCL 1JGEB 3WHXA 4ONOA 4ZPTA 1YPZE 1JNJA 1R3HA 4X9HA 3VXNA 1MNUL 1W8NA 1JTPA 1MRFL 3TN0D 4KUZH 3BO8B 2D31A 4R7DA 3DX7A 3L7FA 2IPKB 3DI2B 1LO5B 2D2OA 2W0FA 4U6VH 5E2WH 3CXHK 1NFIA 3MNVB 4GRMA 3RWEB 1CE6B 5ISZB 1M05B 5IEHA 4D8PA 3T09A 1MFEH 1CL7H 1QG3A 4EOWL 5IEKB 5D70L 5LJYH 4JKPL 1NGWB 3AXLA 1RZ7H 3BZEB 1U8PB 4HIHA 5AG8A 4G5ZH 5F9DC 4QCIB 4L8BA 3MRPB 2KPNA 4KKBD 3BP7A 1EVUA 2ERJC 4DUVA 3TA3B 5D72L 5INDA 3MCKB 5F96L 3KNBB 4M7LL 4NRXA 3KR3H 1FFOA 1T83C 5BXFB 3PP4L 3OSKA 3MC0A 4P2CG 1IEBB 4ZUTB 1F3DJ 1QSEE 2OTWA 4IRSA 1EAJA 2VTFA 3MUHL 4UT7L 4OFPA 3L6FB 3U4AA 4HUVA 4AG4H 2ATKB 4XZUB 5I73C 1F4HA 5GGUB 1GOHA 3REVA 1LMKA 2W9LA 2FBOJ 1VFOA 3BP4A 3D85A 3RWDB 3TCLA 2VN4A 3QO0A 4P2RE 2D4DA 2AJSH 2P5WD 2AJZB 5DFVC 4K3GA 1OAQL 5B39A 4RMTA 2AJUL 4KK5C 5FO9B 3LKOB 3O9WD 1MAKA 4J3WA 1ZT7A 2DBLL 3O6FD 3KLDA 5IOPB 2VWEC 4XX1G 3I84A 2ENYA 2BNQA 3LPFA 2Z31D 1RIVL 1JF1A 5E94B 1LEIA 1JGVH 4LK4A 2VDQL 1DTUA 2OBGA 4XH2A 1ZT1A 1FNGA 5HHOB 1PW3A 4POZD 4BZYA 1UGNA 4U1NB 3ARBD 4AEFA 3CU7A 5FYKH 3NAAL 25C8H 4J3VA 4IMLB 4KMQA 4S10A 5E9DB 3EJZD 3PWNA 4G9FA 1OP5H 1Z9SA 1QRNE 3W0WD 5F7DA 4Y2DA 4LAQL 5ENWA 3DUUA 1ZLVH 1T1ZA 1BMGA 2VZSA 4I3SH 1I7RB 5AWNH 3CFDA 4MQSB 2M26A 4N8CL 35C8L 2DLEA 2HJFA 5I1KL 4KV5E 4LLMA 5ELIA 4E9LA 1FYTA 4KVNL 5HGBA 3V6OA 4KJPC 4C57C 4RWYH 1F02I 4TNWF 1FNSH 3VW3L 4RDQF 5L7XH 3GMLB 4DTGL 2F5AL 1J0YA 4YFLI 2DQDH 1HSBB 5GRUL 3PDOA 3S4SB 4ODXB 4RMWA 5D2LB 4HQQL 4YC2B 3MFGB 5ITFB 1QR1A 1CFTB 1NAKL 1C08A 3MLYH 1MWAB 3BKJL 4Y5XB 4R6UA 3VWKB 1TLKA 4PJ9C 1LEKA 3X3FL 1WFUA 3CLFL 2C4FU 1OM3L 3BIKB 4NHUA 4Q9BA 5MENA 1CVSC 3CH8A 1GGIL 5KJRL 5IM7A 4CMMA 3TYFA 4TUOA 1BF2A 1TZIB 1AO7E 4PBVC 1J1XH 4YDLB 3VWJD 1MCKA 3QWOB 3PABA 5CD5C 4K07A 3B2VL 5EOTA 4IS6B 3PWVB 1P7KA 4X6CA 2FDBP 3RL1B 2NXYC 3QHZL 5D8JL 4F2MB 2BVTA 1BZ7B 4GT7A 4BA8A 4BKLB 4FS0A 4G8GA 3JVGC 4H0IA 3ZTJG 4XHJC 4HG4J 5IVZA 1MLBB 5BOZG 5E6IB 4IDJL 3K4ZA 3PQYA 3H3PH 1YNTB 1YMMB 3MMEA 4UDUB 4JRYA 4ZYKB 1ZLSL 5EBMA 3M45A 3WUWA 4JRXD 2F5BL 3GK8H 4KDVA 5EZIL 2C3GA 3MCLL 4N0CC 3LKSA 4HCRA 4JO4L 1RIUL 1VA9A 4LLAA 3UX9B 2GFBA 4NDMA 2PN5A 5JA8B 1QKZL 5ALBH 3K4AA 3OR7A 4Q74A 4JFPA 