3WJJC

Crystal structure of iib selective fc variant, fc(p238d), in complex with fcgriib
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
164
structure length
164
Chain Sequence
AVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineered antibody Fc variant with selectively enhanced Fc gamma RIIb binding over both Fc gamma RIIaR131 and Fc gamma RIIaH131.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 27
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2013-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjjC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjjC02
5DD6A 1NL0H 5IVXB 1F4YL 1YECH 4ZAKB 1V3LA 5E5UB 1I1FA 4MYWB 5DJZB 5BV7H 4KI5E 3BPLC 4HIHA 2QL1A 3HG1E 4N0YL 3VRLF 3W39B 3PG2A 2OTUB 1Q9KB 3KXFE 3OGCA 3D0VB 3X12A 1EUTA 4LMQE 4E41A 2YK1L 3HPJB 4JY5H 3O41A 5B3JF 1QFUH 4Y89A 2FEEL 3OF6A 2QADC 4M5YH 3ZE0E 1GGYA 2CIIA 2YD5A 4X6DB 3PABA 4JQVA 4L29A 4LRIC 3ECBB 2F5AL 3F65A 5D4QA 2YHGA 3RFZC 5B21A 4D0CB 4DGYH 1CVRA 4WO4A 2AABL 1OGAD 2AJ3B 4M6OH 2VDNH 4Y19D 1AGFA 2E7BA 1PLGL 4Y5VC 1BJ8A 4IHOA 4JM2C 3TZVB 4DFIA 4R97B 4JO3H 1P7QD 4ZSOE 1ZLWK 1U8NA 2J8UA 2R9HD 4M1CC 4UTBL 1J0IA 4JVWA 4JO3L 3CFDA 3A6CL 3RVTD 2L4OA 4XMLH 2VL5B 1QFWI 4JN2B 2X70B 4RMRA 4GXVH 2GY5A 5HHME 3TLRA 4Y4HA 4UUJB 5IBLC 2I07B 4F2MA 4YDJA 4KQ4H 3G5VA 1A7QH 3PDOA 3C08H 4E41E 4HBQA 3RUGB 3ES6B 4APQC 3RI5F 3CK0L 4XCFL 2AVGA 2ZCLL 3NPSB 3ZDXE 1DFBL 3D39D 5DFVC 2BVTA 2YK1H 4MMXC 4YXKL 1C5CL 4YHPA 3BGFC 1P7HL 4B50A 1BX2A 1EJOH 2ZSWA 1AHWC 3U7YL 3IJHA 3L3DA 5DI8B 4JFXA 5F1NA 1H0DA 4YDKL 1SBBA 5TF0A 1I8LA 4KK8D 5INDB 1BQHA 2JJSA 2UYLB 3GSNB 4P3CL 1UM6H 3RUGE 3GSVB 6FABL 4QXWA 3VW3H 2WANA 5GRZA 3EYFA 3OKDB 5T3XD 1PW3A 4NZTH 3BKML 3EJYC 4WRLA 5BRZE 1MRFH 1CWVA 3AC0A 2PXYC 1NFDF 4MJIA 4CADB 1FH5H 3TH3T 5E2UL 5K9KB 1I7UA 5KSAB 3AAZB 5TDPA 4GG8B 5EPMB 4KRPB 1CTOA 3LEYL 3VWJC 1A7OL 3MRGA 4F7EA 3MZGB 4R96B 2VAJA 3TBWB 1S7XB 3VXSA 4OBSA 5DUPH 1JF6A 1CFQB 1P9MC 5EIIB 1AQDA 1DQQB 2A6IB 3GMLB 3QHFL 4PJIA 1UM6L 3IFOA 1QBLH 1XIWB 1I85A 5DK2A 4NQEA 3FO2B 4YE4H 2VWEC 3MPCA 2E9BA 3JWNC 2XKUA 5SX4I 2E7HA 3SE9L 3QEUA 5F89B 5FDYA 4OZIE 1QFWH 4ZAKD 2AK1H 3VXTA 2IANA 2COQA 2ZSVA 4LU5H 5EU4B 3VGEA 4P9ML 1FZOA 2X4NB 4R4BB 1MNUH 4E9LA 2GSIB 2MCG1 3ZE1F 3VRLE 4A6YL 1UWGL 2IFFH 3CSYA 3HNSH 4QTHA 4Y4FD 2OX5A 2AV7A 3O2DA 1SQ2N 2JIXB 5JHLH 5F7LB 1GZPA 4O51A 5AAMA 2JK5A 2J7LA 3QCVH 3JV0A 3UTPE 5JW4M 1RZJL 2YC1A 4X8XA 2HFEA 3QRGH 4JG1H 1XCTA 2AI0H 1B2WH 5BJTB 1XGPA 4HBCH 5GS2H 3RZCD 4OLVH 5T1KB 2VIRB 5I8EA 4YDIL 5KZCD 3OGOE 4MDJA 3CDYA 5F3HA 2AS5M 1VEOA 1Y18A 3MCKA 2A0LC 1DE4B 1A5FH 4P59L 3F12A 1KT2B 1NDGB 4Y8AA 1OAZL 1KEML 4Z78B 2ZUYA 1A0QH 4A2LA 5JQ6L 5SV4A 3IU4L 4G8EB 4H88H 4PP1C 2DQHH 3DV4A 2Q3ZA 4KTYA 4XP4L 1QFPA 4K3GA 4EN3B 4KC3B 2G75A 4LLUA 3UTTD 2DAVA 3BEVB 3DX8B 1LO3L 4KAQL 1S9XA 4PJFA 3QIUC 3RVUD 4UT7L 5B3JE 3DETC 4MQ7B 3SBWA 1F5WA 1TJHH 4ZD3L 1BLNB 2IAND 3THMH 1ED3B 4QHNB 5D7LD 1EA9C 3SDAD 5EZOL 1P6AB 1YECL 3MYJB 1WTGT 3MYJA 1LP9E 4HSQA 1ZS8A 4JO4L 4Z7VA 4IRJC 1SJXA 4YHLL 1X5XA 3B5GA 1FDLH 5CKGA 4Y5XC 1JI2A 1UZ6E 1X6NA 4UIKL 4MGXA 1E4XH 2R8SL 5JIPA 4IS6A 3VG0L 1MFBH 4Z5RB 2P5WA 4G6JL 2AJZB 2BK8A 4OT1L 1WBXB 2NY5H 3LQMA 1HQ4B 1DBML 3ARSA 3DX8A 4HCRA 1ORQA 3KR3H 1G6RA 2AK4B 1U3YA 1HINL 2AJSH 4PJ8C 4ODSL 4S1QL 4MA1C 1IZKA 1NMAH 4R8WH 4JDTL 4U31A 1J1XL 1YDPB 1AR2A 2FIKA 1QHOA 2NY3C 4NWTH 3GSUA 2C3XA 1D5MA 1LO5A 4M62H 2CK0H 1J5OL 3O4OC 4JHBA 5GGVL 1QZ1A 3GO1L 3UPAA 4EDWL 1ZXQA 4ISVB 4XMKH 3RNQB 3VD3A 5A43C 4RWYL 2P47B 4LAJH 1P4IL 1XGPB 1AIFA 5F9DC 3LEVH 1A6AB 3QIBC 2GQHA 3HFMH 4NPYB 4DKEH 4LKCA 1YEHL 5FUOL 1CD9B 2GI7A 1DSFH 5D8JL 1VEPA 4NN6B 5EU3A 1MFAL 1Q9OA 1ADQL 1MJ7L 4ZFOA 1C7SA 4YHIA 1NC2D 1VFOA 4PGJA 3P2TA 1RK1B 5IKCB 4JLRB 4IOFD 1ADQH 4M61A 1RU9H 1KCVL 4NQCB 3MA7A 5D2LF 2QQQA 3TBVA 2D31A 4C59B 1T22A 3BHBB 2GJZB 3S7GA 4NC1E 3TESA 1MJJB 4QHMB 1UCBH 3RVVC 4L8CB 5JW5A 1IAKA 1M1SA 4WENB 1IFHL 3T1FB 3X11B 3KPSA 1N3NA 4F7MA 4Y2DD 1ZLVH 3FO2A 3UBXB 4JRYE 4OZGE 2C1OB 4CW1A 1AQDB 1DQQA 1NMAL 4RDQG 1NCBH 4NJ9L 3BP6B 1QPXA 1ITBB 1T04A 1ZHBA 3LCYA 1S7XA 1SBSH 3RAJH 3TBWA 2XWJB 3AS1A 1CDYA 1BEYH 4JPIA 2Y9RT 4EVNA 2M1KA 4PJ5E 3DYOA 4YZFE 5IJVA 4GG8A 5EPMA 5TDPB 5BQ7B 2XWTB 4OV5B 2BC4B 2BMKA 4PG9A 2NY2C 1CDGA 2DBLH 1FJ1A 3RWGB 5AYUH 4MJ6A 5ESQA 4FTVD 1FCGA 3OKDA 2XA8H 2X4RB 1G9MH 1HHJA 5DQJB 4UIKH 3EUUA 5AAWA 4NN6C 4KKLD 1FLRH 2HG5A 1WIOA 5HDBF 4BM7A 2QSVA 1CK0L 2V2XB 2WBJA 5EZOH 5F1NB 3MRRB 3DTXA 4MDIA 4RFNC 3RVXD 5D6DC 4CU7A 3QDHA 3KJ6L 1BX2B 3QBTB 2X9YA 3O4OB 4YHPB 3EO9L 1ZSDA 3VXOB 2UWEA 4XP1H 5E7BA 1RJZA 4RWHA 4P5TC 4JJ5B 4MNGA 2R0LL 3H9SE 3GMRA 3PDOB 3MRMA 5AWNH 4I4WB 4XMKL 3DOSA 4OLYL 4YDVA 2AJXL 4Y4HB 1MAMH 1KEMH 1A3RH 1L7TH 1W0VB 3CFKB 9CGTA 4LAQH 4LHUD 3VG9B 3HS0A 1SY6H 3TT3H 2VL5A 5I1CH 1ND0A 4KU1A 1W72A 4KK8C 4ODSH 4S1QH 5L7XL 1VB9A 1S7TA 1UFUA 1FBIH 4WW1A 4HC1A 4RGNB 3U6RB 4RCAA 1F58H 2H6PB 1T1YB 5CEXB 4A6YB 3S9DB 3LPFA 2YA0A 1DN2A 4Q6IB 4QRRA 1WT5C 1IC5L 2LABA 3QJFA 4JFDD 3HRPA 5MENE 1NFKA 1ERNA 4APQD 1DUZB 3O2VH 2UZIL 3BJLA 4TSBH 2EXYD 4X6DA 3CDGA 1WBZA 4LLYB 1II4E 