1FDLL

Crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYYTTTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (antibody-antigen)
molecule keywords IGG1-KAPPA D1.3 FAB (LIGHT CHAIN)
publication title Crystallographic refinement of the three-dimensional structure of the FabD1.3-lysozyme complex at 2.5-A resolution.
pubmed rcsb
source organism Mus musculus
total genus 52
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1990-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fdlL01
3VXUA 4KRPB 5ERWB 5KSAD 3NACH 3D39D 2FEEI 2AGJH 3LD8B 1KIRB 4OBSA 4RBPK 25C8L 5IB5B 5KSBF 1WFNA 3GJFA 4LHUD 1NKRA 3O4LE 3CCHB 4RMWA 1RZ8A 1JNHA 5FM5M 1J86A 4WO4A 4OLXL 2YA2A 4PJCA 2DLFL 1TTUA 1BBDL 1Q0XH 1VEMA 3ARGB 4UV4H 4L4TE 3IF1A 4XNUL 4FNLL 3K3QA 1EGJH 3PWLB 4E42B 1LE9B 3WFBH 4OF3A 4NZTH 5MEQB 4X5LA 4TVPD 2YRLA 1TJGL 2NX5D 5DR5L 3RAJL 4Z7VF 1LO0L 2YZ8A 3QEGH 3L3KA 4I3RH 4IRJA 2LU7A 3MCLL 2HFFA 3RQ3A 1T5XB 4NFDA 1MH5B 1Q94A 3D48R 1XMWA 1QNZL 3FB5B 3NMEA 5IW1B 1X44A 3FT2B 2OQJB 5DQ9A 5IWLA 4NRYB 4N1EA 3ZLQC 3BQUC 2CLRB 1BGXL 1NFDE 5DMGC 4BFIB 5IKCA 3WN5C 1NCWH 3NFSL 1JZ2A 4L4JA 3QPQC 1TIUA 2R56L 3K8LA 1MFDL 3BN9C 2RB8A 3RNKB 4WEMB 1RZKH 2VDNL 5I8CA 1R6VA 4L3ED 5DYOB 1R3LA 2X41A 4QYOB 5F88B 4TUKL 1LP9A 1AGBB 2VDLH 4K23H 3QCUH 1HSAB 1RJLB 2RBLA 3BDYH 3LN4A 4RAVA 5TDPA 5JNYA 3ULVE 1E6JH 1F4XL 1UCTA 4X9FA 3WS3A 3LIZL 3DETC 3GHEL 2D7TL 3LV3B 5M95B 4OB5L 4IRSD 3V6ZB 4KJWC 2V5YA 4BSVB 2NXZD 3CZFB 1GIGL 4PV8B 1A7QL 2LFGA 3L5XL 4PGEB 3QZWA 5AAWA 3DPBA 3MZTA 1AGEB 3CXDL 4F15C 2HJLA 2V7NB 2VL4A 4DOHB 1NGPH 2A83A 3OF6D 2CXKA 3RU8H 5GRVL 3BRFA 5D2LA 3IXAB 1TCRB 4MXVE 2NY4C 1KT2B 3STLA 1V7NH 5ADOL 5ECJE 3P9LA 4LLMA 5JUEH 4Y4HC 3BGMB 4F7MA 5ALBL 1Q9LB 3FAXA 3WXVH 5AUMA 4WJ5A 2B1AL 1FYTE 4Z77B 5BZWB 3WSQL 4X4MA 2PNDA 3OXRB 2KH2B 3KXFB 4Z8FH 5SX4H 5EZOH 3O3AA 4CU8A 2AABH 1DBJL 2MCG1 3MXVL 4QHMB 1PG7W 5HHQA 3E6FB 1AR2A 3F5WB 5CSZB 1VPOL 4GRWB 2Z8RA 2DMCA 1S7QB 5C7XL 4XPAL 3CX5J 1J88A 2F74B 2CO7B 1X5ZA 5FIEA 2VERN 3BP5B 1ZHLA 5KVMC 4BQCA 5HHXL 1AQKH 2H8PB 4PJBA 3DLQR 5MENA 4ZPVB 2GW5A 4XGZA 3KR3L 4LOUD 3ZZ1A 1RSFA 3MRBB 3WD5L 2ZPKL 1K9TA 3VWKA 2DMBA 3HLAA 1OTSC 5ICZA 4NUGL 2AK4D 4MWFA 3VRIA 4BM7A 4R0LA 4MNQD 3RIFK 1EEYA 3WJJC 1IMHC 3KPRE 2XNAB 4U1KB 5IG7A 1FCGA 2E3VA 3KPPA 4YE4L 5CINL 1XF2B 3PWPE 5IVNA 3NTCL 2E8YA 2ZOLA 3EDFA 5MEPA 3SKNA 4BFBD 3G5ZA 3KYMA 1QO3A 1T2JA 2HFGL 5F1KC 5FCUL 2IPUK 2F54A 4X8JB 5C0BB 2VR4A 1JPTL 3BT2L 4U7KA 5FYKU 4Y5VA 4LEOA 3IDUA 5GGRY 4C59B 4HGWB 4KQ3L 1LD9A 4CUCA 2V2WB 2AK1H 3B43A 1ONQA 2BSSA 2ZNXA 3PL6C 3GMRA 3LKQB 1DUZB 1WC7B 3QNYB 3QWOB 5C3LD 2R4RL 5FHAL 2B1HH 2NTFA 1J8HD 3LQMA 1QBMH 4AH2A 1YJDL 2OJZL 5L7XL 4Y2DB 5DK2B 4DN3L 2X1PA 4XP5H 3HPJA 2A9NH 4QLRA 4KC3B 2A77H 3P9WB 3M1BA 5ITFB 4LIQL 5H2BB 1YN7A 1ZVSA 2JB5L 4YFDB 3OHXB 3TT3H 1K5NA 1XFPA 4FQPA 4X7CC 4QHKJ 1IGTB 4NZDA 5IQ7H 1Y0LB 3JV6A 3BO8A 5C0JB 4WTZG 2G9HA 3HHRB 1JK8B 1FZKA 1XCQA 2A0LC 2BVQA 3EOYG 3KYKL 3C5ZB 4NQCD 1YYLL 5EU6B 3RWEB 2NYYC 3IJSA 3HC0A 1E27B 3ALPA 1SJHB 4LSVH 3D39A 2W9EH 2HKFH 1ULVA 1FPTH 1ZS8B 1NDGB 1KYOK 1Z9OA 1YEIL 1OY3B 4PGBA 5KSVA 5DJXB 4OSUL 4Y4FA 2H26A 1ORSA 5D9SB 5E5UB 1OCWL 4GMTL 5HYJA 5IMKA 1FZJB 1IE5A 1U8IA 1NPUA 4H0HB 3D3VE 3RL1B 2BZDA 2G75A 3ZDYF 4F9LC 3IJYB 1PFCA 3LKNA 1VHPA 4P3DA 2Z31A 1CLZL 1S7XB 1JYWA 1CIDA 1MWAL 2X7LB 1LE5B 4PJDA 3TPUB 3I2CH 7FABH 4XVTH 2VQ1B 5C0EA 3QDGE 2BCKB 2NY2C 1FVDA 3ULUD 3H42L 2VDRL 3DUSB 4JPWL 1N3NA 4IOFD 4DZBB 4Z7UF 2H6PA 2QKIB 4YH6A 4NZJA 4D0BA 1CDUA 5I8OL 3TIDA 4FP8L 3UJIH 5J8OA 2DDQL 1HH9B 3DARA 1U8NB 2ZG1A 3TBVA 1U8MB 1FC1A 1YC8A 3FO2B 2H9GB 1ODAA 4HUWA 4TVPL 3RPKA 3KPMB 1R3HA 4MHHI 4OT1H 3T2NH 2E7HA 3VA2C 1CIUA 5HJ3A 5FO8B 4X5WB 4Z76A 5J6HB 3O11A 1T4KA 3BUTA 1DLHB 3VJ6B 3S7GA 4S1SH 4NUJA 4CMMA 3G6AA 4FMKA 4Q0XH 5E03A 4HKZA 4JG0H 4CKVX 4NQUA 4LCCA 1H8NA 3GSNH 1A7PH 1CFQB 5EIIB 3R8QA 5E8PB 3ZO0A 2GK0A 5F1OB 2EE3A 2W92A 1OLLA 5J89A 1T1YB 1UB5B 4K71B 2VAJA 3CDYA 2R0ZH 2XWTA 2XTJB 4TOYL 5HYSA 3GJEB 5EU3A 4JFQB 3RGVA 2P43B 4NWUL 5EC2A 4PRPE 5KSBB 3MREB 4C4KT 1ZT4A 4NQEB 3MNZA 1ZHKB 1P7QD 2FBJH 1L6XA 5D70L 3HC3H 2X4NB 3CFJB 4ZFZA 3OSKA 1NCUA 2FO4B 3AS2A 3PQYE 4APQD 3VMNA 4XP6L 2VXUL 3SOBH 3QEQA 1E0OB 4MDJB 1M4KA 3IYLW 5HVHB 3GBMH 4G8IB 1Z3GH 3OPZH 4Z7VB 3LN5B 1I3UA 1LK2A 1MRCL 3BDXA 2A9ML 5DD0H 3W9EB 4Y2DD 1CGTA 1GOHA 3G5VA 3R1GH 4JJ5A 4TRPH 5FYKD 3MLZL 1QFWL 5BS0E 1UGNA 3WIHA 4ZFFB 1I75A 4JO1H 1HILB 1KEGH 1H8SA 5DVMA 2QQNH 1YMMA 4BUGA 1G7HA 1UVQA 4XPGL 2ITCA 2UV3A 4KK5D 1LP9F 1FFNA 3DURB 5JZ7C 1BF8A 4D3CL 5EU6D 5D2NE 1C08A 1VKXA 3RVTC 3LS5L 3PWVB 2OS7A 4I48B 4YBQD 3K2MC 4KGLA 1E4JA 2CH8A 4FXKB 4LQFH 3Q6FA 5A16B 2AS5M 5KANG 5HVGB 4OGXL 5IM7A 2A6IA 5DJ8A 1N4XH 4PJAA 5I16B 3A67H 5SX5K 2YZ1A 4D0CB 1OAQL 5HI5D 4KAQH 4KFZC 4HCRL 1WWAX 4KMTL 1UKSA 1Q72L 4I0PC 3AS3A 4V1DB 1I7ZB 4LEXL 4UI2A 2D7OA 4NNPL 3FFDA 1JZ5A 3C8KA 4LCIH 3THMH 5CJXC 5C0RL 1WVZA 3CVHA 3GBNL 1KENH 1OB1A 1T1XB 3QHZL 4JGJA 2ZUQB 4UU9B 4ONGL 1YDPA 3LKPA 5MI0C 4M03A 3O45B 3SKUD 4PLKD 3VE0B 3EOAB 5IR1B 3MFFB 1FO0H 3VGAB 4EBQL 4UNVA 4L4TA 4PJ9B 