2OL3L 1HYSD 4P4KB 2HJLB 1FL3A 4LSPH 4WUKL 5EA0L 1WTLA 3OKKA 4S1SL 2R2HA 1DEEB 3F6LA 1A9BB 4JHAL 1NBVL 5J1TC 2ZUQC 1Q9LA 4TRPL 5F6IB 3RNKB 1RZIB 3U7YL 4JN2A 3TNMB 4Q97A 4MXVE 1MFDH 1KPRA 3QH3A 1T6VN 1TNNA 2X40A 3OKOB 4YFEA 1YEKL 3TPUA 1ZTXL 3DVGA 1A7RH 4L1HA 3D87B 4YQXL 4OB5L 3DXAB 5C0JA 2AJYH 1Q94B 4EI5D 4BQ8A 1RMFL 5BS0D 1OLZA 3ARGB 2FGWL 2R56H 4P59L 3K2UL 5E00A 3HFML 4KZDL 2BY0A 3EFFB 1RJLA 1R0AL 2GI7A 5D93C 2AXFB 5CZVL 1GHFH 4U7MA 2MSPA 4PTUB 3QUZC 1M7IA 1KYOK 4EXPX 4NPYB 3G9VA 3H9SA 4X8JB 2PW1B 2YEZA 1ZS8B 3FRUA 3LKPA 1R3LB 5EZJB 3LKRA 3UXFA 4PY7A 3BVNB 1T80A 3HRPA 4GUPB 1B4JH 4PV8B 4RFOH 2CDEA 3EOBA 3U9PH 3QHTC 1F6LL 3HMWH 1ZHKA 4K8RC 1LK2A 1MF2L 4WWKB 1P9MC 2EDJA 4XX1E 4X98A 2R0LH 1JHKH 4P0DA 3TVMD 5DUBA 2XN9B 3FONB 1QSFA 3OL2A 1YMHA 1LP9E 3GM8A 4WDIA 3O8XC 3K74B 3MLSH 3D0LA 2RB8A 4OZIF 1FV1A 1HHIB 2XA3A 2EDFA 4OQ1A 2Q7YB 4Z77A 5I8OH 2X9YA 1NAMB 2ADIA 2P8PB 1TCMA 1WAAF 5D1XA 5JZ7D 4HHAA 4D9LL 4MNQA 1KIQA 2DM7A 1FL6B 5IKCB 3HZVA 2SEBA 2ZPKL 5E2VH 2BOCB 2ZG2A 4PJDF 5FHBH 5MP6H 4JM2A 2HMIC 2BDNL 3LQZB 3V0VA 4K7FA 5FKPA 4XPBH 1D5MA 1AD9B 3P4MA 1U2HA 1SVZA 2R0KL 5IVXA 3D3VE 3VXUB 1A1OB 1RUPH 4Y4KD 1JPGB 3QRFM 4KMTL 4PTTA 4JFXA 4PPTA 1TZHA 4F7CA 4ZDHA 2J88L 3WCYA 5C6WH 4KQ4L 1C5CH 1OPGL 1NLDH 4KVCL 1S7VA 3HMXA 5F3BB 3UBXI 4OJFL 4ZTPL 5IUSA 1MI5D 1XF5B 1NC2B 1VPOL 5DJ8A 4UAOB 3P77B 4QTIH 4YK4C 2AXGB 2FWOB 1CGSH 3SY0A 4NUJB 3QDJD 3VXOB 1I1FB 1LWRA 3RIFK 4Z78B 1YEDA 4KK9C 2OSLA 2BX5A 1WQVT 3TO2A 1V5JA 5BQ7B 2D9CA 1C8PA 5AYUL 5FGCE 5H2BB 5C2UB 4MQXD 2YRLA 4PY8I 2ZKHH 2DMCA 4P5KA 5HI3C 2C1PA 4Y16C 1MRDH 1CDJA 2VISA 3UTTA 5DQ9A 1G7QB 3WN5B 1BOYA 1T20A 3C6LC 4HKXA 4BZ1L 4JPVL 4K7PH 3RIFF 1IM9A 4OZ4B 4Z76B 2VZUA 3OAUL 4DCQA 3IDIA 3MRGB 1EBAA 4M6NL 1JZ7A 3L3JA 1ZSDA 4TUJB 4HIIB 5I1CH 3VI4F 4BYHA 2IAMB 3GMMA 4NZRL 1UM4H 1CIDA 5I1JH 1I9JH 1ADQH 3KPRB 5FO8A 4HF5H 3DROB 2DOCA 2O5XL 3SO5A 2FD6H 5FOBB 3B5GA 3RGVA 4JDTL 3STLB 4LEOB 4ZFFA 1AXIB 5EU5A 4GO6B 4ZO8A 1R24A 4QXGL 2VQ1B 1CF8L 1HEZB 3L9RA 3N85H 3BUYA 5F1IB 2EXWD 1W0VA 3GEWB 4L3EE 2ED9A 3HAEH 4PJ8D 3TFKC 3DMMC 1KFAH 3BWAB 3L95A 2FJFA 3SQOL 4M61A 1D5ZB 2OTUB 3SDDB 