3EGSB 3TC9A 2OCFD 4HC1H 1CZ8L 4YHLH 3EYVA 2NY4B 1AXSB 1LO2L 3R0MA 1W72H 2Y5TA 4RAVB 3LB6D 2K7PA 1VGEL 4PJEE 3WE6A 5IGXL 5J4MA 3MODL 4L9LA 1JNLL 1C16A 1DBKH 5J1SC 1JWSA 4EN3C 3HR5A 3QG7H 4LCYA 4OLZH 3WFEH 2F58H 3CX5K 2BCKB 4OZHA 1FG2A 2ZG3A 5IVXA 3WIFB 3PUCA 1QBLL 3B9AA 3NZHL 2C4FT 3NIFF 1BD2B 1Q0YL 3HI5L 5DUPL 2BNQB 4HJGA 3NVQA 4M8QA 2RHEA 5F7MC 1EPFA 1VGKA 2I60L 4P23A 1WLHA 3P0YH 3JWOL 5I1LA 2FO1A 5FYKL 3U36A 4KKCC 1INDL 3BWAA 3K7UA 4YXLH 1UXWA 3IDIA 2UV3A 5ILTL 1WSST 4NCC1 2A6JB 5H94A 1DQJB 3SKOB 1DR9A 3D87B 4JFYA 5ESAA 3AM8C 3T0WA 4JRYA 4FQJL 1RUPH 5FO8B 4OBRA 4YXHL 1RUAH 1KLUA 2CK2A 3VGFA 2Q8BL 1RJLA 5C07D 2DM3A 3O6ML 5BW7A 1G1YA 2NY0B 4W6WB 1LHZA 4GAYA 1CE1H 3QJHB 2B4CL 4K8RL 3T0EC 2APFA 5GSVA 1WCBA 2EYTB 1U58A 5E5MA 2CDFA 1V5JA 4PB9L 3B9DA 2BSRB 4ZO9A 1D5XB 4GW4B 1U6AL 4QHUB 1S9YA 4X7EC 1EHAA 4PJ7F 4HLJA 2KH2B 1SYVB 3NCYP 2XTLA 1DFBH 4WU5A 5C0AA 1PKQB 3P4MB 2D2OA 2EYSA 1TTUA 3ZKSD 4JKMA 5IB2B 3QA3B 4QRTA 5A2LH 2OJZH 3I9GL 3U4EB 4OCWH 4NGHL 5DO2C 5B4MD 4KQ4L 3RPIB 5F6IC 3EYUL 4U1MB 1BQUA 1LGVA 1KIPA 3FB6B 4ZUTA 4F7CB 5KSAC 4EI5D 1HILA 2YD2A 2VUOA 1YEGL 4OAWB 4QRPB 4Y16A 1GGUA 1X5AA 2VOTA 2CKBL 4BK5A 4F9PA 1KN2H 1XH3A 3VXMB 4O9HH 3NIDF 1C1EL 1KTLA 4E42B 4BQBA 4EI5B 3NCEB 3L7EB 3CNKA 4JFDA 1IE5A 3MV7D 1K4CB 4GKNA 2XXMB 1TITA 3IDJA 3WNLA 4POZC 4ZUWB 5LAXB 2F5AH 3HUJB 4JHWH 4M1GL 2V2TA 5DK3A 1BGXL 1ETZA 2VLRD 2IEPA 3C9NB 3NOIA 3FMGH 3ILQD 6FABH 3GMOA 3RY6C 1GL4B 3LEXA 4K7PX 4FP8L 4Y4KD 3FCTA 4AG4L 3B5TA 4YHNB 4M1DH 2PW1A 1UKTA 1T4KB 4QNPE 4XVSH 4WNQA 5IT2H 3T4YA 1IM9A 3QUYC 4G9FB 3S5LB 2IAMB 3REWA 1UKQA 1IAIH 3DMMB 5F21B 3PGDA 4QLRA 1I7ZA 3Q0HA 1DANT 4XVSL 2EKSA 3HZMB 1C5CH 1WC7B 1NMCB 3VMNA 5F7EH 1KYOK 2PYEB 3G5YA 2JJTC 2D7NA 4ZFGL 3T2NH 1XR9B 4NKMB 4RA3A 4NRZB 3FQWA 1P4LB 4LCCC 1A02N 1QRNB 1DEEB 1PG7W 4J1UA 2IADA 1A1OA 3O4LB 3TN0C 4NNPH 2OR8A 5CWSA 4Y5VB 2ATKB 1NCWL 4L1DA 1NCDH 4RFOL 2FJFA 4XMLL 5CD5D 2BRQA 3B8SA 1A14H 2GTWA 4RA0C 5EBWB 3FFCE 3V0VA 1QQDB 3I50L 2B20A 1AFVL 2P8LB 4ZG1A 1FBIL 2VDLL 4YH6A 4UDTB 1F11B 4OD2A 4ORGB 1KB5H 2LE9A 3HMXH 4UU9A 1HYRC 4XNMB 2DI7A 2F9BT 4PD4K 5DRWB 3RVVD 1NUFA 2EE6A 1L9MA 2JLLA 1DQMH 3WHE1 2E8YA 5D6CA 4N1CA 4EJ1C 4N8CL 2CLVA 3D39A 5MI0C 1AKJB 1RHHA 2PCPA 4PLKD 1R3HA 1KUMA 4XNMA 4IOFC 4UU9B 1LE9A 2BVOA 4EOWH 1E4KC 4LSPH 2OZ4A 5KSVA 3EO9H 5DDHA 1N5YH 3F5WB 3PXHA 2GCYB 2F74A 4LCWD 2NY7H 4Z0XA 1FSKC 4N0YH 3STZB 3ISWA 2W59A 3F7VB 2BOCA 2AXGA 3HR6A 3IFNL 2IANE 2PTUA 3OB0K 4K8RH 5CHNA 5F96H 2J6EA 1NL0L 5SX5K 3QXWA 2D4DA 4Q6IC 3IFLH 4HFWB 4XPGL 4I48A 2QR0A 3UJTL 4CJ0A 2VABA 4G9FD 2NZ9C 4RGNC 3ULVE 2XA8L 3C5ZB 4TUKL 3GM0A 3EO1A 4AL8L 4NKMA 3VMPA 2GAZA 5HI3D 2KPNA 2B0SL 3MUGB 4N1HB 5KBNC 2FEDD 2VDKH 3D85B 1T83C 1OGTB 1NGXB 2DQJL 3QWRD 2MFNA 2YUZA 3DMMA 1YYLH 1CT8A 3BD3A 4DN3L 3QUZA 3MRKB 3HI6H 5C0JB 3HC0B 4NKDA 2WUCH 2EE3A 3ZTJG 1T4KA 2H8PB 2ZWLT 1N64H 4JQIL 4NKIH 1TNMA 4DVBA 5HHOB 1KCUL 3FCTB 4JGMA 5EN2A 1JE6A 1KB9J 3NPZB 3CXHJ 3WJLC 1HHGB 2F58L 2I26N 3WFEL 1NGPL 2EO9A 2QHRH 1ETZB 5CBEA 3FRUB 2EZ0C 1LWRA 3JTTB 3VFGH 3T0EB 3V4UH 1UZ8A 1VFBB 2F8OA 3X3FH 1BOYA 2Z8VC 4HZLB 1VGEH 3BUYA 3WFDH 1JNJA 3V0WL 2FWOA 4ZS6C 2DLTA 1S8DA 4GAGL 4JFEA 4CU8A 3RL1A 1WISA 5CJOL 3RDTC 2FD6L 1KCVH 1X5LA 2XV6B 4QYOB 4E42A 3QXDB 3DX6A 3BI9X 1NKOA 3NIGF 1FNGB 4UIMA 4JREB 5ISZB 3WLWD 4HD9A 3KPRB 1OCWH 4G80A 3V6OA 4CDHA 4Y16B 2R2BA 2YPKA 3KAAA 2WSKA 2NY2B 5HYIA 1HILB 1JHLL 1NAMA 3KVQA 1RVFL 1GOFA 4GBXA 2EDOA 2XY1A 2QSCH 5GRXG 4Q2ZA 4JPVH 2DWEA 1NBVL 2Z91A 1FFOA 3RX7A 4OD3L 4HCRH 3L95A 4WWID 1ZTXH 4WUUA 3M17B 1YEKH 5JA9A 5JXEC 2YD9A 4ZSOA 5JXED 2J1KA 1UVQB 1W0WA 1FP5A 4UAOB 1HK6A 3NN8B 4ODWB 4GW4A 5FECB 1HINH 2X4PA 3TT1L 2BSSB 2MSPA 3GI9H 3M8OL 5I2IA 1PJ9A 5TQ0H 3AB0C 4EBQL 2NX5A 3UXFA 5D9SA 4OT1H 5GRJL 3V5HB 5J6HA 1RJLB 5AD0A 25C8L 4GMTL 2DQGL 5DRZA 2PTTA 4MB4A 3UO1H 3BXNA 3QP3A 5A2FA 2XQYK 2G5BA 4D0BA 3N1PC 3WFCL 3P4NB 4JFYB 2VXUL 2HFGL 3V5KB 1CE6B 4OD1L 4GAJL 5DWUH 4R4NC 2VLKB 4ZQKA 2B39A 2DJ4A 5C0NC 4LARL 2ZZUT 4BH7A 3QIBB 1NAML 1LDSA 5F71A 1B4JH 1FLTX 1CN4A 3TYFA 3ARFD 2DLGA 5DK0A 5FOBB 1R3LA 1V7NH 4NP4H 25C8H 1T7VA 2BNQA 3D18B 3VFSB 1G0YR 4HKZB 3IFPA 5TE6H 3IAQA 3VG9C 5DJ8A 2Q86B 1A21A 2AKRA 1XGQA 4HIIB 3T1WA 2ENYA 3WIFA 4EBQH 3S96A 4MA1B 2CUHA 4Z7UE 5EUKB 1TQBC 3KLHD 3KPMA 2IQ9L 4ODHH 1JZ3A 1M71B 4C4KT 1X44A 4QRRE 4JB9L 4KMQA 3HR5B 4UV7L 3HAEA 3IU4H 4BK4A 4L8SB 1JP5A 3MV9B 1WCQA 2F19L 1G6VK 1JPTL 5DC0A 5KS9A 1EEQA 3W0WA 3WE6B 4LHUG 2KQMA 2APTA 1LEKA 3OKNB 5EZLA 4OQTL 2V7NA 2DKUA 1CXLA 1Q9LB 4FHBD 1NBVH 4RGND 1SEBB 4R0LA 3JV4A 3V4VH 1ZHLB 1UCBL 4Y5XB 4LLYA 4WFHD 4MLSA 2HP4A 2D7PA 1YNKL 4NHUA 3QJFB 2A77H 5E6ID 3QIUD 5HHVH 3BAEL 2IQAA 2YZ8A 5EIVA 4QRRB 5HYSG 3HZKB 3RGVD 5LGHL 1X4XA 4HIEB 4PLJC 1MCLA 1T1YA 3CGTA 4JKWA 1XF4B 2DTML 2B1HH 3BZEA 2FD6H 1KN4H 2W9LA 3VFWA 2PO6A 5JIIA 5ITFA 4JY4B 4MD4A 5BXFA 4HGWB 3CFKA 3I6GA 5HGHA 1BFVL 2Z92A 4L3CB 2DWDA 12E8L 1R5IA 1MQ8A 1Y0LA 3D9AH 3UP1A 1INQB 4I4WA 4AQ1B 3G6AB 2BY1A 5D1QD 3ZL4L 1Q1JH 2VSCA 3NFNA 4X0KB 2CK0L 1RULH 2JJWA 2J8UF 5DF0A 3MFGB 5E8NA 1LMKA 4NFDA 2NR6C 2UWEB 5EG6C 3BP4B 