3WJJC

Crystal structure of iib selective fc variant, fc(p238d), in complex with fcgriib
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
164
structure length
164
Chain Sequence
AVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Engineered antibody Fc variant with selectively enhanced Fc gamma RIIb binding over both Fc gamma RIIaR131 and Fc gamma RIIaH131.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2013-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjjC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wjjC02
4YE4L 4IOIA 4K7PY 1BJ1J 4PFEA 5FCUH 5IG7A 4CUCA 1W0WB 4OT1L 3HB3C 2FGWL 1DBMH 2VXQL 1QR4A 3BKCL 3IGAB 1ZLUK 4YIQB 1QVOA 2BC4B 1IEAA 4OKVA 1AXSB 2F5AH 4Q97A 1V8HA 3IU3A 3PGFH 3W2DH 1CVSC 2M26A 5ESVA 1F4YH 5MEPB 2QQNH 2QHLA 3CC5A 1AD0A 3QHZH 2BZDA 2RIKA 5CJXC 4WENB 2E27L 1N4XL 4XAKD 1KBGH 4UIKL 4BJLA 1A6ZA 4U1KA 2AK4D 4IS6B 3H9SD 4XAWH 3T3MF 4DK3A 1W0WA 4S0SD 9CGTA 1XGQB 3V9FA 3QAZC 1INDH 5GRWA 4LASH 5JW3L 2FX9H 2NY3B 3MMEB 4TPRL 4HFUH 4YIQA 1J0HA 2BC4A 2BSSB 1NFIB 2F58H 2XWBB 5ESAB 5E2JA 1AXSA 2EXYD 4HWZB 1N6UA 1ACYL 2DL2A 1BD2B 1RIHL 3PP4L 1P84J 3I6GB 1FV1B 1HKLL 2ILLA 3QPXH 1U3HD 4GSDL 4PLNC 2PUQT 3IFPA 3F5WB 4IS6A 5AG9A 3QXVA 1RZ7L 3TVMC 1XGQA 1Z2KA 5D7KD 3D2UD 4AQ1B 5CILL 5KS9E 3QCTH 3MMEA 3UJTL 4LGPB 4Y16C 1NFIA 2AXGB 5KZCB 4OLVH 4LLVB 5ESAA 3FQTB 5FYKU 4EOWL 4HWZA 2CXGA 1KN2L 4PRIE 1BD2A 5FUCE 3BQUC 5DD0L 3I6GA 1JGUH 1FV1A 3G6JF 2BERA 1QO3B 4UV4H 3EYSL 1KCLA 2KKQA 4RAUA 4WFGD 2MMXA 1TFHA 3BP5B 3RY4A 1N6QH 1GGBH 4DJMA 2DBLL 4HWUA 3BX7C 3MCKB 5F7LB 5C71A 2Z31B 1Z9MA 2AXGA 5MI0B 4KI5D 3FQTA 4CKVX 3NAAH 3VGAB 4JY5H 2Q6WA 2ARJQ 4ODXA 3PHSA 4NO2B 1G6VK 5D7LD 1ZE3C 2OBGA 3T0WA 1QO3A 2XQYK 3E6FA 3Q0HA 1UM6L 4FOMA 4RRPG 2VR5A 3BP5A 5I8CB 4L9LB 4ZG1A 3FONB 4OM0L 3LZFH 3WIHL 3ARSA 3SGEH 2FHBA 2Z31A 1AR1C 1F58H 2WUCL 5FGCE 3ARRA 1IKFH 4LKCB 3TVMD 5IKCB 1UJ3C 1CFTB 4HH8A 3G5YA 1J11A 1DUYA 3NABH 2RQ8A 4Y16D 2HJFB 3SDCA 4G6MH 3O6KL 5CEZL 1UZ6E 1WTLA 5TFSH 3DRTA 2LTQB 4FQXB 5J12C 5ALBL 2XIDA 1T03H 2GY5A 1OY3B 1W72B 3WIHA 4O00A 4V1DE 4X4ZA 3VJ6B 4NN5C 3RBSA 1FPTL 1B0WA 2XYCA 4V2CB 4KVNL 4LKCA 4NN7B 1CFTA 3OAUH 1NCAH 4K55A 2DTSA 1FL6B 4LPCA 4MAYB 4RZCB 7CGTA 3PDDA 4TNWF 4HULB 2HJFA 2VH5H 1MAML 1NFDB 1YJDC 1RZJL 4WO4C 3DURB 3WJLA 5D70L 4FQXA 1W72A 4YQXH 3VJ6A 1G9MC 3BYYA 3LH2H 4GH7B 3IJSA 4KMTH 4QRRD 5CJOL 5F71A 3TLRA 2VDKL 4PS4L 3ES6B 1TJIH 2OI9C 5ID1A 3HE7B 4K94L 3AREA 1QSEA 4S1SL 2FSEA 1A7RH 3MV7B 1YN6B 1BECA 2Y36H 1FL6A 5GJSL 4RZCA 4NM8H 5KVDH 5IEKB 1AR1D 3U30C 3C60A 1NFDA 4EZMA 4OGAC 3DURA 1G84A 3O2DL 3QDGA 4LPUA 4DGYL 2CRYA 4PJGA 4JFQB 4U6XB 5GZND 4AIZB 4EI6B 4CVUA 1B88A 3SPVA 2KZ1B 1JTOA 4LK4A 4MD0B 4RMSA 5DC0A 1IJ9A 1MVUB 4R90H 1X3DA 2NX5D 2VE6B 4IRSB 2NY1D 4MA7H 3ES6A 3HE7A 3DPBA 3RL1B 3MV7A 3U46B 4NUJB 4GMTH 4C58B 1N8ZB 4MD5B 4HBCH 4WW2B 3PHQB 2BVYA 3V6OE 4GRWB 2R29L 5C08A 3DUHA 3MRBB 3OAZK 5IQ9B 1NUDA 2BNQE 2OP4L 3BXNB 3O2DA 4JLRA 4FNLL 4JFQA 4AIZA 3QEGL 5CD3B 5E4EB 3DVFA 3TESA 4OBSA 1WAAA 1JNLL 2QQLH 4MD0A 1RZ8B 4WO4D 5IW6B 2VE6A 5GGQL 3RA7L 4IRSA 1J0IA 3MLZL 3F8UB 2FD6L 3RL1A 2YBRA 3U46A 4NUJA 5DJXB 5E6IC 2GJ6D 4MD5A 5ECJE 3VMPA 4XNYL 3SDXF 2VKWA 3LKQB 3MRBA 4TSCL 2ZNXA 1F42A 3BXNA 3LEYL 5CD3A 3C09C 5JO5B 1N26A 2KBGA 1FZKA 5IB4A 1RZ8A 4OGAD 5IW6A 4FQCH 5HHMD 1TTFA 5CEYA 1NMAH 1U2HA 4PGJA 2WK2A 2Q8BH 1MLCA 4UT7L 3AS1A 5DJXA 5F3HB 3CDCA 4R96A 3ARPA 2G2RB 2O93L 5L9DH 4LP5A 4NRZB 3CXHJ 4X5LA 4LVOC 1PDKA 1URLA 3LKQA 1EEZB 4OM1L 1FYTE 4OLUH 4FQQB 2EYSB 3T2NH 1I8IB 3D3VE 4PTUA 3U4AA 4OI8A 1BIIB 1BQHB 2ZPKH 5D2LE 4LEOB 5ERWB 4PGBA 5F7NC 5DMGC 4P4RB 4RGNC 3X17A 3K8LA 4D0BB 1B9ZA 2HAZA 3NIFF 5F3HA 2G2RA 3S34H 4NRZA 2ZCLL 5C07E 2VMFA 4OLEA 4EQ3A 5CEXB 1EEZA 5FYKD 3T4AB 3QWRD 4FQQA 5D71L 3TYGL 5E6ID 3FMGL 3QXWA 1I8IA 2DWDA 4CRPA 1BIIA 3TJEH 4LEOA 5ERWA 4XPHL 4KK6C 1P7QA 4P4RA 1IC7H 1QLRB 4DTGL 3SGKA 3L1OL 1JNJA 3K1KC 2DYPA 3QR2A 2X05A 1WFNA 1KIPB 1ZGLP 1IGCH 3RQ3A 4ELMF 5I1GL 1JRHL 3WL9B 3T4AA 3MCG1 2VLJA 1R5WB 3QXDB 5DUPL 4PJHE 2AV7B 3ZHDA 1RZFL 3KS0H 3FQWB 4AEHL 5DMYA 2FWOB 5DYOA 2MSPA 1QLRA 4AMKL 1ZANL 3EFDL 4WHYH 3ZDXF 4EEEA 5BVPH 5ISZB 2FLRT 2AERT 5DMGD 3NCYS 3RHWK 3VH8G 3ARGC 4X7SL 4RGND 5TJWK 4WU5B 5M95B 4K7PX 1K3ZA 1V3LA 2O5XL 2XA8L 3RIAK 4E41D 2YD1A 1TJHL 2FHCA 4OIBA 3WL9A 1EXUA 3BWAA 4P4KC 5I18H 1OSZB 2IG2L 1R5WA 4I9WD 1GIGL 2EE6A 1QBLH 1XF3B 5DJDB 5ADOH 3OJDB 4G6AC 1T4KB 3FQWA 1N5YL 2FWOA 4K2UH 1KPVB 3MACL 1I1YB 1KFAH 1A7QH 5J6GB 5KVEH 1RJZB 3GI8L 3LEVL 3UCRA 3MO1B 5ISZA 3VXRD 4KK6D 5CUSH 4WU5A 4TRPH 4Z7WF 3ARBD 1OSZA 4XMKL 4Z8FH 4R8WH 3SDAC 4HKBB 5DJDA 4R3SB 5DA4A 4RWYL 1T4KA 4R97B 4S1DC 4K9EL 2VAAB 2EDDA 2AVGA 4XPBH 1KPVA 2XRAL 3FAXA 1ZEAH 3LN5B 4PP2B 4BSVB 2APVA 3SJVE 3P30H 3GIZL 1RJZA 2EH7H 1LDPL 4PRDB 1OGTB 5D7IE 2IMNA 2FECI 3KYKL 1WGOA 1CL7H 3C2SA 1CF8L 3AS2A 5GS1B 1EEUA 1VEPA 5L2KA 1EBAA 1S5HB 3ARGD 4YDIL 1SBSL 4HKBA 1A6TA 5FM5M 2A38A 2VDNL 2YPKB 3C5ZB 3QH3B 2DJUA 3LN5A 4PP2A 3P9LB 3KAAA 2EDNA 5AYQA 3RU8H 3SN6N 3QUXB 1BREA 2WNGA 1OGTA 1PG7W 2VXSL 3FFDB 1XGYH 5IFJA 2E3VA 2L4OA 1HSBB 2YMXL 