3MSPA 3B9KB 4KJWD 1KG0B 3LEVL 3OG6B 3O8XA 1A7NL 5ICXA 4M6MH 1CK0H 2XWJB 5HHNB 3BI9X 3DBXA 3RWJB 1ETZB 3MRIB 3V6BR 1S7TB 5IK3A 5GS1C 1P7HL 5CEZL 1RUKL 1WC7A 3GSNA 3V5KA 5B3NA 3D39E 4JFOA 4YDJA 4WWID 4UTBH 3VG9B 2EIZA 4QNPE 1S9XB 5A3ID 3E1F1 4F7PB 2VOTA 1T1YA 5MHSE 1A1MA 4TPRH 5EB9A 5EC1B 3P4NB 5CP7B 3GHBL 4KKBC 3DLQR 4OBSA 2Q20A 2BHZA 1S5HA 1YJDH 3QJHA 5IHZA 3GSOB 1PX4A 5ACLA 3B8YA 3DURB 1T0MB 1E6OH 3VU2A 3JV6B 1ZGLA 4LSQL 5TF1L 3MACH 5EN2A 2E7MA 4RGNB 3FQTB 2JTDA 2QR0B 3IDJA 2G9HB 1SEBB 4FXGA 1G9NH 2DQGH 1WVZA 4QHLB 5DJZA 3MV8D 3E0GA 3NZ8B 3SGEI 5JDJA 4J1UB 2WUBH 3SE3A 1H8OA 4Z7OF 2V5TA 3LIZH 5B3JF 1MAML 3FO0L 3RL2A 3T8XA 3D48R 3VXRB 5CILL 3C8KB 4NO3B 4OTXL 4QHMB 3UTZB 4EQ2A 3BW9A 4MDIB 5TPWL 1UXSA 4NO5A 1T5WB 4LU5H 5L88L 1FFQA 5E2TH 4JB9L 5E08L 3WDJA 4Y16A 1UWGH 4XPGL 3O9WC 2VLMD 4QOKB 5DMKA 3GJFK 4U2ZA 5I19L 3O6FC 5FDYA 5EO1B 3E2HC 1A6AB 1RUML 4NP4H 1HYRC 4QY8B 4XCFH 4TVSa 2Z31C 2DQFA 4GG6B 3ULVH 5I1AB 4IRJB 2X1XR 2ZOKA 2VE6B 1S7XB 4KI5E 5F9OH 4JAMA 1G7PB 3STZA 4UOW0 1SJEA 3LZFH 4POZC 1LO0H 5HSFA 1W72L 3UPRB 4LBEA 1Z5LB 2AJXH 1AGBA 4NT6A 4TQEL 4OLXH 2OZ4H 3UTSB 3K80A 1OCWL 3QZWA 4D9RE 2LTQC 2YK1L 5HHPA 1RIHH 2H2PD 4PJAB 3Q5OA 5I18L 3EJZC 4ZS6C 2BVPB 3IGAB 3U9UB 2VQUA 1L9MA 4KRMB 2MPAH 3R06B 5C0CB 1FG2B 1YQ2A 3I9GH 3SKJL 4KRPC 4TSAL 5IJKA 1SY6A 4Y4HA 3QG7L 4HIJA 3TN0A 4L4VA 2ITCA 3HRZB 1V7ML 4XRCB 3SCMD 4XXCA 3TZVD 3G9AB 4C83A 3OQ3B 1ZEAH 3ARED 1RPQA 3ARFD 1MWAH 5C0FB 4M93B 3OKEB 4JHWL 5ITBL 2CXKA 4I48B 5MERB 4ZTOL 3EYSH 4LLYB 1VENA 3VFOA 5EBWB 3ZYZA 4OCMC 4EIZC 3FZUD 4K71B 4PJGE 3BMVA 4GS7C 3CUPB 4LCCB 5J6HA 1P2CA 5D5MB 5SWZD 1OGTA 3QUKB 4PJEF 4PRDB 1JNHA 3UROR 3EJJX 1KENL 1RURH 3M17B 1SMAA 4E0RA 3OKDB 15C8H 1MH5B 2W59A 3B9AA 1I7UA 1FRGL 4GAGL 3VWJC 5F7KC 1FLTX 1UFUA 3V6ZB 1BZ9A 2WM0A 4MJID 1RJYA 4QT5A 4LLWA 2EC9T 3SPVB 4L3EB 4L3AA 3JWOH 5CBAA 4WHTB 2AK1L 1VCAA 4O2CB 3QCUH 2EDDA 2EC8A 1J5OH 1UB6B 2ICWJ 1TZGL 5B39G 1O0VA 4M1DH 3EAKA 2X4TA 3TNNB 4WV1B 4DVRH 1OARH 1U8NA 4WFFE 7FABL 4NZJA 4LARL 3QIUB 5KZCD 2XQYG 2QSCH 3SOBH 4PRHE 2ZUSA 3EHBD 3VRIB 3D39B 2VDLH 3QI9D 5IV2A 2DS4A 4JN1H 3O2VL 4MX7A 4F33B 3S35L 4ISVA 