2VLMD 5AZEL 5F9OH 2HVJB 1XZ0A 1XCQB 3MGTA 2C9AA 2HWZL 4FTVB 5I74B 5EO1A 2IFGA 1QBAA 3GI8L 4JFDE 3S3SA 3GBML 4Y4FC 4ZFZB 4HK0B 1KENL 4J3VA 4Z7OE 5E8PB 2DLFL 4MSWA 5JHDE 4BH8A 5FUCC 2BNQE 3VG0H 2HKHH 3S5LG 3VFOB 4OF8A 3H9HB 3RDTB 4Q9QL 5JMRA 2ZKHL 3U0WL 2HT3C 2ADIB 3IFLL 3SE4A 4AENB 5IQ7L 1F4HA 4DGIH 1FJ1B 3UJIH 2XPGB 4WUKL 2WWKT 3IFNH 5IW1A 5BQ7A 4FQHB 4P4RB 1J9CT 3DO7B 1WZ1L 2QQKH 2XIDA 5IG7A 4WTZG 4H5SA 1LP9A 1VSCA 1N6UA 2P7TA 1A6ZA 1IQWH 4EEEA 2NY3B 1KJ2A 4P57A 2QQLH 5L2KE 2DF3A 1IBGH 3RHWF 3CK0H 2YRZA 1NFDA 5IM7A 2MKLC 4KVNH 5K9OB 3QEHA 3BKJH 3KWWB 4U1LA 1FNEB 3QHZL 1I1AA 2GJ6A 3GHBH 4MA7L 1OTUD 1IEBB 1PSKH 5MHSD 4GRWH 1I8MB 1A5FL 1NGYA 4HEME 3AMLA 3ARGD 5CEZD 3TBVB 2Z31C 1TLKA 3MA7B 3LPWA 4YWGL 4FG6C 4LSQL 1RK1A 2AERT 5IKCA 1IEAB 5EBLB 1K85A 1VFUA 5TDNA 5FB8B 1CDCA 4BSJA 5E9DB 4RQQA 1H3PL 3E1F1 1RUMH 3PV7A 5C6PB 5ID0B 2PTVA 1U0QA 3REVA 4I18A 3T3PE 1AHWB 4FFYH 2R1WA 3PGFL 5K9QI 1QHPA 3L5WB 2FIKB 3K80A 1MNUL 3AS3A 5I76A 3MREB 5IMKB 1MRCH 3O6LL 5DSCB 1M05B 1HDMB 3NFPB 5I1EL 1L9NA 2WIMA 5CSZB 3VXRD 1IAIL 3BN9C 5KVEH 3MV7B 1ORQB 4JO2H 5D7IA 3DWTA 4WV1C 4MS8D 5FCUL 3ARYA 1R3JB 4N5UA 4Q6YA 2P5WB 4H0GA 2Y1VA 3QIWA 4XPTL 1FL6B 4HXAL 2KBGA 3DURA 1AGCA 3UTSD 1CL7L 4H0IA 4NZRL 1I9JL 2W65B 3OAUL 4Z7WE 2EE2A 1OB1B 4AEIL 5E2UH 1QLFB 5DHXB 5IHZB 5I1JL 4RBPH 1KG0A 5GQBA 4NZTL 1RHFA 4JFFA 3LHPL 3F7YA 1TIUA 1S7VA 2X4SB 4OLXH 5C08E 3WHXA 1EEYA 3ZTNH 3QNZA 2JKXA 1N8ZB 2BFVH 3OB8A 4Y4KC 3ZMRA 5DR5L 5FUZH 2CLZB 2NNAB 5CP3H 5EOQL 3QAZC 1JPST 3BEVA 1NBYA 1GGBL 4PRDB 4U7SA 1CG9B 1H3WM 1FN4A 2IAMC 3PWPD 1BWMA 3BPLB 5E0QA 1UENA 4ODTL 1FC2D 3BSZH 3MJ6A 2IALA 1U36A 2XICA 4KVCH 1PEZA 2NY0D 3FZUC 4LLDB 1CTNA 4R7NA 3MLZL 1FFPA 4JCMA 2NW2B 1MFEL 4PRAA 2BOBB 3BPCB 3IDXL 4ZOBA 5D2NE 5DS8B 3C08L 3NH7L 3TIEB 4C57C 3VWJB 3FQXA 3GIZL 3OAZH 1JFQL 4LCWE 1JHTB 3MRJB 3OPZH 4MA8H 2B4CH 1XCTB 3WFZA 3I2CL 4N8VA 5E00B 4DK6A 3NZ8B 2R0KL 3MRLA 2Q8BH 2XXCB 2IWGA 4O51B 1FNAA 5DJYA 5T5NG 5KTEL 3VD5A 4K23L 1GXEA 2GEEA 2ZUQB 4QTHB 4DZ8A 5J57B 1BIIA 3BZ4B 3ULVD 2YA1A 2Y07L 2E9JA 3HE6B 3STLA 5EU5B 4MB5A 4DGYL 4FQPA 4UILH 1FZOB 4X6BB 2WM0A 4MXVE 5FK9B 3G04B 4PIRF 3VXTB 1IAMA 3QISA 3LN5A 3WO4B 2FDBP 3DUUA 5DRXA 1NBYB 5KSAD 2IMMA 5HVHC 4QT5A 2VTFA 2NTFA 1Z9OA 3RX5A 4YPGA 1ZA6A 2R0ZL 1G1CA 4YDLC 3ME0A 5AG9A 1X5JA 3JBG7 3SGEH 2YUWA 5J9PA 1BZ7A 3CFBB 5EA0L 3VXSB 3WHXB 3VXNA 3DROB 5BMFL 1OW0C 4R3SA 4JFFB 1YUHA 3OF6D 1JYXA 3BVNB 3MRGB 1RIVH 1JNLH 4F7EB 1NCNA 3QULB 5E2VL 3TEUA 3T4AA 5F9WC 4YC2B 1KTDA 3L3HB 2IC2A 2NY0C 4CADA 4ENED 2KZ1B 1GC1H 1DQDL 4WTXA 4UDUA 2L7JA 4PRHB 2DLHA 1HYSD 5HDLA 1SVCP 4PJAF 1T66D 1CGSL 3BE1L 4OZ4B 1VFAA 5IFJB 1U93A 4P2OD 1RZ8A 5GS0D 4D9LL 4MS8C 3GSNA 1NQBA 3WIIH 2RGSA 3MV7A 4NZDA 1C5BH 4OZFH 5IWLC 4HS3B 2X5PA 1F90L 5D5MB 5JXAH 3QDJD 4Z95H 4LLMA 2ZSWB 4FZ8H 3DVGA 5CS7A 5AUMB 4PY7B 3GKWH 3U0PB 5JPNB 5DMGD 1MHCA 5I76B 2X6MA 4CN4A 2PYFB 5HJ3A 5C08B 3L5IA 2BDNL 4LP4A 5HYSB 1MAML 4OI8A 1MWAH 4RAUA 2HN7B 4Y2DC 4U1GC 3ES6A 5SX4H 4XCCH 4Z18A 3DI3B 3BESR 3SGJC 2NW3B 3C5SA 5DJCB 1XAUA 2UUDK 5BO1H 1J05B 5F72S 4Z76B 3QDGE 4XNUH 3CSPA 1CFVL 4M7KL 1RK0A 5F7NC 2EH8L 2EICA 5TDNB 5FB8A 5HHMB 3LRHA 3AVEA 4U3HA 4ELKA 5DGQA 1N6QH 4FQXD 3RUGF 2J8UB 2W91A 4EDXA 5JUEH 2B1AH 4WCYH 1E28B 3TZVA 5GS1A 3LKNB 3PV6A 4P9HL 1I8MA 1BBDL 4Y0GA 2AJ3A 1FLRL 2XTJB 4Z7NF 3QEGH 2YZ1A 4FN0A 4MA3A 4W4OA 4D0CA 3Q3GB 1I1AB 8CGTA 3BYYA 3D3VD 4OZFB 1SM3L 1MRDH 1YY8A 5K9OA 2APWA 3DBXA 4QRQB 4K71C 3PNWB 3CJJA 4UZGA 4MCZA 5EO9A 3HPJA 3RX8A 3GHEH 4NN5C 2VDPH 3M07A 5DRNA 3TV3L 3F6IA 3T65B 4AH2B 4JVUA 3QWOA 5M94B 2N4IA 4P5TB 3WFHB 1N6VA 2EDJA 4FQHA 4P4RA 3RA7H 5DJZA 4P4KC 2FH6A 1I1FB 4UT6L 1FYTB 3GSXA 1E27A 1RJYA 3U82B 2OL3A 3WNNA 5SWZE 2DIJA 3IS1X 4ERSH 5IVXE 4KKLC 4AENA 5LGJA 4PG2C 5A16A 1P4BL 4BSVA 1CXHA 3ZDZF 1CBVH 5CJBA 3G6JE 4K7FB 1Z5LB 1OGAE 3K2UL 5DC9B 1TCRB 2OZ4H 3EYQD 1RV6X 4LVOB 5I73C 4IRSB 4PJGB 2DQIL 4YUEL 1CR9H 1ZEAH 4OI9A 5KN5B 1N0XL 2NPLX 3BRFA 3MRHB 1TJGH 5FYJU 4JFZH 4H26B 4CDGC 3FB5B 4FTVA 3QDAA 4B41A 2YPVL 4LLQB 3TFKD 3OTTA 4PRHD 5CBAB 4X8JA 1YEHH 3ARBD 4IRSD 5FUOH 2G2RB 1C7TA 1AO7D 3FT2A 5E8NB 4V1DE 2D0FA 4E41D 1GGIL 4CUCA 4XBPA 4HPOL 2VISA 3EFDL 5BOZG 3L5XH 4LK4A 4X0KA 5FYKE 1REIA 4XBEH 5C0RL 4M93C 3UMTA 4BFIB 1S9KC 4WI5A 4BFEA 2VDQH 5D1QC 2DWDB 4XPHH 1KPVA 4Z7UF 2Z92B 4FABL 2EDDA 3OKMA 1CXEA 2DJUA 1A6UL 4LCUB 4U6YB 3W2DL 1KJMA 3PWUA 3UTOA 1OGAA 4IIQA 2VLLB 1NLDH 5E99L 5JOFB 5KVFL 4TPRL 3T0XA 4U1KB 1JPSH 3Q6GL 1KEGH 3KR3L 3HLAB 4HMEA 1I8IA 3WDJA 3CVHA 5C0BD 5IVZB 2PO6D 2HAZA 1A6VH 4G42A 4LVNB 1HH6B 3P73B 4WHCA 4X4ZA 2IPKA 2OLDA 4G6JH 1NGZB 2R0WH 1YNTB 5FA3A 2GT9B 5FYLE 3SCMA 4G6ML 4PGBA 4X9FA 3CMOL 5DHYA 5ESVB 2Y6SD 3IS0X 3P9LA 1IC7L 1P7KB 3RZCB 4XC1L 5C0BB 4KHTH 1BQLH 5DVNA 2CMRL 4OGYL 5EO0B 1PZ5A 2LTQB 2G9HA 4DKFH 4DVRH 4Q0XL 1ZVSB 3F58L 4K7PL 5GGRA 4G9DA 2DI9A 3IU3A 1M71A 4DQOL 4NSKB 4JRYD 1NANH 3VDAA 4N8PA 3UC0L 1R3IL 1JGVH 1D9KC 4DOHE 3IDUA 1IL1B 2FHFA 2Q1EA 2YMXH 1U8IA 3LKSB 4M5ZH 3B9EA 1U3ZA 4KJWC 2R39A 4WHTA 1Z6JT 5C09A 4F7PB 1J1PL 4XC3H 5DK0B 5FOBA 4TSAH 2VDRL 4RGMB 5C2UB 1S78D 3RVWC 