2NQCA

Crystal structure of ig-like domain 23 from human filamin c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
97
structure length
97
Chain Sequence
b'AGDPGLVSAYGPGLEGGTTGVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Filamin-C
molecule tags Immune system
source organism Homo sapiens
publication title Crystal structure of human filamin C domain 23 and small angle scattering model for filamin C 23-24 dimer
pubmed doi rcsb
total genus 21
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nqcA00
4PLNC 1NEUA 4QXGH 2BVUA 5D1XA 1FRGL 5MI0B 1XGQB 4R26L 3OZ9H 2Q8AL 5LGJA 3OJDB 4FQXC 3HUJE 4LEXL 4KJPC 3B2UD 4HUXA 4LSSH 1KYOK 5BV7H 4BZ2H 2YUWA 4NKOA 2J4WH 1NMBH 1CIDA 2BOCB 3MMEB 4NQDB 2FH6A 1I1YA 3MLXH 2HJFA 4X8XA 3ZKNC 1UZ6F 3MMEA 1AGCA 1KPUB 3VH8G 4ZYKA 3OSKA 2PYED 5KN5B 1JZ2A 1FFQA 2FJHA 4P5TB 3VD4A 4EUPA 4LKCB 3HAEB 5DJZB 3T77A 3QUXC 4HWEH 1EEZB 4XMPH 5GHWH 1OP5K 3ULVC 1FIGH 5DJYB 4L3EB 2EO9A 2HH0H 3CMOH 2AEQL 3CFCH 4JN2A 2HT3C 1FDLH 3OKLB 4FFVD 4ZSOE 4AH2A 4UTBH 4YXHH 2XWJA 1N7MH 1DBAL 2NY4D 2DD8L 3KXFB 4YFLF 5I2IA 2DL2A 1EUUA 4PRIA 1T5WA 3X14B 4BZYA 5J6GB 4K23L 4BA8A 4N0UA 2C3GA 2XZAL 3DUHA 4N0UB 1GGCL 2NLJB 4EQ3A 5HHOB 4MA8H 4Y1AD 1ACZA 2DQIL 3F7VA 1JGEA 1HDMA 4G9FA 4RIRA 5ENWB 2HMID 5JZ7D 4JDTH 1RIHL 2OM5A 4RAVB 1BWWA 5F6HI 1UVQA 5GS3A 5CBAB 1R5IB 4W6WB 3W81A 2DIAA 5C3LD 3C8DA 3BRGC 5J8OA 1WZ1L 4XXCC 1KXTB 3QDMA 4KJPD 1R0AH 1S9WA 3WJJA 4MNGB 1NGWB 1N6UA 3EYUL 3OX8A 3D85D 4X98B 4JZNA 3MLRL 5EU6B 3DVFA 4Y5VB 2FIKB 5IESH 1CD1B 5FYJL 3F58H 5EU3A 4KPHL 3PXHA 4NGHL 4P4RB 4XBPA 1KPRA 4GRMB 1OAUL 4UB0L 3IFOA 3OAYK 3TNMB 5T1MB 4K9EC 5T33L 2IAMB 2VAJA 1EJOL 2JELL 4IRJD 3TJHD 3MRKB 3UJTH 4FXGB 5CGTA 3L7FA 2Z31A 3K2UL 5JUEL 4LSUH 2AAVA 1HXYB 5I1EH 3L5HA 3P0GB 3DMMB 2AJVH 4Q9RL 1SM3H 3BRDA 1Y18A 3ZTJG 4GKNB 4HF5L 4KI5F 3O3BB 4WI4A 4JFXB 3MRBB 4PJBF 4PRHD 1NUDA 5LGJB 4FTVE 2NY1D 1A1MB 3CCHB 3OAUL 4DN4L 1L7IH 5JW5A 1QACA 4HCRA 3MROB 2HMIC 3MV7A 4BM7A 5JW5B 2VDRH 5DUPH 4S2SA 3OBAA 4I0PC 4AT6B 1RQ5A 3O6MH 3G6AA 2R9HC 4XNXH 3VMOA 5CILL 1CR9L 3SKJL 2RIKA 3BKCH 4OQ1A 3TT3H 1I8IB 4UQ2B 5HYQA 2XI9A 1INDL 1CF8L 1I8IA 4I4WA 4U0QB 3P4MB 4KHTL 1Q8MA 1IBGH 2BDNH 2XZQL 4XNZC 1TZGH 1MFCL 2AV7A 4DGYL 3WFHB 4GMTL 1ERNA 4XCCH 5GRVL 3OKLA 4H20L 5FGSA 2R1YA 3V8CA 4PJCF 3DXAE 1CK0L 5TF1L 4KVCH 1C5CL 5D71H 2YD4A 2CR6A 4YGVA 1T7VA 4AENA 4YK4B 3VXSA 1JNLL 5M7QA 32C2A 3X14A 5I0DA 4BZ2L 5SWSE 1KJVA 3HG1A 4KH2A 5GRVK 4OLUH 4KMLB 4K94C 4ODTL 1CCZA 4QTIH 3B3IB 1YECH 1Z6JT 4F33B 2CJUH 3MLXL 1E6JL 1HHGB 4M6OL 3ARDA 5D9SB 3LSOB 3IAGC 3TGXA 4RIRB 3NFNA 4P3DB 2J8OA 4FQQA 4I3SH 1U6AH 2IH3B 4JB9L 1JRHL 3UYRL 1IGYA 4HJJL 2X89D 4AK1A 4X0KA 3O2WL 3OB0H 2OCFD 3PWJA 3KPQB 5EFIB 1FNEA 2VLJA 1FDLL 1OB1B 3QJFA 3QFJE 4JG0L 3IKCA 1KC5H 2H2SC 4KZDH 3ZT5A 4WI2A 3SDXF 2FNBA 5IWLC 1NFDF 4XPTL 4M1DH 1KB5L 1GGCH 5FK9A 4I77L 2YD9A 4YIQA 1A6ZB 4GQPH 3RKDC 4PY8I 2C4XA 3BYYA 3TV3H 2KH2B 2EYTB 4X9FA 4FP8L 9CGTA 2DI9A 4M6MH 2ZOKB 3N1GC 3V6ZA 5IP4A 2B4CL 2HP4A 1DVFD 1SY6H 1RU9L 4L3CA 5D7IA 5JLZA 4WO4A 1WWCA 3G9VA 3KJ4B 3L7FB 4LGSB 5DJCB 1MEXH 3GSXA 1FGVL 5EZOH 4EIZC 3TJEH 1PKOA 4M93B 4DAGH 4GKNA 4NN7C 4QRRD 3TVMA 4N8CH 3RI5F 1Z9OA 1G7MB 1CFNB 1BBDL 1EVTC 3QCTH 4PUBL 2IPUK 3BT2H 2OP4L 2JB5L 4I1NB 4N0FA 4OV5A 1A1MA 3CCHA 1U92B 3KHOA 4KPHH 4PJCB 4MSWB 4LHUD 5C0DA 1FYTE 3GMOB 2HLAA 4AEEA 3L1OL 3LQAH 1VESA 4MJ2A 2YRPA 5HYSA 4QCIA 3O3EB 1VFUA 4LSSL 1DUYA 4S1QL 3LCYA 5C0IB 2V2XB 3UZVB 1EGJL 3QA3A 3P4OB 4Z76A 2EO1A 3SO5A 2UWEE 1DEDA 3BESR 4LNRB 3O9WA 1TVBA 4WTZG 2XTLA 4YDIL 1GCFA 1A7PH 2LU7A 1DANU 4PJHA 4NN6C 1SQ2N 2FX8H 4POZC 4M7KL 3EOAB 1RZKH 2X4OA 3EOAA 3PDOB 5EA0H 3KG5A 2EIBA 4ZMAT 3LH2L 4M02A 1DN0B 2X1WL 4DKFH 4AIXA 4LPVA 2AQ1A 4JGUA 3FQTB 4HLZH 4TVPD 3TO4B 4HJ0C 1KB5A 4G7YH 1V7MH 5CHNB 4QGTA 1KJVB 3T0ED 4HWZB 5CILH 5GGSA 3SKJH 1HINH 5FO8B 2F8XC 2X5PA 4LCYB 1BQLH 1FCCA 5C0BD 4JLRB 3IAPA 1QFWL 4O00A 5E2WH 5C8JB 2YWYA 2XACC 3EFDH 1KN2L 2VMFA 2YC1B 3CK0H 5C0JB 3CPLB 2Q3ZA 3VE0A 2MHAA 4J3XA 3CMOL 5SWZD 5D1QB 4Y4KC 1U3YA 3QWRD 4LLVB 4HIEA 2JTDA 1QQDA 3KHQA 5IJVA 2DQGH 4PJGA 1OTTC 1KCUH 1HK6A 5F6IB 4YLQT 1IQWH 4CVXB 3NBNA 4XI5D 5EBMB 4BUGA 2FYYB 4CVXA 2BERA 3B5TA 4HBQA 4U6HB 4GG8B 1R0AL 5TQ0H 1HILA 4ZPTA 2HLFD 4QF1B 4J12A 4M5YH 3HLAB 1QP1A 4WNQB 2DLGA 2YXFA 4OD1L 4G8EB 3GUTA 4TRPL 4ONGL 1TVHA 3PP4H 5GGVH 2A1WH 25C8L 2XKNB 3SDXE 4H5SA 4ZPVA 5EORL 3THMH 3DETD 4OCYH 1D5IL 3QNXA 3DX6A 3QIBB 3IJHB 3LN5B 2MOVA 1JFQL 3R4DA 4HV8B 2YPKA 3O2WH 3FL7A 1UVQB 4JANA 3ARWA 4OB5H 1XZ0B 5DHVB 1I8MA 3K2UH 2XTJC 5JUEH 5HGDB 4ZS7H 4F37K 4TNVF 4MQSB 1MQKH 5FIEA 4BFEA 5FM4A 4K7PX 3LEXB 3ZDYF 1I1FB 4MA7L 4U1LB 3WLWD 5CGMA 4XBGA 1CFNA 3A6BH 4PP2B 4PJ9B 3ZHLA 4KI5E 5GGRA 2WUCH 5ACMA 3D9AL 2B1HH 4HUWB 2FWOA 3IJYB 3WHXA 5JHDD 1A9EB 1IGJB 5DGRA 3QIWB 1HSAB 3OKDB 1QLRB 4G7VH 4LSTH 3QA3B 3OMZA 4U1HA 2XA3A 3TM6A 4DOHE 1DBJH 1GH7A 2P8MB 1NGQH 3MLUL 5F21B 2CXKA 3DYOA 4FZ8L 3ULVL 4JRYA 4RGNE 4YFEA 1ZT1B 1T0NB 4Y2DA 3BGMA 1JYXA 5EU7E 5HHVH 3MRDB 2LU4A 5EZIL 3WSQH 4JZJC 3ARFC 3D2UB 3V6FB 3NCBB 2ZG3A 3SE4A 5EIQA 1AXIB 4HKXA 2FEDC 1NEZB 