5HGDA 1IL1A 2FLBT 2KQMA 2VLJB 1F00I 1PD6A 2Y36H 1T20A 5GQBA 1WBYA 4CNIA 2AI0L 2BOCB 1W72H 2ZUTA 3F6LA 3JXAA 4EN3C 2OZ4A 3QUYA 1FFRA 4PY7B 5DXWA 3SQOL 3TH4T 4PJGF 4S1QH 3HFMH 4P46A 3S3SA 1MY7A 4ZXBA 1KJ2H 1NUDA 1V3LA 4NQCA 4F37K 5F9OH 3RWHA 4IDJH 1SEBA 2BNQB 2IAMB 3EIFA 4RMUA 2JCCF 4O9HL 5L2KB 3QFJA 3KPOB 5EBMA 1NFDA 2YEZB 3D25A 3EYVA 1MJ7H 3QRGH 3GEWB 2QL1A 3MUZ1 4NM4L 1ZGLB 2V9QA 2XKSA 1BP3B 3ET9F 5FUCC 5IGXH 1I1YB 4YHYB 5CJ8A 2D4DA 1IGFH 4LCYB 4R90L 3MRNA 1W2KT 1HQRA 4HKJA 4XVJL 3VFTB 3N1MC 4Q9QL 4X98A 5L9DH 2VIRA 5E8NA 4WFHE 4OIIL 4WUKH 3GKZA 2JJUA 4FXGB 3BH8A 4KUZL 3B5HA 4U6YA 5C9JA 2YS4A 4I5BB 4FFVC 4RAUB 4PTUB 3F58L 3N0PB 5CZVH 3D6GA 1YNTB 4OFKA 3QUZB 5GGUB 2FSEA 1PG7H 5JR1L 5I6XC 2XY1A 5DC9B 3SDAA 4MJIB 1NDMA 4LSQL 3UTTB 2FIRT 1RK0B 5B3NA 3GNMH 3EFFA 1QSFE 3SDXA 3ARBB 4MD0B 4D9QD 4KRLB 4OV6F 5KVDH 4AT6A 5L2JA 2X89D 3C8HA 5BVPL 5D8JL 4Y1AE 3BAEH 3IU3A 3MLVL 3KHQA 1FZMB 2NXYC 5I18H 3PXHA 2DYPA 1F4HA 3Q5TA 3NPSB 4G8GD 4Z7QF 4J3TA 2NY5C 3AGVA 2AXJA 5A2IH 3ZTJG 2AEIT 3GZKA 1CF8H 1D5ZA 3KPTA 1FYTA 2VL5A 4ZPTB 4OLVH 4U1GC 3ULUL 2OSLB 1K2DB 2O5XL 5ANMB 5I1IH 2EH7L 3CD4A 1I1AD 1MCPH 1S5HA 3OR6A 2EDDA 2C5DC 3GGWA 3BWAB 3ELAT 2GJZB 3V6BR 4C56E 1DQJA 5FUCE 4Y5YB 3MLTA 4HIEA 5I73C 3MMEB 5HXMA 4O2FB 1DFBH 4TQEL 3QB7C 4UUJA 4LHUG 4WENB 1TZIB 3GSRA 1AKJB 4OUUA 5ISZD 4PJ5B 1OGTB 1KJ3L 4F7TA 4KTYA 4GW1A 3V79C 1RULL 3SCMA 4IIQB 3QJHA 4DFIA 5F9JA 5HHNA 3TA3A 4HLZG 5GRXG 2NR6D 1EBPA 3ZSTA 5BRZE 4X4XB 2XQYK 3Q1SL 2EDXA 4N90D 5KVFH 5GISH 2YD7A 3CFKA 5A1AA 2IEPA 1JE6A 2LE9A 3I75B 3MJ7A 4XI5D 2FX9H 4HBCH 3C5JB 2R2EA 1BMGA 3BJ91 2GQHA 1IFHH 3WXWL 1FCCA 3PWPA 2YPLB 1NCAL 4H8WC 1S7SA 2X1XR 1HHJA 2Q87A 4ZSOE 3FB8B 3HC4L 4J1UB 1E4KA 5K9OB 2R1XA 3DRTB 4LF3A 1NCCL 4HUNB 2P5ED 3UO1H 4H26A 3C60D 4Z95H 2IGFL 1YEKL 4S11A 3QUMH 4Z7UB 2V2TB 3L6FA 4EQ3A 3X13A 3UYPA 3IDGB 3MV7A 4OI7A 5JPMB 3GSVB 4M4RA 4O5LH 3TIEB 1C7SA 5IVXA 2WV3A 3CX2A 3EFDH 2FJFB 3ZHDA 3TFKC 1G84A 4LGPB 3O2WL 2X4PB 4X7TB 3O2DL 1D9KB 3M45A 4K8RD 4F57L 3FMGL 3MLSL 1UYWL 2EYTB 1B0RA 1M7IA 1QA9B 2X09A 4N8CH 4HUXB 4POYA 3U6RA 4JREC 1FORH 1KFAH 3D9AH 2BSTB 1CBVL 5FYKL 3H9HB 3VXUB 2J4WL 1HSBA 3VFMA 4N8VG 1NEUA 1HHKA 1LK3L 1F11B 3U79A 4AQ1B 4Z5RA 3GJFB 3C87A 5GGSB 3WLWC 2E27L 3O2VL 3BPOC 1DN0A 1JNHB 1RJYB 1A6VH 1G7MB 4PJCB 3IF1B 3MJ9L 4LGRB 4YZFF 5D71L 2JJWA 3OG4B 2ZCHH 5E8OA 4E9LA 5I30H 4MJID 2FATH 4H0GA 4G7VH 1N59B 2JJVA 3L3KB 4IRJB 2DIAA 4V2BA 5CZXC 5IHUH 1Q94B 4Q9CA 2XZQH 5JOFA 5K9QG 1JZ3A 3RA7L 3D3VA 1H5BC 1JHLH 1RMFH 2UUDH 3MRDA 4LVHC 3CSYB 4NRZA 4RFNC 3PNWA 4A6YA 5IKCB 1D6VH 1S9XA 3O6KH 1U9KA 3QDGA 1NEZG 5I8CB 4ZFGL 2DRUA 2HTKC 4I18B 2VXTL 1CTNA 4RNRB 2OJEA 3M17A 1L0XA 1VFBB 1LP9B 3DMMC 4X5XB 4RAVB 2PW1A 5TDPB 3WL9A 5JNYB 4LVOC 3WS3B 3C2SA 1W0WA 3LDBB 3B2VH 4PJAF 5IBUB 5JIPA 2CJUH 4U49A 1AQDA 5EIVA 1TVBA 1RJZA 1CVRA 3QZWB 4PJHA 5D1XC 5FUOL 3WS6A 3H0TA 4BSWA 1T7XA 2HJLB 3KJ4C 4NHUA 2A83B 1FVEA 2VZOA 1JRHH 4K2UH 3EUUA 4DQOH 5B4MC 5CD3A 4WHTA 3BKMH 4GSDH 3STLB 1GGTA 3BRGC 3D2UD 3P9LB 4LLMB 4ACPA 5F89B 4F7MB 5F3BA 1IC4H 3TT1L 1H0DA 4YDJA 3GIVA 1BLNA 1KJMB 3LPFA 4WJ5B 3JTSB 5GHWH 2EE6A 3MRLA 5E4EC 4HDIA 3VWJD 2F5BL 4FHBD 5INDB 4P9HH 1ZT1B 1OAKH 2FJGA 4S1DD 5KTEL 4UNTA 4OLWH 3GO1H 4U6HA 4MGXA 2VAAA 4JDVA 1OL0A 4U1NB 3PQYA 1E6OL 1S7RB 3PGFH 1CR9H 3PV6A 3FO0H 3C8DA 1BFVL 5E6IA 5LKNA 1ZHLB 4FMFA 1ZT7B 3RKDC 1EMTH 1LO5A 3B9EA 5MENB 1NFDF 1Q9KA 1GGIH 4XGZB 1KIQA 4PJGB 1WZMA 3RZCD 4YHMH 3VWKB 1NMCB 4DCQA 3HLAB 1WFUA 4GAJL 5ICZB 4MWFB 3AY4A 1GGBH 3OAUH 4L1HA 2EDBA 4R0LB 3AROA 3QA3A 3QI9A 1EEYB 1QRKA 1CXKA 3RTQD 4YHLH 5IG7B 2YSSB 3KPPB 4WW1A 4WWKC 4JO4L 4AYFA 4S1RL 5ISZA 4DJMA 1XR8A 2ZOLB 3IGAB 3ULVF 1FDLL 4FG6C 5D2NA 5MEPB 4JPVH 3SKNB 3G5ZB 3WO3B 3KYMB 4PRAA 4KRNA 4HIXL 3GIZH 2L4OA 5BW7A 4WEBH 5ESQA 2NY1B 5DUMH 3EJJX 4PB9L 2F54B 1F4YL 3TBTA 5IFJA 4Y0GA 4Y5VB 4LEOB 3W39A 4GRMA 2ZKHH 4RRPG 1KB5A 4BH8A 5DDHA 3F6IA 2BSSB 3MRFA 4U4BA 4NPYA 2BJMH 2CDEA 3GMRB 4MXQC 5FA3A 2X4QB 4HS8H 4MXVF 2DQUL 4DGVH 1AXTH 4M7KL 2NTFB 4XPTH 1X5YA 3TWCH 4BQ8A 1KCSL 1CK0L 3H6JA 1OTUC 2Y07L 3WUWA 4R6UA 3HPJB 4EI6A 3BPCA 4RA0C 5ESVA 1I8KA 1FNLA 3RBGA 1YN7B 1ZVSB 1DQDH 3KPQA 1K5NB 4DKFH 4OGYH 2LAAA 2FDBP 2E6JA 1XAUA 1JZ8A 4EQ2A 4GW4A 5I71B 1A1MB 3QIWA 2G9HB 5TQ2L 1FZKB 4LSUL 1KB5L 2N7AA 2BVQB 4M02A 4OCWL 4U1JA 3GMQA 2FGWH 2J8UF 5CSBA 3ARSA 1GC1L 4KPHL 3IJSB 1YEFH 2A1WH 3HC0B 2DBLH 2OL3L 1WICA 2X4SB 4NFBA 1NGWA 4YWGL 1VEPA 3G9AB 1HINH 4IRZL 3X12A 2WW8A 2VABA 5KSVB 4XAKE 4UIMA 2H26B 2CLZA 2BXZA 5D7JD 1ORSB 3PWUA 2QADB 5FYJU 3IXTB 1KCRH 3GSUA 3K2UH 7CGTA 5HYJB 4WU5A 5IMKB 1MFBH 1YEGL 1U8IB 3ZDZE 3MRCB 5F7FA 5I9QC 4AMKL 5BV7B 1NGQL 3U7AA 1LDSA 4K8RL 2G75B 4KI5C 4R7NA 1O7VA 2PR4L 1LHZA 1OQOA 2CLVA 4ODTH 5GSRA 1UH3A 4P3DB 2Q8AH 1KELL 3NN8A 5GRYA 1XIWB 1BWWA 3RKPA 2ESVE 1I9JL 2K7PA 3L3GA 1FVDB 4G5ZL 1FNEB 3V5HB 1N3NB 2AJZB 1JI2A 2H6PB 1DANT 3NABH 4D0BB 1PDKA 3MOBL 5HPMA 5DGRA 1F58H 2PF6A 5F71A 1U8QA 3TIDB 4PPTA 4OCYL 3BYTA 2WUBL 2YD6A 3TBVB 1I3GL 2YRZA 1VGEH 3FKUS 2O5YL 2HWZL 5J13B 1R3HB 4Y5XC 1QSFA 1MQKL 3BP6A 5HJ3B 1S9YA 25C8H 