4DOHB 4D94A 3QDMB 4Q6IB 1W0WB 3NFPA 2QSVA 3B83A 5F1NA 5ALCL 3O9WA 1KJ3H 4F8QA 3QXAA 2HG5B 1MPAL 4PJIB 3VXQA 4LCUA 3QIWA 3MXWH 1T1WB 1HE7A 5L0QC 5GZOD 4X80L 1JUFB 3L3OA 5CMAB 2Z31A 1HYSC 1TJHH 2LE9A 2N1KA 2FLBT 4X7CC 1BOGB 5GZND 5CBEB 4N0UE 1IGYB 4OCRH 1KN4H 2VABB 4UTAL 2YN5A 3RU8L 3FTGA 4R4BB 3ARBA 1BD2A 2HH0H 1A3LL 5JOEA 4HCRL 1E4KC 5F7EH 5FECB 1SEQL 3G6AA 4QRRB 5FYKD 2FIKB 2ATPB 4M62L 4KJQC 2GT9B 3W0WA 1CIUA 2W9EH 5ETUA 4Y1AD 1QBLH 3I6KA 4O2EA 5C0BE 4M7KL 2MCG1 3LVEA 4YDKL 2FNBA 3WIIL 3VFUB 3MOBL 4IHOA 3FB6B 2RBLA 1NUNB 4PB9H 5D7JD 1N5YL 1BAFH 4XNZB 2W65A 3D0VB 2KBGA 4L9LA 1UENA 4DEPB 1ES0A 3V6FB 2XA8L 4WW2B 5D7IE 2E3VA 2G5BA 1LO4H 2PYFB 4HW6A 4I0PD 2V9RA 3DVNB 4XCNB 1EO8L 3GNMH 3DV4B 1HI6B 5BRZD 1CU4L 5EC2B 1NFDF 4RA0C 5CCKL 1A4JA 2DM3A 3CZFB 5D1ZD 5FB8B 1BJMA 4MXWH 3RKPA 1PQZB 2O5ZL 5F89B 2XPGA 2W0KA 4H1LH 1F2QA 2RFXA 2JIXD 3QXTA 3BSZL 4WI9A 4PGBA 4C56B 1I3GL 2R4SH 5H94B 3BDBA 4P2QE 1YDPB 4NN5C 2YKLH 2VXSL 3CZJA 3FCTB 3VWJA 4Y5YB 4PV9A 3HC0A 3U4EA 4JDZA 3HI1A 3TVMC 4JPIB 3T2NL 2DTMH 3V4VL 5CEZE 3LAFA 3GJEA 5BJTA 2APWA 1MVFA 3PDGA 5IMMB 3TF7C 3I02B 3UBXB 4QHNA 5HGAA 3WUWG 3X12B 1FC1A 4B41A 1NAMH 1C12A 2D0FA 3D1MC 3NCJH 2Y06L 2PR4H 4MLSA 5IMOA 5IFAL 4N0FA 2X10A 5ID0B 1B6UA 2BNRD 3HZYA 4PGEB 3WL9B 5ACZB 2C3VA 2UWEB 4UU9B 1XF3B 5FM4A 5JZ7C 3LEYL 5ILTH 4DVBA 3VA6A 4P23D 4P5MA 4NQUA 1BLNA 43CAA 3GMNB 2NY7H 2QQQA 4G7YH 4OCWL 1DQLL 4R4NC 1DBJH 2FL5A 3O3AB 5FK9A 1ZA3B 4UINH 2OMNA 4FFYH 1J0HA 1P5VA 3HPJA 1UQSB 4PRAA 4N8VB 1UC6A 4KTEL 2VXVL 4I13B 5I8KL 2KZ1B 2QADD 4JPKH 3TO4B 3MO1A 2HAZA 3MRQB 4D0CB 1NMAH 2G2RB 2PETA 4MSWA 5IG7A 4CNIA 1K6QL 3W9DA 5J3HD 1IAIL 4NRYB 1CICD 4Y2OA 1OQOA 5JO5A 2ZCKH 4F15B 4UQ3B 3SE4C 1SJHA 1QBML 1AGDB 4DN4H 4I9WD 1A3QA 5GS0D 5GRWA 4Z7WF 3JV0A 2VR5A 2X42A 3RWIB 1U2CA 1ACZA 4MQXC 4LVHB 4EI5A 3HMXL 4L8SA 5BS0A 1DR9A 4LCIL 2CSPA 4MAYD 4AH2B 2NW3A 3UTQA 1F58L 4L5FH 1MCJA 3OZ9L 4YXHL 4LF3A 5KS9F 2FHFA 3P40A 3WSQL 3SGKC 4MVBD 2V5MA 1RAMA 2A9MH 3PF2A 4ZD3H 1NGYB 1WSST 2W1NA 3NACH 2XFXA 1HILB 3EFDH 4WW1B 3V5HB 4C4KT 4YHPB 5TFSL 4MMXC 4ORGA 3EDEA 1LNUA 2MTPA 1KBGL 2F9BT 4NUGH 4L4TB 2RR3A 3VD5A 