2P8PB 3WFEL 4H26B 2EDKA 1D9KA 4G3YL 1II4E 4WI5A 2B7DT 1PKQA 2XV6B 2DQTH 4QRTB 1NSNL 3TJHC 4MVBD 3B9KD 1LK3L 3L95B 4LCYA 4O2CB 4ODTH 4YWGH 5BVPL 5DJXB 4PJBE 2A6IB 3CFBB 2V5TA 5KN5A 3IGAB 2P42B 1Q94A 2B1AH 3INUH 2A6IA 3CFBA 3NA9H 3HAEG 5MEPB 1JF1A 4JFPB 3V6OC 5CJXA 3QQ9C 4APQC 2JK5A 1BJMA 3BP7B 1ORQB 4M7KH 4ZG1A 2BVOA 5H94B 1J5OH 4JFDA 3HE6B 4MD4A 2NY1C 2Z91B 1MRDL 2BVOB 4NKIH 3B9AA 1QBLH 2ZG1A 1LP9A 1X9QA 2X70A 1ZHNA 3AY4C 3CUPB 1WVZA 2HVJB 3RWHB 5F7UA 4PV9A 5ADPL 5IW6B 1UM4L 5KS9E 5J6GA 1G1CA 4NPYB 4TVPL 5C0NC 2VR5A 4U1MB 5T1KA 1BD2A 3KXFA 4OLUL 4I0PA 4LSVH 1NAML 1BOYA 3QH3A 4OZFB 5H35B 5IK3B 3TBTB 1W72B 3V5HB 5ESVB 2BNRE 1CT8A 4L3EE 4KDTC 4NQED 2V7HA 4KUZH 4X6CE 4H5SB 4ZPVB 1VA9A 3U6RA 2VRAA 1S7QB 1T04A 2MWCA 1IMHC 3OKNA 4DTGL 4R4NC 4LDLB 1HXMB 2UVFA 3K81A 4BKLB 4E9LA 4E5XA 1X5XA 5I0ZA 1U9KA 5LG1A 3PWLB 2R1XA 1Q9LB 2DBLH 3WHE1 1DL7L 3CLFL 4A2LA 4LGPB 1NAMA 4MVBC 2PYEA 5HSFA 2X05A 4QRPD 3O11A 2NY6D 3BT2L 1LO3H 2WBKA 1QNZL 2Y36L 2E27L 1FG2B 2ZOLA 4EN3A 4KUCD 1S9VB 5KTEH 4P48A 3S36X 3VWJB 1JYVA 3QZWA 1GGYA 1I8KA 2JJSC 5FV1L 3U7WL 4RFNC 1WZKA 1I9RH 4NZDA 2BNQD 5ESAB 2FEEL 3KJ6H 2XY2A 1N2RB 3OKYA 3OXSA 4P59H 4WEBH 5IHZB 3VMNA 4NN6B 5JR1L 4PTUA 1F3JA 3SKUD 5FECB 5I71B 2Z8VC 3GSNB 3HAEH 3PHQB 3VFSB 2GTZA 4HXAH 5FM8A 3FB8A 3PHQA 3H3KA 4PBVC 4PRPE 3VFWB 4PUBH 1S9YB 2XN9E 2X4QB 3GK8H 3O3BA 1YEHL 1HSBA 2VL5B 4NHCH 3L3OB 5IQ7H 4Y7MA 2RFXB 2DTMH 1FL3B 2EDXA 3WEXB 5JO5B 5FUZL 1OW0C 1CL7H 1JPFA 4H26A 4RGNB 5F7NC 2KZWA 2GHWB 4LF3B 1U36A 4PJXE 3CVHB 1I1YB 4X6BB 2V2XA 2QEJA 3G6DL 5ITFB 4POYA 5FV2A 4FMKA 4PJEA 4L8DA 4JRWA 2BCKA 2K7QA 2I60H 5DJZA 3JWOH 1REIA 3MLZL 3L3HB 3HN3A 5DD3L 1KCLA 3MBXL 4JDZB 1T20A 4HH8A 6FABL 1G9EA 5CJ5A 3X17A 5JQHC 2OI9C 4P9HH 1OAZH 4WFHD 1OPGH 3T65B 1ED3A 2CLZB 4WHTB 2F15A 4NRYA 4K71C 3IFPB 3ILPB 3TO2B 1HH9B 3OHXB 1V7ML 3V0WL 1M7DA 3VGEA 4C59B 2R0WL 1R3KA 2AERT 3OR6A 2YD6A 5FHBL 3LSOA 3D85B 2JJSA 4NO5B 1KSRA 2I5YH 3FRPG 3X12B 4N90E 1Q0YL 4X99B 4W4OC 1SYSB 5IQ9A 4F9PC 3PWLA 1GJIA 1CTNA 1QQDB 1K5NB 5CBEB 5KVGH 4EQ2A 4LCWD 1KCUL 4LNVA 4HG4K 1RK1A 4K8RD 3S3PA 1U95A 3FT4A 3GKZA 4HIJB 4KHXH 3VW3H 3K4DA 4PRPB 1NGWA 3OX8B 4Q74A 1G6RL 1AY1L 3PIQB 1EA9C 1RSFA 1MJUL 4Y88A 1KF9B 4TQEL 4JVUA 2APVA 3PL6B 5E7FA 5FK9B 4HQQL 1TCMA 4IMLA 1H5BA 4I9WD 4LKXB 4RISH 2R4RH 1E4JA 1RJLB 5FYLD 3LPWA 3O3AB 4ZXBB 1EHNA 3C6LC 1JZ3A 1WBZB 3ARYA 3HB3C 3SPVB 1IM9D 4LLDB 2ZP0T 2VXVL 2WINB 4U1KB 3G5YA 4KUCF 3DNKA 3QDGD 1RK0B 5I1JL 1RK0A 3ULSA 2YS4A 4OIIL 5IGXL 4XBGB 3P4NA 2R4SH 3WNLA 3NFSL 1P7QB 5E8NA 5SV4A 5LGHL 3MOBH 1WBXA 3VJ6A 2BZDA 4U7KA 3QEUA 1PVHA 1QFHA 5HHOE 3VWKA 4FG6C 4N0YL 1JZ5A 2AABH 1VEMA 2DQTL 4ZAKC 1QOKA 4PRDA 2WBJB 2ITDA 4PR5A 1K2DA 5ID1B 1Q38A 1TJIL 1INQA 4L8DB 4NC0B 5SWQA 4KV5E 3IRPX 4ETQB 1CICD 3A6OA 4K8RC 5DVNA 1BF8A 4P49A 2Q7YA 2YA1A 3CFJA 1IVLA 5D1XC 2AV7B 2HJKB 1EEYA 3FHQA 1L0XA 1TQBC 4Y8AA 4DN3L 5IVNA 2CLRA 1UXWB 5IBLC 3KPOA 4Q2ZB 3QEGL 4NKIL 2C9AA 4Z7OE 1Q72L 2RR3A 4TUJB 3NH7L 2Q8AH 3IFPA 2CIIA 2AJXH 4HIHA 4YPGB 2GY7B 2QQLL 4YO0B 5J13C 3T0EA 2J7LA 5FB8A 2CK2A 4AEIL 2ICWB 3IS0X 1TJGL 3HZVB 4GH7B 4N5UA 4NP4L 4NQDA 2FD6L 3E6FB 4AYFA 3B3IA 2BNQE 4UTAL 5ENWA 2EDYA 2IPKB 3F7YB 5C08E 4XWGH 2J5LB 5DSCB 1J0ZA 1EHLL 3ZDXF 2I60L 1B0GA 1OGAE 3BO8A 3QQ3A 3TH2T 3WFDH 3BP7A 1Y6NR 3RJQB 3FTGA 2P7TA 2R23A 4NQCB 3ULUC 3MXVL 1CZ8H 4HIEB 4P9HL 1I1AA 5GXBB 5H8DA 4NOBA 3H7LA 5C7XH 3FT4B 1K3ZA 2HVJA 3RWHA 1F90H 4AH2B 3FN3A 5BW7C 1A7OH 3TWCH 1I7ZA 1DDHB 4TVPH 5EN2A 1KG0A 2PTVA 3HC0B 1AD0B 4BQBA 4JKPH 3ZTNL 5HYSG 3RWCB 1SJEB 3BPNB 5D2NC 3WJLA 1F42A 3N06B 3V79C 1FC2D 4P46A 3D0VA 1LE9B 4DUWA 1C5DA 4PJ8D 1I3GH 3QBTB 1VPOH 5DJ6A 2DKMA 1KFAL 4F9LC 2VLKD 4HH9B 4P2RE 1QKZL 5IM7B 3IXTB 5HVWA 1I8MB 3WDIA 4YBQC 3LN5A 3ARBB 3FQRB 5I1AB 1M1SA 1UEMA 3V9FA 1JPSL 5FKAB 5MHSD 1BVKA 3ECBB 1F4HA 3WIFB 5C0ND 1UM5L 2VXUH 5IVXB 4PFEA 4OD3H 3UZQA 3QUYD 4IM8A 1X5ZA 1GC1C 5DZLA 2DS4A 1QNZH 1AY1H 2VZ3A 2AQ3A 2Y36H 3LOWA 3U1SL 5JHDB 1YEHH 4AIZA 2AV1A 2YEZA 2DQIH 1NCCH 5FF6B 1VGEL 4FFVC 2VITB 4JFYB 2YWZA 3BAEL 3W0WA 5I1KH 2LVCA 4JPVH 5FA3B 3TH3T 3BGAA 1FZJB 2CD0A 2A6KA 4NBYB 4L9LC 3QIBC 3QDGE 4R2GC 1J8HB 1P5VA 5I1EL 4XCEA 3SDCD 2X9XA 3ORJA 3WXWH 4N8VA 3BKML 2F58H 2VLRE 1YPZE 3NIFE 1IKFH 1Z9SA 4K2UH 2NY6C 4HF5H 5T5NF 3CFKA 1CFQB 4L4TD 4ORGA 5DEGA 4BH8B 3KPLA 1T1YB 1NEZA 4MAUL 1S7WB 3KPLB 1A2YA 5D7KE 4M62L 5B4MD 5I8OH 3P30L 1XR8B 3SQOL 3WKNA 2CIIB 1HQRB 4NHUB 1ODAA 3DV6A 3FB6A 2UWEA 1HNGA 3QUMA 4KJQD 4NKOB 3Q48A 4OUOA 5B21A 4D9RD 5A43C 4HIIA 5BO1L 1DEEB 2XZZA 5FO8A 3LZFL 3P9LA 4G6AD 3U30C 4JG1H 2ATKB 2B4CC 2YD1A 1MF2L 4QGYA 4DVBB 1EMTH 2I5YL 1F58L 1J0KA 2VWEC 1E28B 1RJZB 4NQCA 3VE0B 1MCFA 1FNSL 2G75B 3QAZB 15C8L 5BZDB 4WV1A 2APWA 2EECA 4ODWB 3NH7H 3HC0A 2OBGA 2J6EH 5DT1L 3G5VA 5TF0A 1OVZA 1T5WB 4X4XA 3EJZC 3KNBA 4QHLB 3O6ML 1N3NA 3QULB 3VI4F 5C0FA 4OCSL 1DJSA 4Z8FL 3CVIL 3RY6C 1TJGH 4RQQB 4I18A 4WWKC 4YQXH 8CGTA 4QHMA 1R3KB 2VTFA 4YIQB 3FN9A 5GS1C 4F33A 4K71B 3C6LB 5FUCC 2C5DC 4ESKA 4G43A 1INDH 5C0EB 2YR3A 2JJUA 4OZFH 5A2FA 3T2QA 1GVIA 5EO0B 1SVZA 4P3DA 2OMBA 1TVDA 2XZQH 1OOAA 4TTGA 