1FDLL

Crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYYTTTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA D1.3 FAB (LIGHT CHAIN)
publication title Crystallographic refinement of the three-dimensional structure of the FabD1.3-lysozyme complex at 2.5-A resolution.
pubmed rcsb
source organism Mus musculus
molecule tags Complex (antibody-antigen)
total genus 52
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1990-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlL01
4UB0H 3QFJD 1Q9KB 5C07A 3WN5B 3ECBB 1MJUH 3EYUL 4OZFG 4HJGB 4JRXB 3MLTB 4LPCA 3LDBC 5DI8B 2QSVA 3FQNA 3W39B 5IMMB 5SWSE 2UY7A 4KK6D 2EZ0D 1DBBH 1BEYL 5J8OA 3S96A 4JHZA 5AWNH 3DHJA 1D5XB 5KANI 12E8H 4F7PA 3QSKB 1F2QA 4LF3A 5BV7B 4F7MB 1YMMA 4X6EA 2A83A 5HD8C 1OTUC 4DQOH 4PJDF 1D9KA 3LIZH 3OG6B 1OAXL 4KJWC 5ESAA 3UJJL 4P0DA 5SWZE 1CLOL 3ARDD 2DM7A 4BH8A 5LCVH 2V2XA 1NUGA 1XCQA 1ZHLA 4YHLH 2FZ3A 3QDGE 1UB5B 3QEQD 5HDQL 3WS3B 1N5YH 3NVQA 4YZFF 5I74B 2CXGA 3MZGB 2FNBA 3KDMB 4WW1B 5E1HB 3K1KC 3PWPA 1RK1B 5FCUH 3EW3B 1J1PL 1MWAA 5JDJA 3C5ZD 3QEHA 4LL9A 4QRRD 2F74A 3LKRB 4J3XA 4P59H 3VFNB 4QY8B 1AY1L 2FJFA 1I1AD 1VSCA 3NN8B 5JNYB 1HCFX 2EZ0C 2E6PA 4KK6C 5IEKA 1G9EA 2B39A 5IESL 3AXLB 3FRPA 4M62H 3G5ZA 2HJLB 4GW4B 5HY9B 4R9HA 4JHWL 4I18A 3T4YB 1O7VA 3TBVA 3FTGB 4QNPF 4LK4A 2YPLA 3NTCL 3V6FA 2VXSH 3SE8H 2GJ6A 4NKOB 4JPIB 1WJ3A 4HIEA 4FN0A 3ARGB 1ETZA 3ARDC 2L7JA 1S7UA 1QA9A 4RIRB 2PO6B 3FB8B 2ZPKL 4OLWL 5FOBB 3R1GL 3CDCA 2XKNB 2NY1D 5DD1H 2Q87A 2ATKB 3ULVF 2DQJL 3JWOC 4H0GA 1WAAE 3V4VH 1AXIB 1QSZA 1YEGH 2A9MH 4ZUVA 3C5ZC 1HHIB 1U91A 3WFZA 4Z7VE 2Y5TB 2X4PB 3MJ6A 1CDCA 2B1AH 1HOCB 3TWCL 1KFAH 1N4XH 4J8RA 1M6OA 3NCJL 1CYGA 4LOUC 1JHKL 3QQ3A 3MV01 4F7TA 5IB5A 3QHFL 3CZFB 1I7UA 5JHDD 4F8QA 1BWMA 4XBEH 4JHBA 3CDGA 3QEGL 5C92A 3SJVA 5DRZA 4D0DA 1CDJA 3GO1L 5T1LA 4DKAA 3O3EA 2XPGB 2OJZH 1Q9LB 5IKCB 2VZOA 3RDTD 1T1XA 1SMAA 5IJVB 5HHOE 5KVEL 1ZANH 3CIQA 1I3UA 2V2WA 4I2XA 2MWCA 5EULV 4RBPH 3QH3A 4FRWA 3MLWH 3DVFA 1S7RA 4J1UB 1RY7B 2BOBB 4KAQL 3UDWA 1KCRL 1OVZA 5E2VH 1QFHA 1S7WA 2XG4A 5HDLA 5EOCH 2BY2A 1A1MB 1HH6B 5ESQA 5J11B 2NY1C 1GZPB 1AFVH 1TZHA 4GAYA 2LTQC 3TNNB 5I19H 3RY5A 3EYVB 4WW2B 2YUXA 4XNYL 3L6FA 3RTQD 1I8LA 3DO7B 2BCKA 5DJZA 1VFBA 1IGIH 3VXNA 3LKSB 5CEXA 4NRXB 4G6KH 4HX1B 3ZTNL 4DFIA 3N1PC 1T83A 1QSEA 1NUDA 3WFDL 3MBXL 5HGHB 1T80A 3OV6A 4M5YL 4QHUA 3A6CH 4KKBC 1YQVL 4IM8A 5FO8B 3I6GA 3O6MH 1KJMB 1G6RH 3TT1L 5JW5B 2B4CC 3T0EE 3SN6N 4GW5A 4QGTA 5F44A 3VFVA 4JPKL 3MJ8B 1NC4A 3F6IA 4JM4L 2BXZA 3C09B 1WWCA 2XN9E 1KEMH 4NNYA 1YN6B 3DTXB 4LCUB 4HZLA 1KPVA 4XPHH 2X1XR 2DL9A 1PX3A 4JGMA 3B9KB 5JOPE 1UZ8A 2A6KB 1BM3L 2NY3D 4JFEB 1FAIH 4PRHA 1KCSH 1G7IB 1P7QA 1PX4A 2DQFA 3IDJA 4IS6B 1C16B 2HFTA 2XV6B 2IAMD 2DTSA 3ULUL 2N1KA 4MAUH 3A6BL 3HFMH 4AEHL 3RTQC 5I1AB 1OF2A 4QXTB 1U95B 1IMHC 5H8DA 1MCWW 2VDRL 1Z9OA 3VFTB 1JWMA 3JV4B 3SKMB 2NZIA 4OFYA 5E1AA 3IDNA 4YIQA 1A3RH 1ADQL 1H5BC 1GIGL 3BI9X 4D9LL 1QYGL 3MLRL 4LSRH 3VXME 2D0GA 5C0BE 3RRQA 2HVKB 5DGRA 3DV6B 1DUYB 1A7NH 3CFDB 3TIDA 1NFDB 2EXWC 5DTFA 5F7WC 5HYQB 3V4PL 3RIAF 5KJRL 2KPNA 4PYGA 1O0VA 1W2KT 2VH5L 3O4LA 4X99A 1T1YB 2NY3C 2GYSA 5EB9A 4WU5A 3V52H 4NOBA 4G8EB 4LDLB 1MY5A 4HUKB 1RZ7L 5D1QD 3WE6B 3BP7A 1E6JL 1FH5H 3H9ZA 1G9MC 1A47A 2FH6A 2IAMC 4HUWB 1XAUA 1IAIL 4M7LH 1JUFA 1P4LA 2P5ED 4GKNA 5F6HI 4Z7WB 1XIWD 4TVSa 4HIIB 2V17H 1U0QA 5EZJA 4B7IA 3KXFA 3BAEH 1HH9B 1MUJA 4YQXH 3TT3L 2DQDH 2FD6H 3E8UL 5D1ZA 2CIIB 4IOFD 2YC1A 5C7XL 1C5BL 1EEUA 2AK1H 4LHUD 1I7ZB 3RPIB 4L8SC 3P9LB 2BNUB 3GK8H 1T3FB 1U8PA 4J4PC 4Z7NF 3DSFH 1AGBB 3C60D 4NQDA 4KQ4H 5BVJA 3WFHA 4TUOB 4P5KB 4ODVL 4KRLB 4N9OB 5SWQB 2CK0H 4ZAKB 3E6FB 3MRNA 3QO0B 1U93B 1EHLH 2XNAA 4LP4A 2VXTH 3VXRB 2HG5B 4YEEA 3BD3A 4OZIF 4WO4A 2RQ8A 4YBHA 1KEGH 1AE6H 5FB8A 1NFDF 4FFWD 1LO3L 4Y4FA 1DLHB 5D1QC 1MH5B 3O6LL 3QRGL 3QUXB 4HUXB 1ZGLA 2Z92B 1LGVA 1XIWC 3RGVC 1ZT1A 2Q8BL 3WDIA 2B5IB 3QQ9D 3I3BA 2R69H 1R5WB 1RI8A 3P77A 3DIFA 2HJFB 3GHEL 3O8XB 2GIYA 5HHXL 1IGYB 4M4RA 1AI1H 1NGPL 4IOFC 3O2DL 4Z7WF 4QRQB 4R4BA 4U6XB 2Q1EA 3QIWA 1U2HA 4DVRL 3RWFA 5FHAL 4BSVA 1U8HB 3K1DA 4XH2B 3EOTL 4TVPH 3UJIH 1T4KA 3C60C 1TQBB 4O51A 5LAXA 3CFCH 4O4YH 2ITDA 1IE5A 3IFLH 5I16B 2DTML 5DT1H 1KGCD 3MLSL 5EN2B 2Q3AA 4TTDD 4PS4H 5CBEB 1J18A 2EDHA 1UCBH 2ZUQB 1FL6A 1CD9B 4NQXA 4YFDB 4LVHC 3B9AA 3FQTA 4O9HL 4PRIA 1NGWA 1Q0YH 4FFWC 4X6FB 3TYGH 1LK3H 3NIDE 2FBJH 2YD3A 3VI3E 1IGJA 3DI2B 1W72L 4LCWD 5DJ8B 2R4RL 3PWUB 4N8VB 2NYYD 1MI5D 1SYVA 3D6GA 3QQ9C 3S3PA 1DVFB 3QB7C 3V9FA 3VWJA 5JQ6L 1YUHA 2UYLB 3UPAA 1HHGA 4FABL 1KJ3L 3QWRD 4GUPA 3BHBB 2X2YA 2R0WL 1F8TH 3OKDB 4FQCL 3WIHL 3O6KL 4HXBL 5INCA 2AABL 4HZAA 2I07A 4HG4K 3O2WH 2XQBL 1EFXB 2JELL 3NABH 1FG2B 2YPKB 1KTKE 1SM3L 4Y4HD 3AS0A 3U9UB 4OQTA 5D70H 3CFKB 2QADD 3IAPA 5GGUA 4QTIL 3S4SB 5HVHB 2NNAB 3ELAT 4ZNCD 3V7AE 5DK3A 4BH7B 4TTDC 5I1LA 2Z4QB 4MLSA 5HYJA 1P6FA 1HHJB 4LSPL 3JWDL 4ZO9A 1CS6A 3GMNA 2QEJA 3FQXA 1CXLA 1UEYA 4JZOA 5I71B 4X7TB 4L4VE 5IR1B 2BSED 5GGSB 2V7HB 2VXQH 4Z6AT 5EUKB 3OJ2C 1WIOA 4HUMB 5DSCB 2EIEA 5ACZB 3MRGB 3MRKA 4MCYB 4AL8L 