1JMXA 2BNQE 4HFWA 3CC5A 5HYJD 4JPWH 1JYVA 5BV7C 3S96B 1ZXQA 5C6PB 4JFQA 2DWEA 4NQDD 1DE4A 2WBJD 2VDML 2A73A 3AU1B 2BERA 1H3XA 5TQ2H 5HYQA 3IS1X 4DGYH 5I1EH 5MEOB 1Y6NR 4JGJA 5EOCL 4PJ8C 1A6TB 3HE7B 2IFGA 3O6MH 1F4XH 4OT1H 5I30H 4WI5A 4G9FE 3NIGF 4KJWC 4X7TA 4J3UA 2BJML 2VH5L 3MRMB 2BSRB 1B0GB 2YPKB 3RX8A 4W6XB 2VDOH 4X8XA 1Q38A 3CPLB 4FFZH 5D7KD 1FYTE 1MJJB 4KK8D 3PL6D 3V6OE 3BN3B 4K8RL 3A0OA 1AQDB 3FO9B 2NXZB 5C08A 5FOJA 3GIZL 3RVXD 2R69L 4X7FC 5I8EB 5TH2A 1QLFA 5GGVL 5I74B 4AK1A 2GJ6B 2CUMA 4XNUL 1P84K 2QJDA 1H3UA 4W6YB 3RUGF 1XCTB 3TIEB 3ZE1F 4JLRA 4O2FA 4Y4KA 5DMGD 4X9FA 1AIFB 2IGFL 1EMTL 2MCPH 3ARZA 4HK0B 3CLEL 4LL9A 2C1OB 4ERSH 2CDGA 2WLZA 1CLZL 1IGTB 3G5YB 1WICA 5MENE 1I1CA 3HLAA 4NRZA 3MJ7B 2YS4A 1NEZA 3GSVB 1F3JB 1ZMYA 3NFSL 2BSTB 4YHNA 5I9QC 3DGGB 1MI5A 3BP6B 1HWGB 3FO1B 4LRNH 3CD4A 1H5BC 4PJBA 4HWEL 1CLYL 1U3HB 4M9OA 1GGTA 2X6MA 1CLOL 1IAMA 1DLHB 1A6WH 4AEHH 3SE4A 4Y5VB 1IKFL 4KAQL 4XBEL 1MCEA 4X6CE 4CJ0A 1NMCC 4G8GE 5E4EC 3O4LE 1ZVYA 3PGFH 1KUMA 2W0FB 3PQYE 3QNYA 5DWUL 5EZOL 1NFIB 2JJUA 3G6DH 4JRYE 2IBBA 3GSUB 1E6JL 5DLMH 4PG9A 3KPNB 5JORB 1DP0A 1BQSA 3FN0H 5DT1L 5F9WB 5GXBB 4OGXL 4LLQA 1NDMA 3ZSTA 1AKJA 3BPLC 4N68A 1GPOH 5C09B 4OGAD 4CL7A 5KW9L 5L8LB 5I0ZA 3C2SA 2XNAB 3ZKND 1K2DA 2OK0H 1IJ9A 2FB4H 1CVRA 5DJ6A 1UYWH 1BP3B 5IBTH 1CD1A 3VH8A 5KSUA 3OF6D 2GSIA 4HS3A 4NQXB 3PIQB 1FPTH 4LRIC 2BVQA 1A5FL 1FNAA 1MHEB 1QLRA 1TXKA 2H2PC 43C9B 3IU4L 3VFRA 5C0AD 1UVQB 1R3JA 4Q0XH 1U8KA 4FMKA 1OAUL 3LD8B 3L7EA 1EHXA 3VMOA 3TBYA 4PJ8A 4YGAB 4ZUSB 1NL0H 3A6BL 5K9JL 1F4YH 5CD3A 2EYRB 4YHZL 2X2YA 4LGRB 4O00A 3G08A 4HGWA 1YYLL 4NSKB 1CGVA 3U2SA 2DQTL 1AC0A 1V3KA 3QISA 4HZLB 4HDIA 4OCSL 3SCMC 1EEZB 3TCLB 3TZVC 4AYFA 4LQ1A 5KG9B 3AREC 2Y36H 3QXDA 3ARFC 4KTDL 1XGRB 3TCXA 5ISZD 4IOIB 3VXSA 1C5DA 3QNXB 3R1GH 1KXVC 3FAWA 3INUH 4Q2ZB 2HLAA 5FYLD 1QP1A 1EIBA 3FZUC 1A9EB 5JIIA 2F15A 5J11C 1BX2B 4LCYA 1SY6L 5EIIB 1NMBL 3MGOA 2XZCH 1JF1B 4OQTA 5BVPL 1NLBH 3TA3D 2XV6B 1ZT1B 2FEDD 2A6KA 3E6HB 2D3VA 3H9SE 1KB5L 3NPSC 2YXMA 1N6QH 1XFPA 3HNVL 3VFPA 1HZHL 3MA9L 3UJIL 2DQCH 5I8CB 5IQ7H 4E41B 2G5RA 4PGZA 4G9FB 3TWCL 1A2YA 2EKSA 5D1QB 