2IGFL 3PF2A 3BH9B 5GS1A 1DLHB 1AO7E 3C6LC 4BKLB 1S5HA 4OLWL 2ENYA 5F8QC 2YPKA 3AROA 4CL7A 3QH3A 4I77H 1SM3H 1DN2A 1DQLH 3P9LA 3SDAD 4G9FB 5ABDE 3QUXA 2DI8A 3RP1A 2JCCB 3H8NA 4TULL 3FFDA 1EJOL 3H7BB 2BY3A 5HBBA 4NN6C 4L3CB 3BH9A 2FL5B 2OTWB 1DLHA 2JJTC 5EG6C 1ZLVH 1QFUL 5DLMH 2NW3A 4F9PA 4UU9B 1OSPH 4LIQL 5EZOH 1JTTA 2R0LL 3A0OA 2FX8H 2YN5A 3BH8B 1CE1H 4JDVB 4G9FA 4U0RC 3RWCA 3VI3F 1D3CA 2JCCA 4UOW1 1XF5A 1TZHB 2X5PA 4OI7A 5E7BA 4C56D 4ODVL 3SO3B 4Y4KB 1FO0H 4L3CA 1AY1L 4LEXH 2FL5A 5D6DC 3QJFB 4UU9A 5LQBH 3KYOB 3O81A 3GI9L 5EBLB 4OD1L 4M4RA 3MLXL 3PP3K 1EA9C 3HC0B 1MWAH 32C2B 3C6LD 3QQNA 4HUMB 3BH8A 1AFVH 1ZLSL 1MFNA 3EAKA 3DX9B 1N6VA 4K23H 3RZCC 1TZHA 5KSBF 4R0LC 5TE6L 1WVZA 4KFZC 1NC2B 1NAML 3S3PA 5CJQL 2ZKHL 2AEQL 3C2AH 3RZWA 2HJLA 5T1LA 2ED7A 4LVEA 3OPZL 3QJFA 1LO3L 5EU6B 1PQZB 3KYOA 4F3FB 3T0EB 1FFQA 4ODTH 3HC0A 4GW1B 32C2A 3FN3A 3VGBA 4IRJB 2XQBH 1RD6A 3DX9A 2ITDB 3QI9A 4KY1L 4JFHE 4UTAH 1B0GB 1N2RA 2CJUH 2WIIB 3V7MA 3VGFA 2L7JA 1NC2A 4ZQKB 1NAMA 3OKLB 5ADPH 3DHJA 3BZFB 3O4LB 1MH5B 5EU6A 5C7XH 1BQUA 1JGVH 4DVBA 2OQJB 2C4FT 3GSUB 4GAJL 4F3FA 3T0EA 1WSST 1EERB 1T1WB 1GL4B 1SY6H 3GMQB 3TN0D 4M7ZB 4U2ZA 3ZYOA 4RGOL 4R2GD 4CMHB 1BD2E 3PL6C 3PQYD 1PEZA 4M93C 2FEDC 3SKJL 3QRFM 4PJ8C 2RBLA 3O6ML 4JY4B 4FQLL 2C26A 4ZQKA 3OKLA 2KL6A 2VDML 3SKUD 4P99A 3BZFA 4QHUB 3VMOA 3O4LA 3RZCD 2JIXB 4OV5B 5D7JB 1IM3B 1H3XA 3GSUA 2XY1A 5J13C 4JAMB 2D7TL 4JZJA 4MB5A 5DF0A 3EO1B 1T1WA 4IDJH 5D2NB 3GMQA 4RA0C 1GOHA 3ZDYF 3UJJH 5D9SA 3M8OH 3HNSL 2M1KA 1AKJB 4I1NB 2NTSP 3X3GH 1S9VB 4L3AA 4DKFL 3TCXA 43C9B 5DRNA 1P7KA 1I3GL 4QHUA 4XP4H 3LQMA 1NSNL 2JIXA 4OV5A 5D7JA 1J1XL 3NN8B 3QUYC 3MCLL 4JAMA 4JRYD 4MDIA 2OR9L 4PJ5B 1GOFA 1S9WB 5D2NA 5ELIA 1OHQA 1AKJA 1M6OA 1S9VA 1S9XB 3MOQA 5JUEH 1CR9H 43C9A 2P4AB 5F21B 3IDYB 1DBKH 3PL6D 3MLYH 2FEDD 4GUPB 3NN8A 5AYUH 2A73A 4PJ5A 2XG4A 4F58H 1S9WA 2JELH 4PRPD 4N0UB 3EJJX 3MRPB 5I1LB 5L7XH 1I1RA 4RNRB 1RUKL 4ZPTB 4ZUWB 4AL8L 5EH1A 2VDLL 5HY9B 2R8SL 3QIBB 1S9XA 5EO9B 3ZE1F 3WIIL 4PB0H 1VEOA 4HXAL 2GUOA 3H3PL 1K85A 4MA1C 2V2TB 4GUPA 3MUGA 4QRPB 4R26L 2LE9A 1RUAH 2EIDA 4P5TA 2I9LA 5JNYB 3MRPA 2QL1A 5I1LA 1CIUA 3FB8B 2P5WD 5E8PA 5F1KC 1MF2H 1QSEE 4MB3A 4RNRA 4ZPTA 3ARFC 3QUYD 1RFDH 4H20H 5HY9A 2DQCL 3QIBA 2ZWLT 4HIXH 4RBPH 5E8NB 5CKGA 3VDCA 5I1KL 5FYJE 1I1AC 1MUJB 1NFDE 2DQEH 4PD4J 4YWGL 1NBZB 1C1EL 1ITCA 2BOCB 2V2TA 3WFEL 4FS0A 4GMSH 2QQQA 4QRPA 5SWSD 4HKXA 1C16B 2VJXA 1FH5H 1MNUH 1MCQA 1EVUA 1P4IH 2YD3A 5T5FL 1UXSA 1AGFB 1NMCC 1S78D 3R8QA 1VCAA 3CCHB 1A7PH 3O9WD 3MV7E 4RX4D 5CIPB 1H9VA 3B9KC 4HPOH 1T2JA 1N59A 3CFDA 1BX2B 5HYSA 3FCTB 2HT4C 2EYTB 4MQTB 3FT4B 5FA3B 3ZT6A 3QQ9C 3EW3B 2BOCA 1QPPA 3UPAA 3V2AR 3V6BR 3HZKB 4CW1B 2AJSH 4K71B 1MY7A 1WAAE 2ED8A 3F7YB 4U31A 1AGFA 1D6EA 2IH1A 1JHLH 1Q9WB 4NQCB 1IEHA 3EYQD 4G8FB 1OAYL 5CIPA 5F9OH 3VFUA 4GRWE 3ULVD 3FCTA 4L8SB 3KPSD 3D69B 5FA3A 3ARFD 3HG1D 4Y19D 4YX2H 2DBJA 1YEJL 2EO1A 2IQ9H 5HYJA 3HZKA 4XP5H 4CW1A 1OTUC 3MLUH 2DKSA 2QHRL 4FXGB 1I9IL 5JIHA 4I3RH 5IVXB 1Q9WA 3GSNB 4NQCA 4WI9A 4G8FA 1AXTL 1R0AH 5EU4B 4WDIB 1X5AA 4K3DL 2QLVB 4XGZB 4L3EB 1NCCH 1IVLA 3QIWB 35C8L 4L8SA 4YFDB 3D69A 5F9AC 1SJVA 3WKNA 1FCGA 5EN2B 3T04D 3EYUL 1JGDA 3WHE0 3B9KD 2VDPH 3U7WL 2FJFB 5E6ZA 1W72H 4XMPH 4RAVB 2HT4D 3L3IB 2BY2A 1MRDH 4W70A 4FXGA 2OL3B 3QQ9D 1A47A 5IVXA 3AFLA 3GSNA 3VD9A 1UXWB 1Y0LB 25C8H 2ZCHH 3E1F1 4S1QH 1J8KA 4OCYL 2ERJB 1H3PL 4LLDB 5EU4A 4WDIA 2BMKB 2Q3ZA 4L3EA 4G6FB 2NXYB 3HS0B 3QIWA 5FYJH 4KUZH 2J8HA 4BA8A 1IT9L 1HINH 3BWUC 1JI1A 2FJFA 4WI5A 3HPLA 3N1GC 4MNQD 4RAVA 2OMBA 3L3IA 3VA2C 3IDJB 4PJDF 2OL3A 2CIKB 2DQIH 3ABZA 3EOAA 4M62H 2CIIB 5IF0B 3TA3B 12E8L 1LO2L 1OGAD 1UXWA 1Y0LA 2EZ0C 4ZDHB 4Q6IC 3ULSB 3GM8A 2CUHA 4LLDA 1OTUD 2BMKA 4X6DF 2YSSB 5SX5H 5E8EB 2Q8AL 4XNZB 2GITB 2EXWC 2NNAB 3ZSTA 1RQ5A 4TVSa 5EORL 3SHSA 5CGTA 4OLYL 4H0HB 2FATL 3PWPB 1LK3L 3P4NB 5LCVH 1A14L 3BZ4B 2YD7A 5E99L 4ZAKC 1JK8B 5MEQB 4GAGL 1M7DB 1WTGT 4FQJL 5CKAA 3IDJA 4CNIB 3MGTB 2CIKA 3KS0J 4XWOC 5IF0A 3JWDH 2CIIA 4WY7L 5C0BB 2A0LC 4ZDHA 3ULSA 4ERSL 3VWKB 2YSSA 3P0GB 2H32B 2NNAA 4GRWH 4HS6B 1C5CL 5T1KA 2B20A 3PWPA 4YHIB 1T83A 1TPXB 1UB5B 1F6LL 2BK8A 2D4DA 5KAQG 3EFFB 4CNIA 1NL0L 3WKMH 1N64L 2E7HA 1FFPB 5C0BA 1LEKB 1IQWH 4O58L 1MRCH 1QKZH 5K59F 5ISZE 4NJ9H 2V7HA 4WI4A 2H32A 1QZ1A 4HS6A 4ZTOL 5KSAC 2EZ0D 4NCC1 4XVUC 5EOTB 4YHIA 4D9RE 1NDGB 3A6CH 3CVHB 4WHCA 1UB5A 1TJGL 4WV1C 2DD8L 4IMLB 1GGUA 4U1MB 1GZPB 5JXAL 1FFPA 1SBBA 4LSVL 4WW1A 2EDBA 1LEKA 4DEPB 3IU4H 1UGNA 1E6JH 1C08B 5LGKA 4H8WH 1JF1B 3J8F7 1AHWA 4FP8H 4XWOD 3WXWH 4XNQA 3OKDB 4OZHF 3FB5A 4I13B 5EOTA 4JFFD 1NDGA 3CVHA 1MCFA 2CRIA 1YNLL 3DARA 4HS3B 4IMLA 4F33B 2VXTL 1QFOA 1SYSA 4NZJA 4U1MA 1GZPA 3L7EB 5HHNB 2XN9B 5C0RL 4D94A 1X6LA 4JDTH 4ZOCA 1A5FH 2ICWA 1C08A 1WICA 5E8DH 5GS0C 1JF1A 3HUJB 3OKDA 4HPYH 4NZTL 4YZFF 1NBQA 3VI4F 2B1AH 4HS3A 1NCWL 5KSAD 4F33A 1YEGH 3D25B 5MENB 2IBBA 5HHNA 2K9UA 4XVUD 1S7WB 4O4YL 1E6OH 4Z7VB 3ZZ1A 4PB9H 4NP4L 3E6HA 2K1MA 1F4WH 4MGXA 5DSCB 4PJCA 4OF5A 3UZEA 2BXYA 5DA0B 3HUJA 1A7OL 4G8EB 1W0YT 3RWEB 3ULUL 4BH8B 1A6PA 4JFYA 1A02N 