3O11B 1T4KB 3AB0B 3KDMB 1P4BL 3B9DA 4K9EL 2I9LB 1S7UB 2Y25A 3G6AB 4OLXH 4KVCL 2DLFH 1BBDH 2Z35B 4HKZB 4M7ZC 4Y16A 3BGFC 4YHOL 2VSCA 4QRSA 5E2TL 4O58L 3QDAA 4FNLH 3U1SL 5LG1A 3WDIA 1TQBC 2D03L 4PR5A 5B38G 4JRYE 3QIUB 1TJGH 5DR5H 3MSPA 3NCYP 3RAJH 3QISA 1P4LA 3RIAK 4EIGB 5JMOC 3QUXD 1WUNT 1P53A 4M4PA 5HYSB 3MCLH 4NNYB 3RGVB 2NY1D 1QVOA 1QNZH 4JFDB 3SQBA 3D2UA 2D31A 3CC5A 4C56A 5HVWA 4ZFZB 1SEQL 2YD5A 1F3RB 1PW3A 3MUHL 3NFSH 1EIBA 5DQJA 3CSPA 5TDOB 3QEQB 4B53A 3LQAL 1MFDH 1FE8L 4NZUL 2VDNH 4BZ1L 3MRJB 1T0PB 3NCFB 1KN2L 1LK2B 5I1JL 1NGZA 3RWFA 2OI9C 1F8TL 4TUKH 2IBGA 3UPAA 4JJ5B 4EOWL 2Q3AA 3SO5A 2VDQL 4YBHA 4YXHL 3QDME 5BVJA 4KKCC 1F4XH 1FAIH 3LIZH 3BP4A 2XN9D 1YMMB 1FH5L 1ZE3C 2E7LA 1EDQA 3I85A 1UVQB 4P5TC 5D96B 2ITCB 4OCRH 2YN5A 1GIGH 4G9FB 3UC0L 1A7QH 4ZSOA 3L5XH 4EI5A 5DMYA 1T83C 2BC4A 1P7KA 1C08B 1KBGL 1VKXB 4ONFL 3UTPE 3CXDH 4XBPB 3WNMA 5FHBL 2B5IB 3HB3D 5LGJA 3R4DA 4PRHD 1GOGA 5F7KC 3MCKB 3Q6FB 1EV2E 1AO7B 1KF9B 3RPIA 3EJZC 4HUMB 5IM7B 5DJ8B 1QHPA 4JM2A 4YQXL 3IDYC 1MCCA 4XX1G 5ADOH 4PJAB 5A2KH 5DGQA 3GHBL 4XMKL 1U92B 3O6FB 3P0GB 3G9VA 3BESR 2RJMA 4PJEE 1P6AB 4Q97A 3REVA 2B1AH 5BJTA 3P77A 2P8PA 1XZ0A 3WSQH 3FFDB 1VACA 3LB6D 1MAML 5T1MB 1J0IA 1DBJH 1A4KA 3MXVH 1MFAL 1OP5H 4WFEE 3L5HA 3TGXA 1CE1L 1DLFL 1VPOH 3CVHB 4N0CD 1G7LB 1Q9WA 3AM8C 4LLVB 5FYJD 5C7XH 4XPAH 3I50L 3LKSB 1ZLSL 1E4WL 1G9NL 2DS4A 3LKPB 2X1WL 5T1KD 5HHXH 2KDGA 3FCTA 4L4TB 5HGDB 1N5YL 1IL1B 3HI1A 3KR3H 1TVHB 2ZPKH 5IB2A 4F8QA 1T20B 1WBYB 2EZ0C 3FONA 4CNIB 3L3IA 2IPTL 1I8LC 5DFTA 4NKOB 3QUYB 4JY4A 1WZ1L 2CDGA 5CKAA 1JHTA 3X3GH 5IMOA 4YE4H 5INCA 4ZXBB 1KN4H 3RWHB 3NTCH 4DVRL 2V5TA 3TF7C 3FTGA 2R0KL 2ATPA 4M5YL 2HFGH 2ZUSA 3DI3B 2UUDK 1NFDB 1I3VA 3D25B 3EYVB 3GMNA 1GHFH 4MQ7A 2FHBA 2EC8A 2X4OA 4NN6B 2O61A 1JPTH 3CFCL 5EOQL 3ARFC 3MRNB 4HKJB 1HQRB 3P3YA 3PV7A 3VFSA 3QIUD 5D7JA 1EHNA 5E8NB 1CLYL 3F8UB 1CFNB 2ENSA 4YFLF 4KQ3H 4B41A 4U6YB 1B2WL 3O9WD 4OZFB 4S10A 2R4RH 4NO0A 5FHAH 4NJAL 4DKAA 3WNOA 2OJZH 2FSEB 5L7XH 1BREA 1FG2A 4L4VA 1CD1A 3QIBB 4O4YL 4DN3H 4HG4K 3HTLX 1U3HC 3SDAB 1NDMB 1PJ9A 2JB5H 2EDTA 5CHNA 3SDDA 4GXVL 3BZFB 1FL6A 1WFOA 3EFFB 3L5JA 5MERA 4HGKC 1SMAA 4XCEA 5F72S 4AT6B 4CVZB 5L2JB 2XPGA 3WV0A 4YO0A 3KYKH 1ND0A 1BM3H 4WHDA 1YYLH 3HR5B 4MQTB 3G5XA 3B5GA 5ESAA 2HMID 2DYPB 3GSXB 2B4CC 4N0UE 4JPIB 4G9FD 2WANA 4P2YA 1D5ZB 1FYTB 1YEIH 4OSUH 1DBML 5F96L 2YRPA 5FGRA 2DQFA 1AY1L 3ZTJH 1OCWH 4GMTH 1CDBA 4CVUA 3ARDC 1S5HB 2Q8BL 3OMZA 3OR6B 3I9GL 5ACZA 5EO0A 2Y06L 1AO7D 4ZFOA 5E00B 3GGWB 4PUBH 4RMRA 3KPNA 3O6LH 35C8L 2F53E 1CLZH 4HIEB 2GJ6E 3EJYC 2CGRL 3FQUB 2AEPL 2WWMD 5KAQF 2WWKT 3GSRB 2J8HA 4FQ2L 4PGZA 1A6AA 4XHJD 3H42H 2VDRH 4JPWH 4F7TB 4GW1B 4XC1L 5FDWB 3PHQA 1UB6A 3SCMB 3QJHB 5HHNB 1QSVA 3TA3B 4Y19D 3OKKA 5EG6C 3SBWA 2HVJA 3KPRB 3SKOA 3UBXG 5I8OH 3MJ7B 3H8NA 4HLZH 4FP8H 3DTXA 2DDQH 4Z7NE 5SWSE 3PWPB 1I85A 2KUTA 3O4LD 1TZGL 2P1YA 4TVPH 3PJSA 1HHJB 2QV2A 4LBEA 4G6AD 2R1XB 4LF3B 4ZAKC 4UQ3B 1QLRA 4H26B 2VR9A 1YY8B 2MNUA 4P23D 3O4OC 2O5ZL 5DRNA 1HEZA 2YXFA 1I9RL 1QKZL 1DQQB 2ILLA 5IB1A 4PRNB 1GL4B 2HT3D 3L6FB 4JFOB 2NY4B 3X13B 4X99A 1HDMA 4ZMAT 4ENED 1BZ7B 1JNNL 4Y2OA 3JV0A 2VN7A 4OIAA 2C3XA 3T1FA 2PTTA 1FRGH 4TOYH 1M7IB 2D0GA 1KGCD 4NWUH 2FECL 4M1DL 5D1ZA 2APWA 1JGEA 2DMKA 3ABZA 4KU1A 1NANI 1HSBB 1IM9D 3ZMRA 4QWWD 3VFMB 5D70H 5C8JA 2B2XH 2A6DA 3MRKB 4LLYA 5F1SA 5JIKA 1UENA 5DO2D 2VUYA 5J12C 3SE9L 3VFPA 4Q7DA 4Z5RB 2EDOA 2AJYL 5I66A 4XP6H 3TO4D 2VXUH 4YAQB 3GMMA 3QSKB 3VGGA 3CUPA 4XCFL 3ULVD 1T6WA 2RHEA 4OLZL 3ZE2E 2OYPA 3QG6A 1FNAA 1N8ZA 1MRCH 1N0XL 2PXYA 3QIBD 3O3BB 5JO5A 5E8OB 4J12A 1ZVHA 1QFWH 4JKLA 3GMLB 3AREA 3C09C 3KVQA 4JFFE 4WCYL 3OXSA 3GRWA 3QT2A 4ZOBA 4FZEL 3D85A 4XPGH 2BY3A 1YQ2A 1NBZA 2R23A 5JOFB 4J3OC 5C0CE 3D3VB 2HLFC 4XNYL 1WBZA 4D3CH 3E3QE 3MJ6A 4LARL 3MRDB 4MCYA 5GGTL 4NRZB 3S98A 2IPKA 3SY0B 2I5YL 2GSGA 4NO3A 4XNZB 1L6ZA 2E7CA 3DVGA 4MS8C 1MLBA 3UDWC 3NGBB 1S9XB 3N1QC 3N9GL 4DVBA 3FHQA 3QDGB 2ESVA 1U8OA 4NN5C 4OGXH 3JWDC 4H88L 2P5WE 1H3WM 4FN0A 3TN0C 4D0DA 5FYJL 3PL6B 5D4QA 2M2DA 4XVSL 5F7MC 3BEWA 1WEJH 1KB9J 2HTLC 3M17B 1OAQH 2VJXA 1IGJA 4NYLA 3BISA 3OKDA 1P5VA 4HCRH 4KMTH 4NFCA 3WL9B 2PW1B 3BQUD 1DP0A 4FFYL 4YEEA 5DMGD 5DZNA 1W0WB 4IMKC 3KYOA 3T0AA 4LEXH 4NNPH 2D7NA 1PSKL 1INQB 1DVFA 3TYGL 3QPQD 3O81A 1JWUA 3BN9D 3V4VL 3K4ZA 4RA3A 4GW5B 5C0RH 3H0TB 3GBNH 2FNBA 4BSWB 1MCIA 4GS7B 2X9YA 1T21B 4NHUB 3QHZH 3RWDA 3WFDL 1FVEB 4XPBL 4ONGH 1CFBA 1A2YA 4R4FH 5AD0A 1K8DA 2GTZA 3DETD 3IU4L 4WHTB 1CICC 5TDNA 3BI9X 3JBG7 4EBQH 4KJWD 4F9PA 3RRQA 3QDJD 5EC1A 5E2VL 4MA7L 1H0DB 4YDJB 3GIVB 1BLNB 1BJ1J 3MRMA 2VDOL 1JZ4A 2YUVA 3SE4A 4O00A 3MRLB 4LL9A 4HDIB 4PRPB 2DQIL 5H94B 3L3OA 4U33A 4DGIL 2FJGB 5EBLB 4XP4L 4X0KA 1BHGA 3S96A 4O9HH 4WGVB 4MJ2A 2VAAB 4JDVB 3KPLA 2OTUA 3PQYB 4OCXL 4Y4HD 3WFEL 4P49A 2GUOB 1X5IA 4XXDB 3MNVB 4GBXA 4GRLA 5E6IB 4R90H 4XVJH 4OD3L 1HI6A 4Q9QH 2Z8SA 4K7PL 4XAWL 3PIQA 4OIIH 1KIQB 2OZ4H 3FQNB 4QOKD 3SDCC 4KUZH 3NH7L 5HHOD 1ERNA 4HV8A 4DCQB 1G0YR 4NQXA 4AENA 5BS0B 4H0IA 1CE6A 4JN2A 3F58H 3QDMA 5E94A 2ZG3A 4XVUC 3L9RA 2SEBA 4WW1B 