1QBML 5A3IC 3GIVB 2OTWB 1CXIA 3V7AG 5I71B 3IDMB 4NM4H 1MH5B 1CGWA 1L7IH 1MJUL 1SJEB 2IPTH 4LASL 4AK1A 2VLKA 3HPLB 4TNVF 4NJAL 3B5HA 4YDIH 5IB1B 4HG4J 3SJVB 2G5BB 3R06A 4D0BB 3P40A 3ROOA 3DUHA 3PL6C 4I0PD 4JANA 2D9CA 5F1IA 5DRZB 4TRPH 1SMOA 4F15B 4KK5D 1QUNA 4YJZL 5IW6A 4IRJA 2NX5B 4H8WL 2C26A 2HT3D 4ZYKA 5HHQA 1Y6KR 2EH7L 1OAYH 2JJUA 3QEQD 5IF0B 2DRUA 1KJ3H 4UT9L 3CVIH 4L4VB 3GUTB 1PG7X 3VFVA 1ORSA 1OVZA 4JM2F 4JKKA 5C0CA 3GIVA 2X1OA 4ZDHA 5C0ND 3SDCD 3D69B 3GBNL 1KIQB 5JO5A 4LPXA 3IRPX 4WUUB 1A47A 1NC4A 3L95B 5HHOE 1MREL 3P11H 2IBZY 5JQHC 3LKSA 2DWEB 4KDTC 1BF2A 2UY6A 3H9SB 3OZ9H 1B0RA 1U3HA 5DEFB 4DAGL 2GKIA 2BVQA 3SDXB 3MROB 3KPSD 1MOEA 3AGVA 3IU3B 1U95A 4G9DB 4YNYA 4KZEH 3RWFB 2X1QA 4CVUA 1PZ5B 4UINH 2AJVL 5MENA 3VWKA 4O4YL 1G7JB 2VZ3A 2NY1C 1JHKH 3U9PH 2Z93A 3BQUA 4Y19B 4QGYA 3HA0A 2I9TA 3OR7A 1YA5A 2GT9A 1UZ8B 3U7WH 5FYLD 1D5ZA 1ITCA 2X4TA 3TNMA 2RFXA 3DVFA 5DD3H 2IPKB 3FRUA 5CBEB 4ZO8A 3ZKQD 1JGLH 1MAKA 5EBMB 4RX4A 5IVZA 1A1MB 3OJDB 3WUWG 3PWPB 5FFLA 1CQKA 4HHAB 5F7UA 4U1KA 5DT1L 1DBBL 1EO5A 3O8XA 1A7NH 5HHXL 3TWCL 4UOW1 3KYMB 3BO8B 2XFXB 3H0TA 3RWIA 2DJSA 1MFCL 3QUZB 1OGAB 1CT8B 2P8PB 5E6YA 4QRUA 3G6JB 2E27L 3I75B 5DD5H 3WO3B 1QLEL 1RFDL 2I5YH 2NXZB 2R15A 2I9LA 5F7DB 4ETQB 1KPVB 1T0PB 3K81A 3MRBB 2ZCLH 5E08L 5E5RB 2E3VA 2JELL 1T66C 5ISZE 2EYRA 1ZHNB 3K4DA 1CU4L 2V5YA 3EJJX 2AP2A 4LSRH 3CSBA 4ONFH 1CLCA 4Q97A 5JORB 3TJEL 4NFCA 1EMTL 4LSSH 1AQKL 2G2RA 5ACMA 2BY2A 1R3KA 4X7SL 4AEHL 4KRPC 1F4XL 2X4UB 3PP4H 2MKWA 5JNYA 3C6LC 4JDVB 1AE6L 5E8EB 1MI5A 3GGWA 5FYJE 1BHGA 3ULUF 4H26A 3BJ91 3UROR 2P5EE 4JDZA 1I9IH 4X5XB 2F74B 3VI3F 2YUXA 1UACL 3QB7C 4OCXL 2F15A 1IEHA 1NMBH 3L9RA 4NO0A 3QDJA 1NBQA 4BZ1H 4FQIH 4LQFH 4K7FA 4LSVL 3DSFL 2J3SA 2VQ1A 2EIBA 3OKKB 1ZAGA 3GRWL 2P46B 4AMKL 2ILLA 1DVFA 5KG9A 4O02L 2ITCA 4KTDL 3MLSH 1E27B 1S7QB 2ZOKB 4JQXC 1CDUA 5A40E 3FOLA 5HHOD 5FDWB 2PF6A 4U6VH 3PQYA 5JR1L 3NBNA 3QWOB 1BREA 1IT9H 5AZ2L 1HHKA 3A67L 1JNNH 5CP7B 1A4JA 1FC1A 1EDQA 3ZLQC 4JFOB 1XF2A 3ORJA 3QZWA 2ZG1A 4I2XB 1D5BB 3PNWA 2MJWA 1T5WA 2GTWB 3H3BC 3N50A 3LZFH 3JSSA 1UJ3B 2RCSL 1YY8B 4FQLH 1QNZH 1T0MB 2CDEB 3VGBA 1IVLA 1KCLA 4PJAE 1MCEA 3R8BB 1OF2A 1I4FB 1QYGH 4ZUSA 5D5ME 4XBGB 1A6WH 3GB7A 4NRZA 2GK0B 1QEWB 1CF8H 2C3VA 3R1GH 4OM1H 1J8HE 4YAQB 1JYVA 1OT1A 3VI4E 4N0RA 2ZCHL 4EDXB 2DTSA 4R26L 4UOJA 3AU1A 4R2GD 4QXGH 4MB3A 4ELKB 1I7ZB 1ZGLP 5FYJL 5TE4L 1NUDA 4LKXA 1LEIA 4G9FA 2YKLL 4J2XA 1IM9B 3E8UH 2JB6A 5EUOF 3EIFA 1J05A 3QUYD 5ITBL 2PW1B 3W0WD 4HULB 3DVNA 1RZJC 2JCCF 4WWKC 4GW5A 1AGBA 2HJFA 1LD9A 4JVPA 4RNRB 1BBJA 1XEDA 2VR9A 3L6FB 2OJEA 3O3DA 3IDYB 4V2CB 1QFOA 4MQTB 5I16B 5E8DH 2PYFA 5HJ3B 2HLAB 3LKOB 3DVGB 1YEFH 3CZJA 5AUMA 5B38G 5T1KD 3PIQA 3X3GL 1UGNA 5IHUL 4U1SB 3L7EA 5KSUB 4LSUL 3LKRB 4P23C 5FHBL 4OB5H 3GMQB 4ONGH 2LVCA 1KBGL 5GRYA 1KPUB 3IJSA 2EXWD 5IFJA 4XTRC 5J11B 5D1XC 1VFAB 5MERA 3LS5L 3DV6B 3O45A 4FXKA 4XVTL 1EVTC 2AEQH 4LCIL 4X4XB 2R2EA 4OIIH 5CCKH 2BRRH 1J0JA 3AXLA 2LAAA 3RPIA 3RKDC 3TH4T 4RBPK 5IR1A 2P8MB 1HCVA 1A2YB 3L3HA 3KPNB 4M03A 3QA3A 4QRTB 1OHQA 1NCUA 3RL2B 4PY8J 3TA3A 3FQRA 1X5YA 4LP5A 5J13B 1JWMA 5SWSE 3WKML 5SWSA 4G7YL 2VXQH 4QHUA 1DVFD 5CAYB 1KB5B 4K3JL 1R5VA 4R7DA 3L5HA 4PTUA 4U6TA 1KFAL 5J13C 4O5LL 4CL7A 5HGAB 5GS3A 4L5FL 5D7JC 2GUOB 2QBWA 4KPHL 3ZDZE 3LN5B 4GAYB 4JAMA 2CRZA 5HDQL 3QFJA 4XTRD 1LO0L 1KLUB 4WFFE 4X6BA 4UQ2B 2OP4H 3MR9A 2EC9U 3RWEA 1I8LC 5EU5A 2Z31D 5ESAB 1NCAL 4R90H 2A6JA 4JFEE 2MQ3A 4LLAA 3I6KA 4Q9CA 5D71L 1JN6A 1FVEA 1O7SA 1UXWB 4XXCC 4NM8L 1W8OA 1ZVYA 3QNXA 5IEKB 3TVMD 3BD5A 4P23B 4N8VB 5E00A 3V0WH 4U49A 1UYWL 4BZ2H 2PYED 3D25A 4YGAB 4M6NH 1T0NA 4GUPA 2AQ3A 5EORH 3SE3A 4AT6B 1P9MA 3W0WE 3V7AE 5KS9E 3WN5C 4C56A 1Q0XH 3BZDA 5GRUH 2Y5TB 2VMFA 4RAVA 2CIKA 4RAHA 4OCYL 3CXDL 4KKCD 1ZLVK 1J1OH 5I15H 4CMMA 4OIIL 2E9IA 2IH3B 1QVOA 1RIHL 1HZHL 1BZQK 2WLYA 4K2UL 5SWQA 1WBZB 4FZEH 4UOW0 2CLRB 1IARB 3VXQB 1YQVL 4ETYA 1JF1B 3MV8B 4MJ5B 1TPXC 3ILQC 3K1KC 4A6YA 1WWWX 1I3VA 5F93C 4CRPA 4LNVA 3HZVB 1YMHA 3ET9F 3SGEI 4PJFE 4ZXBC 3NIGE 4QOKD 5C0FA 1NDMB 3I3DA 1EAJA 3QIWB 1I1CA 4YDVB 4KI1A 1TVDA 2LFGA 5T3XL 4I5BA 4QXTB 4F33A 3NCMA 1ZWIB 3KPOB 2EDBA 3GMRB 4MNGB 2XZZA 1P7QA 4JR9H 4P5KA 4ELMF 2OL3L 1LO4H 1XT5A 5HSFA 3VGDA 4EIZC 1D5IH 3QNYB 4U6HB 1YMMB 2V5RA 1X5GA 5I1KL 4JG0H 4GS7C 4M7LT 1OTSC 4E0RA 3MREA 2WQRA 2DQTH 3MACL 3ARQA 2V5TA 2YWZA 2PKDA 4PJXB 5C0CD 4U3CA 2R1WB 4L1HA 4I1NB 5DUML 2X2YA 4FNLH 4X99A 3C6LD 1ZGLB 1F13A 4I18B 3NCJL 2VXSH 2Q87A 1KCKA 3O3EA 4G6KL 4HUWA 2IG2H 5ID0A 4OJFH 5FHAL 4PYGA 3U30B 1P5VA 4S1DC 4JFED 1Z0MA 1QNZL 3MJ7A 5HPMB 2R1XA 3QH3B 5C0DA 3T2OA 5DURD 4CVXB 5DD1H 4C4KO 2P5ED 1YZZA 3H9YA 1IEAA 2WWKO 4G6AD 1CLOL 3MYZA 2BC4A 1MFDH 5ACZA 1HH9A 1PKOA 4YQXH 3GNML 2APVA 4PFEA 4F57H 2MCPH 3A67H 4EVNB 1LVEA 1P1ZA 4XCNA 3FB8A 1RZIB 3RVXC 1I9EA 3UZVB 4HAFA 3IGAB 5BS0B 3MLSL 4GKZA 3CFJA 1FNEA 3WBDA 1MCOL 4L3AA 3RWDA 4K3DL 5FGBC 3QUZC 3KPSB 1N7MH 1QR4A 1LNUB 4QHMA 1FO0H 2VL4A 3IGAA 1I85C 5BS0A 3CX2A 1BVLA 3H42L 1A6ZB 1T22B 3SKMA 3TH2T 1JUFA 2WBWB 4M7ZB 3SGDI 5CEZH 3RIFK 1AO7B 3MBXH 5F1OB 2C7UA 5JOPD 4PUBL 