4QTHB 5FUCC 1TITA 4BZ2L 4YHLL 4NO5B 5MENA 1SEQL 1S7WA 1OAKH 1KYOJ 3UEZA 1GPOL 1BFVL 3VFGL 1CDHA 4G9FE 2VL5B 2OTUB 2JCCE 2XTLA 5DSCA 3I2CL 1G7IB 3QFJD 4G8EA 3S7GA 1SEBB 4EQ2A 4OCWH 3RWEA 2O5YH 4M3JA 2PYEA 1ZXQA 5AAWA 1A2YB 3QCVL 1IAMA 4BH8A 5FV1L 4QTHA 4L8CB 5EC1B 4RMRA 3CFEB 4NO5A 3PJSB 4GXVL 2HP4A 1BIHA 4Q74A 2VL5A 1CVRA 2OTUA 5DURB 1WWBX 2IPTH 5E4IA 4Q58C 3H42L 3OKYA 5HYEA 5BW7C 1SEBA 2X4NB 2AABL 3IAPA 1RJCA 1MCJA 5SWQB 4PBWD 4M7LH 4N9GB 1IAOB 3V4UH 4L8CA 5IHZA 4QEGA 5EC1A 3CFEA 3PJSA 2R39A 4M8QB 3Q6GH 4PRID 5FA4B 3DETC 3QQ4B 2R69L 3RWGB 1CDCA 1P69B 2NTFB 2WBJB 1HIMH 5DJZB 4DGVH 4K3JL 3KPPB 3TT1H 3CK0H 2X4NA 1KG0B 1LILA 1QLEL 2BFVL 1A6VH 1EX0A 1KIUA 5SWQA 4ONHB 4HHAB 4N9GA 2C3VB 1IAOA 5EU6E 3TNNB 4MQSB 2BNUA 1VSCA 3T0EE 3P3YA 5FO7B 3MXVL 4M8QA 3V0WL 4XPFL 2Z8VC 5DJ0A 1R6VA 5CSGA 1I8LC 2XKSA 3QQ4A 1H5BC 3SDDB 4LAQH 3RWGA 4A6YB 2NTFA 4P59H 1P9MC 2UVEA 2WBJA 5DJZA 3IDGB 3BO8B 4BSJA 2R2CA 3KPPA 2MQ3A 5LBSH 1KG0A 4UT9L 4NZUL 3IFNL 3AMKA 2ORBH 3O4LE 4YBLB 4ORGB 1RZIB 4FQIH 4I18A 2HWZL 3TNNA 5I16A 3I75B 5FO7A 4QCIB 2JK5B 5I8KH 1LNUB 4RISL 1NGXB 1NH6A 3F7PC 4LLMB 3FFCB 1BZ7B 3ZKXC 4GS7C 1P7HL 4Y2DB 3SDDA 1D5MB 4A6YA 3SQBA 1F4AA 4L1DA 1QQDB 4JRXA 4NDMB 3SDYL 1T22B 3QDMB 2LU3A 3IDGA 3BO8A 3DYPA 4LVNB 1U6AL 1FAKT 3FQRB 4JQIH 3G6JB 2YPLD 1J1OH 3DETD 4QF1B 4V1DD 5HDOA 2YKLH 3H7LA 1RZIA 4ORGA 1FDLH 3V4VL 3I75A 3VFNB 3DMMA 4QCIA 1J0YA 5JW4Q 1KLFA 3VWJA 1NGXA 4RWHA 4LLMA 5DZNA 2JF1A 2GKIA 2VWEC 1KIRB 2C1OA 5D2NE 3VXTA 3MRCB 3LN4B 3GHEL 4XVJH 5BS0B 2DQHL 4Y2DA 1D5MA 1FIGL 1QQDA 4WEUD 1CGUA 4NDMA 1T22A 3QDMA 3CSYB 4Y8DC 3G6JA 4QF1A 1F90L 2W60B 4EUPB 3DYMA 1MOEA 2VXUL 1R5VA 1UH2A 2XI9A 2AK4B 1EO8L 3OHXB 5C86A 1ZV5A 2YR3A 4PJ5E 4LSQH 1X6NA 3HI5L 3JV4B 3MRCA 4YGVB 1MIEL 3LN4A 3RWDB 4WWKC 2GFBA 2Q87A 4L5FH 1A6AA 3CSYA 5D7SL 4XNXH 4NGHL 2XOTA 2VXVL 2W60A 4EUPA 3VFTB 4HKJB 2CO6B 4XP1H 4F7TA 3WD5H 2AK4A 3OHXA 4YBHA 5L6YH 5JXEA 2E9JA 1CGYA 2GK0B 3NMEA 2P49B 4N0UE 4XP6H 3JV4A 4N0CC 4YGVA 2X1XR 3RWDA 2VDQL 2WSKA 4LLAA 5CS7A 4N1EA 4AG4L 5IT2L 1FGVH 3M17B 3LHPL 4RRPA 3FTGB 4NZDA 5HDLA 4GG8B 4MQ7A 3MOAH 5D72L 1RUPH 5IHLB 1MCIA 5L2JA 2ENSA 1BBJA 5I76B 1N7ML 3ALWA 1CQKA 4IMKA 4QRPE 1U3HA 1YDPB 2DQUL 4Z6AT 5LG1A 2GK0A 2ATKB 2J6EA 5TPWL 3KPQB 3D2UA 3PGDB 1MEXL 2I24N 4WTXA 3M17A 4PYGA 3FTGA 3NA9H 4M7JH 1P6AB 1RUML 4LHUG 3VD5A 1YEHL 5FGBC 3CDYA 5DHXB 4YHZL 4WWKD 3TH2T 5EZJA 1KCSH 1KJ3H 5F72S 5I76A 1FNSH 1E4JA 5H37H 3ARQA 4M43H 4P23B 5FUZL 1YDPA 4FQPA 4J3OC 2ATKA 1KXTB 3HNVH 5CJXA 4LARH 1G7JB 3KPQA 3PGDA 4AH2B 4O2FB 5EWIL 3UBXG 3NTCL 3TIDB 1JHKL 4O51B 1FYTD 1TLKA 2CLRB 2VLRB 3MA9L 2NY5H 1JE6A 4QRSB 4PR5A 4IRZL 2VERN 4AM0B 5J6HB 2GTWB 4HG4K 3VRLF 3TZVB 4P23A 3D0LA 1IGIH 1IGYB 3RX8A 5LAXB 4UDUB 5IBTL 1J5OH 2RHEA 3LPWA 2V5YA 3BQUB 3QXUA 1PG7L 2ZSVB 1G7JA 1T2QL 3V6FB 4NQCE 2MPAL 4O2FA 2V9TA 5BV7L 4IEFB 3K80A 5C07D 1H0DB 3TIDA 2PTTB 4X6FB 3U9PH 2QBWA 1DCLA 2CLRA 2R56H 2VLRA 1NGWB 4QRSA 3OBAA 5B39B 1GVIA 4AM0A 4Y16A 5F93C 1FFRA 1JI2A 3GMMA 3TZVA 4QRTB 1IGYA 2UZXB 5LAXA 4UDUA 1ZLUH 4OQTL 4G7YH 3BQUA 4NO0D 2ZSVA 5IVXE 3HE6C 4OCXH 5DQ9B 2MCPL 4G7VL 3V6FA 5C8JB 1IC5L 1UFUA 3CGTA 1ZTXH 5IROC 4BZYA 4X6FA 4L3EE 4Z9KB 2JJUA 1NGWA 3SDXA 4F80A 1LD9B 5B39A 2CKBL 1JYNA 3CVIL 3BYTA 4NYLB 1UH4A 4NFBA 3PWUB 3RWIB 4UNTA 3B3IB 4D9QE 1JFQL 3R0NA 3I3EA 2V17H 5J12B 1YYML 4HIIB 5INCB 3ZT5A 3B9VA 3C08H 1BLNB 4NN5B 1LD9A 3WFZA 2DF3A 3N06B 1BEYL 2A9NL 4NYLA 3C6SA 1KCVL 5TE7H 4KZDL 4X6EA 4YNYB 4YAQA 2DDQH 1YEEL 3PWUA 3I6KB 4I3GA 2AGJL 1YJDL 4JEGB 1KC5H 4M8VA 4WO4B 5CIPH 5INCA 4XC1L 1S3KL 3KPRD 4ELMB 4XHQA 3HE6D 4Y4HC 4ONGL 4LMQI 1Q9KA 2GJZB 5I8OL 3PWPE 3HAEG 2NY2C 4GQ9H 2X1QA 1WEJL 3IKCA 1G1CA 3SJVD 3V5HB 3I6KA 4TSAH 5C0BE 4Z0BH 4GRMB 4MX7B 3N1FC 4WO4A 1PAMA 1FORH 1YZZA 3P0VL 2WUBL 2D7MA 4ELMA 4HFWB 1IM9D 2EIZB 1J88A 1UKQA 1XR9B 1SJXA 1FRGH 3MRLB 2GJZA 1NUGA 2P8PB 3O3EB 5DHVB 1I1FB 5D1ZB 5LGHH 3VH8B 3HN3A 3GSNH 3TO4D 3C8DA 4LLYB 5FOJA 4GRMA 1QSVA 1RK0B 1GGYA 4WUKH 5JHLH 2QSCL 2WQRA 4FMFA 2DQGL 1AO7D 2QEJA 1UYWH 1YMMB 1KJVB 5F7FA 2P8PA 3TWCL 1MFAH 3O3EA 5DHVA 1S7XB 2R2BB 4Y4HD 4ZOEA 4KV5E 4M6NH 3LCYA 2OL3H 1I1FA 5JOPE 3MODH 2AEIT 3E3QE 5F9WB 1A8JH 1ED3B 4OLZL 2PW2B 4ZFGL 1PLGH 3P4OB 5DEGB 3BD4A 1KELH 3PNWB 3WS6C 3C09B 3HLAB 3TEUA 3BSZH 5TE4H 1YMMA 3UC0L 4Z7WA 1JZ7A 4HUVB 1OM3L 2VQ1B 1L9NA 3TIEB 3CSGA 3OQ3B 2R2BA 3QWRA 4B41A 5DMJB 1NLBL 2XN9E 1V3JA 5E6IA 1KEGH 3I50L 4UNUA 2D7NA 4R6UA 3HTLX 4JDZA 1Q0YH 1WWCA 1ED3A 1OTTC 2PW2A 1DQDL 2DLTA 3P4OA 5AZEL 5DEGA 4PJCE 4HJJL 5E2UH 5E08H 3HUJE 4J6RH 4X0KB 1FBIH 1MVFA 3DI2B 3WMSA 1VDGA 4BFIB 4RGNB 1PY9A 1S7TA 5A43C 2VQ1A 4Y8AA 4CVXB 3HC3H 3CZFB 3SE8H 1MFCH 4NWTH 5MENE 3IAQA 1KXQE 1NCUA 3K4ZA 2XZQH 4KDTC 4QT5B 4Z7VE 4PJBF 5GRUL 1JIBA 5IFAH 4JFED 1J18A 1CT8B 1KJ2B 5J9PB 1FG2A 2H32H 3ARUA 4PJFF 3WFCL 1A0QL 3OX8B 3CH8A 3OAZH 4X0KA 3BD3A 3ILQC 2V2WA 5I1DB 5E0QA 2M8XA 5F8RC 4BFIA 1K8IB 4M6ML 4NQSB 4DKEH 4JPKL 1PSKH 2R0KL 4LSDA 2E9IA 3S35X 3CZFA 1OLZA 1WFUA 4TOYL 4KAQH 4JFHD 2W9EH 1YEKH 4UMGA 1KJ2A 5J9PA 2ITCB 1MCEA 1GCFA 5I1DA 1OTTD 3VGAC 4GLRI 4NQSA 