4H8WL 2WWKO 5E6IA 4LGRB 5TE6L 4OFYA 4X7SH 4N9GA 3VGHA 1CZ8L 3MSPA 4RWYL 2XFXB 1TCRA 5JA9A 4X80H 1FP5A 1MPAL 3ZSTA 5INDB 5HDBF 5DUMH 3PGDA 4PJ5D 5B4MC 3RWDB 4DFHA 1BX2A 2NNAA 1BFOB 3HC3L 5JDSA 1BVKB 4BYHA 2P4AB 2VAAA 4OLEA 4KQ3H 1S7RB 1RUPL 1AP2A 3MRQA 4JN1H 2H6PB 2R8SL 2NCMA 3V4PL 3T4AA 1U3HB 1I1AC 3PIQA 4FQ2H 3O0RH 2X6MA 1GGIL 1K4DB 1NBYB 4QOKB 4ZTPL 1LDPL 2PUQT 3IAQA 2HVKA 3PUCA 4L4VA 1I3GL 2QSCL 5KSUB 4KVNL 3ARGB 3SO3C 1MCWW 3EOBA 4FRWA 3ZKXB 4PRNB 1U6AL 4JDVB 3ROOA 4EI5A 5E00A 2OTUA 5IV2A 5KANG 1ZHBA 4JCLA 1BM3H 1JMZA 4U6YA 5DUBB 4FXLA 5E4IA 5F72S 4FQPA 3AM8A 4U1KA 3PV6B 3CX5J 1DUZA 4E0RA 2PF6A 4MMZC 5I19H 4FTVD 5C2BL 4D94A 3MCLL 5ICXA 4JCMA 3RX7A 2BXZA 4JR9H 1A9BB 4OJFH 5FAAA 1W8NA 3HR6A 1BJ8A 5EH1A 4NQXA 5FA4A 1ACYH 1XAUA 2AKRA 2FHFA 3N9GL 5TDNA 3CX5K 4F8TA 1OCWH 4JJHA 4AEIH 1S7XA 5KSAA 2RAMA 1ZVSB 3AMLA 1S3KL 1FIEA 4LIQE 4OGXL 4RGMB 3T4YA 3JV6A 4WU5B 4Z7UA 1WQVT 4YXLH 3TZVD 2VQ1B 4JEGB 3STZB 4JM2A 3CZFA 1A7PL 4WWID 2VR4A 1WLHA 2V2TA 4ZDHB 3S35H 1JNNL 3V4VH 5DFVC 4DN3H 1AGFB 5EA0L 3MRLB 5F9JA 5CKGA 3WXVH 1HNFA 1QO3A 2C26A 4N1HB 4ODXB 3X3FL 4OLVH 4FG6D 3PWUB 4I0CC 2HKHH 4P2OC 4U7SA 5IB4B 3GRWH 2L4OA 3VFRB 2CK0L 3IDXL 3MRMA 2DRUA 3EO9L 3HG1B 1QHOA 3FFDA 3MJ8A 5DMGC 1CICC 1XGPB 2AI0L 2PXYB 3GGWA 5CP7A 4JY6B 4ZUUB 5ECJE 3EFDL 4U6TA 4QHNA 3GMQB 4LVNC 1XZ0A 5C0JA 2QTEA 4YX2H 4MJ6B 4Q9CA 3KYOA 1YEDA 2VIRA 3M1BB 2F54E 1A7BA 5CBAA 5SX5H 1J1PH 2JCCB 2UY6A 3WCYA 2NY0D 1KG0B 2BNRA 2I07A 2R15A 4PJ7E 3RWJB 1T4KA 4HGWA 4U1NA 4HULB 5C9KA 1MCHA 4JPIA 1PZ5A 1T4KB 3QISA 4POZD 2J8UE 1R3LB 2BSSA 3W9DA 1RUML 3EDFA 3Q3GB 1LILA 3HE6C 2BMKB 1DQJB 4OF6A 1V05A 4U2YA 4A6YA 2VERN 4MLIA 3QNXB 4EN3C 3BAEH 5DVLA 3U79A 5DJDA 3REVA 5HHXL 1IKNC 1FNAA 3CFEB 3KPPB 4X80L 4OKVA 5A2JH 1HXYA 2QV2A 1KEGL 4LMQE 3QRFM 2IQ9H 4ZFGH 3R1GH 2R8SH 3FB7A 1FVDA 1Q9WA 1JPST 4JFXA 1YPZF 4K07A 5GGRB 1MLBA 2DQEL 2EDBA 4OD1H 1MREL 1AO7E 1VGEH 1NCAL 1SYVB 1I7RB 1EIBA 2HFEB 4TPRH 1W0WA 5C0CD 4Q9BA 4AT6A 3QIWA 3WFCL 2RJMA 4JPVL 3JWDH 4LL9A 1CICB 1OAKL 5J1AB 4XAWH 4ZFFA 1A5FL 1A6AB 1IC5L 2V7NA 4EXKA 5BMFH 4WI8A 3UBXB 2DQHH 3O9WB 3SGJC 5DJ0A 2P5WE 3B6SB 4EUPG 5FYKL 5BQ7B 5IF0A 7FABL 5I18H 5JOEA 3CLEH 5CD3A 1F2QA 5I19L 3VRJA 2WBWB 2IPTL 4OLWH 2EKSA 5IFJB 1I3UA 3DBXB 2VLLA 1RIUL 5D1ZB 5SWSD 3I6KB 2C4FU 4EIGB 3MV8B 4YGVB 3DVGB 3OJMB 4DZBB 5JDJA 1KB5B 4MXVE 4O58H 3IVKA 2YD3A 4PJAE 1KTKE 1DBJL 5FOBA 4MDJA 3RTQB 4OGAD 4OQTA 3BH9B 3GGWB 2EZ0D 5HI5D 3CH1A 3V52L 1ETZB 4MWFA 3QFJD 5IQ9B 3UCRA 4FFZL 1OAQL 5EU4A 3BQUA 3FAWA 5ILTL 1AO7D 4LHJB 4JZJA 1B0WA 5DDHA 3IETB 4G8FB 1MPAH 2DYPD 5B3NA 1IAII 2XN9D 1C1EL 5D93C 1H0DB 1R6VA 3WFEH 2PN5A 1JL8A 3QAZC 4G3YH 3G5VB 1NAMB 2ED9A 5MP6H 3DUUA 5GRWA 4ACPA 1R3JA 3EHBD 3VG0L 5ISZE 4O02H 5C71A 1TQCB 5KZCD 3VI3F 1UM6H 4KDWA 5IK3A 3TBTA 1GSMA 2NLJA 4LP4A 2DM4A 4O2FA 3G6JB 3EZJB 5CD5D 1D6EB 3N1QC 2IBBA 5EZJB 3NCYS 2VDOH 3JBG7 1XT5A 3EBAA 2H2PC 2W65A 3EYSL 3RZCD 3NMEA 3S88L 2EEDA 2YPKB 2VH5L 2Y07H 5CJXC 3V6OA 3LHPL 4C56E 1E0OB 2PTTB 4WJ5A 5T3ZH 2OSLA 4YHPA 2PTTA 3B9KB 1U8LB 4WJ5B 1L4IA 5F70A 4WV1C 5IEKA 1BX2B 2R1XB 2AXGA 1IT9L 1FG9C 2D7MA 1WC7A 4X6DB 3ZT6A 2HRPH 3SKMA 3GIVA 2VXTH 3FT2B 1ZA6A 2APBA 2F19L 4WWKD 1E27B 4APQD 1RUAL 3U9PL 4HXBL 5DFTA 4XCFH 1X5GA 2F8VA 4OJFL 4R97C 1FAKT 4U3HA 1JZ8A 1DE4A 3CC5B 1UJ3A 4RFOL 1A22B 4K3EL 4YHLH 3AC0A 5B22A 4HX1B 3B9EA 4ZUSA 2VC2H 2JJTC 4P5MA 3V7AE 3SGEI 1YMME 1YNTA 4NSKB 2OX5A 1R3IH 4OGZA 4XNYL 4ODSH 3N1MC 1FH5L 2O61A 5JXEA 1TTGA 4A2MA 3E3QC 1ZEAH 2NY5L 1IRAY 4LPYA 4RX4D 1ITBB 3O8XB 3E3QE 3D39D 2CGRH 5D1ZA 5J3HD 3GJFH 1HSBB 2VL5A 1W72L 3AB0B 4PY7A 4QY8B 5FKPB 5K59E 3RZCB 5CD5C 2OZ4H 3AB0C 4HKJA 3ZMRA 2QR0A 3QDJA 2H2PD 3GRWL 4DWHA 5KOVC 5J13B 4L5FH 4Y5YC 3W39A 3UJTL 2NPLX 3F65A 1A5FH 1IC5H 5CFHA 3ROLB 3X12A 5DC9B 3VXSE 2VWEE 5MEPA 1IM3A 4R2GB 3Q5TA 4KKCD 4N1CA 3LKQB 3EYOA 3Q1SH 2APFA 3G08B 2F74B 3MRJA 2FGZA 1JE6A 2VLJB 5J4MA 3BQUB 4GKOA 1NGXB 2EYSA 3QDME 1F4YL 3RIFF 3CU1A 3BHBB 3MJ7B 1Y6MR 5C1MB 2FHCA 4GMSH 4U6HA 3MJ7A 2JIXD 4DQOH 3TP4A 2BNQA 1U8QB 2H3NA 4I0PD 2MCPL 3VFOB 3CSYB 3DROB 3PE9A 4H0IA 1NL0L 4ELKA 4L8CA 3ALPA 1QSZA 43CAB 1J18A 4HZLB 1C5DB 4M43H 2GK2A 5DO2C 3WJLC 1IAKA 1AKJD 4WI3A 3ZYJA 4BELD 1WCBA 4LFHD 4MHHG 1Q0YH 6FABH 4O2EB 2WV3A 5LQBH 1HYRC 5JLZB 1WT5C 1C8PA 2EXWC 3GO1H 4XCCL 5L88H 5J3HC 3QIBA 3DX6B 4RGOH 3KYOB 2QADB 1J05A 3VXQB 1NC4B 4C83A 5DD5H 3RWDA 3AROA 2ICWI 4H1LG 5CLWA 5IBUB 1G9ML 5INDA 2DD8H 5EU6D 1ZA6B 4UIMB 2IQ9L 4ZFGL 4M00A 1LDSA 3LKOB 4NWTH 2I9LB 1H15A 4CVZA 3VXRA 1IEBB 2XOTA 5IVZA 4DVRH 2AXFA 4CVUA 3T04D 2UY7A 1UM6L 4NCC1 1MCOL 3QI9B 1T0PB 1MOEA 4AL8H 5FHBH 1QLFA 2VZTA 3MV7E 4K8RL 1OTTD 3BVNA 2CSPA 3KDMA 4H0HB 4XB7A 1T21A 5A2KH 3STBA 4ZXBA 3HZKA 3OKDA 5HHXH 5SWQB 2KPNA 2G2RB 4FXGA 2GJ6B 2CUIA 3RGVA 3QCUL 4ZFOL 3OJ2C 2I9TA 1T0NA 2VXVH 4KJYA 3WUZA 3BZ4B 3DJ9A 2GAZA 5IW1B 4XCYB 1SJHB 4UU9B 2O61B 4P46D 5F96H 4KKNA 3DRTB 3DXAA 4QHUA 3VWJD 5JXEC 2X4TA 2GIYA 1JPTL 4XPTH 3KPMA 2XTJD 3P9MB 3RZCA 2J6EA 4TQEH 35C8L 4RFEA 4N9OB 4GAYA 3TV3L 3HG1E 2Z31D 3H3PL 3SE4C 2QL1A 1AQKL 1WTGT 4AG4H 2CDEB 1D9KB 1DEEA 1CI5A 1JBJA 