4NQDB 3FRPG 5GXBB 4RMQA 1QSZA 3IKCA 4YHIB 3UCRA 1QSFD 5AG8A 4P49A 1JTPA 2VNCA 5ID1A 1IGJA 4PJXF 2ADIA 1AXTL 4OKVB 4ZOEA 4AEHH 5HPMA 3ZKMD 1WFNA 4HUUA 1HIMH 4I77H 3SOBL 4ZNCD 4O2EB 5T1DL 4YGVB 5BVPH 1OAQH 3V6OC 1IGFH 1H9VA 1ZGLA 1WTLA 4X99B 2VLJA 3JV5A 4LNRB 5DUBA 3LSOA 43CAA 1D5MB 1LO5B 4XWGL 4YFLF 4D2NA 3ULUL 5BZWB 2E27H 2W9EH 2VLRA 1BOGB 2GJ6D 4PJFF 3MLYH 4ZFFA 1QSED 1NGWB 3JVGC 3HE7A 1CLZL 3LD8C 2EDXA 3V6ZB 5D1ZC 2FEEI 1GAFL 1BJ1H 3E0GA 3NFSL 3MNWB 3C60C 1MLCA 3MLXH 4Z7VF 1ZWIA 2VJXA 3KPOA 5KJRL 3W81A 3LDBB 5HYFA 5T1DH 4JRXD 5J7CC 4IS6B 3CDCA 2F5BL 2X09A 1QBBA 4FQCH 4Z0BH 2X40A 4S1SL 1I8KB 1T89A 3BMWA 4OTXH 1FV1B 4TUJB 4DW2L 5DLMH 3SGDH 3D2UA 3GSNL 1T03L 2NY3D 2FATL 5LBSH 3BZEB 2FB4H 4JY6B 1NJ9B 3OAZK 5CJXA 5A3ID 1ED3A 3ZDXF 4JN1H 3SPVB 1G7IA 1JF1A 1KCRL 2IH1B 4M6MH 1T1ZA 2Q8AL 3MJ8B 3PQYE 5C0AD 4TQEL 4MJID 3VXUE 3HNVH 4MXWH 1A8JH 1FO0L 4GQ9L 5GS2D 4CMMB 1M7DB 1SEBA 3MGOA 3MRCA 2G75B 4RFEA 1U91A 5I9QC 3LDBC 4BSWA 1G9MC 1RUQL 4HEPG 3OKNA 3DV4B 3O8XD 3T2QA 1Q9WA 5KS9B 2BNRE 4NT6A 2R2HB 1T20B 4L8SA 3H3PH 3K0WA 2RBLA 4P99A 2XQBL 3ULVL 1FORL 3OQ3B 2NXYC 2SEBB 1I1YA 3K8KA 2H3NA 2A0LD 1DDHA 5DTFA 4GRLA 1ZV5A 2D7MA 3S96B 4HMDA 5T1KA 4LEOB 2EKJA 3NCCB 8FABA 2EDYA 2HKFL 4MCYB 2Q86A 3RZCC 5BJTA 5D2LA 5B39G 5GZND 4QWWC 2YC1B 4P2QA 4KDWA 2XOTA 1VADB 2FH8A 3B9KB 1NGQL 1KOAA 3G6DH 3QIBA 5HI4D 3NACH 3BW9A 15C8H 3MJ9A 2FATH 3S4SG 4ZPTA 3P4NA 4JFFE 3DGGB 3T04D 2HLFC 3P4LA 3HC4H 5DJAB 3VXSE 4Z7QF 3FO0H 4AEEA 3ILPB 1X9QA 5FGSA 3V5HA 2HTLD 1HE7A 3QEUB 4OF3A 5IVNA 4N9OB 3DHJA 1S5IH 1H3UA 2GJ6E 3Q6FA 5IB5A 1CFSB 4R7DB 3QXAB 1MCSA 1KB5A 3QO1B 4ZNEE 4Z77B 4ODWA 4OSUL 1HHHB 1MY5A 5SWSB 1XGUB 4TSCH 4ZS6D 3CU1A 4R96A 2H32B 3TA3B 2DQUH 3RL2A 3AAZA 2YA2A 3CMOH 2ESVB 3CFIC 2V5SA 4H25A 1DLHB 4FFVD 1TETL 4PRBA 2F54D 1NAMB 4PJBE 3N0PB 4RMUA 3DV6A 1YEEL 4RISH 2A6DB 1CD1A 4G80B 4IRSC 4LVOC 5KVGH 1QKZH 3VDBA 1I1AD 3U30C 3TPUA 1BQHB 3HN3A 3DX6B 2XTJD 5INDA 1WIPA 1CDJA 3N06B 1E4WH 4GO6B 1KCSL 4JFXB 4JZNB 1S8DB 4JFEB 4KJYA 5DI8A 1A9BB 1RMFH 4QOKE 3V95A 4BFBD 3BUYB 3TCXA 4JPWH 2ID5A 5I75B 2WBJC 5KVMC 3CUPB 3CFEA 3N9GH 2HLAA 2J88H 3FN3A 1DZBA 1S7RA 1ZOXA 4XPHL 2PXYD 2EDFA 2EDRA 2OJEB 2VE6B 1HHGA 2CGRH 2ADFH 4JJHA 4GW5B 2X1WL 1FGVL 5HHOA 1D9KD 3HG1B 2I07A 4DCQA 1KJ2L 4IMKC 4MNQB 3BGAA 5E7FA 5I1IL 5DJ6B 2CJUL 2H2SC 3DRTB 5IOPA 4F57L 1NGXA 1TJGL 3O0RL 3AU1B 1KIRB 4PGCA 3KLAB 3ARTA 3FFDA 4X6EB 1D7FA 4BA8A 1CDHA 4R90L 1A7RH 4MX7A 3WS6C 3MA9L 4MNQE 5D1XB 5J11C 1WBYB 2J5LB 4Z7WF 3J7HA 1OP3K 3S8WA 3RHWK 3S36L 1U92A 4I48B 3OR6B 3N85L 1MIMH 1NC2A 5GRWA 5DJXA 2CSPA 3P4OA 3FFCB 1WT5A 2ZJSH 1UJ3A 5DUMH 3LH2L 4WO4D 2BOCB 3ARBC 4HW6A 4ZUVA 5E2TL 4F7TB 5JW4Q 3QG6A 3T0AA 4Z8FH 4E41B 5CEZE 3X12B 1XGYL 3D0VA 4AEFA 4WI7A 4JKPH 4XMPL 5CP7A 1QACA 1FVDB 2VDPL 4PRHE 3V6BR 2BVOB 3ZYIA 3MXWL 4HIHB 2FJGA 5I30H 5C7XL 4Z6AT 1B0GB 3ELAT 4W70A 3D39B 1U2CA 4M43H 1PG7L 3S97C 3FRPA 1QOKA 1I7RA 2MNUA 3HC3L 3LS4H 3B6SA 4BKLA 4NBZB 5ALBL 1CD8A 3QDME 1QSVA 3L9RB 4NO0B 3AUVA 3EO0A 1NAKL 4HS8L 3MA9H 2J6EL 3ARBB 2AEPH 4YFDB 4WCYL 4YHML 4OFYD 2QKIB 1JGUL 2P8LA 3P77A 2K1MA 5DD0H 5BZDB 1QQDA 1TQCB 5F3BB 1MQKH 5D70H 3K8LA 4X5XA 3EOTL 1NEZA 4GSDH 5D70L 2O5XL 2K9UA 1MI5B 3GGWB 2PXYA 4CVWA 3X3GH 4ZMAT 4PREA 1S7WA 4UBDD 1KJ2H 5F9WB 4PJ7E 3G6JF 3VRIA 3RWJB 3JV6B 1HZHH 1U8JB 4K2UH 2IADB 2RJMA 1ZT4A 3LS4L 5I15L 4EN3D 2BDNH 1DL7L 2EECA 1OTTD 3LB6C 4WFEE 5D7JB 3E6FA 5C7XH 1IQDA 3ULUC 3PGDB 4ODUB 5ERWB 4LCWB 4RX4D 1E4WL 3T4YB 3KYMA 3MLRH 3PP3K 3TYGL 5KANG 4HWBA 5BRZA 4GAFB 1TJIL 1CICD 2CRIA 1EV2E 4HHAA 2D7QA 3LEXB 1JZ7A 1M6OA 4GKSA 5C9JA 3MBED 4U1NA 3DUSA 3NA4A 4U3XA 3VJ6B 1TCMA 3U2SB 2FLBT 2HTKD 5K59E 2V2TB 2RFXB 4NM8H 2XZCH 1TETH 3S36H 1DQDH 3IDJB 2JJSC 6CGTA 1K4CA 1BVKA 3BQUB 4FQLL 1NSNL 2Z93B 4JFDB 2XWBA 5T1LA 3OAYH 3O4LE 3CLFL 3VXUA 2ITDA 4P2OA 3RKDD 1EAPA 3C2AH 1K5NA 4IBLT 3VWKB 5MENB 3JZ7A 3O3BB 1CD0A 2FIRT 5T5FL 1UH4A 3SDDB 3VXMA 3BKYH 4V2BA 4L8BA 4QHKJ 5CUSH 5HBBA 3IAPA 5T1MB 2RQ8A 4QRPA 3O6FC 3MROA 2YS4A 3VJ6A 5J12C 3OL2A 1BQSA 2W60B 4KJPC 1FGVH 1ZANL 1X7QA 1MCIA 4WUUE 1RSFA 3RBGA 5IB2A 4UILL 1KTKE 3QPXH 1T1WB 2WIIB 4KMTL 3QAZB 4HK3N 4HWEH 2EDQA 1OP9A 1ORSB 3QIUA 1HWGB 3FONA 3MV7E 5KTEH 1KCSH 1ACYH 3OJMB 2DBJA 5E5MB 1G9NL 4ZYKB 1WCBB 2EYTA 1OWWA 4XCEA 5JOPE 4PV9B 1ZT4B 2P42B 2ZPKH 4PTTB 4J4PC 3QJHA 2VLRE 3KPSE 1QKZL 1HKLH 2F54A 4E5XA 1JFQH 1N5AB 2DQFB 4CVZB 2NY1B 4PREB 2BXYA 3FL7A 1BZ9B 3I02A 4ONGL 5MEPB 2DYPD 1F8TL 3B9KC 4J8RA 1MFEH 2EDKA 3HPLA 4HWBL 4IJ3B 4GXUN 2PR4H 1JJUA 4PJCB 3MUJA 4WV1B 1MH5A 1ES0A 3DIFB 4N90D 1OP5K 3TO4C 4O58H 4V1DD 1I3RB 5JLZB 3HE7D 1J7VR 2FO4A 2G60H 3UTQB 3EO0B 1VGKB 3U4BL 3ARGB 3KGRA 5C09B 4WHTB 3GMMA 5I17B 4NYLB 5D72L 1LEGB 3MBEC 3RTQA 2OK0L 4Z7VE 4MXWL 2X89A 3S4SB 5ITBH 3KLSA 5E1AB 2L0DA 5BVJB 5FIEA 4L4JA 3K2MC 1ZVHA 4OZIF 1CI5A 1B0GA 1UT9A 1ZMYA 4LGPB 4X5WB 1UWEL 2R69H 5I1GL 5TGBA 1FVDA 5CJ5A 5I9QB 3B2UD 5DQDL 4QHLB 1Z0NA 4NZUL 1Q94B 2FJHA 4JRXE 4QOKA 4UMGA 1UM4L 1MPAL 5B3NA 4J6RH 5ESVA 3LQAH 5T5NF 4DGVH 3QIBD 1UM4H 1ZE3C 4PGBB 2BY0A 2R4RH 4FQCL 15C8L 3SKNB 1A4KB 1U8MB 3FFCA 5FA3B 