1E4XH 1WWBX 5H37G 3C9NA 4X7CC 2W60A 1CLCA 4EI6B 2HWZL 5DEFB 4ODSL 5DJ6B 4RGMB 1MJ7H 4ZOEA 3BZEA 2J6EH 1EJOH 5F7YC 4JFFD 3IJYB 2NYYC 3AREB 3TA3A 3QDJA 2Z8RA 3MPCA 3OL2A 1G7HB 2IFFL 1NDMB 2RFXA 1K6QH 2CLRA 1OCWH 1FVCB 4Y1AD 4Z0XB 1AGCA 1BZ9A 4UIKL 1OSZA 3WHE1 3BIAX 1VGKA 2WQ8A 4HMDA 1P53A 4Y4HC 4FXKB 2I26N 1F4XH 5FUCC 3V6OC 1TTGA 3WHE0 1HXYB 2QADC 3CK0L 3B8YA 1G0DA 2DI7A 1S9KC 3CDFA 4FFVD 1YPZA 4LU5H 3D9AH 2HFGL 2JCCB 3N9GH 1N59B 2C4FU 5CGYD 3KLAB 4X0KA 3QXTA 5FYJL 2Z31B 4MJ6B 3IETA 3CX5K 2L4OA 3HAEB 5FUOH 1H3UA 3VE0A 2EKSB 5MEQA 4ONFL 5JA8B 2EDTA 4R4ND 4Z77B 3G5YB 5LWYL 1A0QL 1S7SB 4PJFA 3ZT6A 1NMAH 1JWSB 5DUPH 2D7OA 2R23A 3TYFA 4XPFH 3PHOA 3S3SA 1MCKA 2PYEB 1QHOA 4X6CF 1IFHH 4DTGL 3BO8A 4NQTA 2AV7B 2XI9A 5SX4I 4YHKH 4OZIE 4LQ1A 2VR5A 3ILQD 5IP4A 1JZ5A 4ZD3H 4PJAB 1JNHA 5TQ0L 1G7JA 4PJIA 2EO9A 5TDPB 1TMCB 2DYPB 2LV4A 4FFVC 2VQ1B 1IQWH 4N0UE 2CLVA 4Y19E 4YHOL 3OB0H 4MQ7B 3FFCA 2Q8AH 3SE4C 3OGCA 3DBXA 3B6SB 3PV6B 3IU4L 43C9B 2VNCA 3UPRA 3VWKB 4NBXB 4W6XB 5INDB 4ODUA 3RIFK 5KSAA 5C0RL 3KAAA 4YDLC 4JO1L 3BISA 4TUKL 4R2GC 3BMVA 4MJID 4R4NC 3ZTJH 4Y5VA 5BCAA 3MV7D 5ICZA 4X5WB 3KPRE 5F9WB 1XGYL 1JZ2A 2EC8A 2X4NB 2HFEB 1N3NB 5IW6A 2DF3A 5SX4H 1QLRA 2GT9B 2X4QA 3C6LA 5F6IC 4NHCH 4UZGA 3WYRA 1S3KH 3HI1B 1QSFB 3MV9B 1NCCL 4GRWB 3GBLA 5JXEC 3D0LA 2A73B 1KYOK 5GGQH 1A1NA 5GRYA 4RZCA 3T08A 5IMLA 3WO4B 2P42B 3ILQC 5T3XE 3RL1A 5I8OL 1LO2H 5EBWB 3O6FA 1RMFL 1T22B 5E4EC 4LMQE 1A7PH 4P4RB 2CK2A 3BPNC 5CS7A 2NY0D 2G60L 4HKZB 4AH2A 3NCYS 4PLKD 1EDQA 4XVSL 1ZLWH 2FLBT 3CSYB 4XNQB 4TQEH 3T3PF 4H0HB 5C2UB 2ZCHL 5KSVA 1CGSH 3F58L 4K7FB 4YDJA 1IC7L 3EYSL 1B9ZA 2BNRB 4NUJA 4R7DA 2OM5A 2BK8A 4OI7A 1MVUA 3PGDA 5IT2L 3EJYD 3OR6B 4K7PX 5JLZB 2VDOL 1UZ6F 1UACH 4OF8A 2JJSC 3X12A 2VDPL 2XKSA 2F53E 3REWA 2R0LH 1UXSA 3RWGA 1I9JL 3S5LA 5IB3A 1QRNE 2A9NH 1JYXA 1R0AL 5I1CH 4HS6B 2J3SA 4KUZL 3V79C 2QJDA 1MHEB 1JPGB 1BPVA 5TPWH 4LCCB 4LPTA 4P2QD 1G9ML 1CXHA 4GRWF 4X6DE 4P2RB 4U1IA 2Q7YB 3KYMB 4XRCB 4KPHH 4RGOH 3G6AB 2C5DC 3BQUA 2NY0C 4PLKC 4RWYH 3O11B 4HK3N 3K8LA 5E7FA 1ZVYA 3U4BL 4PJXB 5CZVH 4Y2DC 1AKJD 1GPOL 4NQCB 4ZSOE 2BJML 3ALPA 4EN3A 5T5NF 2VLMD 1I8KB 5JR1L 4D9RD 4MNGB 3LKOA 1CGYA 2VTFA 5D2LE 2CLZA 3U7YH 1NLDH 1QUNA 2BHYA 3QHZL 4WWKA 3O3DA 3O0RH 4FP8H 4MS8D 4MJ4A 1SEQL 4QOKD 4WJ5A 3DX6A 2JB6B 2DMCA 4HT1L 4HF5L 1OWWA 4HV8B 1PG7L 2GSGA 3RI5F 3WDHA 4I0CC 4LSTH 1XGPA 5MERA 3U2SA 1DBAH 1NBVL 2GITA 3SDCA 3QXVA 1BBDL 2CMRH 4NJAH 2AKRA 4UT9H 5IVXA 4G3YH 4H88H 5E70A 3KPSB 3HN3A 4S2SA 5LGJB 4HFUH 1GZQB 4ZTOH 1LVEA 2BC4A 3TV3H 4Z95L 3FN9A 2ADFL 5IHUH 2M26A 5F9DC 4AJ0A 4LQFH 5I6XB 5D5MB 1QFUL 4JR9H 3P11H 4D0BB 2CO6B 2NW2B 1UM5H 3BW9A 3UTSE 1INEH 7FABH 5IVZA 4NC2B 1INDL 1I3VA 3U1SH 2Y9RT 3S5LG 2WLYA 2JB5L 4IRZL 1ZHKB 1KCLA 1HILA 5DF0A 1B0RB 3BPCB 3QUZA 1I1YA 2X1QA 4Y16D 5TF1H 3ULUF 4UV7H 2IQAA 5DHVB 4ZPVA 4YPJA 4OZHA 3VFRA 3UZEA 3CMOH 4U1JA 4MS8C 3TBTA 3PJSB 4EBQH 4PV8B 2BNQB 4XCEB 1QQDA 1NGQL 3ARYA 2HRPL 1ZLSH 1PSKL 1VHPA 4JDTL 5DZOA 3WLBA 4AMKH 2XZAH 1D5BB 1QFWL 1X5GA 2P8PA 3Q6GL 2ZKHL 4OZGB 3V8CA 4Q9RH 3O9WB 2EDDA 4K7PH 1B0GA 3QFDB 4LIQE 5D7IF 1FYTE 4OCRH 3MRBB 4JPWH 3SY0B 5C0CA 5T3ZE 2H32A 2JE8A 2EE9A 3OX8B 5FDYA 5JOFA 5I30L 1HEZB 3CVHL 3E6HA 1A9BA 5KTEH 2JIXB 4LSSL 1WIUA 4XP6L 2A0LD 4NRYA 3NIGF 1MFEL 1KB5A 2NY6B 4I48A 4GMSH 3GM8A 3QJFB 3IJHA 3WJLA 4O2EB 3GIVA 4R8WL 4XHQA 1F4YH 4Y5YC 1OGAE 3IU3A 5D5MF 2WLZA 4Y16C 1Z5LB 1KTDA 1I8IA 1CFVH 1IL1B 3RX8A 2VITA 4GXVH 2WINA 5D7JB 2LQRA 3MUGB 2ILLA 3DMMA 1CGXA 1EHXA 1WICA 1MHCA 2D7TL 2DQGH 1AIFA 3ARVA 4HMCA 3VGAC 3CVIH 3D2UB 3LOWA 1G9NH 3W0WA 3BOVA 4PJ9D 4BM7A 1RJZA 4OCLC 1T89C 5ANME 5C2BL 2VLKD 3FMGL 2X89A 4LRNH 5DRXA 5EORH 5BZWA 4NKDB 3ETBF 1YNKH 2R8SL 3IXAA 1FFNA 1PKQA 4TPRH 2AQ3A 4N5UA 1S7VB 3MCLH 5E56A 1KIRA 2H2PD 2A0LC 3KPPB 5T5FL 1QBLL 1W72B 1MPAH 3KPLB 5CGTA 2BDNH 4WV1A 3WD5L 4WTZA 2YD7A 2EO1A 3TO4B 4WU7A 1FZOA 4CVXB 4K07A 1R24B 3TN0D 3X13A 3HI5L 1MSPA 2Q76A 1X3DA 2EIDA 1OGTB 5E6YA 3MRRA 3HMXA 3GI8L 5CUSH 1KJ2L 4NPYB 4JO2H 1R5IB 1TDQA 2ID5A 4CJ1A 3S88H 1BQLH 3Q6FB 5J9PB 2CJUH 1FNFA 3PWNA 1OP5K 4RDQG 1UKSA 3SE3C 4L29B 1NGZA 3NCMA 5E00A 3S8WA 5C07B 1X4ZA 4HCRH 5F89A 4PJ9C 3QNZA 5F88B 1PLGH 1VFUA 4K94H 2AJSL 1K9TA 4OZ4A 4QXUL 1YEIL 4KY1L 1HK6A 3CXHK 1I3RB 4P3WA 2ED9A 3DROA 1XEDA 1SY6A 4HGKC 1P69B 4PPTA 4X6BA 25C8H 4E0RB 1MF2L 1CLYH 4FMKA 2F9BT 2X4TA 4OTXL 1UWGL 3GNML 3S37L 1D9KB 2QQNL 1U6AH 2ZSVA 1CFSB 3HA0A 3TN0C 1N7MH 1NMCB 3MYZA 2V5TA 1OAYH 4J2XA 1ZHLB 2K1MA 3O3UN 1A7OL 1IGML 2FZ3B 3GJFA 3H3KA 3DXAE 4W6WB 2WK2A 4CW1A 2A6DA 3NZ8B 1YEHH 1FIGH 2X05A 3SKJH 4PG9A 2HMID 1U36A 2EEBA 3C5ZB 4WIQA 1SMOA 1J05A 1MWAB 4PD4J 4HS8L 5JW4M 1HWHB 3QEHB 1Y6MR 2HKFH 2KDGA 1FNSH 2PTUA 4G6JH 2BSSA 1F00I 2F74B 5ITBH 5M94B 1I1AB 4YXHH 2RAMA 3T0VA 2FJFB 4K9EH 4I9WD 4V1DA 1H8NA 5B3NA 3TFKD 1PVHA 2A74A 5ALCL 4MJ2A 5D72H 4AIOA 2VDKL 5HGAA 5HI5D 3P4OA 4ETQB 4KRMB 2R2CA 4PRPD 2XG5A 3GSXB 4QRSB 3G6DL 3TBVB 4AEEA 4FQIH 3M17A 2YPLB 2Q86B 1KELL 2DM3A 4XMLH 4L4TE 4JG1H 4LVNC 4JKMA 1P1ZA 4HIEB 4YUEH 1ETZB 4UT7H 1UENA 2RGSA 2VISA 2AXFA 4HJ0D 3OQ3B 