1GZQA 2NY3D 3VXNB 4WWID 2A77L 2KQMA 5EO1B 1R3HB 3FO0L 4TVPE 4EXPX 2FLBT 1BD2D 4K3EL 4L9LC 1ZS8B 5F88A 4DZBB 5IW3A 4PJ7F 1FNHA 4FXKB 5I19L 3QDAA 4P4KB 4N1HB 4RA3A 3RWFB 4FFYH 2ITCA 1MY5A 3PWNB 2B39A 1EFXB 5K9KB 3AGVA 1JP5A 2YRPA 4XPTL 4LLQB 2AJUH 4NZRH 1CLZL 3VXNA 4OJFH 2XT1B 5KZCD 3JV6B 1R3HA 4ZFOL 3UAJC 2V5TA 5CHNA 2J3SA 5F70A 4DZBA 3NGBB 3GNML 4FXKA 4P4KA 3RWFA 4RQQB 2ZG2A 5KSBA 3Q6FA 2HLFD 4HIHB 3PWNA 3V0VB 1H3WM 4LLQA 3T3ME 3QNZB 1TXKA 4MAYC 2Z31D 5DUML 3RAJL 3THMH 2ZUTA 1I7ZB 4DFIA 3JV6A 1KCUL 3DYOA 1KN4H 3VRIB 3MRNB 1JV5B 3OF6A 1CK0H 2Z8WC 1UWEH 1IILE 3VXPB 1LWRA 4JRXE 4ALAH 4W81A 2FBJL 3SDAA 1YECL 5I9QB 5F3BB 4HIHA 4F8TA 2AS5M 3CUPB 4JFDB 3V0VA 4ZXBC 3HE7C 2EDFA 1AQKL 4F9LC 5INDB 4RFNB 3QNZA 2W0LA 2BNRB 3LPFA 3OKEB 2VUYA 2V5RA 3HI1B 5I74C 3VRIA 3MRNA 1JV5A 5CJ8A 2IWGA 1LO0L 4I2XB 3H9YA 4E0RA 3VXPA 4QTIH 3CFBB 3GUTB 3QDME 1G7MA 3C6LB 2HG5B 1RV6X 2W9DH 3RVVD 3UAJD 5F3BA 3HZVA 4FQXD 4Y5XC 3G6JE 1T7VA 3U36B 3JWDC 3RGVB 3I6LE 2OXGA 5INDA 4U1GB 1C5BH 1XR8B 2BNRA 2A6IA 2EH8L 1EJ6A 4I3SH 2C4XA 5FDYA 4WW2C 5KVFL 1BF2A 4LRNH 4F37F 3WDIA 4YBQD 1J0ZA 5ALCL 4MAYD 5BS0E 5JIPA 3O3BA 4I2XA 5E4EC 3CFBA 5KBNC 5FYJD 5I2IA 3GUTA 3FOMB 3PWJB 3C6LA 3V52H 2YZ8A 4JM4L 3U36A 5HI5C 5HHVL 4U7MA 2C3GA 5F7DB 3ZTNH 1XR8A 3BI9X 1WZLA 1NBVL 3P9MB 5F7UA 1QRNB 1MJ8L 1DN0B 3TH4T 1JPSH 4XAKE 5TF1L 3DROA 2AK4E 1QHOA 5JHDB 4KTDL 4ZXBD 4Q0XH 3HE7D 3MJ9L 2XZCL 2D03L 1S9YB 4ODSH 2DQTL 3UYPA 5GIRA 3U7YL 3BGFB 3FOMA 1QFWM 3PWJA 1JZ5A 2JJTA 4AQOA 4LSTL 4TUKL 2A2QT 4OFIA 4UIKH 3KPMB 2Q86B 1YQ2A 3P9MA 1CXLA 1DN0A 5F1IB 2VUOA 4IRSD 1CFVH 1DTUA 3RNQB 4PRAA 5JHDA 5T33L 1F3DH 1OT2A 3RZCB 1KTLA 1DBBL 4TPRH 1QFPA 3RVUC 2AJYL 1S9YA 4M4PA 4R0LB 4TTGA 5SV3A 2ZUUA 1EDQA 1YEDA 1G0YR 2EEAA 5H8DA 4YHNB 3QRGL 5D6DA 5ACZB 4XXCC 1DLFH 2OMNA 4IHOB 4JO4H 1RIHH 4WTWA 3PP4H 3D0VB 1RIVL 4GSDH 3GSOB 2Q86A 3PQYA 1WZMA 5F1IA 3B2VH 4HWEL 3BISA 3RNQA 2PW1B 5I15L 3OXRB 4WFGE 1CE6B 3RZCA 2BDNL 3UJTH 3QUKB 4YK4B 4R0LA 3BPNC 3BHBB 4JRYB 4YHNA 3WHE1 5C3TA 5DJAA 5ACZA 4G6KL 4IHOA 2YA2A 3ZSSA 4OD3L 3GSOA 5FKAB 4HWBA 1YUHB 4ODHL 4Q2ZA 5GGTL 1KENH 2R4RL 4YXKL 3OXRA 2DLIA 1CE6A 4QXTB 2Z92B 5I1CL 3QUKA 4M93B 5EBWA 4J7RA 4PJ8B 3RJQB 2D2OA 4JRYA 1QUNA 1FQ9C 5IUSA 2EE2A 4BH7B 1R3KB 1KPRA 2F19H 3RVUD 5IQ7H 5J11B 2VLRE 3IKKA 4I0CC 5FKAA 5J13B 4J3VA 1DFBH 4X80L 1YUHA 4EUPH 4M3KB 3ROOB 5GSVB 1CLOL 2O5ZL 3UYRL 1BJMA 1F6AB 4MCYB 4Z95L 4Q9CA 4QXTA 2Z92A 1CCZA 3QZWG 3HI6L 5DJ6A 3CMOH 3Q3GB 3QEQB 4PJ8A 5GGSB 1L9MA 1HH6B 1XGRB 4QXGL 5TH2B 2IFFL 5IFHL 3D9AH 4PRPA 4QGTA 3RGHA 3H2WA 1NC4B 1RK1B 2PR4L 2OJEB 1WITA 1GHFL 1R3KA 2ICCA 2OZ4H 4NC1E 2P5WB 4PPTA 4Z7UF 4WW2F 2APFA 3MYJB 3S5LA 1TENA 3NFNA 1OOAA 3IDMA 5GSVA 5E70A 5BVJB 4MCYA 2A74A 1TZIB 1FPTH 2J6EH 3Q3GA 3SKMB 4KVNH 1RU9H 1ZT1B 1HH6A 2GCYA 2B4CL 5DFTA 5TH2A 4R97C 4WCYL 1RK1A 2OJEA 1JWUB 1G6RB 3HC4L 3LRGA 2BVQB 2ESVB 3WFHA 2P5WA 4NUGL 1P6FA 1MAMH 3MYJA 3GMLB 1RIUH 5I0ZA 5IB1B 3BFOA 4JO2H 3MRRA 4LPXA 4YUEL 1NMBL 4HD9A 4A2MA 5KG9B 4HIEB 2QQKL 5IVNA 3SO5A 1A7NL 1L7TH 4PJDB 5F1SA 5HHXL 3SKMA 5SWSA 3EDDA 4HMEA 2VDKH 4PS4H 5ISZD 1J8HB 1ZT1A 3WDJA 4S1SH 3MRKB 3NIFE 1FZOB 5E2TL 3CX5K 1KV3A 5C0CB 1JWUA 3NVQA 4MXQD 3C5ZC 2BVQA 4MA1B 4TQEL 1RJYB 4X4XB 4X6DB 3ZKSD 4D9RD 1MCKA 5IB1A 1TZGL 2Y07L 1OAZL 3HNTL 5AUMB 3ULVL 1KXVC 4UNVA 1EUUA 5KG9A 3MLVL 4Y19B 2HFGL 5C9KA 4KK5C 2P45B 2ED9A 1AD9B 3S36X 4IOFD 4PJDA 2AV1B 3NZHH 1X5FA 3TM6A 3BN3B 1PKOA 1J8HA 4OCSH 3TGXA 1I1AB 3MRKA 1FZOA 1JZ8A 1ITBB 5IIEA 4X6DA 4ELME 3MOBH 1BQSA 1BJ8A 4U0QB 1UADC 1WLHA 3ECBA 1XGPB 4C54A 2EDYA 4FABH 5AUMA 5DMIL 4ELKB 4MXWH 3QXAB 3VDBA 3HG1A 4Y19A 5I66A 4R7NB 3P2TA 1QG3A 3S88L 3LKSA 5DJYB 2AV1A 4KPHL 4HKZB 1MCOH 3AU1A 5LKNA 4U1NB 1I1AA 4U05A 4HUWB 3ZDXE 1S5IL 3T3PF 2IADB 2COQA 2E6PA 4GAFB 4LMQE 1FZJB 3S3JA 4LFHG 4R4BB 3MC0A 1XGPA 2L0DA 3CJJA 4MA8L 4ZS7H 1MPAL 3NCYP 4NKOA 1CG9B 3C5ZD 4G43B 3QXAA 4ELKA 3NBNA 7FABH 3EGSB 4M7LT 2KZWA 4R7NA 5I1HL 5FV2A 4Y5YC 3SO3C 1D6VL 4Y1AB 5BCAA 4Y4KC 3EYOB 4HKZA 2DI7A 3TBYA 4U1NA 3UX9B 3CPLB 4MNQB 4E42B 2P48B 2WLYA 4HUWA 1EFQA 4NQDB 4KK5D 3CNKA 3NOIA 2IADA 1OGAB 1FZJA 1OARH 3E2HC 3GJEB 2OSLB 1YMME 4R4BA 3QO1B 2QSVA 3F12B 5EBMB 4OM1H 4OZHB 4N0YH 5EZLB 4UOJA 3V79C 5FB8A 5E00B 4NCDA 3WUWB 4G43A 1WISA 4N8VG 1X5XA 4UINL 3EGSA 2C1PB 4X5XB 5FYKE 1F8TH 5EO0B 5HDBF 4Y1AA 4PV8B 4G9FD 3EYOA 2F74B 1CLCA 4CVWA 4MNQA 1PYWA 1P4LB 4E42A 4GXUN 1IZKA 1CLYL 4NQDA 1U8NB 3DVGB 4JHAL 4GG6F 1OGAA 4JQXC 1FNLA 3GJEA 5CLWA 2OSLA 2ZCLH 5DC4B 3QO1A 3F12A 1CD0A 5EBMA 4IRJC 3VU2A 4E9LA 4OZHA 2GT9B 5E00A 5FCUL 3WUWA 3O3AB 4KJYB 5ESQB 3W11C 4OV6F 2Z93B 4RMUA 2C1PA 3DUUB 1DBML 1Q9LB 1B4JH 5EO0A 4BM7A 4PV8A 2W1NA 2ATPB 3C5SB 2F74A 4NBYB 1NLDH 1P4LA 4YHMH 2F5AL 1U8NA 3DVGA 3PGFL 3W2DL 4Y4KD 1F4YL 4LL9A 2QQNL 3BAEH 4ZD3L 4M7ZC 3RFZC 1KBGL 5L8JB 3BRFA 5E95B 2GT9A 4RGNE 4H5SB 3O3AA 5ESQA 2HRPH 1A3RL 2YD9A 2Z93A 1U8HB 5JLZB 4BUGA 2XFXB 3DUUA 1Q9LA 2YC1A 1RZFH 3GMPA 1INDL 4I9WE 5FECB 5CSZA 2ATPA 2FX9L 3C5SA 3FT3B 3L3GB 4HFUL 1B6UA 1ZANH 3EFDH 5GJTH 2F58L 3MRGB 3H3KA 1NC2D 3G6AB 2YD2A 4L8DB 4ZAKB 3U83A 1PG7X 