4JO4L 3S4SA 4KK9D 1OWWA 2ZCHL 3T0BA 5FGBA 1D9KC 4NM8L 3SGJA 1PG7X 2ESVE 3U4BL 3V7MA 4NQDD 4GW1A 5BXFB 2EH8L 3FTGB 3VXTB 2X09A 4I48A 3CZFB 4WUUB 5EPMA 3PL6D 1HHIA 5L9DH 4WW2A 3S96A 1HI6A 5BVJB 4PRHE 4NKMB 3FOMB 3H0TB 3L3DA 1IFHL 1KIRA 2AK4A 1U8NA 3MYJA 4YAQB 1KIRB 2AK4B 3VI4E 1D6VH 3DO7B 4PB0H 1G7LA 4P2CG 3S36H 4DZBA 2H3NB 3RAJH 5E2UH 5JW4R 1IGML 3AXLB 2IQAB 3HI6L 4S10A 5TH2A 4WUUE 5BZWB 4NQCE 3HUJF 1PLGL 2FB4H 4R4BB 5KS9F 1OWRM 4GKSB 2DMCA 4F7TB 3RX5A 3WFZA 2DIBA 1HKLH 3VG9B 3PWPE 1HZHH 3NPSC 1HXMA 2EEBA 3Q1SL 4QHNB 3KPSB 3T8XB 1I3VA 2HAZA 3H9SE 5AZEH 5HDBE 3WD5L 5KSVB 3QEGH 4N9GB 1QSFB 2FZ3A 3WIFA 3NTCH 3HCVB 5K93A 5C92A 4YZFF 2VIRB 1VB9A 3BEVB 3SDDA 1I4FB 3OL2A 2H6PA 4U1LA 3BEVA 1EPFA 2VAAB 4KRLB 3T0EE 4LSDA 4MNHA 3SGKC 2D7NA 1B3JA 4CVZB 3QPXH 3T0EC 1MAMH 2ZJSL 4PREA 4D9QE 3C5JB 4F9LA 2Q8BL 3S6CA 4CUCA 1I7UB 5I6XC 3G6JA 1ZVYA 1S5IL 2DJ4A 3DGGA 1B6UA 3RFZC 3RIAF 1OGAA 2WM0A 5MI0C 4KY1L 4MD5A 3FQXA 4BFIA 3T1FA 3NCYP 2BMKA 4M4RA 5KSAC 5F7FA 2G2RA 3ILQD 3AAZA 2W60A 4H1LH 3QEQA 3VI3E 3PHSA 1UQSA 4XWOC 1R3HA 1IAIM 2DQGL 3LKPB 1R3IL 4XNYH 3O4LD 1VACB 3V7AG 3VFSA 1T1ZB 1FZOB 1UM5H 2WP3T 3SKMB 3EHBC 5BW7A 4M1CD 2F19H 1ZHLB 4R4ND 4YHNA 5F88A 3SJVD 1ZT4A 3ZDZE 2CMRL 3DO3A 4HG4J 3ULUD 5F9OL 2ICCA 4XMLH 4YHOH 4M6NL 3QUXB 1ZXQA 3GMOA 2A1WL 2ZNXA 1J0YA 3LN4A 2HFEA 4PJFF 1E4KA 3WNMA 1MJ8H 1WIOA 4TOYH 3RP1A 1AGEB 1P53A 4NFDA 1CFVL 1JI2A 1F4WL 3BWAB 1SY6A 2FJHB 4QO1A 1XCTA 2SEBA 2JK5B 2NY3C 3MA9H 3RHWK 2Y5EA 2EC8A 3QCTL 3EYFB 3TYFB 3C87A 4HIXL 4NZTL 3QDHA 5GJTH 3B9DA 3WIIL 1V3LA 1CDCA 1X5LA 1NC2B 2DM7A 2Q7NA 2X70B 4OZHE 3BP6A 3KS0J 1AGFA 1GHFH 4YAQA 4GS7C 4EZMA 4X4ME 3ZE0F 1WZ1H 1ZGLP 5F7EL 3GSOA 3SQOH 5GZOD 4LAQH 2Z4QA 5TFSL 3IFNL 5TH2B 4YE4L 4G9DB 5H35A 1IZKA 3LZFH 1WT5A 5GIRB 3O4LE 5I1CL 4YFLI 3CMGA 2FH8A 3D39B 3RWIB 5C8JA 1K8IB 1HOCA 4KKAD 2IJ0C 1RZJL 2F5AL 1J8HE 1YEKL 2Y7QB 1PY9A 1TXKA 4R4FL 1F4YH 1DBMH 2I27N 3MRNB 4X6CA 3JV4A 4LCUA 3KR3L 4RMUA 2J6EL 5DT1H 4X98A 3QDGB 4IJ3C 4QHLA 1XF5B 2DLIA 43C9A 3HLAA 4TNVK 1Q0XL 2XYCA 2GCYB 1RURH 2AJ3A 4AL8L 2CDGB 3RTQC 3OF6A 4G43B 5C0EA 3FJTA 1MRCH 5JNYA 3FQXB 3WO3B 5F3BB 1EMTL 2OTUB 4QWWC 5IV2B 3G5ZB 3P0YL 2DIJA 2R2BA 5HJ3A 2ZOKA 3IF1B 1ULVA 4PJEF 3U36A 2JJVA 5LQBL 15C8H 5CLTA 4ZTOL 4X7SL 1NFDB 3OKMA 4OZGA 3RJDA 3VXQA 3BDYH 5I1AA 2W60B 2P5EA 5HGDA 5HHQB 2WIMA 2NX5A 3MV9D 3BP4A 5DUML 1A8JH 3RUGA 1U8LA 4EKXA 1MFEL 1Q9WB 2NZIA 4UT9H 3T0WA 1ZOXA 3MBEB 2BRRL 5IBTL 2J8UF 4JY4B 5T3ZE 3DPBA 4Y5VA 3D3VA 1SYVA 4TRPH 4ZNEA 2Q8BH 25C8H 1M71B 3VXNA 2UZIL 2WQ8A 2X7LA 2XN9B 1MCPL 2V5MA 2X4PA 3OKOA 4CU7A 1N0LA 4I5BA 2XN9A 4GRLC 3TIDA 4HX1A 3K1KC 4RBPK 2A83B 1FORL 4ONFH 2DLTA 5E5RB 4XT1C 3ALWA 4PRIE 3STZA 1C7SA 4ZAKA 4JHBA 1CXKA 5HYFA 3LRSA 4IDJH 4P4KD 5JPMA 4Z95H 4E0RB 1G9MC 1RV6X 3ARSA 3KWWB 3TYFA 3BUYA 1I85C 3M17B 5JW4Q 1BZ9B 3B5GA 3O0RL 4NC2B 3CNKA 5IB5B 3BP5A 4JG0H 2CLRB 1M6OA 3E6HA 4L4VE 4KI1A 3I6KA 1UGNA 4Q9QH 1PX3A 2UWEB 4AG4L 4LSTL 3W11C 2ENYA 5HYJD 4Z7WE 4LVOC 3ARDC 4NOFA 1C7TA 4C56D 1HHKB 1S7XB 4ZOEA 2R29L 2XRAH 1S7UB 2P5WA 4K7PY 1HEZB 2P44B 1RZKC 4YC2C 3U4BH 3S8WA 1KT2B 4X8JB 1ETZA 5I1HH 5K9JL 1J1OH 1P6FA 3F7YA 4HXAL 5C0RL 4XP6H 2CIKA 2J1KA 4TSCL 5DA4A 3MCLH 4M9PA 3MNWA 2NW2B 4ZOBA 5IKCA 3PWPD 3MRNA 4X6CB 2R23B 4E41D 4RAHA 1UH2A 5F9JB 1D5BA 3WLBA 1BQUA 5E5UB 3MYJB 2BNRB 1BJ1J 3I6GB 3BGFC 4TNWK 1YJDH 3UZEA 5IMKA 5CUSL 3IFNH 3UROR 4HMDA 1L6XA 5C0BB 5C0CE 3HPJA 1N0XL 1WFTA 1EO8L 2GJJA 4NZRH 4Z78A 5K9OB 2E5EA 2PW2A 3EKCA 4CN4A 3D0VB 1TPXC 1LE9A 1VFAB 3O3AA 1UWXH 4GW5B 3Q5YA 3PL6C 4FQLH 1JNNH 1G9NH 1G7JB 3F7QA 1C5BH 2EDQA 5GGSY 2B39A 3KPSE 4ZUVA 2NXYB 4LPWA 1SMAA 5EOCJ 3MREA 5ACZA 1VEOA 3GMPB 3KR3H 3QCVH 1BIIB 1JI1A 3EIFA 4JY4A 3ARDD 3GB7B 1YUHA 4HGWB 4MDIB 4M9OA 3B43A 1KIPB 2VNCA 4N0CD 1DQMH 3VGDA 2R0WH 4WFGD 4J6RH 2HTKD 1FNLA 4V2CB 4BQ9A 5E70A 4I5BB 2CO6B 4G8GD 1IGFL 5I1LA 1T21B 4KFZC 4JDVA 2AJSL 2WQRA 2D7TL 3KJ4C 4NSKA 1W2KT 5E8OB 3SY0B 5DJDB 1YEJL 3REVB 1DLFH 1MJJA 1WBZA 3ARGC 3KPRB 3QUMH 4ZAKB 1CDBA 1UEYA 5FA3A 1KJMA 4LSQH 3MACH 2MFNA 4OFDA 2E8YA 4PJ8C 1G6RA 2F54A 2PW1B 3G9AB 5TDPB 3UO1H 1SJHA 2QHRL 4ODHL 4UU9A 5E08H 3JSSA 3VGBA 4WTZA 4A6YH 1QVOB 1ADQH 2AJZA 1G6RH 2R0KL 4HK3J 1UKQA 2W9LA 5F9OH 4HKXB 5J12B 3DXAB 2FX9H 5IJKA 4IRSA 1ZGLB 3VXPA 3K0WA 3WKMH 1A2YB 2X4NB 3QEQD 5L2KD 2QQQA 3LPFA 5J12C 3VFGL 4YEFA 2YPLE 4GUPA 4PJ7B 3U7WH 1KTDB 5TQ0L 4YDJB 4XXDA 3L95A 4X7TA 4IRZL 5J1AA 5E8EA 4WIQA 5I66A 1TPXB 3GDBA 5D6DA 1LE5A 1AGCB 2WAHA 3PGCB 1AC6A 2DQHL 3BXNA 1T6VN 5C09B 1CGTA 2VXSL 2GK0B 1GGBL 1U8IA 2CH8A 1ROWA 3TN0D 5HHME 4LLYA 5JOPD 4HIXH 1KACB 3U7AA 2X9YA 3TVMC 1RZJH 1LO4L 1CG9B 3QDJE 3P2TA 1KB9J 5EDXA 4ZS7L 3KPOB 4Q2ZA 3M8OL 1NGXA 1JNJA 3DUUB 4RA0C 2CLZA 4OFPA 3BHBA 5F7EH 5I2IB 1JHTB 4U6XB 4YDLC 4JAMB 4QTHB 1IAOB 2LABA 4O58L 1ZA3B 4Q0XL 5FOBB 4P46B 3TEUA 3HPJB 3CSYA 1TJIH 3D9AH 1BGXL 2DQUH 4R0LA 3O8XC 1MH5A 2DM2A 2VLME 3SBWC 1DQDH 3NZHH 1NQBA 3NFNB 5GS2H 1JN6A 4K7FB 4YHIB 4ZFOB 4BH7B 2V5SA 1G0DA 4AM0A 5KSVA 2GITA 2WWKT 1TCRB 4UT6H 5LAXA 1AXTH 1OP3K 3BZEB 1NMAH 2VISA 2E9IA 3IETA 4M3JA 2BHZA 1EX0A 1AQDB 3BSZL 3ALXA 