2P5WD 4OM1L 4JFDE 1HI6B 4ZFFA 5BRZD 3VW3L 4DN4H 1YN7B 4GXUM 4IRSD 2B2XH 3T2QA 1F13A 2LTQB 3RP1A 4ZUTA 5F9AC 1RUQH 2VZVA 1YEJL 4K7PY 4E41E 2HMIC 5AD0A 1KTLA 2NW3A 5BS0A 5ITFB 5HHME 1FSKC 4TVPD 2W0FA 3KHOA 4P2OA 2ZCLH 5IJKA 3H2WA 1C1EL 3D39E 4K3JL 4ODBD 3SE9H 5F1NB 3RVUC 3GUTA 1DUZA 43CAB 4ELMA 4PJ8D 1UM6H 4JB9L 4J8RB 1M6OB 2Y23A 4OCXL 5DQDH 3TH2T 3JTTA 1S9VA 4UIMA 1D6VL 2EC9T 3PWJB 3QDMA 3QQ3B 1AR2A 3TFKC 4F7TB 4PJGB 1I7UB 2J4WH 1HE7A 2DBLL 4OUUA 3L5XH 4MWFA 4YWGH 5HI5C 1MCFA 1QKZH 3WLWD 4O5LL 3VXPA 3RDTB 2F19H 4WI6A 4NBYB 1T1XB 3U36A 2OSLA 3BSZH 3WFCL 4JY4A 3TH4T 2ZUWA 1FVDA 4PTUB 4I2XB 2W38A 1E28B 1OARL 4KRPD 2OR9H 4HJ0C 2Z8VC 4Q6IA 5T33H 3FFDB 3V0AC 5I73C 1S7WB 1CF8L 4IRSC 1UWEH 4NNPL 1AQDB 4WFED 4L8BB 5HHNA 1ZLUK 3MLYH 4GAYB 1UWXH 4P3DA 5MHSE 4XXCC 2D4DA 3TLRA 3VXSA 1W0WA 5GRJH 4N9GA 3RTQB 4LLQB 4UB0L 1A6WH 5DJ2A 3L6FB 1MY7A 1PBYA 4PJ8C 3ESVF 5EUOA 5ISZE 5LQBH 4YHNA 3U0TB 5TDNB 3VG9B 5CGMA 2ENYA 3CCHA 2Q7NA 3VXNB 3BVNA 3AMLA 5C0EA 4APQA 3GMPA 4HGMA 4JCLA 2J8UA 2P49B 5DWUL 5GGTH 1DBBL 1JF6A 5C0NC 1H5BB 3L5WB 1U8OA 2DBJA 1QSEB 5AWNL 3WLWC 3PG2A 1XCTA 5FIEA 3X3FH 2DQCH 12E8L 4RMUA 2BVOB 4QRTA 3ZZ1A 5DVLA 2IH1A 4HKBA 4DQOL 5ID0B 4TUJA 3DX7B 2OZ4A 4FTVA 4PJHE 3H9HB 4JREC 5EU5A 3VD5A 5LCVL 4G9FA 1YYMH 4AIXA 2YPVH 3AM8C 4YHLL 1EPFA 3U0WH 2VDLH 2Y4SA 4XX1G 4WUUA 5BZDA 5H2BB 5DJ0A 3GMLB 5F7MC 3UPCA 1N5YL 2I9LA 1NL0L 4PRHB 3WHXA 4UQ3A 1P7QB 3Q2CA 3H6JA 1F58H 4CBPA 4H26B 2C3VB 1A6AA 1O5DT 3KPOA 4OBSA 4JZJB 4B41A 4P2CG 3ULVH 4WFFE 5FCSH 3ZE0E 1EO5A 4KTEH 4P9MH 1OF2B 1BFVH 3EGSA 3MV8E 3IDGA 4QHLA 4P59L 1EBPA 3VDAA 5EC1A 2W9DH 1JWMB 2IJ0C 4N90D 2VR9A 1AQKH 2LVEA 4KI5E 1OM3H 3V5KA 5B3JF 1FO0A 3IDNB 4M62L 2EYSB 3CFBB 1LE9B 2C9AA 1YDPA 4K3DH 5C0GA 1K2DB 1PD6A 4MB5A 1QHPA 2VXSL 1FORH 3SE8L 2A6JA 3TIDB 3MJGX 5DTFB 5HTSA 4RX4A 3VXUD 5FV2A 5AUMA 2H45A 4IOIA 4X7SH 3QULB 1EO8L 3O4LB 4X99B 2VERN 4QCIB 5D7LA 2ICES 3BP7B 4GKSA 2VLJD 2P5EB 3V4VL 1XIWB 1YEGL 1EK3A 2GJZB 2A9ML 3ES6A 1P4LB 1JYNA 5JZ7D 3RWEA 2DIBA 2O5YH 5EZJB 5DK0B 2B1AL 1QPXA 1KFAL 1YMME 1DN2A 1Y0LA 3DX8B 5E9DA 1S7XA 4PD4K 1UH4A 4BKLB 1FHGA 1MRFH 1EGJH 1TFHA 5DJYB 3C60B 5EOQL 1F3DJ 1A2YA 3WS6C 3X11A 1AD9B 5BVJB 2FX9H 4BA8A 4KMQA 3WFHB 4M43L 1RIHH 3BRFA 4PGCA 3SBWA 5ADOL 1J8KA 3WXWH 5E6IA 3MLWL 3PWPE 1KBGH 4M9OA 5EO1A 2O93L 5E2VL 2NLJB 1X4YA 5EOCL 3DURA 2QQLH 4H1LA 1AGFB 1AFVL 4Y4FB 5BQ7B 3MRQA 5I19L 2DKUA 1A6ZB 2BY1A 1F4WH 3HPJA 1IAMA 4RNRB 5JZ7C 3W9EA 1YECH 1ZT1B 1AC0A 3CVHB 2AJZB 5C8JB 2NX5D 1PY4A 3P77B 4DGVH 1IGIL 5D9SA 3OMZA 4ZFGH 4NQEA 2GJJA 2OK0H 4UDTA 4F57H 3QYCA 4X8JA 5GXBB 2FHCA 2NPLX 1NJ9A 4G6KL 2FECI 2X9XA 3ALWA 3OR7A 4R4BB 2GJ6E 4U3HA 3AAZA 3U30C 4LSVH 2E9WA 1AHWC 1FL3A 2K3TA 3A6CL 3GFUA 5J6GA 1T4KB 5LG1A 1G6RL 4M6OH 5LAXB 1MCPH 4G5ZH 5C0IA 2XY2A 1Z9LA 1KEML 4J4PA 3UYPA 4XPHL 3IDMB 3RUGA 5DZLA 4NQXB 2QKIB 2QQKH 4ONHA 3FQTB 4PRIB 3BKMH 3UC0H 1FAIL 2C26A 1KCSL 4LKCA 3GMRA 1OAZH 4BJLA 1RJLB 1T0MA 1Q94A 4XBGA 1IGJB 1OT1A 2KKQA 4JDVA 4M7JH 3LQMA 3GMQA 4MAUL 3HFML 4HWBH 1SYVB 4N5EC 3D3VE 5IWLC 1IC5H 2BZDA 1HHGB 2AK4B 2ICWA 4GG6B 4GUPB 4JVPA 4JRXE 1Z0NA 4HEME 1NC2D 3RGVA 5INCB 2E7BA 2D2OA 4Y4HB 4JFOA 1N26A 5E8EB 4LSRL 2P8LA 1XZ0A 3S34H 4ZPTB 3K4AA 1D5IH 5DMKA 3GMMB 4LHUA 5GS3A 2IAND 4MAYA 3OAYH 1KJ2B 1DQQA 1A7NL 4M93B 1BOYA 2G2RB 3NFPA 3WL9A 5I1LB 5HYJB 1NFKA 4P5MB 2X41A 4P4KC 1C12B 5T1MA 3FQXB 4ERSH 1RZGA 1X5ZA 3QXAA 4JZOB 1VGEH 5D1XD 1J8HD 4UBDD 5K59E 2W0PA 2DKMA 1D3CA 5B3JE 3GRWH 5FYLH 3V52L 4OLVH 5K9OA 2W60B 1NLBH 1TZGH 5CLTA 1FH5L 4JFFB 4I0PD 4ZQKA 4M7LL 1ONQA 2FHBA 3TA3B 3MLUH 2V17L 3U83A 4CN6A 2R9HD 3LPWA 3BAEL 4YQXL 3ROLB 3H9SD 5KOMC 2DQDL 5MEND 3T1FB 1BD2D 2PKDA 3QDAA 4FQQA 4LLUA 4Y1AB 2CLRB 3QQ4A 2HP4A 2UUDH 4OIAA 2AK1L 3OG4B 1AGCB 3HB3D 3SGKC 4LMQI 1OSZB 3H42H 2YRZA 1ZHBB 1VGKB 3BFOA 1NEZA 4N1EA 4GG6F 3GK8L 1VADB 1Z6JT 3DSFL 2UVEA 1KLGA 4KQ4L 3PL6D 1JZ3A 3FO1A 1IC4H 4HKJA 4D3CH 1ZVSA 3L7EB 2F58H 1YPZB 1JGVH 3C2SA 3NPSC 2R1YA 4OSUH 4BUHA 5ERWB 2CK0L 3RL2A 4YDKH 2GY7B 5D1XC 3T3MF 4UBDC 3OF6A 2VYRE 2VXTL 3TP4A 2D31A 2DMKA 3P0VH 3IETB 4UOJA 1CT8B 4YDLB 1KEGL 3AU1A 5E8PB 1E27B 4DCQB 4MXQD 1AXSA 4TYUA 1WBYB 3UTPE 5MEQB 2YA0A 5D6CA 2ARJQ 5DVNA 4BZ1H 5B8CC 3P4LA 3TYFB 3OBAA 3MUY1 4HIXH 3NMEA 2R9HC 3PHOB 2R69L 5C09E 1Z2KA 4LHUG 1AI1L 3BO8B 5DD0H 2I24N 4RAUB 3TO2A 5GS1B 3HB3C 3LRSB 2E5EA 5C9JB 1LP9A 2APWA 1UVQA 3L95B 4G8FA 4TVPL 3UJIL 2J7LA 2X09A 3HE6D 5FF6A 3BPNB 3CFCL 3OKKA 1HZHH 3IFLL 5E4IA 2FIKB 3VH8A 5IW1B 4MQTB 4FQHA 3THMH 4PS4L 1P9MC 2ITCA 4TSCH 4U7MA 4X9HA 1GGIH 3HHRB 2ADIB 4O58H 1T6VN 3DBXB 1UCBL 5SWSD 5C08E 1CU4H 1YPZF 3SQBA 4ODUB 4MJIB 1Q0YL 3C8KA 3KXFE 4MXQC 2OYPA 4D0CB 3SHSA 3MV7B 5FYJU 1LK3L 3DVNB 3TYGL 5DK2B 4U7SA 2FBJL 3DX9A 1UJ3C 4Y5VB 4RFEB 8FABA 4PBVC 4TNWF 4P2YA 2Z35A 4ZUUA 1X5YA 1NEZG 1X6LA 1LQSR 5HGDA 1IBGH 2PW1A 3R06B 3QPXH 1QLRB 3C6LB 4PJFF 2VZTA 1F8TL 1SYSA 3QDGD 5GSRA 2H6PA 4NN5C 4MJ5B 2ZJSH 5IMLB 3P4MA 3BD4A 3O2WL 4XAWH 1KPRB 3RL1B 3NABL 3QUYA 4TNVK 3UXFA 3IFNH 4NQSA 3HE7D 3O6FB 1KUMA 5DQJB 3HE6C 5D70L 2NY0B 3PQYE 1OW0C 3L3JA 5F7FA 5D96B 5SX5K 