4ZTOL 2EXYC 1V8HA 1T2XA 4FQXB 1OARH 4NC0B 1MIEL 4HH9B 4HQQH 2Z31B 5C2BL 3WV0A 1WBYA 5GISH 1RAMA 1XF3A 4MX7B 3NCYS 3JXAA 2FNBA 1GVIA 3OZ9L 3FFDB 2OR7A 5LQBL 2EXWC 3KLAA 5I1EH 5FGCE 3DHMA 1KJMB 4LCUA 3DRTA 4U6YA 4XPAL 1HNGA 1R0AH 3GBNH 1FORH 3C60B 5KSBA 2Q76B 3HMXA 2G60L 1W0VA 3EFFA 5IFHH 4PJ9A 4HKBB 5D1ZB 1G7MB 2OI9C 3O3AA 2VN7A 4AIOA 5FYKU 4WGWB 5T33L 2XN9B 5CIPH 4FXLA 1G6RL 3VCLB 3QQ3B 4DOHB 1RUML 4RMWA 4CGTA 3B9VA 3A0OA 3U46A 1JGEB 2VQUA 5I8KH 3CFEB 5CJQH 4YO0B 3SKJL 1OL0A 2V9RA 3DTXB 5TH2B 4AY0A 3MSPA 4PUBH 1BPVA 2W9DH 4NUGH 3QUXA 1IKNA 2X1XR 4PJGE 2ICWJ 3E6HB 4PJGA 5LXGL 2ZOLB 1DP0A 4MXVF 1TCRA 4PRPD 1EMTH 5DJ0B 2X4RA 2VH5L 1V3MA 5SV3A 5JW3H 4PRBB 2DN7A 1XFPA 2A9NH 4JHAL 3BIKB 3RWGA 4U7MA 1MCOH 1KF9B 2OL3B 2YMXL 4H25B 5D2NA 5IROA 4PG9B 3BEWB 4CAGA 2YR3A 4FS0A 4D94A 1FE8H 5J1AB 1CLZH 4P5TA 2HT4D 4JPIB 3T65A 1WZ1H 2OS7A 3QT2A 5CUSL 4K7PH 4M93B 3ZE2F 4BYHA 3D3VA 5I1HH 3BKYL 5HHXH 4OZFG 4MCZB 5EO9B 4Z77A 4GG6E 2W9EL 3UJIL 2VB5A 3DI2B 2BSTA 3U48A 3RGVC 4X6CF 3LV3A 4MD5B 4WGVB 1BM3H 2CUMA 5GS0H 5I8CA 1F45A 3T1FA 1K8DA 3X11A 2EDTA 1A7PH 1LILA 1OAQL 5BVPL 1MJJA 1WEJL 4XHQA 3RQ3A 5M7QA 1FPTL 1R5WA 2APXA 4HDIA 2DLFH 3WD5L 2VXVL 4PGDA 4Y4FA 3MTRA 4Z7UB 1WGOA 3MGAA 5GS1B 4F15C 4KQ3L 1E28A 1GGCL 4ZPTB 2DDQH 4PJHB 3GRWA 4NZUH 4ZFOB 5CIPA 2H2SD 1Q9OB 3HMWL 1MUJA 1VADA 5I1KH 5K9JL 4HKJA 3SE4C 4NKOB 5HGBA 1VERA 4Z76A 2ATPB 3ZTJH 2CDGA 2OL3H 1AIFB 1IGYB 4C56D 2OK0H 3DXAD 5DJCA 3C5SB 4MCYA 4WEBH 2NW3A 4LEOA 4ISVA 3VDCA 3FJTA 1N7ML 1U8HA 2H26A 3SO5A 4GRLB 1TQBB 3GSUB 2YPLA 4JM4L 4L3EE 1JNHA 4KK6C 1YDPA 3SEPA 2SEBA 3T77B 4HX1A 5MEOA 4XP9L 3JWDH 1Q9WB 4LLMB 4H20L 2YPVH 2F54E 4IDJH 3GZKA 3MOAH 5GSRB 4UB0H 1I1AC 3OAYK 1M7DA 5I18L 1GHFH 2W0LA 1WBXA 3SDYH 2NR6D 4R6UA 1TFHA 3VWKD 1KJVA 3ARZA 3V4VL 4YHZL 3KYOA 1T1ZB 1SJHB 2FHCA 1G7IB 5GJTL 3ARFC 1EHLH 2JTDA 4NJAH 2X1PA 1MF2L 1G9EA 1K4DA 5C0EA 3O4LD 4LVNC 1VCAA 2RAMA 4JY6A 1LE5A 3JTSB 3WUWA 3E2HC 2J8UE 3DECA 3QULA 1S9VB 2UVEA 4NNXA 5DVOA 1HOCB 5I8OL 4QXUH 3PDGA 4X4ME 1MEXL 4WI3A 3VXNB 4XC3L 5IQ9A 3GJFH 5J9PB 4XPFH 1U8QB 5FUCE 1BFOB 4UAOC 4GRWE 4Y5YC 4BUHA 3KYKL 4OGXH 3SN6N 1TZHA 3KLDA 5E2TH 2HFFA 5TFSL 1MCWM 4YZFF 1H8OA 1U8OA 3DUUB 3MLUL 1ROWA 4JFQA 4HIJA 1XR8A 2PUQT 3RVTC 3TA3D 3L3GB 4HJJH 2A6KB 5E4IA 1UA6L 1MIML 3RKPA 4JFHD 1YN7A 3GSQB 4POYA 3F12B 1AGEA 1BBDH 3STLB 4C83B 1FL3A 5E6IA 1MCFA 4P9HH 4Y16C 1RZ7H 5F3HB 2JE8A 4ELMA 3LSOB 43CAB 4LNRA 5JUEL 3WFCH 2Y36H 2VIRA 5I8EB 5L6YL 4KZDL 4I0PA 3VXME 3KYNA 5IMMB 1YY9C 2BP3A 2OP4L 1NEUA 4I9WD 4PGZA 5FV2A 1BAFH 4O2EA 4JZJA 4TTDD 3F7PC 3VXPA 3Q5TA 3IAGC 1A6VL 5F9JA 1YQVH 4BQ8A 1P84J 1C08B 4HUUB 5KW9L 4YC2C 1KELH 4L5FH 1XGTB 3MFFA 4WI2A 5E2WH 3VD9A 2JIXA 4G8IB 2BOBA 3BPCA 4P48A 2P24A 1NPUA 3CXDH 3S98A 4Y8DC 4LLDA 4C56E 1AO7A 1GIGH 5F6HJ 2X4NA 2KL6A 3N9GL 3MNZA 4KUZL 1BJMA 1BVLB 2IANB 4JFPB 5LCVL 1N4XH 1RVFH 4LSDA 2OQJB 3FQNB 3OHXA 4XZUB 3QEQB 2C1PA 4XP6L 2VLME 2JJTA 3CFJB 1JZ4A 1N8ZA 2LAGB 3QNZB 1CFNA 2XQYG 3BE1H 3OJVC 3TVMA 5HPOA 2ZUQC 3SDDD 5D7LA 3SDAA 3C5ZC 4XCNB 4JQVC 4JFZL 4PGEB 3RU8H 3KDMA 5J3HC 1HH9B 3WL9A 1L0YA 3L3KB 4J3UA 3EYOB 3WEXB 3QFDA 2R4SH 3UBXG 1OB1A 4YX2L 3CX5J 4FFWD 2W65A 4Y16D 4LRNL 3QQ4A 4CVXA 5CILH 4WEMB 5TPWL 1ZLSL 4PRIE 5GIRB 1FHGA 4KROC 1FL6A 2Y6SC 1UA6H 3UAJC 2C3GA 1T7YA 2IBGA 3DX9A 3TBTB 4WI8A 3IXTA 5D1ZD 2X44D 3VD7A 3QUKA 2GSGA 2B4CC 5FM5M 2WUCL 4D0DB 4Y19E 4PJXA 4OUOA 4K3JH 3IJHB 3MUHL 2EDNA 3IDYC 5L88H 1YPZE 2X42A 4HIXL 1C5DB 1ZGLM 4WWKB 3L5WA 1YMMA 2F53D 4AYFA 1Z9MA 1SHMA 4BUGA 2GSGB 5TQ2H 2UWEE 1AHWA 1E4XI 3NABL 4X7CC 4LHQB 3IXTB 3NACL 3WLBA 2WUBL 5D7IE 1YNLH 3IETA 4F2MB 3C6SA 2Z9TA 1JI1A 4YHZH 3ARXA 4Z9KB 1AI1L 5E9DA 4FRWA 1NDMA 2X70A 4OFYA 4L3EB 3DGCR 4CN1A 1E6OL 3BPOC 4M1CD 7FABL 3EYOA 3WCYA 4NDMB 3IXAA 5IHUH 4X4MA 4L3EA 4XP9H 3EW3B 3BP7A 1S3KL 1SEQL 3RY4A 5JOEA 5E70A 4J7RA 2GJ6B 3DVIA 4L29B 3QEQA 1AP2A 3IETB 3VA6A 3OHXB 5F7KC 2AJYL 3QEHB 1QVOB 2IH3A 4KKAD 5DHVH 1F2XK 5IM7B 3DRQA 4K94L 1N0LA 4JFPA 3L7FB 1OAKL 1NMBL 1KJ2B 3GKWL 5HI5D 4XNZB 4EZMA 3OGCB 2B5IC 1B88A 5BV7B 2K3TA 5IG7B 5MEQA 3DO7A 1KCRH 4YBQC 4YEEA 3U79A 4I13B 2XY2A 2DM4A 1C5BL 5DHVA 4D0DA 4PB0L 3QUKB 1BMGA 1VFMA 4TULH 4ONOA 1IMHC 3HE6C 5LBSL 3ESUF 5DD6B 2F53A 2HFTA 5ANMB 1XGTA 1KACB 4NNPL 1LK3L 5FGRA 3RDTA 3TBTA 4EI5C 4LSSL 2CKBB 2FX7H 2HYMA 3B83A 5IEKA 4JO1H 4LBEA 2UWEF 4LVEA 3JWDC 3QFJD 5CD3B 2A38A 4POZD 1IKFL 1HNFA 2NY6B 1JN6B 3WEXA 4ELMB 1OY3B 4I0CC 3WL9B 3VXRA 5EO1B 3KDMB 1OD9A 4C83A 4KJQC 5BS0D 3GSQA 3GSOB 1MFCH 3MR9B 3RWEB 4O2FA 3PQYD 3WMSA 3O6LH 2A6KA 4F80A 5KVDH 1IRAY 2J12B 5JXEA 4M3JA 1EX0A 1XR8B 3BWUC 4HIJB 4PLKC 2H2PD 5DJDA 2ADGA 4X98B 4FFYL 2HFFB 1NBZB 4TVPD 1R5VB 2YD8A 3OKOA 1CXFA 3G9VA 1A1NB 1K8IB 4KI5F 5HGHB 2XKSA 3I6GB 2FZ3A 5A2IH 3FAWA 4FQIL 3LOWA 4NNXB 1BD2E 4Y4KB 4X6DF 3Q2CA 3FQRB 4OCXH 4I0KA 4PLNC 4PG2A 4X4YB 3JTSA 4O4YH 1LE5B 1TXKA 2XN9E 2R1YB 4OCSH 1A2YA 1BIHA 2P8MA 1OW0A 3GJEB 4G8IA 1WAAE 2DLIA 2IF7A 3FB7A 4OV6F 2L7UA 2GW5A 2R0KH 3AXLB 3KPPA 3V8CA 1KJVB 4U6XA 3V5DB 4MAYA 3S36X 3O9WD 2VDML 3O45B 3GJFK 3IDNB 3VXPB 3JV4B 3NH7H 3O3UN 4J4PD 1KPRB 