2JB5L 2P8MB 3KG5A 2VITB 5A2FA 4Y2DB 4YDVB 1T6WA 1FVEA 5GGRB 3MV8A 4G6AD 2V2XB 4LDOB 1XR9A 1Q9OB 3BFOA 3CFDB 4TSBH 1YN6A 1ZHBB 4UV4L 3BYYA 1OAKH 1S5IH 1FYHB 5L2KD 4G6FB 4LNVA 5HGGS 4RFNB 2NLJA 4LPYA 2R29L 2DJ4A 1QR4A 4RMSA 3EHBC 4U1SB 4DK3A 1IFHH 2EEBA 1WZ1L 1GIGL 4DZBB 5HGBB 1JV5B 1I1YB 4V2CB 1U3JA 1N26A 5T3XH 3E6FB 3GO1H 5DVKA 1K4CA 1PVHA 4P4RA 1TCRB 2ZUVA 3I6GB 4XP4H 3GMRA 1A3RL 2ADFH 3O3EA 5HD8D 4MNQE 3ELAT 2VLLA 2WQ8A 2XICA 3ARRA 5CGYD 5F93C 5GZOC 4UILH 3KPSD 1L7IL 1JTTA 1VACA 2G75A 1G7JB 3O4OC 5GZNC 4BFIB 5HHOD 4PJCF 4HC1L 4Y19B 3ULVD 1E28B 1P1ZA 1CYGA 3B8SA 1MJ7L 2YD2A 3QCVL 1AP2A 1REIA 2WLYA 5JDSA 3MV9B 3ME0A 5JOFB 4MMZC 4RNRB 3BPOB 3RQ3A 1J10A 3VRJA 4X4YA 4X6CB 5LBSH 5D96B 5FYJH 1U8LB 3MNWA 2A6DA 5CFHA 1FGVH 2P4AB 2ICEA 3TJHD 4HH9B 4F7TB 3THML 3O4LB 4Z7NF 4Z95L 4JFZH 5DTFB 1NUFA 4LSSL 8FABA 5D7JC 3JZ7A 4JY5L 2C5DC 4JRYB 5EO9A 3NTCL 3SCMA 3TZVA 1A64A 4PD4K 3LOWA 3AREA 5JA9A 4OFYD 1I9RL 4FTVB 3GUTA 3UTTE 3LKSB 1V3MA 2FO1A 5CEXA 3PV6B 1KC5H 1OAYH 1CD9B 1QFWL 5FDWB 1NANH 1EHLL 5D1ZC 5FUOH 4GSDL 1JPFA 2X9WA 3BKMH 3VFVA 3VWKD 5IB2B 1U3YA 1MFCH 3B2UD 1HINH 5SWZA 4ZUUB 2Q3ZA 4GXUM 4ELKA 1IGFH 2Z8VC 3KHOA 4NQEA 3ULSB 3OPZL 2X1PA 4U4BA 1Q9LB 4MJIA 1N0LA 2AJVL 3ORJA 4RQQB 2EDTA 2Z35B 2P5EB 1OOAA 3D2UB 3NFNA 3Q6FB 1CDBA 2ICWA 1INEL 3BEWB 3ESVF 2KL6A 3DRQB 1YEHH 2B2XL 4S1RH 4RIRA 1AFVH 1MHPH 4P3CH 1T03H 3GDBA 5E6ID 2FSEA 4MB4A 3EW3B 4RFEA 5EIQA 4GKOA 3C6SB 3U0WL 1WEJL 1YMMD 3SDXB 5C0JB 1R3IH 1YPZF 2QLVB 3ULUE 1OTTD 2ARJB 1MHCB 4OLVL 1OAXH 2ADJA 4LMQI 4P23C 5KSBB 1QEWB 3QI9A 1KEMH 5IW3A 3ZTNH 4NNPL 4H88L 1HHGB 3VXMB 3VE0A 3UEZA 4ODVH 2ZUTA 4YDIH 3HZKA 4TULH 4U1GB 4LOUD 1J05A 2DQIL 3IVKA 5IFJB 4M5ZL 2Z4QA 4P4KD 5DMYA 1F45A 4WJ5B 3VG0L 3P30H 3UDWC 1QYGH 3FRUB 3LKPB 1DANU 2UYLB 3IJHB 2QQNH 4NCC2 2R4RH 3P9WB 4I18C 2D03H 2XKNB 4XWGL 5J3HC 1SVCP 4ZSOA 2O93L 5J4MA 1BVKA 1SYVB 4S1QH 1CICC 1EV2E 1QFWI 5GGSB 5ADOH 4MZ2A 5KANI 3R8BB 3KJ6L 4U1MA 1ITCA 4KJYB 4KGLA 5GQBA 4PP2B 3NA9L 5GS0C 4X98B 4NM8L 1M71B 1KLUB 5F3HA 3MFFB 2DQJL 2B20A 1C5BH 4ELMA 2E8YA 3HNSL 5E2UH 4JG0L 4Y1AA 4P2RD 3UJJL 3DXAD 4IDLA 3MYJB 1F8TL 2ITDA 5JR1H 