3VFWA 4AH2B 1PJ9A 4U3CA 4U1KA 5ELIA 5ACMA 5D93C 5GGRA 4Y7MA 3KYKH 4CVZA 1FZJA 3O3BA 4PJIF 2ERJC 3IKKA 3P73A 5IQ9B 3GJFK 4LARH 5GZOD 2VXQL 4CMHC 5KSVB 1E4XL 2VJXA 3QEUA 3F62A 4JFEE 5ESVA 1MJ7L 5JIHA 1G9NC 5GS0H 4HJJH 4HQQH 3RHWF 1W8NA 1EJOL 1Z9SA 1P2CA 1ACZA 1R3HA 3OHXA 1I7TB 2UZYB 4FQ2H 2VLRB 1F11B 2OZ4L 3X12B 3REWB 1A1OA 1K6QL 5LBSH 3MGTA 4X5XA 3VXQB 3EJZC 3VH8G 1IM9A 4M8QB 1CE6B 1IEBA 1WAAA 4F7EA 1UG9A 5DRNB 5L2JB 4PBWD 4U7KA 3IGAA 3E2HC 1WTLA 4CMMA 1F4XL 2P43B 3ZKSD 1BEYH 1BVKA 4D8PB 4OLXH 4Z7VA 5JXEA 1FL5A 4LU5L 4ZG1A 3D9AL 3GKWH 1BOGA 4M7LT 5ETUA 3T0XA 3N9GL 4LLYB 4YGVA 5T1KD 3FN0H 1G7PA 3LKQB 5GZOC 5GRWA 3QIUD 1LWRA 4EN3B 3RZCA 4O2FA 2CUMA 3FOLB 4HUUA 5FUOL 1MJ8H 3ZE1E 2ZP0T 4U0RC 5FA3B 5IBUB 3LKOB 2X6MA 5HHOA 1JBJA 1NAKH 1UFUA 5DRWA 2QBWA 3IDXH 3ZO0A 1J1OH 4XPFL 3VD3A 5T3ZH 3PNWA 1A5FH 3JSSA 4JFYA 1NBYA 4HWZA 3TJEH 2ADGA 4M5ZH 2EDRA 4XT1C 3RX7A 4NGHH 3KS0H 4KJQD 2V2TA 1WV7T 2EYRA 1K3IA 4YHKL 2O26U 3FCTA 5C0AE 1XGPB 4UDUB 1MAJA 3RWCB 1LD9A 3DPBA 1ERNA 3F6LA 2HA1A 4ZD3L 1ORQA 4L3EE 4MNQD 2AKRB 3LQAL 2KQNA 3AUVA 4O00A 3WFEH 3VG0H 3MRCB 2BC4B 5J12B 3KYNA 2JJTC 1AJ7H 3P30H 1T1ZA 1XF4B 5DVKA 1IGTA 2EXYD 4XMKH 1KLUB 5EA0H 2Q8AL 4YX2H 4ODTH 1NPUA 2FL5A 3QIUC 3UTTD 1GGUA 2C3XA 2IBZX 2ICWJ 3HS0B 4HXAH 4JFXA 3VXRE 3BW9B 1YZZA 3DYOA 1VFAB 1BZ7A 5IVZB 4ZODA 2B0SH 5DEZA 3T0EA 4Y16B 1UKQA 4AM0A 1HILB 3QUZB 4Y2DA 1H15B 1RHFA 2IQAB 2ESVD 1F3JB 1WZ1H 2V5RA 3IF1B 4OZHB 3VFRB 4U1JB 1QVOA 5JORA 4WDIA 1JIBA 2AGJH 2VXUL 2XN9D 4KJQC 4NO5A 4NHCL 4W4OC 1S3KL 4J3SA 5GGQL 5JOPD 5KS9B 2P8PB 4PGDA 3UMTA 5GSVA 3WJJA 2VLLB 3VGAB 4WEMB 4AZ8A 1HDMA 2IPTH 1LO2L 4JLRA 4TOYH 4LEXH 2H32B 3ILPA 1HSBA 3W2DH 5CD3A 3NH7H 5CILH 1A7PL 3QT2A 3QXUA 4GOSA 3MGOB 4MXVE 2HLAA 4GRWH 5CP3H 3GSOA 2P47B 3WKMH 4MCZB 1WK0A 2EXYC 4P2QA 5DMIH 1W8OA 4RSVA 1RU9H 5IVXF 4TQEL 5KG9A 4UU9A 4NRYB 4OCNC 3JVGC 3P0YH 4CADA 4ZO8A 1SHMA 4Z7QE 3IJHB 4JPVH 3GIVB 5C0BA 3HR5A 3VXMD 3GEWB 3KPNB 5E5RB 3MJ9A 3VFUA 3IU3B 1I8IB 1I4FB 2ZCKH 5ID1A 3DGGA 3SKOB 4IHOA 5LGHH 1UACL 1U42A 1BJMA 1J0YA 4C56D 2R0LL 4MA3A 4PJIE 4WTXA 5MP6H 3H7BB 1OP3K 5GZND 2A9NL 1G6RB 4OM0H 4PY7A 5I1CL 4OZHF 3DNKA 5DEGB 4LGRB 4L9LA 3NIFE 1AIFB 5TPWL 2QSTA 3FFCE 4QYOA 3NFNB 2FWOB 3GHBL 1DZBA 2J12B 2VLKB 5DJXB 1RJZB 4RGOL 3MBXH 4YNYB 1KXQE 2EDOA 4HFWB 5BZWB 3T65B 1CLZH 1VKXA 2FJHA 1PKQB 4RWYL 2W65A 2VSCA 3BGFC 2CO7B 1KIRB 3TM6A 1M7XA 3LVEA 2BVQA 5CZVL 1CG9A 1MEXH 3MCKA 5BMFH 4C55A 4RDQF 3ULVD 3WNOA 3TN0B 1AGDA 4LKXA 4M61B 1MIEH 3S35X 1FZOB 3U7YL 1NLDL 3X13B 3NOIA 2JLLA 2Q76B 2F8XC 3WV0A 5DYOA 2R2BA 3MRRB 2EC9U 5EOTB 4X98A 3O0RL 4FP8L 3ARBC 1FFRA 3OXRB 4GAGH 1B6UA 3ULUH 4HW6A 1KCKA 3A6BH 4LGPB 5GZNC 1M4KA 4NFCA 1BVZA 2H9GA 4Q7DA 4LSTL 3U48A 4Z7OE 4D9QD 1DBAL 5DJAB 1X5JA 5E00B 5I76B 2BMKA 3GSNH 2CMRL 3B9EA 4NJAL 2EDXA 4UT9L 1ZLVH 4G3YL 5L8LB 4MQSB 1MQKL 4WHYH 4HFUL 3WEXB 4ZTOL 1UM4H 4YFLI 3TV3L 3R0NA 1DBML 3DROB 5BV7C 3F12A 5IHUL 3MXWL 4HUVA 4OD1H 3ULSB 5EIIA 1NAMH 2JCCE 1YJDH 4X6BB 4I4WA 4JR9L 2MOVA 2X4TB 1UM5L 1JP5A 3IDYB 5IVOA 3H0TB 3LQZA 1INEL 2C7UA 4WI9A 5DD5H 3ULVC 3ARGD 2YD1A 3CC5A 4PUBH 4KDTC 4QT5A 5EU7C 3U1SL 3AY4A 4JQXC 1VCAA 2QV2A 1LNUB 2OBGA 5F93C 4XGZB 3MREB 1E4WH 2KBGA 4UV7L 1SJVA 5I74C 3SDXE 3VD4A 3Q5TA 1TCRA 1J9CT 4EBQL 3VU2A 1M7IB 4CW1B 2A6DB 1FFOB 3FOMA 5L8JB 1MCRA 1ZLSL 5B38A 3SKNA 4CGTA 4PB9H 2JF1A 1AP2A 4AMKL 2XZAL 4Q9RL 1WC7A 5I1JH 4URTB 4OCRL 5DHVH 4QXGL 4JPWL 4PJBB 4XZUA 4PJAE 2FR4B 5F3BA 2IMNA 3QZWA 3UAJD 4V1DB 3MBEA 2YBRB 4PRPB 4YAQA 3W11C 5K93A 3P4OB 3G04B 3NPZB 4U6HA 1I7RA 4HMEA 4BQCA 3M17B 5AAMA 4NHUA 4GMSL 3ARGC 4ISVA 4DK6A 3MMEA 2CKBH 3ARQA 4DOHE 1F4YL 4HLZH 4LPVA 5FECB 1TJIH 5BRZB 1CFVL 2EH7H 1LK2A 4IRSB 1ZS8A 3O6LH 1WLHA 3PIQA 4F37K 3ET9F 4GXVL 4OZFH 5HPMB 1OL0A 4XXDB 2BVTA 4ZUTB 2GK0A 1PQZA 5IOPA 1UC6A 5BS0B 3VMPA 3S35H 1RJYB 1XR8A 1QSFE 1HHKA 4QRUA 5A16A 5EC2A 5TFSH 2IWGA 4F9PA 2DQGL 3MLZL 4LFHG 1DUZB 3CVIL 4ELMB 4LEOA 3UAJC 1PKOA 3ARRA 1U8QA 4PJEE 5B21A 2UZIH 5EZLA 3S98A 2X40A 1XMWA 3BIBX 5EORL 4LRNL 4M48H 3DUSA 1YNKL 4OUUB 3AS1A 4UUJB 4TPRL 4PJBF 3K80A 4Q2ZA 1BREA 4EI5D 2DI8A 3U36B 1MPAL 2ZUSA 2BDNL 4ORGB 1FVDB 1XF5A 4KRPB 1JF1A 1M05B 5B38G 3N1MC 1FDLH 2DWDB 4Y5XC 5J11C 3CPLB 4Q58C 5CUSL 1ZA6A 3OXSA 3C5SB 3HPLB 3QZWG 1JWUA 3BZ4A 5EBLA 5C0CE 4WW2C 5DC0A 3S88L 1BQLL 5GPRA 4W70A 6FABH 2GSIB 5D6DC 3TNMB 2CJUL 4X4ME 3VXSB 3R8QA 1W0WB 5C0FB 3HC0A 5EU4A 4BFBD 5DJ2B 3TVMA 2HAZA 1Q9OA 4HXBH 4HCRL 5EUOB 1EO7A 4DUVA 2AABH 3F7QA 1PLGL 4K94L 3GM0A 3JXAA 1JNLH 2AP2A 1A6UH 1EH9A 4APQB 2EICA 1U8OB 4XPGH 1V8HA 5DVOA 4JM2A 1XCTB 1ODAA 3EYOA 1RSFA 3FT2B 3V7AG 4ELMF 3ARUA 1RUML 3OKEB 1HKLH 4NQUA 5FYLD 4EI5C 1A64A 1CFQA 1CLYL 2VN4A 4QRTB 2EDLA 3JWDH 1XGRB 2IH1B 5FO9A 2EEDA 1WBZB 2DB8A 3VD9A 3C09C 1U6AL 5FM8A 4ZMAT 1IKNC 5CZKA 2NTFA 4GRMA 1N7ML 2IBZY 4EVNB 4AL8H 1B2WH 4JN1H 5EU5B 1JN6A 1OAYL 4G9FB 4JDZA 4F3FB 3BRDA 2DD8H 4Y19A 1CVRA 2HWZH 4ODSH 5L88H 4POYA 5F1IA 3WNPA 5MEOA 4KUCF 2I9LB 3QUKA 5FHBH 4UQ3B 2ZOKA 1YEHL 3L9RB 4FQXA 1FIGL 5I17B 1KOAA 2OS7A 3HG1D 5DFVD 5HHPA 1WVZA 1KXVC 3GIZL 4G9DB 1PY9A 1T6WA 