3KYNB 1A3QA 4NQXB 2P49B 1CU4H 1JVKA 2JELH 3BP5A 1E6OH 1G7PB 4LIQH 1UADC 4FTVE 5HVGB 4HX1B 1YN7B 3T77A 5F7FA 5HGDA 5F8RC 2AK4E 3NA9H 1G0XA 5EUKA 1CQYA 3O3DB 1WK0A 1XGQB 4HIIA 2AKRB 3IVKB 3ZDYE 5DR5H 3T3PF 3D18A 2O26U 2ZKHH 2D4FA 4IIQC 2Q8AH 2JB6B 4Q9QH 1NANI 4FQJH 2BJMH 3QDMB 3BD4A 2J2ZA 2V7HB 1MELA 5FKAB 4NQDE 2FL5A 5AYQA 5ICZB 2FB4L 3ULVF 3WUWB 2C5DC 4J3WA 3LRGA 5DLML 1IGML 4IM8A 4OQ1A 2ARJQ 5H2BA 5IHLB 2AV1A 2VDRH 2ED9A 1KB9K 2HWZH 1I4FA 4XPTH 1YPZB 3P0VL 4TVPL 3MV9D 2D3VA 2H2PC 1Q72L 1SY6A 5FCUH 4M5ZL 3EJZD 1P53A 4XGZA 1RZKL 1EHNA 1FAKT 5DQ9B 1CIDA 1LO4L 2A1WH 5BS0E 4Y4HC 3QDGD 2X4PB 1D5BA 2GYSA 4RMVA 1UH2A 1CICC 3QZWB 1OP5H 4UBDC 1MRCL 4KXZI 2LQRA 4N8VG 5EOTB 1HHKB 1KIUA 4NQED 4KGJA 4XC1H 3PGCB 4XP6H 1AY1H 3M17A 3ULUD 3FOLB 1ACZA 2FECI 2XYCA 4TVPE 2H9GB 2YPLB 5C71A 4JKLA 1FIGH 2A2QT 2IBBA 2ITCB 2VERN 3U83A 3PWLA 4A2MA 5IB3A 4WHYG 3SOBH 3DNKA 1S7SA 2VQ1B 1QPPA 1H3PH 2CDGB 4KUZH 5D1XD 4F58H 2A77L 2CXGA 2XN9D 2ZOLA 4LF3A 4HKJB 4PBXA 5GGTA 5FM4A 1UJTA 5EBGA 5HVWA 5KVFH 3P9MB 2EDHA 2EEDA 3MBXL 2JCCB 2FWOB 2A83A 4WY7H 2IPTL 4Z7UA 4JDVA 4Y4FB 1EXUA 2X41A 3EYSH 4OLYH 4YIQA 3QCTH 1JGEA 2N7BA 4YFEA 5E94B 2ZUVA 4TSAL 3QPXL 1TVBA 4XBEL 5JORA 2MPAL 1K8DB 2Y36L 5I8CB 2OMBA 5EN2B 3RNKA 1ZHNA 1KGCE 3RJQB 4S2SA 2BSTB 5LWYH 1G7MA 3O3AB 3L1OL 1OSZB 2R56L 32C2A 2FECL 5EU7C 2I9LB 3P0GB 5C0JA 3MRKA 2VLJD 3G5XA 3MX0A 3O6FD 3RPKA 3ZKXC 4NO3B 4NQSA 2Z35A 3IJYB 5D1QA 1SYSB 4P46D 4PJBB 5ANME 3D85A 1JF5A 5C0CE 3BO8A 2WWMD 3BEWA 4ZUUA 1FYHB 3MV8E 1UCTA 5IQ7H 2VXUH 1TZIA 3S37L 3BIKA 1PBYA 5EBMA 1C12A 4URTB 5DA4A 3QDMD 5DJ0A 1P4BH 3GJFB 4FQXA 4XNQA 5F8QC 4G6KH 1CDIA 3PXJA 1WAAF 3MUY1 5HD8D 4FNLL 1QO3A 1FO0A 3BOVA 4Y19A 4NHCH 3M8OH 3PF2A 5I73B 3TP4A 1EGJA 4NBYB 1AJ7H 1UB6B 3AREA 4TPRH 5TH2A 4Z0XB 3TYGH 5GJTH 3B2VL 4QHLA 1SBSL 3RAJL 3RWFA 2FX9H 3LRSB 5CSBA 5JA8B 2OR9H 1B3JA 4LPVA 4PV8B 2WK2A 1D5IL 1R3HB 1AKJA 1RHHB 3HI1A 1GHFL 1SJVA 5E1AA 1U3HB 3LQZA 3QUYA 5DEFA 5D6CB 1OTUC 4OLUL 3RTQB 4UB0L 3WUZA 5I17A 3JVGA 1NCTA 3GMPA 2DM7A 3PWNA 3ARGA 3U9UB 3D69A 1DANU 2Q76A 3UTQA 5KSBB 3C60A 5IFAH 2FO4B 4NC1C 3B3IB 5C0CB 2W38A 4M6AA 1E0OB 3GSWB 4D9QE 1OCWL 5FV1L 1VESA 5C92A 1CLYL 2VWEE 4ORZC 3UTSA 2GIYA 1PVHA 3EOTH 3ARRA 3FFCD 1MQKL 3MRQB 5D8JH 3WNOA 2FJFB 3BAEH 4KUCF 5HHQB 2XTJC 5EUOB 1K9TA 3C6LA 3FO9B 1ZT7B 2DQFA 3WFDL 4JM2A 5HHPA 5ETUA 4JEGB 4MWFA 5K9JH 2OZ4L 3FTGB 5EFIB 2N7AA 3EDFA 4G5ZH 4FQQB 4JANB 3GO1H 4EDWH 3SKNA 2PW2B 5INCA 3W82A 4NZJA 4OQTH 3G5YB 5GRUL 2P5EA 3GKZA 3OXRA 1QLRB 4JQIH 1MVUA 3IDMA 4NKIL 2FJHB 3X14A 2XACC 4ZPVB 1KLGB 4JB9H 2IAMA 5TE4H 2BJML 2IQ9H 5FYJH 4X5WA 4OZGF 2HT2C 3S37H 2VDKL 4S0TD 1X7QB 3ZKND 5CFHA 3F62A 5ENWB 4M6NL 1UG9A 3B4NA 4NO5A 5JPMA 3JWOC 4L8BB 2DL2A 3PHQA 1ZVSA 5I0ZA 1FE8L 2EEBA 1I3RA 1GZQA 4GKNB 3SDDA 1QFHA 2V9TA 2VKWA 3EDJA 4MZ3A 1PY9A 4XVUC 5C0BA 1FAIL 2ITDB 4P2OB 4XVUD 4S1RL 1M7XA 1RIVL 2P45B 3FT4B 1KTLB 5DHYB 3THML 4YLQT 5EUOE 1MY7A 3I02B 3LKQA 4WIQA 3VFTA 5B8CC 1N5AA 4KV5F 4JPKH 4ZTPL 2CJUH 2P1YA 2F54B 1B90A 4OAWA 3EYSL 4AJ0A 3TJHC 2ICWI 3MRNA 2A74A 4U6VL 1HH6A 2ICEB 4PLJD 1CFTA 3H9ZA 3F6LA 4LHUB 1M6OB 4HLZH 3TT1H 5DMKB 1MJ8L 1WZLA 5BRZB 3UTZA 4TNWF 2BY3A 2VXQL 3RWHA 4D9RD 2F53E 5IV2A 4LQFL 3OKMB 4FQ2L 5IV2B 3T09A 2AEIT 5HYEA 4FZ8L 4G9FE 1JK8B 4OD3H 1P2CA 3EYQC 4BQCA 4IDLA 5FCSH 4ZFOL 4X6FB 3UTZB 1CDBA 4OLVL 2J4WL 1P6FA 2HVKA 2P5WE 4LHUA 1AD9B 3WIIL 4L4TA 4MHHI 4G43A 1AE6H 3FQTB 4OUUB 3N1MC 1WQVT 3BZFB 4X83A 3MRNB 1MHEB 1UM5L 3MRIB 2YEZB 1WFOA 3LKQB 4LPCA 2XNAB 3MJGX 3V8OA 1EFXD 3HRZA 5L2KA 4LFHD 5FO7B 1NEZB 2IFFL 3FT4A 3MRHA 1DQJA 3VXUB 3H9SD 4TOYL 2XWBB 1KTRL 3ALPA 3X13A 5BZDA 3CCHA 3P77B 2DKMA 5F7EL 5HYJE 3IDIB 5I6XC 2FYYA 3U0TA 5B39B 3S35X 4DK3A 5DD5L 4DEPB 2E7MA 3PHQB 5FA4B 5F6IB 5CGYD 4WI6A 5EH1A 4HJGB 3SE9H 3RP1A 4U1NB 2R4RL 4GKSB 5FGCB 2R2CA 1KC5H 4KTEL 3WNMA 4M1DL 5CGMA 3RBSA 2ICWB 1MCQA 3I3BA 5JHDB 4BELD 1MHPH 1FYTA 2BCKA 4OZHB 5CJ8A 3ZTNL 1HHIB 4I3RL 5DQDH 3S34L 3MRPA 5MEND 3LHPH 1JWSB 4AH2A 2P43B 5DD3L 4X6DE 3FO0L 1IQDB 3WS3B 3V52H 1MVUB 5L0QC 3RJDA 3EZJB 1A9EB 2HJKA 4F7TA 4AEIH 4U1HB 4U0QB 3OAUH 4ONHA 2DM2A 3EYVB 1KC5L 4KTEH 1JHKL 3Q5YA 3KYAA 4OZGB 4MXQC 4OZFA 4FQQA 3FN9A 4O9HL 4PJXE 3U4BH 1NC2B 4XPGH 3F7RA 2AJYH 3KS0J 3RWJA 3OR6A 1U92B 5ETUB 1ZLUH 3MRFA 4JM2B 4MA3B 1YEGH 4LIQL 1S7WB 4P3CH 5EUOA 3LZFL 4Q6IA 3QO0A 2GTZA 3V7MA 4J12A 2HKFH 5F9AC 3EYUH 3UTSB 1G7HA 4P46C 2PN5A 4OFIA 4PJEA 4PGCB 3UTTE 4MNGE 4XB8A 3A6OA 3WLWC 5AZ2H 1W72B 3T0DA 3D1MC 1ND0B 4YXKH 3T8XA 5DJ6A 1EIBA 4PRPE 1T83A 1T5XB 1U41A 4BKLB 4N8CH 3HG1A 1YYMH 5I1DB 3UYOD 3CVIL 3DMMC 3GMPB 4PJHE 4KV5E 1EK3A 5EC2B 3OXSB 5DEZA 3QUYB 5JZ7D 1YEJH 5BCAA 1D3CA 2HN7A 1KNOA 1HSBA 1MI5D 3TFKC 1ZSDB 4R9HA 1MHCB 4WJ5B 3CUPA 3IDGA 4HIXH 5CMAB 1OAXH 5L88L 1UQSA 4UTBH 2Z0BA 3DX7B 2JB5H 5D5MA 2W0KA 1UB6A 3AREB 1PD6A 3S34H 1Z3GL 4ZUVB 5DEGB 2ARJA 3VH8G 4NOFA 5H8DA 4DKAA 3GM8A 1QO3B 1DN0B 3HB3D 4LASH 3ZO0A 5ILTH 5KVDL 3ZT6A 2A6DA 5FYKH 4OZ4A 4XNQB 5D2LE 4OLEA 4F9LC 1LP9F 3G08A 2F5BH 3BKJL 4ONFL 5C70A 2Z8WC 4MJ6B 5ESQB 2O93L 4M5YL 4N90E 1FZJA 1DLHA 5ADPH 4NIKB 5TPWH 1ZLSH 