2NY4C 3IAGC 2I26N 4S10A 5HGGS 3QPXL 2CK0H 3WN5C 3T0ED 4H5SA 4HX1B 4ZYKA 5DHVH 1U8HA 5JLZA 2XFXA 5KW9H 4TSBH 4DVRH 2AQ2A 2NY5C 4M6OH 4IRJD 4I4WB 5FECA 1T5XB 2KH2B 3QCTL 3L3GA 1IGJB 3MRIA 1HYSC 3KWWB 3W11D 5J4MA 4OLVL 1IEBB 5IJKC 5GRJH 3IJYB 4FQ1L 1ZA6B 3VGDA 5TDOB 1YNTB 3G6AA 2LV4A 4L8DA 5IVZA 4ZAKA 1JGUL 1B0RA 4AENA 1NAKL 4P2OC 1X5JA 2DMKA 4EN3C 1MCWW 3OZ9H 1Q72L 4UV4L 2A6JA 4HX1A 5F6IB 1N6QL 1GGBL 4GO6B 2R0ZH 1EGJH 5IHBA 1T5XA 5BOZG 3CFCH 4CADB 4JHWH 3KWWA 4OF6A 1PZUB 2DIJA 4XRCB 1IEBA 3IJYA 5F7WC 1ZA6A 1D5XB 3NAAL 4JY5L 4O2EB 4N8PA 5FKPB 5C70A 2RAMA 2DLHA 2J5LB 4WV1B 4D3CL 2O26U 2EECA 3RUGF 2JIXD 1R3IH 1CF8H 5D7JD 1UWGH 1VPOH 3MV11 2GHWB 4M02A 5FO8B 3NCFB 1GOGA 4KROB 3QUMB 4CADA 3GB7B 1AKJD 4DUWA 1I3VA 1F58L 3B5TA 5KSAA 3B5GA 1C5DB 2J4WH 4LCWB 1FAIL 2VXSH 2CSPA 2VSCA 4WV1A 3MLRH 1HYSD 3T1FB 1RZGB 4G6ML 2IGFH 5GXBB 1KTKE 3QPQC 1P53A 3QFJB 4GRLC 2A83B 1T03L 5FO8A 3LQAH 4YDJB 3QUMA 1G7HB 3GB7A 4DN4H 1Q1JH 2H1PL 5ACLA 3PGCA 3I3BA 1KJ2H 1C5DA 1BQLL 4LCWA 3OAUL 1NCAL 2BOBB 3P11L 2SEBB 1OPGH 2IANB 2I27N 5DQJB 4L29B 4JFDE 3T1FA 1OF2B 2VH5L 4MS8C 2BNRE 5HDQH 3QFJA 3IT8D 4MQXC 1E4KC 2WINB 2A83A 3W39A 1QFUH 4DGIL 3X13B 1HEZB 2R1WB 4YQXL 2KPNA 2HT2C 4YDJA 1T66C 3SKOA 3MQIA 4KMTL 1G7HA 1OAQH 1TJIL 4I2XE 2R15A 3C9NB 3ZDYE 4OSUH 4XWGL 4K71C 3WDHA 1A7RL 2BOBA 2VTFA 1M7XA 2SEBA 4NM8L 5KVDL 4L29A 1FP5A 1OF2A 4ODVH 4LHJB 4QRPD 1F3JB 3Q48A 3KXFB 4PJIF 4LLUB 5FHBL 4X6CF 3MZGB 4GW4A 4E5XA 2WINA 4RMQA 2R1WA 4K8RL 4L8SC 2CUIA 4OD1H 1HDMB 2WIMA 1GJIA 1HH9B 4NO3B 1KB5B 4KQ4L 3C9NA 4F15B 5CWSB 4LGSB 2P47B 2E9WA 1QOKA 1U8KB 4BK4A 4GMTL 5F6HI 4GLRH 2BX5A 2ZKHH 3T8XB 1F3JA 3FOLB 3OKNB 3VXMB 3KXFA 4LLUA 1EUTA 1QRNE 5LGJB 1KSRA 5JHDE 4UB0L 5K9QG 1OW0C 2QQLL 1HH9A 4MS8D 1F3DJ 4NO3A 2FJHA 1KB5A 5GGVH 5CWSA 3CD4A 2HT2D 1U8KA 4Y4FB 1WFTA 1T66D 3O11B 1AC6A 2N56A 5HJ3B 1KULA 2G9HA 4XBPB 2WWKT 3UTSB 3FOLA 3OKNA 4NNYB 2X4SB 1FFNB 4UILH 2QJDA 2YPLB 3C5JA 3E8UH 3VE0B 4F7CA 3L95A 4GAJH 4NQCD 4JPVH 1GGIH 2XWJB 3FO2B 4FQCL 5BW7A 4Q6YA 1NMAL 2Q8BL 1AGEB 5J57B 3CX2A 3AS3A 3ILPA 3O11A 5HJ3A 3TA3C 5L9DL 4FQLH 1HHHB 5EB9A 3O8XB 2VDMH 4NNYA 2X4SA 2V7NB 4OLUL 1ZA3B 3WIFA 1X5HA 2YPLA 3T2NL 2Q3AA 1H5BB 3D39B 5EU5A 2ZPKL 3WE6B 2XWJA 4LHUB 3UBXI 1T83C 3UTTB 1QNZL 4DN3H 4JRYE 3MR9B 4L3ED 4MWFB 1QFWI 5I1EH 3QIWD 2M2DA 3FHQA 2D0GA 1A4JA 5GHWH 3R06B 1TETH 2J8OA 4HZAA 5KOVC 3WCYA 1HHHA 3IF1B 1EIBA 2V7NA 4XBGB 5C0IA 3BJLA 1ZA3A 1QHPA 3VWKC 3ZKXB 4PJEB 4GS7B 1I8LA 5IM7B 1H5BA 3D39A 4ZO9A 4EVNB 3TJEL 3ARXA 3WE6A 2FGZA 3LS4H 1YY8B 5B22A 2UY6A 2UZIL 3NFSH 1DQJB 4JFXB 4LHUA 3UTTA 4HXBL 1IC7L 4MWFA 3MR9A 4G6FD 2NXYD 1UA6H 1XF4B 4PREB 1E4XI 1ZWIB 2GSGB 3QJHB 2HFTA 1IGCL 3BZEA 1KF9B 3HMWH 5CMAB 3GRWA 4WNQB 5TDPB 4WHYG 1KTDA 5HVWA 2R23B 4XBGA 1LO4H 2ADJB 2V9QA 3TA3D 4EVNA 4LCIH 4JREB 2PF6A 1UKTA 5DD6B 1YY8A 1IC4H 1DQJA 4HUUA 4JFXA 3HRZA 5DD1H 2Y25A 1XF4A 2YHGA 2R8SH 4PBVC 4BYHA 2GSGA 1M05B 5BVPL 2P5WE 4OZGF 3WIIH 3S96B 2YD8A 4DEPC 4ZODA 1U8LB 3DV6B 2R23A 5I18L 4X99B 2ADJA 2VZVA 4OKDA 3KG5A 5ADOL 3K0WA 3KJ6H 1O5DT 4F57L 5DD6A 1F4XH 2A1WH 5I71B 1Z9OA 1T20B 4K2UL 1S7QB 1FVEA 3VWKD 1KFAL 1A7QL 4PLOB 3EJZC 1MHHB 3WFBH 1CN4A 4NRXB 5KVEL 3PABB 1EAJA 1HWHB 4PJXF 1M05A 2ESVE 1UB6B 5CUSL 3S96A 4D8PB 3ZKMC 4HWBH 3FO9B 2CDFB 3DV6A 3G04B 4TRPL 1RMFH 4W4NA 1ETZB 4XCEB 1C1EH 4P9HH 4X99A 3L7FB 5J0BA 4G8GB 4R8WL 4WWKA 4YPJA 5IMOB 1IGMH 5FM8A 4PJDE 5EOCH 1BWMA 4XPBL 1J8HE 1X5GA 1DEDA 1MHHA 5DMKA 3VXSB 4NRXA 3P30L 3PABA 1GH7A 2EH7L 4X6DE 4D8PA 3MRJB 3FO9A 2CDFA 3L7FA 4G5ZH 4G8GA 4EXKA 5JOPD 4KZEH 4Y19E 2EDJA 5IMOA 4KK9C 1R3JB 1WWAX 1NEZG 1KIQA 1AI1H 4KHXH 3VXSA 4U6TA 2XA3A 5D96B 2HFEA 3TCLA 5E2WL 4P9ML 1XGYL 3MRJA 5C07A 5FF6B 5BQ7B 4U1JB 3ROLB 3EJZD 5HYQB 5MHSE 5B21A 4OUUB 2XN9D 5H94B 2Y1VA 3D85B 3RWHA 4J3WA 3ZKMD 2F54B 2QHRH 5HVGB 4DQOH 1ONQA 2VITB 1RURL 1A21A 2GI7A 1UC6A 2AAVA 5HGAB 5FGBA 2BVOA 4I77L 1DQLL 1HQ4B 5K59E 4HH9B 4U1IA 4K3DH 1MCNA 1UJTA 3T0BA 35C8H 4P2QD 4M7KL 3VGHA 5BQ7A 4F2MB 4U1JA 5HYQA 4LRIC 5MEND 5H94A 4N9OB 1KTRL 2MTPA 3D85A 4Y1AE 3AB0B 2VITA 5EZOL 2FX8L 5HGAA 4MNQE 1Q9OB 1NCDH 1CE1L 4NQDE 4OCYH 1HQ4A 3MJ6A 4HH9A 1G6RH 4QRQB 4KK9D 1OGAE 3S4SG 5GGUB 4FMKA 3W9EB 1WJ3A 3KLAB 4F2MA 4OZHE 4HK3N 4XP9H 3KPRB 1REIA 1FO0B 4LEXL 5DD5H 1X5LA 1NGYB 3EHBD 4W6WB 2BCKB 3BDYH 4JFOA 1U8OA 4KV5F 5LQBL 4RCAA 2N4IA 1JN6B 2ZUYA 3OB8A 1EO7A 1NGQH 2NR6D 1JWSA 1MWAL 4W6YB 3PIQB 1AFVL 1INQB 2JJSC 4QRQA 4XHJC 2Y6SD 3VW3H 3LDBB 4K23L 2P8MB 5BXFB 5GGUA 3RKDC 4PUBH 1SJHA 3H0TB 1K4CA 3W9EA 3KLAA 3OJMB 2FATH 4NSKB 4U1SB 3KPRA 4YZFE 1FO0A 3C2AL 1JZ6A 3OG4B 3HE6A 3VI4E 2BCKA 4DW2H 1U8QB 3FB7A 5IROA 3MV9B 2EEDA 1JN6A 5DURD 3HZYB 4WY7H 1I8KB 1U8IB 4FFWC 4PJBB 4YBLC 3H9HB 4KC3B 3PIQA 2JJVA 4CMMA 2XQBL 3HZMB 4PLJC 3F6IA 3TJHC 2GJJA 4ERSH 2P8MA 4PJFB 5BXFA 4UTAL 2CJUL 3N85H 5DDHA 3H0TA 4DKDC 2C9AA 3D48R 1IM9A 4LVNC 2BHZA 1UEMA 2NYYC 5C7XL 1JGVL 4HF5L 4TN9A 1DE4B 3FN0H 1EHLH 3MV9A 3HZYA 2WBJD 1I8MB 1U8IA 4Z7VF 4PJBA 3MXWH 1SY6L 4Z77B 1JZ3A 2UYLB 3H9HA 4OZFG 2AQ3A 4JRWA 3SKNB 3HZMA 3N0PB 5ICXB 5JDSA 4HAFA 4PJFA 3A67L 4NQED 3B4NA 