2HKFL 1FNSL 4G6JL 5ITBL 4WI2A 4ZUSA 4YXHL 2X4UB 3KPMA 4NO2A 3SDDD 3GBMH 4YE4H 2DJ4A 4K9EL 3KPRD 4R0LC 3G5XA 2E3VA 3QAZB 3BEWB 1N6QL 3RVXC 1Q0XH 3V5KB 5D72L 2OCFD 2H3NB 1MWAH 5EUOF 3SGDH 4U1GB 3OKMB 5C0GB 5CIPA 4FQIL 2DQTH 2OQJB 5BW7C 2J8UF 2HFGH 4XMLL 2JKXA 4ZAKD 4Z78A 2WSKA 4JG1L 2A6JB 3C6SA 3DRTB 4YUEL 4UT7L 5DDHA 2YUWA 1S7TB 4KXZH 4IOIB 4JY5H 3ZT5A 1RHHB 5LWYH 2B2XL 1MFCH 5HDBF 4CDHA 3ZT7A 3X14B 1RUQL 2X1PA 5JO5A 5F7DA 2FSEA 2WWKT 2N56A 2PTTA 5DFVC 2ZCLL 1UB6B 1KT2B 4OZGE 3O8XD 2YMXH 4OKVA 4NZDA 4MQXD 1UM6L 3G6JB 2VIRA 5DQDL 3LCYA 1V3LA 2Y36H 4U31A 5TQ0H 2J4WL 2N4IA 2F53A 4JEGB 5F7EH 1GSMA 3L5XL 1AHWB 1QKZL 5C6PB 1CFNB 1QRNA 3VRLE 5D2NC 1HQ4A 3KYOA 4CJ0A 5CD5D 4PGBB 1UXWB 2F19L 3RVVC 1A2YB 3X11B 1D6EA 5DJDB 3BSZL 2C3WA 3L3OA 4XNUH 4ZAKC 5TE7H 4XCYB 2CD0A 2ICEA 4JRYB 3F7PC 2OR9L 2WAHA 5E6IB 3T2OA 1NEUA 5T33L 3NCEB 3QA3B 2EIZA 3D87B 5EO1B 4LLVB 4PGEA 1MCWM 5IFJB 1D7FA 3VXOB 5LGKA 1UWEL 4H1LB 4G8GD 4WNQA 5IMOA 3TPUB 3VFSA 2GTZA 5D7KD 3MLYL 4QRPE 1R3JA 3MRQB 4KV5E 3HPJB 2F5BH 4Z7UA 5GRJL 1C5DB 1MHHA 2ZNWA 4YHMH 2NX5B 2FHFA 3V7MA 1SEBA 5D2LA 3W9EB 1A6WL 3SEPA 4IMKC 3O8XC 1WSST 1F02I 2XQYG 1Y18A 3BGMA 2QHLA 4MQXC 5E94B 1L7TH 5LQBL 2ARJA 4C83A 5L9DH 4Q9CA 4UILH 3MYJA 2DAVA 4NQEB 4X8JB 1EFXD 3SPVA 4H0IA 1B0WA 2HN7B 1K5NA 3AAZB 3FB5A 5I66B 1FL3B 3X3FL 1TQBC 4Q97A 2M1KA 3ALXA 1AO7E 5J6GB 4XPBH 1S5IH 3DV4A 3LHPH 4XNMA 5GS0D 5BVPH 1CL7I 1NCDL 5C0IB 4FOMA 1DEDA 3BX7C 5CEZD 3A67H 3MLXL 4GQPH 3D69A 3PHQA 4ODXB 2N7BA 2XTJB 1IC7H 1E0OB 1YYML 3CU1A 3WS6A 2YPVL 3Q3GA 4LPWA 5DD3H 3U0WL 2VDLL 1T0NB 3QUMA 4PY8J 4ONHB 5EFIA 2YS4A 3FT4A 5IT2H 4LKCB 3WIFB 1F58L 1Q94B 4XBGB 3DRQA 2BSTA 3ARED 3QDME 4MD0B 4JDVB 3IFPA 3W81A 3UTSD 3T09A 2VDPH 2IQ9H 2XYCA 3QFJE 4KTEL 5F70A 4P9ML 1BFVL 3CSGA 2F54D 3GSVA 3KWWB 3NFSH 1ZAGA 4HBCH 1X5XA 4JKPL 1L7IH 2W9DL 2MPAL 4X4YA 2VDQL 1AQKL 1UCTA 2FJGA 1OM3L 1BQHB 4JFOB 5AAWA 2P8LB 1XZ0B 3E1F1 4K3DL 1CL7H 3F7VA 1BX2B 1DFBH 3BESR 5DMKB 5GS0C 1Q38A 3O4OC 4D2NA 3EKCA 1DQQB 1FORL 3B9VA 3MLVH 1FYTD 3MROA 1DQJA 5I71C 5CBAA 2ENSA 3NFPB 5T3ZD 5IM7A 3AB0B 4QXWA 2Z31D 4X7SL 1JV5A 3DYMA 3QEQE 1XF3B 3RNQB 3FO0H 5DQ9B 5CSGA 2NY2B 3QWOA 5A3ID 2R2HB 4RGMC 3FAXA 5K9OB 4QTHB 1CD1A 4I0PB 3AREC 4ZFOA 1T1WA 2O5ZL 4ZQKB 3DGCR 2KZ1B 3RUGF 1ONQB 1SEQH 1H8OA 4QRRE 2PYED 2O5YL 5MENB 2E9JA 1BD2B 1XF2B 1OGAA 1TNNA 1I75A 3KPQA 4IEFB 3QXWA 5TF0A 3WDJA 4N0FA 3VFPA 2AVGA 5C70A 3VRIA 4FQJL 3G08B 1JGEA 1BBDH 1AGEB 3TBYB 1U3HB 3DO3A 1HSAA 3K2UH 4ZXBD 1MRFL 1EGJL 5IWLA 1U8IB 2VRAA 9CGTA 4PJ5A 3MO1A 2DYPD 3PL6B 2P8MB 2EDBA 3ARFA 2FX9L 3VCLA 3EOBA 1ZVSB 3M07A 4WUUE 2V7NB 4ACPA 5L7XH 5CSZB 1MLCB 4R96B 3WXWL 2HFFA 1RIUH 5ANMA 2XOTA 2Z31C 4MD5B 1EVTC 5HI3D 3MRHB 1KBGL 3D25B 4GBXA 4G80B 2QQLL 3CZJA 5A3IC 4EIGB 5IEHA 1UJ3B 3CH1A 3MACH 3DHMA 2JK5B 4P4KA 5D6CB 1PEZA 2AI0H 3CFIC 3EOAA 2FYYB 5L2KD 1YECL 4N68A 5JW4R 1DCLA 3S36X 3Q5YA 1ZV5A 5F9OH 3QCUH 3MV9D 4DGVL 1QLFA 4CNIB 1QFWH 3Q6GH 3RWIB 2ZKHH 3L3HB 1UEMA 3VJ6A 5GIRB 4JZNA 3ISWA 4F57L 3PDOB 2WMPA 5JHDE 4KKLD 2AJ3B 4PJGE 3HLAB 4LSVL 3HE6B 3S37X 3SCMA 1CXFA 3FT3B 2OTUA 2CUHA 4AENA 4QEGA 1I9IH 4M6OL 5FF6B 4L9DA 3DUHA 4LSSH 5F7LB 3PXHA 4PREA 5I0ZA 2HT2C 5H37H 4XP6H 3K2MC 5D93B 5D7LE 1MCPL 4G5ZL 3WO3B 5SWSB 5DFTA 4XC1H 3FONA 5HI3C 4LNRA 3T4AA 5I18H 5I8KH 3GKZA 1EZVY 3LN5A 4U1LB 2FIRT 3IVKA 1JHLH 3L3KA 5SV3A 2QQKL 2BNRD 3UC0L 4ZNEE 2HTLD 4BQ8A 2HJKA 1OAZL 4XVTH 5F9WC 1BJ1J 5FOJA 3EJJX 1AH1A 5IB4A 8FABB 3LN4A 4M7JL 4MD4B 5E9DE 4DEPB 3B43A 4G7VL 2PXYA 4HWBL 1IGFH 5SWZB 1IC5L 3PGCB 4HLJA 2FECL 2MHAA 5E8NA 3VDCA 3D85A 3QDGB 3MNZA 4NO0A 5JPNB 3LRHA 5IUSA 3WO4C 2VZ3A 4KKLC 2DM4A 4W68A 1CDIA 1U8NB 5J1SC 3E3QC 3DXAD 3P4MB 3V0VA 4PP2A 1FFPB 1N2RA 2C1OA 3H9SA 3HE7B 1O7SA 4P2RD 3ZDZE 3WNKA 1JZ4A 1SJHA 4NQSB 4XCFH 3S34L 4QWWC 1D5IL 5K9QG 1JGUH 3L3JB 3S97C 2Y7QA 4OLYH 4DZ8B 3UBXA 5JDSA 5F1OB 5GGRB 4N0CD 3FRUA 4NQCD 4ERSL 3O3BB 1VGEL 3ULUD 1FLRH 3I75A 1L6XA 3TZVD 2HTLC 4U0RB 1G0YR 3GRWL 5FYLL 4OQTH 4OLVL 2CRYA 3RPKA 5J6HA 5HSFA 1TZGL 1JRHI 4L4TA 4CU8A 4DKDC 5ENWB 2NQCA 1P2CB 2XWJB 4MA8H 3RU8H 1CXIA 3MLUL 4HC1A 2VQUA 2EDKA 4QHMA 3AMKA 4QHKJ 1NBZB 1A1OB 4JFDA 1J0ZA 4X5XB 4PB0H 5HVWA 1LO0H 1TQCB 2EE2A 1IM9B 1EAJA 5HI4D 4LCCC 2P46B 1WUNT 1YEFH 3H42L 5F8QC 4F7EB 1NCNA 2AJSH 3S36H 5JMRA 1JTOA 1CFTA 4QXUH 3IGAB 5FGCE 3KPSD 4CMMB 1BVKB 4M3JA 3RUGE 4AY0A 4OCYH 4D3CL 3D39D 4H5SA 2F58L 1JGVL 1FL5B 3P9WB 1T5XA 4OSUL 3M1BA 1BOGB 5EU6D 5ETUB 4N0CC 3VGBA 4NC0B 3PWLA 5DUBA 3ULUC 3GNMH 2WIMA 3OKLA 3AFLA 3CJJA 3PWVA 3TZVC 3V2AR 4NSKA 1MCNA 3O3AB 4HUUB 3LY6A 4JANB 1QEWA 3MRIB 3G5VB 1IGMH 1NCAL 4A6YA 3GJEB 5HHOB 3VMOA 3O41A 4MYWB 4M1CC 2P5EE 2WWMD 2OJEA 1NGXA 4GRLD 1EHAA 2BNQD 4Z5RB 3PNWB 4JFYB 5CJBA 5CP7B 4YK4C 2O61B 1OD9A 2XRAH 1D5MA 1MAMH 5DD0L 3EO1A 3FQWB 5KAQG 5IROA 1SVCP 3UBXG 3O9WD 1YJDC 2EYRB 2ZG3A 1U8KB 3V0WH 5I1GH 5HI4C 4WHTB 2DLIA 4EUPA 1LD9B 1OAUH 5GGVH 2HVJA 2HT4D 4IRJA 4U1MA 1ORQB 1QACA 2BXYA 1BF2A 5J89A 1J0IA 4EIZC 1HZHL 4O2CA 5ISZA 3EFFB 1WAAF 5EO0B 5I6XC 5JTWA 3THML 4BZ2H 2IH3B 4TSCL 1GGIL 3RY6C 4O58L 3BH8A 1LO4H 3HZYA 4HS3A 