1MHCA 2X1QA 1S9WB 5M94B 1MFBH 2FYYA 1MCKA 1U3HA 1MIML 4NNYA 3ULVD 5IBTH 2A9MH 5FF6A 4XAKD 1G6VK 2BXYA 4P4RA 3GEWB 1E6JH 1Z2KA 4X7DC 4YXKH 1MRCL 3TPKA 2YD5A 4JFZL 2ZUWA 2VE6A 1EZVY 3W0WB 3ESUF 5I1LB 3SGDI 2WUBH 3EJZD 3EYSH 2P45B 2XTJB 1FYHB 1CXEA 2D7OA 1G84A 4ZTOH 2V9QA 3T1FB 1XIWA 2I9TB 1LGVA 2X4SB 4QHKJ 1DN2A 4XCEB 5IWLA 1CDJA 2FECL 5J6HA 2QQKH 2GJ6A 3BP4B 1QR1A 4BQ8A 2PW1A 5TDPA 3UPAA 4ZSOB 4Y4KA 3IDNB 4N8VG 5GRZA 4R90L 4ENED 5H2BA 4PTTA 5GHWL 2CR3A 1G7MA 5JIKA 4KRPC 3FKUS 4L8BA 1MRDH 2D4DA 4XP4H 3RNKA 3RL1A 4GT7A 2DLEA 5HI3C 5KVMC 2FRGP 4WO4C 5J9PB 1A6TB 2Y6SD 3I2CH 1UM4H 1PKQB 1YY8A 2AJUH 3QPQC 4J3VA 4QCIB 3PQYE 4Z7VA 4NT6A 3RY4A 4L29A 3VFTB 4K55A 2J4WL 4NQDE 4G5ZL 4ONFL 3N50A 4GBXD 2V9RA 1FZJA 3BXNB 4WENB 2ADIA 1LE5B 5HGBA 2NY7L 3D3VD 1WK0A 3EAKA 1CN4A 1QA9B 3I9GH 3NAAL 4HWEL 1EEZA 4F3FA 1HHIB 4ZS6C 5D8JH 3VCLA 1NJ9B 3RWGA 4F37F 4D9QD 3VWKD 3DBXA 3T2OA 1CXIA 3H9HB 5L2KE 2E3VA 3T65A 2J3SA 3MA7B 3TA3C 5FKPA 1ZLWK 3BPLB 4NKMA 1DN0A 1ZKAA 1DL7H 4IRJA 5F1KC 4OCWL 1IEAA 1MI5E 1CDUA 3QH3B 5IJKC 2OYPA 1YMMA 2PTUA 4LSRL 4WU7B 4MA8L 3MJ9A 1XR9B 3GMNB 3C9NB 4P4KC 3S3JA 4KZEL 2HJFB 3SDAA 2A6DA 3LIZH 2UUDK 4PRHB 4OIAA 4X7FC 4YDIH 2XXMB 4XPGL 3AS0A 1FC1A 4JDTL 3SJVE 4PRHA 1TLKA 4FN0A 1YMHA 2AK4E 3FMGH 5FYJD 1RAMA 2MPAL 3KJ6L 3KPQA 3BH8A 1AFVH 5D2LA 5HYJB 3FQWB 5EUOE 3BH8B 1Q72H 4OCRL 4FQCL 3HR5A 3HZYA 1BLNB 1SM3L 3VH8A 4OF7A 3ZHKA 1PQZB 5IW3A 1BD2B 4PREB 2BSTA 1LO5A 2IFGA 4NO0A 1SBSL 4IBLT 4R26H 1LEGB 3VRIA 3PL6A 1CL7L 4HKZB 5GISL 5I30L 4JPWH 5L7XH 4R9HA 5BV7L 1KTLB 1Q9KB 4CN1A 3E2HC 2YN5A 2FEEI 5AD0B 2FECI 1JGUL 2DQJH 4GFTB 4RGOL 1FFPB 1NMAL 2R2CA 2VLRA 1DUZB 4E42B 2ZUUA 3UO1L 5FKAA 3GBLA 4X7EC 1G9MH 5LKNA 3C6SB 4DKAA 1A1NA 4X6DA 3UTSA 1IBGL 1G7IB 5DEFB 3ZTNH 1LQSR 5L8KB 1ZHLA 3QHFL 4CJ0A 4Y5XB 1E6OL 3C2AH 4MSWA 4Y4FA 1ZWIA 2XQYG 5C0DB 3VXNB 2X1XR 4OUUB 4IRSD 1JGDA 4Y5YB 4Y4FB 1FE8H 1T0MB 3MV7B 2NY0C 1X5HA 4Z7VB 1DUYB 3H7BB 2IAMA 2XIDA 1V7NH 4P4KB 2PCPB 5LXGH 2EIDA 4OCXL 1D3CA 3T2NH 3QUYA 3C5ZD 1JPSH 1UYWH 2ZUXA 3VXTA 5JPMB 2FX7H 4U1SB 5DLMH 3WS3B 5ALCH 3MOAH 2HFGH 1RUPH 4EN3D 1OLZA 4MXWL 1HI6B 3MODH 2ZUQB 3MRLA 1OSZA 1DVFC 3RWGB 3QNYB 4ORGB 2DLFH 2BSED 3HZMA 2FHBA 4ZOCA 1P4LA 2NTSP 1DQLH 4NO2B 2LU3A 3S34H 4DCQB 1WCQA 3QDJD 5GGUA 2Z4QB 5DMJB 1HH9A 4Y1AE 3EYUH 4NUJB 1RZGB 3FQTA 3SBWA 4OFYD 5ID0B 5DQJB 4OAWA 3HZVA 5D93B 2W9DL 3ZHDA 4C4KO 4LDOB 2CJUL 4F2MA 3ARFA 2DQFA 1NLBL 3RTQA 4JKLA 4LHUG 4WGWB 3O41A 3O6LH 1QD0A 3B2UC 4FP8H 2VLKA 4K2UL 2IH3A 4MWFB 1INEL 5JA8B 2AK1H 1IC4L 2G75A 3VFPA 3WFHA 3TBWB 3M8OH 4UOW1 1MHHB 5F71A 1M05A 4LHQB 4IRSC 5EU5A 4Z18A 3TJEL 4CU8A 3N9GH 4B7LA 4OZIB 1PYWB 1RUKH 4M61B 1MFBL 2C3HA 4HAFA 4WUKL 1HILB 4PB9H 5DVMA 3GSNL 3VXSB 3QQ4B 1IGMH 2J8UB 5E2JA 2JB5H 2XQBL 4KMTH 2DQUL 3W5MA 4ZO9A 3C6LA 1M4KA 2PR4L 5DYOA 4QT5A 1AKJA 1VFAA 5DD0L 1K85A 1XEDA 5AD0A 5LWYH 3WYRA 5IOPB 2IGFL 1AE6H 4HEPG 2R2BB 5HJ3B 2PO6C 3NCEB 1W0YT 4IS6B 4S1DC 4PS4L 1QSEB 2JF1A 4NN5C 2Y25A 4FQ1L 1QSEA 1CLCA 5F7DA 3LKSB 4R7DA 4NN5B 5F7HA 4JHWH 2HKHL 4ETYA 4R90H 1YUHB 4LASL 4MB4A 4W68A 2EDEA 3BISA 3RWJA 1OHQA 3QPXL 4GXUM 3FT2A 4JZNB 5EU6A 2GUOA 4YEEA 4QYOB 1SBSH 1MI5D 1UC6A 5DMGD 2DF3A 3KPTA 5D7IF 5E6ID 2J8HA 3KGRA 1NPUA 1UKSA 5JQ6H 4JRXD 3O3EA 4W70A 5GISH 3ARED 1JF5A 3CDGB 1DQJA 4L3ED 2CRIA 2EDDA 2NX5E 1JV5A 1TJHL 3D0LA 3QWRA 4PIRF 4PJBB 1BOGA 4YHKL 3SKNA 2NR6C 5T5FH 4YBLC 4XHJC 3TPUA 4BJLA 1A0QH 5IHZA 1DBKH 1QR1B 4PG2A 3ZYOA 5IMOA 2B8OT 3DOSA 4NKDB 4OD2B 2BY0A 3LQAC 4JN1L 3D69A 3SDCB 3DXAD 4D3CH 2DB8A 3GBNL 4L4VD 2AGJL 2H32B 5A2IH 5KAQF 2VLLB 3RIFK 4D0DA 1NBZA 5C7XL 3U82B 2PKDA 4I3RL 3VXMA 1S5IH 4NQVB 3CXDL 3L3JB 3HE6D 3VGAB 3FT3A 4TSAL 1A14H 4BK5A 4HMCA 3SDAC 4L29B 3VFTA 5CP3H 1RZGA 4MAYC 1LNUA 5FO7B 3FFCE 5C6TL 4HKBA 4RMQA 1QRND 4X7TB 4G6FD 1K2DB 1UWEL 5ID1A 2ADIB 4P5TA 3WFBL 5B39G 4IOFD 5DC0A 5E2WL 2QLVB 4MQ7A 2FJGB 2WW8A 1AGDB 4OF8A 4PJ8B 3MNZB 1E28A 3NAAH 4OLYH 5GSVA 5C09A 1NCDL 1DBBH 1FN4B 3MRJB 4M93C 4KI5C 2X2YA 3RX8A 4JM2D 4Z7QF 4U3XA 3MR9A 3I6LE 5EO1A 1P69B 4J1UB 3VFMB 2IAMD 1OGAD 1I7ZB 1TFHA 3AREC 3EDEA 4IRJB 4RAUB 5DQDL 4C57C 1VFBA 2X40A 3M07A 4W6XB 1F02I 1ZA3A 4TSBL 1JWMA 4RQQA 5FDWA 4S1RH 3LQZA 4NRXB 2VDPH 3GI9H 4O2FB 1F4WH 3G5ZA 2FEDD 3DX7A 5FXCH 2FBOJ 5HDLA 5ITBH 4IEFB 2VN4A 1UB5B 4M8VA 3SOBH 5L7XL 4ZS6D 1K6QL 1CLZL 4G6JL 4X99A 2OTWB 4OB5L 3MUGB 3PNWA 2R0LL 1YEGL 2NTFB 2VR9A 1JK8B 4ORZC 2GSGA 2NTFA 1KEML 1CD9B 1DBML 4D8PA 2DDQL 4UNVA 3ZT7A 1WC7B 1WFNA 4WFGE 1U95B 2OQJA 2VABA 2APTA 4NNPL 5HHOD 4TTDD 1L9NA 3A6BL 5EBWB 4KKBD 4JFED 4RBPH 1WGOA 1P2CA 1KIPA 3HPLA 1I7UA 2KBGA 4Z7NE 3DX9A 3I85A 4DKFL 1MCRA 1KJ3H 5D70L 3BD4A 3N85L 5I30H 5SWZA 1ZLVH 4B5EA 3MRGB 1D5MB 1G7QA 1YNTB 4JJ5B 2Z31B 3EOYG 1KOAA 4PJ5B 3DV4A 3HHRB 3MRFA 3QEQB 3UDWA 1DFBH 1RI8A 1J9CT 1MIEL 2X4RA 5EBGA 5KVGL 4OCLC 5IW1A 2NX5B 1VEPA 3BJLA 4N8VB 1J1PL 3NA9L 1HN1A 2V2WB 2FX7L 1QFPA 5IMMA 5GPRA 4PV8B 1JGLH 5IVXA 4IMKC 3NCCB 4JZOB 5GS0H 1T2JA 3ZE2F 5F6HJ 4MXVF 4KXZI 3DRTA 2CLVB 1D5XA 3LN9A 4NUGH 2DQDH 1NBQA 1RZJC 1FL3A 4M1GL 1FCGA 4OFVA 5J9PA 4PJDB 1N4XL 4LPXA 4RFEB 5EOCH 1IM9A 