5JR1H 4TSAL 3T4AB 3OAZH 2GT9A 5CJOL 5D2NB 5I1LB 1JHKL 4PRBA 4YK4B 1TFHA 1T89C 5ESQB 2CXGA 1OTSD 4P2OC 5DVLA 3A6CL 5C0FA 5BVPH 5D8JH 2EDLA 3TBTB 5B8CC 5GRVK 1SY6A 1PY9A 5FA4B 3W39B 2HG5B 1EAJA 5MHSE 4GRMB 2K9UA 3MV9E 4GG6A 3C5SA 2X6MA 3PHOA 1G6RL 4BH8B 2DKSA 1T1ZA 1P9MC 3STZB 4NPYB 2CDEB 5FA3B 3B9KA 4KRPC 2VXSL 1CT8A 4PJEA 3O3DA 2ERJB 1JP5A 3LD8C 2OR9L 3ULUH 5L8JB 2C9AA 2O5XH 5E56A 3RDTA 3WUWB 4L9LC 5FM5O 5HBBA 4EI6B 5ESVB 4G7YL 4ELKA 4Q58C 5GJSL 2AV1B 3KPQB 1A9BA 4YPGA 3T2PA 1AC6A 1MCLA 3ARGC 4FQIL 1F2QA 1PYWA 1SY6L 5BXFA 1OP5K 4GW4B 5E9DA 3PL6D 3BZ4A 3VXSE 4Z6AT 3QIWB 4V2CB 4G8EA 4J3XA 3T4YB 3MNWA 4TQEH 2BRRL 1KPVA 5L8KB 2YD4A 4U1JB 2VSDA 1NGXB 2Z4QA 1NGWB 4HQQL 1RULH 1T7ZA 2R0WH 1RIHL 1FLRL 4YLQT 3S9DB 2IQ9L 3NAAH 3Q1SH 2F58L 4LDEB 1F6AA 2XV6B 1EEQA 2VZ3A 4UIMB 4EUPG 5DD5H 3VXME 3WXWH 1A6ZA 4YDLB 4PRIE 1NC4A 3GSUB 4WU5B 1QRNE 2A0LD 5HI3C 1NCAH 3FOMA 3ZKND 4Q9RL 1ZA6B 5SWZD 3HC4H 2Q86A 4R7NB 2CLVB 2HVKB 2IGFH 3GSOA 3UX9B 1YEKH 2W1NA 5C08E 4HJGB 1B4JH 3FN3A 3IAGC 3MJ8A 3SGDI 1AHWC 2BSRB 1I7TA 3L3GB 3FQXA 2GFBA 3FJTA 1RHHA 2IADA 4TNWK 4PGDB 3S36X 4U6VL 1T0NA 3MV8E 3CFEB 2A2QT 4MJ5B 2Q3ZA 3O2WH 3ULVL 3O2DH 4ZOEA 5HPMB 5IHBA 4BA8A 4F57H 3FMGH 3BZEA 3MLSH 1UYWH 1U8QB 1ITCA 1U36A 5IJKA 1Y18A 1KPUA 3MQIA 3LEXA 4L8DA 5CFHA 3S37L 5FYKH 1CBVH 1N6QL 3K7UA 2J4WH 4GKOA 1C5CL 2NY2D 4GLRI 1QSFB 4HMCA 3BP6B 4HK0A 3HG1E 2KL6A 1LK3H 4UDTA 4WNQA 4J23A 1S9YB 3U48A 3HAEA 5J06A 4JG1L 5MI0B 2E27H 3O2VH 4MB5A 4Y1AB 3W0WD 5BS0D 3LHPL 4NC1C 4XC3L 5CWSA 4Y16B 3V7AE 4N0UA 4HUVA 3H2WA 4QRSB 1A4JA 3OJ2C 3MJ9H 2LV4A 5DUPL 5D71H 3SEPA 1WWCA 4M5ZL 5IEHA 3HZMA 1BQSA 4XH2B 2P24A 3QR2A 1RUML 1P4LB 4LMQI 4KDTA 3SJVA 2J7LA 4ZNEA 3VFUA 2KKQA 1QVOB 5F8RC 4L8SA 3RA7H 2R0LL 2YR3A 3OKMB 4XB7A 3QDJA 3DX9B 2D31B 4C56B 5EUOE 4IOIA 3LKRA 3MPCA 5DFVC 4K3EL 5DQJB 1MCKA 4YUEL 3AXLB 3I6LD 1K4DB 4NOBA 4CMHB 2GY5A 4OFYD 1JYVA 4ZFGH 2UWEA 2VXTH 1NGZB 1XGQA 4LU5L 5BRZB 1HKFA 3RWFB 2HJFA 2AAVA 4PG9B 5BQ7B 3RX8A 2XQBL 1IZJA 3OJMB 2RQ8A 5GS0C 2APFA 4M6OL 5DJZB 5I6XB 1Z9MA 5SWSA 2FRGP 5E1HB 1OAZL 4MA8L 2ADIB 3ZYJA 5DD3L 4A6YH 4ZSOB 5JHLL 4EI5B 3DROB 2BC4B 1P7KB 5FUOH 4QOKA 5FXCH 1NJ9B 4EXPX 3CMGA 1WZLA 5K59E 4LAJH 5LGJB 4C58B 1YYML 1IEAB 5FGBA 1EGJA 5D7IF 1ZHNA 4NC1E 3GUTA 3RPIB 3KLHC 1WFTA 1KTRL 1AP2A 1EO8L 5HDLA 1ETZA 4QXWA 3RWJB 4E41E 5L0QC 3NBNA 4MLSA 3RVWC 5JZ7D 1P1ZA 2NMSA 3TT1H 5D5MF 1K4CA 3BIKB 4CVWA 4X9IA 3RVTD 3REVB 1INDL 1FNGB 3RIFF 2MJWA 2ARJQ 5BJTB 1S9WA 2OX5A 2P8PB 1XZ0B 2F5BH 3G08B 1I1RA 1KEML 3ZYIA 1VACB 3WLBA 2A73A 3C5ZC 3QQ9C 1UJTA 3QPXL 4JFEE 5KTEH 5LGHL 1A4KB 4BYHA 4WFHD 1WBXA 5F7EL 3F12A 2Q1EA 1A6UL 2CR6A 3QNZA 1Q9WB 1E6OH 3VRJB 3E8UL 1T66C 1YA5A 2WP3T 5FKPA 4G9DA 4QRRE 3TH2T 4I0PD 2JE8A 2I27N 3CDCA 2AXGA 3P30L 2GEEA 5D7LD 1G0DA 4GOSA 3FCTB 5JHDE 1LEKA 1MRDL 4NNXA 3CXHJ 3SE3A 4GAJH 3FONB 3L3IB 1AGDB 3WFHB 1GGUA 1YECL 3ESVF 5INCB 3FN0H 4ODHL 4LDOB 3D0LB 4S1RH 3FO1B 5DT1L 1FDLH 5TFSL 1D6EB 3FTGB 4JCLA 2D0HA 2X70B 1KXQE 2ARWA 3GMNB 3FOLA 4PB9H 1MHHA 2X4OB 3PWNA 3CH1A 4EN3D 1EFQA 2PTVA 1UACL 4YDIL 43C9A 4KWUA 5SWZA 5EUKA 2DQUH 2I26N 1CLCA 4D8PA 4M7KH 4NO0B 3RWIA 4HGMA 4LRIC 1KCKA 1KCSH 1ZLUH 3ES6B 5EOTA 1CK0H 1I7RB 2Y07H 1WTLA 4HKXB 4WFGE 5C6PB 4QRQA 1FG2B 1CD1B 1F90L 2IFFL 4Z7WE 3T0EE 1XGUB 2HFTA 4PJEF 1QP1A 3B2UD 5CHNB 3SDDB 5BO1L 1PX4A 2NW2A 4FFVD 3MLXH 3RNQA 3S3JA 5KZCB 3BPOB 4B0MM 4LSUH 1KB5H 4K71C 4YO0B 3SGEI 3VXNA 4YR6A 1ND0B 4OCWH 2FBOJ 3G5XB 2XTJC 1GC1H 4KPHH 3EO0A 2OL3H 4OZHE 3K4DA 3V4PL 4J3UA 5HGAA 4PTTA 4YWGH 4RX4D 3IDJB 1B4RA 3EYFA 5IROC 1TJIL 1CU4L 1PAMA 1MCQA 4U1SA 3BWUC 5TE6L 2DQFB 1CI5A 1H5BB 3N06B 1YEGH 1Z5LA 5ACZB 1JMZA 4LVHB 5EO0B 4AMKH 5C9KA 1NGQH 3MZGB 4K8RH 2NXYD 4JB9L 1F5WA 1F4AA 4LPCA 4RFNB 4ZFOB 2DM7A 3KPNB 2PR4H 3CNKA 1RURL 2YHGA 1G9MC 2BOBA 1KELH 3L3DA 4XNQA 4MQXC 1MCRA 4PP1C 2PYFA 5HYQB 3KPSD 5JLZA 1IKFH 2ICEA 4UBDC 2GKIA 4G5ZH 1I9JH 4HWBL 3HNVL 3E6HA 3PHQB 1UB6B 5IP4A 1WJ3A 2OCFD 5JXEC 3L5IA 1NAML 2A6KB 2LTQC 1MELA 3CVIL 3MOBH 4X9GA 1NL0L 4LVOB 4PP2A 2HVJB 5CBAB 1TLKA 1ZVYA 3RWCB 3DTXB 4OCYH 4YHIA 2WUBH 5KG9A 1I3GH 3QCTL 3BGAA 5D1XB 2O5YH 2HWZH 4RGNE 3PJSB 1KCLA 3HE6C 5DEZA 1B9ZA 4LBEB 3OAZK 3N1FC 1MSPA 1MQKH 1FGNL 3ZL4L 4RDQG 1KLUA 5DRNB 3L3JB 1P4BH 4K9EH 1T03L 4XRCA 4JKPH 6CGTA 2ENYA 4X99B 3DXAE 5GGSY 1HDMB 3MUJA 3MV9A 4KVCH 4LSRL 1MCJA 4YHOH 5FEBA 1HE7A 5E2TH 5E5MB 4LHJB 4HXBL 4O58H 2DI7A 1FV1A 1NH6A 1MCOL 3U1SH 4N9OB 2FCBA 2PTTB 3ESUF 3HAEG 2W91A 3INUL 4ZDHA 1X4ZA 4PJ8C 5DQDL 1IKNA 4WTXA 2V2XB 4HJ0C 1DQLL 1GH7A 2ITDA 5I15L 3I3EA 1C1EL 3K1DA 1CL7I 5D1ZB 1JGEB 4PJ9C 2A6DB 4LLYB 5E08H 4BH7A 2E9BA 3VFPB 1JN6B 1AIFA 1SEQH 2V7HA 3NIFE 1VGKB 3IETB 4W4OA 2CUHA 1U0QA 5I66B 1NQBA 1X7QB 1MHCA 3CLFH 4DGYL 1FE8H 4NZUH 1YEEH 4OV5B 1MFEL 2ICCA 3QG6B 1KN2H 4CN6A 2YUWA 3RY4A 4I3GA 2HN7A 2PXYB 3DVFA 3BMWA 5I1JH 1F8TH 1BQHG 2IAMC 4WVRA 4EOWH 2XZAL 3R8BB 4HX1A 2VDQH 3AREB 4YXHH 5CD5C 1GZQA 2R1YA 3OXSB 4KI1A 4PJIE 3VXMA 4TYUA 4NKQB 1FH5H 4PRIA 3L5WB 4XCNA 3DVIA 4YHYC 3D85B 5FGSA 4PJ7E 4LVEA 1NBZB 3UC0H 4G42A 3V0WH 4HPYL 1WIPA 4AIOA 2BRQA 1HWGB 