4Z7VF 4PJCB 2FL5B 1CU4L 1XGTA 2I27N 3HUJB 5F96H 3DLQR 2G5BB 3GSUB 4IMLA 4CU7A 1BZ7B 4OLZH 3OJMB 4XC3H 1KNOA 1ZXQA 4F2MA 3QI9A 2QTEA 1EAPA 3N1FC 4GRLC 1V05A 1DJSA 4NYLA 1IBGL 4PJHA 5E5MA 2XN9B 1TVBB 2DQUH 3BH9A 3QPXL 5TDOB 5AZEH 3O9WC 3VFOA 2MMXA 4G43A 2QLVB 2ZJSL 4XAWL 2VABB 2ICCA 2HT4C 2XWTA 4PRBA 3LKNB 2E9IA 4JLRB 3IFNL 1IAOA 3ILPB 1HSBB 3AS3A 3P4NB 3MV8A 5CD3B 4O5LH 3OKOA 1P84J 2HLAB 4QF1A 1KGCE 3BGFB 4Y4KD 1JPTH 3WFCH 4U2YA 2NY6C 2E6QA 1BFOB 2YD8A 1IC1A 4LARL 2XTLA 3EO9H 4MA7H 1FNEA 4MHHG 2VL4A 1OARH 2VAAB 4F33A 3KHQA 4GS7C 3TO4D 3VXMB 1F6LL 2C3GA 1WFTA 1WT5C 1CF8H 2AEPH 4YHYB 1D5ZA 4EUPG 5GS0L 4HJJL 4LCWE 3VFUB 4HQQL 4S10A 1A3QA 4LGSB 1MI5E 5B39B 4FQ2L 4EDXA 1LP9E 3UTZA 1Q9WA 1AXTH 5DHYA 5CWSA 4TULH 5LBSL 4MA3B 2OL3A 4L8CA 4ZFZA 2YD5A 1PW3A 3FB7A 1NANI 5C07D 2OLDA 1CICB 2GCYB 2YD6A 4FXLA 1I1FB 2XQYK 4QYOB 2YEZA 3V95A 5DWUH 5FUCE 3V6OE 3K7UA 4W4OA 4OLXL 2LU3A 2WUCL 2VWEC 2OTPA 4P46A 2MKWA 2P44B 2F8OA 3GKWL 4Y4KC 5BXFA 3OJDA 3SOBH 5CHNB 4BYHA 1AD0A 5IB2A 1HXMA 4MNQA 1YMMD 4F7CA 3FN0L 2BVQB 1QSVA 1T20A 3Q0HA 1VB9A 3AROA 1D9KD 1MJ8L 3TO4C 1JPSL 2P7TA 3FHQA 1CGUA 3ZKQD 1AGDB 4LKXB 5HGGS 4JQVC 1B4JH 2Z91B 1TJGH 1NAKL 4HAGA 1VFOA 2UWEA 3OKNA 4JCMA 4U1HB 1NL0H 4JFFE 4LIQL 4PRDB 3IDXL 1C8PA 1J1OL 1FVEB 4KJPD 4YHZH 2BP3A 2DQEH 1KULA 1ORSB 4M6AA 4X98B 5T3ZL 1A5FL 1G7LB 5EPMA 3TJEL 4M5ZL 1IEAA 5IF0B 1NANH 5EDXA 2GFBA 4NGHL 4Y1AE 1A3LH 5GJTH 4BQ6A 2APXA 4YJZL 1BMGA 4WCYH 2DDQH 3CGTA 3JWDC 4GKZA 5H35B 5ICXA 5FEBA 1RUAH 1EVUA 3CFEB 5FYJD 2AJVH 2P1YA 3EYFA 4Z0BH 2CDGA 4LLMA 2B1HL 5IIEB 4OV5A 4UINH 3WFEL 5C0JA 3VG0L 4ZYKB 5KBNC 5IHZA 2C1PA 4K3GA 3RJQB 1AJ7L 3P30L 2UY6A 3ZKMD 5EA0L 4XMKL 3PABB 4YX2L 3T0WA 3DI3B 4ODTL 2YPLD 1NQBA 4U6VH 1QBBA 4HXAL 1S8DB 1D9KC 3DWTA 1DEEA 1GJIA 2XT1B 2C7UB 1NMCC 3CC5B 4QT5B 2B0SL 1NDGA 3CH8A 3DVGB 4KJYB 1EO8H 2Y25A 4LAJH 4H8WH 5A2KH 4FS0A 4KJPC 3OAZK 1WZ1L 4LDOB 1TCRB 2Z8SA 2AGJL 3LRGA 1LEIB 5CLWA 5GGVY 2EECA 5HYSA 5KVDL 2XZQH 1I1AC 1DE4A 4JHAH 4MSWA 5HVGB 1WC7B 4KZEH 2SEBA 2D3VA 2IPTL 3ARBA 4TOYL 2J2ZA 4LEXL 4XZUB 2ARWA 3D3VA 3W2DL 3NH7L 5CILL 1Q9KA 3SJVD 4NZTH 3WN5A 4CVUA 5EOQH 3ECBA 5T1LD 4LASH 4ORZC 2PW2A 4HJGA 3RWDB 3WKML 1H0DB 4JRXA 3ZKMC 5DMIL 4U6HB 3W39A 4HKXB 1RU9L 4M43H 1EFQA 3J7HA 4CKVX 1NBQA 4J3WA 2OTWB 3P0YL 4LLWA 3RVWD 5ADOH 4DKEH 1T2XA 4S0TD 3RGHA 4NHUB 1XFPA 3EIFA 1D5XA 2H32H 4P5TA 4JPVL 4DN3H 4MJIE 4Y5XB 3MMEB 4N1CA 4F7MA 1L4IA 3MV7E 4WUKH 4JGUA 2ZCKL 3NGBB 1OAQH 1ZS8B 2A77H 5LGHL 4G6FD 1MCEA 1KB5H 4L4VB 1UH2A 2GK0B 3QP3A 1JMXA 4HG4J 5MP6L 5C9KA 1FC1A 4HK0B 1HHKB 4OM0L 4QRUB 5C1MB 5A16B 2Y07H 2XFXA 5EC2B 4WW1A 4NM4H 5FV1L 4F58H 5J56B 3OB0K 4MVBD 5IGXH 1RK1A 1GGBH 1Y6KR 1MFAH 1QSED 3LKRA 3NIDF 3UO1H 1Z9MA 3DUSB 3RDTC 3VFNA 1R3LA 1CLZL 4QY8A 3VI3F 4JG0H 5CEYA 4EI5B 4ODWB 4Q2ZB 3QPQD 4NDMB 1MEXL 3RVWC 5E2TH 5LXGH 1CXEA 5BMFL 4DAGH 3U0PB 1NC4D 1P84K 2FO4B 2HJLA 4GW4A 5HY9A 1JF1B 3T4YA 1RZIB 5HYSG 1MIEL 4Z18A 4KROB 3UDWC 3FTGA 2VMFA 4NKOA 5A40E 2FEEI 4LRIA 5FYKU 4PRHD 3H3PH 1P7QD 2BVPB 4GAGL 1JWUB 3BZ4B 1GGYA 1ZT7A 2PO6A 3OJVC 4RIRA 1SQ2N 2V5MA 3HZVB 3QIBA 5FOBA 1KJVB 2P48B 2XKNA 1I8LC 1WWAX 3V6ZA 5HVFB 1BAFH 2ATKA 5ECJE 3TVMB 3VG9C 1WCBA 4MVBC 5TJWK 1Q9OB 4P2QE 1RAMA 3GSNL 3HMXH 2AEWA 4R0LB 5K33A 4S0SD 3P3YA 1F3DH 1HHIA 4Y89A 5GS2D 4OFYD 2X5PA 2Y5TA 2X4PA 5C09A 1UM4L 1YMHA 1CDUA 5DD6A 3CX5J 3EUUA 3EYOB 4OD1L 4OZIB 1NAML 1S9WB 1YJDL 3QPQC 1CFQB 4JQIH 1DL7L 3RQ3A 1WIPA 4R26H 1BP3B 2VLME 4WFHD 5I1HH 5DD5L 5FKPA 4PUBL 3RNKA 5IKCA 2IALB 1QP1A 2NTFB 1NGYA 4X7DC 5IJVA 1P5VA 3K81A 1SJEB 2CKNA 1IT9H 4N0UB 1JN6B 3BYYA 4S1DD 1E4WL 1M7DB 3O4LD 5GJSL 5KSUB 4Y19B 1SY6H 1KENL 4OI9A 5MEOB 3BZDA 4JFQB 4QOKE 5C08A 2YXMA 4FFYH 4YHIB 5AYQA 1T7YA 4J1UA 1BJ8A 4IDJH 4FQXB 5DURB 3HG1B 4JZJC 4PB9L 5SX5H 1A1MA 3CDYA 4R3SA 3KXFD 5I1JL 3SDDB 3VXTB 2AQ1A 4HDIA 4ZUSB 3TNNA 3KPRB 3KPMB 4NO2B 4M1DH 1C5CH 2RR3A 3ARTA 4KVNL 5D1ZD 3EYVA 3KNBB 4TSAH 4WW2A 3GJFH 1N5AA 1MCJA 3ZYOA 2VKXA 4LP5A 4MMZC 4J7RA 5HPOA 1PYWB 3N50A 4BFIA 1MREH 2X4RB 5D2NB 2DMBA 4CN4A 4RGND 4NQDD 1TETH 1JVKA 2A1WH 3K3QA 4NRXA 4DW2H 1F90H 3BP5A 4ETYA 1A02N 5HGHA 1ZT4B 4XCCH 3B2VH 4JM2F 4P9HH 2CKBL 3PQYA 1M71B 5FO8A 1A9EB 4L1HA 1KJMA 5JW5A 4L3CB 1TJIL 4WO4D 4BFEA 4NCC1 2EH7L 3MJ8A 5EBGA 5JHLH 4Y4FD 3LS4H 3MRPB 1KYOJ 1OWRM 1YN6A 3DTXA 4P23A 4IBLT 3F5WA 3PP4H 3QNYA 1S7QB 3S35L 3B9KA 2R2EB 1OQXA 4HPYH 2PTTB 1V5JA 2A6KA 3F65A 4JFEA 1WBXA 5TFSL 5KS9E 1G7IA 3KGRA 1X5HA 4PRAB 3FKUS 4KK9D 1GVIA 4HH9B 4OIIH 3VFGH 1U8LB 3BUYA 2R0KH 1OPGH 2C4XA 2UZIL 3QIWD 4QXTA 4WVRA 2X4SB 2F53B 4M48L 4LBEB 2IGFH 4RGNC 4EXPX 4ZS7H 1QRNB 5C6TH 5KN5B 1QR1B 3KYOB 1NCWH 3CNKA 3MA7B 3GSQB 4OBRA 5J7CC 3SKMA 3BT2H 1SBSH 4FMFA 4GH7B 1WCQA 3L3OB 5IBLD 3QISA 4DUWA 4B7LA 2IPUK 2Z0BA 4X6DB 3NACH 3I2CH 3IKCA 1RK0B 1OB1A 2ICEB 1FDLL 2G9HB 2CSPA 5EH1A 5IFHH 4RWHA 1DANU 3B5GA 3VI4E 5FKAB 1E4JA 3DV6A 4WHCA 1ND0B 4PGEB 4KGLA 4G8GB 4PRID 1YEDB 1NFDA 4Y4FC 5HYQA 3VGFA 3T8XA 5IMOB 4ZSOB 5EWIH 3VFSB 2GTZB 6FABL 1JTPA 1R3JB 1DN0A 1MRDH 1T1YA 2YSSB 5JW3H 4G8EA 2AK4D 5HJ3A 2X70A 3WE6A 4KK9C 3BGMB 2E7CA 