2X4PB 4M7JL 4M7LL 5C0BE 4NO3B 1TJHH 1HEZA 4I9WE 3UTSD 5I9QC 1LNUB 5LXGL 3SKOB 1T5XB 4F15B 3S5LG 4XVUC 3WS6C 4DUXA 5ICZA 1AGDA 3INUL 5I1DA 4WFEE 3ARVA 1EXUB 4PJCE 1U8PA 5ALCL 2OJZL 4MNQA 4UT9L 1ITCA 3SE8L 2H9GB 5L0QC 4XNQA 1QA9A 4DTGH 2AK1L 5GGRY 3LB6D 2YMXH 2EYSB 4WV1B 2J88L 2VN7A 3P77A 1JRHI 3I6GA 5T1LB 4KJWC 4JQVA 4XPAH 2E7LA 5IB1A 2F53E 5ISZA 2ZUQC 4KQ3L 3KNBB 1BJ1H 3IS1X 4P5KB 3I3DA 4UV4L 2AABL 4KROC 4WFFE 4PJIA 4WU7A 4Y19D 3CVHH 1NCBL 4XGZB 2PO6A 3IDYB 3AXLA 5C86A 3K3QA 1P7HL 2PR4H 3O6LL 4ODSL 3B83A 3B2VH 3NCJL 4L4TA 4GJTB 5CJBA 3R06B 5CSGA 1D5ZB 3GMRA 4HCRH 1EJ6A 2KUTA 5SX5K 3TBWA 5B8CC 1JF6A 4OZ4B 3ARTA 5E6YA 2Y5TA 5CCKL 5HDQL 1KCKA 1I4FA 3P11H 2V5RA 4F57H 1EFXB 3QDGA 5CUSH 2CQVA 4OI8A 4PD4J 4XP5H 2A74A 5DRZA 3MLYH 2ARJB 1IAIL 3DROA 3QG7H 1PQZA 1UA6L 3AS1A 5I74B 2IC2A 1FRGH 5EU3B 4CVWA 5CEZH 3X3GL 4XPHH 1ZANL 3GJEA 4PJDF 3SCMC 4F58H 4XI5C 1K9TA 5F3BA 3EO1A 1ACYL 3FO1B 3MGOA 3PJSB 4UB0H 4KKCC 1T22B 4JRXA 5C0AE 1NSNH 5M95B 4K3HA 3FO9B 3AM8C 1OAQH 1YDPA 4POUB 4MD5B 1ZGLM 4CNIB 4LLDA 3C8KA 3QXAA 2E7BA 5F7YC 1KEMH 4C83B 2C7UA 3GMPA 1YJDL 4MQXC 4P23C 4ZSOA 5KVEH 1CIUA 5DEFA 3ABZA 4WHDA 5DD3H 1SBBA 3MBEA 2WP3O 2AGJH 5BJTB 1PG7H 2X4QA 1DQML 1IILE 5GJSH 1NAKH 3OAZK 1GIGL 3HC4H 4I3RH 4Z0XB 1RVFH 4U4BA 3I75A 2CUMA 4XB8A 5FO9A 3AY4A 1JGVH 3WLWC 4NO3A 3MLWH 5C0IA 3HMWH 4FA8A 3S37H 3I02B 4P4KA 5F9WB 4QOKE 5DGQA 4FFWC 3BZ4A 3C08L 3QCVL 4HAGA 2YUVA 3MLZH 3VRJB 3FZUD 5HVGB 3D18A 1RD6A 3FB8B 1RUAH 5GRUH 3U4EB 3WO4C 2LE9A 2AEQH 1MJ7H 4KQ4L 3JWDC 3PWVA 1RJCA 4LVEA 5T3XE 3AGVA 4PY7B 4QY8A 1OARL 1B0RA 4RX4A 1QLEL 3BWUC 1J12A 1LO2L 4YXHL 5E1HB 4XBEL 1CQKA 3CFDB 1T03H 2EDNA 1F4AA 2FBJL 4NO2A 1A7RL 1IEAB 4PJGF 4HFWB 5DQ9B 3U46B 4R3SA 3ARFD 3Q6FB 4EDXA 1S7UA 2P5WB 3RNQA 3E6FA 1NMCC 3LMJL 5DHXB 1OT2A 4LRNH 3SDAB 2BOBA 1ZV5A 4X4ZA 4M6OH 4YBHA 2DL9A 1OAUH 1HCVA 3L5WA 2BRQA 2ZCLL 2VXSH 4WI6A 1NANI 1ZS8B 2R4RL 1CXHA 3VDCA 1V3KA 1ZLVK 3W9EA 3L3KA 4PJ5E 1H9VA 4MX7B 2JJWA 5EU4B 4HJJH 4I48B 2VLKB 4WUUA 3UYRH 4ZDHA 2YUXA 1S9KC 3EZ8A 5IVXF 1HHJA 5BZDA 1MHCB 5AAMA 5EU5B 1AO7B 2WBJD 4GG6B 4NZUH 4KRPB 5I8KH 1U8QA 2EXYC 3VD5A 4X4XB 4LLAA 4TSBH 1Z9LA 3AU1A 3IJSA 2ZSWB 2JB6A 5CEYB 1IZJA 2FO1A 1N26A 5LGHH 5JPNB 2ZKHH 5ESVA 1NANH 7CGTA 2AXJA 3LKNB 3LEVL 3U36B 2R1WB 4HWBL 4I13B 4OFIA 5A1AA 1JK8A 5DHVA 3UTQB 5DI8B 3IXAA 1YEDB 2Y23A 1K5NA 4Q9RH 1A1NB 3MCKA 1MEXL 4OI9A 2G5BA 3D25A 3BSZH 4G9FE 2JCCE 4WVRA 1WISA 4KDTA 1UT9A 5KAQG 1H15B 3NFPB 2RCSH 3TN0C 4Q0XH 2GUOB 1U8HB 1A3LH 4P2OA 2W07A 4NZJA 3UC0L 3X3GH 5TF1H 1L7IL 3BVNB 5E9DD 4K7PH 4GO6B 1C5CH 4Y2OA 1FZKA 5C6PB 4PGDA 5K9QG 4BQ6A 4M7JH 4X6DF 1IAMA 4FQJH 4LHUA 4NM4H 2P8MA 1XGTA 2AEIT 1ZHBB 4UT6L 3ESVF 1KJMB 1X3DA 3O6KH 3HUJB 1XGYH 2L7JA 3NCMA 4CN6A 3PHOA 2D31B 1QR4A 3I50L 3LRSB 3RPKA 3V52H 5DJ0B 1J88A 4OKVB 4XPFH 4Z7NF 5SX4H 4S1SH 4HC1H 1I75A 4JKWA 1A02N 4HLJA 2HKFH 1MFCH 1X4YA 4DGYH 2BJMH 5EC2A 4HS8H 4UIKH 2NY3B 3R0MA 2VKWA 1UXWA 4YHYB 1KGCE 1B6DA 4HC1A 5KOMC 2DKUA 3OJDA 1C1EH 5KVDH 3LV3B 3PWPB 1YZZA 2EDJA 1XH3B 2QSCH 3K8KA 4KVNH 5CJ8A 5E99H 2YRLA 2DYPB 3QEUB 5FYKU 4GS7B 1P84J 3T3MF 2ICWA 2HA1A 2YD7A 4LF3A 2WLZA 5C0AB 4UV7H 2Z35A 3HMWL 2G9HA 3QUKB 3TCLB 1ZLUK 4JE4B 4U7MA 4RRPA 1SEBB 1PSKL 1U8PB 3GMMA 4JM2B 1MUJA 1S8DA 1WWAX 4EUPB 4LLYB 4M1CC 4HS3A 4N8PA 3G08A 5IEHB 2ADFL 4W6YB 2MHAB 3GHBL 4CU6A 5D5MB 1J11A 3UBXI 2J2ZA 3HR5B 3QIBD 1TITA 1OSPH 5J56B 1H3GA 3FOMA 5A40E 4ODWA 4RAUA 4LVOB 5DMKB 3SGDH 5IMKB 3VRLE 2BNQB 3ZKSD 3VXUB 4LPCA 2B0SH 2VSDA 4NRYB 5HVHB 4ENEC 4OZFA 3K80A 4KRPD 4I0PB 3LQZB 4NRXA 3I3BA 3TZVB 1UA6H 3KPNA 1DZBA 4YXLL 2NY7H 3ARQA 3KPSD 3W11D 1HCFX 1YYLL 4OLXH 1U3ZA 4HPOL 1B0GB 2YUZA 3FMGL 3VXOB 5BRZD 1SYSA 4JFFD 5DHYA 1I1AB 3NVQA 1Z0MA 4WCYL 1FO0H 4PGZA 1BP3B 2VXUL 5CEXA 4ZUVB 5GZOC 4KROD 4Z5RA 3S36L 3BMVA 2FIKA 1CLOL 2I07B 5EBLA 4XCNB 2MMXA 1MLCA 5F1IA 1PAMA 3SDDD 1K4DA 4GRWH 1SEQL 2WUCL 3MOQA 1TETL 4P2QA 1T2QL 1UJ3B 2AJ3B 4K94L 1FZKB 1YN7A 5I8OL 2VE6B 5IFAL 4GQ9L 3MLTA 3EOBB 2HRLA 1HSAA 2AEPL 2ICES 2W65B 1RIVL 2R0ZH 5JW4M 1A6VH 4PTUB 4HUKB 3DMMC 4MLSA 3UTPE 3X13A 1ES0B 5D2LE 4P5TC 1YEFH 4NJAL 1ZLSH 3L7EA 3UAJC 1FFNB 3HS0B 4HW6A 4JG1L 2X4RB 4HBCH 3WXWL 4YHPB 3NIFF 3K7UA 4H88H 1GAFH 4QRPB 4LLQA 5TPWH 5HHVL 3C6LD 1IJ9A 3EFFA 3ZL4H 3QXDB 4NJ9H 2HJLB 4BSVB 4IRSB 1ZGLA 1RZ7L 1U3JA 1S7WA 4R6UA 4RMRA 1IC1A 1ZWIB 1S9XA 3VD9A 2GSIB 4BZ1H 1A7OL 3TWCL 5HVHC 5FA4B 5ID0A 4DZ8B 4NT6B 1E4WH 3U83A 2Q76B 3HI1A 4GUPB 3H6JA 2VDQH 5C08D 5A16A 1LHZA 2MQ3A 3H7BA 3HI1B 2FL5B 3TIDB 3BIBX 2QHLA 2OR7A 4YWGL 1LEKA 3IYLW 3RY5A 3NZ8B 3CFIC 3T2NL 3L3GA 1EXUA 1VPOL 4APQA 1B4RA 3L3GB 2NY1B 3PGCA 2ZCLH 3MZTA 4H1LB 4WI9A 5GGTL 1NCWH 4XP1H 2H32H 3ARGD 2EDHA 1A3RL 5DK3A 3OAZH 1E6OH 3C2AL 4WHTA 3LDBC 1K8DB 4URTB 5KVDL 1MCJA 3WO4B 1X6LA 3DO7A 4NWTL 2FCBA 4KTDH 2R56L 3O2DL 3PQYB 2BX5A 1Z0NA 4GRLD 5CJQL 4ZFZB 3PWNA 4UOJA 2OR9H 2Y72A 2GW5A 3MV9A 3OKKA 3IB4A 4PJFA 5EZLA 1KULA 4GAGH 1E4XI 3FOLB 1UYWL 1LK2A 4FABL 2IPKA 3ME0A 3H8NA 4JO2L 4JHAH 4G7VL 3GMRB 4YHMH 3FQUB 5HHMD 5ELIA 4LLUB 3LEYL 5ANME 1BM3L 1ZTXH 3DURA 1R24B 3UDWC 4BKLA 2P7TB 3BZEA 2XY1A 4F7CB 