2KPNA 1KBGH 2IPKB 4ONFH 5CS7A 2GSGB 4Z7NF 5DJDB 2EXWC 4YGVA 5FHBH 5EZIL 2AEQH 1MLBB 5C08A 4NQDE 3UTSD 3GSNA 4DVBB 4U1LB 3S4SB 2ESVB 1SMOA 3QUZC 5E8DL 4DZ8A 1XF4A 4YQXH 4D0DB 5CZXD 1EFXD 5EIQA 3GHBH 3BEWB 4HMDA 4XMKH 3DO7A 5ITBL 4POZC 4NYLB 3OKDB 1OGAE 1HHIA 1N64L 1FSKB 4OFDA 3HNSH 5CILL 4P2QE 5DJ2B 1R5VA 3CDGB 3QUKB 4F37F 1KCUH 2QEJA 1Z2KA 5I1EL 2H2PC 1MAMH 1CD9B 1HNFA 1I3RB 1JWUB 3HG1A 3NPSC 5KS9E 2VQUA 4K3GA 1DLFH 4WHYG 4ZTPL 3VMOA 5DJ6A 2WLZA 3T3ME 3I50H 3RWDB 4ORGB 1ZLSH 3RHWK 3VG0L 1E4WH 3DMMD 1G9NH 2X05A 3VGFA 3T65A 2X42A 5AD0B 1K8DB 1ITBB 3L1OL 4J4PA 5C09D 2GTZB 3P4OB 5TDNB 3IS1X 1N5YH 2DTSA 2DIBA 1QLFA 3W11C 32C2A 4WGWB 1TENA 4JRYB 5FECB 5D1XD 3OKLB 2IPTH 4PJXE 3ZE2F 3MRMB 1WZ1H 5A2FA 1ZGLM 5FGCE 5DRWA 3WDHA 3JWOH 3C9NA 4Y5YC 1R24A 5IB3B 3S8WA 4ODVL 4DVRH 4UZGA 3O8XA 5B4MD 2Q20A 1O0VA 1ADQL 4X0KB 3S96B 4RX4A 1MJUL 5GRJL 5EUOA 5T1LD 4IIQC 2YC1A 2WIMA 2OTUB 4Z0BL 3OKOA 4ODSL 4KUCF 1I7UB 4GBXB 1J05A 4ELMA 5EOQH 2FEEL 1HI6B 1ZV5A 5D7KD 3PIQB 1CLYH 1RIUL 1YQVL 2I25N 3DI2B 4MNGE 1JF1A 4BFGA 1TTFA 4NQVA 4HV8B 4U1HA 1B2WH 4U1IA 1FFOA 4KVNL 1FNFA 5DD1L 1CE6B 2IALA 2OP4H 3QDMB 4KQ4L 4KJYA 4NJAH 5E94B 4WDIA 2D2OA 3DRQA 1WAAA 2IBBA 2SEBB 3L9RB 1GYAA 3RKDD 4Y5XB 2GT9B 4GXVH 3GI9L 4FQHA 1S78C 3P11L 3LRSA 2D9CA 1H3XA 3DWTA 5C0FB 1D9KC 1S7WA 2DQTL 3TJHC 1C16B 1LVEA 2BDNL 3BGFB 3IAPA 4QHUB 3IB4A 1W72A 1YN6A 2NY5L 3C5SB 3S5LG 4E41A 4WWKD 3LVEA 1CDJA 2DM3A 2V17H 1A64A 4X4YA 1T1ZB 1BPVA 4HHAB 1V7ML 1KJ2A 1CT8B 4PJEB 3O3DB 5CIPH 1HCVA 3VMPA 4ZUUB 4D2NA 2DTML 3OGOE 1P84J 3RDTB 1HOCA 2E9WA 4QGYA 1AY1H 4WIQA 1ZA3A 2WIIA 2Q8BH 4ELKB 3I9GH 4WO4C 4JFEA 5F6IC 2Y06H 3EYUH 4FTVE 4YPGB 1A9BB 5B39A 2MQ0A 1PYWB 1A3QA 2JJTA 5BXFB 35C8H 4MXQD 3BZ4B 5C07E 5C0GA 3RGHA 2WNGA 5I8KH 2EDHA 3Q0HA 3MNWB 1KPVB 3WDJA 2CGRH 2AEPH 3NFPB 4XMPL 1OTUD 4FQ2H 4IRJC 1VSCA 6FABL 2YPLE 5JHDA 2Z4QB 1IT9L 4CBPA 1NMAL 4KZEH 5IWLC 3HMXL 3X11A 2DQJL 1NGYA 2W59A 1JF6A 1T04A 1ZLVH 3LZFH 4QRUA 4QHLB 1A6ZB 3P2TA 4JRXD 1NC4B 4H8WL 5HGGS 1AXSB 3FOMB 4EUPH 1S3KL 4P57A 3RVUC 4MCZB 1CFVL 2Q86B 4B7IA 3SKJL 1BD2E 3TBYA 4KZDL 2R4SL 5LBSL 3U0TB 2O5ZH 1QKZH 1JGDA 4NQSA 4W68A 1D5BB 5FFLA 4RQQA 5F93C 3ROLB 3W2DL 5E95B 3BHBA 1I7TB 3IDYB 5GS3A 3FQXB 3LDBC 1RHHB 4GFTB 1FYHB 2VDPL 4ZD3H 1XR9A 4KI5D 2VN4A 4X9BA 3WFCL 4NM8H 1VCAA 5BMFL 1ZLUK 3MBEA 1Y18B 2IAND 1KPUB 1JGVL 3FFCE 4M1DH 4Z7WA 3T0EA 2NY6B 3LEXB 1NBYA 5DRZB 2A38A 2VYRE 4JZNA 1TETL 3TH3T 5DEFA 2E7MA 5T1DL 2VXVL 5DJCA 3VFOA 4WNQB 3EDKA 5E99L 4AL8L 3SE9H 3CZJA 4H5SA 4M3JA 2AJYH 5EPMA 3TNNA 1UH4A 5DVOA 1F6LL 1UM6L 3PGDB 4XCFH 5HY9B 2R69L 4J6RL 5C0AA 4OLZH 5CWSB 3T08A 4OZHA 1J87A 3TZVA 1GOFA 4N0UB 4HUVB 3VGHA 4G6FB 1N0XH 4K7PY 1A4JB 5EORL 3D69A 1I1CA 1KIPB 3BEVB 1SYVB 1FG9C 2P24B 4AQOA 3UTPD 4QRPE 4WCYH 2X5PA 3SJVB 1G7IA 4FZEH 3MRHB 5FO7B 4GKZA 1D5MA 4GAYA 5C09A 3FQWB 4L8SB 3ZKMC 4NSKA 3QUMA 5KW9L 4XNYH 5GGTH 2BHUA 2F53B 3VWKC 4LCWE 4IOIB 3LKRB 5D7SL 1NMCC 3T77A 4P48A 5SV4A 3TVMA 2AP2A 3ARFB 3KNBA 3N9GH 1FVCA 3VU2A 4R0LC 4X4ZA 3SN6N 2NY3B 2DF3A 4H88H 1YNKL 4TVSa 1HCFX 3IDNA 4MD5A 3S35X 5FYJH 1LO2L 2MPAL 1XGQB 4XVSH 3CLEL 2HJFB 2VLMD 4Z0XB 4FFYH 3NZHL 5IMMA 5SWSB 5EU4B 4CDGC 5D2LE 1PSKH 2BERA 3NIGE 3TYGH 1XF5B 3QO1A 4R4NC 4Y5VC 2FJHA 4N9GA 3WFDH 2GSIA 3V6OA 4R3SA 4XPBH 4ZTOL 4U3CA 2EDEA 1ZHNB 4GAFB 4KKCD 3RVVC 4ZNCD 3GUTB 1AP2B 3IU4H 4X4ME 4NO5A 4P5TD 1OWWA 3D1MC 2BNRA 3BVNB 2BHZA 4JKWA 5E2VH 5JMRA 4NKMB 1QTYT 3BD4A 1K4CB 2ZNWA 4JJHA 3ZT7A 2VDOH 4BSJA 5I71C 3OG6B 1S9WB 4KMQA 5FOBA 2DQIH 3ZT6A 2A73B 2AERT 1A21A 1G7JA 4ZUVA 1RZ7L 3FZUC 4DGIH 4PJBE 3EJZD 4XP4H 1N7ML 1Y6MR 4PJFE 1WBXB 2ZP0T 4PV9B 1VESA 3QNZB 4OCXH 5C0IB 3WFEH 1DL7L 4G9DB 4B7LA 4OD3H 5ID1A 1OVZA 4HS6A 1FGVL 4XAWH 2AXGB 4FQXA 4K7PH 4Y4FC 5HDQL 5J11B 5EUOF 2QADC 1T1WA 1LEKB 1MNUH 3MR9B 3NH7H 5KN5A 1C12A 4HEME 3CX5K 4J8RA 5HGHA 5BV7C 1J0KA 3IDIA 2BMKA 4JFHE 4JFFB 5FV1L 1UT9A 2NZ9C 2PO6A 2Z31C 4JFPB 1CFTA 4JKKA 1B6UA 4TSAH 4PJ7A 4RZCA 3PP4L 4LSDA 5C0CB 1XIWC 5T5FL 5IOPB 1VFAA 2QQLL 1JHKH 2VLRD 2WBJA 4KKNA 2D3VA 1GPOH 4RFEA 3U4BH 3O4OB 4U0RB 3O41A 3VFWB 2ADFL 3FOLB 1JNLL 1MHHB 2N4IA 4GKSA 4NQDA 2EZ0D 3A6CH 4K3JL 3EYSL 3L3HA 1UWXH 1X5HA 3H7BB 2P5WB 4P2RA 5HYFA 1IVLA 5K59F 2CKBL 43C9B 1G6RH 5JOPE 3UTOA 3VXRE 2PUQT 2XKNA 5DJYA 5J13C 1OGAA 2VXSH 4D8PB 4OTXL 1U95A 3RWIB 4ISVA 4M3KB 3SE8L 1VA9A 1N5AA 2ED7A 2CRMA 3CFDB 3AMKA 2OR9H 4QRQB 2F53D 1OPGL 2GJ6D 4G7YH 2XFXA 1QSED 5HDBE 5GJSH 5KS9A 1A6TB 1OW0A 3TLRA 3QWRA 3KYNA 4Y4KA 1PBYA 4FQIH 4LCCC 5J12B 3QRFM 1X6LA 1SY6H 3D39E 3BXNA 3RNQB 3BPLB 2BRRH 3VXNB 1WISA 1CXLA 4YR6B 3BJLA 3ECBA 3RGVC 1FL3A 4YFLI 3PGCA 3L95A 3CPLA 4R7DA 5HGAB 1U3HD 1F02I 1FLRH 3EYFB 4P2CG 2FR4B 5B39G 3GMOB 3LEYL 3C09B 4FQQA 2IQ9H 4PJXA 4KXZI 2F58H 2F8VA 3Q5OA 4MYWB 4BKLA 4TVPE 2AJVL 2NX5E 1S5IL 5C0NC 3V5DB 4PJDE 4KROC 4JZJA 5ICXA 2YN3A 1RD6A 4Q9RH 2BSED 1ORQA 1MCFA 2EE2A 1U8KB 4L8CA 1UH2A 3GSQB 2LVCA 3V4UL 3BYYA 2BOBB 3L3DB 4XNQB 5AZEL 2PYFB 4JY5L 4M6NL 4POUB 4NN5B 3DV4A 2CSPA 2ICEB 5EU5A 1A1NA 1CGXA 5B22A 2E6PA 3E6HB 1F4WL 4U6VH 5I1GH 5CP7A 3ARDD 3D0VA 1JPSL 1P2CA 