3GMNA 4ZTOH 2NY2B 5KTEH 4Z7NF 2YPVL 2DS4A 4XHJD 1AJ7L 2VC2H 3L6FB 1AO7A 1DBAL 3RKDD 4KRMB 1MLBB 1DE4A 5T5NG 3SDDD 3GKZA 2QKIB 3KHOA 4Y4HA 4IDJL 4ESKA 1I8MA 3BPLC 1SY6A 4PJ7B 1MI5D 3UJJL 3SKNA 5ITFB 5JXEC 3GKWH 3M8OL 4HUNB 5FAAA 3RHWF 2Y4SA 4YJZL 4L4TB 4FFWD 3RIAF 1WBZB 5DR5L 3S97C 2XWTB 4PLJD 1NFKA 3TJHD 1T1YB 4XP4L 8CGTA 3FFCD 3T1WA 3FAWA 3ZTJG 3DHMA 4Y2DD 1IBGH 3EOTL 3GGWB 3SE4A 5C0RH 5F7KC 3MRHB 2QKIA 3QDMD 3NPZB 1WUNT 1L0XA 4NC2B 1KNOB 2NYYD 4PJ7A 3GFUA 4ACPA 3EO0B 5ITFA 3I6LD 3TP4A 5I73B 2F9BT 4HJGB 4L4TA 4JFEB 5CCKH 5I1AB 5JUEL 1J0KA 1WBZA 3P77A 4HK3J 3I84A 1N5AB 1T1YA 4UTBH 1HHJB 4EDXB 2YUWA 4RFOH 5L0QB 3MLYL 1NCWH 5AYUL 3VGGA 5BS0D 3EDKA 3GGWA 1DL7H 2JELL 3MRHA 3TBTB 4GKOA 5L7XL 1KNOA 4NP4H 5D1QC 3EO0A 4LCWE 5B38B 4MLSA 4YHYC 4MJ4A 4HJGA 1PD6A 2ZOKB 4JFEA 1KEML 3P4MB 2VAJA 1CBVH 5MEOB 1BFSA 3QFJE 3FQXB 5JXED 1HHJA 4EDXA 2W38A 5FM4A 1INEH 3BIKB 3IGAA 3QDJD 4O2CB 1OD7A 2DMCA 4XCCH 1GYAA 4JKPH 3MGOB 3ZLQC 3TBTA 2BHYA 1JMZA 2QSQA 3WS6A 4XPAH 4P23C 2HT3D 1MF2L 3RTQC 4HLZG 1RFDL 4DCQB 3GBMH 4JZNB 4H20L 5B38A 5MEPA 2XXMB 2IANE 2ZOKA 4HIXL 4UDTB 3P4MA 5CP7B 2DQEL 2BSED 3SBWC 4JO1H 3QCVH 4HW6A 3FQXA 4B50A 4GMSL 5DK0B 5JZ7C 1MNUL 4O2CA 1P4IL 4GXVH 4RMVA 4EI5B 3MGOA 4MCZB 4UV7H 2BSSA 1ZLWK 3S9DB 2YN3A 2Q76B 3TZVC 2XWBA 3HB3D 1A7PL 4NFCA 1I1CA 3CAFA 4JZNA 5B8CB 1UWXH 3JSSA 4QKXB 1E28B 3SOBH 1VFAB 4UDTA 3UROR 2FR4B 5CP7A 2OJZH 1FN4B 3F5WA 3KXFE 5K9JH 4KDTA 4FZEH 1G7LB 2DI9A 3BJ91 3PV7A 4NC1C 3SEPA 4F7EB 5I1JH 5DK0A 2LAGB 1RULL 4EI5A 1I85C 3DXAB 2Q76A 2Z91B 1NQBA 4LLVA 4KTEH 1QFHA 2PO6C 4K3JH 1E28A 2QV2A 1VFAA 2FR4A 3RL2B 1FL3B 5F9OL 1FN4A 1Q0XH 4P23D 1QLEH 1OD9A 4U49A 1LE5B 1AGDB 3EBAA 1JJUA 1G7LA 5HVHC 3KJ4B 2IQ9L 5HYIA 3MNZB 2K3TA 1IAII 3DOSA 3MLUL 4KWUA 3MXVH 3QUMH 3MCKA 1B4RA 4XPFH 4X9IA 4I3RL 1CXFA 2Z91A 3CFKB 1IGTB 1IGFH 4FN0A 2VLRD 5JZ7D 1R0AL 3L3DB 1GAFH 4NO2A 4S2SB 5TGBB 1FL3A 1NCCL 3VXUB 3TZVD 4QRUB 3UTSE 4JZOB 5FK9B 1LE5A 1AGDA 2CGRH 4D0DB 3UMTA 4L9LA 5I8CA 3FONA 3BQUD 2C7UB 3MNZA 2VDPL 2YPLE 1T04B 1W72L 3DGGB 4MYWB 4XMPL 5FYLE 3L5XH 1MRDL 5GS0H 3BPOC 5FGSA 1TNNA 2A9ML 3SCMB 1CFSB 1T7WA 3CFKA 2ARJB 1IGTA 5IKCA 3NACH 4S1QL 3QA3B 1B2WH 3SDYH 3L5HA 4GT7A 3CLFH 4M1CC 3TPUB 1H3VA 1U6AH 4LSUL 2JKXA 4S2SA 5TGBA 3VXUA 4F8QA 5FYJL 1HZHH 4KUZL 4QRUA 4JZOA 5FK9A 5I17B 4O02H 2PO6D 2YXMA 3VFOB 2UUDK 2C7UA 3G5VB 3DGGA 2AI0H 3V4VH 3B9DA 3D39E 1KCRH 4KKNA 1T1ZB 3U4EB 5ICYB 4HAGA 1BF8A 4CAGA 3Q2CA 4Y89A 3UTTE 4CVZB 2DQIL 1CFSA 4M62L 2ARJA 4ZXBB 4U7KA 4XVSH 1EMTL 4OGYH 3QA3A 1CFQB 4KJQC 3TPUA 4MAYA 2PTUA 3T0VA 1EH9A 2WP3T 5I74B 4PY7B 5I17A 3OKMB 4N0FB 5LCVL 3S6CA 3VRLE 3G5VA 4C59B 4D9LH 3Q1SH 5TQ0H 3U4EA 5ICYA 4CVZA 1KB5H 4Q9RH 5HYFA 4Y5XB 4OIIH 1MIEH 3JWDL 4ZXBA 1L0QA 4AIOA 2FJGB 3PXJA 4F9LA 5J8OA 1CFQA 1YN6A 5D1ZC 4Z7UB 5IEKA 1QSFB 3BGAA 3SE9L 1EAPB 2VXVH 5LXGH 1ORSB 4PY7A 4PRNB 4N0FA 2VWEE 4WJ5B 1M71B 5ENWB 1WIOA 4P3CH 4M1CD 4U6XA 4EI6A 3TFKC 1VGEH 2NPLX 1XGUB 3INUL 4XNUH 1MVUA 4MSWB 3WKML 1QLFB 4Y5XA 2OCFD 2VDQH 1IQWL 4YLQT 5C1MB 1BVKB 1MRCL 2HA1A 5DHYB 1QKZL 4NJ9L 4Z7UA 1N8ZA 1NKRA 1EAPA 3PHQA 2BSRB 4WW2A 5F9WC 1UM5H 4QYOB 2P1YA 3O2WH 4PRNA 5IQ9A 2B1HH 5CZVH 2LVCA 4WJ5A 5ENWA 3A6CL 4KJQD 3CXDH 3MROB 5FYLH 1F97A 3EJYC 4JO3L 5F7EL 3LKOB 2V2XB 4MSWA 1QLFA 5EOCJ 4PTTB 3BKYH 3IU4L 1BVKA 2CKNA 2RCSH 1ZVSB 4H8WL 4FP8L 1UM4H 3GM0A 3WXWL 4YHZH 5JPMB 4J4PC 4G8GE 2YK1H 5D1ZD 4U33A 1L7IH 5JO5A 1U58B 3T65B 5DC9B 3LKOA 5HVFB 3TYFB 5T3ZE 5GSRB 3TFKD 1A5FL 3VXSE 3NTCH 1YMMD 4X7EC 3LQAC 2CPCA 5SX4I 3EYVB 1H8NA 3HMXA 3GRWH 1WZ1H 4HPYL 1DEEB 1DANU 5FEBA 3QXTA 5JPMA 4Y7MA 5I1IH 3OTTA 2EYSA 2ZUXA 4M9OA 3OGCB 3BPNB 2HTLC 1NDMB 1A6WH 2B1AL 1BQHA 1QFWH 1YEGL 3T65A 4WFFD 4XXCA 2AEPH 3LKPB 3P0YH 1T2QH 2Z35B 3BE1L 4LLWB 4OI9A 4WEMB 3TYFA 4D0BA 5DD3H 5DTFB 4PB9L 2EIBA 2I9TB 1ZVHA 4FFVC 5TF0A 3EJYD 3U4BL 3RY5A 3EYVA 4NWUH 1ZT7B 5CEXA 2PYFB 1DEEA 3BIAX 1P4BH 3OGCA 1GGCH 5DRXB 2F54E 5DJ8B 1MAKA 3GO1H 5HGBB 3S37H 5KJRH 1E4XH 3DNKA 4LLWA 4J4PD 4ZFFB 3P73B 1OAKL 4JKKA 3AMLA 5DTFA 3SE3C 2I9TA 1QSZA 4OF3A 4GXUM 1KIPA 5IB3B 3H6JA 1ZT7A 2EDHA 4OCWL 2O5YL 3U1SH 4ZTPH 4B0MM 3QXDA 3CVIH 4XXDB 2MJWA 2PXYC 3KYAA 2AV7A 3I02B 4NFDA 4ODUB 1QD0A 4LQFL 3WYRA 3P73A 4ZFFA 3B2UC 4KH2A 5GZOC 4GG6B 5IB3A 5D8JH 1FNAA 4LNVA 4M5ZH 1A4KB 3NGBC 1N3NB 3KPRE 4HBQA 1QEWB 4FFVD 4JB9H 1BEYH 3BESR 3K8MA 4M7LL 4XI5C 2PN5A 3C8HA 1IL1B 1XF3A 3N50A 4MJIB 1G0XA 3OJDA 3V4UL 3I02A 4ODUA 4UT6H 4PLKC 4XH2B 2VZ1A 1CWVA 1YEEH 5C0GB 1I1YA 5T3ZH 3ZL4H 4QXWA 4NKQB 2YD4A 5J6GA 2UZYB 2J88H 5JIIA 4ZUVB 5ICZB 2MFNA 3MO1A 1HIML 2E6QA 4XC1H 4DGVL 4GG6A 1S3KH 4WI7A 3K2UH 3CFIC 3TT1L 5I8EB 3CK0L 1A4KA 1VFOA 1D5IH 1T7YA 3O41B 1A6VL 1N3NA 3EOBB 4UBDC 5E9DD 4K3GA 4FRWA 1MHPH 1FLTX 2NLJB 1NBYB 1IL1A 5I9QC 4HG4J 2B8OT 3ZKNC 4R3SA 1MIMH 3MV9E 1NGPH 5JQ6H 4XH2A 2VAAA 4P4KD 4RFNC 4XCFH 4PJBE 1ZK9A 3O6FC 2VQUA 3BKJH 1EFXD 2F53B 4LAQL 4BSVA 3HAEH 4G6AD 2LU7A 4ZUVA 5ICZA 4P59L 2WUBH 4PRDA 4PJFE 3LRHA 1YY9C 4RSVA 4AZ8A 1SMOA 2VOTA 5I8EA 5LBSL 5GZOD 2VDOL 4LCYB 3O41A 3EOBA 1MELA 1QP1A 5C6TL 4JKLA 4M03A 1NBYA 3VFPB 3OF6D 1HCVA 