3MUGA 5E56A 4R7DB 3OR7A 1WEJH 4L9LA 5C70A 5I8EB 4H8WC 1PGRB 3U4AA 2VDKL 5EC1A 2H8PA 4L9LB 2RHEA 4QXUL 3AU1B 5MEOB 4D0CB 5C2BH 3VXUE 2Z93B 5FOJA 4ELMB 4XNMB 5CJOH 3FFCB 4NQCD 5KSBE 3QYCA 4M62H 3W5NA 4G8EA 4QT5B 4K7PL 1D6EA 4FFYH 1AQKH 3D0LB 3FO9A 5D96B 3DVNA 1ORSA 4KKLC 5BO1H 1G7JA 4JGMA 1JHKH 4OM1H 2KQMA 3C09C 3UTQA 3ULVH 3MNVA 2P47B 3TBVB 5HHQA 1GZPB 5CEZD 5MEND 2WINA 2C7UB 3R0NA 3DMMA 4UUJB 4XPFL 1JP5A 1LP9E 1RUKL 4NDMA 2AJZB 1F6FB 4Y19E 1Q9OB 4QXGL 4D0DB 3P4NB 1A3LL 5CIPA 1U2HA 1BFVH 5L9DL 1OW0A 3GK8L 1MLBB 1P6AB 2EIZA 4YZFE 5I73B 2A0LC 3VWKB 4GAYB 5L8LB 3RL1B 4Z7WA 5B3JF 3QUXD 4PB0L 1BQHB 5CINH 4YDKH 1IGTA 5C9JA 1UZ6E 1U8OB 4D9LH 1KENH 1MHPH 3MV8D 4W4NA 3G6DH 4I0KA 1CQYA 1BOGB 2VDLH 5T5FL 1MCCA 5CKAA 5ADOH 1JWUB 2FJGA 5C08B 2G60H 2LVEA 3LKRA 3REWA 2HT2D 3JTTA 3I02A 2H9GA 4JKMA 5JIPA 4NQEA 2MKLC 1ZT1A 1UWGL 4NKDA 1KCVH 3BN9D 1P7QD 3IDMB 3KWWA 3ARZA 3S35L 4FMFA 5TE6H 1FLRL 2C1PA 4XX1E 4LQFH 4N0CC 1FO0B 3D2UA 3L3DB 1T83C 5T3ZD 2Q1EA 3LV3A 2F53B 3SE9L 3VXMB 5GGUB 4G42B 3R8BB 1UFUA 4YPGA 1MVFA 3OV6A 1VSCA 2AW2A 2IADB 3LS5H 4LCWE 3S4SG 3QUMB 1FORH 5BZWA 3GJFB 1HHGA 3GSRB 2G9HB 3DX7B 5JOFB 5HI3D 1JYNA 4W4OA 5F9AC 2B2XH 1NGYB 1ONQA 4PG2C 1MCWM 5EOTB 3ZZ1A 4JFQA 1JNHA 2V2TB 4J2XA 3V5KB 2CGRL 1CU4H 2F5BL 3TO4D 2MKWA 3WNNA 2YPLD 2A0LD 1YNLL 1AQDA 3SGKA 3EW3B 3MLPA 2Y5TB 4XHJD 3RGVC 4LK4A 1A6UL 5KANI 4K23H 3D48R 4HIJA 1IARB 4OF5A 5HPOA 1KBGH 3FFCA 5C0FB 3DARA 1UWEH 3SE3A 3O2VH 5AWNH 4Z78B 5EWIL 2IH1A 3JUZA 3V5HA 2X89A 4WY7H 5FGBC 4KK8D 1UB5A 1DBBL 3MGOB 4BK4A 4YHML 3V6ZB 3SPVA 4HUMB 3VFUB 3ECBA 1UACL 1X4ZA 2X42A 3G5XA 2EYRA 3MRHA 1GZPA 1QFOA 3D6GA 4MYWB 2AXGB 5ETUA 4GG6F 1XF4A 3OF6D 3EJJX 3TVMB 1Q9LA 1FGNH 5ETUB 5D7SL 1DR9A 5L6YL 2KKQA 3S37X 4LLMB 1W0VA 1RZ8B 2D3VA 2W0FA 2VUYA 4KV5F 3GI9L 4Y4HB 1PZ5B 1RIUH 1QYGL 1O7SA 4G8IA 3O8XD 4K94H 5CSBA 1I7RA 1FG2A 1KJ3L 3LN4B 1DSFH 5KSBB 1CVSC 4Z0XA 2BVQA 5DJ8A 1XF3A 5CWSA 2VITA 4LHUB 2Z0BA 2QADD 1BQHG 1KPVA 1FL6A 5ICYA 1G9NL 4PGDB 1WF5A 3OQ3B 4BFIB 4YE4H 3V0WH 2WBJA 5E1AA 3LS4H 1YEGH 5HTSA 5CEZE 2V7NB 4LVHC 1FAIH 5E2TH 4TVPE 4HBCL 1U8MA 2DKSA 4B7IA 1YA5A 4LNRA 3U2SA 3IDNA 1HH6A 1JHLL 4U1SA 5FCSH 2YD2A 4BH8A 5J89A 2HYMA 4OSUL 1WJ3A 3AREB 3N1PC 4IRJC 1OM3H 5F6IC 3FAXA 5F1NA 2N7AA 2A38A 3D87B 1A9BA 1A7NL 2VLJD 1OAYL 4DW2L 5CINL 4YDKL 2AJSH 2EDFA 3DI2B 2R56H 3O2DH 4G8GE 1DANT 3TO4A 1QSFE 2VJXA 2JE8A 1CE1H 3S4SB 1CR9H 4P5TD 2ATKA 1OLLA 3RNQB 2QQKL 3F12A 5SV3A 6CGTA 2YBRA 4XX1G 2XG4A 1A6AA 2OL3B 2YPVL 3MRIB 2H2SD 4HQQH 2Y06H 3QDAA 4JQXA 5EOTA 3T77B 4ZNCD 2VDOL 3GM8A 5IG7B 4F7EA 3DVIA 4NQSB 2DOCA 3TYGH 4PJXA 5IKCB 3LHPH 1RY7B 5IFJA 2E7LC 3LQMA 1KTRL 5I1GH 1K3IA 3C5ZC 3P40A 1H0DA 2XWJB 5I16A 1BLNA 1LP9B 3CUPA 3QPQD 4QF1A 2YSSA 4KZDL 1TZIB 3LAFA 1B2WL 3P0VH 5C0BA 4HPYL 5AZ2L 2R4SL 4M61A 5DFVD 3MRMB 2N56A 5I15L 3OHXA 4PJIB 4HFUH 5CZVH 1MREH 2ZSWA 3RGHA 5CJOL 4YNYA 3ZDXE 3GUTB 4HUVA 5I8CB 3SE3C 5E6IB 2LTQC 3IF1A 2ARJQ 2DM3A 4DEPC 3NA4A 2DWEB 4LCIH 1T04B 4YHIA 3TBYB 3QFDA 3OB8A 3BX7C 8FABB 2UV3A 1BIHA 4XAWL 4K3JH 2OSLB 4E41E 3MCKB 5DD6B 2KDGA 3BZFB 1I1FA 1FGVH 4K3DH 3MQIA 5GS1B 4PD4K 3QHZH 4Z5RB 5D6CB 5FYKH 2PXYD 4N8CL 1AD9B 5KJRL 2IWGA 5K9KB 1WAAE 1U8HA 5FYJU 5K9KA 5E2UL 4UNUA 1W0VB 2W0FB 4Y4HA 4P99A 4P2YA 1QLFB 2JJTA 3MRRB 3VA6A 1KPVB 1CL7I 4XPGH 1T22A 5DJ8B 3MJ9H 3ZO0A 4RRPG 4ZQKB 1F11A 1G7HB 4TYUA 5D7IE 1EGJH 2NYYC 3D5OF 1AFVL 4NKQB 4KAQH 4UT7L 1N5YH 3HNTL 4U6VL 2OTPA 1XGRB 5E4EC 3P11L 2V2WA 3BDBA 5FHAH 3HS0A 4FZEL 1UWGH 4HJ0D 2F58L 3QSKB 4YC2B 2CRZA 3SDCA 1IAIH 1FVDB 3MPCA 5CIPB 5ILTH 2CLVA 5DTFB 3KPMB 4Q6IB 1P4BH 1NDGA 1FZMA 4P9MH 1T7XA 1WIPA 4ZODA 2WUBL 2IFFL 1N64H 3IDIA 4GBXB 5A16B 3DIFB 4QRTA 5CZKA 4NQUA 4DJMA 2EDLA 3QUKA 3QUZD 2PCPA 2VDLL 2HT4C 1X5JA 3REWB 4WU5A 1OF2B 1Z9MA 5IIEA 2D03L 3SCMD 4R7NA 4GW1B 2UWEF 2GEEA 2AEWA 2CIKB 3EYOB 5IF0B 1UCBH 5CZXD 1NJ9A 4HS3B 5IEHA 3GO1L 4Z77A 3T09A 5L88L 1WITA 2W0LA 2PETA 2BNUB 4U2ZA 4XP4L 1QPXA 2NR6D 4MJID 3HZMB 2O5XL 1N59B 5L0QB 1MAJA 5DD5L 4WDIA 3FO0H 1LO2H 1N59A 4UAOC 1WIUA 2VLKE 3ILPA 3AFLA 3T0DA 1QSFD 3MCG1 3DX8B 1UB6A 4P23D 1MJ8L 4ZFZA 2VZUA 4Y5XC 4GRWB 4XCFL 43CAA 1IGIL 3VWJC 1UCTA 5JOFA 3F62A 5L2JA 4JY5L 3GMNA 3U6RB 1NGPL 3SDXA 4R4BA 4LOUD 1A1OA 1OAXL 1J1XH 2PXYA 3RA7H 3DRQB 3RVXC 4JPKH 2G5RA 3I9GL 2A77H 5EO0A 2E8ZA 1HIMH 1HOCB 3WUWB 1LD9B 4MXWH 2D2OA 1VKXA 4RAVA 2O93L 3MRPB 2NW2A 2EZ0C 2MNUA 4D8PB 4D9RE 3MRPA 1MHHA 3MREB 1JZ6A 4PJHF 1MQKL 4PJ9C 1DTUA 1RK1B 1A6UH 3RI5K 1IGCL 1IKFL 1O0VA 3ARXA 4Y8DC 5EBWA 3S5LB 5I15H 4LSRH 4FQXB 5HGGS 4ALAL 3GSUB 5ANMB 3VRLF 2FSEB 4MAUH 1R3LA 1OL0A 2BSSB 2PNDA 4EI5C 3ISWA 2OZ4L 3UTPD 2C3XA 5GGTA 3P9WB 3F7PC 5IUSA 5IROC 1WZLA 4ZQKA 1JFQH 4KU1A 4IOIA 3LS4L 2AK4D 1FBIH 1RULH 4IOIB 4IIQB 1OY3B 4KJYB 2P5EB 4PGJA 4DKDC 2FLBT 2E6QA 2GKIA 3EOTL 3C60C 4NDMB 4HUNB 4YHZH 2YRZA 4ZO8A 3NABH 2CO7B 3GSNH 1J7VR 4BSVA 1I8LA 3VJ6B 3WEXA 4DGVL 1QEWB 5E8NB 3HMXL 3WE6B 4HUXB 1GGUA 1MCIA 4DZ8A 1Z5LA 3TESA 2NY2C 1T1XB 2GSIA 2WBJC 3G6AB 2CXGA 3IDIB 4MA1C 1LK3H 5ALBL 1T5XA 4S1DD 4YQXL 1CE1L 4PJBA 4ETQA 3V0VA 2ITCA 4APQB 3P4OA 4Z76B 3NZ8A 4PJ9D 2YPVH 