2GQHA 4HUWA 4Z7WA 3BN9D 1TVHB 1JNLL 1A6UL 2VLKE 3QIWC 4HIIA 4Q9QL 5D71H 2AXHA 1QFWM 1HH9A 4XVJH 1DTUA 3SPVB 4XPGL 5DXWA 1A14H 3MRFB 4NCDA 2CR3A 5HXMA 35C8L 1HKLL 4LDEB 4RISH 5C0AA 3FAWA 1MCIA 4WWID 3O4OB 1J1XH 1ZGLM 5IBLC 3RPIA 4L3EA 3FO9B 3JWOH 4W6YB 5I2IB 5HYJD 2BNUA 1NH6A 5FO7A 1AGBA 2R0ZH 1HHHB 1XT5A 1B2WL 3PHQB 4JN1L 2DD8L 4TUOA 4P5KA 2YR3A 4X6CB 4X6DF 2HT3D 5L88L 3E6FA 5FUZH 5FHBL 3QO0A 1U93A 1OQOA 3VXRA 3UTSB 3DRQB 4LAQH 4I3GA 2YD2A 1VACB 2BSTB 3TA3D 1TXKA 3QDJD 2OZ4H 3IFPB 4KH2A 4JY6B 2F54B 2GUOA 3S7GA 3MFFB 3ZKND 1DLHA 1MH5A 3QUXA 4HUXA 3GSVB 3B5HA 3GBML 4YE4L 2Z92A 3BN9C 2ZG1A 15C8H 4X4YB 2Z93A 5D2LF 2FJGB 1Q0XL 1FNGA 1CDGA 4IMKA 1MWAL 5EBMB 2JJVA 3K8MA 3F7VB 3S9DB 5I0DA 4QRQA 4U6XA 2DQTL 3GSWB 4M93C 1FYTB 3FO2B 4YEFA 1QNZL 1RIVH 4LCYA 4XH2A 3U79A 4JFPB 3MROB 4UQ2B 1CGVA 2EKJA 1FO0H 4JY5L 1QG3A 2W0LA 3WXVH 2VL5B 5I16A 5FM4A 3MA9H 4QKXB 2HT3C 5EN2A 5CBEA 2MCPL 1MFCL 1X5LA 2D7QA 3IT8D 4YDVA 4HGWA 2IADB 4WI8A 3TA3C 4DFHA 1G7MA 1UQSA 2HLFD 1MELA 3ZKNC 4X6FA 1B3JA 4Q9BA 4UAOB 2YMXL 1OGAB 5C0DA 2PN5A 2YN5A 1YNTA 3VFPB 5DJ8A 3VRIB 3QXDA 3PWUA 4N8VA 1RV6X 2DIJA 2Y36L 1K8DB 3MC0A 4HK3J 1DVFA 4ZXBB 2UYLA 1P5UA 5F7EL 3LQAH 2NY4D 4PRPE 4RAHA 2AXGB 3MR9B 3ZDXE 4WFGD 3MO1B 1TTUA 3KPTA 1KCVH 2IPKB 4N8PA 4EKXA 4XNUL 5CGYC 3EOBB 1VENA 4R90H 4XWOD 1EFXA 5TE7L 3MOBH 3IAGC 2QR0A 3FFCD 5DGQA 2HFFB 3U9UA 2OR7A 1E6OH 2P5WE 3S4SA 5AG8A 2CDEA 5KSAD 5BRZE 4GBXB 3MUZ1 4TSBH 4DGIL 2GEEA 2XWBA 3H8NA 1HHJA 5DVMA 4R97B 5IEHB 3HKFA 3CH1B 4LSUH 4Q6YA 4FQLH 4HIHA 4X7TA 1OD7A 5GGSA 2V7HA 4EDWH 5L2KB 4KDVA 5EUKA 5DSCA 2F5BL 4TVPE 5ACZA 3MRGA 2HLFC 2VXUH 3EOAB 4YHML 4KI1A 2NXZD 4NC1C 3QJHA 3C6LD 5DEFA 3SQOH 1L7TL 1QLFB 5L9DL 5GS1C 4UILL 4R4FH 4H1LH 3IJYA 3AREA 2PNDA 2D9CA 2IG2L 1QO3B 1ZA3A 2AEQH 1G7QA 3HI6H 1G7HA 1BECA 2NY4C 1NDMA 1OY3B 3JBG7 1Q1JL 3O6FD 4Z8FH 4X4XA 4U3XA 1FVCA 3SCMB 4OF6A 3TF7C 2OTUB 4XPBL 1S5IL 4AENB 2XZCH 3LEYH 4JO4H 3LHPL 4K8RH 4XWOC 2HYMA 5BVPL 4YXLH 2CXKA 3BD5A 4KKCD 4FXKA 1I1RA 4HBQA 2ICWI 3HCVB 3U7AA 4C59B 5DFWH 3A67L 1HQRB 3IB4A 2EH8H 5KSAC 4UTBL 5DD3L 2RHEA 4HWEH 4GAFB 2J8HA 3L3KB 4WFEE 2JCCA 4U1SB 4Y5VC 2G75B 4N8VG 3B83A 5CCKH 2Z31A 1JHTA 4M7ZB 4YO0A 2VAJA 3LN4B 3HAEA 2ZSWA 2VLRD 2IQ9L 4OF3A 2PXYB 2I60H 4XWGH 2EKSA 1U8JA 3C6LC 4FXGB 4Z77A 1UADC 1S7SA 3BUTA 4RRPA 3CXHJ 1JWSA 2MHAB 5E8NB 5FAAA 3NFSL 3DVIA 3D85B 4HBCL 3SDXA 2Y6SD 3MNZB 4NO0B 1L7IL 3IYLW 3BDYH 4RQQB 3DXAB 1MCLA 3ARPA 2APBA 3GHBH 5A2LH 3ZYJA 2D0FA 4ZOBA 3V0VB 3S4SG 1N2RB 3O6FC 2C1OB 5I8EB 2AV7A 1H9VA 3X3GH 3CMGA 1CL7L 5D96C 1IM3A 3OZ9H 2NY7H 3TBSB 1DFBL 3E0GA 5DHXB 3BQUD 2BHUA 4LLDA 5IFAH 5CJOL 4CL7A 4KKCC 4PJAA 3MLVL 4KMTH 1UWXK 3QG6A 5TDPA 3FRUB 1T03H 4EN3D 4Z7UE 1BLNA 4ZO6A 3TZVB 3W9DA 3I75B 3LS5H 1F5WA 3FO0L 1RZ8A 3EJYC 4MQ7A 4DZBB 2XACC 1U2CA 5SV4A 3B6SA 3GSNB 1KCUH 4KKNA 4U1NB 43C9A 4WWKD 5MI0B 4L4TB 5IG7B 3VWKA 4I3RH 4YDIL 5D7IB 4K3HA 2GTWA 2AJUH 5F7HA 2MCG1 1JCKA 4YK4B 1CTOA 4NKQB 4X5WA 5J06A 4BK5A 1NAMB 4JFDB 4N90E 2HFEA 1C08A 1TCMA 1N3NA 2BFVH 3BMWA 4XNXH 4XBPB 5FM5M 3SDCD 3SDAB 4UMGA 2JJUA 1XR9B 2GT9A 5E2WH 1ZHNB 3K2UL 4E41B 1MQKH 1K4CA 3MV9A 1FN4B 1QSFA 3BWAB 3HI1A 3DUUB 2WBJA 1JGDB 3KR3H 3D39B 3BQUC 5KSBE 1DBMH 3H9YA 3MQIA 2BY0A 3MXWH 4Z9KB 5EU6B 4AK1A 1T5XB 5L7XL 2J88H 3VXUE 4PJEA 2VQTA 3HMWH 1RIUL 3HAEG 1T22A 4EN3C 1NMBH 5DUBB 3BZFB 3HC4H 4LVEA 1XGQA 3PWVB 4RRPG 5I75B 4R7NA 5KAQF 4XNQA 3MACL 3BJLA 3QUZD 2VLJE 4WWKC 3TC9A 4DVBB 3O41B 2AI0L 2YHGA 4GRLB 4OGYH 3MOAH 5FA4A 2D7NA 1R5VB 1U3ZA 5B4MD 1FZMB 3BXNB 1W0VB 2AV1B 4PTTB 5F9OL 3QCUL 5GRUL 1D5MB 5TGBB 3OR6A 4G6MH 2W9EH 5JLZA 3G6JE 4NN7C 4QXGH 5EZOH 5EIVA 2L7UA 1B4RA 5C0CD 4X4MA 1BIHA 3RWHA 2CKBB 4U1MB 4LSDA 3T2PA 4XB7A 1I9IL 3GMOA 4HS6A 1KF9B 3NCFB 1MHEA 1PZ5A 5J12C 4H8WC 4O2CB 4H20H 5ISZB 2Y5EA 4OZFB 2X44D 4P2RA 4OAWB 3KYMA 1GOFA 4XC1L 5I8KL 5I18L 3G6AA 3HZYB 4HS3B 1TIUA 4M6ML 3P0GB 1XGTB 4GS7B 5FYKH 1JHLL 3O11A 4H25A 4X80H 4IMLB 1OAKH 3QUZC 4OD2B 4PJXA 1KNOB 4XVTL 4HULB 4NQCA 4RFOH 1FP5A 1FRGH 1I8KA 3T77B 3N1QC 5E2JA 1IGFL 2W59A 4ALAH 5TH2B 2WV3A 4PJHB 4XP1H 5B4MC 5HYEA 2NX5E 1KN2H 4PJ7E 3BH9B 2GY5A 4JJ5A 4PJ5E 4YFLF 4B5EA 4HWUA 3BP6A 3VFOB 3MLZH 4G43B 4F9LA 5JUEH 1ADQA 1N8ZB 3W0WD 4JN2B 2JB6A 4HV8A 4PRBB 4BQBA 4XCFL 1DR9A 2X89D 1J5OH 1JGUL 3MV8B 2IC2A 3MRDB 3OKOB 4Y4KB 4ZTPH 2X9WA 1JI1A 4NUGH 4QF1B 4OLYL 5I9QB 1ITBB 1T5WA 2B20A 3QBTB 4WEBH 1LO5B 1HIMH 1GZQA 3K0WA 4JKKA 1U3YA 4JJHA 1FLRL 3WJLC 4L4JA 1KPUB 4OQTL 4LVOB 4NT6A 1NKOA 5M95B 1EXUB 1BIIA 3P40A 5J1AB 3F7YB 1NUNB 3RY6A 4D0BA 5GRVL 2NW2A 5HHQB 1W0YT 1GHFL 4MA8L 3RU8L 2HKHH 1EIBA 1ZHKA 1Q9WB 2QQQA 4KDWA 2EDYA 2OL3B 3JTSA 4PB0L 1LO0L 5CJXA 4L8CB 4ZFZB 1MFDL 3FB7B 2PR4L 4PJHF 1YEFL 4PV8A 3FQNB 3S36L 4O02H 2YEZB 3OAUH 3S96B 3CSBA 1D5BA 1YYLH 4OZGA 4CU6A 1QD0A 4IIQA 4OCYL 2IANE 2H2PC 3RIAK 4P46B 1RUMH 4ZS6D 4F7PB 4LF3B 3MRBA 1CIUA 2CDFA 1YMMB 4W4NA 4X6EB 3RAJL 3IRPX 2FB4H 1HXMB 3BE1L 5EU3A 5FM5O 2A83B 3ZE0F 2E7LA 1J8HE 4GFTB 5GISH 2J5LB 5ESAB 4NZJA 2JIXA 2P7TB 4WI4A 3WSQH 4BH8B 2V2XB 1XCQB 1RVFL 2WP3T 4KI5F 1X6NA 3REVA 1I9RH 3QJFA 1GL4B 