4FQIL 3IETB 3RGVC 5I8KL 4OLXH 3C5ZA 4U1GC 1RZKH 1VACB 3CFJB 2FDBP 4XI5D 5JPNB 2F53A 1BMGA 3LKNB 4PLKD 2FEEI 4S1DD 1LP9F 4KRNA 3S37X 2QSCH 4IDLA 1MJ7L 1HSBA 3DIFB 4ZOAA 1BAFH 3MTRA 1J1OL 1CGVA 4LCYA 5HXMA 2QR0B 2WM0A 5EBGA 4Z18A 4QHLB 1DVFC 4BKLA 2YKLL 4BFBD 3VFPA 3NA4A 3IETA 4MZ3A 2EDOA 1BM3H 1FDLL 3QFDB 1IAKB 4UBDD 1NUFA 1XGTB 1VACA 3CFJA 2E6JA 4OLZH 5JPNA 1CXHA 4PJ7E 4XVJL 3ZKND 4JFDD 4ZFGH 5E6YA 2DLGA 4WTZA 2F5BH 3LKNA 4QO1A 5DT1H 4ZSOB 2BNRD 4L4TE 1S7VB 4HUKB 4S0TD 3DIFA 3H7BA 4PGDB 4Y5YB 3RUGB 3UC0H 2QR0A 3BGFC 4G80B 4POZC 4POYA 3RY6C 2OYPA 2OTWA 3LQZB 3QFDA 1FIEA 4GJTB 1IAKA 1XGTA 2JE8A 3E2HB 3OR6B 3QSKB 4JDVA 5IBUG 3QCUL 4OF0A 3P40A 3RGVD 4L5FL 4ZSOA 4KHTH 3MYZA 4U3CA 3MBXH 4JANB 4JFEE 1HXMB 4JVWA 4PGDA 4Y5YA 3RUGA 4Y4KA 4G80A 2JB6B 5F96L 1VENA 3LQZA 1UZ8B 4XMLH 1PW3A 4XP1L 2F8VA 1I3UA 3WD5L 1CDYA 5EBLA 5L6YL 2XZZA 4P9HC 3OR6A 5GRUH 2MQ0A 4HC1A 3NZ8B 4YK4C 1WIPA 4JANA 1KLUB 1QRND 1RUPL 5C0AD 1TIUA 2JB6A 3WV0A 5A2FA 5JHDD 3I3DA 4M6MH 3L3HB 3WFDL 4JPKH 4FQ2H 1JYVA 4OGZA 1UZ8A 2R0KH 1PQZA 5SWZD 4NQXB 4POZD 3O0RH 5KS9B 4JQXA 1RAMA 1XCQB 5F7HA 4GW1A 2G5BB 4IRJA 4KGJA 4P3WA 2DJ4A 2ITDA 5JDJA 3NA9L 4M7JL 1B0GA 5J06A 2WIIA 1KLUA 3SY0B 1BGXL 5CINH 1KCSL 4PJIB 1FNSL 1XIWC 4X6CB 5F7YC 5I75B 1R24B 1MH5A 2B0SL 2BVPB 5CLTA 4KVCH 5J11C 2OQJA 1E4WH 1RI8A 4RFEB 4NQXA 2XY2A 1XCQA 3HNVL 2G5BA 2NY4B 3WN5B 3VD7A 4G9DB 4LU5L 4ZO6A 1QYGH 2P8LB 3QHFH 1T0PB 3SY0A 3WS3B 2IQAB 4JY4A 4HMCA 2NY5L 5F1NB 4PJIA 4X6CA 1CLZH 4PGEB 1R24A 2BVPA 5K9QI 1IM3A 1MHCB 1IGIL 4OFYA 4CU7A 4CDHA 4RFEA 2P5ED 2I5YL 2VN7A 3EO1A 3DXAE 2LU4A 4P2OB 3WN5A 4EN3B 3NH7L 1GRWA 4GQPH 4G9DA 4WI3A 3N9GH 2AK1H 1G9NH 4RAHA 3U9PL 1O0VA 2R56L 1CFNB 3W5MA 4F7PB 3X3FH 5F1NA 2XNAB 1MFDH 1DSFL 4PGEA 2FX7H 3MPCA 2JB5L 5IJKA 4LCCC 4PJ8D 4I0KA 4G3YH 4M48H 1MFEH 3K2MC 1L0YA 1XIWD 2ZJSH 3U6RB 5D5MF 2BP3A 4P2OA 2YOCA 4EN3A 5AAMA 1ZTXL 2IEPA 5JR1H 2IAMC 3VXUE 4F7MB 4F7PA 4M1GH 2W91A 4W68A 4AEIH 1A6UH 3QEQD 5GRZA 5HYSG 5LVEA 3RI5K 1T89C 1VGKB 4N0UA 1NC4D 4O5LH 1I4FB 3MREB 5F9JB 4ZUWA 2V17L 4GRLB 1WBXB 3QUZB 4ZNCD 5EO9A 1OCWH 4PG2C 1U91B 4F7MA 3C08L 3KLDA 3UXFA 2EH8H 3QBTB 2Y72A 3STLB 1PX3A 2FRGP 5TE7L 4KXZI 5BMFH 1VGKA 1N0LA 4NKIL 5JNYA 2DDQL 5ALCH 3FB8A 2HJKB 2ESVD 4JCMA 1KC5L 2CH8A 1J1PH 1I9RH 3MREA 4NRYB 5F9JA 4O9HH 4L1HA 3V0AC 4HCRA 4GRLA 4RMWA 4XX1G 2E7LA 5E8NA 1U91A 5EULV 5FUOL 3MSPA 1MUJA 3IDXH 3T77B 1NBZA 1NBVH 3DTXB 4M1DH 3CLEH 5A1AA 2IAMD 3STLA 1C16A 1J8HD 4KTDH 3AS0A 4NM4H 2NY6C 4Z7QE 4RIRB 5C0CD 4TSAL 2DQTH 2HJKA 4Z0BL 3CCHA 4MLIA 4NRYA 4NHUB 4LDOB 3LD8C 5J1TC 1FORL 1E4KA 1Z3GH 4Z7UE 4OZGB 1QSFE 4KKBC 5GS2H 3S35L 2CLVB 1BX2A 1PGRB 2GYSA 2EYTA 3FT4A 3T77A 3MNWB 1FRGL 1VB9A 2XG5A 3HR6A 3DTXA 4JY6B 3V6ZB 4LP4A 3UO1H 1OQXA 5EUOF 5JTWA 1I1AD 2F8OA 5DFVC 3F7YA 2UY7A 1DBBH 4JM2C 2ICEB 5LGHL 1KJMB 3GSNL 4RDQG 1VADB 2IBGA 3PHOB 3EO9H 4NHUA 3QRGH 3ZDZE 5JOFB 3BZDA 3T09A 1H3UA 4PJXB 4OZGA 4WUKL 2HFFB 3QWQB 5MHSD 1RIVH 2CLVA 1UYWL 1CIDA 1IAIH 4J2XA 3MNWA 4JY6A 5DI8B 3V6ZA 2DIBA 1EEQA 1MFAL 1O7SA 1FGNH 3D3VB 4KQ3L 3UZQA 4DKAA 4M6NL 3BEWB 2QSTA 1CQYA 2OL3L 5DRZB 1KJMA 3MODL 4URTB 5E5UB 1LQSR 4ODWB 1MRFH 3PV6B 3PHOA 1A9EB 1PLGL 1JVKA 4J1UB 5GGRB 4G6KH 4PJXA 2NY6D 4XGZA 3MV01 4OQ1A 2HFFA 1KELL 5FDWB 4OD3H 3BSZL 3MBEC 1HQRB 1OW0A 1FE8L 3FL7A 4JN1H 5EN2A 5JIKA 4Y1AD 5DI8A 4KKBD 5AD0B 1JHTB 3BEWA 2X4RB 4X7CC 1MFBH 4NQDD 3LSOB 5DRZA 4H88H 3ULUC 3LY6A 4ODWA 3PV6A 4EJ1C 1CDJA 1IQDB 1A9EA 5DFVD 4J1UA 5GGRA 3HFMH 3LKRB 4JM2D 5E2UL 5E08L 5FDWA 5IMKB 3HS0A 4M5YH 4X7TB 1YC8A 5L88H 1LVEA 1HQRA 1FBIL 1CXKA 3IVKB 3STZB 3JWOH 2BRRH 2H8PB 2O5ZH 3CU1A 5EFIB 5AD0A 3HC3L 4KI1A 1JHTA 3SE8L 2X4RA 1MFCL 1HHGB 4NWTL 1JBJA 1B6DA 1MCCA 3LSOA 1TCRB 4NKDB 3TA3A 5JMOC 5DZLA 5HHQB 2IFFH 5IFAL 3T3PE 5IFHH 1IQDA 1JPFB 1FCCA 2PCPB 3QB7C 2PR4H 5FO9B 3RDTB 1K6QL 4N90E 5E8EA 2GITA 5IMKA 4X7TA 5BOPA 3IVKA 3ALPA 3P4NA 3BZ4A 2ZG3A 1U92B 2H8PA 3VG9B 4DKEL 4LSPH 1JK8A 5EFIA 1PSKL 2R0WH 5MEQA 4NJAH 1M7DA 1WQVT 1HHGA 2ZCKH 3MGTA 1TCRA 4NKDA 5F6IC 3EYFB 4KAQL 2B4CH 2W9EL 3X11B 5HHQA 1YEKL 3PG2A 1JPFA 3L5JA 4WI8A 2PCPA 5FO9A 5DXWA 1P1ZB 3RDTA 3VWKA 2N7AA 5KAQF 5TQ2H 1CGSH 4U7SA 4AJ0A 2V5SA 1MHEB 2YA1A 3CVHL 1NKOA 1D7FA 4YUEH 1U92A 5E03A 1NMBH 5T1MB 2J5LC 2EXWD 3GMRB 1YYLH 3DX6B 3EFFA 4P2RB 5HDBE 1LK2B 2BSTB 4MAUH 1JNNH 3TH3T 3EYFA 3REVB 3X11A 4ZAKD 4WEBL 1RJLB 5E2TH 2APTA 2GQHA 4KROC 4GG6E 3RIFK 4TQEH 3MGAA 4W6XB 3HMXH 1DQTA 1TZGH 4DUVA 1MHEA 2A0LD 4JM2F 3ISWA 3HNTH 4DZ8B 2AJUL 3ULVH 4NZRL 4NKMB 4MJIE 3GMRA 4XB7A 3STBA 4OJFL 1EHAA 1HXYB 3DSNA 3DX6A 1LK2A 4AYFA 2BSTA 1T6VN 1YEIH 2HVJB 2Q20A 3REVA 4H0IA 2R1XB 1AE6H 2MNUA 4GW5B 3ME0A 1UVQB 3Q5OA 4DZ8A 4MXVF 2DLFH 3VFMB 5BRZB 1PVHA 4P2QB 3EZJB 1HXYA 5C2BH 3S88H 3L7EA 1KN4L 3O4OC 5B3JF 2XN9A 4KPHH 1CK0L 2HVJA 5KVGH 5SX4H 1UWEL 2C3HA 3D18B 1S5IH 2F53E 2R1XA 2APXA 1ADQA 4JHZA 4ALAL 1I3RB 3JBG7 4H1LG 4YXHH 3NCJH 1UKSA 3IS1X 3ET9F 1CZ8H 5IP4A 1UVQA 2H2SC 3ULUF 1JNHB 4KROD 3VFMA 5BRZA 4P2QA 2B5IB 4OZFB 1JZ2A 5I1HH 5GRVL 4RGMC 4XBEL 3D25A 4LCWD 4Z7VA 3D18A 4QTIL 1K2DB 4KDVA 3VFRB 4KRLB 6CGTA 2W9DL 