1NC2A 1Q9OB 2MQCA 4L3EE 5J1TC 3RIAF 2QR0B 2J6EA 3NA9L 2B5IC 5C2UB 3P4MA 3GK8L 4KJQC 2XXCB 3QCVL 5E6ZA 5KG9B 3EJYD 3S37H 1N6QH 4YHNA 1C5CH 1PZ5A 1LO4L 2QSQA 4I0KA 1KLUB 2BK8A 2PYED 4Z7WF 4JG1H 2EECA 3WHE0 4BQ6A 4JDZA 3S97C 4XRCB 4F80A 3MRIA 4XPFL 3LHPH 3PABB 4NRXA 3D18A 3MV9B 5L88L 4XC3H 3CMOL 4NCC1 5CBEB 3QXUA 5DUPH 2J6EL 5ICYA 1FV1B 3VH8A 3V5KA 2I9TA 5C0CD 3VGEA 1CLOL 2AJSL 2AQ3A 4ZAKD 3NCCB 4OF8A 1V8HA 4OZHF 4ZDHB 4NJ9H 1BFTA 5JW4N 3PXJA 4G8FA 2ITDB 5IF0B 5IMLA 3PDGA 5DC0A 3FRUA 4JQXA 4E0RA 4JANA 1G9EA 3HAEH 4WHCA 1JYXA 4FTVA 1XF1A 2R0LH 5DMJB 3QJFA 1EK3A 1BX2A 1FJ1A 2OK0L 3AS0A 1AIFB 1CYGA 4IHOA 2VITA 4JZOA 4RMTA 5EFIA 4KKBC 4YUEH 3BOVA 2DICA 1MI5A 1MHCB 3QUYC 4WU7A 1CD8A 2FX8L 4P46C 4ZXBC 3FRPG 3Q6GL 2HN7B 3U2SA 4LU5H 2BY1A 4RISL 3B3IA 1BEYL 1MPAH 4HX1B 2ADGA 1WV7T 2XQBH 5DHVH 1UADC 4G6KH 2IJ0C 1L0YA 1GZQB 2AK4E 3FT3A 2R1YB 4QY8A 3UTQA 2YKLL 3KWWB 3VXMB 1UM5L 2DD8L 4PRIB 4MNQE 4NN6C 1UFUA 4P4KA 1OAZH 1QRNB 4MA8H 1CGVA 4MXWL 5CEZE 3MLYL 4G42B 5DD3H 2Z92A 5GGVY 5JHLH 4C83A 4MAYA 4AIZA 2HJKB 1BD2A 1BVZA 3F7VA 1BIIA 1EHXA 3WJLA 4BQBA 4P2OB 1FIEA 3F7PC 5C08B 3IFNL 3ZKXB 4QCIA 1TPXB 3GSNB 3AM8A 3H9SA 5C1MB 3KLAA 1EO8H 4DZ8B 4I1NB 1XF4B 2ICWA 5H35B 2VDKL 3MV8B 4XBEL 4DEPC 5CJQL 3SDAC 1B88A 1WT5A 4M1CC 3DO7B 2EIZA 2HLFD 2VLRA 3HKFA 1IGIH 2FZ3A 2HFEA 2VLLB 1HHIB 1UQSA 1UXWA 1INDH 4N0RA 5L6YL 4L9LB 3HE7A 5F44A 4LSSH 2MKWA 3UYOD 1J8HE 1R5VB 2X9XA 3FFCA 4MS8D 1MVUA 1KEMH 2A74B 2XI9A 5MP6L 4NT6A 2J88L 3LMJH 4MHHG 1JV5A 4WI8A 5LGHH 3HG1B 5D1QA 3TN0D 1AGCA 1AD9A 5E8EA 5DJ6B 3E8UH 2HTLD 1BVLA 4PREB 4X7SL 4K3DL 4G43A 1U8JA 4WHYH 3T65B 4IOSD 4JQVA 4R26L 3P30H 4NQCE 3NIFF 5CSGA 1E28A 1MRDH 1QLFB 5JPNB 2PKDA 32C2B 4IM8A 2UY6A 5D6CB 2R2HB 3QFJE 2DQHL 4QRPA 3JV4A 5J7CC 1YECH 2GTWB 1F3JA 1R24B 5CLTA 1WSST 4ODHH 3QQ3A 5H8DA 3O8XB 3OR7A 5DT1H 3VGDA 1CICD 4PJIF 3ILQC 1L7IL 2Q7YA 4PG2A 4LCWA 5EUOB 5F1NA 5F8QC 4F7CB 3SCMC 1RK1B 2YC1B 3TA3C 4PJ7F 1PKQE 2ICES 2WM0A 1AHWB 1J05B 1CGSH 3VCLA 2ZOKB 4X6BA 2RR3A 1JJUA 4GMSL 4YDIH 4NDMA 2VLKD 2W0FB 1T7YA 4M1GL 4QNPE 5KVEL 1JF1B 5KJRL 4OZIA 4NQVB 2OR7A 4U1HB 5TQ0H 3ULUE 3IFLL 1DBAL 1FFOB 1DEEA 3BSZL 1E4KC 2IALB 1IARB 3SDXE 3MRRB 3DRQB 2JK5A 1T2QL 2XT1B 3NACL 1F90H 4LPXA 1IAOA 3VXSD 4CVXA 2FHFA 3T04D 2IFFH 2J5LC 3DHJA 4FOMA 1CDYA 3CU7A 3LH2L 1ED3A 4FQHB 3IVKA 3KLSA 3SDCD 3C6LA 1JPFA 3LRSB 5BO1H 1OHQA 1FO0B 1TZHA 2KQNA 1S7WB 5KS9F 1LO3L 4XVUD 2RAMA 2B4CL 4RMSA 5DZOA 3T3MF 4E41B 4CJ1A 3V4PH 1QFUL 4HXAL 4LKXB 3J8F7 4LP5A 1QRND 4FRWA 1CZ8L 2IPUG 1CU4H 1DJSA 1KJ2B 2EO9A 1DZBA 3LRHA 3ZT5A 1N6VA 4WUUD 4FS0A 5TE6H 4QT5B 4BK5A 4RWHA 3QO0B 1I1FB 5CZKA 4P2OD 1ZA3B 5DRXB 2WIIB 1S7VA 2X9WA 4PJXF 4JFEB 4PJFA 5HSFA 2W60A 4JB9H 3AFLA 3MGOB 1U41A 1RURH 1QLEL 4OGZA 3UXFA 3EDJA 4LPUA 5C0GB 4KRPD 5KVGL 4QRRB 3VFGL 3ARXA 3IDXL 5FUZL 3TPKA 2XWBA 1MJJB 1JUFA 3IFPA 1O5DT 5DSCA 2V9RA 4CW1A 1AI1L 4TN9A 4HWBH 5JHDB 5TH2A 2VKXA 3VFRA 3VXQA 5EH1A 4I2XA 1HIML 4I9WD 2N56A 1NAMH 4ODXA 1IC1A 4HIHA 3CVIH 4UNUA 1NL0H 4IEFB 3ARGD 2BNUB 1T04B 4XNZC 5FYKE 1MCWM 1R5WA 2WLYA 4QRUB 3NGBC 4XHQA 2OTWB 3WEXA 3MV7E 3LS4L 2ZCKH 1NGPL 2R8SH 5D72H 4TUOA 3EOBB 4DK6A 4RWYL 3MC0A 4P57B 5IVXE 1FGNH 3MA7A 3ZL4H 5E1AA 4ZUTA 5DUBA 3I84A 4NQSB 3WE6B 1T03H 1U2CA 3BKYL 4U05A 5EB9A 3OGCA 4LSRH 1UWXK 1Z9LA 5L0QB 1F6FB 4KKAC 3VXRA 4HXBH 5HI3D 1A6WL 1MCOH 1TCMA 2EH8L 2F15A 3O3UN 5JDJA 4CJ0A 3RL2A 3WS6C 2R1WA 3ARWA 3TM6A 4GS7C 3UMTA 1DQLH 2XYCA 3VFVA 5I15H 3MBEB 4Z7WB 5J9PA 1OF2B 3T0EB 1ROWA 2C3WA 5K9KB 5JW5A 4OJFL 1EA9C 2C1OA 2CPCA 4YGAB 1ZWIA 1MWAA 3VD9A 1AGFB 1MJ8L 3VH8G 5KSAA 1MLCA 5DJCB 1CGWA 3VFOB 5E24E 4HJJL 5I1CL 2Y7QB 4ZUWA 4IDLA 4H5SB 5AEAA 5EPMB 5A43C 1CD0A 4UQ2B 1BFOA 4LHUA 3MYJB 4DGYH 1UEMA 4OLUL 5FK9A 1MFEH 1YY9C 2CKNA 4OZHB 5EO9A 1HXYA 2AV7A 4AEIL 1EAPA 4HWUA 3D69B 4H20L 4L5FL 4U2YA 2XZAH 4ONHB 2GHWB 2VRAA 4HIIB 2NX5A 1A3RL 1NUNB 2PW2A 1G7IB 3ROOA 1D5MB 1DSFH 5E6IC 1T0MA 4GAYB 1U91A 4FXLA 4P9ML 3EW3B 2X4UA 3QUMB 4NSKB 2Z0BA 4KDWA 3B5TA 5EN2A 3KXFD 2WAHA 3OKNA 2X4RA 1ZSDA 3TVMB 5EZIH 2OTPA 3RY6A 3S88L 4O2CB 3AY4C 3KJ6L 1FVCB 1R0AL 3JWDL 3QI9C 5E8DH 3IDNB 4MD5B 1DQML 1QBML 4XX1E 2YPKA 5KSUA 1I9IL 4NP4L 4L3EA 5ITBH 4PJHE 4JEGB 5D2NC 1FZOB 1N64H 4YK4C 5BW7C 2NR6C 3DUHA 5CILH 2H32B 3DJ9A 1E4XI 1VADB 3TT3L 3V7MA 5IMMB 5DFVD 2FWOA 2JIXB 2BFVL 1MF2L 3KG5A 4N5EC 3RP1A 4IRSA 5I1EH 1IQDA 4RGNB 4XI5C 3BE1H 3QO1B 2OM5A 2FJHB 4HSQA 5TF1L 1TNMA 4N8VA 4BZYA 1BWMA 1BVKA 4CL7A 1OD9A 4ZTPH 2Y5EA 4N9GB 2XA8H 2GSIB 3VG0H 3GB7A 4PJCF 2ERJC 4D9QE 4YDKL 3AAZA 3OF6A 2DJSA 3DXAB 4Z18A 5HHVL 3L1OH 5GS0D 4ORZC 4FQLL 1KTLA 1UWEL 5C0BD 2BNRB 1CTOA 2APVA 2EYSA 2OBGA 3EYQC 1GSMA 2ZJSL 4AEFA 4LLDB 4G8GE 1FLTX 2WINA 1HZHL 2BVUA 3QIWC 3MRQB 4NC0B 4PIRF 2H2SC 3G6JE 4ZUVB 4ODVH 3KLHD 3WIFA 1ADQH 1MJUH 5GRJH 3C2AL 3LOWA 5FO9A 3RVWD 3MROA 4Z0BH 4ODSH 4I8DA 4PBWD 5ID1B 1NEZA 4FQXB 4MA1B 1S8DA 4HCRA 1RIUH 1YQVH 3QNXA 3RWGA 1JPGA 1T1WB 4YDLC 1J9CT 5ISZE 1BBJA 3C5ZD 3DX8A 2LTQB 1C12B 5KN5B 4J8RB 5HGHB 4KVNH 5DD1H 2BMKB 4KQ4H 4W4NA 4EEEA 4EVNB 2AK4A 4PJIB 4OT1L 1MCNA 4PD4J 3T2NL 1CFTB 4MNQA 4N90E 