3C09B 4B53A 1CXLA 4NQTA 2BCKB 3P4MA 1UJ3C 4XCYA 1KCSL 3WSQL 1JIBA 2F53D 3ILQC 3TYGL 1BEYH 4DGIH 2JCCF 4Z77B 3CH8A 4N5ED 4QRSA 3GBML 3QIUA 3BIKB 4FQHA 5E8PB 3SDYL 2QQNL 1A64A 3F5WA 4OLZL 5IB1B 1T1YA 4LCCA 3BIKA 3QIUB 1UB6B 4CMMA 5JOPE 3JXAA 4HIHB 3L6FA 3MUHL 4XTRC 4BQCA 1PEWA 4DVRL 2BVYA 2V5YA 3G6JF 1V7NL 5DK0B 5DS8B 4HIIB 1YEEL 5DS8A 2DQFB 1L0YA 5DSCA 2B1AL 1MWAB 5DRNB 3BE1L 2IBZY 3RWIA 3U0PB 3WNPA 1A4JA 3R06A 1QTYT 1ONQB 3UPCA 4XVJH 1S5HA 3W2DL 5DF0A 5DDHB 3WUWA 1QSEE 2HH0L 2XPGA 4MB5A 2N4IA 3NN8B 3QJHA 5D72L 3WV0A 1GC1L 4HT1L 3V4UH 3VD7A 1FLTX 5I8EA 3FO0L 5I16B 4LEXH 4K3DL 1AD0A 2P5WD 1FFOB 4PJFE 2IBGA 3O2DA 3SDAD 1MLCB 2FATL 2IMNA 3MV8E 4EVNA 5KS9B 1IC7L 4QTHA 2A9NL 4MZ3A 1QFWM 2Z93A 2HFTA 2ARJA 1A6ZA 3UTTE 1DQQB 1GGTA 4YHOL 5EZJA 3GSUA 5ANMA 4IOFC 5K33A 4NYLB 4OKDA 4JM4H 3PG2A 5DHVH 3EO1B 5K59F 3OGCA 4TUOA 1I9RL 3DV4B 4X5XB 2R2HA 1IC4H 4CRPA 1FIGL 1S3KH 4WO4B 3JZ7A 1WV7T 3K2MC 4L1DA 2XFXA 1XFPA 2DJUA 4Y4KB 2HFFA 1N7ML 1IL1A 1DBAH 3QXAB 4ONHB 4CGTA 1BBJA 3MJGX 2B0SL 4GXUN 1R5WB 3GJFK 3QXVA 3GHEH 1HE7A 2PYEE 4YFDB 4MNGE 4AIZB 1MRFL 4OIBA 1H8NA 1Y6KR 1SEQH 4PJ9A 4LCCC 5HYSB 3PGFH 3KLAB 5KTEL 1DE4B 2EC9T 3CC5A 4ZUTA 5DD0H 5JW3L 3WL9B 3X3FH 4IDLA 1EK3A 1A9EA 1IGJA 1CLZH 4G6JH 4QRPE 2Q20A 1G7HA 3UP1A 4P5MB 1NFIA 5MERA 5AYUL 3MFGB 5ICYB 2AVGA 3IU4L 3BWAA 2AJVL 3RTQD 4MNQB 5CGYC 1GAFL 2YKLH 1F13A 5FM5M 3D18B 3TA3A 1H3PL 1RUQH 5F97E 1CFQA 4NNPH 5DEGB 2EKSB 1FO0A 2HJLA 3F58L 4YX2L 2C1PB 4TUJA 2IALB 4I2XB 3ZE0E 5IQ7L 1BZ7B 3FHAA 5DZNA 3OAUH 4Y4HC 4CADB 5JQ6L 1NC2D 4FQIH 2A2QT 3RU8H 4UQ3A 4G42A 4WEUD 5CHNA 3PWNB 3QDJB 2QR0B 2XWTA 5D1QD 4WW1B 2WNGA 5MENA 2DICA 3ZKXC 3J8F7 3QRGL 4Y16B 1IEHA 5KSAB 3UTOA 3C9NA 1OF2A 1DBKL 1O5DT 4L4TB 4PJEE 1RUMH 4C58B 1AJ7H 1I9EA 2BY3A 2Z31C 5B8CA 1MUJB 1S8DB 2W9EL 3CSPA 1UCBL 1KCSH 2CPCA 1TZGL 1T89A 1F4XL 1D9KD 4PRID 4L1HA 3RKPA 4JQVC 4ODBD 3FCTB 1D5BB 4Z7QE 4OLZH 4KVCL 2FJFB 1KIQA 4G6MH 4DFIA 1AO7A 4UOW0 2X44D 4D0CA 1MFEH 2A74B 5DRZB 4QNPE 2GJZB 1NUNB 1TNMA 2X1PA 3VFOA 3E8UH 3VDAA 2GCYA 1Q1JH 2OR9L 1CT8B 4YUEL 4UINL 5L2JB 5EZLB 4HSQA 1NGPH 4R0LB 4P2RB 3TN0B 4J3UA 4J4PD 3TH4T 2XKNA 4TVSa 4GW5A 4X6CF 2A6DB 1I1CA 5BRZE 3OKNB 3DYMA 4ZO6A 2R1WA 2BVTA 3A6CL 2NXYC 4JB9H 4GMTH 3MNVB 1BPVA 1QUNA 1ZTXL 3C8KB 3P73B 1B88A 1FYTA 3GSXB 1J05B 5D72H 3FQRA 4HWNA 3UMTA 4M7ZC 3RUGB 1X5FA 5C07D 5DLML 1GPOL 4MCZB 1IL1B 2EIEA 4ONHA 3MA9L 4P2RD 2YK1H 4M7ZB 3LKOA 5DK2B 5D7JA 3ZYZA 1CE6B 5IESL 2JLLA 4U1NB 1KELH 4Y5XA 3WL9A 3GIZH 4OM0H 2R2EA 4WTXA 2HVKB 4X4YA 2DI8A 4RFOH 5SWSA 2IPUG 4F80A 4Q9QL 4JFFB 4LAQL 2IANA 5T1MA 1MCPH 4YHYC 5L2KA 5F1OB 4P2QD 2EDOA 3MXWL 5FYKD 5E1AB 1OGAB 4ODUB 3ROOB 4EI5B 2D9QB 3RGVB 3MZGB 1FL6B 1MJJB 3KPRA 2VZSA 5DJAA 5DR5L 2A6KB 1X5IA 4PYHA 1I85A 2E6PA 3CFEA 1WEJL 2BY1A 5K9JH 5LVEA 2BVEA 5I1JH 4XVTH 2ICEB 4X83A 5GRJH 3TC9A 1MNUL 2X4OB 2K3TA 3QFJA 2F5AH 5IB5A 1BZ7A 4L8BB 4GSDL 1ZT4B 2F53A 5AAWA 4NRZA 2EE9A 4EI5D 5CEZL 3OPZH 2IALA 3GBMH 1OP9A 1V3MA 2X4NA 2ZZUT 2IG2H 5FM5O 1UKTA 3MO1B 3RHWF 2DYPA 4XAKE 4FFYL 4Y5YA 1XH3A 2Z9TA 1W0WB 1IGTB 5C9JB 2AKRB 5TDNB 4D9LL 3GSVB 5HBBA 1GYAA 1N0XH 4CL7A 2XRAL 1VFOA 4LPTA 5AYUH 2NY2B 3BJ91 1JUFA 1RURL 4NZRL 4L4TE 4PJEB 2OL3A 1UWXK 1SEBA 1JWUA 4GKZB 5C08A 3UPRA 3O41B 5AEAA 3KVQA 4PP1C 1JF1B 1FQ9C 4LKCA 1ZHKA 2Z8SA 3WN5B 2HN7A 1U8IB 1JMXA 4NBZB 4AIOA 3B6SA 3OXRB 3VFPB 1FLRH 3MNWB 4KKLD 3QIWC 1C5BL 1LO0H 3U0WH 2DQDL 3H9HA 5DJYA 1GC1H 4HT1H 3S96B 5BVJA 1K8DA 4MJ5A 3HRPA 2NY2D 1L0QA 1M6OB 4AENB 3RY6A 4P5KA 5DMKA 2VXTL 3C5ZA 4O02L 5CSZB 4G5ZH 1XGUA 4OAWB 4P3WA 2FD6H 2HG5B 3NIDE 1HHKA 3QRGH 4GXVL 4L8CB 4QHMB 3SO3B 1XGUB 1QRNE 3QXUA 1BQLL 5IBLD 3S97C 3ZDZF 1MWAA 1B4JL 1NKRA 2YZ1A 1XGPA 2B2XL 4FFWD 4P2RA 2DQCH 3L5IA 1QKZH 3HMXA 5F7MC 5CMAB 3EYVA 1KUMA 3SE8H 2NQCA 3FZUC 1JRHH 2EE3A 2FX8L 4X0KB 5JMOC 2YHGA 5GGQH 1QSVA 3P4LA 3TBYA 1WICA 3NN8A 3QJHB 2P24B 4KQ4H 2DJSA 3LH2H 4MJ6A 1JPGA 1A0QL 1I9IL 1KLUA 1G7PA 2WSKA 4L3AA 5D6CA 2QHRH 5CEXB 4G8FA 5FYLE 2GJ6D 5D1ZC 2FBJH 1BIIA 4XTRD 1C08A 2LQRA 2PYEB 5DWUL 4B50A 1T3FB 3LS5L 2CKBL 3BN9C 3H9ZA 2AXFB 1MRFH 5DA0B 4WHYG 3E8UL 2V17H 3K8LA 3MRRA 5J1SC 2QBWA 5I76B 4GRMA 5IT2L 4KWUA 1LEGA 2D0GA 4F7MA 2H26A 3FO2B 3ARGA 3GFUA 3QZWB 5EULV 2OR8A 5T5NG 1KN2H 1PEZA 1KN4L 3U48A 2VC2L 4CMHC 2B4CH 5JW4N 1YEJH 4L4JA 1DLFL 2D31A 3PHOB 3KLHD 4G80A 1UZ8A 5D96C 1NBVH 4RGND 4JFEA 3BGMB 2XT1B 1QBAA 1SMOA 4AMKH 1VERA 3L7EB 1F00I 1BBJB 4NZUL 5I8KL 1CWVA 1E4XH 4KJQC 1NCDH 2EXYD 3CZJA 5H2BB 1S9YA 3RWFA 5CAYB 3BD3A 3W82A 5D7LE 1NLDH 4NN7B 1S7SB 2M8XA 3TO4C 5DTFA 3A0OA 4ZUTB 3QUXA 2X41A 3VFGH 3BPOB 3K74B 4XHQA 1BHGA 1D5IH 4Y0GA 5I73C 2XWBA 1N6QH 1B9ZA 3LDBB 2XZCH 4Q7DA 2VDPL 3O4LB 5GSRB 4NM8H 3SY0A 4FZ8H 5F9DC 5ICZB 2VDMH 1CGVA 3WN5A 4PLKD 4OCMC 1BD2E 2NZ9C 4I4WB 1T20B 4PLOB 5L6YH 1CGXA 2BHYA 1KCRL 1FNSH 4J3OC 4X6FA 3AREA 1F4XH 1NAKL 3QNYA 2H45A 3GSOB 3UAJD 4LBEA 1N6VA 3O45B 4PY8J 4Z7OF 2OMNA 4U1MA 5T1KB 4FQIL 3HA0A 4OTXL 4MHHI 3IVKB 3L3JA 1PW3A 4JAMA 2P8LB 5MEQA 5FDWB 3O6FD 4R3SB 4MNQD 3MJ8B 1LEIB 32C2B 3MLWL 3U9UB 1MCOH 1V5JA 1Q1JL 4XGZA 3VG9C 3IDGB 4MA1B 3RPIB 3KYKL</