5AG8A 1IFHH 1FSKC 4F15C 2CLZB 4PYHA 1QR1B 1C5BL 2MOVA 1NANI 4I3SL 5GS0D 5JW4R 1I9JH 4OZFA 4NNPH 2P42B 3U82B 1G9EA 4TVPL 4LRNL 1JF6A 3FJTA 2MWCA 1QVOB 2IAND 1CLYH 1K2DA 3IU3B 3VFRA 4ZSOE 5HHOB 3CX5J 5ESVB 2YD5A 1AD0B 1G7IA 1Q94B 3N1PC 3V52L 3BD5A 4OD2B 2BJML 3RUGE 2CLZA 2YWYA 1A2YA 2EDKA 1A6ZB 1NUNB 3MNVB 1IZJA 4U1KB 3ZTNL 1QR1A 4Y4FC 4CGTA 4OIAA 1JPSL 4X4MA 3W0WB 1G1YA 1ZVYA 4YDLC 4Q0XL 2H2SD 4JFZH 4ODSL 1YA5A 4LRIA 5HHOA 3CSBA 3JV5A 3KXFD 1Q94A 4OD2A 1FC1A 5DK2B 4ZD3H 3U0PB 5AWNH 3IFPB 4NQEB 3MNVA 4Z78B 3FQNB 5DVOA 3FRPA 3EIFA 1A3RH 4LDLB 1IE5A 3W0WA 4KI5C 1CFVL 3UDWC 3O8XC 1KB9K 3RPIB 3R1GH 4U3XA 4IJ3B 5FA4A 4A6YL 4CJ1A 2APBA 1MCRA 3VXMD 1DLFL 4CN1A 3I9GL 4JO4L 1MI5B 5DK2A 4HGWB 3TPKA 3U0PA 2J8UF 4NQEA 1JYWA 4Z78A 3FQNA 3B9AA 4ONHA 4RAUB 4HHAA 5DFWH 2C3VA 3B2VL 2IH3B 4YEFA 1NEUA 1HHIB 4R9HA 2JJSA 2EDEA 3VFSB 5EUKB 3RNKB 3RPIA 2WWMC 4Y4FD 1GC1H 3CZJA 2HKFH 1F5WA 1XEDA 1KGCE 4FQ1H 2X89D 3BUTA 2Q6WB 3UTSD 4HLJA 4ODXB 1MI5A 2X6MA 2R2HB 4HGWA 2CMRH 3S36L 1NAKH 5BV7C 5IHUH 4PJIE 1Q72H 3E6FB 1QBMH 4X6CE 5FYLD 5T1DH 1KENL 5FCSH 3WSQH 2IH3A 4Q9QH 1HHIA 5FIEA 5CAYB 3VFSA 2PTVA 2OK0H 2JK5A 1LNUA 1FZMB 5EUKA 3RNKA 4YDKL 5ETUB 4Y5VC 4EUPG 3FFCA 1BZ7A 3DECA 4R7DB 4JREC 1FYHB 3G5YB 3O8XD 2F19L 1DUYB 4D3CH 5IQ7L 2R2HA 3FQRA 3SDCB 2X2YA 3SGDI 3K4AA 1DFBL 3D39D 3DRTB 3K81A 3MA7B 2FH6A 3BPLB 4LHUD 3UTTD 3VFNA 1FZMA 5ETUA 3CMOL 1KIRA 4BQCA 5BS0A 4HC1H 3QDJB 5DQDL 4R7DA 4XVTH 2LABA 3D9AL 1FAIH 3RX5A 2OZ4L 5GZNC 5I71C 2WWMD 4OTXL 3MA7A 4NHCH 2NY1C 1A9BB 4FTVB 3V8CA 2VDRH 3GZKA 5B4MC 1ODAA 3ARWA 1UACH 2OM5A 1DBJL 3IJSB 2J6EL 1VESA 1F02I 2H1PH 1RU9L 4JG0L 2VABB 5ID1B 3QDJA 3AREB 1QSEB 5ITBH 4QY8B 2FSEB 1BQLH 1CTNA 2FO4B 5C0FB 3P11H 1FFOB 2OZ4A 1U42A 4HQQH 3C60B 1RIUL 1MJJB 4JO2L 5BZDB 2X4PB 3QDGB 2X09A 1A9BA 3VFTA 3B8YA 4HKJA 4FTVA 4PJGB 2WAHA 4LPTA 4YC2B 5EDXA 4DGIH 3O2VH 1ZGLM 4WUUB 5D4QA 3SPVB 5GGRY 5D1QB 3S98A 4APQB 2UVFA 4EDWH 2XZAH 1L7TL 4YHYB 2DM7A 3IFLL 3WEXB 5C09B 2VABA 3MJ8B 4QY8A 4XWGH 5DVMA 1BBDH 4UQ2B 3G08B 2FO4A 5C0FA 1FFOA 3G6DH 4U4BA 4GG8A 4KI5F 1K8DB 5C08B 1MJJA 5BZDA 5FHBH 2X4PA 4JLRB 5D96C 4PRHB 4DAGH 1FNFA 1OAXH 4K8RH 4WUUA 2D31B 4POUB 5D1QA 2EC8A 2X9XA 3RTQB 4H26B 4APQA 2C5DC 3NZHL 2EDXA 3WEXA 1CDUA 5L8KB 4KQ4H 4OCSL 5C09A 3QT2A 3MJ8A 5B4MD 2YBRB 5BJTB 3GK8L 4UQ2A 3G08A 3MOBL 5A2LH 1K8DA 1RZKC 4ZO8A 5JQHC 4N0CD 4G8GD 4HT1H 4XTRC 1V7NH 4X9BA 2MCG1 4M9PA 4CU6A 4FABL 4PRHA 3LEXB 4PJEF 3LS5H 2YA0A 4MXWL 4RMTA 4CJ0A 2D31A 3RTQA 4L4JA 2WANA 5T3ZD 4H26A 1FZKB 4UB0H 4PJAF 3MLPA 5IB4B 1R3LB 1YQVH 3GSQB 5B39G 3VXSD 1MCOL 4HEPG 4ZOBA 4BQ9A 4K7PH 5CEYB 4AH2A 2DRUA 2BVEA 3SBWA 1MLCB 5BJTA 3AB0C 1CTOA 3LIZL 3MRMB 1YPZF 4O51A 4OZGE 4R96B 3TBSB 3O45B 2Z8SA 3GHBH 5J6HA 4ZS7L 1RVFH 3LEXA 2GTWA 5IR1B 4PTUB 7FABL 4BZ1H 2PO6B 3VG0L 2B2XH 1MREH 1R3LA 4PGBB 3GSQA 1S7RB 3BN9C 1D9KB 3L9RB 3RJDA 1CS6A 3OGOE 1A64A 3DX7B 4YHKH 3RPKA 4WVRA 1H0DA 2PTTA 3MRMA 4PJXE 3IDNB 5HVHB 3OKOB 1OP3K 1SHMA 3TBSA 3O45A 1OARL 5MP6L 3NCEB 1MCPH 3O6LL 1BVZA 2X70B 3ZE0F 3GBNH 3D85D 4N0YL 2YWZA 3ZYZA 2F54D 1I85A 3LDBC 2N1KA 3FN9A 2XTJB 5IR1A 4QRTA 2DWDB 3C8KB 2PO6A 5BZWB 1F8TL 3NFPB 4GKSB 4G6JH 1S7RA 4XTRD 1D9KA 1P7QB 3L9RA 1QNZH 5DQ9A 3EZ8A 4LNRB 5C8JA 3DX7A 5FHAL 2D9QB 2C4FU 1CDGA 2DYPB 2DQJL 4HCRH 3D87B 3IDNA 2H26B 3OKOA 4OCLC 4C55A 2AP2A 4MZ2A 1QBAA 3NCCB 2X70A 3BPOB 2VLKB 2VLJB 4YH6A 4JR9H 3C8KA 1JRHI 4XNMB 1PZ5B 5BZWA 1B4JL 3NFPA 4GKSA 1MCBA 5T3XE 1ZLWH 2UZIH 3GDBA 1DQMH 2IPKB 2HTKC 4HXBH 1W8NA 4S1RH 5DYOB 3RWIA 1NLDL 3B3IA 4LNRA 3W9DB 4YHML 1Q8MA 3IJHB 1V5JA 4YHOH 3ARBC 1F2QA 1X44A 3TT3H 2H26A 4HIIA 1OWRM 3BAEL 3BN9D 4JPIB 4I8DA 1T2XA 1BLNA 1G9ML 4ONFL 5DWUH 2HH0H 2OLDA 2VLKA 5GISH 5K33A 1EXUB 3BWAB 2ICES 3RVXC 2OR8A 4KXZH 4R4FH 4UAOB 1QTYT 2HRPL 1ND0B 3QHTC 1YNKL 4XNMA 1PZ5A 1TTUA 3RRQA 4P0DA 5E2VH 5ILTH 2XICA 4YNYA 2LFGA 3DSFH 5GRVK 2IPKA 2D4FA 1J87A 2NZIA 5GJTL 2D0HA 3W9DA 3IJHA 1JGLL 2NXZC 3SE4C 3TV3L 4JPIA 4MMZC 1Y18B 4X9GA 2CK0L 1EPFA 2W0PA 3MV9D 1YC7A 1ND0A 3IB4A 5IESL 5KW9L 1KCKA 4TSBL 2AJXH 4DVRL 2LQRA 4F57H 4M6OL 4JPWH 3WNNA 3V5HA 4MX7A 4P46B 1SVZA 5GRJL 3HA0A 3V4PH 4OGXH 4D0CB 4HFWA 2HTKD 1UENA 2EIZA 1Y18A 1VFUA 3TBWB 4EBQH 4PY8I 1XR9A 3RKPA 3MRLA 3G9VA 4ISVB 1X5YA 3OZ9L 5L2KB 1P5UA 5I73C 1XFPA 1G9NC 4IBLT 5FYKL 1TMCB 1A6TB 1BOYA 3MUY1 1QACA 2R0ZL 4P2RE 1BPVA 1EGJL 4NCC2 5D1ZA 5MERB 3RVXD 2P46B 3VH8A 3CFCL 4JHWL 4LLYA 5L0QC 3NCBB 4P46A 1R5IB 2NY2D 3MRDB 1RK0A 2GTZB 4D0CA 2AJZB 2IFGA 5IFJB 3TBWA 1KJVA 4Z76B 1R3IL 5C6WH 1UWGL 4ISVA 1VPOL 2NXZD 2UUDH 1RY7B 4CU8A 1X4YA 1S7XA 1U0QA 2IALB 2WLZA 4OBRA 2BY0A 2W59A 1EGJA 5T3XH 1RUQL 2NMSA 2DQDL 5MERA 4U1HB 1TCMA 4BSWB 4MJ2A 4DK6A 4L4TD 1R5IA 3MRDA 2GTZA 3BT2H 2J4WL 5IGXH 2ZG1A 2AJZA 5E2WH 5DEZA 3PNWA 3KYNB 4P9MH 2E8ZA 3HLAA 3MLRL 4CDGC 1J10A 4Z76A 2ID5A 2X1PA 4HUVA 4K7FB 4AK1A 5BRZE 4P2QE 3TIEA 2NW3B 5IB5B 2WBKA 1Z9SA 2IALA 1ACZA 3MV8D 3LQAL 3MRQB 1RURH 4U1HA 4BQ8A 4BUHA 4DN4L 1Z0MA 1Q1JL 4BSWA 1FVCB 1CICB 4WI6A 1EVTC 1A3LH 1CU4L 2EICA 3RWCB 3VD3A 1KJ2L 1CFBA 4J4PA 1XF5B 5EZIH 1WT5C 4EI5C 1LP9B 1OPGL 3KYNA 3KNBB