2WK2A 1T66D 4PJ7B 3TBWA 4RZCB 1KIRA 1KNOA 3K1KC 1CDHA 3HE6B 5IV2A 5D6DA 5IB5A 1TVDA 2CQVA 3GI9H 3ZTNL 2WBJB 4RFEB 3P11H 5D2LF 1J0JA 1A1OA 1J0YA 3NIGF 2P5EE 2UVEA 2ZSVA 4GKSB 4NQDB 5DMKA 3FO9A 1ZAGA 3DVNA 3PWLA 4E42A 2KZ1B 1DR9A 1BQLL 2BDNH 4P2RB 4YHPA 2NY5H 4W6XB 2BVPB 3NZ8A 1XGRA 1JTPA 2XKNB 5DJYB 1V7MH 1OGAB 3RUGE 2YD1A 1MH5A 1U95B 4PJ8B 4ISVB 4FFZL 4WV1A 3WKML 4MVBC 1N5AB 4M7JL 2DTMH 3VXTB 1WZKA 4P2QB 1J8HA 4NRYA 5FAAA 1A8JH 5E7FA 4ZO8A 4HBQA 3BKJL 2W65A 3KHOA 2XFXB 1IGYA 1N2RA 4F3FB 3OZ9L 5KS9B 4JO2L 4XWGL 5DURB 3MACL 4Y16C 3KYNB 4Y4KB 3GBML 4EDWH 1KTDB 3BXNB 4DWHA 1HQ4A 4XZUB 5EZLA 4MAUH 1JMXA 4PJBF 4PJFF 5DYOA 4OKVB 4QYOA 4XMPH 3ECBB 6FABH 4ODUA 3ZYOA 1FL3B 1RJLA 4TNWF 4JO1L 3PGCB 3L95B 3CPLB 4R7DB 3P9MA 3TCLA 1IT9H 1NMAH 3V52L 1IAIL 3HMXH 4PJXB 2DQJH 2QSCL 4PV8A 4OCNC 5FGCB 4PGEA 4M93B 3V8OA 1AGEA 3U0WL 2DIJA 4H8WH 5ICXB 2V7NA 5LJYH 4WI5A 4CMHC 3EGSA 1ORQB 1S3KH 2XTJD 3DXAD 4D94A 1CFVH 4L8CB 3IXAA 1TCRA 1ES0A 1YC7A 3SKJH 1PKQA 2R4SH 4NQED 1DCLA 4XNXL 5E2JA 4NHCL 1N4XL 4Q6IA 4EJ1C 3BPNB 2W9LA 1U6AL 1XGPB 3H9ZA 3DV4B 3W2DH 1AR1C 1A1NB 1P7HL 4ETQA 5DMIL 2E7LC 2B0SH 4MNGB 4OZ4B 4QF1A 4RRPA 2B39A 3D0VB 1P2CB 5DLML 4Z77A 2VDPH 1NC2B 1QR1B 4EI5C 4TTGA 4H1LG 3BP7A 3N85L 4ZOCA 3WFCH 1ZOXA 2VOTA 3RVXC 5BMFH 4QHMA 3MGAA 3E6FA 3P4MB 1EUUA 3F5WA 5CSZA 1JGVH 4PP1D 1KENL 3B9VA 4HFWA 4PRDA 2QLVB 4UBDD 2VXQL 1TETH 2CDFA 4MD4A 1PZ5B 5CJ5A 4JM2C 4JHAL 2Z91A 3BP5A 2NNAB 5T1DH 2VXVH 1G7PB 4M43L 2ZUVA 5F1IA 4HZLB 2AXHA 4AL8H 5JXED 2QQKL 1MRFL 5HDBF 3MRBA 3B6SB 1DBKH 3MRIB 1UM6H 2YD9A 2F5AL 5DF0A 4NRXB 2R69H 2X40A 1S9VB 5EORH 5ICYB 4U1KA 3HE6D 3MCG1 4AIXA 1HK6A 3JWOC 1EXUA 1WWBX 1ZLWH 5T33L 4X6EB 1MIML 4DAGL 4FABL 4WW2A 4KHTL 2JELL 5IMLB 5F7WC 4ZUSA 4E0RB 4JANB 4XCYA 5IB4B 1BJ1H 5IGXL 4FTVB 3QJFB 3O3EA 4V1DD 5C0BA 5TE4L 3KS0J 1P7QA 1BX2B 1FJ1B 3FQRB 4PJDF 5L9DL 5D7SH 1PLGL 5C07B 4IHOB 4JZOB 2VITB 2CK2A 4U0QB 3EDEA 4APQA 3CFBA 2MCPL 4WU7B 5ADPL 2F8XC 1YNKH 4HJ0D 1A5FL 4P2QD 3O2DA 2DQCL 2MPAH 4OGAC 3CLEH 4U6XA 4YHZL 3MFGB 4Y2DA 3DYMA 5DK2A 3NCJL 3STZA 5L8LB 4N0FA 4PJ9D 5GS0L 1I8IA 3DV6A 2VLJD 3FT3B 4QY8B 3NZHH 2PN5A 1U8PB 1CN4A 4P4KB 3SPVA 2GYSA 3MV01 5C0JA 5ELIA 4FQ1L 5D7JC 2WZPD 2Z92B 4LPVA 5KVDL 4MAYB 4AIZB 1JK8A 3ME0A 1BD2B 1MUJA 5CEXA 3ARQA 5EU6A 1BIIB 3RWEA 2AQ2A 3JWNC 4I13B 1RUAL 2BNQD 1W0VB 2IAMD 1GZPB 4ZTOH 3MJ9A 5L2KD 5CD5D 3HS0B 3KLAB 1VFMA 3K80A 1NDGA 1U8LA 2ICWB 3OX8B 4OLVL 1L7TL 4LHQB 2EIZB 2FZ3B 4PYHA 3SDDC 4JDTL 2H1PL 1UQSB 5B38A 3WIIL 5FCSH 2EXWD 3HE7B 4K94C 3FFCB 1UKTA 3WBDA 1RZ8B 5IESL 2NW3A 4WO4B 4NT6B 5F6IB 2P8MA 1RZ7H 1UJ3A 3QUZD 1NFKA 1JV5B 1N7MH 2X7LA 1AGCB 1K3ZA 1AD9B 5E8EB 1KPRA 2BCKA 5DWUH 4YX2L 3UTTD 4POZD 1L9MA 2E5EA 1U8JB 2QKIA 4I4WA 5I17A 3ARBD 4L8BA 1FGVH 2HFFB 4ZOAA 5HDQH 4DW2L 4KK6D 5LQBH 4AJ0A 5GISL 1U2HA 4RAHA 4OFPA 1E28B 5DQ9B 3MYZA 2H2PD 1U8NA 2XZZA 1KCVL 4QRPB 3JV4B 2EKSA 1F3JB 5GS1A 5FO8A 5T5FH 1I4FA 3OR7B 5IQ9A 2Q7YB 1R3LB 4LCWB 1INEL 1JNLH 3W11D 4CGTA 3LN4B 4K3JH 3EYSH 2EC9U 3SBWC 2ZCLH 4NBZB 4X6BB 4L4VE 2CKBH 1I85C 2HA1A 2XZCH 4CN4A 4JFQA 5GRZA 3IFOA 1AKJD 1DEEB 4PJ5D 4NKIH 5KSBA 4OTXH 3SE8H 3MOQA 8FABA 3IS0X 2DQGL 4HWNA 3HZYA 5T3ZD 3QAZC 2JLLA 2C4FT 5D2LB 3ZHKA 2X4NA 3CFJA 1IAOB 3UZQA 1OPGH 3VDBA 4OQTL 2ID5A 2IWGA 2UVFA 4GKNA 1ED3B 3IVKB 2L7JA 2FX7L 2YPLD 3C6LB 1JPFB 4K7FA 2JTDA 2LU3A 1MQ8A 1TZHB 5AUMB 2V5SA 3VXPA 4AY0A 2X89A 5I30L 3EBAA 4HLJA 2VDML 1HILA 3O3AB 5D1ZC 5EDXA 4JM4L 3AMLA 4G8GA 2G2RA 5HHQB 4K55A 2EYRA 5GRUL 4PLJC 1S78D 4HPOH 2VZ1A 3DURA 1QOKA 2AJVH 1S5IH 3UYRH 1KC5H 3G6JA 1D9KD 1S7VB 4PJBB 3S34L 1I1AA 4PJFB 5SX4I 2W60B 1J10A 5GJTL 1G9ML 5A16A 2PXYC 3QEUA 3V4UH 2HH0L 1XH3A 3VXUD 4HULB 3VRIB 4M6ML 1S7TA 5AZEH 4M6NH 4JY5H 3AREC 3C08L 1JUFB 3IFPB 4D0CA 5DSCB 1F3DJ 5DC4B 4CW1B 4KTEL 4MJ6A 4WFFD 5F21B 4QXGH 2VB5A 1CXIA 1F4WH 5I0DA 1BOYA 3I6GA 1JPSH 4WWID 4WO4D 4I2XB 1QO3B 1U3ZA 4HIHB 4HAFA 5CGTA 4HH8A 5A2LH 3S6CA 4QNPF 3NA9H 5JXAL 1R5WB 3ULUF 3GK8H 1CXEA 5T3XD 1BF2A 3WEXB 2E6QA 2XN9E 5TPWL 3SDXF 4IRJD 1LD9B 1LO4H 1UA6L 5K33A 1JRHL 1ONQB 4ZUTB 2Q7NA 3VE0A 4DQOL 3LCYA 2P5EA 5DUBB 3S36L 3C60A 2OL3A 2WUCH 4F7EA 1FSKC 4AH2B 2G60L 4XPFH 3OGCB 4WI9A 3ZDXE 2VISA 4PRHE 5L88H 2BOCA 3K4AA 2IH1A 5I74C 3M1BB 2IQAA 3CMOH 2ED9A 4U3XA 1SM3L 1GXEA 3VXRB 1DVFC 2J6EH 2ZUUA 5F9AC 3RUGA 1IQWL 3E2HB 3RVUD 1CLOH 2AJSH 3RL2B 2R1WB 3OJDA 1MCDA 3BO8B 3JV6B 1MAKA 3AUVA 1T3FA 3VFVB 4R8WL 1XCQB 4F8TA 1B3JA 3KPOA 5J9PB 4EKXA 1Z0NA 5IIEA 3IKCA 1CR9L 4KTDL 1I1YA 2DN7A 2ARJA 3QP3A 3I02A 5C2BL 4LCYA 3WMSA 4F9PC 5KSAB 3VFTA 4WW2F 1UXSA 3D39B 2OK0H 2GIYA 4ZUWB 4UILL 5IW3A 3RI5K 4PGBB 2DQDL 5FYJE 1OSZA 4Y4FB 4LHUB 4ZO9A 4I5BA 4QXTA 4XP1L 5FK9B 3SE4C 2FX8H 1LILA 4PTUA 5DFWH 5EO9B 1HXYB 1X3DA 5F7NC 4J3VA 2VQTA 3Q6GH 2A6JA 5GGUA 1RVFH 4RISH 4OLEA 2HMIC 2AQ1A 2N1KA 4MJIA 3LKNB 4OM0L 2Z31B 1VENA 3SO3C 3UBXA 1KV3A 3OWEA 1R5IA 2NX5B 2YKLH 4JPVL 1UM5H 2PW2B 5HYEA 4PJDB 4LPYA 3ARBA 4GBXC 4GRLC 5C0EB 4MXWH 3MLYH 1U91B 3V0AC 1VFUA 4LLAA 4BZ2L 1U58A 3OKNB 2X4RB 1FZMA 4YHKL 15C8L 3RHWF 1ZSDB 1T22A 4X6DE 4JVUA 4RMVA 5IVXF 2VO5A 5F7YC 