2ESVA 4X6EA 3P3YA 4OGAC 5L2JB 4OV5A 3HNTH 4PJ5B 5IJVB 4TOYH 4RGNE 3ULVC 2BVPA 1IGTB 1KYOJ 4EI6B 2Z35B 3IJYA 4L4VE 4OF0A 4JGJA 4WHYH 4CKVX 1NC4D 2VZTA 3DROA 1J0YA 2FX7L 4IMLA 3T3MF 2DMCA 1UM5H 4WUKH 1F4YH 2HJLA 3LN4B 3Q6FB 5DO2D 5B4MC 2NTFB 4NQEE 4QT5B 3BMVA 3U0WH 4Y88A 4PB0H 1NFIB 3FMGL 4PJBF 2XRAH 3MLRL 1DQLH 1AO7E 1TVBB 1IAKB 3GBLA 1V7ML 3GK8L 1GCFA 4M1GH 1A3LH 4RFNB 2GJZA 3FN0H 4I77L 3ROLA 5EZJA 5EIQA 5DMGC 3BISA 3WJJA 1A9BA 4KJYB 5J0BA 4JZNA 2P48B 1C1EH 3WFBL 5L8KB 2XZAH 3MV9E 3FOMB 3TPUB 1KN2L 4NKQB 4G5ZL 3BYTA 5E2WL 1MCJA 2QSQA 1CD1B 4U0RC 3PP3H 2CD0A 4P2OC 4NPYA 1SY6L 1S3KH 1PX4A 1PSKL 5CD5C 3MUZ1 1JHTA 2MOVA 1S7SB 4JPKL 4ZTPH 3C5JA 3VI3E 4JE4B 4NGHH 3VWJA 1H3XA 2OJZL 12E8H 5F1SA 5DS8A 2GK2A 1JGUH 3ULUE 4LLWA 5DMIH 4R7NB 1FAIH 2QQLL 1I75A 2BNQD 1T20A 2R2HA 5EOTA 4B0MM 1U6AH 3ZHDA 3BN3B 1X5KA 1HHHA 1IAIM 1P5UA 2MCPL 3I85A 1FN4B 4OLUH 4NQCD 1PGRB 4PRDA 5IB5B 1CCZA 3WN5A 1MFDL 3MRDA 3AY4C 3MRCB 1MWAA 3N1GC 4JRXB 4DGIL 2D03L 2AJZA 4TRPL 5C86A 1RUAL 4OGXL 3ILPA 2VN4A 3K2UH 2HMIC 4PYHA 4XPBH 1S7VB 2AV1B 2X4SA 4LCCA 2VZSA 3F7YB 4OCRL 1MEXH 5C09D 4RZCA 3DXAA 4X6CA 1ZS8B 4Z7VB 5IB4A 4WO4C 3KNBB 1KXQE 1EO7A 5ICZA 4EUPB 1I8KA 3B9KA 1JRHH 4G6FD 1BLNA 2GITB 4QRPD 3DURB 4MQ7A 5K93A 3GMNB 4WU7A 3TV3H 4JG0L 1T2QL 4PJFB 1K3IA 1R3JA 1S9XB 3MJ9L 3NZHH 1NCBL 5EU6A 1CYGA 1A7RL 3IVKA 1DBJL 3SDYL 5T3ZH 4NP4L 4WUUD 4EN3A 5TJWK 5C6TL 2H3NB 1I1YB 4FG6D 3RTQC 2KQNA 1HDMA 1M05A 3NFPA 4H20H 2VLRB 4HUVA 3BRGC 1VENA 3STBA 5GGTL 2HFGH 1HXYA 5BZWA 4GMSL 2OBGA 4ZNEA 4NQXA 4G6MH 1I1RA 3VH8A 2UUDH 3C09B 5LCVH 3MGOB 4YGVA 2DQGH 3OSKA 4DWHA 1JIBA 1MFAH 3QCTL 3SE8L 3CC5B 5B38A 3WXVH 2HFEB 4RQQB 1IC5H 4OGZA 3RI5K 4MAYB 5ECJE 3MJ8A 4HXBL 3HFML 3HE6D 4OKVA 2IH1A 2JK5B 4WY7L 4P0DA 1GZPB 4MLIA 3AM8A 1F58L 1VKXA 2YD4A 3B2VH 2AV7B 4RWYH 2R1YA 4NQDA 3M1BB 2XZAL 1MWAL 2C7UB 2QTEA 1UEMA 3MQIA 2HRPH 1NGYB 3ZYZA 1H5BA 4IOIB 1MSPA 4R8WL 3AB0B 2MQ0A 3FHQA 1IEBA 2FZ3B 4WW2B 4DUWA 5JIHA 4HCRL 5EU4A 5T3XE 4HWNA 3HCVA 1A3LL 4JPVL 3KWWA 4ODHL 2JIXD 5FF6B 4XX1G 1MLCB 2XRAL 1GGIH 3MNWA 5KZCB 2ADGB 3L3JB 4PJ8A 5DK2B 1NFDB 1CIUA 1JHLH 1LK2A 3V6ZA 4XP1L 1AY1L 4D9QD 4P57B 5EIIA 3PWJB 1RURL 5FGBA 3H2WA 1NGWA 1V7NL 4YBLC 3UX9B 3KJ6H 4O2FB 5C08D 3W9EB 1BOGA 1VACA 3H7BB 2V2WB 1G0DA 4WTWA 5CJOH 5ABDE 5GGRY 3HNTL 3L1OH 5DUBB 2VDOL 3AMKA 4NN7C 1DBJH 5FM5O 3WIHH 1RZKH 2CQVA 1YMMD 4LOUC 4WDIB 2DOCA 5C0DB 3QH3A 3H9HA 3WKNA 5HHNA 3MLWH 1ONQB 3MOBL 1QR1A 4PJDA 1J11A 1ONQA 4GMTH 3GSVA 4ERSL 3O3EB 1AR1C 3UDWA 1IGMH 4EQ2A 2UYLA 1N64L 1LO3H 1RY7B 3BX7C 4ZFZA 3IKCB 3ESVF 4N0CC 1A64A 5MHSE 4OCRH 1UWXH 3S88H 4LMQI 3C09C 1DVFC 5MEQB 2OXHA 5DMYA 2JB5L 1QD0A 3UTPD 4PBVC 4H88L 3W9EA 2M8XA 5KOMC 3SKMB 4QWWD 1S5HB 4HK3J 3BP4A 1QSFE 3PWJA 4XHJC 1XIWC 5I8KL 1G84A 1LK2B 4TUKH 3L3JA 3PE9A 4PJ8B 3CD4A 3RUGA 4P5KB 1YEJL 3NA9L 3G6AA 5FF6A 4YDJB 2QSCL 1AP2B 2R29L 4I5BB 4QXTA 5T33H 4KROD 1FIGL 3QWRA 4GKZB 4WW2A 3BP7B 4JG1L 2WW8A 2YN3A 5DMIL 5ITFB 1M7IB 3IXAB 2BZDA 4PJIF 1Z9SA 4JM4H 3CFDB 3VFMB 5C6WH 1YMHB 3HZVA 1O7VA 4IOSD 5L8JB 3T2PA 4ZS7H 3PJSA 1T89C 2CUIA 4P2YA 1ZLWH 5FHBH 4HUMB 4GAGH 5MP6H 3HZKA 3MV8A 4PRPA 4TQEH 1O5DT 3VFRB 2R1XB 4WO4B 1BECA 1YEFL 5GISL 1PY4A 2YRLA 3VXQA 3WYRA 2CLRA 1MIEH 4HQQL 4NRXA 5K9QG 3HMWH 1OARL 4Y5XA 1FSKB 5DJ2A 4LDLB 1QFWL 1UXSB 2W07A 4KRNA 4TTDC 4OCSL 5FYLL 3WFBH 3QHTC 4O00A 3VH8B 2V7NB 1GGCH 3GSNH 1LEKB 1X5ZA 2OYPA 5MI0B 4S1SH 1QA9B 5GGVY 2BFVL 3DETD 2OTUA 3MV9A 4Z95L 1WWCA 4NNYB 1LDPL 1UWEH 2R69L 5I1GH 3C60D 3LEYH 1AGDA 4XAKE 3HZYA 4NQVA 4QF1B 1N2RA 2B0SH 5DMJB 5DZLA 5C0AE 1T0NB 2EDEA 4GUPB 3TZVD 3FT3B 2E7LC 5CGTA 4FFVC 3VFSA 2D9QB 3SO3C 4U2YA 4P3DB 2GITA 5C0FB 3S3PA 5IW3A 3PWPE 1NKRA 2BHYA 3K4AA 3I6KB 5E95B 5C3TA 5HGGS 5TE7L 1IKFH 1CE6A 4W4OC 5IB4B 2PR4L 1IGFL 4HMCA 5H35B 3VFPB 2A9NL 5BMFH 3TN0B 1T1XB 1TJHL 4RGOL 4LCCB 4F3FB 2O5ZH 5IT2L 5GZNC 4F8TA 3ZSSA 3ZKNC 5J6HB 4AG4H 2VDMH 4JAMB 2X4QB 4TULL 1NMCC 2YBRA 2OQJA 3FQNA 4JRXA 2BNRB 2WINA 3QPQD 3KS0H 2MWCA 4G8GB 1G9NH 2J4WH 4XP4H 1JPFA 3PWVA 1OAXL 4NCDA 3RDTD 1JZ8A 4EXKA 1UVQA 1W0WB 2K7QA 1ZHKB 2VITA 4J3TA 2AK4D 4I3GA 1U3HD 4AT6A 1CFBA 2MMXA 2X9XA 3KPNA 3MO1A 2N56A 3VXSD 4K3DH 5SWSD 1A7BA 1I9IL 5IR1B 4YWGH 1S78C 5GGSA 3RVWD 4Z7NE 4HBCL 1NUGA 1EEZA 3C5JB 1B2WL 1YC8A 4DEPC 2Z8SA 4X4XA 2F8VA 5I6XB 3I3EA 2NY6C 1EERB 2R2BB 2AABH 3LY6A 4X5LA 5F9JB 4KRPD 2AXJA 3QNXB 3QHZH 5C09E 5L2KD 5T3ZE 2QV2A 5J8OA 3I6LD 4RGOH 4KVNL 3HNSL 1YN6B 3FOMA 4G6AC 4QYOA 4WFFD 4F8QA 1MVFA 4ZFGH 5TE7H 3O81A 1IBGL 5E6IB 1MCHA 5IEHA 3EJYD 1RFDH 3ALXA 2BERA 3O9WA 4ODTH 3T0EA 5EZJB 4F37K 3JTTA 3ROLB 5I16A 2QQKL 4ZTOH 5C0GA 3VA2C 3L3GA 1J87A 3BGFB 2E6JA 4LLVA 5TQ2L 1FIEA 3NPSC 3MZTA 4PTUB 4Y2DA 2H8PA 1F2QA 5DVMA 3HAEH 1LEIB 1LDPH 5IQ9B 2FLRT 1E6JL 1F3JB 1HOCA 4M9PA 2E6PA 3ARDA 3U7WL 5HD8C 1MHPL 3N1FC 4PJ5A 1FH5L 5A1AA 3BDXA 4W68A 3HTLX 5C0EB 4YXLL 2GAZB 1CL7H 2NY1D 3EO1B 2GK0A 3GB7B 5B8CB 1AC6A 5T3XH 4F9PC 4P46B 3KYOB 2LV4A 4R97C 1JWUA 1KXTB 3HI5H 3BH8B 3TZVC 4KMLB 4LRNH 4ZXBD 1T0MA 2CDEA 3IJSB 1KPUA 2HH0L 2VLKD 2R4SL 5FEBA 2I25N 1DN0A 5MP6L 1F4WH 1I9RH 4Y2OA 1WVZA 1T5WB