4PLOB 2FCBA 3U0PB 4DAGH 1A7QH 4G8FA 5DMIH 4HS6B 3H42L 1ZV5A 3ARGD 3RVWD 2AERT 4XBGB 2VLKB 3BAEL 3HI6L 1FJ1B 5D7JA 2FX8H 4M1GL 4XNQA 2I26N 3K0WA 4FZ8H 5D1XB 4NQSB 4MVBC 4BZ2L 4ZAKC 1DL7H 3C5JB 3KDMB 4N5UA 4I0PA 1ZHLA 5EORH 3D25B 2OI9C 1HQ4A 5ERWB 3FFCB 3KPPB 2D7QA 5F7YC 5BRZA 2CLZA 5DRZB 1D5MB 4BH7A 3UO1H 5T33H 1CDYA 2YD1A 4MHHG 3VFMB 4IJ3B 4KU1A 1FSKC 2HKHH 4LNRA 1OTUD 3QEUA 1JWSB 1TZHB 2JIXA 3JWDC 2YC1B 4XGZA 5I75C 4NBXB 2AABL 1DBKL 4JFDA 4WWKD 1RULH 3DSFL 4ZFZB 4HKZB 3I6LE 2BCKB 1YY8A 3UJTL 3MX0A 4NZTL 2FO4B 5KVEH 4OSUL 2JCCA 3I50L 5HDQL 2ORBH 1EJOL 4KPHL 3OXSA 4LASL 3WFBH 5FKAB 1HDMA 2BNRA 2C9AA 4KK8C 4CAGA 4LPUA 4L4VE 4HGKC 4XMLL 3PL6C 5GRYA 1D5XA 1ZHNA 2X4QB 4KV5F 4M8QA 5CSZA 3S3JA 4XBPA 3IDMA 2JK5A 2P24A 5C0ND 3RVXC 4WHYG 4U1KA 1FORL 1AGCA 1F90L 1PAMA 4FFWD 3OXRA 3DIFA 1PG7L 1OT2A 3M1BA 4R97C 1RZGB 4DUWA 3TJEL 3VXUD 1UACL 2YMXL 5DMGC 1KELL 3OKLA 3VFWB 3MZTA 3P0YH 3Q48A 4XC3L 2AW2A 5FA4A 3RGVB 3UDWA 2R2EA 3L3HB 5I76A 1RD6A 2XWTB 2XQBH 4R90H 2D7TL 1NC2D 1LO3L 2X9XA 2A77L 4I18A 4XP6L 1G7LB 2HT4C 2DDQH 5CLWA 1PZUB 3MR9A 1EFXB 1WWCA 1CICA 2Q76B 1U95B 4HLZG 1IC5L 1W0VB 4R8WL 3TBTB 4R96A 4OZFG 4PG2C 1FO0B 2BFVL 4WFGD 5SV4A 2CLVB 1QVOA 1V8HA 1X5HA 1WGOA 5DYOB 4M03A 3KXFA 4MD4A 4HK3N 5GRVL 1D5BB 5FIEA 5L6YH 4LVNB 1DBMH 5AZEH 3IFNH 3WS3A 3MNZB 5GS3A 5JPNA 4MAYA 3T4YB 5IB3B 3GSXA 1WC7B 5FO7A 2Q8BL 2E6JA 4H25B 5E5MA 3VXTB 3N1PC 4M1CD 4LIQH 3QEHA 4ODSL 4OGAC 2IAMD 3MLUL 4H20H 3ZKNC 4ODTH 3CNKA 1HH9A 2XTLA 3KPRD 3QQ4A 1OP9A 1R5WA 4LMQE 4MLIA 4BUHA 4XVJL 2BZDA 1CGUA 1JNLH 1NPUA 1RU9H 1T2QH 4G6ML 5TF0A 1JPST 3TT3H 3FT3B 5JMOC 3DYOA 5HYJA 4YBLC 2VB5A 3SQBA 2OMBA 2Z93B 3P0VH 4NQDA 2CGRH 2WBJA 1QO3A 1AE6L 1UWEL 1KIPA 4EI6A 3BP5A 5K9QG 5JNYA 1BD2E 4Z7UA 3KJ4B 3O6LH 1T2XA 1TVHA 2Y9RT 3DX8B 3TPKA 2M1KA 1CD8A 1PX3A 5IROA 2HT2D 5A2IH 3BGFC 1N2RB 1T7YA 4OLWH 3SDDD 4YFDB 3BRFA 4ZFOA 3B9KD 2IH1A 4MXVF 3W0WE 3KWWA 2UZIH 3RL2B 2F53A 5LKNA 3BT2H 3ZO0A 2FRGP 1JNNL 5E1AA 4OD2A 5HHXH 3KS0H 5BV7L 1ED3B 4KUCF 1PD6A 3MRRA 1FZKB 2ADGB 3E3QC 4ZS7H 3MRHB 3LN5A 3GKWH 4EUPG 1D9KD 3SKMA 4J12A 1FFRA 5F7FA 5D6DC 4IRZL 4CMHC 2VDKL 4KY1H 1NEZG 