3EOTL 4K3HA 4KMLB 4JHWL 2VDKH 4HUWB 4XBEH 4GG8A 5CJQH 4M8VA 2RGSA 2YPKB 4JGUA 2OSLA 4L3EB 3ZKMD 4ZQKA 5MEND 1QD0A 4Z76B 5L6YH 5DD6A 4QHNA 5HD8C 3VWKD 1TJHL 1DQDL 4NUJB 2GJZA 4CMMB 4IRSB 1IQDB 1KB9K 2J88H 2NXZB 1P69B 4XNUH 4I0CC 4LCCB 1BVKB 5F7DA 2NTSP 2GK0B 4LAQL 3B9KC 4X7SH 2DBLL 1PEWA 1NMBL 3GB7B 5I19L 1LO0H 3AAZB 3MA9L 4K3DH 2XWTB 1BOGA 5EU3B 4R26H 4X4XA 5EC2B 3RDTC 2HT3C 3VD5A 1KTLB 1ZT4B 2F54D 4LK4A 4OZGE 5CKGA 1JVKA 3MNZB 1OAUL 5F9DC 3C5JA 4WEUD 3IT8D 2WSKA 1AC0A 2WINB 1XGTA 1BGXH 2DQHH 4ETYA 3FB8A 1ZLWK 4KROB 2R56H 2DWDA 3VWJA 5IJVA 3RVVD 2V2TA 1WCQA 1W8NA 5T3ZL 1L7IH 1UZ6E 1OOAA 2IG2L 3G5VB 1AD0A 3IDGA 5JPMA 1JGLL 5JOPD 3TIEA 3U4EA 4N68A 4X7EC 5FO9B 4HIJA 5DJ0A 2HAZA 1IEBA 4ODWA 1BJMA 2V5RA 2XKUA 4UOJA 3GHEH 2D7TH 4M00A 4OB5H 1NEZB 1G7HB 1S8DB 3P0YL 4GMSH 3QNXB 4M1GH 1FFNB 3ZYZA 4M9PA 5KJRH 2GCYA 2E9IA 1YNLL 2W0PA 3DX8B 3RZCA 3IFLH 1DBAH 1LGVA 4HK3J 3LEVL 4ZS7L 2BSTA 4Y19E 2AK4B 3UEZA 1T2QH 4MNQB 1JZ7A 4PJHF 3RTQA 3TBWB 3NOIA 5E6YA 1KNOB 5IV2B 1IAII 1F11A 2A6IB 3VA6A 4Y4FD 1TDQA 4GG6E 5GGSA 4M6AA 3LH2H 3TCXA 4EZMA 2QADD 5BCAA 4KK8C 1RJYA 5HYJD 5ALBH 1G7MA 1SHMA 5F9WB 3BD3A 1A1OB 2ZSVB 4KKLC 5DMKB 3FO9B 5J3HD 4G3YL 1HHGA 3DVNB 4DUWA 3AC0A 1LO3H 2NZ9D 2B4CH 2IH3A 2Z31D 4UT6L 4YHPB 2NY7L 5IJKC 3NZ8B 5ILTL 1QFUH 2NY6C 1N59A 4HXAH 3C8KB 3DBXA 1XGRB 3QFDA 1XIWD 1RZJC 1CZ8H 4NO2A 1KUMA 4LVNC 1OB1B 4WV1B 2M26A 3X3FL 1CXHA 5E9DE 1IBGL 1J8HB 4FFWC 4TUJA 1YDPB 3CSYA 1OTTC 1LNUA 2W65B 4W6YB 3NA4A 1IGYB 1KGCE 5JIIA 1N2RB 3VD4A 3WD5H 2V5MA 2P7TA 1H8OA 4NUGH 1QLEH 5T3XL 2JJSA 1HQ4B 3G6JF 5KVGH 5EZLB 4B5EA 3WNPA 4I18A 3VFGH 3IDXH 2IF7A 4RNRA 5FUZH 2FEDD 4U1MA 1VFBA 4P46B 4QRTA 5CINH 4KDTC 1AI1H 4NQCB 4ODUB 4X5XA 4KJPC 1FAIL 3P9MB 1SEBB 3MO1A 3TCLB 4L8SC 5K93A 1HIMH 5FCUH 3QFJB 4OCRL 5EBMB 3IDMA 3FL7A 3BT2H 3LN9A 2YPVL 3Q2CA 4X98B 2VIRB 3LS4H 3FQTA 2NY3C 4PY8I 3EGSB 3SDYL 1OWRM 3BH8B 4RWYH 5FYLD 2H3NA 3HMWL 3RGVD 1ES0B 5C9JB 4JFDD 1PKQB 4Q6IB 3V95A 2BP3A 1YJDH 3BKYH 5F89A 2MKLC 2OXGA 3P0VL 4ETQB 1MCSA 4DEPB 5HGBA 1KJMA 5C0ND 2C7UA 2VWEC 5CIPA 4QF1B 5IVZA 3JTSA 4KROD 4LIQH 3QEQD 4LRNL 1A6WH 1IRAY 2EH8H 3BP7B 5INDA 3SDXB 1ZT1A 1UM4L 4YIQA 2DKMA 3VRLE 5BZDA 4H1LH 2X2YA 3UTZA 2J8UE 3RUGF 3IU3B 3A0OA 3PDOA 5JW3L 4U1NA 5FGBC 1S7RA 5C6TL 4HFWB 4PRDB 1IC5L 4OJFH 4Q2ZA 2CDFB 1YMMD 4MD4B 2Z91B 5SWQA 1MJ8H 1ZT7A 4EXKA 5F1IB 4HJJH 1PVHA 5I1CH 5J57B 3EYOA 1IC7L 2VL5B 4PJGA 3SJVE 4OLUH 4ZNEE 4KJQD 2EXYC 4F2MA 4AEIH 2JCCA 4H20H 5DK3A 2YSSA 3X3GL 5CEZD 4L5FH 4GUPA 1KN4L 3QDJE 4Y8AA 1EXUB 4D9RD 1DQJB 3MLWL 3JUZA 4Y8DC 4LASL 3IGAA 3MLTB 4EUPA 1A3RH 1RZKC 1MWAH 3PWJA 4WW2B 3O6FD 4UUJB 5FB8A 3QUXA 4LLUA 1EZVX 4R97B 4ZUSB 4OUUB 4XCYB 1GHFL 4P9MH 2YK1L 5J11C 3O3EB 1Z0MA 2DI9A 2UWEE 1P7QB 1UWGL 2KZWA 5F9JB 1RJCA 3SE3C 4TSCL 4K07A 4GAGL 4RIRA 3S88H 3CFKB 3KJ6H 1R0AH 4APQB 3CFBB 3JWDH 2R2EB 3GFUA 2X4QA 4TTDC 3RX5A 5C92A 1BZ9A 2VH5L 2VWEE 4ONOA 1DQMH 1S7SB 1I9IH 4NP4H 3RBSA 4U6XB 1JWMA 3E3QC 3NCYS 4QOKE 1D5XA 2EE9A 2O93L 5HHOE 4N0FB 4L4TD 1I8IB 3DV6B 4U0RC 4MB3A 3DYPA 4JKMA 1DN2A 3BX7C 2BFVH 1MF2H 3SPVB 2XN9A 2J5LB 4KKBD 3MV7B 4NN7B 3QUYD 4UTBL 1A1MA 5DI8A 5IVXB 1OP9A 4UV7L 5TF1H 4P46D 3ZKNC 1A3LL 1MUJB 4ZXBD 3SKMA 1BM3L 5CEXB 1NCBL 4M48L 2X4SA 4YDKH 1GGYA 3QFJD 4PRHA 5I8EA 1B0RB 5HHVH 4OF5A 3MLUL 3U6RB 1U8LB 4FQLH 1UWEH 4RGMB 2ZJSH 1HHKB 3IXTA 4WI7A 1HZHH 5B38B 1CDGA 1KJVA 3DX7A 3MRCA 2MTPA 3MUGA 3ZE0E 2H41A 5GGTA 4PUBL 3BPLC 3ZKQD 1DN0B 2NW3B 2DAVA 3O6LL 5CP3H 2P8MB 1UJ3B 1A22B 3UAJC 2A9MH 1XIWA 5J1AA 4CU7A 1NCDL 3C2AH 4S0TD 3SDAD 1EZVY 1KPRB 1T7WA 3MLZH 4M1CD 1FNEA 3V5HA 2BVOA 1SJVA 5FM4A 2AJZA 3FAWA 4I4WB 5I17B 4L8BB 5T1KA 1PG7X 1V3KA 1HWHB 1X5AA 3TJEL 4XMLL 5BV7L 1CVSC 1GRWA 3LS5H 1R3JA 2DYPD 1NFIA 4CDHA 1QFHA 3PNWB 4A6YB 4HF5L 1MCEA 3MLPA 4RMQA 2EKSB 3ZE1E 1ZANL 2CIKA 5KOMC 5GS1B 2C3VA 1FYTD 3N1PC 3CXHK 1I4FB 2VE6A 2J12B 3KDMA 1HYSC 4GH7B 3ZTNH 5IQ9B 2I9LA 4X7FC 2OJEB 3ARZA 1S7UA 1CL7L 3W5MA 1EJ6A 5SWZE 2Z35A 1Q72H 4X6DA 3JVGA 5TE7L 4JM2F 5J6GA 4YFEA 1P5UA 2R2BA 1BQLH 1FRGL 2XACC 3MRGA 3QIUA 1AQDB 2Z8VC 1TVBB 1RJZB 2XXMB 4PJHB 4AG4L 1BECA 5AWNL 1AXIB 4NNYA 3IFOB 3O9WA 4JFDA 4AEEA 3ILQD 4FFZH 3WKMH 8FABB 4M7JH 3HZYB 3SCMD 1NCTA 1EHAA 3TA3D 2B2XL 4L3CA 3BKJH 3G04A 5HHME 5CD3B 3KPRD 1R3IL 2CRZA 3SGKC 3OZ9H 4JO2H 4XWGH 5TDOA 3MACH 4GKNB 1M7DA 4JLRA 3PWPD 4NOFA 5F3BB 3BZDA 4K7FB 2AI0H 3MRJA 5GGQL 1C5BL 2ED8A 5CEYA 3VXPB 1FNSL 3SQOH 2W0LA 2ZUWA 5FYLL 1IKNC 1QBAA 1JRHI 2C1PA 4L3AA 4OZGA 3W0WE 4HT1L 4WRLA 3OB8A 1MHPL 3ALWA 1IAMA 2NQCA 2NY4D 4U7SA 4G8GB 2G2RB 3MV7D 3V52H 1IAIH 4U6HB 2EYRB 1VERA 2RCSL 2QSCH 4G9FA 2APXA 4NM4H 4ESKA 5GZOC 2EDNA 3PV6B 3VG9B 4W4OC 1G1CA 3U0WH 1LO5B 1J1XL 3V2AR 4XBPA 3G6JB 1Q9KB 1I1AB 1REIA 2EIEA 1UCBL 1H3TA 3MCKA 5I75B 1AO7A 5IBUG 3QEUB 4XNXH 3PE9A 1XH3B 4NHCH 3OTTA 4O51A 3WIHL 1G6RA 4M7LL 3QA3B 1S7TB 3QI9B 4YXKL 3QZWG 1U6AH 1WEJL 1U92A 1HXMA 3O6FA 1KXTB 1N6UA 4MJ6B 3I6LE 5DMIH 3NCMA 1ZGLP 3ISWA 5ISZB 1HNGA 4LSQH 3ARRA 1XR8B 3I6GB 5DLMH 4JR9L 2CK0L 4FQJL 4LQ1A 4PRAB 3N85H 4Y19A 5T1MA 5C0DA 3U36A 1P6FA 2COQA 3BRDA 4BELD 2D9QB