3H9SE 3PWPB 5EPMB 3UJTH 5MENE 2XRAL 3O2DA 2GFBB 3GIZH 1CCZA 1MAML 1Z5LA 2W0KA 3ABZA 2BSRA 5I1GL 3V0WL 3RIFF 4QRPA 2KUTA 4FNLH 1X44A 1H8SA 4M1GL 3PF2A 1OAUL 4HIJA 5GGVL 2VDNH 5IEKB 5D7JA 1N6QH 4V1DD 4PYHA 2CDGB 4LLMB 1SJXA 4OV5B 3G5ZB 2RB8A 1F4AA 4ZS6C 4OKDA 4K23H 4I18B 5IHZB 4XCNA 3D2UA 4WRLA 2WUBH 4BZ2L 3V6FB 1LO4L 1JK8A 3IDYC 2GJ6B 3TGXA 4NKDA 5F96L 5I8CA 1FV1A 1S7UB 4G8IA 1AO7A 1S7VA 4OLZL 1QA9B 2R29H 4XC3L 2FATH 1FJ1A 1W72A 2Z9TA 2UUDK 1K8IA 3KPLA 2DQUL 4CVXA 1R24A 4ZUVB 4K3EH 5BS0D 3UYOD 4JQVA 3EFDH 5AZEL 1U91B 3F7RA 3WIHA 4P2OD 3NZHH 4NPYA 3I9GH 1AC6A 3GSRA 1EEZA 1R5IA 2SEBB 3H7LA 5AYUH 3Q6FA 1ZSDA 5IB5B 3TCLA 2DQIH 4KFZC 4P9HC 3QFJA 3UCRA 3CDGB 3SJVB 5DRZB 4D0DB 5BJTA 4L29A 5T1LB 3D3VB 3O3EB 3JUYA 4BFGA 2PW2B 1LHZA 5F88A 1JPTL 4LPXA 2V2WB 1EERB 3EO9L 1X5FA 4MA7L 1I3RA 1I8MA 4LLWB 5F71A 4J3TA 2H41A 3QH3B 4C54A 4JAMA 4KUCD 5IBTH 2O5XH 4P5TB 1S7RB 1QBML 5ICYA 4E0RA 2FRGP 2AEPL 4G6AD 32C2A 3T04D 2JJWA 3K8KA 5ESQB 5HYIA 4G6FB 3SDYL 1TZHB 4JVWA 5FK9A 3ARDA 1CFSA 1A21A 2EDFA 3KLDA 1AXTL 4OB5H 5F3HA 4TULL 1P4BH 3QEQA 3VXSD 4P2OC 3PDDA 5IJKC 4M4PA 1T2QL 5FXCH 4M3KB 2BCKB 5DJZB 1VFBB 3MJ9H 2XFXB 4YHPA 3NZ8A 3C5ZA 5CEXB 5E08H 4APQD 4QRRA 1EEYA 4QHUB 4KU1A 1I1AA 4POZD 4QLRA 1MHPH 3RZWA 1R3LB 2RCSH 3I6GB 3SOBL 4NKMA 5CEYB 1J10A 4GW5B 4OLUH 3LEVH 2DL2A 4LOUD 1U3JA 3VFVB 1P7KA 1NCDH 1NC4B 4XAKD 1N0XH 5CJ5A 4KRPC 3KJ4B 4ETQA 3MLXH 4NNYB 4HZLB 1KPVB 4FTVD 4Q6IC 3GSXA 4QRSA 1WZMA 5GGRY 1B4JL 4G6AC 1TJGL 4G9FD 5E8OA 4UTAH 2OMNA 1UZ8B 2Q86A 2E27H 4WUUD 4NQVA 4YHZL 2DQEL 2DQFB 4K71B 1JZ8A 3IDJB 5CINL 4CRPA 3BDXA 1ZT7B 3QIBB 1A3LL 1HI6A 1RURH 5GJTL 1YN7A 1ZKAA 3HR6A 1S78D 3V6ZB 4WCYL 2DDQL 3UROR 4JKPH 4M8VA 2MPAH 1WCBB 2OXHA 5K59F 1RUAL 3QCTH 5E8DH 2VDQH 5ITFA 2KL6A 4APQC 2AJVL 4Z0BL 4GSDH 2H8PA 1ZTXH 1U9KA 5E1AB 4YIQB 4UINL 1VA9A 1MCOL 5F1NA 5C09B 4XVUD 4P3CH 4POZC 1RZFH 1YMHB 43CAA 3HNVH 3ZDYE 5DD6B 5JW4Q 1UYWH 2E7MA 3SGEI 5LKNA 5JHDA 5IR1A 3PWJA 4U6VL 4PJGA 4XPTL 3TESA 4RX4D 3RDTA 5FKPB 3RNKB 4KKBD 1FCGA 1NGYB 1GRWA 4PY8I 4H8WL 4WU5B 2R39A 4PTUA 3B8SA 4PGZA 5D7LD 1CBVL 1E28A 2O5ZH 4NN6B 4E5XA 2ZUUA 5C08B 1JUFB 4GKNB 4RMWA 3FFDA 1ROWA 5E03A 4OGAD 4ZNEA 3KXFB 5TE6H 1MUJB 4R3SB 2XZQL 1S78C 1AQDA 4JHAL 5GQBA 4L8BA 4KZEL 5D1ZB 4FQJH 3IS1X 2YC1B 2DS4A 4HDIB 4MNQE 2BVYA 3FRPG 4JFZH 3QAZC 1N5AB 4NIKB 5E9DD 3RTQA 4LLQA 2VKWA 3SGEH 4XVUC 4NZTL 1U8PB 4LASL 3TEUA 4RGNB 4U1GC 1KIPA 1TENA 3L5JA 3BKYH 4BFIB 4NQDB 4TRPH 5TDNA 3U0TA 1QFPA 2UWEE 5HHVH 4X5LA 3UTTE 2MFNA 1H5BA 3L5WA 3ZL4H 4PJCE 4DKEL 3ZHDA 3MRNB 3BP5B 3HUJE 4JRYD 3MX0A 2XNAB 5E6ID 4DN3L 4AG4L 3PQYB 2BVOA 4MDJA 4WO4B 4DGYH 1G6VK 3OTTA 5FB8B 4WUKL 1OAQL 2ESVE 1CGWA 5ID0A 2A77L 3DX7A 2EXWD 3MJ7A 4C4KT 1E4KC 1ZGLB 1KB5L 3H9HA 4BELD 3LQAC 4P23B 2Z8WC 1F3RB 3F5WB 4OGAC 3QNYB 1YY9D 2FH8A 3RA7H 5H2BA 3GMLA 3DIFB 1RPQA 2Y07L 5F7UA 1WBXB 2B7DT 4K8RD 4F58L 4NM4L 2IAMA 4NZRL 4AEFA 2YD4A 5IGXL 4H26A 1RZJH 2C3VA 3BPLB 4NQED 3AGVA 3BUYB 3FL7A 3QIWB 1GGBL 4JZJA 1DSFH 3B4NA 3RWFB 1MFAL 4PJDE 4BSVB 3UO1L 4O51B 4JG0L 4G7YH 1YEEH 3GBNH 2EE6A 2ITDB 4WW2F 1V7MH 4G42A 3OGOE 1CDBA 4N8CH 3SGJC 5E2TL 4L8SA 3STLA 5LXGL 3SBWC 4YZFE 4DAGL 2EYSA 5IQ7H 5CZXD 5E6IC 3CFBA 2CIKA 1LE9A 3IKCB 1OB1B 1FL6B 5DJCA 3QHTC 4J4PD 1K2DA 2XTJD 1EJ6A 3FZUD 1NGWB 3MXVL 4U49A 4LPYA 1JFQL 4I5BA 1KC5L 3H3PL 4ESKA 3T8XB 3V5DA 4C56E 4G7VH 2D03H 3QULA 1YY9C 4L3AA 5FDWA 3VWJB 4AQ1B 1YUHB 1DN0B 2ORBH 3TIEA 5I1DA 5D1QA 4QCIA 1BAFL 2AW2A 4K8RC 5HJ3B 2X70B 4RFNB 4AT6A 3HMXL 2P5EA 1DQTA 1XIWA 2E7HA 2GJZA 4QNPE 3ARSA 3PP3H 2I07B 3RGVD 3WMSA 5FFLA 5DK0A 2ATPA 4JFHD 5GGUB 3DX8A 5C0AB 4JQIL 4R26L 4MAYD 2CPCA 4E9LA 4KC3B 1U58A 3O81A 4BKLA 3GMNB 4L3EB 1F6AA 5CZXC 5I1HL 2NTSP 4OFPA 5DJYA 3ULVE 3C60A 5EU7E 2DJUA 5FO7B 2XTJC 2FEEL 3FZUC 1AD9A 3MRKB 1IT9L 3C9NB 1KIQA 2FX7H 1SY6L 2NY2D 3SO3C 4U05A 3DYPA 4HSQA 3BZEB 2DLTA 4RMRA 5IHBA 3RI5K 4FFYL 3IFOA 4IDJL 5A1AA 3QDJB 5AG9A 1G1YA 2NLJA 5DR5H 3VA6A 5DO2D 1GXEA 4D9QE 1AGFA 2RFXB 2GI7A 2GUOB 4OLEA 5BQ7A 4F15C 2Q3ZA 4M1DL 1C5CL 1A6ZA 1QR4A 1BZ9B 1PGRB 4RNRA 4TSAL 2PYFA 3ZE1F 2ED7A 5D8JH 1U3HD 3CVHA 2AJZA 2Z93B 1JJUA 5C8JA 4YC2B 1FNGB 1CK0H 1MREL 1C7TA 1DBJH 4KKAD 1TETL 1Y6NR 4MAYC 2A1WL 4ODHH 4DW2L 1LDSA 2NY5H 3L3GA 3QG7H 1F90L 4YBLB 3BIKA 2CRZA 3AB0C 4XCCL 3K4DA 3OKYA 3B2VL 4X0KB 4LCYB 3T1WA 4P9HL 1BJ1H 3OF6D 2DRUA 3VE0B 4XB8A 2NY2C 3BPOC 3MODH 1NCAH 4B53A 5JHLL 1FYHB 3LS4L 4I0PC 4PJFB 5CIPH 5T3XH 5IHLB 2QSQA 1ZLVK 1MFBL 5L6YH 2R23B 4YDVB 5GHWL 2PUQT 3ZYIA 4F8TA 3IDMA 4HGWB 4K2UH 5F9JA 3PP4L 1RULH 2QKIA 4HPYL 5DO2C 1G7MB 1UQSB 1MNUL 4QHKI 1RJLA 4LCWA 5C0DB 1RUKH 4OIIL 2DM2A 1YNTB 1E4XI 1MI5A 3VFGL 2XKUA 3MRJA 1EMTH 2R0KL 4KK5D 1OPGL 3QXDB 1U3HC 3QWRA 1FE8H 1JNHB 1LILA 2NY4B 3LD8B 2AK4A 1G7JB 4PJIB 1HYSD 1B6DA 4GG6A 2IGFL 4HAFA 3PL6C 5FYKD 1NCTA 3I6LD 4ZS7L 5C6TL 4KKAC 4JVUA 1NCWL 1Q8MA 2CLVB 3BT2L 1SBSL 3BDBA 4YR6A 3HZKA 3FFCB 4Y4HA 3OGCB 5E8EA 3V6OA 3I6KA 2DQHL 3N85H 2F15A 2QR0B 3I2CL 3NACL 3V5HA 5CKAA 4ZPTA 5IFHL 4EQ3A 1JGLH 3UPRB 2GHWB 3GMMA 5KSAB 1GH7A 1OSPH 1H3GA 1KJ2A 2CDEB 3LEXA 3ROOA 1J7VR 2G2RA