4X5WA 5D2NB 1CBVL 4I2XA 1RK1A 3TA3C 1H8NA 5TDNA 2FEDC 4FQJH 3LQMA 5J1AA 4HJJH 1TJGL 4H26B 4YHYC 2W9DL 3FQWA 5IB5B 1YJDC 4XP9H 4X6FA 1JHTB 3BGMB 2GCYA 5IMKA 1CDUA 3IJYB 3RVTD 5K9KA 1FG9C 2OQJA 2HFFB 4G6AC 4M6OH 1EAPB 3DV6B 2NY2B 2VL5B 1Q72H 3VXRD 4P57A 3HTLX 4BFEA 4Y4HB 4HIJB 1UCBH 4X83A 3Q1SL 1XGPA 4L4VB 2UZYB 1IT9H 1LP9F 1S7UA 3CFBA 3PHOA 3KPMA 5DI8B 3OX8A 4NGHL 3LSOB 5E8EB 1DQJA 4QEGA 3EZJB 3VH8G 4X6EB 4GW5A 5HD8C 3TC9A 3F8UB 4K94C 1G7MB 1DQDH 1NCAL 2X4NA 2B39A 5CGYC 5EFIA 1KTDA 3GSQA 3C08L 4LEXH 2VIRA 4IRJD 3C2AH 3C87A 5J6HB 3TIDA 4X4ZA 1G6VK 1RZKH 4ODUA 4EN3A 2A6JA 3EGSA 3BGAA 4YXLH 5IFHL 5DD0H 3ULVC 3F62A 1XGYH 3OF6A 2BOBA 2A38A 1RZJL 1EPFA 2MJWA 3QIBA 1NGZB 1ADQA 1RFDH 1S8DA 3Q3GA 4WO4B 4K3DL 5C0AA 1A8JH 1E4WL 1Q9KB 5IBLD 2XWBB 3NCCB 2OJEA 2E6QA 4MJ6B 4Y4FC 4YFLF 2AJ3B 1DQQB 5E8PB 5C0CD 2VDNH 4LGSB 3UC0L 1JGEA 4JFFB 4UUJB 3AB0B 3LS5L 2M8XA 3TJHC 5EWIL 5DHYB 1KLGB 1U8NB 4JR9L 3BO8A 4PLKD 4YJZL 3CCHA 5DSCB 3EDDA 3HAEA 4PJ5B 3MROB 2JJSC 2VDPH 1NUDA 2R15A 2IPKA 3T0EC 1LO5A 3IETB 5F7MC 2I9LB 5FGRA 3MNVA 3CX2A 3RWEA 3LS4L 1OAZH 1CE6A 5ISZA 4NHCH 3IDNB 1M05A 3MRNB 5HVHB 4OLZL 4MJ2A 2KKQA 2NYYD 2XZAL 5IEKA 4ALAL 3ESUF 5J6GB 1J1OH 1NGWA 5BO1L 3VWKC 3MBXH 3BZEA 1BFTA 2F74B 1U8PA 4DN3L 3WO4B 3B2UC 3VXPB 1A6UH 4QCIA 4UMGA 3MRPA 1I3UA 4JHBA 3CAFA 3LHPH 3MCKA 1UB5B 3KNBA 2EDEA 4L3ED 4XI5D 1Z3GH 4Y89A 1WWAX 2GQHA 1RK0B 4U6VL 5E2WL 4O02H 4ZUTA 3LDBB 4ETYA 4G8IB 3ALWA 5MEQB 3L6FA 1NBZB 2ATKA 4XZUA 3QIUD 4XXDB 1XZ0B 5GGUA 3T0BA 3BKCH 3MLZL 2JELL 1OTTC 3RWDA 3O6KH 4QRPB 3D39D 2IWGA 1TQBB 2AJZA 2AEPH 4I3RH 2W65B 3QDMD 5FO9A 3LKOA 1JZ6A 5C6TH 1BQHB 5IOPA 4N1EA 1S9YB 3RVUD 3KR3L 4XWOD 1TPXC 5C08E 3BD4A 4RSVA 3OWEA 2J8OA 5E94A 4QNPF 4GLRI 3QAZB 4EJ1C 1X4XA 3NABL 4NJ9L 1MFBH 2RFXB 1UH2A 5HHOA 3BZFB 1C1EH 5JHDB 4LHUB 4U1NA 4XP5H 5I2IB 3MLXH 3GBNH 4UT6L 2J12B 4YX2L 4IMLA 4LPTA 5E9DA 2K7QA 4QRRD 3RNQA 2YD3A 1FH5H 3ABZA 2VNCA 4JDZB 2OZ4A 5T5FL 2V5RA 2DIBA 4QHUB 2O61B 1I8LA 3DVFA 3C8DA 1MI5E 4NO0A 3OAZK 5DD6B 2PTTB 4PJBE 5ID1B 1D6EB 1C12B 3BH9B 3T0XA 3I2CH 4KZEH 3NZHH 4M5YH 5HJ3A 1OVZA 1DDHB 3ARGC 3RVWC 1JGVL 5F72S 2W92A 4HPOH 4OZGB